1KE4A

X-ray crystal structure of ampc beta-lactamase from e. coli
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based approach for binding site identification on AmpC beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ke4A00
5EVIA 3Q82A 3WRTA 1BTLA 5GHYA 3SS4A 1K54C 2GDNA 1JTDA 4KZBA 3UPPA 3VFHA 2V2FF 1MWRA 5M18A 4OOLA 5EVLA 4OQGA 4KZ7A 4OPRA 4RX3A 3VFFA 3HLDA 5J8XA 4S2LA 5CRFA 2Y2JA 1NY0A 1YLPA 1ZC2A 5HAIA 2J7VA 4CPKA 2XD1A 3BFCA 3FKVA 2RCXA 3ITAA 1PYYA 3N4IA 4RVAA 4NK3A 5AQ9A 3HLFA 5AQAA 5A92A 3DWKA 4IVKA 5CTNA 3PBSA 3HUOA 4GD8A 1ESUA 4R23A 3VP4A 1NZUA 2XR0A 1I2SA 3O88A 1ES3A 3G34A 3Q81A 3A3JA 1DJAA 3MBZA 2XQZA 2Y2PA 4QY5A 1MWTA 3BEBA 3IXHA 3TG9A 4OQIA 3PAEA 2BG1A 2X02A 3G35A 3LY4A 4U3TA 4X6TA 5DTTA 5KZHA 4JBFA 1ES2A 3D4FA 4S2NA 2G2UA 3ZG7B 4C75A 2EFXA 3C4OA 1K38A 2X01A 1GHIA 4Y0TA 3ZG8B 3P09A 2EX8A 2XEPA 1FR6A 3IXBA 5FAPA 3VOYA 1YMSA 4R1GA 3M6HA 4NETA 3UPOA 1HD8A 3Q7VB 3IQAA 1W8QA 2WUQA 2JC7A 3SH7A 1LI9A 1ONHA 1SHVA 4JPMA 1RCJA 3OZHA 2Z2LB 4KZ5A 1K57A 4OQ0A 2Y2GA 2PU4A 2DCFA 2OSUA 4WZ5A 5CEDA 2HDQA 3MXSA 3P98A 4RYEA 1JVJA 1GHMA 1K57C 4JKTA 5EVIB 5KMWA 3TSGA 3IXGA 4CJNA 1SCWA 4EWFA 4OLGA 4PM8A 1FQGA 1H8ZA 1K56A 3OPPA 3UDXA 2ZM0A 1PW1A 1MPLA 4HESA 4OH0A 3B3XA 3UPNA 4BD0A 1SKFA 4D2OA 4ZJ1A 3C7UA 3EQVA 4F94A 4XUXA 1NXYA 4C3QA 1XPBA 4BL2A 2Y91A 2HP9A 3MZFA 4YFMA 2ZJ9A 3IF5A 3FWLA 4E3JA 4S2IA 2Y2KA 1PW8A 3I7JA 3SS5A 4BJPA 4OQHA 4FH2A 5F1GA 1K25A 4MBKA 5TGFA 5BOHA 5GLAA 1K6SA 2Y2LA 1I5QA 1JWZA 3G32A 5M1AA 4EV4A 1O7EA 2XLNA 3NBLA 2EXBA 3W4PA 1G68A 4K0XA 5CGXA 3HLCA 4HBTA 5F83A 3UNWA 3BYDA 4E3MA 3HBRA 5E2GA 3FYZA 3W8KA 2Q9NA 4WBGA 3SOIA 1NYYA 5A90A 5FQMA 3M2JA 2ZC7A 3NIAA 4YINA 4QU3A 3PBTA 1FSWA 3CG5A 4WELA 1MWSA 1OMEA 1FCOA 1Y54A 4XUZA 3UN7A 5CHUA 4LV2A 2XFTA 2P74A 5AQ7A 1BLHA 2BLSA 4XXRA 4R3BA 3FV7A 4X53A 5F82A 3Q7VA 1IELA 2HDSA 3NY4A 3DW0A 5I94A 1RGYA 1KGEA 3TOIA 3C7VA 5DF8A 3N8LA 1NJ4A 4FD8A 1KGFA 3S4XA 4R4SA 2Y2NA 4N9LA 3HLGA 3NI9A 4ID4A 4E3LA 2HP6A 2QPNA 2R9WA 1K55C 1ESIA 2ZQ9A 3LCEA 4MBHA 1KDSA 1QMEA 1XA1A 4X56A 1W5DA 1K54A 1YMXA 1K6RA 3C4PA 4OP5A 4X69A 2IWBA 1DJCA 1PWCA 4ZAMA 4QY6A 5CECA 1W8YA 5FQIA 1J9MA 5FI6A 1N9BA 2Y59A 2ZMAA 3ZG5A 1LL9A 1NRFA 5HFOA 1LL5A 1MY8A 4E6XA 5JYPA 2X71A 1ERMA 1CI8A 3OCLA 1L0DA 4H8RA 5EOEA 4KG6A 1O07A 3BECA 3V39A 4Y0OA 1YLWA 2IWCA 4PPRA 2JCHA 3W4OA 5HX9A 5CERA 1BLCA 1RGZA 1SDNA 4BENA 3JYIA 1PZOA 1CEGA 4P85A 4BD1A 3VP1A 1E4DA 3WWXA 2Y2MA 4HEFA 1XGIA 3BRMA 4FCFA 4FSFA 3RJUA 4JXVA 3WRZA 1HVBA 5CXWA 1PI5A 1XKZA 1BZAA 1W79A 2OLUA 5JYOA 3M6BA 3BLSA 3OPRA 1LHYA 2ZM8A 3UO9A 1L0FA 3G30A 3ZCZA 1K55A 4MLLA 2A3UA 3A3IA 2C5WB 3RXWA 4DE3A 3MXRA 4JF6A 4KZ6A 5E2FA 5FAOA 1BSGA 2WZZA 4KZ4A 1PWDA 1TEMA 4DF6A 5GL9A 4OONA 5FQKA 4ZJ3A 4DDSA 3GSGA 1CEFA 3PBOA 5DVAA 3IWIA 3VP3A 4LV1A 4OPZA 3UDFA 1RP5A 2WKEA 2WKHA 4IBRA 4S2MA 4QD4A 5TR7A 4DKIA 1TDLA 4LCMA 4P0MA 4MBFA 4N9KA 4PMAA 4GNUA 1JWVA 1KE0A 3HL9A 1HTZA 3IWQA 4IBXA 1PIOA 3MKEA 3DWZA 1AXBA 1KDWA 3IH8A 3WS1A 4BLMA 4FH4A 1BULA 5HARA 3HUMA 4DE2A 3V50A 1CI9A 2V20A 3LY3A 1L0GA 1MBLA 2WYXA 3HUNA 4B88A 1GCEA 4JF5A 4S2OA 1PWGA 1U60A 2H0TA 2PU2A 3GMWA 4OKPA 3OPLA 5FI7A 1NYMA 1K4FA 4DXBA 2HPBA 2ZM2A 1YQSA 2VGKA 2ZQCA 2ZD8A 5GLCA 4GKUA 3W4QA 2J9OA 5HAQA 1NZOA 2UWXA 4QB8A 1I2WA 3ZVTA 4BL3A 4S2NC 2H5SA 3VSKA 5E2EA 2ZC6B 4EBLA 4U0TA 2V1ZA 1N4OA 3NCKA 4WM9A 4IEDA 5FAQA 4E3KA 1KVLA 1LI0A 5CTMA 1H5XA 4KG2A 1XP4A 2ZQ7A 2Y4AA 5EECA 4K0WA 4B4XA 1YM1A 5EPHA 3MKFA 3WS2A 4ZTKA 4KZ3A 3ZNYA 3ITBA 5EVID 1KE4A 5FASA 3Q7ZA 1YT4A 1S6RA 2ZQDA 3IWOA 1Z6FA 1L2SA 4WEJA 5KSCA 5GLBA 3HLWA 3GTCA 3GV9A 3ZNTA 4WMCA 2EX2A 2Z2MB 4L0LA 5DTKA 4UA7A 4DRTA 1EROA 3UDIA 1YLYA 3N8RA 4JLFA 1E3UD 1TDGA 2JE5A 4S2JA 3HLEA 4PM7A 3S22A 5L2FA 1IYOA 1GHPA 4O7DA 2JBFA 4PM9A 3CMZA 2WAFA 2ZLYA 3HVFA 5GLDA 3BFDA 1DJBA 1IYQA 4OPYA 4Y0UA 3GR2A 5GHXA 3IXDA 5DF9A 3VSLA 3ZG0A 1VM1A 2J8YA 5DF7A 1S0WA 2PBYA 5FQQA 4E3OA 2XK1A 3ZGAB 2FFFB 3M2KA 5EUAA 1FR1A 4OOYA 1YLJA 4JXSA 5U47A 3SH9A 1ERQA 3G2ZA 4K91A 4GN2A 4LV0A 1Q2PA 4WYYA 3IHAA 1EWZA 1WE4A 3HREA 2QZ6A 1ZG6A 5A91A 1YLZA 3PTEA 5E43A 3IH9A 3PBQA 4Z9QA 2DRWA 1SDEA 4PM5A 3WS0A 3QNBA 3BLMA 3G2YA 5FA7A 2Y55A 1C3BA 2ZC3B 4N1XA 2VGJA 2WGVA 5FQJA 2XDMA 1L0EA 2Y2OA 3CZDA 4DE0A 4OP8A 3N7WA 2XGNA 2OLVA 3UE3A 1GA9A 1BLPA 3EQUA 4UHUA 2FFYA 3O3VA 4M3KA 4OLDA 3DTMA 3VP0A 1M40A 3AGFA 5G18A 4GDNA 2J9PA 3PBNA 4A5RA 2ZC4B 5TFQA 4EBPA 3Q07A 3IT9A 3AGDA 4S2PA 1MKIA 1KE3A 2ZC5B 2Y2HA 1BUEA 4RA7A 5IHVA 1W7FA 3N8SA 4KQQA 3N6IA 4IVIA 5EVIC 2G2WA 4X68A 3E2LA 4Q8IA 3QNCA 1PZPA 3VMAA 3OC2A 4PM6A 3VP2A 5HW3A 5FI2A 2WGWB 3O87A 2EXAA 3HLBA 4JXGA 3BFFA 4KZ9A 1E25A 4E3IA 1ES4A 2ZQ8A 4OPQA 1WYBA 3BM6A 4LCLA 4N1HA 4WZ5C 5GHZA 3SH8A 1MWUA 2H10A 1TVFA 3V3SA 1HZOA 1FSYA 1FCMA 4ZBEA 4DXCA 1IKIA 4QJGA 5D3OA 1MXOA 5FSRA 4X55A 4WMCD 4ZJ2A 4EUZA 3IF6B 4LV3A 5FDHA 1BT5A 3G31A 1GA0A 1K4EA 4KENB 4N92A 3UE0A 3AGEA 1DY6A 3Q1FA 5FQ9A 5F1FA 5KSHA 3GRJA 1E3UA 1ALQA 5AQBA 4R3JA 3WS4A 2XH9A 3GVBA 2B5RA 3OPHA 1ZG4A 4JF4A 2P9VB 5M19A 4UA6A 3RXXA 2IWDA 5E2HA 4MEZA 2WADA 2EFUA 3O86A 4HBUA 5EE8A 5A93A 3CJMA 3SS3A 2WK0A 1XGJA 5CHMA 3FKWA 3ZVWA 2OV5A 3C5AA 4C6YA 2H0YA 1XX2A 5CGSA 4DDYA 4JXWA 4OVDA 1JWPA 2EX9A 4ZDXA 2WKIA 3IHBA 1XA7A 3MFDA 3ZDJA 2DNSA 1H8YA 3NC8A 2WAEA 3V5MA 1IYSA 1XXMA 4UAAA 3S1YA 3WS5A 1IEMA 3E2KA 4GB7A 3ISGA 3LO7A 2EX6A 2Q9MA 2R9XA 2QMIA 1BLSA 2RL3A 4MNRA 5CHJA 2HDRA 2I72A 3FZCA 4GD6A 3A3FA 3LEZA 2XFSA 1CK3A 1FCNA 1M6KA 2Y2IA 4E3NA 1VQQA 4Y7PA 2ZQAA 1KGGA 1ZKJA 2A49A 3A3EA 5HAPA 1IKGA 4QHCA 4U0XA 3ZHHA 1QMFA 2WGWA 1PI4A 3BFEA 4OOMA 4E6WA 4GOGA 3MZEA 2XD5A 4UA9A 2C6WB 3OCNA 4KQRA 1KVMA 5HL1A 4LENA 4KQOA 2E8IA 4WEKA 4KZAA 4GZBA 2HP5A 3PAGA 4R4RA 4EBNA 3ZFZA 4KG5A 1LLBA 1YLTA 5CEBA 5CGWA 2CC1A 2HDUA 1FOFA 4S2KA 3PBRA 3IF6A 3MZDA 2XF3A 1ONGA 5EOOA 2WZXA 4B4ZA 3NDEA 4EQIA 1WYCA 3ZG9B 3IF6C 3G4PA 1Q2QA 3GQZA 3UE1A 3UY6A 3BFGA 3A3DA 3NDGA 4P87A 4RX2A 5FATA 4BQMA 5DTSA 2P9VA 4WZ4A 4P6BA 3VOZA 1EI5A 4KZ8A 1G6AA 4GDBA 1IYPA 3QHYA 1JTGA 2Y2QA 3V3RA 1K56D 2WGIA 1ES5A 4R0QA 4DE1A
chains in the Genus database with same CATH superfamily
3WRTA 3SS4A 2PBDP 4KZBA 2V2FF 5AJGA 4OOLA 5EVLA 3B47A 4L9FA 4OPRA 4RX3A 3T1QB 3HLDA 1NY0A 2RCXA 2GNXA 1V9ZA 3IS2A 3MFXA 5A8BA 5A92A 1CQAA 4GD8A 1TS8A 3VP4A 2QYBA 1I2SA 3A3JA 4QWOA 2XQZA 2Y2PA 3E4OA 5HSQA 3G35A 4X6TA 3TRCA 2P04A 5F6AA 3ZG7B 3EGDC 3P09A 1FR6A 5FAPA 3M6HA 4WF0A 3KO6A 4XT2A 2JC7A 3BY9A 1RCJA 3OZHA 4FUWA 4OQ0A 2VV7A 2HDQA 3P98A 4CJNA 3UDXA 2JKTI 1SKFA 4ZJ1A 4EU0A 4XUXA 3BJNA 4HQAA 3MZFA 4YFMA 2MJ6A 4S2IA 2Y2KA 1PW8A 3I7JA 4BJPA 4BMWA 4MBKA 4Y17A 5GLAA 5M1AA 1O7EA 5CX7A 2EXBA 4HBTA 3K2NA 3BYDA 3JPUA 4ESPA 1DRMA 3UB5P 4WBGA 3NIAA 4BWIA 3CG5A 3LEQA 4ETXA 4WELA 1OMEA 2JKTM 3MF0A 3E4QA 2ZOHA 3QP8A 3RFBA 1KGEA 4GHIB 3E4PA 3C7VA 3N8LA 1NJ4A 1CJFA 3S4XA 1OPXA 1XJ2A 2E8JA 2QPNA 1K55C 1YAXA 4MBHA 3JVVA 3C4PA 3BQAA 1PWCA 4ZAMA 5CECA 1W8YA 3S7QA 1D1JA 2ZMAA 1NRFA 4E6XA 3OCLA 4KUKA 5TJJA 4KG6A 4Y0OA 1YLWA 2IWCA 3MSHA 1BLCA 1E4DA 1XGIA 2Q0OA 3RJUA 3V67A 3VOLA 5CXWA 1PI5A 3T12B 1LHYA 3UO9A 1L0FA 2YKFA 3CUEC 5IU1A 4RQ9A 4KQDA 3H7WA 2W1TB 4LFUA 3IWIA 3VP3A 4LV1A 5TR7A 3IX4A 4QD4A 4PMAA 2WKQA 2QJ7A 3MKEA 3DWZA 3H82B 4FH4A 4LRXC 1CI9A 2V20A 2P7JA 1MBLA 4LLOB 1PWGA 1U60A 2H0TA 2PU2A 5FI7A 4DXBA 2HPBA 2VGKA 3NECA 3W4QA 2UWXA 4X1LA 4QB8A 3ZVTA 3GDIA 4EBLA 5HD3A 4U0TA 4NXGA 5IT5A 1KVLA 1LI0A 2BASA 5CTMA 3EEHA 5EECA 1LSWA 2O99A 3ITBA 1YT4A 3IWOA 4WEJA 4DMZA 4WMCA 4L0LA 2VEAA 1EROA 4S2JA 5L2FA 2LB5A 1IYOA 1GHPA 2WAFA 4F3LA 1IYQA 4Y0UA 3VSLA 2PDRA 1VM1A 2J8YA 1S0WA 4HY8A 4E3OA 2XK1A 3ZGAB 2FFFB 5HL6A 2JKFA 4JXSA 5U47A 1ERQA 3G2ZA 4GN2A 4LV0A 1Q2PA 3HREA 2QZ6A 5A91A 4ZRRA 1A0KA 1N9OA 5FA7A 1C3BA 2ZC3B 4UEYA 2VGLM 2VGJA 4GS9A 4DE0A 3CZDA 1ACFA 4OP8A 3N7WA 2PR5A 1GA9A 4MCWA 3LFVA 4OLDA 3DTMA 1TF1A 2J9PA 5TFQA 5L09A 1NLZA 4RA7A 1PNEA 3N8SA 3KSGA 3CI6A 4IVIA 1SKOA 3BW6A 3F1PB 4JXGA 1OT9A 3L9KA 1MWUA 1FCMA 2V1AA 1IKIA 5D3OA 5FSRA 4ZJ2A 4EUZA 3CUEA 3IF6B 3F1OB 1K0KA 3WS4A 5EV0A 2B5RA 3O86A 3CJMA 2DMWA 3ZVWA 5CGSA 1XX2A 2ACGA 4DDYA 1Z09A 2EX9A 4ZDXA 1H0MA 1XA7A 3MFDA 1XJ3A 3V5MA 2V1BA 1XXMA 3T1RA 4UAAA 1IEMA 3ISGA 2EX6A 2R9XA 5HPFA 3UB9A 2RL3A 4MNRA 3LEZA 2XFSA 2YKHA 4E3NA 1VQQA 5HAPA 1IKGA 4U0XA 1NRJA 2WGWA 3S7OA 4UA9A 2XD5A 3MQOA 3BY8A 1GSVA 4KQOA 3ZFZA 1LLBA 5CGWA 4S2KA 4P6ZS 3MZDA 2WZXA 4B4ZA 1ODVA 3GQZA 4RX2A 4UQIS 4BQMA 4K08A 2P9VA 3VOZA 1IYPA 2OWJA 1DP8A 1ES5A 4R0QA 4DE1A 5EVIA 4EERA 5J8XA 1BTLA 4H6JA 4NXFA 3VFHA 3UPPA 1NWZA 4OQGA 5J3WA 1S1ZA 4ARZB 2VK3A 4S2LA 2J7VA 2XD1A 3BFCA 3FKVA 3DTKA 4RVAA 4NK3A 4LPZA 2ZMVA 2XROA 2FZ0A 3DWKA 4IVKA 5CTNA 3PBSA 3HUOA 3F1NA 2XR0A 3OLOA 1VEUB 1DJAA 3MBZA 4I5SA 4QY5A 3T4KA 1MWTA 3BEBA 3TG9A 2INWA 2BG1A 4X1MA 4JBFA 1ES2A 3D4FA 4S2NA 3SZTA 3C4OA 1K38A 2X01A 3ZG8B 3C38A 3VOYA 3Q7VB 3IQAA 2WUQA 3UB6A 1SHVA 1G6OA 4JPMA 2GZAA 2Z2LB 2XRNA 2Y2GA 1EW0A 5CEDA 1JVJA 4JKTA 3E0YA 4CQHA 4EWFA 1YPRA 4PM8A 3OPPA 4R6LA 2ZM0A 4HESA 4D2OA 1FILA 2Y8HA 3C7UA 1NXYA 2HP9A 2ZJ9A 3IF5A 4E3JA 4OQHA 4FH2A 1W63M 1K6SA 1I5QA 4EV4A 5DKKA 2WKRA 3W4PA 4K0XA 3FPVA 5F83A 5E2GA 5A90A 1NYYA 3M2JA 2ZC7A 1FSWA 2BTFP 1MWSA 5L10A 1FCOA 3UN7A 3K3CA 5CHUA 4LV2A 3T4JA 4I39A 1G28A 5AQ7A 2LB9A 5F82A 3QP2A 2HDSA 3NY4A 4XT2B 3DW0A 3JVUA 3S7PA 5I94A 3TOIA 2HV1A 1T1CA 3NI9A 4ID4A 3P01A 1QMEA 2OWHA 1K54A 4X69A 1DJCA 4QY6A 5FQIA 1J9MA 1N9BA 2Y59A 4G3WA 5HFOA 4DN0A 4IUHA 1L0DA 3QP5A 3BECA 4CLCD 3P7NA 2JCHA 1SDNA 3JYIA 1OTBA 1PZOA 3LR5A 1H8MA 2A24B 2Y2MA 3WWXA 3MR0A 4FCFA 5EM1A 2J3TC 3G6OA 3UMDA 3B42A 3WRZA 3FG8A 2ZMFA 3OPRA 2ZM8A 2W3GA 3FC7A 3ZCZA 1K55A 2A3UA 3GECA 2C5WB 2J80A 4DE3A 4JF6A 5E2FA 4X25A 1BSGA 4KZ4A 3UMEA 1TEMA 4DF6A 5GL9A 5FQKA 1VETB 4R38A 5DVAA 4G3KA 2WKEA 2WKHA 4IBRA 1TDLA 4LCMA 1FIKA 4P0MA 4MBFA 3LI9A 4N9KA 4GNUA 3HL9A 2M7VA 4IBXA 1PIOA 1TS7A 1AXBA 1KDWA 3IH8A 4HIAA 1BULA 2FH5A 4MN6A 4B88A 4OKPA 3OPLA 1S67L 2ZQCA 3R7WA 3T50A 5HAQA 4S2NC 2Z6CA 2ZC6B 2V1ZA 1KOUA 4IEDA 4E3KA 3LR4A 4L9EA 4LRYC 4K0WA 3LI8A 5HWTA 5EVID 3Q7ZA 2ZQDA 4BBTA 1L2SA 5GLBA 3H7WB 2EX2A 2Z2MB 1LL8A 4DRTA 1DP6A 2W3EA 3UDIA 3E98A 4JLFA 2R78A 2V0UA 2P08A 1OTEA 2M7UA 5DF7A 3C2WA 3H82A 2PBYA 5FQQA 3M2KA 1FR1A 4OOYA 1YLJA 3IHAA 1EWZA 1WE4A 1ZG6A 2ZBBA 1YLZA 3PTEA 3IH9A 1SDEA 2B95A 3WS0A 3QNBA 3BLMA 1J3WA 1Y4OA 4N1XA 5HDCA 3NOPC 5FQJA 2XDMA 1L0EA 4WLAA 2JKRI 2O9AA 1BLPA 3MXQA 3O3VA 4M3KA 1M40A 3AGFA 3PBNA 2ZC4B 3Q07A 3LYXA 4KQQA 3E2LA 3QNCA 1ZHHB 3S7NA 5HW3A 4KUOA 3O87A 1XFQA 1ZTUA 3CWFA 4E3IA 2ZQ8A 1WYBA 3BM6A 4HH2A 4N1HA 4WZ5C 3SH8A 4MN7A 2H10A 1MZUA 3CPTB 2W3HA 1HZOA 4DXCA 2KDKA 2I9VA 4NEED 4LGWA 1GA0A 1K4EA 2HGVA 3AGEA 3KYQA 5FQ9A 5KSHA 1ALQA 3R4KA 4JF4A 3RXXA 3QP4A 2WADA 2EFUA 4JGOA 4O8GA 4C6YA 3KSFA 4PKYG 4GS9B 4OVDA 4JXWA 2DNSA 2WAEA 1IYSA 1XFNA 1P0ZA 2W1RA 5FDSA 5HD5A 4YWZA 2CMNA 5KIZA 1BLSA 3FZCA 3BQ8A 4HJ6A 4BBUA 2ZQAA 1KGGA 1N9LA 1ZKJA 2A49A 4QHCA 4EUVA 3BFEA 4OOMA 5DJUA 4EQ1A 3D72A 5HL1A 4GZBA 4D60A 4EBNA 5FEGA 2V8FA 1P97A 4KG5A 1OJ5A 3IF6A 1ONGA 4ETZA 1LSXA 4EQIA 3ZG9B 3UE1A 1HLUP 3UY6A 3NDGA 1XJ6A 3T4TA 1P9RA 3V3RA 2WGIA 3PBQA 2JHEA 3Q82A 4B9OA 4GJ4A 1K54C 2GDNA 5HDSA 1T19A 5M18A 4KZ7A 3VFFA 2OAP1 3C30A 1YLPA 1ZC2A 1PYYA 3HLFA 3UB8A 1IOUA 2QWSA 4EXOA 4WL9A 1NZUA 4UQIM 1WA9A 2D02A 3Q81A 2O9BA 3IXHA 2L4RA 3PAEA 2X02A 3LY4A 1Y28A 4C75A 2K31A 2EFXA 4Y0TA 4CLCC 2EX8A 3IXBA 2PD7A 4R1GA 3UPOA 4O01A 5G4YA 4NG2A 1ONHA 2G7UA 4KZ5A 2XA7S 2PU4A 2DCFA 2OSUA 4WZ5A 3MXSA 1K57C 5EVIB 5KMWA 3IXGA 1SCWA 4H6JB 4OLGA 4EW7A 1FQGA 1H8ZA 4OH0A 3B3XA 4Y2FA 3UPNA 3EQVA 4F94A 4BL2A 3FWLA 5F1GA 5TGFA 2Y2LA 3G32A 1BYWA 3LR0A 4CLCE 1G68A 3TE8A 5CGXA 3HLCA 3UNWA 2JN7A 4E3MA 3W8KA 5HWVA 1UWPX 2AVXA 4YINA 4QU3A 5EM0A 3SW1A 1S1YA 3MQQA 2XFTA 2P74A 1BLHA 4R3BA 3FV7A 3Q7VA 2UV0E 1RGYA 5DF8A 4FD8A 2V0WA 1KGFA 5L8MA 3HLGA 3W2ZA 3T4LA 2HP6A 4E3LA 2ZQ9A 1ESIA 5FL3A 1X0OA 2ZL1B 1XA1A 3LIDA 4X56A 1W5DA 3FPWA 4GLQA 1MKMA 5K5BA 3ZG5A 1LL9A 2XA7M 3CAXA 4B93A 1LL5A 2L0WA 1MY8A 2NUTC 2QHKA 1CI8A 3V39A 3A0RA 4PPRA 3PR6A 5HX9A 5CERA 3ZQ5A 1CEGA 4P85A 4FSFA 4JXVA 2VA0A 1XKZA 1BZAA 5JYOA 3M6BA 2D01A 2W0NA 4MLLA 1LSVA 3A3IA 3RXWA 3MXRA 2B18A 4KZ6A 1PWDA 5HDDA 3RH8B 4ZJ3A 4MDZA 1CEFA 3PBOA 1VB6A 1F9IA 3UDFA 1RP5A 2VV6A 4DKIA 5DFXA 2H28A 1KE0A 3KYEA 3QP6A 1N9NA 3WS1A 4BLMA 4DE2A 3V50A 5TBMA 2WYXA 3HUNA 1GCEA 2Y79A 3GMWA 1NYMA 1K4FA 4O0PA 4R3AA 2ZM2A 1SZVA 2ZD8A 2VZWA 1YSPA 4E04A 2J9OA 2VX8A 1NZOA 1I2WA 3A0VA 4FTXA 2A24A 2OAQ1 3NULA 3VSKA 3D9YA 5FAQA 1H5XA 2ZQ7A 2Y4AA 3ICYA 4NXBA 5EPHA 3CHWP 1S6RA 1Z6FA 5KSCA 3HLWA 3ZNTA 1VETA 4HI4A 5DTKA 4UA7A 3KSHA 3IBRA 1E3UD 1TDGA 3S22A 2HZ5A 2JE5A 3HLEA 4PM7A 4O7DA 2PD8A 3CMZA 2ZLYA 3HVFA 1DJBA 5GHXA 3GR2A 5DF9A 3QP1A 5F69A 5EUAA 3OBFA 3SH9A 1OTDA 3O5YA 3L7HA 4WYYA 1T1AA 2KOIA 3LUQA 3R7WB 5HWWA 1W63Q 4PM5A 3IBJA 2QJ5A 4II7A 2XGNA 2OLVA 4UHUA 1STZA 1S4RA 3EQUA 2FFYA 4A5RA 5G18A 4EBPA 3IT9A 3ULFA 4S2PA 2ZC5B 2Y2HA 1BUEA 2EWVA 5EFWA 1T1BA 1W7FA 5EVIC 1DP9A 2PHYA 4Q8IA 4Y13A 4PKYA 4DJ3A 4KZ9A 1LT0A 4OPQA 1YKDA 3MQ0A 1TVFA 1L3LA 3V3SA 1T18A 1FSYA 4ZBEA 2K2NA 5I5LA 4QJGA 2GJ3A 5MC7A 4Q0JA 4X55A 4HOIA 2HJEA 1BT5A 3G31A 5F1FA 1DY6A 3GRJA 1E3UA 5AQBA 2B02A 2Z6DA 3LR3A 2XH9A 3T4OA 3GVBA 3OOVA 3OPHA 4PAUA 3DAVA 4QPRA 4UA6A 4CLCB 2WKPA 4P6ZM 4MEZA 4HBUA 3IX3A 2IA2A 3SS3A 2WK0A 1XGJA 5CHMA 3FKWA 3LICA 1TS0A 3IHBA 3ZDJA 3S1YA 3KYZA 4GB7A 3LO7A 2QMIA 5CHJA 4GD6A 4HP4A 1CK3A 3IS2B 3MJQA 1UWNX 3ZYTA 3ZHHA 2OOLA 1PI4A 4YNRA 4GOGA 3MZEA 2C6WB 3OCNA 1KVMA 4LENA 3CPTA 4R4RA 3HCYA 2HJ9C 5L07A 2CC1A 2HDUA 1FOFA 4NXEA 4JGQA 2XF3A 5EOOA 5HZHA 3UE6A 4HHDA 3BFGA 5DTSA 4GDBA 3QHYA 2Y2QA 5GHYA 3RTYA 1D7EA 1JTDA 4FOFA 3T4QA 1MWRA 3VV4A 5F68A 5DFYA 4G3VA 5J7EA 2W3FA 2HF6A 5CRFA 2Y2JA 4GCZA 5HAIA 4CPKA 3ITAA 3N4IA 5AQ9A 5AQAA 3KSIA 2W3DA 1PFLA 1ESUA 4R23A 3O88A 1ES3A 3G34A 2VV8A 3C8CA 5FEFA 4OQIA 4U3TA 3EOIA 5DTTA 5KZHA 1F2KA 2G2UA 1YSQA 1GHIA 4HH3A 2W27A 2XEPA 1YMSA 1OT6A 4NETA 1HD8A 1W8QA 4L9GA 3SH7A 1LI9A 4GHIA 2VJWA 2ZOIA 4JGPA 3K3DA 1K57A 3BWLA 4LRZE 4RYEA 1GHMA 3TSGA 5EVEA 2PAVP 4PHTA 4IHQA 1K56A 1PW1A 1MPLA 2PR6A 4BD0A 4C3QA 1XPBA 2Y91A 2JKGA 3PXPA 5C5KA 4DJ2A 4YOFA 2EWWA 3SS5A 2O9CA 1K25A 1V9YA 5BOHA 1JWZA 2XLNA 3NBLA 3TJZC 1TS6A 1PRQA 3HBRA 3FYZA 2Q9NA 3SOIA 4BBVA 3U4LP 5FQMA 3PBTA 4M4XA 4XUZA 1Y54A 4Y15A 4HNBA 4IJGA 2BLSA 4XXRA 4X53A 3T1SA 1IELA 2W1TA 4GW9A 4R4SA 2Y2NA 4N9LA 2PYRA 1IFQA 2J3TD 2R9WA 3LCEA 1KDSA 4JGRA 1YMXA 1K6RA 1UGUA 2JKRM 4I3IA 4OP5A 2IWBA 5FI6A 3LIFA 3LIEA 3IX8A 5JYPA 2X71A 1ERMA 4H8RA 5EOEA 1O07A 3DTEA 5AVEA 5F5YA 3W4OA 2EA9A 1D06A 1RGZA 4BENA 4BD1A 3VP1A 4HEFA 4Q0HA 3BRMA 1HVBA 3T1XA 1W79A 2OLUA 3BLSA 4Q0IA 3LGOA 3G30A 5FAOA 2WZZA 1F98A 4OONA 3NJAA 2VLGA 3GSGA 4DDSA 1MC0A 4OPZA 2V9AA 4S2MA 4I3AA 3DTIA 1JWVA 2ZL1A 1HTZA 3IWQA 1OTIA 2J3WA 4F3LB 1P9WA 4NKPA 5HARA 3HUMA 4HJ3A 3LY3A 2L1MA 2NUPC 1L0GA 4JF5A 4S2OA 4ME4A 5LBRA 5IS1A 1YQSA 2KLIA 5DJTA 2V8CA 5GLCA 4GKUA 1GSWA 5DKLA 4BL3A 2H5SA 3CLOA 5E2EA 1N4OA 3NCKA 4WM9A 4KG2A 1XP4A 4Y5FA 4B4XA 1YM1A 3MKFA 3WS2A 4ZTKA 4R70A 4KZ3A 3CITA 3ZNYA 5FASA 1KE4A 2VKSA 4Y3IA 3GTCA 3GV9A 3D3OA 1SKOB 2PRFA 5J4EA 3F1PA 1JNUA 1YLYA 1CF0A 3N8RA 1G5UA 1S66L 2JBFA 4PM9A 4EEPA 5GLDA 3BFDA 4OPYA 3IXDA 3ZG0A 3PYPA 3EWKA 5TBMB 3F1OA 1TD5A 4K91A 5G4ZA 5E43A 4MMNA 4Z9QA 2DRWA 3G2YA 4EETB 2Y55A 2WGVA 1NLYA 2Y2OA 3EEAA 3UE3A 1F5MA 3VP0A 4GDNA 2K7SA 3AGDA 1MKIA 1KE3A 5IHVA 3N6IA 2G2WA 4X68A 3A0SA 2XSSA 1OJGA 1PZPA 3MS6A 3OC2A 4PM6A 3VMAA 3VP2A 5FI2A 2WGWB 2EXAA 3B33A 3HLBA 3NOUC 3BFFA 1E25A 1GSXA 1ES4A 3MMHA 4LCLA 4EEUA 5GHZA 3EGXC 2PT7A 5AVFA 1MXOA 2KX6A 3T4SA 4WMCD 4MN5A 2QKPA 3HJIA 4LV3A 5FDHA 4KENB 4N92A 3UE0A 3Q1FA 3PHYA 3H9WA 4R3JA 4I38A 1ZG4A 2P9VB 5M19A 3VE3A 5E2HA 2IWDA 1OTAA 5EE8A 5A93A 4AFIA 4WUJA 2OV5A 3C5AA 2H0YA 3KX0X 4IUKA 1JWPA 2WKIA 4I3JA 1H8YA 2O0YA 2A2LA 2M1CA 4ARZA 3WS5A 1H3QA 3E2KA 2Q9MA 2HDRA 3NOTC 4Z1WA 2I72A 2VGLS 3A3FA 1FCNA 1M6KA 2Y2IA 2PYPA 4Y7PA 3A3EA 3HJKA 1QMFA 3DBAA 4E6WA 3F1NB 4HJ4A 4KQRA 1VEUA 3VE4A 1AWIA 1XJ4A 4WEKA 2E8IA 4KZAA 3TW8A 2HP5A 2GX5A 3PAGA 3U2AA 3UB7A 5HPIA 4WN5A 1YLTA 5CEBA 3NHQA 3PBRA 4EESA 3LIAA 3NDEA 1WYCA 3IF6C 3G4PA 1Q2QA 3A3DA 4P87A 5FATA 1VHMA 4WZ4A 4P6BA 4CLCA 1EI5A 4HP9A 4KZ8A 1G6AA 1S4SA 1JTGA 1K56D 3NC8A 3LIBA
chains in the Genus database with same CATH topology
5EVIA 3Q82A 3WRTA 1BTLA 5GHYA 3SS4A 1K54C 2GDNA 1JTDA 4KZBA 3UPPA 3VFHA 2V2FF 1MWRA 5M18A 4OOLA 5EVLA 4OQGA 4KZ7A 4OPRA 4RX3A 3VFFA 3HLDA 5J8XA 4S2LA 5CRFA 2Y2JA 1NY0A 1YLPA 1ZC2A 5HAIA 2J7VA 4CPKA 2XD1A 3BFCA 3FKVA 2RCXA 3ITAA 1PYYA 3N4IA 4RVAA 4NK3A 5AQ9A 3HLFA 5AQAA 5A92A 3DWKA 4IVKA 5CTNA 3PBSA 3HUOA 4GD8A 1ESUA 4R23A 3VP4A 1NZUA 2XR0A 1I2SA 3O88A 1ES3A 3G34A 3Q81A 3A3JA 1DJAA 3MBZA 2XQZA 2Y2PA 4QY5A 1MWTA 3BEBA 3IXHA 3TG9A 4OQIA 3PAEA 2BG1A 2X02A 3G35A 3LY4A 4U3TA 4X6TA 5DTTA 5KZHA 4JBFA 1ES2A 3D4FA 4S2NA 2G2UA 3ZG7B 4C75A 2EFXA 3C4OA 1K38A 2X01A 1GHIA 4Y0TA 3ZG8B 3P09A 2EX8A 2XEPA 1FR6A 3IXBA 5FAPA 3VOYA 1YMSA 4R1GA 3M6HA 4NETA 3UPOA 1HD8A 3Q7VB 3IQAA 1W8QA 2WUQA 2JC7A 3SH7A 1LI9A 1ONHA 1SHVA 4JPMA 1RCJA 3OZHA 2Z2LB 4KZ5A 1K57A 4OQ0A 2Y2GA 2PU4A 2DCFA 2OSUA 4WZ5A 5CEDA 2HDQA 3MXSA 3P98A 4RYEA 1JVJA 1GHMA 1K57C 4JKTA 5EVIB 5KMWA 3TSGA 3IXGA 4CJNA 1SCWA 4EWFA 4OLGA 4PM8A 1FQGA 1H8ZA 1K56A 3OPPA 3UDXA 2ZM0A 1PW1A 1MPLA 4HESA 4OH0A 3B3XA 3UPNA 4BD0A 1SKFA 4D2OA 4ZJ1A 3C7UA 3EQVA 4F94A 4XUXA 1NXYA 4C3QA 1XPBA 4BL2A 2Y91A 2HP9A 3MZFA 4YFMA 2ZJ9A 3IF5A 3FWLA 4E3JA 4S2IA 2Y2KA 1PW8A 3I7JA 3SS5A 4BJPA 4OQHA 4FH2A 5F1GA 1K25A 4MBKA 5TGFA 5BOHA 5GLAA 1K6SA 2Y2LA 1I5QA 1JWZA 3G32A 5M1AA 4EV4A 1O7EA 2XLNA 3NBLA 2EXBA 3W4PA 1G68A 4K0XA 5CGXA 3HLCA 4HBTA 5F83A 3UNWA 3BYDA 4E3MA 3HBRA 5E2GA 3FYZA 3W8KA 2Q9NA 4WBGA 3SOIA 1NYYA 5A90A 5FQMA 3M2JA 2ZC7A 3NIAA 4YINA 4QU3A 3PBTA 1FSWA 3CG5A 4WELA 1MWSA 1OMEA 1FCOA 1Y54A 4XUZA 3UN7A 5CHUA 4LV2A 2XFTA 2P74A 5AQ7A 1BLHA 2BLSA 4XXRA 4R3BA 3FV7A 4X53A 5F82A 3Q7VA 1IELA 2HDSA 3NY4A 3DW0A 5I94A 1RGYA 1KGEA 3TOIA 3C7VA 5DF8A 3N8LA 1NJ4A 4FD8A 1KGFA 3S4XA 4R4SA 2Y2NA 4N9LA 3HLGA 3NI9A 4ID4A 4E3LA 2HP6A 2QPNA 2R9WA 1K55C 1ESIA 2ZQ9A 3LCEA 4MBHA 1KDSA 1QMEA 1XA1A 4X56A 1W5DA 1K54A 1YMXA 1K6RA 3C4PA 4OP5A 4X69A 2IWBA 1DJCA 1PWCA 4ZAMA 4QY6A 5CECA 1W8YA 5FQIA 1J9MA 5FI6A 1N9BA 2Y59A 2ZMAA 3ZG5A 1LL9A 1NRFA 5HFOA 1LL5A 1MY8A 4E6XA 5JYPA 2X71A 1ERMA 1CI8A 3OCLA 1L0DA 4H8RA 5EOEA 4KG6A 1O07A 3BECA 3V39A 4Y0OA 1YLWA 2IWCA 4PPRA 2JCHA 3W4OA 5HX9A 5CERA 1BLCA 1RGZA 1SDNA 4BENA 3JYIA 1PZOA 1CEGA 4P85A 4BD1A 3VP1A 1E4DA 3WWXA 2Y2MA 4HEFA 1XGIA 3BRMA 4FCFA 4FSFA 3RJUA 4JXVA 3WRZA 1HVBA 5CXWA 1PI5A 1XKZA 1BZAA 1W79A 2OLUA 5JYOA 3M6BA 3BLSA 3OPRA 1LHYA 2ZM8A 3UO9A 1L0FA 3G30A 3ZCZA 1K55A 4MLLA 2A3UA 3A3IA 2C5WB 3RXWA 4DE3A 3MXRA 4JF6A 4KZ6A 5E2FA 5FAOA 1BSGA 2WZZA 4KZ4A 1PWDA 1TEMA 4DF6A 5GL9A 4OONA 5FQKA 4ZJ3A 4DDSA 3GSGA 1CEFA 3PBOA 5DVAA 3IWIA 3VP3A 4LV1A 4OPZA 3UDFA 1RP5A 2WKEA 2WKHA 4IBRA 4S2MA 4QD4A 5TR7A 4DKIA 1TDLA 4LCMA 4P0MA 4MBFA 4N9KA 4PMAA 4GNUA 1JWVA 1KE0A 3HL9A 1HTZA 3IWQA 4IBXA 1PIOA 3MKEA 3DWZA 1AXBA 1KDWA 3IH8A 3WS1A 4BLMA 4FH4A 1BULA 5HARA 3HUMA 4DE2A 3V50A 1CI9A 2V20A 3LY3A 1L0GA 1MBLA 2WYXA 3HUNA 4B88A 1GCEA 4JF5A 4S2OA 1PWGA 1U60A 2H0TA 2PU2A 3GMWA 4OKPA 3OPLA 5FI7A 1NYMA 1K4FA 4DXBA 2HPBA 2ZM2A 1YQSA 2VGKA 2ZQCA 2ZD8A 5GLCA 4GKUA 3W4QA 2J9OA 5HAQA 1NZOA 2UWXA 4QB8A 1I2WA 3ZVTA 4BL3A 4S2NC 2H5SA 3VSKA 5E2EA 2ZC6B 4EBLA 4U0TA 2V1ZA 1N4OA 3NCKA 4WM9A 4IEDA 5FAQA 4E3KA 1KVLA 1LI0A 5CTMA 1H5XA 4KG2A 1XP4A 2ZQ7A 2Y4AA 5EECA 4K0WA 4B4XA 1YM1A 5EPHA 3MKFA 3WS2A 4ZTKA 4KZ3A 3ZNYA 3ITBA 5EVID 1KE4A 5FASA 3Q7ZA 1YT4A 1S6RA 2ZQDA 3IWOA 1Z6FA 1L2SA 4WEJA 5KSCA 5GLBA 3HLWA 3GTCA 3GV9A 3ZNTA 4WMCA 2EX2A 2Z2MB 4L0LA 5DTKA 4UA7A 4DRTA 1EROA 3UDIA 1YLYA 3N8RA 4JLFA 1E3UD 1TDGA 2JE5A 4S2JA 3HLEA 4PM7A 3S22A 5L2FA 1IYOA 1GHPA 4O7DA 2JBFA 4PM9A 3CMZA 2WAFA 2ZLYA 3HVFA 5GLDA 3BFDA 1DJBA 1IYQA 4OPYA 4Y0UA 3GR2A 5GHXA 3IXDA 5DF9A 3VSLA 3ZG0A 1VM1A 2J8YA 5DF7A 1S0WA 2PBYA 5FQQA 4E3OA 2XK1A 3ZGAB 2FFFB 3M2KA 5EUAA 1FR1A 4OOYA 1YLJA 4JXSA 5U47A 3SH9A 1ERQA 3G2ZA 4K91A 4GN2A 4LV0A 1Q2PA 4WYYA 3IHAA 1EWZA 1WE4A 3HREA 2QZ6A 1ZG6A 5A91A 1YLZA 3PTEA 5E43A 3IH9A 3PBQA 4Z9QA 2DRWA 1SDEA 4PM5A 3WS0A 3QNBA 3BLMA 3G2YA 5FA7A 2Y55A 1C3BA 2ZC3B 4N1XA 2VGJA 2WGVA 5FQJA 2XDMA 1L0EA 2Y2OA 3CZDA 4DE0A 4OP8A 3N7WA 2XGNA 2OLVA 3UE3A 1GA9A 1BLPA 3EQUA 4UHUA 2FFYA 3O3VA 4M3KA 4OLDA 3DTMA 3VP0A 1M40A 3AGFA 5G18A 4GDNA 2J9PA 3PBNA 4A5RA 2ZC4B 5TFQA 4EBPA 3Q07A 3IT9A 3AGDA 4S2PA 1MKIA 1KE3A 2ZC5B 2Y2HA 1BUEA 4RA7A 5IHVA 1W7FA 3N8SA 4KQQA 3N6IA 4IVIA 5EVIC 2G2WA 4X68A 3E2LA 4Q8IA 3QNCA 1PZPA 3VMAA 3OC2A 4PM6A 3VP2A 5HW3A 5FI2A 2WGWB 3O87A 2EXAA 3HLBA 4JXGA 3BFFA 4KZ9A 1E25A 4E3IA 1ES4A 2ZQ8A 4OPQA 1WYBA 3BM6A 4LCLA 4N1HA 4WZ5C 5GHZA 3SH8A 1MWUA 2H10A 1TVFA 3V3SA 1HZOA 1FSYA 1FCMA 4ZBEA 4DXCA 1IKIA 4QJGA 5D3OA 1MXOA 5FSRA 4X55A 4WMCD 4ZJ2A 4EUZA 3IF6B 4LV3A 5FDHA 1BT5A 3G31A 1GA0A 1K4EA 4KENB 4N92A 3UE0A 3AGEA 1DY6A 3Q1FA 5FQ9A 5F1FA 5KSHA 3GRJA 1E3UA 1ALQA 5AQBA 4R3JA 3WS4A 2XH9A 3GVBA 2B5RA 3OPHA 1ZG4A 4JF4A 2P9VB 5M19A 4UA6A 3RXXA 2IWDA 5E2HA 4MEZA 2WADA 2EFUA 3O86A 4HBUA 5EE8A 5A93A 3CJMA 3SS3A 2WK0A 1XGJA 5CHMA 3FKWA 3ZVWA 2OV5A 3C5AA 4C6YA 2H0YA 1XX2A 5CGSA 4DDYA 4JXWA 4OVDA 1JWPA 2EX9A 4ZDXA 2WKIA 3IHBA 1XA7A 3MFDA 3ZDJA 2DNSA 1H8YA 3NC8A 2WAEA 3V5MA 1IYSA 1XXMA 4UAAA 3S1YA 3WS5A 1IEMA 3E2KA 4GB7A 3ISGA 3LO7A 2EX6A 2Q9MA 2R9XA 2QMIA 1BLSA 2RL3A 4MNRA 5CHJA 2HDRA 2I72A 3FZCA 4GD6A 3A3FA 3LEZA 2XFSA 1CK3A 1FCNA 1M6KA 2Y2IA 4E3NA 1VQQA 4Y7PA 2ZQAA 1KGGA 1ZKJA 2A49A 3A3EA 5HAPA 1IKGA 4QHCA 4U0XA 3ZHHA 1QMFA 2WGWA 1PI4A 3BFEA 4OOMA 4E6WA 4GOGA 3MZEA 2XD5A 4UA9A 2C6WB 3OCNA 4KQRA 1KVMA 5HL1A 4LENA 4KQOA 2E8IA 4WEKA 4KZAA 4GZBA 2HP5A 3PAGA 4R4RA 4EBNA 3ZFZA 4KG5A 1LLBA 1YLTA 5CEBA 5CGWA 2CC1A 2HDUA 1FOFA 4S2KA 3PBRA 3IF6A 3MZDA 2XF3A 1ONGA 5EOOA 2WZXA 4B4ZA 3NDEA 4EQIA 1WYCA 3ZG9B 3IF6C 3G4PA 1Q2QA 3GQZA 3UE1A 3UY6A 3BFGA 3A3DA 3NDGA 4P87A 4RX2A 5FATA 4BQMA 5DTSA 2P9VA 4WZ4A 4P6BA 3VOZA 1EI5A 4KZ8A 1G6AA 4GDBA 1IYPA 3QHYA 1JTGA 2Y2QA 3V3RA 1K56D 2WGIA 1ES5A 4R0QA 4DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI A;  3Q82 A;  3WRT A;  1BTL A;  5GHY A;  3SS4 A;  1K54 C;  2GDN A;  1JTD A;  4KZB A;  3UPP A;  3VFH A;  2V2F F;  1MWR A;  5M18 A;  4OOL A;  5EVL A;  4OQG A;  4KZ7 A;  4OPR A;  4RX3 A;  3VFF A;  3HLD A;  5J8X A;  4S2L A;  5CRF A;  2Y2J A;  1NY0 A;  1YLP A;  1ZC2 A;  5HAI A;  2J7V A;  4CPK A;  2XD1 A;  3BFC A;  3FKV A;  2RCX A;  3ITA A;  1PYY A;  3N4I A;  4RVA A;  4NK3 A;  5AQ9 A;  3HLF A;  5AQA A;  5A92 A;  3DWK A;  4IVK A;  5CTN A;  3PBS A;  3HUO A;  4GD8 A;  1ESU A;  4R23 A;  3VP4 A;  1NZU A;  2XR0 A;  1I2S A;  3O88 A;  1ES3 A;  3G34 A;  3Q81 A;  3A3J A;  1DJA A;  3MBZ A;  2XQZ A;  2Y2P A;  4QY5 A;  1MWT A;  3BEB A;  3IXH A;  3TG9 A;  4OQI A;  3PAE A;  2BG1 A;  2X02 A;  3G35 A;  3LY4 A;  4U3T A;  4X6T A;  5DTT A;  5KZH A;  4JBF A;  1ES2 A;  3D4F A;  4S2N A;  2G2U A;  3ZG7 B;  4C75 A;  2EFX A;  3C4O A;  1K38 A;  2X01 A;  1GHI A;  4Y0T A;  3ZG8 B;  3P09 A;  2EX8 A;  2XEP A;  1FR6 A;  3IXB A;  5FAP A;  3VOY A;  1YMS A;  4R1G A;  3M6H A;  4NET A;  3UPO A;  1HD8 A;  3Q7V B;  3IQA A;  1W8Q A;  2WUQ A;  2JC7 A;  3SH7 A;  1LI9 A;  1ONH A;  1SHV A;  4JPM A;  1RCJ A;  3OZH A;  2Z2L B;  4KZ5 A;  1K57 A;  4OQ0 A;  2Y2G A;  2PU4 A;  2DCF A;  2OSU A;  4WZ5 A;  5CED A;  2HDQ A;  3MXS A;  3P98 A;  4RYE A;  1JVJ A;  1GHM A;  1K57 C;  4JKT A;  5EVI B;  5KMW A;  3TSG A;  3IXG A;  4CJN A;  1SCW A;  4EWF A;  4OLG A;  4PM8 A;  1FQG A;  1H8Z A;  1K56 A;  3OPP A;  3UDX A;  2ZM0 A;  1PW1 A;  1MPL A;  4HES A;  4OH0 A;  3B3X A;  3UPN A;  4BD0 A;  1SKF A;  4D2O A;  4ZJ1 A;  3C7U A;  3EQV A;  4F94 A;  4XUX A;  1NXY A;  4C3Q A;  1XPB A;  4BL2 A;  2Y91 A;  2HP9 A;  3MZF A;  4YFM A;  2ZJ9 A;  3IF5 A;  3FWL A;  4E3J A;  4S2I A;  2Y2K A;  1PW8 A;  3I7J A;  3SS5 A;  4BJP A;  4OQH A;  4FH2 A;  5F1G A;  1K25 A;  4MBK A;  5TGF A;  5BOH A;  5GLA A;  1K6S A;  2Y2L A;  1I5Q A;  1JWZ A;  3G32 A;  5M1A A;  4EV4 A;  1O7E A;  2XLN A;  3NBL A;  2EXB A;  3W4P A;  1G68 A;  4K0X A;  5CGX A;  3HLC A;  4HBT A;  5F83 A;  3UNW A;  3BYD A;  4E3M A;  3HBR A;  5E2G A;  3FYZ A;  3W8K A;  2Q9N A;  4WBG A;  3SOI A;  1NYY A;  5A90 A;  5FQM A;  3M2J A;  2ZC7 A;  3NIA A;  4YIN A;  4QU3 A;  3PBT A;  1FSW A;  3CG5 A;  4WEL A;  1MWS A;  1OME A;  1FCO A;  1Y54 A;  4XUZ A;  3UN7 A;  5CHU A;  4LV2 A;  2XFT A;  2P74 A;  5AQ7 A;  1BLH A;  2BLS A;  4XXR A;  4R3B A;  3FV7 A;  4X53 A;  5F82 A;  3Q7V A;  1IEL A;  2HDS A;  3NY4 A;  3DW0 A;  5I94 A;  1RGY A;  1KGE A;  3TOI A;  3C7V A;  5DF8 A;  3N8L A;  1NJ4 A;  4FD8 A;  1KGF A;  3S4X A;  4R4S A;  2Y2N A;  4N9L A;  3HLG A;  3NI9 A;  4ID4 A;  4E3L A;  2HP6 A;  2QPN A;  2R9W A;  1K55 C;  1ESI A;  2ZQ9 A;  3LCE A;  4MBH A;  1KDS A;  1QME A;  1XA1 A;  4X56 A;  1W5D A;  1K54 A;  1YMX A;  1K6R A;  3C4P A;  4OP5 A;  4X69 A;  2IWB A;  1DJC A;  1PWC A;  4ZAM A;  4QY6 A;  5CEC A;  1W8Y A;  5FQI A;  1J9M A;  5FI6 A;  1N9B A;  2Y59 A;  2ZMA A;  3ZG5 A;  1LL9 A;  1NRF A;  5HFO A;  1LL5 A;  1MY8 A;  4E6X A;  5JYP A;  2X71 A;  1ERM A;  1CI8 A;  3OCL A;  1L0D A;  4H8R A;  5EOE A;  4KG6 A;  1O07 A;  3BEC A;  3V39 A;  4Y0O A;  1YLW A;  2IWC A;  4PPR A;  2JCH A;  3W4O A;  5HX9 A;  5CER A;  1BLC A;  1RGZ A;  1SDN A;  4BEN A;  3JYI A;  1PZO A;  1CEG A;  4P85 A;  4BD1 A;  3VP1 A;  1E4D A;  3WWX A;  2Y2M A;  4HEF A;  1XGI A;  3BRM A;  4FCF A;  4FSF A;  3RJU A;  4JXV A;  3WRZ A;  1HVB A;  5CXW A;  1PI5 A;  1XKZ A;  1BZA A;  1W79 A;  2OLU A;  5JYO A;  3M6B A;  3BLS A;  3OPR A;  1LHY A;  2ZM8 A;  3UO9 A;  1L0F A;  3G30 A;  3ZCZ A;  1K55 A;  4MLL A;  2A3U A;  3A3I A;  2C5W B;  3RXW A;  4DE3 A;  3MXR A;  4JF6 A;  4KZ6 A;  5E2F A;  5FAO A;  1BSG A;  2WZZ A;  4KZ4 A;  1PWD A;  1TEM A;  4DF6 A;  5GL9 A;  4OON A;  5FQK A;  4ZJ3 A;  4DDS A;  3GSG A;  1CEF A;  3PBO A;  5DVA A;  3IWI A;  3VP3 A;  4LV1 A;  4OPZ A;  3UDF A;  1RP5 A;  2WKE A;  2WKH A;  4IBR A;  4S2M A;  4QD4 A;  5TR7 A;  4DKI A;  1TDL A;  4LCM A;  4P0M A;  4MBF A;  4N9K A;  4PMA A;  4GNU A;  1JWV A;  1KE0 A;  3HL9 A;  1HTZ A;  3IWQ A;  4IBX A;  1PIO A;  3MKE A;  3DWZ A;  1AXB A;  1KDW A;  3IH8 A;  3WS1 A;  4BLM A;  4FH4 A;  1BUL A;  5HAR A;  3HUM A;  4DE2 A;  3V50 A;  1CI9 A;  2V20 A;  3LY3 A;  1L0G A;  1MBL A;  2WYX A;  3HUN A;  4B88 A;  1GCE A;  4JF5 A;  4S2O A;  1PWG A;  1U60 A;  2H0T A;  2PU2 A;  3GMW A;  4OKP A;  3OPL A;  5FI7 A;  1NYM A;  1K4F A;  4DXB A;  2HPB A;  2ZM2 A;  1YQS A;  2VGK A;  2ZQC A;  2ZD8 A;  5GLC A;  4GKU A;  3W4Q A;  2J9O A;  5HAQ A;  1NZO A;  2UWX A;  4QB8 A;  1I2W A;  3ZVT A;  4BL3 A;  4S2N C;  2H5S A;  3VSK A;  5E2E A;  2ZC6 B;  4EBL A;  4U0T A;  2V1Z A;  1N4O A;  3NCK A;  4WM9 A;  4IED A;  5FAQ A;  4E3K A;  1KVL A;  1LI0 A;  5CTM A;  1H5X A;  4KG2 A;  1XP4 A;  2ZQ7 A;  2Y4A A;  5EEC A;  4K0W A;  4B4X A;  1YM1 A;  5EPH A;  3MKF A;  3WS2 A;  4ZTK A;  4KZ3 A;  3ZNY A;  3ITB A;  5EVI D;  1KE4 A;  5FAS A;  3Q7Z A;  1YT4 A;  1S6R A;  2ZQD A;  3IWO A;  1Z6F A;  1L2S A;  4WEJ A;  5KSC A;  5GLB A;  3HLW A;  3GTC A;  3GV9 A;  3ZNT A;  4WMC A;  2EX2 A;  2Z2M B;  4L0L A;  5DTK A;  4UA7 A;  4DRT A;  1ERO A;  3UDI A;  1YLY A;  3N8R A;  4JLF A;  1E3U D;  1TDG A;  2JE5 A;  4S2J A;  3HLE A;  4PM7 A;  3S22 A;  5L2F A;  1IYO A;  1GHP A;  4O7D A;  2JBF A;  4PM9 A;  3CMZ A;  2WAF A;  2ZLY A;  3HVF A;  5GLD A;  3BFD A;  1DJB A;  1IYQ A;  4OPY A;  4Y0U A;  3GR2 A;  5GHX A;  3IXD A;  5DF9 A;  3VSL A;  3ZG0 A;  1VM1 A;  2J8Y A;  5DF7 A;  1S0W A;  2PBY A;  5FQQ A;  4E3O A;  2XK1 A;  3ZGA B;  2FFF B;  3M2K A;  5EUA A;  1FR1 A;  4OOY A;  1YLJ A;  4JXS A;  5U47 A;  3SH9 A;  1ERQ A;  3G2Z A;  4K91 A;  4GN2 A;  4LV0 A;  1Q2P A;  4WYY A;  3IHA A;  1EWZ A;  1WE4 A;  3HRE A;  2QZ6 A;  1ZG6 A;  5A91 A;  1YLZ A;  3PTE A;  5E43 A;  3IH9 A;  3PBQ A;  4Z9Q A;  2DRW A;  1SDE A;  4PM5 A;  3WS0 A;  3QNB A;  3BLM A;  3G2Y A;  5FA7 A;  2Y55 A;  1C3B A;  2ZC3 B;  4N1X A;  2VGJ A;  2WGV A;  5FQJ A;  2XDM A;  1L0E A;  2Y2O A;  3CZD A;  4DE0 A;  4OP8 A;  3N7W A;  2XGN A;  2OLV A;  3UE3 A;  1GA9 A;  1BLP A;  3EQU A;  4UHU A;  2FFY A;  3O3V A;  4M3K A;  4OLD A;  3DTM A;  3VP0 A;  1M40 A;  3AGF A;  5G18 A;  4GDN A;  2J9P A;  3PBN A;  4A5R A;  2ZC4 B;  5TFQ A;  4EBP A;  3Q07 A;  3IT9 A;  3AGD A;  4S2P A;  1MKI A;  1KE3 A;  2ZC5 B;  2Y2H A;  1BUE A;  4RA7 A;  5IHV A;  1W7F A;  3N8S A;  4KQQ A;  3N6I A;  4IVI A;  5EVI C;  2G2W A;  4X68 A;  3E2L A;  4Q8I A;  3QNC A;  1PZP A;  3VMA A;  3OC2 A;  4PM6 A;  3VP2 A;  5HW3 A;  5FI2 A;  2WGW B;  3O87 A;  2EXA A;  3HLB A;  4JXG A;  3BFF A;  4KZ9 A;  1E25 A;  4E3I A;  1ES4 A;  2ZQ8 A;  4OPQ A;  1WYB A;  3BM6 A;  4LCL A;  4N1H A;  4WZ5 C;  5GHZ A;  3SH8 A;  1MWU A;  2H10 A;  1TVF A;  3V3S A;  1HZO A;  1FSY A;  1FCM A;  4ZBE A;  4DXC A;  1IKI A;  4QJG A;  5D3O A;  1MXO A;  5FSR A;  4X55 A;  4WMC D;  4ZJ2 A;  4EUZ A;  3IF6 B;  4LV3 A;  5FDH A;  1BT5 A;  3G31 A;  1GA0 A;  1K4E A;  4KEN B;  4N92 A;  3UE0 A;  3AGE A;  1DY6 A;  3Q1F A;  5FQ9 A;  5F1F A;  5KSH A;  3GRJ A;  1E3U A;  1ALQ A;  5AQB A;  4R3J A;  3WS4 A;  2XH9 A;  3GVB A;  2B5R A;  3OPH A;  1ZG4 A;  4JF4 A;  2P9V B;  5M19 A;  4UA6 A;  3RXX A;  2IWD A;  5E2H A;  4MEZ A;  2WAD A;  2EFU A;  3O86 A;  4HBU A;  5EE8 A;  5A93 A;  3CJM A;  3SS3 A;  2WK0 A;  1XGJ A;  5CHM A;  3FKW A;  3ZVW A;  2OV5 A;  3C5A A;  4C6Y A;  2H0Y A;  1XX2 A;  5CGS A;  4DDY A;  4JXW A;  4OVD A;  1JWP A;  2EX9 A;  4ZDX A;  2WKI A;  3IHB A;  1XA7 A;  3MFD A;  3ZDJ A;  2DNS A;  1H8Y A;  3NC8 A;  2WAE A;  3V5M A;  1IYS A;  1XXM A;  4UAA A;  3S1Y A;  3WS5 A;  1IEM A;  3E2K A;  4GB7 A;  3ISG A;  3LO7 A;  2EX6 A;  2Q9M A;  2R9X A;  2QMI A;  1BLS A;  2RL3 A;  4MNR A;  5CHJ A;  2HDR A;  2I72 A;  3FZC A;  4GD6 A;  3A3F A;  3LEZ A;  2XFS A;  1CK3 A;  1FCN A;  1M6K A;  2Y2I A;  4E3N A;  1VQQ A;  4Y7P A;  2ZQA A;  1KGG A;  1ZKJ A;  2A49 A;  3A3E A;  5HAP A;  1IKG A;  4QHC A;  4U0X A;  3ZHH A;  1QMF A;  2WGW A;  1PI4 A;  3BFE A;  4OOM A;  4E6W A;  4GOG A;  3MZE A;  2XD5 A;  4UA9 A;  2C6W B;  3OCN A;  4KQR A;  1KVM A;  5HL1 A;  4LEN A;  4KQO A;  2E8I A;  4WEK A;  4KZA A;  4GZB A;  2HP5 A;  3PAG A;  4R4R A;  4EBN A;  3ZFZ A;  4KG5 A;  1LLB A;  1YLT A;  5CEB A;  5CGW A;  2CC1 A;  2HDU A;  1FOF A;  4S2K A;  3PBR A;  3IF6 A;  3MZD A;  2XF3 A;  1ONG A;  5EOO A;  2WZX A;  4B4Z A;  3NDE A;  4EQI A;  1WYC A;  3ZG9 B;  3IF6 C;  3G4P A;  1Q2Q A;  3GQZ A;  3UE1 A;  3UY6 A;  3BFG A;  3A3D A;  3NDG A;  4P87 A;  4RX2 A;  5FAT A;  4BQM A;  5DTS A;  2P9V A;  4WZ4 A;  4P6B A;  3VOZ A;  1EI5 A;  4KZ8 A;  1G6A A;  4GDB A;  1IYP A;  3QHY A;  1JTG A;  2Y2Q A;  3V3R A;  1K56 D;  2WGI A;  1ES5 A;  4R0Q A;  4DE1 A; 
#chains in the Genus database with same CATH topology
 3WRT A;  3SS4 A;  2PBD P;  4KZB A;  2V2F F;  5AJG A;  4OOL A;  5EVL A;  3B47 A;  4L9F A;  4OPR A;  4RX3 A;  3T1Q B;  3HLD A;  1NY0 A;  2RCX A;  2GNX A;  1V9Z A;  3IS2 A;  3MFX A;  5A8B A;  5A92 A;  1CQA A;  4GD8 A;  1TS8 A;  3VP4 A;  2QYB A;  1I2S A;  3A3J A;  4QWO A;  2XQZ A;  2Y2P A;  3E4O A;  5HSQ A;  3G35 A;  4X6T A;  3TRC A;  2P04 A;  5F6A A;  3ZG7 B;  3EGD C;  3P09 A;  1FR6 A;  5FAP A;  3M6H A;  4WF0 A;  3KO6 A;  4XT2 A;  2JC7 A;  3BY9 A;  1RCJ A;  3OZH A;  4FUW A;  4OQ0 A;  2VV7 A;  2HDQ A;  3P98 A;  4CJN A;  3UDX A;  2JKT I;  1SKF A;  4ZJ1 A;  4EU0 A;  4XUX A;  3BJN A;  4HQA A;  3MZF A;  4YFM A;  2MJ6 A;  4S2I A;  2Y2K A;  1PW8 A;  3I7J A;  4BJP A;  4BMW A;  4MBK A;  4Y17 A;  5GLA A;  5M1A A;  1O7E A;  5CX7 A;  2EXB A;  4HBT A;  3K2N A;  3BYD A;  3JPU A;  4ESP A;  1DRM A;  3UB5 P;  4WBG A;  3NIA A;  4BWI A;  3CG5 A;  3LEQ A;  4ETX A;  4WEL A;  1OME A;  2JKT M;  3MF0 A;  3E4Q A;  2ZOH A;  3QP8 A;  3RFB A;  1KGE A;  4GHI B;  3E4P A;  3C7V A;  3N8L A;  1NJ4 A;  1CJF A;  3S4X A;  1OPX A;  1XJ2 A;  2E8J A;  2QPN A;  1K55 C;  1YAX A;  4MBH A;  3JVV A;  3C4P A;  3BQA A;  1PWC A;  4ZAM A;  5CEC A;  1W8Y A;  3S7Q A;  1D1J A;  2ZMA A;  1NRF A;  4E6X A;  3OCL A;  4KUK A;  5TJJ A;  4KG6 A;  4Y0O A;  1YLW A;  2IWC A;  3MSH A;  1BLC A;  1E4D A;  1XGI A;  2Q0O A;  3RJU A;  3V67 A;  3VOL A;  5CXW A;  1PI5 A;  3T12 B;  1LHY A;  3UO9 A;  1L0F A;  2YKF A;  3CUE C;  5IU1 A;  4RQ9 A;  4KQD A;  3H7W A;  2W1T B;  4LFU A;  3IWI A;  3VP3 A;  4LV1 A;  5TR7 A;  3IX4 A;  4QD4 A;  4PMA A;  2WKQ A;  2QJ7 A;  3MKE A;  3DWZ A;  3H82 B;  4FH4 A;  4LRX C;  1CI9 A;  2V20 A;  2P7J A;  1MBL A;  4LLO B;  1PWG A;  1U60 A;  2H0T A;  2PU2 A;  5FI7 A;  4DXB A;  2HPB A;  2VGK A;  3NEC A;  3W4Q A;  2UWX A;  4X1L A;  4QB8 A;  3ZVT A;  3GDI A;  4EBL A;  5HD3 A;  4U0T A;  4NXG A;  5IT5 A;  1KVL A;  1LI0 A;  2BAS A;  5CTM A;  3EEH A;  5EEC A;  1LSW A;  2O99 A;  3ITB A;  1YT4 A;  3IWO A;  4WEJ A;  4DMZ A;  4WMC A;  4L0L A;  2VEA A;  1ERO A;  4S2J A;  5L2F A;  2LB5 A;  1IYO A;  1GHP A;  2WAF A;  4F3L A;  1IYQ A;  4Y0U A;  3VSL A;  2PDR A;  1VM1 A;  2J8Y A;  1S0W A;  4HY8 A;  4E3O A;  2XK1 A;  3ZGA B;  2FFF B;  5HL6 A;  2JKF A;  4JXS A;  5U47 A;  1ERQ A;  3G2Z A;  4GN2 A;  4LV0 A;  1Q2P A;  3HRE A;  2QZ6 A;  5A91 A;  4ZRR A;  1A0K A;  1N9O A;  5FA7 A;  1C3B A;  2ZC3 B;  4UEY A;  2VGL M;  2VGJ A;  4GS9 A;  4DE0 A;  3CZD A;  1ACF A;  4OP8 A;  3N7W A;  2PR5 A;  1GA9 A;  4MCW A;  3LFV A;  4OLD A;  3DTM A;  1TF1 A;  2J9P A;  5TFQ A;  5L09 A;  1NLZ A;  4RA7 A;  1PNE A;  3N8S A;  3KSG A;  3CI6 A;  4IVI A;  1SKO A;  3BW6 A;  3F1P B;  4JXG A;  1OT9 A;  3L9K A;  1MWU A;  1FCM A;  2V1A A;  1IKI A;  5D3O A;  5FSR A;  4ZJ2 A;  4EUZ A;  3CUE A;  3IF6 B;  3F1O B;  1K0K A;  3WS4 A;  5EV0 A;  2B5R A;  3O86 A;  3CJM A;  2DMW A;  3ZVW A;  5CGS A;  1XX2 A;  2ACG A;  4DDY A;  1Z09 A;  2EX9 A;  4ZDX A;  1H0M A;  1XA7 A;  3MFD A;  1XJ3 A;  3V5M A;  2V1B A;  1XXM A;  3T1R A;  4UAA A;  1IEM A;  3ISG A;  2EX6 A;  2R9X A;  5HPF A;  3UB9 A;  2RL3 A;  4MNR A;  3LEZ A;  2XFS A;  2YKH A;  4E3N A;  1VQQ A;  5HAP A;  1IKG A;  4U0X A;  1NRJ A;  2WGW A;  3S7O A;  4UA9 A;  2XD5 A;  3MQO A;  3BY8 A;  1GSV A;  4KQO A;  3ZFZ A;  1LLB A;  5CGW A;  4S2K A;  4P6Z S;  3MZD A;  2WZX A;  4B4Z A;  1ODV A;  3GQZ A;  4RX2 A;  4UQI S;  4BQM A;  4K08 A;  2P9V A;  3VOZ A;  1IYP A;  2OWJ A;  1DP8 A;  1ES5 A;  4R0Q A;  4DE1 A;  5EVI A;  4EER A;  5J8X A;  1BTL A;  4H6J A;  4NXF A;  3VFH A;  3UPP A;  1NWZ A;  4OQG A;  5J3W A;  1S1Z A;  4ARZ B;  2VK3 A;  4S2L A;  2J7V A;  2XD1 A;  3BFC A;  3FKV A;  3DTK A;  4RVA A;  4NK3 A;  4LPZ A;  2ZMV A;  2XRO A;  2FZ0 A;  3DWK A;  4IVK A;  5CTN A;  3PBS A;  3HUO A;  3F1N A;  2XR0 A;  3OLO A;  1VEU B;  1DJA A;  3MBZ A;  4I5S A;  4QY5 A;  3T4K A;  1MWT A;  3BEB A;  3TG9 A;  2INW A;  2BG1 A;  4X1M A;  4JBF A;  1ES2 A;  3D4F A;  4S2N A;  3SZT A;  3C4O A;  1K38 A;  2X01 A;  3ZG8 B;  3C38 A;  3VOY A;  3Q7V B;  3IQA A;  2WUQ A;  3UB6 A;  1SHV A;  1G6O A;  4JPM A;  2GZA A;  2Z2L B;  2XRN A;  2Y2G A;  1EW0 A;  5CED A;  1JVJ A;  4JKT A;  3E0Y A;  4CQH A;  4EWF A;  1YPR A;  4PM8 A;  3OPP A;  4R6L A;  2ZM0 A;  4HES A;  4D2O A;  1FIL A;  2Y8H A;  3C7U A;  1NXY A;  2HP9 A;  2ZJ9 A;  3IF5 A;  4E3J A;  4OQH A;  4FH2 A;  1W63 M;  1K6S A;  1I5Q A;  4EV4 A;  5DKK A;  2WKR A;  3W4P A;  4K0X A;  3FPV A;  5F83 A;  5E2G A;  5A90 A;  1NYY A;  3M2J A;  2ZC7 A;  1FSW A;  2BTF P;  1MWS A;  5L10 A;  1FCO A;  3UN7 A;  3K3C A;  5CHU A;  4LV2 A;  3T4J A;  4I39 A;  1G28 A;  5AQ7 A;  2LB9 A;  5F82 A;  3QP2 A;  2HDS A;  3NY4 A;  4XT2 B;  3DW0 A;  3JVU A;  3S7P A;  5I94 A;  3TOI A;  2HV1 A;  1T1C A;  3NI9 A;  4ID4 A;  3P01 A;  1QME A;  2OWH A;  1K54 A;  4X69 A;  1DJC A;  4QY6 A;  5FQI A;  1J9M A;  1N9B A;  2Y59 A;  4G3W A;  5HFO A;  4DN0 A;  4IUH A;  1L0D A;  3QP5 A;  3BEC A;  4CLC D;  3P7N A;  2JCH A;  1SDN A;  3JYI A;  1OTB A;  1PZO A;  3LR5 A;  1H8M A;  2A24 B;  2Y2M A;  3WWX A;  3MR0 A;  4FCF A;  5EM1 A;  2J3T C;  3G6O A;  3UMD A;  3B42 A;  3WRZ A;  3FG8 A;  2ZMF A;  3OPR A;  2ZM8 A;  2W3G A;  3FC7 A;  3ZCZ A;  1K55 A;  2A3U A;  3GEC A;  2C5W B;  2J80 A;  4DE3 A;  4JF6 A;  5E2F A;  4X25 A;  1BSG A;  4KZ4 A;  3UME A;  1TEM A;  4DF6 A;  5GL9 A;  5FQK A;  1VET B;  4R38 A;  5DVA A;  4G3K A;  2WKE A;  2WKH A;  4IBR A;  1TDL A;  4LCM A;  1FIK A;  4P0M A;  4MBF A;  3LI9 A;  4N9K A;  4GNU A;  3HL9 A;  2M7V A;  4IBX A;  1PIO A;  1TS7 A;  1AXB A;  1KDW A;  3IH8 A;  4HIA A;  1BUL A;  2FH5 A;  4MN6 A;  4B88 A;  4OKP A;  3OPL A;  1S67 L;  2ZQC A;  3R7W A;  3T50 A;  5HAQ A;  4S2N C;  2Z6C A;  2ZC6 B;  2V1Z A;  1KOU A;  4IED A;  4E3K A;  3LR4 A;  4L9E A;  4LRY C;  4K0W A;  3LI8 A;  5HWT A;  5EVI D;  3Q7Z A;  2ZQD A;  4BBT A;  1L2S A;  5GLB A;  3H7W B;  2EX2 A;  2Z2M B;  1LL8 A;  4DRT A;  1DP6 A;  2W3E A;  3UDI A;  3E98 A;  4JLF A;  2R78 A;  2V0U A;  2P08 A;  1OTE A;  2M7U A;  5DF7 A;  3C2W A;  3H82 A;  2PBY A;  5FQQ A;  3M2K A;  1FR1 A;  4OOY A;  1YLJ A;  3IHA A;  1EWZ A;  1WE4 A;  1ZG6 A;  2ZBB A;  1YLZ A;  3PTE A;  3IH9 A;  1SDE A;  2B95 A;  3WS0 A;  3QNB A;  3BLM A;  1J3W A;  1Y4O A;  4N1X A;  5HDC A;  3NOP C;  5FQJ A;  2XDM A;  1L0E A;  4WLA A;  2JKR I;  2O9A A;  1BLP A;  3MXQ A;  3O3V A;  4M3K A;  1M40 A;  3AGF A;  3PBN A;  2ZC4 B;  3Q07 A;  3LYX A;  4KQQ A;  3E2L A;  3QNC A;  1ZHH B;  3S7N A;  5HW3 A;  4KUO A;  3O87 A;  1XFQ A;  1ZTU A;  3CWF A;  4E3I A;  2ZQ8 A;  1WYB A;  3BM6 A;  4HH2 A;  4N1H A;  4WZ5 C;  3SH8 A;  4MN7 A;  2H10 A;  1MZU A;  3CPT B;  2W3H A;  1HZO A;  4DXC A;  2KDK A;  2I9V A;  4NEE D;  4LGW A;  1GA0 A;  1K4E A;  2HGV A;  3AGE A;  3KYQ A;  5FQ9 A;  5KSH A;  1ALQ A;  3R4K A;  4JF4 A;  3RXX A;  3QP4 A;  2WAD A;  2EFU A;  4JGO A;  4O8G A;  4C6Y A;  3KSF A;  4PKY G;  4GS9 B;  4OVD A;  4JXW A;  2DNS A;  2WAE A;  1IYS A;  1XFN A;  1P0Z A;  2W1R A;  5FDS A;  5HD5 A;  4YWZ A;  2CMN A;  5KIZ A;  1BLS A;  3FZC A;  3BQ8 A;  4HJ6 A;  4BBU A;  2ZQA A;  1KGG A;  1N9L A;  1ZKJ A;  2A49 A;  4QHC A;  4EUV A;  3BFE A;  4OOM A;  5DJU A;  4EQ1 A;  3D72 A;  5HL1 A;  4GZB A;  4D60 A;  4EBN A;  5FEG A;  2V8F A;  1P97 A;  4KG5 A;  1OJ5 A;  3IF6 A;  1ONG A;  4ETZ A;  1LSX A;  4EQI A;  3ZG9 B;  3UE1 A;  1HLU P;  3UY6 A;  3NDG A;  1XJ6 A;  3T4T A;  1P9R A;  3V3R A;  2WGI A;  3PBQ A;  2JHE A;  3Q82 A;  4B9O A;  4GJ4 A;  1K54 C;  2GDN A;  5HDS A;  1T19 A;  5M18 A;  4KZ7 A;  3VFF A;  2OAP 1;  3C30 A;  1YLP A;  1ZC2 A;  1PYY A;  3HLF A;  3UB8 A;  1IOU A;  2QWS A;  4EXO A;  4WL9 A;  1NZU A;  4UQI M;  1WA9 A;  2D02 A;  3Q81 A;  2O9B A;  3IXH A;  2L4R A;  3PAE A;  2X02 A;  3LY4 A;  1Y28 A;  4C75 A;  2K31 A;  2EFX A;  4Y0T A;  4CLC C;  2EX8 A;  3IXB A;  2PD7 A;  4R1G A;  3UPO A;  4O01 A;  5G4Y A;  4NG2 A;  1ONH A;  2G7U A;  4KZ5 A;  2XA7 S;  2PU4 A;  2DCF A;  2OSU A;  4WZ5 A;  3MXS A;  1K57 C;  5EVI B;  5KMW A;  3IXG A;  1SCW A;  4H6J B;  4OLG A;  4EW7 A;  1FQG A;  1H8Z A;  4OH0 A;  3B3X A;  4Y2F A;  3UPN A;  3EQV A;  4F94 A;  4BL2 A;  3FWL A;  5F1G A;  5TGF A;  2Y2L A;  3G32 A;  1BYW A;  3LR0 A;  4CLC E;  1G68 A;  3TE8 A;  5CGX A;  3HLC A;  3UNW A;  2JN7 A;  4E3M A;  3W8K A;  5HWV A;  1UWP X;  2AVX A;  4YIN A;  4QU3 A;  5EM0 A;  3SW1 A;  1S1Y A;  3MQQ A;  2XFT A;  2P74 A;  1BLH A;  4R3B A;  3FV7 A;  3Q7V A;  2UV0 E;  1RGY A;  5DF8 A;  4FD8 A;  2V0W A;  1KGF A;  5L8M A;  3HLG A;  3W2Z A;  3T4L A;  2HP6 A;  4E3L A;  2ZQ9 A;  1ESI A;  5FL3 A;  1X0O A;  2ZL1 B;  1XA1 A;  3LID A;  4X56 A;  1W5D A;  3FPW A;  4GLQ A;  1MKM A;  5K5B A;  3ZG5 A;  1LL9 A;  2XA7 M;  3CAX A;  4B93 A;  1LL5 A;  2L0W A;  1MY8 A;  2NUT C;  2QHK A;  1CI8 A;  3V39 A;  3A0R A;  4PPR A;  3PR6 A;  5HX9 A;  5CER A;  3ZQ5 A;  1CEG A;  4P85 A;  4FSF A;  4JXV A;  2VA0 A;  1XKZ A;  1BZA A;  5JYO A;  3M6B A;  2D01 A;  2W0N A;  4MLL A;  1LSV A;  3A3I A;  3RXW A;  3MXR A;  2B18 A;  4KZ6 A;  1PWD A;  5HDD A;  3RH8 B;  4ZJ3 A;  4MDZ A;  1CEF A;  3PBO A;  1VB6 A;  1F9I A;  3UDF A;  1RP5 A;  2VV6 A;  4DKI A;  5DFX A;  2H28 A;  1KE0 A;  3KYE A;  3QP6 A;  1N9N A;  3WS1 A;  4BLM A;  4DE2 A;  3V50 A;  5TBM A;  2WYX A;  3HUN A;  1GCE A;  2Y79 A;  3GMW A;  1NYM A;  1K4F A;  4O0P A;  4R3A A;  2ZM2 A;  1SZV A;  2ZD8 A;  2VZW A;  1YSP A;  4E04 A;  2J9O A;  2VX8 A;  1NZO A;  1I2W A;  3A0V A;  4FTX A;  2A24 A;  2OAQ 1;  3NUL A;  3VSK A;  3D9Y A;  5FAQ A;  1H5X A;  2ZQ7 A;  2Y4A A;  3ICY A;  4NXB A;  5EPH A;  3CHW P;  1S6R A;  1Z6F A;  5KSC A;  3HLW A;  3ZNT A;  1VET A;  4HI4 A;  5DTK A;  4UA7 A;  3KSH A;  3IBR A;  1E3U D;  1TDG A;  3S22 A;  2HZ5 A;  2JE5 A;  3HLE A;  4PM7 A;  4O7D A;  2PD8 A;  3CMZ A;  2ZLY A;  3HVF A;  1DJB A;  5GHX A;  3GR2 A;  5DF9 A;  3QP1 A;  5F69 A;  5EUA A;  3OBF A;  3SH9 A;  1OTD A;  3O5Y A;  3L7H A;  4WYY A;  1T1A A;  2KOI A;  3LUQ A;  3R7W B;  5HWW A;  1W63 Q;  4PM5 A;  3IBJ A;  2QJ5 A;  4II7 A;  2XGN A;  2OLV A;  4UHU A;  1STZ A;  1S4R A;  3EQU A;  2FFY A;  4A5R A;  5G18 A;  4EBP A;  3IT9 A;  3ULF A;  4S2P A;  2ZC5 B;  2Y2H A;  1BUE A;  2EWV A;  5EFW A;  1T1B A;  1W7F A;  5EVI C;  1DP9 A;  2PHY A;  4Q8I A;  4Y13 A;  4PKY A;  4DJ3 A;  4KZ9 A;  1LT0 A;  4OPQ A;  1YKD A;  3MQ0 A;  1TVF A;  1L3L A;  3V3S A;  1T18 A;  1FSY A;  4ZBE A;  2K2N A;  5I5L A;  4QJG A;  2GJ3 A;  5MC7 A;  4Q0J A;  4X55 A;  4HOI A;  2HJE A;  1BT5 A;  3G31 A;  5F1F A;  1DY6 A;  3GRJ A;  1E3U A;  5AQB A;  2B02 A;  2Z6D A;  3LR3 A;  2XH9 A;  3T4O A;  3GVB A;  3OOV A;  3OPH A;  4PAU A;  3DAV A;  4QPR A;  4UA6 A;  4CLC B;  2WKP A;  4P6Z M;  4MEZ A;  4HBU A;  3IX3 A;  2IA2 A;  3SS3 A;  2WK0 A;  1XGJ A;  5CHM A;  3FKW A;  3LIC A;  1TS0 A;  3IHB A;  3ZDJ A;  3S1Y A;  3KYZ A;  4GB7 A;  3LO7 A;  2QMI A;  5CHJ A;  4GD6 A;  4HP4 A;  1CK3 A;  3IS2 B;  3MJQ A;  1UWN X;  3ZYT A;  3ZHH A;  2OOL A;  1PI4 A;  4YNR A;  4GOG A;  3MZE A;  2C6W B;  3OCN A;  1KVM A;  4LEN A;  3CPT A;  4R4R A;  3HCY A;  2HJ9 C;  5L07 A;  2CC1 A;  2HDU A;  1FOF A;  4NXE A;  4JGQ A;  2XF3 A;  5EOO A;  5HZH A;  3UE6 A;  4HHD A;  3BFG A;  5DTS A;  4GDB A;  3QHY A;  2Y2Q A;  5GHY A;  3RTY A;  1D7E A;  1JTD A;  4FOF A;  3T4Q A;  1MWR A;  3VV4 A;  5F68 A;  5DFY A;  4G3V A;  5J7E A;  2W3F A;  2HF6 A;  5CRF A;  2Y2J A;  4GCZ A;  5HAI A;  4CPK A;  3ITA A;  3N4I A;  5AQ9 A;  5AQA A;  3KSI A;  2W3D A;  1PFL A;  1ESU A;  4R23 A;  3O88 A;  1ES3 A;  3G34 A;  2VV8 A;  3C8C A;  5FEF A;  4OQI A;  4U3T A;  3EOI A;  5DTT A;  5KZH A;  1F2K A;  2G2U A;  1YSQ A;  1GHI A;  4HH3 A;  2W27 A;  2XEP A;  1YMS A;  1OT6 A;  4NET A;  1HD8 A;  1W8Q A;  4L9G A;  3SH7 A;  1LI9 A;  4GHI A;  2VJW A;  2ZOI A;  4JGP A;  3K3D A;  1K57 A;  3BWL A;  4LRZ E;  4RYE A;  1GHM A;  3TSG A;  5EVE A;  2PAV P;  4PHT A;  4IHQ A;  1K56 A;  1PW1 A;  1MPL A;  2PR6 A;  4BD0 A;  4C3Q A;  1XPB A;  2Y91 A;  2JKG A;  3PXP A;  5C5K A;  4DJ2 A;  4YOF A;  2EWW A;  3SS5 A;  2O9C A;  1K25 A;  1V9Y A;  5BOH A;  1JWZ A;  2XLN A;  3NBL A;  3TJZ C;  1TS6 A;  1PRQ A;  3HBR A;  3FYZ A;  2Q9N A;  3SOI A;  4BBV A;  3U4L P;  5FQM A;  3PBT A;  4M4X A;  4XUZ A;  1Y54 A;  4Y15 A;  4HNB A;  4IJG A;  2BLS A;  4XXR A;  4X53 A;  3T1S A;  1IEL A;  2W1T A;  4GW9 A;  4R4S A;  2Y2N A;  4N9L A;  2PYR A;  1IFQ A;  2J3T D;  2R9W A;  3LCE A;  1KDS A;  4JGR A;  1YMX A;  1K6R A;  1UGU A;  2JKR M;  4I3I A;  4OP5 A;  2IWB A;  5FI6 A;  3LIF A;  3LIE A;  3IX8 A;  5JYP A;  2X71 A;  1ERM A;  4H8R A;  5EOE A;  1O07 A;  3DTE A;  5AVE A;  5F5Y A;  3W4O A;  2EA9 A;  1D06 A;  1RGZ A;  4BEN A;  4BD1 A;  3VP1 A;  4HEF A;  4Q0H A;  3BRM A;  1HVB A;  3T1X A;  1W79 A;  2OLU A;  3BLS A;  4Q0I A;  3LGO A;  3G30 A;  5FAO A;  2WZZ A;  1F98 A;  4OON A;  3NJA A;  2VLG A;  3GSG A;  4DDS A;  1MC0 A;  4OPZ A;  2V9A A;  4S2M A;  4I3A A;  3DTI A;  1JWV A;  2ZL1 A;  1HTZ A;  3IWQ A;  1OTI A;  2J3W A;  4F3L B;  1P9W A;  4NKP A;  5HAR A;  3HUM A;  4HJ3 A;  3LY3 A;  2L1M A;  2NUP C;  1L0G A;  4JF5 A;  4S2O A;  4ME4 A;  5LBR A;  5IS1 A;  1YQS A;  2KLI A;  5DJT A;  2V8C A;  5GLC A;  4GKU A;  1GSW A;  5DKL A;  4BL3 A;  2H5S A;  3CLO A;  5E2E A;  1N4O A;  3NCK A;  4WM9 A;  4KG2 A;  1XP4 A;  4Y5F A;  4B4X A;  1YM1 A;  3MKF A;  3WS2 A;  4ZTK A;  4R70 A;  4KZ3 A;  3CIT A;  3ZNY A;  5FAS A;  1KE4 A;  2VKS A;  4Y3I A;  3GTC A;  3GV9 A;  3D3O A;  1SKO B;  2PRF A;  5J4E A;  3F1P A;  1JNU A;  1YLY A;  1CF0 A;  3N8R A;  1G5U A;  1S66 L;  2JBF A;  4PM9 A;  4EEP A;  5GLD A;  3BFD A;  4OPY A;  3IXD A;  3ZG0 A;  3PYP A;  3EWK A;  5TBM B;  3F1O A;  1TD5 A;  4K91 A;  5G4Z A;  5E43 A;  4MMN A;  4Z9Q A;  2DRW A;  3G2Y A;  4EET B;  2Y55 A;  2WGV A;  1NLY A;  2Y2O A;  3EEA A;  3UE3 A;  1F5M A;  3VP0 A;  4GDN A;  2K7S A;  3AGD A;  1MKI A;  1KE3 A;  5IHV A;  3N6I A;  2G2W A;  4X68 A;  3A0S A;  2XSS A;  1OJG A;  1PZP A;  3MS6 A;  3OC2 A;  4PM6 A;  3VMA A;  3VP2 A;  5FI2 A;  2WGW B;  2EXA A;  3B33 A;  3HLB A;  3NOU C;  3BFF A;  1E25 A;  1GSX A;  1ES4 A;  3MMH A;  4LCL A;  4EEU A;  5GHZ A;  3EGX C;  2PT7 A;  5AVF A;  1MXO A;  2KX6 A;  3T4S A;  4WMC D;  4MN5 A;  2QKP A;  3HJI A;  4LV3 A;  5FDH A;  4KEN B;  4N92 A;  3UE0 A;  3Q1F A;  3PHY A;  3H9W A;  4R3J A;  4I38 A;  1ZG4 A;  2P9V B;  5M19 A;  3VE3 A;  5E2H A;  2IWD A;  1OTA A;  5EE8 A;  5A93 A;  4AFI A;  4WUJ A;  2OV5 A;  3C5A A;  2H0Y A;  3KX0 X;  4IUK A;  1JWP A;  2WKI A;  4I3J A;  1H8Y A;  2O0Y A;  2A2L A;  2M1C A;  4ARZ A;  3WS5 A;  1H3Q A;  3E2K A;  2Q9M A;  2HDR A;  3NOT C;  4Z1W A;  2I72 A;  2VGL S;  3A3F A;  1FCN A;  1M6K A;  2Y2I A;  2PYP A;  4Y7P A;  3A3E A;  3HJK A;  1QMF A;  3DBA A;  4E6W A;  3F1N B;  4HJ4 A;  4KQR A;  1VEU A;  3VE4 A;  1AWI A;  1XJ4 A;  4WEK A;  2E8I A;  4KZA A;  3TW8 A;  2HP5 A;  2GX5 A;  3PAG A;  3U2A A;  3UB7 A;  5HPI A;  4WN5 A;  1YLT A;  5CEB A;  3NHQ A;  3PBR A;  4EES A;  3LIA A;  3NDE A;  1WYC A;  3IF6 C;  3G4P A;  1Q2Q A;  3A3D A;  4P87 A;  5FAT A;  1VHM A;  4WZ4 A;  4P6B A;  4CLC A;  1EI5 A;  4HP9 A;  4KZ8 A;  1G6A A;  1S4S A;  1JTG A;  1K56 D;  3NC8 A;  3LIB A; 
#chains in the Genus database with same CATH homology
 5EVI A;  3Q82 A;  3WRT A;  1BTL A;  5GHY A;  3SS4 A;  1K54 C;  2GDN A;  1JTD A;  4KZB A;  3UPP A;  3VFH A;  2V2F F;  1MWR A;  5M18 A;  4OOL A;  5EVL A;  4OQG A;  4KZ7 A;  4OPR A;  4RX3 A;  3VFF A;  3HLD A;  5J8X A;  4S2L A;  5CRF A;  2Y2J A;  1NY0 A;  1YLP A;  1ZC2 A;  5HAI A;  2J7V A;  4CPK A;  2XD1 A;  3BFC A;  3FKV A;  2RCX A;  3ITA A;  1PYY A;  3N4I A;  4RVA A;  4NK3 A;  5AQ9 A;  3HLF A;  5AQA A;  5A92 A;  3DWK A;  4IVK A;  5CTN A;  3PBS A;  3HUO A;  4GD8 A;  1ESU A;  4R23 A;  3VP4 A;  1NZU A;  2XR0 A;  1I2S A;  3O88 A;  1ES3 A;  3G34 A;  3Q81 A;  3A3J A;  1DJA A;  3MBZ A;  2XQZ A;  2Y2P A;  4QY5 A;  1MWT A;  3BEB A;  3IXH A;  3TG9 A;  4OQI A;  3PAE A;  2BG1 A;  2X02 A;  3G35 A;  3LY4 A;  4U3T A;  4X6T A;  5DTT A;  5KZH A;  4JBF A;  1ES2 A;  3D4F A;  4S2N A;  2G2U A;  3ZG7 B;  4C75 A;  2EFX A;  3C4O A;  1K38 A;  2X01 A;  1GHI A;  4Y0T A;  3ZG8 B;  3P09 A;  2EX8 A;  2XEP A;  1FR6 A;  3IXB A;  5FAP A;  3VOY A;  1YMS A;  4R1G A;  3M6H A;  4NET A;  3UPO A;  1HD8 A;  3Q7V B;  3IQA A;  1W8Q A;  2WUQ A;  2JC7 A;  3SH7 A;  1LI9 A;  1ONH A;  1SHV A;  4JPM A;  1RCJ A;  3OZH A;  2Z2L B;  4KZ5 A;  1K57 A;  4OQ0 A;  2Y2G A;  2PU4 A;  2DCF A;  2OSU A;  4WZ5 A;  5CED A;  2HDQ A;  3MXS A;  3P98 A;  4RYE A;  1JVJ A;  1GHM A;  1K57 C;  4JKT A;  5EVI B;  5KMW A;  3TSG A;  3IXG A;  4CJN A;  1SCW A;  4EWF A;  4OLG A;  4PM8 A;  1FQG A;  1H8Z A;  1K56 A;  3OPP A;  3UDX A;  2ZM0 A;  1PW1 A;  1MPL A;  4HES A;  4OH0 A;  3B3X A;  3UPN A;  4BD0 A;  1SKF A;  4D2O A;  4ZJ1 A;  3C7U A;  3EQV A;  4F94 A;  4XUX A;  1NXY A;  4C3Q A;  1XPB A;  4BL2 A;  2Y91 A;  2HP9 A;  3MZF A;  4YFM A;  2ZJ9 A;  3IF5 A;  3FWL A;  4E3J A;  4S2I A;  2Y2K A;  1PW8 A;  3I7J A;  3SS5 A;  4BJP A;  4OQH A;  4FH2 A;  5F1G A;  1K25 A;  4MBK A;  5TGF A;  5BOH A;  5GLA A;  1K6S A;  2Y2L A;  1I5Q A;  1JWZ A;  3G32 A;  5M1A A;  4EV4 A;  1O7E A;  2XLN A;  3NBL A;  2EXB A;  3W4P A;  1G68 A;  4K0X A;  5CGX A;  3HLC A;  4HBT A;  5F83 A;  3UNW A;  3BYD A;  4E3M A;  3HBR A;  5E2G A;  3FYZ A;  3W8K A;  2Q9N A;  4WBG A;  3SOI A;  1NYY A;  5A90 A;  5FQM A;  3M2J A;  2ZC7 A;  3NIA A;  4YIN A;  4QU3 A;  3PBT A;  1FSW A;  3CG5 A;  4WEL A;  1MWS A;  1OME A;  1FCO A;  1Y54 A;  4XUZ A;  3UN7 A;  5CHU A;  4LV2 A;  2XFT A;  2P74 A;  5AQ7 A;  1BLH A;  2BLS A;  4XXR A;  4R3B A;  3FV7 A;  4X53 A;  5F82 A;  3Q7V A;  1IEL A;  2HDS A;  3NY4 A;  3DW0 A;  5I94 A;  1RGY A;  1KGE A;  3TOI A;  3C7V A;  5DF8 A;  3N8L A;  1NJ4 A;  4FD8 A;  1KGF A;  3S4X A;  4R4S A;  2Y2N A;  4N9L A;  3HLG A;  3NI9 A;  4ID4 A;  4E3L A;  2HP6 A;  2QPN A;  2R9W A;  1K55 C;  1ESI A;  2ZQ9 A;  3LCE A;  4MBH A;  1KDS A;  1QME A;  1XA1 A;  4X56 A;  1W5D A;  1K54 A;  1YMX A;  1K6R A;  3C4P A;  4OP5 A;  4X69 A;  2IWB A;  1DJC A;  1PWC A;  4ZAM A;  4QY6 A;  5CEC A;  1W8Y A;  5FQI A;  1J9M A;  5FI6 A;  1N9B A;  2Y59 A;  2ZMA A;  3ZG5 A;  1LL9 A;  1NRF A;  5HFO A;  1LL5 A;  1MY8 A;  4E6X A;  5JYP A;  2X71 A;  1ERM A;  1CI8 A;  3OCL A;  1L0D A;  4H8R A;  5EOE A;  4KG6 A;  1O07 A;  3BEC A;  3V39 A;  4Y0O A;  1YLW A;  2IWC A;  4PPR A;  2JCH A;  3W4O A;  5HX9 A;  5CER A;  1BLC A;  1RGZ A;  1SDN A;  4BEN A;  3JYI A;  1PZO A;  1CEG A;  4P85 A;  4BD1 A;  3VP1 A;  1E4D A;  3WWX A;  2Y2M A;  4HEF A;  1XGI A;  3BRM A;  4FCF A;  4FSF A;  3RJU A;  4JXV A;  3WRZ A;  1HVB A;  5CXW A;  1PI5 A;  1XKZ A;  1BZA A;  1W79 A;  2OLU A;  5JYO A;  3M6B A;  3BLS A;  3OPR A;  1LHY A;  2ZM8 A;  3UO9 A;  1L0F A;  3G30 A;  3ZCZ A;  1K55 A;  4MLL A;  2A3U A;  3A3I A;  2C5W B;  3RXW A;  4DE3 A;  3MXR A;  4JF6 A;  4KZ6 A;  5E2F A;  5FAO A;  1BSG A;  2WZZ A;  4KZ4 A;  1PWD A;  1TEM A;  4DF6 A;  5GL9 A;  4OON A;  5FQK A;  4ZJ3 A;  4DDS A;  3GSG A;  1CEF A;  3PBO A;  5DVA A;  3IWI A;  3VP3 A;  4LV1 A;  4OPZ A;  3UDF A;  1RP5 A;  2WKE A;  2WKH A;  4IBR A;  4S2M A;  4QD4 A;  5TR7 A;  4DKI A;  1TDL A;  4LCM A;  4P0M A;  4MBF A;  4N9K A;  4PMA A;  4GNU A;  1JWV A;  1KE0 A;  3HL9 A;  1HTZ A;  3IWQ A;  4IBX A;  1PIO A;  3MKE A;  3DWZ A;  1AXB A;  1KDW A;  3IH8 A;  3WS1 A;  4BLM A;  4FH4 A;  1BUL A;  5HAR A;  3HUM A;  4DE2 A;  3V50 A;  1CI9 A;  2V20 A;  3LY3 A;  1L0G A;  1MBL A;  2WYX A;  3HUN A;  4B88 A;  1GCE A;  4JF5 A;  4S2O A;  1PWG A;  1U60 A;  2H0T A;  2PU2 A;  3GMW A;  4OKP A;  3OPL A;  5FI7 A;  1NYM A;  1K4F A;  4DXB A;  2HPB A;  2ZM2 A;  1YQS A;  2VGK A;  2ZQC A;  2ZD8 A;  5GLC A;  4GKU A;  3W4Q A;  2J9O A;  5HAQ A;  1NZO A;  2UWX A;  4QB8 A;  1I2W A;  3ZVT A;  4BL3 A;  4S2N C;  2H5S A;  3VSK A;  5E2E A;  2ZC6 B;  4EBL A;  4U0T A;  2V1Z A;  1N4O A;  3NCK A;  4WM9 A;  4IED A;  5FAQ A;  4E3K A;  1KVL A;  1LI0 A;  5CTM A;  1H5X A;  4KG2 A;  1XP4 A;  2ZQ7 A;  2Y4A A;  5EEC A;  4K0W A;  4B4X A;  1YM1 A;  5EPH A;  3MKF A;  3WS2 A;  4ZTK A;  4KZ3 A;  3ZNY A;  3ITB A;  5EVI D;  1KE4 A;  5FAS A;  3Q7Z A;  1YT4 A;  1S6R A;  2ZQD A;  3IWO A;  1Z6F A;  1L2S A;  4WEJ A;  5KSC A;  5GLB A;  3HLW A;  3GTC A;  3GV9 A;  3ZNT A;  4WMC A;  2EX2 A;  2Z2M B;  4L0L A;  5DTK A;  4UA7 A;  4DRT A;  1ERO A;  3UDI A;  1YLY A;  3N8R A;  4JLF A;  1E3U D;  1TDG A;  2JE5 A;  4S2J A;  3HLE A;  4PM7 A;  3S22 A;  5L2F A;  1IYO A;  1GHP A;  4O7D A;  2JBF A;  4PM9 A;  3CMZ A;  2WAF A;  2ZLY A;  3HVF A;  5GLD A;  3BFD A;  1DJB A;  1IYQ A;  4OPY A;  4Y0U A;  3GR2 A;  5GHX A;  3IXD A;  5DF9 A;  3VSL A;  3ZG0 A;  1VM1 A;  2J8Y A;  5DF7 A;  1S0W A;  2PBY A;  5FQQ A;  4E3O A;  2XK1 A;  3ZGA B;  2FFF B;  3M2K A;  5EUA A;  1FR1 A;  4OOY A;  1YLJ A;  4JXS A;  5U47 A;  3SH9 A;  1ERQ A;  3G2Z A;  4K91 A;  4GN2 A;  4LV0 A;  1Q2P A;  4WYY A;  3IHA A;  1EWZ A;  1WE4 A;  3HRE A;  2QZ6 A;  1ZG6 A;  5A91 A;  1YLZ A;  3PTE A;  5E43 A;  3IH9 A;  3PBQ A;  4Z9Q A;  2DRW A;  1SDE A;  4PM5 A;  3WS0 A;  3QNB A;  3BLM A;  3G2Y A;  5FA7 A;  2Y55 A;  1C3B A;  2ZC3 B;  4N1X A;  2VGJ A;  2WGV A;  5FQJ A;  2XDM A;  1L0E A;  2Y2O A;  3CZD A;  4DE0 A;  4OP8 A;  3N7W A;  2XGN A;  2OLV A;  3UE3 A;  1GA9 A;  1BLP A;  3EQU A;  4UHU A;  2FFY A;  3O3V A;  4M3K A;  4OLD A;  3DTM A;  3VP0 A;  1M40 A;  3AGF A;  5G18 A;  4GDN A;  2J9P A;  3PBN A;  4A5R A;  2ZC4 B;  5TFQ A;  4EBP A;  3Q07 A;  3IT9 A;  3AGD A;  4S2P A;  1MKI A;  1KE3 A;  2ZC5 B;  2Y2H A;  1BUE A;  4RA7 A;  5IHV A;  1W7F A;  3N8S A;  4KQQ A;  3N6I A;  4IVI A;  5EVI C;  2G2W A;  4X68 A;  3E2L A;  4Q8I A;  3QNC A;  1PZP A;  3VMA A;  3OC2 A;  4PM6 A;  3VP2 A;  5HW3 A;  5FI2 A;  2WGW B;  3O87 A;  2EXA A;  3HLB A;  4JXG A;  3BFF A;  4KZ9 A;  1E25 A;  4E3I A;  1ES4 A;  2ZQ8 A;  4OPQ A;  1WYB A;  3BM6 A;  4LCL A;  4N1H A;  4WZ5 C;  5GHZ A;  3SH8 A;  1MWU A;  2H10 A;  1TVF A;  3V3S A;  1HZO A;  1FSY A;  1FCM A;  4ZBE A;  4DXC A;  1IKI A;  4QJG A;  5D3O A;  1MXO A;  5FSR A;  4X55 A;  4WMC D;  4ZJ2 A;  4EUZ A;  3IF6 B;  4LV3 A;  5FDH A;  1BT5 A;  3G31 A;  1GA0 A;  1K4E A;  4KEN B;  4N92 A;  3UE0 A;  3AGE A;  1DY6 A;  3Q1F A;  5FQ9 A;  5F1F A;  5KSH A;  3GRJ A;  1E3U A;  1ALQ A;  5AQB A;  4R3J A;  3WS4 A;  2XH9 A;  3GVB A;  2B5R A;  3OPH A;  1ZG4 A;  4JF4 A;  2P9V B;  5M19 A;  4UA6 A;  3RXX A;  2IWD A;  5E2H A;  4MEZ A;  2WAD A;  2EFU A;  3O86 A;  4HBU A;  5EE8 A;  5A93 A;  3CJM A;  3SS3 A;  2WK0 A;  1XGJ A;  5CHM A;  3FKW A;  3ZVW A;  2OV5 A;  3C5A A;  4C6Y A;  2H0Y A;  1XX2 A;  5CGS A;  4DDY A;  4JXW A;  4OVD A;  1JWP A;  2EX9 A;  4ZDX A;  2WKI A;  3IHB A;  1XA7 A;  3MFD A;  3ZDJ A;  2DNS A;  1H8Y A;  3NC8 A;  2WAE A;  3V5M A;  1IYS A;  1XXM A;  4UAA A;  3S1Y A;  3WS5 A;  1IEM A;  3E2K A;  4GB7 A;  3ISG A;  3LO7 A;  2EX6 A;  2Q9M A;  2R9X A;  2QMI A;  1BLS A;  2RL3 A;  4MNR A;  5CHJ A;  2HDR A;  2I72 A;  3FZC A;  4GD6 A;  3A3F A;  3LEZ A;  2XFS A;  1CK3 A;  1FCN A;  1M6K A;  2Y2I A;  4E3N A;  1VQQ A;  4Y7P A;  2ZQA A;  1KGG A;  1ZKJ A;  2A49 A;  3A3E A;  5HAP A;  1IKG A;  4QHC A;  4U0X A;  3ZHH A;  1QMF A;  2WGW A;  1PI4 A;  3BFE A;  4OOM A;  4E6W A;  4GOG A;  3MZE A;  2XD5 A;  4UA9 A;  2C6W B;  3OCN A;  4KQR A;  1KVM A;  5HL1 A;  4LEN A;  4KQO A;  2E8I A;  4WEK A;  4KZA A;  4GZB A;  2HP5 A;  3PAG A;  4R4R A;  4EBN A;  3ZFZ A;  4KG5 A;  1LLB A;  1YLT A;  5CEB A;  5CGW A;  2CC1 A;  2HDU A;  1FOF A;  4S2K A;  3PBR A;  3IF6 A;  3MZD A;  2XF3 A;  1ONG A;  5EOO A;  2WZX A;  4B4Z A;  3NDE A;  4EQI A;  1WYC A;  3ZG9 B;  3IF6 C;  3G4P A;  1Q2Q A;  3GQZ A;  3UE1 A;  3UY6 A;  3BFG A;  3A3D A;  3NDG A;  4P87 A;  4RX2 A;  5FAT A;  4BQM A;  5DTS A;  2P9V A;  4WZ4 A;  4P6B A;  3VOZ A;  1EI5 A;  4KZ8 A;  1G6A A;  4GDB A;  1IYP A;  3QHY A;  1JTG A;  2Y2Q A;  3V3R A;  1K56 D;  2WGI A;  1ES5 A;  4R0Q A;  4DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...