1KE4A

X-ray crystal structure of ampc beta-lactamase from e. coli
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase
publication title Structure-based approach for binding site identification on AmpC beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ke4A00
4IVKA 4KG5A 3PAGA 2WZZA 3A3FA 4CPKA 4C6YA 3OCLA 3HUMA 5CEBA 3V50A 1ES5A 1PWDA 3Q7ZA 5D3OA 4N1XA 4KZ6A 5I94A 2ZMAA 4BLMA 2V2FF 5FI6A 1K38A 5AQ9A 5FAQA 1VQQA 3GQZA 3EQUA 3IF5A 3LEZA 5KSCA 4QY5A 3SS3A 3Q7VB 1XXMA 2WGIA 2EXAA 3MZDA 1ONHA 2HP5A 2ZD8A 4DXCA 5CGWA 2H0YA 4K91A 3VOYA 1FR1A 4R4RA 5BOHA 1YLJA 2HP6A 1IKIA 4IEDA 4PM7A 5U47A 2Y59A 4E3IA 5M19A 4FSFA 3WS1A 1KGGA 5TGFA 2ZLYA 2UWXA 2Y2PA 1SDNA 3VP0A 1K56D 2JE5A 2ZC6B 3N7WA 3QNCA 4X56A 4CJNA 1ZG6A 1KE3A 3UE1A 1XKZA 1DJAA 1IKGA 1K25A 3G32A 5CTMA 3A3JA 1KDSA 4C75A 1FQGA 3HLGA 3RJUA 3VP2A 1C3BA 1CK3A 4OPRA 5DTKA 5E2HA 5A90A 1Z6FA 5DF8A 1KGFA 3VP3A 3RXXA 3IWIA 5EECA 1XPBA 4PM8A 2H5SA 3V39A 2Y2GA 1W8YA 1MWTA 3NIAA 2WGWB 3DWZA 3TG9A 3S4XA 3IXHA 1I5QA 3BFDA 5HFOA 1GHPA 4R23A 3OPPA 4HESA 2ZJ9A 3G2ZA 4RVAA 5M1AA 3ZDJA 1YQSA 4F94A 1K57C 1RGYA 2Y2NA 4LCLA 4MBKA 4WZ5C 5TR7A 4E3OA 5A92A 1E25A 4XUXA 2EXBA 4UA7A 2DRWA 1YLZA 3C4OA 3E2LA 3W8KA 4P6BA 3MKEA 2ZQAA 2R9WA 4GN2A 2WKHA 5GHYA 1Q2PA 3IT9A 4MEZA 4Y0UA 1G6AA 3GSGA 3FWLA 1I2SA 3W4QA 1NZUA 3IH8A 2ZQ8A 2WGWA 4OP5A 3UY6A 3P09A 4E3NA 1BT5A 3VP4A 1MWSA 5JYOA 1GA0A 3O3VA 4KQOA 1PZOA 4R0QA 4EBNA 4JLFA 3ZHHA 4DKIA 3A3DA 4MBHA 2Z2MB 4OVDA 1O7EA 5JYPA 4GB7A 2B5RA 4WELA 2Z2LB 4DXBA 1L0EA 1KVMA 4YINA 4Y7PA 3SS4A 5A93A 3FV7A 3IF6A 1ERMA 3Q81A 2VGKA 3NI9A 4IBXA 3LY4A 1YLTA 1MWUA 3FZCA 4S2JA 1Q2QA 1KDWA 1S6RA 4S2KA 4S2PA 4X6TA 3ZG5A 4BD0A 2PBYA 3ZG0A 2Y2MA 4QY6A 4WEKA 3B3XA 2H10A 2XEPA 3GR2A 3SH8A 3M2JA 4GD8A 5F83A 5FQMA 3BFEA 1FOFA 3MZFA 2XD1A 3HLDA 2OLVA 4ZAMA 2WAFA 5E2FA 1ZKJA 3G35A 2G2WA 3SOIA 2IWCA 2HPBA 3HLEA 1WYBA 2ZM8A 3A3IA 4DE0A 3UPPA 3O86A 3G30A 3ZGAB 4OQHA 4GNUA 4U0XA 3VSKA 4BENA 4OPYA 4OPQA 1NRFA 4FH4A 4KZ5A 3N6IA 4OONA 3QHYA 3IF6C 2XD5A 4ZTKA 1KGEA 1QMEA 3IXDA 1FCNA 2X02A 3VFHA 1XGIA 4QU3A 4JXVA 3GRJA 5IHVA 3MXRA 1SHVA 1FCOA 2Y55A 3G34A 3V5MA 5EE8A 3HVFA 1EROA 4DE3A 2EX9A 1W79A 2WZXA 4JXGA 4JBFA 2HDQA 3HUOA 2HDRA 4KG6A 2XGNA 3ZNTA 3A3EA 1LLBA 3ZFZA 4HBUA 4Y0TA 2EX8A 3EQVA 4X55A 1K6RA 1DJCA 3BECA 2XDMA 3HBRA 3M2KA 1GCEA 3PBSA 1PW8A 1FCMA 1S0WA 4KQQA 1BTLA 1PWCA 4BJPA 1NXYA 2XFSA 5AQ7A 1LHYA 3IXBA 4GD6A 4KZBA 3SH7A 1BLSA 3VOZA 4MLLA 2ZM0A 3WRTA 2ZQ9A 1ES3A 1BLHA 4KENB 3WS5A 5EVID 1FSYA 4DE2A 3O87A 4ID4A 3LCEA 4LV0A 2WADA 1YMSA 3ZVTA 1RCJA 2Y2HA 1K57A 4WZ5A 2J9OA 5DTSA 4R1GA 1K4EA 1XP4A 4LV1A 1NZOA 5GLBA 4WMCD 1BLCA 4DE1A 3OC2A 4OLGA 3DTMA 5DF7A 3UPNA 4WM9A 2OV5A 4E3LA 5CRFA 5KZHA 1BULA 2Y2IA 3ITAA 3CJMA 3JYIA 1CEFA 4S2LA 1IYSA 1MXOA 1CEGA 1PIOA 1GHMA 3MXSA 3P98A 4U3TA 2V20A 1SDEA 2GDNA 2I72A 5DF9A 3PAEA 4OP8A 4OQGA 2V1ZA 1JWPA 4D2OA 3C4PA 4E3MA 5FA7A 5CERA 1H5XA 3CG5A 4ZBEA 3E2KA 3GV9A 4A5RA 4EUZA 1PI4A 1ERQA 1MBLA 1M40A 1YLPA 2ZQCA 3I7JA 4PM6A 2VGJA 1LI9A 1K56A 5HL1A 3G31A 4OQIA 4N9LA 4XUZA 3ZNYA 1TDGA 4OQ0A 4WEJA 2RCXA 3IHBA 4RX2A 5TFQA 1IYOA 3C7VA 3WS4A 5CTNA 4S2IA 1W7FA 1IELA 1E3UD 3D4FA 2WGVA 2WAEA 1ONGA 3IF6B 4R3BA 3C7UA 4LENA 1K6SA 2Y2QA 1BZAA 1XX2A 2A49A 2FFFB 4GZBA 4RYEA 1LI0A 3OCNA 2JC7A 2Y2KA 1BUEA 5GLCA 2IWDA 4WBGA 1SCWA 4JXWA 5EVIC 3LO7A 4UA6A 3NCKA 1YMXA 3UE3A 1MWRA 4JF6A 2J7VA 2QZ6A 3GMWA 5KMWA 3NC8A 4X68A 3WS2A 3UPOA 3HREA 1PYYA 5DTTA 4BD1A 2EX2A 4N9KA 4P85A 4K0WA 5FQIA 4WZ4A 3IWQA 1NJ4A 2C6WB 4O7DA 3NBLA 1IYQA 4KZ8A 3Q82A 4FD8A 4UAAA 1GA9A 1PZPA 3FKWA 3HLCA 3VMAA 1G68A 4RA7A 4S2NC 4U0TA 5FAPA 3ZVWA 4GKUA 1W8QA 4S2MA 5GHZA 2A3UA 3BRMA 3MKFA 4QD4A 4OOYA 1LL9A 3OZHA 4EWFA 1H8YA 2EFXA 4IBRA 4E6WA 3IQAA 1MY8A 4DDYA 2WKEA 1IEMA 3AGDA 5EOOA 2ZQ7A 4JKTA 5FQJA 1SKFA 5HAQA 1FSWA 4KZ3A 1YLYA 1HTZA 2PU2A 3DW0A 1KE0A 1K54A 2HDUA 1N9BA 2EFUA 1XA1A 1DY6A 1EWZA 3BLSA 3ZCZA 3DWKA 3QNBA 4FH2A 1U60A 3UN7A 2R9XA 2ZC7A 4E6XA 5GLAA 5FDHA 2WYXA 2Y91A 5FAOA 5F82A 3AGFA 1ESUA 2ZQDA 5EPHA 3UE0A 3CZDA 3HUNA 2E8IA 3HLBA 5FQ9A 5M18A 3NDGA 3S1YA 1VM1A 3BEBA 2OLUA 1ZG4A 4UHUA 2XF3A 5E43A 4GDNA 1KVLA 1MKIA 4PM5A 4XXRA 2RL3A 4JPMA 4KZ9A 2JBFA 4ZJ2A 3Q07A 4OLDA 2Q9NA 1JWZA 1LL5A 2PU4A 2P9VB 4HBTA 3HLFA 5J8XA 1ZC2A 2QPNA 1L2SA 1L0DA 5EVIB 3RXWA 3ZG7B 4DDSA 1TVFA 1BSGA 3ZG8B 1ESIA 1K54C 3PBRA 4BL2A 3IH9A 2QMIA 2ZC4B 2J9PA 4PMAA 5CHMA 3FKVA 1RGZA 1H8ZA 1ES4A 1QMFA 4KZAA 3VSLA 3PBOA 4MBFA 5FSRA 1Y54A 1O07A 4OOMA 3FYZA 4GDBA 1IYPA 1CI8A 1NYMA 2C5WB 4DF6A 1YT4A 3S22A 1DJBA 5HARA 4B4XA 3SS5A 1TEMA 3Q1FA 5FI2A 4LV3A 2XFTA 1J9MA 5GHXA 2P9VA 4B4ZA 2WKIA 4R4SA 5KSHA 5G18A 5EVIA 4ZJ3A 1AXBA 3WWXA 4X69A 2WK0A 3BYDA 1ES2A 4Y0OA 1K55C 3GTCA 3IXGA 4WMCA 4BL3A 5CGXA 1NYYA 5A91A 1WE4A 2Y2LA 3Q7VA 4JF4A 2DNSA 2J8YA 4K0XA 2HP9A 4FCFA 1HD8A 5GLDA 4P0MA 5EOEA 1E4DA 5F1GA 5CEDA 2X01A 1TDLA 2JCHA 4P87A 3VP1A 1JWVA 3HL9A 1W5DA 1OMEA 3BFCA 4S2NA 3PBQA 3CMZA 1M6KA 2CC1A 1EI5A 4NETA 3V3SA 1JTGA 3PBNA 5EVLA 4KZ7A 3UDXA 2FFYA 1BLPA 3M6BA 1WYCA 4E3JA 2HDSA 3C5AA 2P74A 4KZ4A 5AQBA 3TOIA 4N92A 4OOLA 5HX9A 1N4OA 4DRTA 4ZJ1A 3IWOA 4JXSA 1HZOA 5HAPA 2EX6A 3OPLA 4GOGA 4OH0A 3VFFA 3PTEA 3ZG9B 2DCFA 1I2WA 2Y2JA 5CECA 1E3UA 3N8RA 4PPRA 1JVJA 4EBLA 5FQQA 3UNWA 4PM9A 4YFMA 2XR0A 3V3RA 2WUQA 5CGSA 3W4OA 2G2UA 3IHAA 1ALQA 2Q9MA 4M3KA 5CHJA 2XLNA 3BLMA 3WS0A 4B88A 4Z9QA 5GL9A 3BFGA 5E2GA 4OPZA 3G4PA 3PBTA 3ISGA 1FR6A 4QB8A 3AGEA 2ZC5B 1K4FA 2OSUA 3BM6A 5CHUA 3W4PA 5FQKA 1L0FA 3N8SA 3WRZA 2XK1A 1PI5A 3SH9A 3ITBA 4N1HA 4EQIA 5F1FA 4H8RA 4KQRA 1KE4A 5AQAA 1RP5A 3MFDA 3MZEA 2X71A 4BQMA 5HAIA 2ZC3B 3OPHA 4LV2A 1XA7A 4R3JA 4ZDXA 1PWGA 5L2FA 1YM1A 2ZM2A 5HW3A 3GVBA 1JTDA 3TSGA 3UDFA 4C3QA 4JF5A 4LCMA 4Q8IA 2BG1A 4QJGA 3G2YA 1L0GA 3MBZA 3UO9A 3HLWA 1MPLA 2XQZA 3N8LA 4HEFA 4MNRA 2BLSA 5DVAA 4X53A 3M6HA 1CI9A 3N4IA 4IVIA 4EBPA 5FASA 3LY3A 3NY4A 4OKPA 4WYYA 3NDEA 5FI7A 1XGJA 3O88A 3OPRA 4L0LA 5FATA 4RX3A 1HVBA 2H0TA 2XH9A 4UA9A 5E2EA 4E3KA 2IWBA 2Y2OA 4NK3A 4QHCA 4S2OA 3UDIA 2Y4AA 5EUAA 1NY0A 4KG2A 1K55A 5CXWA 1GHIA 1PW1A 3BFFA 1YLWA 4EV4A
chains in the Genus database with same CATH superfamily
4KG5A 1ZTUA 4C6YA 5CEBA 2ZMAA 5AQ9A 3UB7A 3T4LA 3MF0A 3IF5A 3PXPA 3MZDA 1ONHA 5CGWA 4K91A 5DKLA 1S1YA 5BOHA 2VJWA 5U47A 2Y59A 4Q0JA 3EGXC 4FSFA 4HJ6A 4X25A 3VP0A 2ZOIA 2ZC6B 4X56A 1P97A 4X1MA 4B9OA 1SKOA 4OPRA 5A90A 5DF8A 1KGFA 3VP3A 3IWIA 3V39A 2Y2GA 3IXHA 5HFOA 3OPPA 4HESA 4BBVA 4Z1WA 3E0YA 1E25A 2EXBA 3E98A 2O9BA 2R9WA 2XSSA 3L9KA 3IT9A 2BASA 1F2KA 4Y0UA 3SW1A 1CF0A 4GW9A 3W4QA 3P09A 1BT5A 3D3OA 1MWSA 2PHYA 4HJ4A 5HD5A 4JLFA 4EBNA 3IS2B 1N9LA 5JYPA 3UE6A 4II7A 2Z2LB 4YINA 2HJ9C 2VGLM 2G7UA 4BWIA 4IBXA 3LY4A 4S2JA 3GR2A 2E8JA 3BFEA 5FQMA 1FOFA 3NECA 2WAFA 5E2FA 1GSXA 3SOIA 2IWCA 3HLEA 2ZM8A 3ZGAB 1TS7A 2PRFA 4OPYA 1NRFA 2PYRA 3N6IA 3IF6C 1FCNA 4HHDA 4QU3A 2O0YA 4JXVA 3QP8A 5IHVA 1FCOA 3F1NA 3JVVA 3HVFA 1W79A 2WZXA 4CLCD 3HUOA 2HDRA 4KG6A 1N9OA 2XGNA 3ZNTA 3ZFZA 4Y0TA 3EQVA 2QKPA 3BECA 5G4YA 1P0ZA 3HBRA 1GCEA 4BJPA 1PW8A 1NXYA 2Q0OA 3FPWA 2ZM0A 1ES3A 3T1XA 4LV0A 3CI6A 1YKDA 2GX5A 1RCJA 3ZVTA 4HOIA 5DTSA 4WMCD 4DE1A 2ZBBA 3OC2A 3OBFA 5DF7A 3UPNA 4WM9A 3RTYA 2Y2IA 2M1CA 3JYIA 3BQ8A 4IUKA 4G3VA 2V20A 4UQIM 3S7NA 2V1ZA 5FDSA 1FIKA 1JWPA 4D2OA 4E3MA 3GDIA 2B95A 2K7SA 1YLPA 1ERQA 4PM6A 2ZQCA 3KYQA 1LI9A 1D7EA 1TDGA 4OQ0A 1PNEA 4S2IA 1E3UD 3IF6B 3D9YA 5FL3A 1XX2A 3O5YA 3OCNA 2Y2KA 1BUEA 4Q0IA 2GZAA 1SCWA 4JXWA 5EVIC 3LO7A 1YAXA 1YMXA 4JF6A 4UEYA 4ARZB 2QZ6A 5DTTA 3T1QB 3U4LP 4K0WA 3NBLA 3Q82A 1HLUP 3FKWA 4Y3IA 3ZVWA 1W8QA 1LSVA 4OOYA 1LL9A 1D1JA 4EWFA 2O9AA 1H8YA 2ACGA 4ZRRA 4R3AA 1IEMA 3AGDA 4JGQA 4JKTA 1P9RA 3DTIA 1SKFA 5FQJA 5L09A 2A24B 3VV4A 4D60A 1KE0A 2HDUA 1XA1A 3QNBA 2R9XA 1A0KA 2IA2A 2WYXA 2Y91A 1ESUA 5HWVA 2ZQDA 3UE0A 3CZDA 3HLBA 5FQ9A 3S1YA 1VM1A 1ZG4A 1XJ4A 1TF1A 1T19A 1G6OA 4ZJ2A 2Q9NA 2P9VB 1LSWA 2H28A 5EVIB 1L0DA 2ZMFA 1ESIA 4BL2A 4Y17A 1H8ZA 2J3WA 3PHYA 1QMFA 5FSRA 1Y54A 5F69A 1F5MA 1IYPA 1NYMA 4DF6A 5HARA 5FI2A 1J9MA 4B4ZA 5KSHA 5G18A 4K08A 4ZJ3A 3WWXA 2Z6CA 1ES2A 3IXGA 3PR6A 3EWKA 3KSFA 2JKTM 4K0XA 2HP9A 1E4DA 5CEDA 2X01A 3VP1A 1JWVA 2B02A 4E04A 3PBQA 4NETA 3V3SA 5AJGA 4P6ZS 3LR0A 2PD7A 2FFYA 1WYCA 2HJEA 1N4OA 4ZJ1A 2V0WA 1HZOA 3IX3A 4H6JB 4OH0A 3VFFA 2JKRI 1I2WA 2Y2JA 5A8BA 3N8RA 4GHIB 4EBLA 3ZQ5A 4YFMA 3W4OA 4I3AA 2G2UA 1DRMA 3IHAA 1ALQA 2Q9MA 4M3KA 5E2GA 3ISGA 2INWA 3CWFA 2OSUA 5FQKA 1L0FA 2JKFA 4O8GA 1PI5A 3SH9A 3R7WB 4H8RA 4KQRA 1KE4A 1OTIA 3R4KA 2V0UA 4BQMA 5HAIA 4LV2A 5L2FA 2CMNA 2ZM2A 1JTDA 2M7UA 3UDFA 4QJGA 2EA9A 1MPLA 1H0MA 2QWSA 4X53A 3N4IA 1UWPX 5FASA 3NY4A 3K2NA 5TBMA 3ULFA 1VETB 2OAQ1 3O88A 2W3HA 4L0LA 1XJ3A 4RX3A 4E3KA 4S2OA 4MN7A 4L9GA 5EUAA 1K55A 1PW1A 3AGFA 4HP4A 4JGPA 3OCLA 3HUMA 3V50A 3Q7ZA 3S7OA 4N1XA 5DJTA 5I94A 1K38A 1VQQA 3IX4A 3EQUA 2OWHA 3LEZA 4BBUA 5KSCA 5CX7A 4IUHA 2VV7A 2H0YA 1SKOB 4EW7A 4KUKA 1T18A 4E3IA 5M19A 3WS1A 2ZLYA 3MFXA 2Y2PA 4M4XA 3QNCA 1UWNX 4CJNA 1KE3A 2PR6A 3G32A 5CTMA 1KDSA 3HLGA 5DTKA 2FZ0A 5HPFA 3NJAA 3S4XA 2WKPA 2OAP1 1GHPA 4RVAA 2ZJ9A 1RGYA 4MBKA 4XUXA 4UA7A 2DRWA 4ME4A 3C4OA 4P6BA 1X0OA 4GN2A 5HZHA 3NOTC 5GHYA 4DN0A 5F5YA 1G6AA 3IH8A 2ZQ8A 3UY6A 4RQ9A 3LFVA 3VP4A 5JYOA 1PZOA 3LR5A 3UB8A 3A3DA 4MBHA 2B5RA 1KOUA 2W3EA 3HJIA 4NXBA 1MWUA 3CUEA 4S2KA 1S6RA 4BD0A 1AWIA 2PBYA 3ZG0A 5IT5A 3SH8A 2XEPA 2PD8A 4GCZA 3HLDA 3F1NB 3G35A 1OTEA 1WYBA 3A3IA 3UB5P 4GNUA 1NRJA 4OPQA 4FH4A 3MSHA 2PAVP 3MQOA 3MR0A 4OONA 5DFXA 2XD5A 4ZTKA 1KGEA 4HQAA 3VFHA 1MKMA 1SHVA 2Y55A 3G34A 1EROA 2EX9A 1G5UA 4HY8A 5L10A 1DJCA 3PBSA 1PWCA 1LHYA 3IXBA 4GD6A 1BLSA 4G3KA 5EVID 3O87A 3LCEA 2WADA 1UGUA 1YMSA 4WZ5A 3E4OA 1K4EA 1BLCA 3DTMA 2OV5A 4E3LA 5CRFA 4HIAA 3CJMA 3A0RA 4EUVA 1PIOA 3BWLA 3MXSA 4U3TA 5DF9A 3PAEA 4OP8A 4OQGA 5FA7A 1VB6A 4ZBEA 3E2KA 3GV9A 4A5RA 4EUZA 1PI4A 4ESPA 1MBLA 3I7JA 1K56A 4JGOA 5HL1A 4N9LA 1JNUA 4WEJA 3VOLA 4O01A 4O0PA 3C7VA 1XFQA 1W7FA 3D4FA 2WGVA 1ONGA 3C7UA 2Y2QA 2FFFB 4R38A 4RYEA 4I3IA 2JC7A 1PRQA 2ZL1B 5GLCA 2IWDA 3D72A 3NCKA 3UE3A 4Y5FA 2J7VA 4AFIA 1EW0A 3GMWA 3QP2A 3S7QA 3UPOA 3HREA 3CPTA 4N9KA 5FQIA 3IWQA 2C6WB 1IYQA 2WKQA 1PZPA 3T1RA 5GHZA 2A3UA 3OZHA 2V9AA 3EEAA 1MY8A 5EOOA 3T50A 1DP8A 2O99A 2ZQ7A 4BBTA 4KZ3A 4PKYG 2P04A 1HTZA 1YSPA 3CAXA 2KOIA 2EFUA 1DY6A 3UN7A 2ZC7A 5GLAA 2OWJA 2JHEA 5F82A 1OPXA 3HUNA 3F1OA 4X1LA 3NDGA 4UHUA 1GSVA 4GDNA 1XFNA 3SZTA 4PM5A 4JPMA 2QHKA 1JWZA 2XROA 1TVFA 1BSGA 1VHMA 1K54C 1RGZA 1ES4A 3PBOA 3FYZA 2C5WB 1CI8A 3S22A 1DJBA 4FOFA 4B4XA 4EEUA 3Q1FA 5AVFA 5GHXA 3BY8A 3LYXA 2WKIA 1AXBA 3FPVA 4Y0OA 1K55C 3GTCA 3QP4A 1WE4A 4I39A 2W1RA 1CJFA 2JCHA 4NXEA 4P87A 3DTKA 1P9WA 4S2NA 2CC1A 5FEFA 1JTGA 3M6BA 5HL6A 4KZ4A 5FEGA 3F1PA 5AQBA 3T4OA 1BYWA 4OOLA 3LI8A 4LRYC 3IWOA 4JXSA 3UMDA 5HAPA 2EX6A 3OPLA 4PHTA 5CECA 3KYEA 4PPRA 4GLQA 5KIZA 2WUQA 5CGSA 5HSQA 3MS6A 4B88A 4I38A 2KDKA 4OPZA 3PBTA 1FR6A 4HNBA 2L0WA 2ZC5B 5J3WA 1K4FA 3BM6A 3W4PA 2AVXA 3N8SA 3WRZA 2XK1A 1L3LA 2Y8HA 4Y2FA 4N1HA 5LBRA 5F1FA 5TBMB 2ZC3B 1XA7A 1YM1A 3QP1A 5HW3A 5IS1A 3TSGA 4MN5A 3N8LA 1VEUB 4WL9A 4IVIA 4EBPA 4OKPA 2P08A 5FI7A 1HVBA 2XH9A 5E2EA 2Y2OA 4NK3A 4QHCA 5CXWA 1GHIA 3MMHA 4WF0A 1IKIA 3PAGA 4JGRA 3U2AA 2W3FA 1ES5A 2W1TA 3LIAA 4KZ6A 2V2FF 3GQZA 5HDCA 3SS3A 3Q7VB 1XXMA 4R70A 2EXAA 2HP5A 2ZD8A 3TW8A 3C38A 3EEHA 3LIFA 4DXCA 3LIEA 3CHWP 1FR1A 1YLJA 4IEDA 4KUOA 1KGGA 5TGFA 2JE5A 3N7WA 1ZG6A 3LEQA 1DJAA 1IKGA 3A3JA 4C75A 3VP2A 1CK3A 2LB9A 5E2HA 2MJ6A 1Z6FA 3MJQA 1S67L 3RXXA 1XPBA 1I5QA 5M1AA 5EVEA 4B93A 1YQSA 2Y2NA 4WZ5C 5A92A 4LCLA 5TR7A 5EV0A 3E2LA 3H7WA 3W8KA 4IJGA 3MKEA 2L1MA 4DJ2A 3GSGA 1I2SA 2V1AA 2WGWA 4WLAA 4E3NA 3BW6A 2PYPA 2W3DA 1ACFA 2Z2MB 1O7EA 4GB7A 1STZA 1L0EA 1CQAA 3FV7A 3IF6A 3OLOA 3Q81A 3T4JA 2VGKA 3FZCA 5HDDA 4Y15A 1KDWA 4X6TA 3ZG5A 3ICYA 2Y2MA 4QY6A 2H10A 3FG8A 3M2JA 5F83A 3MZFA 2G2WA 2HPBA 3BJNA 4DE0A 3G30A 4U0XA 3LGOA 3VSKA 1J3WA 4CQHA 4KZ5A 3B33A 1QMEA 4LPZA 2X02A 1XGIA 2J3TC 4F3LA 5L07A 1OTAA 1OT6A 1NLZA 5EE8A 2Y79A 4JXGA 4JBFA 2HDQA 2W27A 1LLBA 3G6OA 4X55A 1K6RA 1FCMA 5AQ7A 2VLGA 4KZBA 3SH7A 1T1CA 2NUTC 4EERA 4DE2A 1FSYA 4BMWA 3B47A 3T1SA 1K57A 1OTDA 2J9OA 4R1GA 1XP4A 4LV1A 1NZOA 5GLBA 2QJ7A 3C8CA 2VK3A 1MZUA 5J7EA 5KZHA 3GECA 1Y28A 4P6ZM 3P98A 1SDEA 2K2NA 2GDNA 2I72A 4ETXA 4L9FA 5CERA 1H5XA 3CG5A 5EFWA 1LT0A 1M40A 3DBAA 2VGJA 3G31A 3ZNYA 2RCXA 1IYOA 4LLOB 4XT2A 1IELA 3CPTB 3A0VA 1BZAA 3VE3A 5HD3A 4GZBA 5F6AA 4HH3A 2V8CA 4UA6A 4DJ3A 3DTEA 3H82A 3HCYA 3NC8A 3L7HA 4BD1A 4NG2A 1NJ4A 2VA0A 4UAAA 1GA9A 3VMAA 3NOUC 4RA7A 2WKRA 4S2NC 3MXQA 4U0TA 3BRMA 3MKFA 1NWZA 3EOIA 3RH8B 4E6WA 3KSGA 2WKEA 2V1BA 3KX0X 3F1OB 1FSWA 2VGLS 2PU2A 2VV8A 3DW0A 1N9BA 1D06A 3BLSA 3DWKA 4FH2A 1U60A 1PFLA 4E6XA 5FDHA 4EXOA 2K31A 3P01A 3JPUA 3E4QA 5M18A 2OLUA 4HJ3A 4KZ9A 4MN6A 3Q07A 2PU4A 4HBTA 2QPNA 1L2SA 3RXWA 4CLCA 3PBRA 3IH9A 4PMAA 2ZC4B 2QYBA 1VETA 3LR4A 4KZAA 3IX8A 2OOLA 1YT4A 3A0SA 3QP6A 3DAVA 5EM1A 3BY9A 4X69A 2WK0A 4WMCA 2QJ5A 5CGXA 5A91A 2Y2LA 4JF4A 3F1PB 4FCFA 1T1AA 5GLDA 4P0MA 5EOEA 5F1GA 2JKRM 2UV0E 1OMEA 3CMZA 1T1BA 3PBNA 4KZ7A 1BLPA 4YNRA 2P74A 2HV1A 2JKTI 3TOIA 3HJKA 5HX9A 4UQIS 4DRTA 2EWWA 1K0KA 2XA7M 3PTEA 3NOPC 1E3UA 3UNWA 4PM9A 3V3RA 2VEAA 2W3GA 2Z6DA 2PR5A 3NHQA 5CHJA 2XLNA 3BLMA 5EM0A 5MC7A 4Z9QA 2GNXA 5GL9A 5HWTA 3BFGA 4DMZA 1G28A 3AGEA 5CHUA 2R78A 5C5KA 1Z09A 4HP9A 4EQIA 3UB9A 2PDRA 1RP5A 2X71A 4ZDXA 1V9YA 4R3JA 1PWGA 3IBRA 3GVBA 4QWOA 4LCMA 4Q8IA 2BG1A 3G2YA 1L0GA 3UO9A 3HLWA 2XQZA 4GJ4A 4GS9A 2BLSA 4Q0HA 3KO6A 1CI9A 2W1TB 4WYYA 3KYZA 1XGJA 3OPRA 4NXFA 3RFBA 1NY0A 2L4RA 1DP6A 4IBRA 4IVKA 4CPKA 2WZZA 3A3FA 1PWDA 5D3OA 4BLMA 2BTFP 5FAQA 5FI6A 3E4PA 3T4QA 4QY5A 1OT9A 2WGIA 2I9VA 4LRXC 5HWWA 3VOYA 4R4RA 5K5BA 2HP6A 4PM7A 5IU1A 2UWXA 1SDNA 1K56D 3UE1A 1XKZA 2O9CA 4EETB 1K25A 3H7WB 1FQGA 1H8MA 3RJUA 1C3BA 1IFQA 4NEED 2GJ3A 1S66L 5EECA 4PM8A 4QPRA 2H5SA 3T4SA 1W8YA 2B18A 1MWTA 3NIAA 2WGWB 3DWZA 3TG9A 2DMWA 5AVEA 3BFDA 4R23A 5F68A 4F94A 3ZDJA 3G2ZA 1K57C 1YPRA 4E3OA 1YLZA 5HPIA 3QP5A 4PAUA 4EEPA 2ZQAA 2WKHA 1Q2PA 4MEZA 2J3TD 3FWLA 1NZUA 2KX6A 3T4KA 4OP5A 1GA0A 3O3VA 5J4EA 4KQOA 1OTBA 4R0QA 4DKIA 3ZHHA 5DFYA 4OVDA 1DP9A 4WELA 4DXBA 1KVMA 4Y7PA 3SS4A 5A93A 2D01A 1GSWA 1ERMA 3NI9A 1YLTA 1Q2QA 3K3DA 1F9IA 2ZL1A 2VX8A 4S2PA 4ETZA 4WEKA 3B3XA 3IS2A 4IHQA 1OJ5A 4GD8A 4F3LB 2XD1A 2OLVA 1ZHHB 4ZAMA 1ZKJA 4EQ1A 3PYPA 3UPPA 3O86A 3BQAA 3LI9A 4OQHA 4BENA 3QHYA 3VE4A 3IXDA 3TRCA 2HZ5A 4LGWA 3C2WA 3CUEC 4HH2A 3GRJA 3MXRA 3V5MA 4KQDA 4R6LA 4DE3A 5L8MA 4FUWA 3A3EA 3B42A 4NXGA 4HBUA 2EX8A 2XDMA 3M2KA 4KQQA 1S0WA 1BTLA 4CLCE 2V8FA 2XFSA 4I5SA 4MDZA 4I3JA 3VOZA 4MLLA 3WRTA 2ZQ9A 1BLHA 4KENB 3WS5A 4ID4A 3TE8A 2XRNA 2Y2HA 4OLGA 1BULA 3ITAA 3UB6A 1CEFA 1V9ZA 4S2LA 1IYSA 1MXOA 1CEGA 4LFUA 1GHMA 4XT2B 3LUQA 1TS6A 4EESA 3C4PA 5G4ZA 1NLYA 4WUJA 3JVUA 4OQIA 4XUZA 3IHBA 4RX2A 1TS8A 4CLCC 5TFQA 2W0NA 3H82B 3WS4A 5CTNA 4FTXA 3CLOA 2WAEA 4R3BA 4LENA 1K6SA 1Y4OA 2A49A 3KSHA 3OOVA 1LI0A 4Y13A 4WBGA 4L9EA 1MWRA 5KMWA 4X68A 3WS2A 1PYYA 1TS0A 2EX2A 4P85A 1SZVA 4WZ4A 4O7DA 4KZ8A 4HI4A 4FD8A 3TJZC 3HLCA 1G68A 5TJJA 2FH5A 1IOUA 1S1ZA 5FAPA 4YWZA 4GKUA 4ARZA 2LB5A 4S2MA 2EWVA 4QD4A 2P7JA 2VV6A 2ZMVA 2EFXA 3EGDC 1XJ2A 3IQAA 3MQQA 4DDYA 5HAQA 3ZYTA 1YLYA 3K3CA 2D02A 1OJGA 1K54A 1EWZA 1S4SA 3ZCZA 2HGVA 4CLCB 5FAOA 5EPHA 2VKSA 2A24A 2E8IA 3LIDA 2HF6A 3BEBA 2M7VA 2XF3A 5E43A 1MC0A 3UMEA 1KVLA 1MKIA 4XXRA 2RL3A 2ZOHA 3P7NA 2JBFA 4OLDA 1LL5A 1H3QA 1VEUA 3HLFA 5J8XA 1ZC2A 4DDSA 3ZG7B 3ZG8B 2QMIA 5CHMA 2J9PA 3FKVA 2PT7A 3NULA 3VSLA 3CITA 4YOFA 4MBFA 1O07A 4OOMA 4GDBA 4EU0A 2J80A 3SS5A 1TEMA 4LV3A 1ODVA 2XFTA 2P9VA 4R4SA 1FILA 5DKKA 5HDSA 5DJUA 1YLWA 5EVIA 3BYDA 2YKFA 2PBDP 1S4RA 4NKPA 4BL3A 3LICA 1NYYA 3Q7VA 2DNSA 2J8YA 3MQ0A 1HD8A 3V67A 3C30A 1TDLA 3LR3A 1WA9A 2KLIA 3HL9A 1W5DA 4G3WA 3BFCA 1M6KA 2JKGA 1EI5A 5EVLA 3UDXA 4E3JA 2HDSA 3C5AA 4N92A 4PKYA 4GOGA 3H9WA 3ZG9B 2DCFA 1JVJA 4WN5A 5FQQA 2XR0A 4MCWA 3IBJA 1N9NA 3WS0A 3G4PA 2JN7A 4H6JA 2A2LA 4QB8A 1XJ6A 1W63Q 4GS9B 1LSXA 4GHIA 3S7PA 3W2ZA 2NUPC 3FC7A 3ITBA 1TD5A 5AQAA 3MFDA 3MZEA 5I5LA 3OPHA 2XA7S 2VZWA 4C3QA 4JF5A 1W63M 4LRZE 3MBZA 4HEFA 4MNRA 4MMNA 5DVAA 3M6HA 3R7WA 3LY3A 1YSQA 3NDEA 1F98A 5FATA 3T12B 2H0TA 4UA9A 2YKHA 1LL8A 2IWBA 3T4TA 3UDIA 2Y4AA 3KSIA 4KG2A 3BFFA 3LIBA 4EV4A
chains in the Genus database with same CATH topology
4IVKA 4KG5A 3PAGA 2WZZA 3A3FA 4CPKA 4C6YA 3OCLA 3HUMA 5CEBA 3V50A 1ES5A 1PWDA 3Q7ZA 5D3OA 4N1XA 4KZ6A 5I94A 2ZMAA 4BLMA 2V2FF 5FI6A 1K38A 5AQ9A 5FAQA 1VQQA 3GQZA 3EQUA 3IF5A 3LEZA 5KSCA 4QY5A 3SS3A 3Q7VB 1XXMA 2WGIA 2EXAA 3MZDA 1ONHA 2HP5A 2ZD8A 4DXCA 5CGWA 2H0YA 4K91A 3VOYA 1FR1A 4R4RA 5BOHA 1YLJA 2HP6A 1IKIA 4IEDA 4PM7A 5U47A 2Y59A 4E3IA 5M19A 4FSFA 3WS1A 1KGGA 5TGFA 2ZLYA 2UWXA 2Y2PA 1SDNA 3VP0A 1K56D 2JE5A 2ZC6B 3N7WA 3QNCA 4X56A 4CJNA 1ZG6A 1KE3A 3UE1A 1XKZA 1DJAA 1IKGA 1K25A 3G32A 5CTMA 3A3JA 1KDSA 4C75A 1FQGA 3HLGA 3RJUA 3VP2A 1C3BA 1CK3A 4OPRA 5DTKA 5E2HA 5A90A 1Z6FA 5DF8A 1KGFA 3VP3A 3RXXA 3IWIA 5EECA 1XPBA 4PM8A 2H5SA 3V39A 2Y2GA 1W8YA 1MWTA 3NIAA 2WGWB 3DWZA 3TG9A 3S4XA 3IXHA 1I5QA 3BFDA 5HFOA 1GHPA 4R23A 3OPPA 4HESA 2ZJ9A 3G2ZA 4RVAA 5M1AA 3ZDJA 1YQSA 4F94A 1K57C 1RGYA 2Y2NA 4LCLA 4MBKA 4WZ5C 5TR7A 4E3OA 5A92A 1E25A 4XUXA 2EXBA 4UA7A 2DRWA 1YLZA 3C4OA 3E2LA 3W8KA 4P6BA 3MKEA 2ZQAA 2R9WA 4GN2A 2WKHA 5GHYA 1Q2PA 3IT9A 4MEZA 4Y0UA 1G6AA 3GSGA 3FWLA 1I2SA 3W4QA 1NZUA 3IH8A 2ZQ8A 2WGWA 4OP5A 3UY6A 3P09A 4E3NA 1BT5A 3VP4A 1MWSA 5JYOA 1GA0A 3O3VA 4KQOA 1PZOA 4R0QA 4EBNA 4JLFA 3ZHHA 4DKIA 3A3DA 4MBHA 2Z2MB 4OVDA 1O7EA 5JYPA 4GB7A 2B5RA 4WELA 2Z2LB 4DXBA 1L0EA 1KVMA 4YINA 4Y7PA 3SS4A 5A93A 3FV7A 3IF6A 1ERMA 3Q81A 2VGKA 3NI9A 4IBXA 3LY4A 1YLTA 1MWUA 3FZCA 4S2JA 1Q2QA 1KDWA 1S6RA 4S2KA 4S2PA 4X6TA 3ZG5A 4BD0A 2PBYA 3ZG0A 2Y2MA 4QY6A 4WEKA 3B3XA 2H10A 2XEPA 3GR2A 3SH8A 3M2JA 4GD8A 5F83A 5FQMA 3BFEA 1FOFA 3MZFA 2XD1A 3HLDA 2OLVA 4ZAMA 2WAFA 5E2FA 1ZKJA 3G35A 2G2WA 3SOIA 2IWCA 2HPBA 3HLEA 1WYBA 2ZM8A 3A3IA 4DE0A 3UPPA 3O86A 3G30A 3ZGAB 4OQHA 4GNUA 4U0XA 3VSKA 4BENA 4OPYA 4OPQA 1NRFA 4FH4A 4KZ5A 3N6IA 4OONA 3QHYA 3IF6C 2XD5A 4ZTKA 1KGEA 1QMEA 3IXDA 1FCNA 2X02A 3VFHA 1XGIA 4QU3A 4JXVA 3GRJA 5IHVA 3MXRA 1SHVA 1FCOA 2Y55A 3G34A 3V5MA 5EE8A 3HVFA 1EROA 4DE3A 2EX9A 1W79A 2WZXA 4JXGA 4JBFA 2HDQA 3HUOA 2HDRA 4KG6A 2XGNA 3ZNTA 3A3EA 1LLBA 3ZFZA 4HBUA 4Y0TA 2EX8A 3EQVA 4X55A 1K6RA 1DJCA 3BECA 2XDMA 3HBRA 3M2KA 1GCEA 3PBSA 1PW8A 1FCMA 1S0WA 4KQQA 1BTLA 1PWCA 4BJPA 1NXYA 2XFSA 5AQ7A 1LHYA 3IXBA 4GD6A 4KZBA 3SH7A 1BLSA 3VOZA 4MLLA 2ZM0A 3WRTA 2ZQ9A 1ES3A 1BLHA 4KENB 3WS5A 5EVID 1FSYA 4DE2A 3O87A 4ID4A 3LCEA 4LV0A 2WADA 1YMSA 3ZVTA 1RCJA 2Y2HA 1K57A 4WZ5A 2J9OA 5DTSA 4R1GA 1K4EA 1XP4A 4LV1A 1NZOA 5GLBA 4WMCD 1BLCA 4DE1A 3OC2A 4OLGA 3DTMA 5DF7A 3UPNA 4WM9A 2OV5A 4E3LA 5CRFA 5KZHA 1BULA 2Y2IA 3ITAA 3CJMA 3JYIA 1CEFA 4S2LA 1IYSA 1MXOA 1CEGA 1PIOA 1GHMA 3MXSA 3P98A 4U3TA 2V20A 1SDEA 2GDNA 2I72A 5DF9A 3PAEA 4OP8A 4OQGA 2V1ZA 1JWPA 4D2OA 3C4PA 4E3MA 5FA7A 5CERA 1H5XA 3CG5A 4ZBEA 3E2KA 3GV9A 4A5RA 4EUZA 1PI4A 1ERQA 1MBLA 1M40A 1YLPA 2ZQCA 3I7JA 4PM6A 2VGJA 1LI9A 1K56A 5HL1A 3G31A 4OQIA 4N9LA 4XUZA 3ZNYA 1TDGA 4OQ0A 4WEJA 2RCXA 3IHBA 4RX2A 5TFQA 1IYOA 3C7VA 3WS4A 5CTNA 4S2IA 1W7FA 1IELA 1E3UD 3D4FA 2WGVA 2WAEA 1ONGA 3IF6B 4R3BA 3C7UA 4LENA 1K6SA 2Y2QA 1BZAA 1XX2A 2A49A 2FFFB 4GZBA 4RYEA 1LI0A 3OCNA 2JC7A 2Y2KA 1BUEA 5GLCA 2IWDA 4WBGA 1SCWA 4JXWA 5EVIC 3LO7A 4UA6A 3NCKA 1YMXA 3UE3A 1MWRA 4JF6A 2J7VA 2QZ6A 3GMWA 5KMWA 3NC8A 4X68A 3WS2A 3UPOA 3HREA 1PYYA 5DTTA 4BD1A 2EX2A 4N9KA 4P85A 4K0WA 5FQIA 4WZ4A 3IWQA 1NJ4A 2C6WB 4O7DA 3NBLA 1IYQA 4KZ8A 3Q82A 4FD8A 4UAAA 1GA9A 1PZPA 3FKWA 3HLCA 3VMAA 1G68A 4RA7A 4S2NC 4U0TA 5FAPA 3ZVWA 4GKUA 1W8QA 4S2MA 5GHZA 2A3UA 3BRMA 3MKFA 4QD4A 4OOYA 1LL9A 3OZHA 4EWFA 1H8YA 2EFXA 4IBRA 4E6WA 3IQAA 1MY8A 4DDYA 2WKEA 1IEMA 3AGDA 5EOOA 2ZQ7A 4JKTA 5FQJA 1SKFA 5HAQA 1FSWA 4KZ3A 1YLYA 1HTZA 2PU2A 3DW0A 1KE0A 1K54A 2HDUA 1N9BA 2EFUA 1XA1A 1DY6A 1EWZA 3BLSA 3ZCZA 3DWKA 3QNBA 4FH2A 1U60A 3UN7A 2R9XA 2ZC7A 4E6XA 5GLAA 5FDHA 2WYXA 2Y91A 5FAOA 5F82A 3AGFA 1ESUA 2ZQDA 5EPHA 3UE0A 3CZDA 3HUNA 2E8IA 3HLBA 5FQ9A 5M18A 3NDGA 3S1YA 1VM1A 3BEBA 2OLUA 1ZG4A 4UHUA 2XF3A 5E43A 4GDNA 1KVLA 1MKIA 4PM5A 4XXRA 2RL3A 4JPMA 4KZ9A 2JBFA 4ZJ2A 3Q07A 4OLDA 2Q9NA 1JWZA 1LL5A 2PU4A 2P9VB 4HBTA 3HLFA 5J8XA 1ZC2A 2QPNA 1L2SA 1L0DA 5EVIB 3RXWA 3ZG7B 4DDSA 1TVFA 1BSGA 3ZG8B 1ESIA 1K54C 3PBRA 4BL2A 3IH9A 2QMIA 2ZC4B 2J9PA 4PMAA 5CHMA 3FKVA 1RGZA 1H8ZA 1ES4A 1QMFA 4KZAA 3VSLA 3PBOA 4MBFA 5FSRA 1Y54A 1O07A 4OOMA 3FYZA 4GDBA 1IYPA 1CI8A 1NYMA 2C5WB 4DF6A 1YT4A 3S22A 1DJBA 5HARA 4B4XA 3SS5A 1TEMA 3Q1FA 5FI2A 4LV3A 2XFTA 1J9MA 5GHXA 2P9VA 4B4ZA 2WKIA 4R4SA 5KSHA 5G18A 5EVIA 4ZJ3A 1AXBA 3WWXA 4X69A 2WK0A 3BYDA 1ES2A 4Y0OA 1K55C 3GTCA 3IXGA 4WMCA 4BL3A 5CGXA 1NYYA 5A91A 1WE4A 2Y2LA 3Q7VA 4JF4A 2DNSA 2J8YA 4K0XA 2HP9A 4FCFA 1HD8A 5GLDA 4P0MA 5EOEA 1E4DA 5F1GA 5CEDA 2X01A 1TDLA 2JCHA 4P87A 3VP1A 1JWVA 3HL9A 1W5DA 1OMEA 3BFCA 4S2NA 3PBQA 3CMZA 1M6KA 2CC1A 1EI5A 4NETA 3V3SA 1JTGA 3PBNA 5EVLA 4KZ7A 3UDXA 2FFYA 1BLPA 3M6BA 1WYCA 4E3JA 2HDSA 3C5AA 2P74A 4KZ4A 5AQBA 3TOIA 4N92A 4OOLA 5HX9A 1N4OA 4DRTA 4ZJ1A 3IWOA 4JXSA 1HZOA 5HAPA 2EX6A 3OPLA 4GOGA 4OH0A 3VFFA 3PTEA 3ZG9B 2DCFA 1I2WA 2Y2JA 5CECA 1E3UA 3N8RA 4PPRA 1JVJA 4EBLA 5FQQA 3UNWA 4PM9A 4YFMA 2XR0A 3V3RA 2WUQA 5CGSA 3W4OA 2G2UA 3IHAA 1ALQA 2Q9MA 4M3KA 5CHJA 2XLNA 3BLMA 3WS0A 4B88A 4Z9QA 5GL9A 3BFGA 5E2GA 4OPZA 3G4PA 3PBTA 3ISGA 1FR6A 4QB8A 3AGEA 2ZC5B 1K4FA 2OSUA 3BM6A 5CHUA 3W4PA 5FQKA 1L0FA 3N8SA 3WRZA 2XK1A 1PI5A 3SH9A 3ITBA 4N1HA 4EQIA 5F1FA 4H8RA 4KQRA 1KE4A 5AQAA 1RP5A 3MFDA 3MZEA 2X71A 4BQMA 5HAIA 2ZC3B 3OPHA 4LV2A 1XA7A 4R3JA 4ZDXA 1PWGA 5L2FA 1YM1A 2ZM2A 5HW3A 3GVBA 1JTDA 3TSGA 3UDFA 4C3QA 4JF5A 4LCMA 4Q8IA 2BG1A 4QJGA 3G2YA 1L0GA 3MBZA 3UO9A 3HLWA 1MPLA 2XQZA 3N8LA 4HEFA 4MNRA 2BLSA 5DVAA 4X53A 3M6HA 1CI9A 3N4IA 4IVIA 4EBPA 5FASA 3LY3A 3NY4A 4OKPA 4WYYA 3NDEA 5FI7A 1XGJA 3O88A 3OPRA 4L0LA 5FATA 4RX3A 1HVBA 2H0TA 2XH9A 4UA9A 5E2EA 4E3KA 2IWBA 2Y2OA 4NK3A 4QHCA 4S2OA 3UDIA 2Y4AA 5EUAA 1NY0A 4KG2A 1K55A 5CXWA 1GHIA 1PW1A 3BFFA 1YLWA 4EV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVK A;  4KG5 A;  3PAG A;  2WZZ A;  3A3F A;  4CPK A;  4C6Y A;  3OCL A;  3HUM A;  5CEB A;  3V50 A;  1ES5 A;  1PWD A;  3Q7Z A;  5D3O A;  4N1X A;  4KZ6 A;  5I94 A;  2ZMA A;  4BLM A;  2V2F F;  5FI6 A;  1K38 A;  5AQ9 A;  5FAQ A;  1VQQ A;  3GQZ A;  3EQU A;  3IF5 A;  3LEZ A;  5KSC A;  4QY5 A;  3SS3 A;  3Q7V B;  1XXM A;  2WGI A;  2EXA A;  3MZD A;  1ONH A;  2HP5 A;  2ZD8 A;  4DXC A;  5CGW A;  2H0Y A;  4K91 A;  3VOY A;  1FR1 A;  4R4R A;  5BOH A;  1YLJ A;  2HP6 A;  1IKI A;  4IED A;  4PM7 A;  5U47 A;  2Y59 A;  4E3I A;  5M19 A;  4FSF A;  3WS1 A;  1KGG A;  5TGF A;  2ZLY A;  2UWX A;  2Y2P A;  1SDN A;  3VP0 A;  1K56 D;  2JE5 A;  2ZC6 B;  3N7W A;  3QNC A;  4X56 A;  4CJN A;  1ZG6 A;  1KE3 A;  3UE1 A;  1XKZ A;  1DJA A;  1IKG A;  1K25 A;  3G32 A;  5CTM A;  3A3J A;  1KDS A;  4C75 A;  1FQG A;  3HLG A;  3RJU A;  3VP2 A;  1C3B A;  1CK3 A;  4OPR A;  5DTK A;  5E2H A;  5A90 A;  1Z6F A;  5DF8 A;  1KGF A;  3VP3 A;  3RXX A;  3IWI A;  5EEC A;  1XPB A;  4PM8 A;  2H5S A;  3V39 A;  2Y2G A;  1W8Y A;  1MWT A;  3NIA A;  2WGW B;  3DWZ A;  3TG9 A;  3S4X A;  3IXH A;  1I5Q A;  3BFD A;  5HFO A;  1GHP A;  4R23 A;  3OPP A;  4HES A;  2ZJ9 A;  3G2Z A;  4RVA A;  5M1A A;  3ZDJ A;  1YQS A;  4F94 A;  1K57 C;  1RGY A;  2Y2N A;  4LCL A;  4MBK A;  4WZ5 C;  5TR7 A;  4E3O A;  5A92 A;  1E25 A;  4XUX A;  2EXB A;  4UA7 A;  2DRW A;  1YLZ A;  3C4O A;  3E2L A;  3W8K A;  4P6B A;  3MKE A;  2ZQA A;  2R9W A;  4GN2 A;  2WKH A;  5GHY A;  1Q2P A;  3IT9 A;  4MEZ A;  4Y0U A;  1G6A A;  3GSG A;  3FWL A;  1I2S A;  3W4Q A;  1NZU A;  3IH8 A;  2ZQ8 A;  2WGW A;  4OP5 A;  3UY6 A;  3P09 A;  4E3N A;  1BT5 A;  3VP4 A;  1MWS A;  5JYO A;  1GA0 A;  3O3V A;  4KQO A;  1PZO A;  4R0Q A;  4EBN A;  4JLF A;  3ZHH A;  4DKI A;  3A3D A;  4MBH A;  2Z2M B;  4OVD A;  1O7E A;  5JYP A;  4GB7 A;  2B5R A;  4WEL A;  2Z2L B;  4DXB A;  1L0E A;  1KVM A;  4YIN A;  4Y7P A;  3SS4 A;  5A93 A;  3FV7 A;  3IF6 A;  1ERM A;  3Q81 A;  2VGK A;  3NI9 A;  4IBX A;  3LY4 A;  1YLT A;  1MWU A;  3FZC A;  4S2J A;  1Q2Q A;  1KDW A;  1S6R A;  4S2K A;  4S2P A;  4X6T A;  3ZG5 A;  4BD0 A;  2PBY A;  3ZG0 A;  2Y2M A;  4QY6 A;  4WEK A;  3B3X A;  2H10 A;  2XEP A;  3GR2 A;  3SH8 A;  3M2J A;  4GD8 A;  5F83 A;  5FQM A;  3BFE A;  1FOF A;  3MZF A;  2XD1 A;  3HLD A;  2OLV A;  4ZAM A;  2WAF A;  5E2F A;  1ZKJ A;  3G35 A;  2G2W A;  3SOI A;  2IWC A;  2HPB A;  3HLE A;  1WYB A;  2ZM8 A;  3A3I A;  4DE0 A;  3UPP A;  3O86 A;  3G30 A;  3ZGA B;  4OQH A;  4GNU A;  4U0X A;  3VSK A;  4BEN A;  4OPY A;  4OPQ A;  1NRF A;  4FH4 A;  4KZ5 A;  3N6I A;  4OON A;  3QHY A;  3IF6 C;  2XD5 A;  4ZTK A;  1KGE A;  1QME A;  3IXD A;  1FCN A;  2X02 A;  3VFH A;  1XGI A;  4QU3 A;  4JXV A;  3GRJ A;  5IHV A;  3MXR A;  1SHV A;  1FCO A;  2Y55 A;  3G34 A;  3V5M A;  5EE8 A;  3HVF A;  1ERO A;  4DE3 A;  2EX9 A;  1W79 A;  2WZX A;  4JXG A;  4JBF A;  2HDQ A;  3HUO A;  2HDR A;  4KG6 A;  2XGN A;  3ZNT A;  3A3E A;  1LLB A;  3ZFZ A;  4HBU A;  4Y0T A;  2EX8 A;  3EQV A;  4X55 A;  1K6R A;  1DJC A;  3BEC A;  2XDM A;  3HBR A;  3M2K A;  1GCE A;  3PBS A;  1PW8 A;  1FCM A;  1S0W A;  4KQQ A;  1BTL A;  1PWC A;  4BJP A;  1NXY A;  2XFS A;  5AQ7 A;  1LHY A;  3IXB A;  4GD6 A;  4KZB A;  3SH7 A;  1BLS A;  3VOZ A;  4MLL A;  2ZM0 A;  3WRT A;  2ZQ9 A;  1ES3 A;  1BLH A;  4KEN B;  3WS5 A;  5EVI D;  1FSY A;  4DE2 A;  3O87 A;  4ID4 A;  3LCE A;  4LV0 A;  2WAD A;  1YMS A;  3ZVT A;  1RCJ A;  2Y2H A;  1K57 A;  4WZ5 A;  2J9O A;  5DTS A;  4R1G A;  1K4E A;  1XP4 A;  4LV1 A;  1NZO A;  5GLB A;  4WMC D;  1BLC A;  4DE1 A;  3OC2 A;  4OLG A;  3DTM A;  5DF7 A;  3UPN A;  4WM9 A;  2OV5 A;  4E3L A;  5CRF A;  5KZH A;  1BUL A;  2Y2I A;  3ITA A;  3CJM A;  3JYI A;  1CEF A;  4S2L A;  1IYS A;  1MXO A;  1CEG A;  1PIO A;  1GHM A;  3MXS A;  3P98 A;  4U3T A;  2V20 A;  1SDE A;  2GDN A;  2I72 A;  5DF9 A;  3PAE A;  4OP8 A;  4OQG A;  2V1Z A;  1JWP A;  4D2O A;  3C4P A;  4E3M A;  5FA7 A;  5CER A;  1H5X A;  3CG5 A;  4ZBE A;  3E2K A;  3GV9 A;  4A5R A;  4EUZ A;  1PI4 A;  1ERQ A;  1MBL A;  1M40 A;  1YLP A;  2ZQC A;  3I7J A;  4PM6 A;  2VGJ A;  1LI9 A;  1K56 A;  5HL1 A;  3G31 A;  4OQI A;  4N9L A;  4XUZ A;  3ZNY A;  1TDG A;  4OQ0 A;  4WEJ A;  2RCX A;  3IHB A;  4RX2 A;  5TFQ A;  1IYO A;  3C7V A;  3WS4 A;  5CTN A;  4S2I A;  1W7F A;  1IEL A;  1E3U D;  3D4F A;  2WGV A;  2WAE A;  1ONG A;  3IF6 B;  4R3B A;  3C7U A;  4LEN A;  1K6S A;  2Y2Q A;  1BZA A;  1XX2 A;  2A49 A;  2FFF B;  4GZB A;  4RYE A;  1LI0 A;  3OCN A;  2JC7 A;  2Y2K A;  1BUE A;  5GLC A;  2IWD A;  4WBG A;  1SCW A;  4JXW A;  5EVI C;  3LO7 A;  4UA6 A;  3NCK A;  1YMX A;  3UE3 A;  1MWR A;  4JF6 A;  2J7V A;  2QZ6 A;  3GMW A;  5KMW A;  3NC8 A;  4X68 A;  3WS2 A;  3UPO A;  3HRE A;  1PYY A;  5DTT A;  4BD1 A;  2EX2 A;  4N9K A;  4P85 A;  4K0W A;  5FQI A;  4WZ4 A;  3IWQ A;  1NJ4 A;  2C6W B;  4O7D A;  3NBL A;  1IYQ A;  4KZ8 A;  3Q82 A;  4FD8 A;  4UAA A;  1GA9 A;  1PZP A;  3FKW A;  3HLC A;  3VMA A;  1G68 A;  4RA7 A;  4S2N C;  4U0T A;  5FAP A;  3ZVW A;  4GKU A;  1W8Q A;  4S2M A;  5GHZ A;  2A3U A;  3BRM A;  3MKF A;  4QD4 A;  4OOY A;  1LL9 A;  3OZH A;  4EWF A;  1H8Y A;  2EFX A;  4IBR A;  4E6W A;  3IQA A;  1MY8 A;  4DDY A;  2WKE A;  1IEM A;  3AGD A;  5EOO A;  2ZQ7 A;  4JKT A;  5FQJ A;  1SKF A;  5HAQ A;  1FSW A;  4KZ3 A;  1YLY A;  1HTZ A;  2PU2 A;  3DW0 A;  1KE0 A;  1K54 A;  2HDU A;  1N9B A;  2EFU A;  1XA1 A;  1DY6 A;  1EWZ A;  3BLS A;  3ZCZ A;  3DWK A;  3QNB A;  4FH2 A;  1U60 A;  3UN7 A;  2R9X A;  2ZC7 A;  4E6X A;  5GLA A;  5FDH A;  2WYX A;  2Y91 A;  5FAO A;  5F82 A;  3AGF A;  1ESU A;  2ZQD A;  5EPH A;  3UE0 A;  3CZD A;  3HUN A;  2E8I A;  3HLB A;  5FQ9 A;  5M18 A;  3NDG A;  3S1Y A;  1VM1 A;  3BEB A;  2OLU A;  1ZG4 A;  4UHU A;  2XF3 A;  5E43 A;  4GDN A;  1KVL A;  1MKI A;  4PM5 A;  4XXR A;  2RL3 A;  4JPM A;  4KZ9 A;  2JBF A;  4ZJ2 A;  3Q07 A;  4OLD A;  2Q9N A;  1JWZ A;  1LL5 A;  2PU4 A;  2P9V B;  4HBT A;  3HLF A;  5J8X A;  1ZC2 A;  2QPN A;  1L2S A;  1L0D A;  5EVI B;  3RXW A;  3ZG7 B;  4DDS A;  1TVF A;  1BSG A;  3ZG8 B;  1ESI A;  1K54 C;  3PBR A;  4BL2 A;  3IH9 A;  2QMI A;  2ZC4 B;  2J9P A;  4PMA A;  5CHM A;  3FKV A;  1RGZ A;  1H8Z A;  1ES4 A;  1QMF A;  4KZA A;  3VSL A;  3PBO A;  4MBF A;  5FSR A;  1Y54 A;  1O07 A;  4OOM A;  3FYZ A;  4GDB A;  1IYP A;  1CI8 A;  1NYM A;  2C5W B;  4DF6 A;  1YT4 A;  3S22 A;  1DJB A;  5HAR A;  4B4X A;  3SS5 A;  1TEM A;  3Q1F A;  5FI2 A;  4LV3 A;  2XFT A;  1J9M A;  5GHX A;  2P9V A;  4B4Z A;  2WKI A;  4R4S A;  5KSH A;  5G18 A;  5EVI A;  4ZJ3 A;  1AXB A;  3WWX A;  4X69 A;  2WK0 A;  3BYD A;  1ES2 A;  4Y0O A;  1K55 C;  3GTC A;  3IXG A;  4WMC A;  4BL3 A;  5CGX A;  1NYY A;  5A91 A;  1WE4 A;  2Y2L A;  3Q7V A;  4JF4 A;  2DNS A;  2J8Y A;  4K0X A;  2HP9 A;  4FCF A;  1HD8 A;  5GLD A;  4P0M A;  5EOE A;  1E4D A;  5F1G A;  5CED A;  2X01 A;  1TDL A;  2JCH A;  4P87 A;  3VP1 A;  1JWV A;  3HL9 A;  1W5D A;  1OME A;  3BFC A;  4S2N A;  3PBQ A;  3CMZ A;  1M6K A;  2CC1 A;  1EI5 A;  4NET A;  3V3S A;  1JTG A;  3PBN A;  5EVL A;  4KZ7 A;  3UDX A;  2FFY A;  1BLP A;  3M6B A;  1WYC A;  4E3J A;  2HDS A;  3C5A A;  2P74 A;  4KZ4 A;  5AQB A;  3TOI A;  4N92 A;  4OOL A;  5HX9 A;  1N4O A;  4DRT A;  4ZJ1 A;  3IWO A;  4JXS A;  1HZO A;  5HAP A;  2EX6 A;  3OPL A;  4GOG A;  4OH0 A;  3VFF A;  3PTE A;  3ZG9 B;  2DCF A;  1I2W A;  2Y2J A;  5CEC A;  1E3U A;  3N8R A;  4PPR A;  1JVJ A;  4EBL A;  5FQQ A;  3UNW A;  4PM9 A;  4YFM A;  2XR0 A;  3V3R A;  2WUQ A;  5CGS A;  3W4O A;  2G2U A;  3IHA A;  1ALQ A;  2Q9M A;  4M3K A;  5CHJ A;  2XLN A;  3BLM A;  3WS0 A;  4B88 A;  4Z9Q A;  5GL9 A;  3BFG A;  5E2G A;  4OPZ A;  3G4P A;  3PBT A;  3ISG A;  1FR6 A;  4QB8 A;  3AGE A;  2ZC5 B;  1K4F A;  2OSU A;  3BM6 A;  5CHU A;  3W4P A;  5FQK A;  1L0F A;  3N8S A;  3WRZ A;  2XK1 A;  1PI5 A;  3SH9 A;  3ITB A;  4N1H A;  4EQI A;  5F1F A;  4H8R A;  4KQR A;  1KE4 A;  5AQA A;  1RP5 A;  3MFD A;  3MZE A;  2X71 A;  4BQM A;  5HAI A;  2ZC3 B;  3OPH A;  4LV2 A;  1XA7 A;  4R3J A;  4ZDX A;  1PWG A;  5L2F A;  1YM1 A;  2ZM2 A;  5HW3 A;  3GVB A;  1JTD A;  3TSG A;  3UDF A;  4C3Q A;  4JF5 A;  4LCM A;  4Q8I A;  2BG1 A;  4QJG A;  3G2Y A;  1L0G A;  3MBZ A;  3UO9 A;  3HLW A;  1MPL A;  2XQZ A;  3N8L A;  4HEF A;  4MNR A;  2BLS A;  5DVA A;  4X53 A;  3M6H A;  1CI9 A;  3N4I A;  4IVI A;  4EBP A;  5FAS A;  3LY3 A;  3NY4 A;  4OKP A;  4WYY A;  3NDE A;  5FI7 A;  1XGJ A;  3O88 A;  3OPR A;  4L0L A;  5FAT A;  4RX3 A;  1HVB A;  2H0T A;  2XH9 A;  4UA9 A;  5E2E A;  4E3K A;  2IWB A;  2Y2O A;  4NK3 A;  4QHC A;  4S2O A;  3UDI A;  2Y4A A;  5EUA A;  1NY0 A;  4KG2 A;  1K55 A;  5CXW A;  1GHI A;  1PW1 A;  3BFF A;  1YLW A;  4EV4 A; 
#chains in the Genus database with same CATH topology
 4KG5 A;  1ZTU A;  4C6Y A;  5CEB A;  2ZMA A;  5AQ9 A;  3UB7 A;  3T4L A;  3MF0 A;  3IF5 A;  3PXP A;  3MZD A;  1ONH A;  5CGW A;  4K91 A;  5DKL A;  1S1Y A;  5BOH A;  2VJW A;  5U47 A;  2Y59 A;  4Q0J A;  3EGX C;  4FSF A;  4HJ6 A;  4X25 A;  3VP0 A;  2ZOI A;  2ZC6 B;  4X56 A;  1P97 A;  4X1M A;  4B9O A;  1SKO A;  4OPR A;  5A90 A;  5DF8 A;  1KGF A;  3VP3 A;  3IWI A;  3V39 A;  2Y2G A;  3IXH A;  5HFO A;  3OPP A;  4HES A;  4BBV A;  4Z1W A;  3E0Y A;  1E25 A;  2EXB A;  3E98 A;  2O9B A;  2R9W A;  2XSS A;  3L9K A;  3IT9 A;  2BAS A;  1F2K A;  4Y0U A;  3SW1 A;  1CF0 A;  4GW9 A;  3W4Q A;  3P09 A;  1BT5 A;  3D3O A;  1MWS A;  2PHY A;  4HJ4 A;  5HD5 A;  4JLF A;  4EBN A;  3IS2 B;  1N9L A;  5JYP A;  3UE6 A;  4II7 A;  2Z2L B;  4YIN A;  2HJ9 C;  2VGL M;  2G7U A;  4BWI A;  4IBX A;  3LY4 A;  4S2J A;  3GR2 A;  2E8J A;  3BFE A;  5FQM A;  1FOF A;  3NEC A;  2WAF A;  5E2F A;  1GSX A;  3SOI A;  2IWC A;  3HLE A;  2ZM8 A;  3ZGA B;  1TS7 A;  2PRF A;  4OPY A;  1NRF A;  2PYR A;  3N6I A;  3IF6 C;  1FCN A;  4HHD A;  4QU3 A;  2O0Y A;  4JXV A;  3QP8 A;  5IHV A;  1FCO A;  3F1N A;  3JVV A;  3HVF A;  1W79 A;  2WZX A;  4CLC D;  3HUO A;  2HDR A;  4KG6 A;  1N9O A;  2XGN A;  3ZNT A;  3ZFZ A;  4Y0T A;  3EQV A;  2QKP A;  3BEC A;  5G4Y A;  1P0Z A;  3HBR A;  1GCE A;  4BJP A;  1PW8 A;  1NXY A;  2Q0O A;  3FPW A;  2ZM0 A;  1ES3 A;  3T1X A;  4LV0 A;  3CI6 A;  1YKD A;  2GX5 A;  1RCJ A;  3ZVT A;  4HOI A;  5DTS A;  4WMC D;  4DE1 A;  2ZBB A;  3OC2 A;  3OBF A;  5DF7 A;  3UPN A;  4WM9 A;  3RTY A;  2Y2I A;  2M1C A;  3JYI A;  3BQ8 A;  4IUK A;  4G3V A;  2V20 A;  4UQI M;  3S7N A;  2V1Z A;  5FDS A;  1FIK A;  1JWP A;  4D2O A;  4E3M A;  3GDI A;  2B95 A;  2K7S A;  1YLP A;  1ERQ A;  4PM6 A;  2ZQC A;  3KYQ A;  1LI9 A;  1D7E A;  1TDG A;  4OQ0 A;  1PNE A;  4S2I A;  1E3U D;  3IF6 B;  3D9Y A;  5FL3 A;  1XX2 A;  3O5Y A;  3OCN A;  2Y2K A;  1BUE A;  4Q0I A;  2GZA A;  1SCW A;  4JXW A;  5EVI C;  3LO7 A;  1YAX A;  1YMX A;  4JF6 A;  4UEY A;  4ARZ B;  2QZ6 A;  5DTT A;  3T1Q B;  3U4L P;  4K0W A;  3NBL A;  3Q82 A;  1HLU P;  3FKW A;  4Y3I A;  3ZVW A;  1W8Q A;  1LSV A;  4OOY A;  1LL9 A;  1D1J A;  4EWF A;  2O9A A;  1H8Y A;  2ACG A;  4ZRR A;  4R3A A;  1IEM A;  3AGD A;  4JGQ A;  4JKT A;  1P9R A;  3DTI A;  1SKF A;  5FQJ A;  5L09 A;  2A24 B;  3VV4 A;  4D60 A;  1KE0 A;  2HDU A;  1XA1 A;  3QNB A;  2R9X A;  1A0K A;  2IA2 A;  2WYX A;  2Y91 A;  1ESU A;  5HWV A;  2ZQD A;  3UE0 A;  3CZD A;  3HLB A;  5FQ9 A;  3S1Y A;  1VM1 A;  1ZG4 A;  1XJ4 A;  1TF1 A;  1T19 A;  1G6O A;  4ZJ2 A;  2Q9N A;  2P9V B;  1LSW A;  2H28 A;  5EVI B;  1L0D A;  2ZMF A;  1ESI A;  4BL2 A;  4Y17 A;  1H8Z A;  2J3W A;  3PHY A;  1QMF A;  5FSR A;  1Y54 A;  5F69 A;  1F5M A;  1IYP A;  1NYM A;  4DF6 A;  5HAR A;  5FI2 A;  1J9M A;  4B4Z A;  5KSH A;  5G18 A;  4K08 A;  4ZJ3 A;  3WWX A;  2Z6C A;  1ES2 A;  3IXG A;  3PR6 A;  3EWK A;  3KSF A;  2JKT M;  4K0X A;  2HP9 A;  1E4D A;  5CED A;  2X01 A;  3VP1 A;  1JWV A;  2B02 A;  4E04 A;  3PBQ A;  4NET A;  3V3S A;  5AJG A;  4P6Z S;  3LR0 A;  2PD7 A;  2FFY A;  1WYC A;  2HJE A;  1N4O A;  4ZJ1 A;  2V0W A;  1HZO A;  3IX3 A;  4H6J B;  4OH0 A;  3VFF A;  2JKR I;  1I2W A;  2Y2J A;  5A8B A;  3N8R A;  4GHI B;  4EBL A;  3ZQ5 A;  4YFM A;  3W4O A;  4I3A A;  2G2U A;  1DRM A;  3IHA A;  1ALQ A;  2Q9M A;  4M3K A;  5E2G A;  3ISG A;  2INW A;  3CWF A;  2OSU A;  5FQK A;  1L0F A;  2JKF A;  4O8G A;  1PI5 A;  3SH9 A;  3R7W B;  4H8R A;  4KQR A;  1KE4 A;  1OTI A;  3R4K A;  2V0U A;  4BQM A;  5HAI A;  4LV2 A;  5L2F A;  2CMN A;  2ZM2 A;  1JTD A;  2M7U A;  3UDF A;  4QJG A;  2EA9 A;  1MPL A;  1H0M A;  2QWS A;  4X53 A;  3N4I A;  1UWP X;  5FAS A;  3NY4 A;  3K2N A;  5TBM A;  3ULF A;  1VET B;  2OAQ 1;  3O88 A;  2W3H A;  4L0L A;  1XJ3 A;  4RX3 A;  4E3K A;  4S2O A;  4MN7 A;  4L9G A;  5EUA A;  1K55 A;  1PW1 A;  3AGF A;  4HP4 A;  4JGP A;  3OCL A;  3HUM A;  3V50 A;  3Q7Z A;  3S7O A;  4N1X A;  5DJT A;  5I94 A;  1K38 A;  1VQQ A;  3IX4 A;  3EQU A;  2OWH A;  3LEZ A;  4BBU A;  5KSC A;  5CX7 A;  4IUH A;  2VV7 A;  2H0Y A;  1SKO B;  4EW7 A;  4KUK A;  1T18 A;  4E3I A;  5M19 A;  3WS1 A;  2ZLY A;  3MFX A;  2Y2P A;  4M4X A;  3QNC A;  1UWN X;  4CJN A;  1KE3 A;  2PR6 A;  3G32 A;  5CTM A;  1KDS A;  3HLG A;  5DTK A;  2FZ0 A;  5HPF A;  3NJA A;  3S4X A;  2WKP A;  2OAP 1;  1GHP A;  4RVA A;  2ZJ9 A;  1RGY A;  4MBK A;  4XUX A;  4UA7 A;  2DRW A;  4ME4 A;  3C4O A;  4P6B A;  1X0O A;  4GN2 A;  5HZH A;  3NOT C;  5GHY A;  4DN0 A;  5F5Y A;  1G6A A;  3IH8 A;  2ZQ8 A;  3UY6 A;  4RQ9 A;  3LFV A;  3VP4 A;  5JYO A;  1PZO A;  3LR5 A;  3UB8 A;  3A3D A;  4MBH A;  2B5R A;  1KOU A;  2W3E A;  3HJI A;  4NXB A;  1MWU A;  3CUE A;  4S2K A;  1S6R A;  4BD0 A;  1AWI A;  2PBY A;  3ZG0 A;  5IT5 A;  3SH8 A;  2XEP A;  2PD8 A;  4GCZ A;  3HLD A;  3F1N B;  3G35 A;  1OTE A;  1WYB A;  3A3I A;  3UB5 P;  4GNU A;  1NRJ A;  4OPQ A;  4FH4 A;  3MSH A;  2PAV P;  3MQO A;  3MR0 A;  4OON A;  5DFX A;  2XD5 A;  4ZTK A;  1KGE A;  4HQA A;  3VFH A;  1MKM A;  1SHV A;  2Y55 A;  3G34 A;  1ERO A;  2EX9 A;  1G5U A;  4HY8 A;  5L10 A;  1DJC A;  3PBS A;  1PWC A;  1LHY A;  3IXB A;  4GD6 A;  1BLS A;  4G3K A;  5EVI D;  3O87 A;  3LCE A;  2WAD A;  1UGU A;  1YMS A;  4WZ5 A;  3E4O A;  1K4E A;  1BLC A;  3DTM A;  2OV5 A;  4E3L A;  5CRF A;  4HIA A;  3CJM A;  3A0R A;  4EUV A;  1PIO A;  3BWL A;  3MXS A;  4U3T A;  5DF9 A;  3PAE A;  4OP8 A;  4OQG A;  5FA7 A;  1VB6 A;  4ZBE A;  3E2K A;  3GV9 A;  4A5R A;  4EUZ A;  1PI4 A;  4ESP A;  1MBL A;  3I7J A;  1K56 A;  4JGO A;  5HL1 A;  4N9L A;  1JNU A;  4WEJ A;  3VOL A;  4O01 A;  4O0P A;  3C7V A;  1XFQ A;  1W7F A;  3D4F A;  2WGV A;  1ONG A;  3C7U A;  2Y2Q A;  2FFF B;  4R38 A;  4RYE A;  4I3I A;  2JC7 A;  1PRQ A;  2ZL1 B;  5GLC A;  2IWD A;  3D72 A;  3NCK A;  3UE3 A;  4Y5F A;  2J7V A;  4AFI A;  1EW0 A;  3GMW A;  3QP2 A;  3S7Q A;  3UPO A;  3HRE A;  3CPT A;  4N9K A;  5FQI A;  3IWQ A;  2C6W B;  1IYQ A;  2WKQ A;  1PZP A;  3T1R A;  5GHZ A;  2A3U A;  3OZH A;  2V9A A;  3EEA A;  1MY8 A;  5EOO A;  3T50 A;  1DP8 A;  2O99 A;  2ZQ7 A;  4BBT A;  4KZ3 A;  4PKY G;  2P04 A;  1HTZ A;  1YSP A;  3CAX A;  2KOI A;  2EFU A;  1DY6 A;  3UN7 A;  2ZC7 A;  5GLA A;  2OWJ A;  2JHE A;  5F82 A;  1OPX A;  3HUN A;  3F1O A;  4X1L A;  3NDG A;  4UHU A;  1GSV A;  4GDN A;  1XFN A;  3SZT A;  4PM5 A;  4JPM A;  2QHK A;  1JWZ A;  2XRO A;  1TVF A;  1BSG A;  1VHM A;  1K54 C;  1RGZ A;  1ES4 A;  3PBO A;  3FYZ A;  2C5W B;  1CI8 A;  3S22 A;  1DJB A;  4FOF A;  4B4X A;  4EEU A;  3Q1F A;  5AVF A;  5GHX A;  3BY8 A;  3LYX A;  2WKI A;  1AXB A;  3FPV A;  4Y0O A;  1K55 C;  3GTC A;  3QP4 A;  1WE4 A;  4I39 A;  2W1R A;  1CJF A;  2JCH A;  4NXE A;  4P87 A;  3DTK A;  1P9W A;  4S2N A;  2CC1 A;  5FEF A;  1JTG A;  3M6B A;  5HL6 A;  4KZ4 A;  5FEG A;  3F1P A;  5AQB A;  3T4O A;  1BYW A;  4OOL A;  3LI8 A;  4LRY C;  3IWO A;  4JXS A;  3UMD A;  5HAP A;  2EX6 A;  3OPL A;  4PHT A;  5CEC A;  3KYE A;  4PPR A;  4GLQ A;  5KIZ A;  2WUQ A;  5CGS A;  5HSQ A;  3MS6 A;  4B88 A;  4I38 A;  2KDK A;  4OPZ A;  3PBT A;  1FR6 A;  4HNB A;  2L0W A;  2ZC5 B;  5J3W A;  1K4F A;  3BM6 A;  3W4P A;  2AVX A;  3N8S A;  3WRZ A;  2XK1 A;  1L3L A;  2Y8H A;  4Y2F A;  4N1H A;  5LBR A;  5F1F A;  5TBM B;  2ZC3 B;  1XA7 A;  1YM1 A;  3QP1 A;  5HW3 A;  5IS1 A;  3TSG A;  4MN5 A;  3N8L A;  1VEU B;  4WL9 A;  4IVI A;  4EBP A;  4OKP A;  2P08 A;  5FI7 A;  1HVB A;  2XH9 A;  5E2E A;  2Y2O A;  4NK3 A;  4QHC A;  5CXW A;  1GHI A;  3MMH A;  4WF0 A;  1IKI A;  3PAG A;  4JGR A;  3U2A A;  2W3F A;  1ES5 A;  2W1T A;  3LIA A;  4KZ6 A;  2V2F F;  3GQZ A;  5HDC A;  3SS3 A;  3Q7V B;  1XXM A;  4R70 A;  2EXA A;  2HP5 A;  2ZD8 A;  3TW8 A;  3C38 A;  3EEH A;  3LIF A;  4DXC A;  3LIE A;  3CHW P;  1FR1 A;  1YLJ A;  4IED A;  4KUO A;  1KGG A;  5TGF A;  2JE5 A;  3N7W A;  1ZG6 A;  3LEQ A;  1DJA A;  1IKG A;  3A3J A;  4C75 A;  3VP2 A;  1CK3 A;  2LB9 A;  5E2H A;  2MJ6 A;  1Z6F A;  3MJQ A;  1S67 L;  3RXX A;  1XPB A;  1I5Q A;  5M1A A;  5EVE A;  4B93 A;  1YQS A;  2Y2N A;  4WZ5 C;  5A92 A;  4LCL A;  5TR7 A;  5EV0 A;  3E2L A;  3H7W A;  3W8K A;  4IJG A;  3MKE A;  2L1M A;  4DJ2 A;  3GSG A;  1I2S A;  2V1A A;  2WGW A;  4WLA A;  4E3N A;  3BW6 A;  2PYP A;  2W3D A;  1ACF A;  2Z2M B;  1O7E A;  4GB7 A;  1STZ A;  1L0E A;  1CQA A;  3FV7 A;  3IF6 A;  3OLO A;  3Q81 A;  3T4J A;  2VGK A;  3FZC A;  5HDD A;  4Y15 A;  1KDW A;  4X6T A;  3ZG5 A;  3ICY A;  2Y2M A;  4QY6 A;  2H10 A;  3FG8 A;  3M2J A;  5F83 A;  3MZF A;  2G2W A;  2HPB A;  3BJN A;  4DE0 A;  3G30 A;  4U0X A;  3LGO A;  3VSK A;  1J3W A;  4CQH A;  4KZ5 A;  3B33 A;  1QME A;  4LPZ A;  2X02 A;  1XGI A;  2J3T C;  4F3L A;  5L07 A;  1OTA A;  1OT6 A;  1NLZ A;  5EE8 A;  2Y79 A;  4JXG A;  4JBF A;  2HDQ A;  2W27 A;  1LLB A;  3G6O A;  4X55 A;  1K6R A;  1FCM A;  5AQ7 A;  2VLG A;  4KZB A;  3SH7 A;  1T1C A;  2NUT C;  4EER A;  4DE2 A;  1FSY A;  4BMW A;  3B47 A;  3T1S A;  1K57 A;  1OTD A;  2J9O A;  4R1G A;  1XP4 A;  4LV1 A;  1NZO A;  5GLB A;  2QJ7 A;  3C8C A;  2VK3 A;  1MZU A;  5J7E A;  5KZH A;  3GEC A;  1Y28 A;  4P6Z M;  3P98 A;  1SDE A;  2K2N A;  2GDN A;  2I72 A;  4ETX A;  4L9F A;  5CER A;  1H5X A;  3CG5 A;  5EFW A;  1LT0 A;  1M40 A;  3DBA A;  2VGJ A;  3G31 A;  3ZNY A;  2RCX A;  1IYO A;  4LLO B;  4XT2 A;  1IEL A;  3CPT B;  3A0V A;  1BZA A;  3VE3 A;  5HD3 A;  4GZB A;  5F6A A;  4HH3 A;  2V8C A;  4UA6 A;  4DJ3 A;  3DTE A;  3H82 A;  3HCY A;  3NC8 A;  3L7H A;  4BD1 A;  4NG2 A;  1NJ4 A;  2VA0 A;  4UAA A;  1GA9 A;  3VMA A;  3NOU C;  4RA7 A;  2WKR A;  4S2N C;  3MXQ A;  4U0T A;  3BRM A;  3MKF A;  1NWZ A;  3EOI A;  3RH8 B;  4E6W A;  3KSG A;  2WKE A;  2V1B A;  3KX0 X;  3F1O B;  1FSW A;  2VGL S;  2PU2 A;  2VV8 A;  3DW0 A;  1N9B A;  1D06 A;  3BLS A;  3DWK A;  4FH2 A;  1U60 A;  1PFL A;  4E6X A;  5FDH A;  4EXO A;  2K31 A;  3P01 A;  3JPU A;  3E4Q A;  5M18 A;  2OLU A;  4HJ3 A;  4KZ9 A;  4MN6 A;  3Q07 A;  2PU4 A;  4HBT A;  2QPN A;  1L2S A;  3RXW A;  4CLC A;  3PBR A;  3IH9 A;  4PMA A;  2ZC4 B;  2QYB A;  1VET A;  3LR4 A;  4KZA A;  3IX8 A;  2OOL A;  1YT4 A;  3A0S A;  3QP6 A;  3DAV A;  5EM1 A;  3BY9 A;  4X69 A;  2WK0 A;  4WMC A;  2QJ5 A;  5CGX A;  5A91 A;  2Y2L A;  4JF4 A;  3F1P B;  4FCF A;  1T1A A;  5GLD A;  4P0M A;  5EOE A;  5F1G A;  2JKR M;  2UV0 E;  1OME A;  3CMZ A;  1T1B A;  3PBN A;  4KZ7 A;  1BLP A;  4YNR A;  2P74 A;  2HV1 A;  2JKT I;  3TOI A;  3HJK A;  5HX9 A;  4UQI S;  4DRT A;  2EWW A;  1K0K A;  2XA7 M;  3PTE A;  3NOP C;  1E3U A;  3UNW A;  4PM9 A;  3V3R A;  2VEA A;  2W3G A;  2Z6D A;  2PR5 A;  3NHQ A;  5CHJ A;  2XLN A;  3BLM A;  5EM0 A;  5MC7 A;  4Z9Q A;  2GNX A;  5GL9 A;  5HWT A;  3BFG A;  4DMZ A;  1G28 A;  3AGE A;  5CHU A;  2R78 A;  5C5K A;  1Z09 A;  4HP9 A;  4EQI A;  3UB9 A;  2PDR A;  1RP5 A;  2X71 A;  4ZDX A;  1V9Y A;  4R3J A;  1PWG A;  3IBR A;  3GVB A;  4QWO A;  4LCM A;  4Q8I A;  2BG1 A;  3G2Y A;  1L0G A;  3UO9 A;  3HLW A;  2XQZ A;  4GJ4 A;  4GS9 A;  2BLS A;  4Q0H A;  3KO6 A;  1CI9 A;  2W1T B;  4WYY A;  3KYZ A;  1XGJ A;  3OPR A;  4NXF A;  3RFB A;  1NY0 A;  2L4R A;  1DP6 A;  4IBR A;  4IVK A;  4CPK A;  2WZZ A;  3A3F A;  1PWD A;  5D3O A;  4BLM A;  2BTF P;  5FAQ A;  5FI6 A;  3E4P A;  3T4Q A;  4QY5 A;  1OT9 A;  2WGI A;  2I9V A;  4LRX C;  5HWW A;  3VOY A;  4R4R A;  5K5B A;  2HP6 A;  4PM7 A;  5IU1 A;  2UWX A;  1SDN A;  1K56 D;  3UE1 A;  1XKZ A;  2O9C A;  4EET B;  1K25 A;  3H7W B;  1FQG A;  1H8M A;  3RJU A;  1C3B A;  1IFQ A;  4NEE D;  2GJ3 A;  1S66 L;  5EEC A;  4PM8 A;  4QPR A;  2H5S A;  3T4S A;  1W8Y A;  2B18 A;  1MWT A;  3NIA A;  2WGW B;  3DWZ A;  3TG9 A;  2DMW A;  5AVE A;  3BFD A;  4R23 A;  5F68 A;  4F94 A;  3ZDJ A;  3G2Z A;  1K57 C;  1YPR A;  4E3O A;  1YLZ A;  5HPI A;  3QP5 A;  4PAU A;  4EEP A;  2ZQA A;  2WKH A;  1Q2P A;  4MEZ A;  2J3T D;  3FWL A;  1NZU A;  2KX6 A;  3T4K A;  4OP5 A;  1GA0 A;  3O3V A;  5J4E A;  4KQO A;  1OTB A;  4R0Q A;  4DKI A;  3ZHH A;  5DFY A;  4OVD A;  1DP9 A;  4WEL A;  4DXB A;  1KVM A;  4Y7P A;  3SS4 A;  5A93 A;  2D01 A;  1GSW A;  1ERM A;  3NI9 A;  1YLT A;  1Q2Q A;  3K3D A;  1F9I A;  2ZL1 A;  2VX8 A;  4S2P A;  4ETZ A;  4WEK A;  3B3X A;  3IS2 A;  4IHQ A;  1OJ5 A;  4GD8 A;  4F3L B;  2XD1 A;  2OLV A;  1ZHH B;  4ZAM A;  1ZKJ A;  4EQ1 A;  3PYP A;  3UPP A;  3O86 A;  3BQA A;  3LI9 A;  4OQH A;  4BEN A;  3QHY A;  3VE4 A;  3IXD A;  3TRC A;  2HZ5 A;  4LGW A;  3C2W A;  3CUE C;  4HH2 A;  3GRJ A;  3MXR A;  3V5M A;  4KQD A;  4R6L A;  4DE3 A;  5L8M A;  4FUW A;  3A3E A;  3B42 A;  4NXG A;  4HBU A;  2EX8 A;  2XDM A;  3M2K A;  4KQQ A;  1S0W A;  1BTL A;  4CLC E;  2V8F A;  2XFS A;  4I5S A;  4MDZ A;  4I3J A;  3VOZ A;  4MLL A;  3WRT A;  2ZQ9 A;  1BLH A;  4KEN B;  3WS5 A;  4ID4 A;  3TE8 A;  2XRN A;  2Y2H A;  4OLG A;  1BUL A;  3ITA A;  3UB6 A;  1CEF A;  1V9Z A;  4S2L A;  1IYS A;  1MXO A;  1CEG A;  4LFU A;  1GHM A;  4XT2 B;  3LUQ A;  1TS6 A;  4EES A;  3C4P A;  5G4Z A;  1NLY A;  4WUJ A;  3JVU A;  4OQI A;  4XUZ A;  3IHB A;  4RX2 A;  1TS8 A;  4CLC C;  5TFQ A;  2W0N A;  3H82 B;  3WS4 A;  5CTN A;  4FTX A;  3CLO A;  2WAE A;  4R3B A;  4LEN A;  1K6S A;  1Y4O A;  2A49 A;  3KSH A;  3OOV A;  1LI0 A;  4Y13 A;  4WBG A;  4L9E A;  1MWR A;  5KMW A;  4X68 A;  3WS2 A;  1PYY A;  1TS0 A;  2EX2 A;  4P85 A;  1SZV A;  4WZ4 A;  4O7D A;  4KZ8 A;  4HI4 A;  4FD8 A;  3TJZ C;  3HLC A;  1G68 A;  5TJJ A;  2FH5 A;  1IOU A;  1S1Z A;  5FAP A;  4YWZ A;  4GKU A;  4ARZ A;  2LB5 A;  4S2M A;  2EWV A;  4QD4 A;  2P7J A;  2VV6 A;  2ZMV A;  2EFX A;  3EGD C;  1XJ2 A;  3IQA A;  3MQQ A;  4DDY A;  5HAQ A;  3ZYT A;  1YLY A;  3K3C A;  2D02 A;  1OJG A;  1K54 A;  1EWZ A;  1S4S A;  3ZCZ A;  2HGV A;  4CLC B;  5FAO A;  5EPH A;  2VKS A;  2A24 A;  2E8I A;  3LID A;  2HF6 A;  3BEB A;  2M7V A;  2XF3 A;  5E43 A;  1MC0 A;  3UME A;  1KVL A;  1MKI A;  4XXR A;  2RL3 A;  2ZOH A;  3P7N A;  2JBF A;  4OLD A;  1LL5 A;  1H3Q A;  1VEU A;  3HLF A;  5J8X A;  1ZC2 A;  4DDS A;  3ZG7 B;  3ZG8 B;  2QMI A;  5CHM A;  2J9P A;  3FKV A;  2PT7 A;  3NUL A;  3VSL A;  3CIT A;  4YOF A;  4MBF A;  1O07 A;  4OOM A;  4GDB A;  4EU0 A;  2J80 A;  3SS5 A;  1TEM A;  4LV3 A;  1ODV A;  2XFT A;  2P9V A;  4R4S A;  1FIL A;  5DKK A;  5HDS A;  5DJU A;  1YLW A;  5EVI A;  3BYD A;  2YKF A;  2PBD P;  1S4R A;  4NKP A;  4BL3 A;  3LIC A;  1NYY A;  3Q7V A;  2DNS A;  2J8Y A;  3MQ0 A;  1HD8 A;  3V67 A;  3C30 A;  1TDL A;  3LR3 A;  1WA9 A;  2KLI A;  3HL9 A;  1W5D A;  4G3W A;  3BFC A;  1M6K A;  2JKG A;  1EI5 A;  5EVL A;  3UDX A;  4E3J A;  2HDS A;  3C5A A;  4N92 A;  4PKY A;  4GOG A;  3H9W A;  3ZG9 B;  2DCF A;  1JVJ A;  4WN5 A;  5FQQ A;  2XR0 A;  4MCW A;  3IBJ A;  1N9N A;  3WS0 A;  3G4P A;  2JN7 A;  4H6J A;  2A2L A;  4QB8 A;  1XJ6 A;  1W63 Q;  4GS9 B;  1LSX A;  4GHI A;  3S7P A;  3W2Z A;  2NUP C;  3FC7 A;  3ITB A;  1TD5 A;  5AQA A;  3MFD A;  3MZE A;  5I5L A;  3OPH A;  2XA7 S;  2VZW A;  4C3Q A;  4JF5 A;  1W63 M;  4LRZ E;  3MBZ A;  4HEF A;  4MNR A;  4MMN A;  5DVA A;  3M6H A;  3R7W A;  3LY3 A;  1YSQ A;  3NDE A;  1F98 A;  5FAT A;  3T12 B;  2H0T A;  4UA9 A;  2YKH A;  1LL8 A;  2IWB A;  3T4T A;  3UDI A;  2Y4A A;  3KSI A;  4KG2 A;  3BFF A;  3LIB A;  4EV4 A; 
#chains in the Genus database with same CATH homology
 4IVK A;  4KG5 A;  3PAG A;  2WZZ A;  3A3F A;  4CPK A;  4C6Y A;  3OCL A;  3HUM A;  5CEB A;  3V50 A;  1ES5 A;  1PWD A;  3Q7Z A;  5D3O A;  4N1X A;  4KZ6 A;  5I94 A;  2ZMA A;  4BLM A;  2V2F F;  5FI6 A;  1K38 A;  5AQ9 A;  5FAQ A;  1VQQ A;  3GQZ A;  3EQU A;  3IF5 A;  3LEZ A;  5KSC A;  4QY5 A;  3SS3 A;  3Q7V B;  1XXM A;  2WGI A;  2EXA A;  3MZD A;  1ONH A;  2HP5 A;  2ZD8 A;  4DXC A;  5CGW A;  2H0Y A;  4K91 A;  3VOY A;  1FR1 A;  4R4R A;  5BOH A;  1YLJ A;  2HP6 A;  1IKI A;  4IED A;  4PM7 A;  5U47 A;  2Y59 A;  4E3I A;  5M19 A;  4FSF A;  3WS1 A;  1KGG A;  5TGF A;  2ZLY A;  2UWX A;  2Y2P A;  1SDN A;  3VP0 A;  1K56 D;  2JE5 A;  2ZC6 B;  3N7W A;  3QNC A;  4X56 A;  4CJN A;  1ZG6 A;  1KE3 A;  3UE1 A;  1XKZ A;  1DJA A;  1IKG A;  1K25 A;  3G32 A;  5CTM A;  3A3J A;  1KDS A;  4C75 A;  1FQG A;  3HLG A;  3RJU A;  3VP2 A;  1C3B A;  1CK3 A;  4OPR A;  5DTK A;  5E2H A;  5A90 A;  1Z6F A;  5DF8 A;  1KGF A;  3VP3 A;  3RXX A;  3IWI A;  5EEC A;  1XPB A;  4PM8 A;  2H5S A;  3V39 A;  2Y2G A;  1W8Y A;  1MWT A;  3NIA A;  2WGW B;  3DWZ A;  3TG9 A;  3S4X A;  3IXH A;  1I5Q A;  3BFD A;  5HFO A;  1GHP A;  4R23 A;  3OPP A;  4HES A;  2ZJ9 A;  3G2Z A;  4RVA A;  5M1A A;  3ZDJ A;  1YQS A;  4F94 A;  1K57 C;  1RGY A;  2Y2N A;  4LCL A;  4MBK A;  4WZ5 C;  5TR7 A;  4E3O A;  5A92 A;  1E25 A;  4XUX A;  2EXB A;  4UA7 A;  2DRW A;  1YLZ A;  3C4O A;  3E2L A;  3W8K A;  4P6B A;  3MKE A;  2ZQA A;  2R9W A;  4GN2 A;  2WKH A;  5GHY A;  1Q2P A;  3IT9 A;  4MEZ A;  4Y0U A;  1G6A A;  3GSG A;  3FWL A;  1I2S A;  3W4Q A;  1NZU A;  3IH8 A;  2ZQ8 A;  2WGW A;  4OP5 A;  3UY6 A;  3P09 A;  4E3N A;  1BT5 A;  3VP4 A;  1MWS A;  5JYO A;  1GA0 A;  3O3V A;  4KQO A;  1PZO A;  4R0Q A;  4EBN A;  4JLF A;  3ZHH A;  4DKI A;  3A3D A;  4MBH A;  2Z2M B;  4OVD A;  1O7E A;  5JYP A;  4GB7 A;  2B5R A;  4WEL A;  2Z2L B;  4DXB A;  1L0E A;  1KVM A;  4YIN A;  4Y7P A;  3SS4 A;  5A93 A;  3FV7 A;  3IF6 A;  1ERM A;  3Q81 A;  2VGK A;  3NI9 A;  4IBX A;  3LY4 A;  1YLT A;  1MWU A;  3FZC A;  4S2J A;  1Q2Q A;  1KDW A;  1S6R A;  4S2K A;  4S2P A;  4X6T A;  3ZG5 A;  4BD0 A;  2PBY A;  3ZG0 A;  2Y2M A;  4QY6 A;  4WEK A;  3B3X A;  2H10 A;  2XEP A;  3GR2 A;  3SH8 A;  3M2J A;  4GD8 A;  5F83 A;  5FQM A;  3BFE A;  1FOF A;  3MZF A;  2XD1 A;  3HLD A;  2OLV A;  4ZAM A;  2WAF A;  5E2F A;  1ZKJ A;  3G35 A;  2G2W A;  3SOI A;  2IWC A;  2HPB A;  3HLE A;  1WYB A;  2ZM8 A;  3A3I A;  4DE0 A;  3UPP A;  3O86 A;  3G30 A;  3ZGA B;  4OQH A;  4GNU A;  4U0X A;  3VSK A;  4BEN A;  4OPY A;  4OPQ A;  1NRF A;  4FH4 A;  4KZ5 A;  3N6I A;  4OON A;  3QHY A;  3IF6 C;  2XD5 A;  4ZTK A;  1KGE A;  1QME A;  3IXD A;  1FCN A;  2X02 A;  3VFH A;  1XGI A;  4QU3 A;  4JXV A;  3GRJ A;  5IHV A;  3MXR A;  1SHV A;  1FCO A;  2Y55 A;  3G34 A;  3V5M A;  5EE8 A;  3HVF A;  1ERO A;  4DE3 A;  2EX9 A;  1W79 A;  2WZX A;  4JXG A;  4JBF A;  2HDQ A;  3HUO A;  2HDR A;  4KG6 A;  2XGN A;  3ZNT A;  3A3E A;  1LLB A;  3ZFZ A;  4HBU A;  4Y0T A;  2EX8 A;  3EQV A;  4X55 A;  1K6R A;  1DJC A;  3BEC A;  2XDM A;  3HBR A;  3M2K A;  1GCE A;  3PBS A;  1PW8 A;  1FCM A;  1S0W A;  4KQQ A;  1BTL A;  1PWC A;  4BJP A;  1NXY A;  2XFS A;  5AQ7 A;  1LHY A;  3IXB A;  4GD6 A;  4KZB A;  3SH7 A;  1BLS A;  3VOZ A;  4MLL A;  2ZM0 A;  3WRT A;  2ZQ9 A;  1ES3 A;  1BLH A;  4KEN B;  3WS5 A;  5EVI D;  1FSY A;  4DE2 A;  3O87 A;  4ID4 A;  3LCE A;  4LV0 A;  2WAD A;  1YMS A;  3ZVT A;  1RCJ A;  2Y2H A;  1K57 A;  4WZ5 A;  2J9O A;  5DTS A;  4R1G A;  1K4E A;  1XP4 A;  4LV1 A;  1NZO A;  5GLB A;  4WMC D;  1BLC A;  4DE1 A;  3OC2 A;  4OLG A;  3DTM A;  5DF7 A;  3UPN A;  4WM9 A;  2OV5 A;  4E3L A;  5CRF A;  5KZH A;  1BUL A;  2Y2I A;  3ITA A;  3CJM A;  3JYI A;  1CEF A;  4S2L A;  1IYS A;  1MXO A;  1CEG A;  1PIO A;  1GHM A;  3MXS A;  3P98 A;  4U3T A;  2V20 A;  1SDE A;  2GDN A;  2I72 A;  5DF9 A;  3PAE A;  4OP8 A;  4OQG A;  2V1Z A;  1JWP A;  4D2O A;  3C4P A;  4E3M A;  5FA7 A;  5CER A;  1H5X A;  3CG5 A;  4ZBE A;  3E2K A;  3GV9 A;  4A5R A;  4EUZ A;  1PI4 A;  1ERQ A;  1MBL A;  1M40 A;  1YLP A;  2ZQC A;  3I7J A;  4PM6 A;  2VGJ A;  1LI9 A;  1K56 A;  5HL1 A;  3G31 A;  4OQI A;  4N9L A;  4XUZ A;  3ZNY A;  1TDG A;  4OQ0 A;  4WEJ A;  2RCX A;  3IHB A;  4RX2 A;  5TFQ A;  1IYO A;  3C7V A;  3WS4 A;  5CTN A;  4S2I A;  1W7F A;  1IEL A;  1E3U D;  3D4F A;  2WGV A;  2WAE A;  1ONG A;  3IF6 B;  4R3B A;  3C7U A;  4LEN A;  1K6S A;  2Y2Q A;  1BZA A;  1XX2 A;  2A49 A;  2FFF B;  4GZB A;  4RYE A;  1LI0 A;  3OCN A;  2JC7 A;  2Y2K A;  1BUE A;  5GLC A;  2IWD A;  4WBG A;  1SCW A;  4JXW A;  5EVI C;  3LO7 A;  4UA6 A;  3NCK A;  1YMX A;  3UE3 A;  1MWR A;  4JF6 A;  2J7V A;  2QZ6 A;  3GMW A;  5KMW A;  3NC8 A;  4X68 A;  3WS2 A;  3UPO A;  3HRE A;  1PYY A;  5DTT A;  4BD1 A;  2EX2 A;  4N9K A;  4P85 A;  4K0W A;  5FQI A;  4WZ4 A;  3IWQ A;  1NJ4 A;  2C6W B;  4O7D A;  3NBL A;  1IYQ A;  4KZ8 A;  3Q82 A;  4FD8 A;  4UAA A;  1GA9 A;  1PZP A;  3FKW A;  3HLC A;  3VMA A;  1G68 A;  4RA7 A;  4S2N C;  4U0T A;  5FAP A;  3ZVW A;  4GKU A;  1W8Q A;  4S2M A;  5GHZ A;  2A3U A;  3BRM A;  3MKF A;  4QD4 A;  4OOY A;  1LL9 A;  3OZH A;  4EWF A;  1H8Y A;  2EFX A;  4IBR A;  4E6W A;  3IQA A;  1MY8 A;  4DDY A;  2WKE A;  1IEM A;  3AGD A;  5EOO A;  2ZQ7 A;  4JKT A;  5FQJ A;  1SKF A;  5HAQ A;  1FSW A;  4KZ3 A;  1YLY A;  1HTZ A;  2PU2 A;  3DW0 A;  1KE0 A;  1K54 A;  2HDU A;  1N9B A;  2EFU A;  1XA1 A;  1DY6 A;  1EWZ A;  3BLS A;  3ZCZ A;  3DWK A;  3QNB A;  4FH2 A;  1U60 A;  3UN7 A;  2R9X A;  2ZC7 A;  4E6X A;  5GLA A;  5FDH A;  2WYX A;  2Y91 A;  5FAO A;  5F82 A;  3AGF A;  1ESU A;  2ZQD A;  5EPH A;  3UE0 A;  3CZD A;  3HUN A;  2E8I A;  3HLB A;  5FQ9 A;  5M18 A;  3NDG A;  3S1Y A;  1VM1 A;  3BEB A;  2OLU A;  1ZG4 A;  4UHU A;  2XF3 A;  5E43 A;  4GDN A;  1KVL A;  1MKI A;  4PM5 A;  4XXR A;  2RL3 A;  4JPM A;  4KZ9 A;  2JBF A;  4ZJ2 A;  3Q07 A;  4OLD A;  2Q9N A;  1JWZ A;  1LL5 A;  2PU4 A;  2P9V B;  4HBT A;  3HLF A;  5J8X A;  1ZC2 A;  2QPN A;  1L2S A;  1L0D A;  5EVI B;  3RXW A;  3ZG7 B;  4DDS A;  1TVF A;  1BSG A;  3ZG8 B;  1ESI A;  1K54 C;  3PBR A;  4BL2 A;  3IH9 A;  2QMI A;  2ZC4 B;  2J9P A;  4PMA A;  5CHM A;  3FKV A;  1RGZ A;  1H8Z A;  1ES4 A;  1QMF A;  4KZA A;  3VSL A;  3PBO A;  4MBF A;  5FSR A;  1Y54 A;  1O07 A;  4OOM A;  3FYZ A;  4GDB A;  1IYP A;  1CI8 A;  1NYM A;  2C5W B;  4DF6 A;  1YT4 A;  3S22 A;  1DJB A;  5HAR A;  4B4X A;  3SS5 A;  1TEM A;  3Q1F A;  5FI2 A;  4LV3 A;  2XFT A;  1J9M A;  5GHX A;  2P9V A;  4B4Z A;  2WKI A;  4R4S A;  5KSH A;  5G18 A;  5EVI A;  4ZJ3 A;  1AXB A;  3WWX A;  4X69 A;  2WK0 A;  3BYD A;  1ES2 A;  4Y0O A;  1K55 C;  3GTC A;  3IXG A;  4WMC A;  4BL3 A;  5CGX A;  1NYY A;  5A91 A;  1WE4 A;  2Y2L A;  3Q7V A;  4JF4 A;  2DNS A;  2J8Y A;  4K0X A;  2HP9 A;  4FCF A;  1HD8 A;  5GLD A;  4P0M A;  5EOE A;  1E4D A;  5F1G A;  5CED A;  2X01 A;  1TDL A;  2JCH A;  4P87 A;  3VP1 A;  1JWV A;  3HL9 A;  1W5D A;  1OME A;  3BFC A;  4S2N A;  3PBQ A;  3CMZ A;  1M6K A;  2CC1 A;  1EI5 A;  4NET A;  3V3S A;  1JTG A;  3PBN A;  5EVL A;  4KZ7 A;  3UDX A;  2FFY A;  1BLP A;  3M6B A;  1WYC A;  4E3J A;  2HDS A;  3C5A A;  2P74 A;  4KZ4 A;  5AQB A;  3TOI A;  4N92 A;  4OOL A;  5HX9 A;  1N4O A;  4DRT A;  4ZJ1 A;  3IWO A;  4JXS A;  1HZO A;  5HAP A;  2EX6 A;  3OPL A;  4GOG A;  4OH0 A;  3VFF A;  3PTE A;  3ZG9 B;  2DCF A;  1I2W A;  2Y2J A;  5CEC A;  1E3U A;  3N8R A;  4PPR A;  1JVJ A;  4EBL A;  5FQQ A;  3UNW A;  4PM9 A;  4YFM A;  2XR0 A;  3V3R A;  2WUQ A;  5CGS A;  3W4O A;  2G2U A;  3IHA A;  1ALQ A;  2Q9M A;  4M3K A;  5CHJ A;  2XLN A;  3BLM A;  3WS0 A;  4B88 A;  4Z9Q A;  5GL9 A;  3BFG A;  5E2G A;  4OPZ A;  3G4P A;  3PBT A;  3ISG A;  1FR6 A;  4QB8 A;  3AGE A;  2ZC5 B;  1K4F A;  2OSU A;  3BM6 A;  5CHU A;  3W4P A;  5FQK A;  1L0F A;  3N8S A;  3WRZ A;  2XK1 A;  1PI5 A;  3SH9 A;  3ITB A;  4N1H A;  4EQI A;  5F1F A;  4H8R A;  4KQR A;  1KE4 A;  5AQA A;  1RP5 A;  3MFD A;  3MZE A;  2X71 A;  4BQM A;  5HAI A;  2ZC3 B;  3OPH A;  4LV2 A;  1XA7 A;  4R3J A;  4ZDX A;  1PWG A;  5L2F A;  1YM1 A;  2ZM2 A;  5HW3 A;  3GVB A;  1JTD A;  3TSG A;  3UDF A;  4C3Q A;  4JF5 A;  4LCM A;  4Q8I A;  2BG1 A;  4QJG A;  3G2Y A;  1L0G A;  3MBZ A;  3UO9 A;  3HLW A;  1MPL A;  2XQZ A;  3N8L A;  4HEF A;  4MNR A;  2BLS A;  5DVA A;  4X53 A;  3M6H A;  1CI9 A;  3N4I A;  4IVI A;  4EBP A;  5FAS A;  3LY3 A;  3NY4 A;  4OKP A;  4WYY A;  3NDE A;  5FI7 A;  1XGJ A;  3O88 A;  3OPR A;  4L0L A;  5FAT A;  4RX3 A;  1HVB A;  2H0T A;  2XH9 A;  4UA9 A;  5E2E A;  4E3K A;  2IWB A;  2Y2O A;  4NK3 A;  4QHC A;  4S2O A;  3UDI A;  2Y4A A;  5EUA A;  1NY0 A;  4KG2 A;  1K55 A;  5CXW A;  1GHI A;  1PW1 A;  3BFF A;  1YLW A;  4EV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...