1KE4A

X-ray crystal structure of ampc beta-lactamase from e. coli
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structure-based approach for binding site identification on AmpC beta-lactamase.
pubmed doi rcsb
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ke4A00
3TSGA 1ESIA 5EE8A 2OSUA 2Y2NA 2ZC6B 3HLCA 4QHCA 1PZOA 4X56A 4JBFA 3OCLA 1K57A 4ZTKA 1L0GA 3SS3A 4R0QA 1RGZA 3NDGA 4P85A 1MWTA 3SS5A 1EROA 4S2IA 4WEKA 3OPLA 4PM9A 3C4OA 1E4DA 4GD8A 1BT5A 2J7VA 2ZLYA 2XFTA 2ZMAA 3FKWA 1KE0A 4PM7A 2EX8A 4XUXA 4R3JA 4PM8A 5CGWA 5HAIA 3VOYA 2XGNA 3W8KA 4IEDA 5FQJA 1KVLA 3P98A 2Y2QA 3CG5A 3V3RA 2Z2MB 4O7DA 1ERMA 2X02A 1G6AA 3HUNA 5HW3A 1ES3A 4UHUA 4A5RA 2I72A 3BFCA 4KG6A 3GVBA 3TG9A 2WGVA 3N8LA 4E3OA 2RL3A 1S0WA 2EXBA 4RA7A 2IWDA 3SOIA 3VSKA 1GHIA 3GR2A 1FOFA 4HEFA 2Y2JA 3FKVA 3UPOA 5EPHA 4KZBA 3IHAA 3PBRA 4KZ4A 4Q8IA 3Q7ZA 1TDGA 1WE4A 4ID4A 5EVIA 4X69A 3MZFA 4DF6A 2EX2A 4XUZA 5CHJA 2XD5A 1E3UA 3HLBA 3ZDJA 3GRJA 4Y7PA 1ZC2A 3WS1A 1IYQA 1K56D 2P9VB 5HFOA 1MWRA 3BFDA 3IH8A 2XR0A 4IBXA 5FQQA 3UDIA 5A91A 1LL5A 5KSCA 4F94A 4EUZA 2XLNA 3CMZA 3UPNA 5IHVA 1JWZA 5GLAA 4E3LA 2V2FF 4HESA 2WGIA 3BECA 1W8QA 3IXDA 3NBLA 1L0FA 1CEGA 2HP6A 3Q81A 3LO7A 5D3OA 5EOEA 3ZG5A 4R23A 4U3TA 3HLDA 4PM5A 3G2ZA 1HVBA 3OCNA 3PAEA 2RCXA 3EQVA 3GV9A 4FH4A 4QU3A 1DY6A 1FSYA 3HBRA 3RXWA 3Q1FA 5FAOA 5FI7A 4ZDXA 3G31A 5EVIB 3SS4A 2Y2KA 1BLHA 5CTMA 1K6RA 4WM9A 1I2SA 5CHMA 3HUOA 4EQIA 3ISGA 4MLLA 1YLTA 1RP5A 3A3JA 4GB7A 4KQRA 3PBQA 4Y0TA 1FQGA 5F1FA 4LCMA 1PW8A 3UO9A 1EWZA 3SH8A 2ZM0A 3BFFA 4D2OA 4KZ7A 3AGEA 2Z2LB 5M1AA 1FR6A 1FSWA 1KVMA 4CJNA 3OPHA 2ZQ8A 3BFEA 5A92A 1LL9A 4K0WA 4GN2A 4FSFA 4YINA 5AQ9A 3Q82A 1O07A 4KG5A 2Y2LA 5DVAA 2WKEA 1SCWA 5A90A 5M18A 4BL3A 2Y91A 1PI5A 3W4PA 2ZD8A 4JXSA 3FYZA 4QD4A 2HP5A 2XFSA 3IF6A 1NZOA 5DF9A 2HDRA 3VP2A 2Q9MA 2Y2HA 4OONA 1MY8A 3LEZA 1K54C 3M6HA 5CGSA 4ZAMA 1IYSA 4C3QA 5EOOA 5TGFA 2JE5A 3GTCA 1PYYA 3OZHA 3AGFA 3WRZA 2DRWA 4JF4A 1MXOA 2DCFA 4LENA 4E3MA 1DJAA 1W5DA 2BLSA 2E8IA 2PBYA 4KZ9A 2EX9A 3IQAA 3HVFA 3N7WA 1ES2A 4EBNA 5J8XA 1JWPA 4GZBA 2HPBA 1K55A 4JPMA 3QNCA 2H5SA 4R4SA 3UN7A 3HL9A 3NIAA 3VP1A 2H0YA 1WYCA 3QNBA 1XGJA 2WGWB 3MXSA 3MFDA 4N92A 1ESUA 3SH9A 3WS5A 4QY5A 3VMAA 3TOIA 4QB8A 2A3UA 5F83A 1LLBA 2ZM8A 4WMCD 4HBUA 3WS2A 4IVIA 3NY4A 4RX2A 2J9OA 5I94A 1SDEA 1BTLA 2H10A 4GOGA 4GNUA 4HBTA 3VSLA 3Q7VA 2Q9NA 1ONGA 1G68A 4GDBA 4R1GA 4UA7A 4DE3A 5FDHA 1DJCA 1CEFA 1SKFA 4FCFA 3ZG7B 2IWBA 4X55A 1K6SA 5EVIC 3G2YA 2PU2A 2G2UA 2WAEA 5EUAA 1JTDA 1YM1A 3BLMA 3S1YA 4KZ3A 4B88A 4LV1A 2EX6A 3LY3A 3V39A 1DJBA 1N9BA 4WBGA 2R9WA 4DDSA 4N9LA 1MPLA 2ZQDA 1K54A 3IF6C 1E3UD 2JCHA 1H8YA 2WYXA 2FFYA 4WYYA 3QHYA 4E3NA 4KG2A 1IYOA 2R9XA 3GSGA 4LCLA 1BUEA 2J9PA 3V3SA 3PBTA 4KZ5A 3IXHA 1PW1A 5L2FA 1H5XA 5FSRA 5BOHA 3IF5A 5KSHA 2ZC5B 3FV7A 2ZQCA 2WZZA 3UE3A 4ZBEA 1WYBA 3HREA 2EXAA 5DTSA 4DXBA 3WWXA 1VQQA 3HLFA 1YMXA 1PI4A 3N8SA 3ZG9B 3DWZA 4DXCA 4QJGA 4KQOA 4GKUA 4X68A 1ES5A 2QPNA 3ITBA 5CHUA 2XF3A 4OLDA 4P0MA 3ZCZA 5E2FA 3Q7VB 3G35A 3MZEA 1YQSA 3WS4A 1YMSA 2Y2MA 4BLMA 1FCNA 1I5QA 1XGIA 1XX2A 1O7EA 3IF6B 3S22A 1RCJA 4GD6A 4OPYA 2X01A 4JF5A 2ZC3B 1GA9A 1IYPA 3VOZA 3NC8A 2WGWA 4WZ5C 2XK1A 3IHBA 3UNWA 5EVID 5CEDA 3E2LA 2HDUA 4EWFA 3LCEA 1KGEA 3ZG0A 4KQQA 2WUQA 1IELA 3G30A 2EFUA 3MZDA 1SDNA 4WZ4A 1RGYA 4IBRA 3GMWA 3UE0A 2GDNA 1IEMA 3OPPA 4PM6A 3A3EA 4FD8A 1OMEA 2QZ6A 3ZHHA 5HAPA 2Y2PA 1LHYA 1Q2PA 4OP5A 1PWCA 3A3IA 3IH9A 5FI6A 1K25A 4MEZA 1AXBA 3ZVWA 4OKPA 5JYPA 4WEJA 4OQHA 2C5WB 3CZDA 5DTTA 2ZQ7A 4WMCA 3MXRA 1GHMA 2ZM2A 5E2HA 1HTZA 3V5MA 3E2KA 4OPRA 5FI2A 5M19A 5FQ9A 4P87A 4YFMA 3RXXA 3NCKA 1L2SA 3MKFA 4U0XA 3ZG8B 4JKTA 3W4QA 4ZJ3A 1XA1A 1S6RA 1NZUA 4OOYA 4LV2A 1VM1A 3HLGA 4KZ8A 4OPQA 5HAQA 2CC1A 5G18A 1K56A 1KDSA 1PIOA 4NK3A 2WKIA 3M2JA 4JXWA 5GHZA 1IKGA 3W4OA 3AGDA 1I2WA 3O86A 4OOMA 3ZFZA 3D4FA 2J8YA 5CRFA 3PBOA 2V1ZA 2HP9A 3UPPA 4S2OA 4B4XA 2P74A 2WKHA 1NYMA 3VFHA 1JWVA 4M3KA 1TEMA 4ZJ2A 4S2KA 2DNSA 3O3VA 2ZJ9A 1JVJA 4DKIA 3CJMA 4OQ0A 3LY4A 4MBFA 4FH2A 4JF6A 1M40A 1H8ZA 2X71A 4LV0A 4OVDA 4EBPA 3DTMA 2PU4A 4ZJ1A 3VP3A 3SH7A 4OOLA 5TR7A 1NJ4A 2VGJA 3C5AA 4OQIA 1K4EA 4P6BA 4U0TA 4EBLA 4PPRA 1XXMA 4OLGA 4K0XA 4S2NA 2WADA 2G2WA 1XP4A 3FWLA 3MBZA 4KZ6A 2C6WB 1YLJA 5AQAA 2B5RA 5AQBA 5CEBA 1FCOA 3N4IA 5CERA 2Y2IA 4XXRA 5CXWA 4LV3A 4RYEA 4RVAA 1ONHA 5GHXA 4MBHA 3G34A 3IXBA 3Q07A 3BLSA 3A3FA 4Y0OA 3VP4A 2Y2OA 3ZNTA 3DWKA 1NY0A 2HDQA 3VFFA 4Y0UA 1L0DA 2IWCA 4S2LA 1XPBA 4WZ5A 5KMWA 1EI5A 1KGGA 2ZC4B 1BLCA 3RJUA 3O88A 2OV5A 4JXGA 1PWDA 1QMEA 2WZXA 1HD8A 2ZC7A 4CPKA 1BLSA 1KDWA 3FZCA 1LI9A 5HARA 1KE3A 3UY6A 4DE1A 5GLDA 5CGXA 1Y54A 4DRTA 4NETA 5CECA 4DE0A 1K57C 4N1HA 1YT4A 3PAGA 4OH0A 4BENA 3PTEA 4C6YA 1L0EA 3VP0A 1K38A 2Y59A 1ZG4A 1BULA 2V20A 4UA9A 1GHPA 1NYYA 1Q2QA 1MWSA 5FQIA 1MBLA 4BD0A 4RX3A 1ZG6A 1K55C 3PBSA 3BEBA 4DE2A 1NRFA 1QMFA 2FFFB 4S2JA 4E3IA 3P09A 3IXGA 2HDSA 3ZGAB 3IWOA 4L0LA 5DF8A 4JLFA 4PMAA 4S2NC 1JTGA 1YLWA 2WK0A 2Y55A 4OPZA 5EVLA 5F1GA 3UE1A 3NDEA 4OQGA 2XEPA 5FATA 2WAFA 4X6TA 3S4XA 1KGFA 1Z6FA 1W79A 3WS0A 3IWIA 4BQMA 1W8YA 1FCMA 3A3DA 3BYDA 3C4PA 3HLEA 5GHYA 1U60A 4WELA 1IKIA 5FASA 3V50A 3C7VA 2XH9A 5AQ7A 5CTNA 1HZOA 4S2PA 5JYOA 2VGKA 4DDYA 1PZPA 4MBKA 3ZVTA 3BM6A 4E3JA 1XA7A 5E2GA 2Y4AA 2OLUA 5GLCA 1K4FA 2ZQAA 2XQZA 5E43A 5F82A 5FAQA 3M2KA 4BL2A 1C3BA 3DW0A 3IT9A 2OLVA 4IVKA 5HX9A 5A93A 1GA0A 1YLZA 3UDXA 4C75A 1CI9A 1YLPA 3N6IA 3B3XA 4E6XA 3ITAA 4R3BA 4Z9QA 2A49A 3I7JA 1NXYA 3BFGA 3HUMA 3ZNYA 4B4ZA 4BD1A 4BJPA 1ERQA 2QMIA 5DTKA 4E3KA 3GQZA 3NI9A 5TFQA 3OC2A 2H0TA 4UAAA 3EQUA 2P9VA 3G4PA 4E6WA 3N8RA 1MKIA 3M6BA 1FR1A 1J9MA 1PWGA 5GLBA 1ALQA 4N1XA 4QY6A 4S2MA 5FAPA 5HL1A 1SHVA 2XD1A 1YLYA 5U47A 3IWQA 1BZAA 1TVFA 2UWXA 5DF7A 1MWUA 1ZKJA 1GCEA 1TDLA 3BRMA 3HLWA 5FA7A 5KZHA 1M6KA 1ES4A 5EECA 1XKZA 5E2EA 2XDMA 2Y2GA 3PBNA 4GDNA 5FQKA 1CI8A 2JBFA 4X53A 1BLPA 2BG1A 2EFXA 3C7UA 4MNRA 4OP8A 4K91A 1N4OA 3G32A 1BSGA 3MKEA 4H8RA 4N9KA 4EV4A 3WRTA 3O87A 3OPRA 2ZQ9A 3JYIA 1E25A 1KE4A 5GL9A 1W7FA 4KENB 1LI0A 4UA6A 3UDFA 2JC7A 5FQMA 4KZAA 4R4RA 4JXVA 1CK3A
chains in the Genus database with same CATH superfamily
3LGOA 2Y2NA 3HLCA 4QHCA 1L0GA 4JBFA 5L8MA 3B33A 3PR6A 4R0QA 3U4LP 2BASA 4ARZA 4GD8A 3FC7A 5F69A 3FKWA 2XFTA 2ZMAA 1F9IA 2EX8A 4H6JA 4GJ4A 3W8KA 3GECA 3EEHA 3CG5A 1ERMA 4A5RA 2I72A 3BFCA 4KG6A 4NXFA 2WGVA 3UMDA 2KX6A 2IWDA 1GHIA 3JVUA 2DMWA 3GR2A 4QWOA 2Y2JA 3FKVA 3PBRA 4Q8IA 1WE4A 4X69A 3MZFA 4DF6A 5CHJA 4BBVA 3ZDJA 4PKYG 1S4SA 2UV0E 2WKQA 3IH8A 4HY8A 3UDIA 1LL5A 4EUZA 3VV4A 5DFXA 1JWZA 3E4QA 5GLAA 2WGIA 1F2KA 2GJ3A 3Q81A 5D3OA 2PD8A 1OTDA 4U3TA 4PM5A 5TJJA 2OAQ1 2L0WA 3PAEA 2RCXA 3GV9A 1DY6A 3HBRA 3Q1FA 3LR5A 1NRJA 5EVIB 3SS4A 4RQ9A 4EQIA 3ISGA 4MLLA 4GB7A 2M7VA 5F1FA 3KYEA 3VE3A 2ZM0A 3BFFA 4KZ7A 2Z2LB 1S67L 5A92A 4X25A 4GN2A 3NOUC 3Q82A 4KG5A 3W4PA 3R4KA 4EERA 5DF9A 3IF6A 1NZOA 2HDRA 3LEZA 1K54C 4ZAMA 5CGSA 1EW0A 4O0PA 5EOOA 4DMZA 3GTCA 3CUEC 3OZHA 2DRWA 3TJZC 2DCFA 4E3MA 4UQIS 2EX9A 3HVFA 5HDCA 1ES2A 2HPBA 4G3VA 4JPMA 3QNBA 1XGJA 3MFDA 3SH9A 1LLBA 4IVIA 5F5YA 2H10A 4GNUA 3Q7VA 2Q9NA 1ONGA 3IS2B 1SKFA 3UMEA 4X55A 5EVIC 2PU2A 3T1QB 3KSHA 1JTDA 3BLMA 3FPVA 1DJBA 4N9LA 3IF6C 4R70A 4HQAA 2JCHA 2WYXA 4E3NA 2FFYA 3QHYA 4KG2A 3GSGA 2Q0OA 1GSWA 2J9PA 1PW1A 3S7OA 5BOHA 5KSHA 2ZC5B 2ZQCA 3UE3A 1WYBA 4I3AA 3CHWP 3ZG9B 1X0OA 3KSIA 4DXCA 3C30A 4GKUA 3ITBA 5J4EA 3T12B 5AVFA 1OTBA 1D7EA 2PT7A 4BLMA 1G5UA 4D60A 3IF6B 1O7EA 3S7NA 4JF5A 1GA9A 2WGWA 5CEDA 3W2ZA 4HJ6A 2O9BA 4NXGA 3MZDA 4WZ4A 1RGYA 3UE0A 2JKRI 1IEMA 2GDNA 1OJGA 3ZHHA 2JKRM 3B42A 4EUVA 4OP5A 3EWKA 5FI6A 1H8MA 1K25A 3C38A 2P7JA 4OKPA 5JYPA 5DTTA 2ZM2A 5FI2A 5FQ9A 1OT6A 4Y3IA 1L2SA 4U0XA 3T4JA 2A2LA 4OPQA 5G18A 1KDSA 2Y79A 3ULFA 3KSGA 3LUQA 4OOMA 3ZFZA 3PBOA 4S2OA 5FL3A 3D9YA 1JWVA 2JKFA 4ZJ2A 2ZJ9A 1JVJA 4OQ0A 4JF6A 3U2AA 2X71A 4CLCB 3DTMA 4R6LA 3VP3A 2J3TC 5TR7A 1NJ4A 4PPRA 1XXMA 4K0XA 4S2NA 3LI8A 1CF0A 1YLJA 3KO6A 2B5RA 1MZUA 2Y2IA 4XXRA 4RVAA 3IXBA 3Q07A 3VP4A 2LB9A 3ZNTA 3KSFA 4XT2A 3T1RA 3V67A 3CITA 4WZ5A 1EI5A 3RJUA 1BLCA 1VB6A 2ZC7A 4CPKA 1KDWA 1KE3A 3F1NA 5LBRA 1Y54A 1K57C 3E4OA 1YT4A 2OWJA 3CI6A 4OH0A 3PTEA 1K38A 1ZG4A 4UA9A 1MWSA 1FILA 2W1RA 4BD0A 1K55C 4DE2A 1QMFA 4P6ZS 4E3IA 3P09A 1OTAA 3JPUA 5DF8A 3T4QA 4JLFA 2Y55A 1TD5A 5F1GA 2D01A 3NDEA 4X6TA 1D1JA 1W79A 3LIEA 4BQMA 5IU1A 1FCMA 3BYDA 3HLEA 5IS1A 3NOTC 4MMNA 4MBKA 2O9AA 3BM6A 1UWNX 1XA7A 2V1AA 1OJ5A 5GLCA 2ZOIA 3M2KA 4IVKA 3LR0A 3UDXA 4EQ1A 3B3XA 2ZMVA 4Z9QA 2A49A 2PBDP 3F1NB 3ZNYA 4ETXA 4BD1A 4UAAA 5F68A 3N8RA 1PWGA 1ALQA 4N1XA 4QY6A 5HL1A 1SHVA 4XT2B 2XD1A 1YLYA 3IWQA 1BZAA 2UWXA 4HIAA 1ZKJA 5AVEA 3BRMA 3HCYA 1DP9A 2XROA 5EECA 1BLPA 1Z09A 1N4OA 3G32A 4N9KA 5IT5A 2ZQ9A 1CJFA 1G28A 3LI9A 4R4RA 3TSGA 1ESIA 5HDSA 2ZC6B 4X56A 3UB5P 5EM1A 4I38A 3BQAA 1RGZA 4WEKA 1LL8A 2VLGA 1E4DA 2PR6A 5HWVA 2J7VA 1KE0A 2XGNA 2J3WA 4IEDA 4PKYA 2Y2QA 4WLAA 3V3RA 1UGUA 2Z2MB 2XA7S 5HW3A 4UHUA 3TG9A 3B47A 2RL3A 1S0WA 2EXBA 2W3EA 3UPOA 1LSVA 3C2WA 4ID4A 5EVIA 3HJIA 4P6ZM 4XUZA 4Y7PA 3WS1A 2W1TA 1MWRA 3BY8A 3SZTA 5FQQA 3MR0A 5A91A 3BY9A 3PXPA 3CMZA 1YSPA 4HH3A 3BECA 1W8QA 1L0FA 3HLDA 3G2ZA 3K2NA 3OCNA 4ZRRA 1XFQA 5FAOA 2PHYA 4ZDXA 2Y2KA 5CTMA 1K6RA 4WM9A 4NKPA 4KQRA 3A3JA 4Y0TA 1FQGA 1PW8A 3UE6A 3UO9A 3SH8A 4GHIB 5J7EA 1FR6A 3QP1A 2ZQ8A 3BFEA 4K0WA 3GDIA 4YINA 5AQ9A 5DVAA 2WKEA 1SCWA 2XRNA 5A90A 4CQHA 2ZD8A 1MY8A 4HH2A 4C3QA 2JE5A 3BWLA 3WRZA 1DJAA 3QP2A 1W5DA 2BLSA 2E8IA 4IHQA 4KZ9A 4EBNA 1JWPA 1K55A 3QNCA 5FEGA 2H5SA 4R4SA 3MXQA 2WGWB 3MXSA 4HHDA 4QY5A 3H82A 5F83A 4HBUA 3E0YA 3NY4A 4RX2A 3HJKA 4UA7A 4GS9A 4HOIA 1IOUA 2G2UA 1FIKA 5EUAA 1YM1A 4B88A 4KZ3A 5DFYA 2GNXA 4LV1A 3LY3A 3V39A 1OPXA 2HZ5A 4WYYA 1IYOA 4LCLA 1H5XA 5FSRA 3IF5A 2WZZA 3NHQA 5DTSA 1T1BA 1XJ2A 1CQAA 3N8SA 4QJGA 1ODVA 4EETB 4X68A 1ES5A 3DTIA 2OAP1 3EOIA 2XF3A 4I39A 4O8GA 3Q7VB 2HJEA 3MZEA 1YQSA 3F1PA 2Y2MA 1I5QA 4X1LA 3P7NA 2PRFA 1RCJA 2ZC3B 1IYPA 1V9YA 3MQQA 3VOZA 4WZ5C 3T4SA 2W3FA 4F3LA 4EWFA 1KGEA 3ZG0A 2WUQA 1IELA 2EFUA 2V1BA 1SDNA 3BQ8A 4IBRA 3OPPA 3A3EA 2Y8HA 2QZ6A 5HAPA 2Y2PA 1LHYA 1Q2PA 1SZVA 2XA7M 5HDDA 4OQHA 3CZDA 2INWA 3LFVA 3MXRA 1GHMA 1N9LA 5E2HA 2R78A 3G6OA 4HJ4A 4YFMA 3NCKA 3MQ0A 4JKTA 2JN7A 3MF0A 1NZUA 4OOYA 4LV2A 3HLGA 2LB5A 4NK3A 3M2JA 3E4PA 5GHZA 4I5SA 1I2WA 5CRFA 2V1ZA 3IX3A 3UPPA 2P74A 3DAVA 4DKIA 3O3VA 3LY4A 1M40A 2Z6CA 4JGOA 3C5AA 4P6BA 2WADA 4JGRA 1XJ4A 1Y4OA 3MBZA 3BJNA 4KUOA 4LV3A 2L4RA 5L09A 1NY0A 4Y0UA 2IWCA 1XPBA 2OV5A 1JNUA 4DJ3A 1LI9A 3UY6A 5GLDA 2W27A 1P0ZA 4N1HA 1KOUA 4BENA 1L0EA 3VP0A 2Y59A 1Q2QA 2BTFP 5AJGA 4RX3A 3PYPA 2ZMFA 1NRFA 2V0UA 2YKFA 2VZWA 1S1YA 2XSSA 4PMAA 1JTGA 1YLWA 2V8CA 4OQGA 5FATA 3IWIA 1W8YA 2VA0A 3OBFA 2PD7A 2HJ9C 2XH9A 5CTNA 5JYOA 4IUKA 2Z6DA 2Y4AA 2OLUA 3T1SA 2XQZA 5E43A 1S4RA 1C3BA 2OLVA 5A93A 5HPIA 2PAVP 3N6IA 4E6XA 3T50A 3ITAA 4ME4A 3I7JA 1F98A 3BFGA 3HUMA 3EQUA 1MKIA 3M6BA 4LGWA 1VHMA 5EVEA 1DRMA 4S2MA 2H28A 2V0WA 3IBRA 5DF7A 4R38A 5EV0A 1GCEA 1TDLA 3HLWA 1M6KA 3EEAA 2JHEA 1XKZA 5E2EA 2Y2GA 3PBNA 4X53A 3K3CA 1W63M 4K91A 4BMWA 4EV4A 3WRTA 4JGQA 2J80A 3T4TA 1L3LA 1E25A 1KE4A 5HL6A 3UDFA 2JC7A 2HGVA 4JXVA 1CK3A 1S1ZA 5EE8A 1PZOA 5CX7A 4ZTKA 1K57A 3SS3A 3NDGA 1MWTA 1A0KA 1EROA 4S2IA 4WUJA 3SS5A 3OPLA 4KQDA 4PM9A 2EA9A 5C5KA 2ZLYA 4XUXA 3VOYA 5HAIA 1DP6A 5FQJA 1KVLA 2CMNA 2ZL1B 2A24B 5TBMB 3UB8A 1ES3A 4UEYA 3GVBA 3MJQA 3SOIA 4BBTA 4G3KA 4RA7A 3VSKA 5HWTA 1FOFA 4HEFA 4Y2FA 4KZBA 3IHAA 4KZ4A 3Q7ZA 4I3IA 2EX2A 1VETB 2ZOHA 1ZC2A 2P9VB 2W3HA 3BFDA 4IBXA 1TS8A 2OOLA 3CWFA 4YNRA 1VEUB 4EW7A 2XLNA 3CUEA 4E3LA 3IXDA 3NBLA 3T4LA 2HP6A 3H7WB 1MKMA 4IUHA 4FH4A 3RXWA 3LIDA 5FI7A 5FDSA 4CLCC 2ACGA 3T4KA 2M1CA 5F6AA 1I2SA 1RP5A 1T1CA 4LCMA 4AFIA 2VGLS 1KVMA 4CJNA 2KLIA 3OPHA 4GW9A 4FSFA 1O07A 2Y2LA 5M18A 4BL3A 5DKLA 2Y91A 1PI5A 5EM0A 4IJGA 2XFSA 4FOFA 1D06A 2EWWA 3VP2A 2Y2HA 1T19A 5EFWA 4L9FA 2B95A 2IA2A 1PYYA 2HF6A 2VEAA 4LENA 4LPZA 2PBYA 3N7WA 4Y15A 3UN7A 3VP1A 3HL9A 3NIAA 3A0VA 2H0YA 4N92A 3WS5A 3NOPC 1SKOA 3TOIA 4Y5FA 4WMCD 2J9OA 5I94A 4GOGA 3MQOA 3IX4A 2NUTC 3VSLA 4R1GA 2QJ7A 4DE3A 1ACFA 3EGXC 3LR4A 4H6JB 1TS7A 2IWBA 3ZG7B 3G2YA 3UB6A 1XFNA 1GSVA 4ARZB 2EX6A 3DTEA 4GS9B 1N9BA 2V8FA 4WBGA 2R9WA 4B93A 4DDSA 1MPLA 2ZQDA 4NXEA 1E3UD 2R9XA 1BUEA 5G4ZA 3V3SA 3PBTA 5DJTA 3IXHA 1LSWA 4ZBEA 3HREA 4YOFA 4DXBA 3HLFA 2QHKA 1YMXA 1PI4A 3DWZA 4ESPA 2VK3A 5CHUA 2ZBBA 4P0MA 1YKDA 3G35A 1XJ6A 3WS4A 1YMSA 1XGIA 2W1TB 2K7SA 4OPYA 4GD6A 1P97A 3MFXA 2FH5A 2XK1A 3UNWA 2HDUA 1TS6A 3LCEA 2G7UA 3G30A 3D72A 4GHIA 4FD8A 1OMEA 4I3JA 3DTKA 3A3IA 1PRQA 5DJUA 4MEZA 4EU0A 1AXBA 1UWPX 4WEJA 4HP9A 2C5WB 4WMCA 1HTZA 3V5MA 3MKFA 2QWSA 3ZG8B 3W4QA 2M7UA 1S6RA 4MN6A 1VM1A 4EEUA 5DKKA 5HAQA 1BYWA 2CC1A 2VJWA 4JXWA 3AGDA 3O86A 3TW8A 3D4FA 3MS6A 2B18A 1NYMA 3QP4A 2DNSA 5TBMA 2VX8A 2VGLM 2VV7A 5FEFA 4OVDA 1S66L 2PU4A 4OQIA 1K4EA 5L10A 4WF0A 4QPRA 1MC0A 1XP4A 3FPWA 3FWLA 2C6WB 4EESA 5AQAA 5AQBA 1FCOA 3N4IA 4WL9A 4DJ2A 5CERA 2PYPA 2QYBA 5CXWA 5I5LA 4Y0OA 3LIBA 3E98A 3DWKA 3ZYTA 2HDQA 1LSXA 3NECA 4S2LA 4Y17A 2EWVA 4JXGA 1PWDA 2L1MA 3RFBA 1BLSA 3FZCA 5HARA 4DE1A 3R7WA 4DE0A 3PAGA 1AWIA 1BULA 2V20A 1GHPA 1NYYA 2K31A 4LFUA 3PHYA 1MBLA 2E8JA 3QP6A 3IX8A 1YAXA 2FFFB 4S2JA 2HDSA 3IWOA 1WA9A 4S2NC 2WK0A 2VV8A 4MDZA 3S4XA 1KGFA 1Z6FA 3ICYA 4BWIA 5GHYA 1U60A 5AQ7A 4S2PA 2JKGA 2VGKA 4DDYA 4NG2A 3ZVTA 1F5MA 3A0RA 4LRYC 1K4FA 2ZQAA 4JGPA 5F82A 5FAQA 1H3QA 5HX9A 4EXOA 1GA0A 1TS0A 1YLZA 2PYRA 3CAXA 1NLZA 1CI9A 4R3BA 3F1OB 1NXYA 4B4ZA 4BJPA 2QMIA 5DTKA 3NI9A 5TFQA 3RTYA 3MMHA 2P9VA 1J9MA 3FG8A 2GZAA 5FAPA 5U47A 1TVFA 4K08A 1MWUA 1PFLA 5FA7A 3QP5A 4HJ3A 1J3WA 4HP4A 2XDMA 4GDNA 3CPTB 1CI8A 4M4XA 4MNRA 4OP8A 4GCZA 1BSGA 3O87A 3OPRA 3JYIA 5GL9A 1W7FA 5G4YA 1G6OA 1LI0A 5FQMA 3LEQA 3A0SA 5MC7A 2OSUA 3EGDC 1YSQA 3OCLA 3O5YA 4P85A 4YWZA 2GX5A 3C4OA 4HI4A 1BT5A 3KYZA 4PM7A 4MN5A 4R3JA 4PM8A 5CGWA 3P98A 4CLCA 4O7DA 2X02A 1T1AA 5HSQA 1G6AA 3HUNA 3N8LA 4E3OA 3JVVA 3ZQ5A 3KYQA 5EPHA 3CLOA 1TDGA 3T1XA 1NLYA 2JKTI 2XD5A 1E3UA 3HLBA 3GRJA 4LRXC 1IYQA 1K56D 5HFOA 2JKTM 2XR0A 5K5BA 2K2NA 5KSCA 4F94A 3UPNA 5IHVA 1V9ZA 2V2FF 4HESA 1T18A 1CEGA 5EOEA 2QJ5A 3LO7A 3ZG5A 1ZTUA 4R23A 1HVBA 2I9VA 3EQVA 4QU3A 4DN0A 1VETA 1FSYA 3LIFA 3G31A 1IFQA 1BLHA 5CHMA 3HUOA 1YLTA 3PBQA 1NWZA 3T4OA 1EWZA 4D2OA 3AGEA 2PR5A 5M1AA 3L7HA 1FSWA 1ZHHB 1OTEA 1LL9A 4CLCD 1W63Q 4F3LB 3IS2A 4JXSA 3FYZA 4QD4A 2HP5A 4NXBA 2Q9MA 4OONA 3M6HA 1IYSA 4BBUA 5TGFA 3R7WB 3AGFA 4JF4A 1MXOA 2W0NA 5HWWA 1H0MA 3IQAA 1GSXA 5J8XA 4GZBA 5A8BA 1WYCA 1P9WA 1ESUA 3UB7A 3NULA 3P01A 3VMAA 4QB8A 2A3UA 2ZM8A 3WS2A 1SKOB 1SDEA 1BTLA 4HBTA 2QKPA 3H82B 1G68A 4GDBA 4MN7A 5FDHA 1DJCA 1CEFA 4FCFA 2ZL1A 1K6SA 2WAEA 2OWHA 3S1YA 4Z1WA 3S7QA 3SW1A 1K54A 1H8YA 3LICA 3OLOA 1N9OA 4KZ5A 4L9EA 5L2FA 2W3DA 3FV7A 2EXAA 3WWXA 1VQQA 2WKPA 4LLOB 4KQOA 5HPFA 3CPTA 2QPNA 1PNEA 2P04A 4OLDA 1DP8A 3S7PA 3ZCZA 3UB9A 5E2FA 2FZ0A 1FCNA 4PAUA 1XX2A 3S22A 2X01A 1YPRA 3NC8A 2J3TD 3IHBA 5EVID 3E2LA 4WN5A 4KUKA 4KQQA 3GMWA 4FUWA 4PM6A 4Y13A 3F1OA 1VEUA 1OT9A 1PWCA 1OTIA 3IH9A 4O01A 2W3GA 4E04A 3ZVWA 5KIZA 2D02A 3QP8A 2ZQ7A 4B9OA 2HV1A 4EEPA 3E2KA 4OPRA 3VE4A 5M19A 4P87A 3RXXA 3LR3A 3F1PB 4ZJ3A 1XA1A 4KZ8A 2A24A 4II7A 2WKRA 1K56A 1PIOA 4Q0HA 2WKIA 2PDRA 5J3WA 1IKGA 3W4OA 2J8YA 3L9KA 2HP9A 2AVXA 1LT0A 1N9NA 4B4XA 2WKHA 3VFHA 3H7WA 2VV6A 1TEMA 4M3KA 4S2KA 3RH8B 3CJMA 4HNBA 2O99A 4MBFA 3K3DA 4FH2A 1H8ZA 2KOIA 4LV0A 4EBPA 5HZHA 4ZJ1A 3SH7A 4OOLA 2VGJA 4EBLA 4U0TA 3KX0X 4OLGA 3DBAA 2G2WA 4KZ6A 5CEBA 4Q0IA 1STZA 5GHXA 4RYEA 1ONHA 4MBHA 3G34A 3BLSA 3A3FA 2Y2OA 4X1MA 2B02A 3VFFA 1TF1A 1L0DA 2YKHA 5KMWA 1KGGA 2ZC4B 3O88A 3NJAA 2KDKA 2O9CA 1QMEA 2WZXA 1HD8A 5HD3A 4MCWA 5CGXA 4DRTA 1Y28A 4NETA 4G3WA 5CECA 4C6YA 2NUPC 4Q0JA 5HD5A 1XJ3A 3C8CA 5FQIA 1ZG6A 3PBSA 3BEBA 3BW6A 3IXGA 3ZGAB 4L0LA 3OOVA 4OPZA 5EVLA 3UE1A 2VKSA 2XEPA 2WAFA 3WS0A 3TRCA 4PHTA 4CLCE 3A3DA 3C4PA 4WELA 4ETZA 1IKIA 5FASA 3V50A 3C7VA 1HLUP 2O0YA 3LYXA 4UQIM 1HZOA 1PZPA 4NEED 4FTXA 4E3JA 5E2GA 3IBJA 3H9WA 4BL2A 3DW0A 3IT9A 4R3AA 1YLPA 2V9AA 4L9GA 3MSHA 4LRZE 1ERQA 4E3KA 3GQZA 3OC2A 2H0TA 3TE8A 4GLQA 3G4PA 4E6WA 1K0KA 1FR1A 5GLBA 3VOLA 3D3OA 3LIAA 5KZHA 1ES4A 2MJ6A 5FQKA 2JBFA 2BG1A 2EFXA 3C7UA 5L07A 2P08A 3MKEA 4H8RA 4KENB 1P9RA 4UA6A 4KZAA 4C75A
chains in the Genus database with same CATH topology
3TSGA 1ESIA 5EE8A 2OSUA 2Y2NA 2ZC6B 3HLCA 4QHCA 1PZOA 4X56A 4JBFA 3OCLA 1K57A 4ZTKA 1L0GA 3SS3A 4R0QA 1RGZA 3NDGA 4P85A 1MWTA 3SS5A 1EROA 4S2IA 4WEKA 3OPLA 4PM9A 3C4OA 1E4DA 4GD8A 1BT5A 2J7VA 2ZLYA 2XFTA 2ZMAA 3FKWA 1KE0A 4PM7A 2EX8A 4XUXA 4R3JA 4PM8A 5CGWA 5HAIA 3VOYA 2XGNA 3W8KA 4IEDA 5FQJA 1KVLA 3P98A 2Y2QA 3CG5A 3V3RA 2Z2MB 4O7DA 1ERMA 2X02A 1G6AA 3HUNA 5HW3A 1ES3A 4UHUA 4A5RA 2I72A 3BFCA 4KG6A 3GVBA 3TG9A 2WGVA 3N8LA 4E3OA 2RL3A 1S0WA 2EXBA 4RA7A 2IWDA 3SOIA 3VSKA 1GHIA 3GR2A 1FOFA 4HEFA 2Y2JA 3FKVA 3UPOA 5EPHA 4KZBA 3IHAA 3PBRA 4KZ4A 4Q8IA 3Q7ZA 1TDGA 1WE4A 4ID4A 5EVIA 4X69A 3MZFA 4DF6A 2EX2A 4XUZA 5CHJA 2XD5A 1E3UA 3HLBA 3ZDJA 3GRJA 4Y7PA 1ZC2A 3WS1A 1IYQA 1K56D 2P9VB 5HFOA 1MWRA 3BFDA 3IH8A 2XR0A 4IBXA 5FQQA 3UDIA 5A91A 1LL5A 5KSCA 4F94A 4EUZA 2XLNA 3CMZA 3UPNA 5IHVA 1JWZA 5GLAA 4E3LA 2V2FF 4HESA 2WGIA 3BECA 1W8QA 3IXDA 3NBLA 1L0FA 1CEGA 2HP6A 3Q81A 3LO7A 5D3OA 5EOEA 3ZG5A 4R23A 4U3TA 3HLDA 4PM5A 3G2ZA 1HVBA 3OCNA 3PAEA 2RCXA 3EQVA 3GV9A 4FH4A 4QU3A 1DY6A 1FSYA 3HBRA 3RXWA 3Q1FA 5FAOA 5FI7A 4ZDXA 3G31A 5EVIB 3SS4A 2Y2KA 1BLHA 5CTMA 1K6RA 4WM9A 1I2SA 5CHMA 3HUOA 4EQIA 3ISGA 4MLLA 1YLTA 1RP5A 3A3JA 4GB7A 4KQRA 3PBQA 4Y0TA 1FQGA 5F1FA 4LCMA 1PW8A 3UO9A 1EWZA 3SH8A 2ZM0A 3BFFA 4D2OA 4KZ7A 3AGEA 2Z2LB 5M1AA 1FR6A 1FSWA 1KVMA 4CJNA 3OPHA 2ZQ8A 3BFEA 5A92A 1LL9A 4K0WA 4GN2A 4FSFA 4YINA 5AQ9A 3Q82A 1O07A 4KG5A 2Y2LA 5DVAA 2WKEA 1SCWA 5A90A 5M18A 4BL3A 2Y91A 1PI5A 3W4PA 2ZD8A 4JXSA 3FYZA 4QD4A 2HP5A 2XFSA 3IF6A 1NZOA 5DF9A 2HDRA 3VP2A 2Q9MA 2Y2HA 4OONA 1MY8A 3LEZA 1K54C 3M6HA 5CGSA 4ZAMA 1IYSA 4C3QA 5EOOA 5TGFA 2JE5A 3GTCA 1PYYA 3OZHA 3AGFA 3WRZA 2DRWA 4JF4A 1MXOA 2DCFA 4LENA 4E3MA 1DJAA 1W5DA 2BLSA 2E8IA 2PBYA 4KZ9A 2EX9A 3IQAA 3HVFA 3N7WA 1ES2A 4EBNA 5J8XA 1JWPA 4GZBA 2HPBA 1K55A 4JPMA 3QNCA 2H5SA 4R4SA 3UN7A 3HL9A 3NIAA 3VP1A 2H0YA 1WYCA 3QNBA 1XGJA 2WGWB 3MXSA 3MFDA 4N92A 1ESUA 3SH9A 3WS5A 4QY5A 3VMAA 3TOIA 4QB8A 2A3UA 5F83A 1LLBA 2ZM8A 4WMCD 4HBUA 3WS2A 4IVIA 3NY4A 4RX2A 2J9OA 5I94A 1SDEA 1BTLA 2H10A 4GOGA 4GNUA 4HBTA 3VSLA 3Q7VA 2Q9NA 1ONGA 1G68A 4GDBA 4R1GA 4UA7A 4DE3A 5FDHA 1DJCA 1CEFA 1SKFA 4FCFA 3ZG7B 2IWBA 4X55A 1K6SA 5EVIC 3G2YA 2PU2A 2G2UA 2WAEA 5EUAA 1JTDA 1YM1A 3BLMA 3S1YA 4KZ3A 4B88A 4LV1A 2EX6A 3LY3A 3V39A 1DJBA 1N9BA 4WBGA 2R9WA 4DDSA 4N9LA 1MPLA 2ZQDA 1K54A 3IF6C 1E3UD 2JCHA 1H8YA 2WYXA 2FFYA 4WYYA 3QHYA 4E3NA 4KG2A 1IYOA 2R9XA 3GSGA 4LCLA 1BUEA 2J9PA 3V3SA 3PBTA 4KZ5A 3IXHA 1PW1A 5L2FA 1H5XA 5FSRA 5BOHA 3IF5A 5KSHA 2ZC5B 3FV7A 2ZQCA 2WZZA 3UE3A 4ZBEA 1WYBA 3HREA 2EXAA 5DTSA 4DXBA 3WWXA 1VQQA 3HLFA 1YMXA 1PI4A 3N8SA 3ZG9B 3DWZA 4DXCA 4QJGA 4KQOA 4GKUA 4X68A 1ES5A 2QPNA 3ITBA 5CHUA 2XF3A 4OLDA 4P0MA 3ZCZA 5E2FA 3Q7VB 3G35A 3MZEA 1YQSA 3WS4A 1YMSA 2Y2MA 4BLMA 1FCNA 1I5QA 1XGIA 1XX2A 1O7EA 3IF6B 3S22A 1RCJA 4GD6A 4OPYA 2X01A 4JF5A 2ZC3B 1GA9A 1IYPA 3VOZA 3NC8A 2WGWA 4WZ5C 2XK1A 3IHBA 3UNWA 5EVID 5CEDA 3E2LA 2HDUA 4EWFA 3LCEA 1KGEA 3ZG0A 4KQQA 2WUQA 1IELA 3G30A 2EFUA 3MZDA 1SDNA 4WZ4A 1RGYA 4IBRA 3GMWA 3UE0A 2GDNA 1IEMA 3OPPA 4PM6A 3A3EA 4FD8A 1OMEA 2QZ6A 3ZHHA 5HAPA 2Y2PA 1LHYA 1Q2PA 4OP5A 1PWCA 3A3IA 3IH9A 5FI6A 1K25A 4MEZA 1AXBA 3ZVWA 4OKPA 5JYPA 4WEJA 4OQHA 2C5WB 3CZDA 5DTTA 2ZQ7A 4WMCA 3MXRA 1GHMA 2ZM2A 5E2HA 1HTZA 3V5MA 3E2KA 4OPRA 5FI2A 5M19A 5FQ9A 4P87A 4YFMA 3RXXA 3NCKA 1L2SA 3MKFA 4U0XA 3ZG8B 4JKTA 3W4QA 4ZJ3A 1XA1A 1S6RA 1NZUA 4OOYA 4LV2A 1VM1A 3HLGA 4KZ8A 4OPQA 5HAQA 2CC1A 5G18A 1K56A 1KDSA 1PIOA 4NK3A 2WKIA 3M2JA 4JXWA 5GHZA 1IKGA 3W4OA 3AGDA 1I2WA 3O86A 4OOMA 3ZFZA 3D4FA 2J8YA 5CRFA 3PBOA 2V1ZA 2HP9A 3UPPA 4S2OA 4B4XA 2P74A 2WKHA 1NYMA 3VFHA 1JWVA 4M3KA 1TEMA 4ZJ2A 4S2KA 2DNSA 3O3VA 2ZJ9A 1JVJA 4DKIA 3CJMA 4OQ0A 3LY4A 4MBFA 4FH2A 4JF6A 1M40A 1H8ZA 2X71A 4LV0A 4OVDA 4EBPA 3DTMA 2PU4A 4ZJ1A 3VP3A 3SH7A 4OOLA 5TR7A 1NJ4A 2VGJA 3C5AA 4OQIA 1K4EA 4P6BA 4U0TA 4EBLA 4PPRA 1XXMA 4OLGA 4K0XA 4S2NA 2WADA 2G2WA 1XP4A 3FWLA 3MBZA 4KZ6A 2C6WB 1YLJA 5AQAA 2B5RA 5AQBA 5CEBA 1FCOA 3N4IA 5CERA 2Y2IA 4XXRA 5CXWA 4LV3A 4RYEA 4RVAA 1ONHA 5GHXA 4MBHA 3G34A 3IXBA 3Q07A 3BLSA 3A3FA 4Y0OA 3VP4A 2Y2OA 3ZNTA 3DWKA 1NY0A 2HDQA 3VFFA 4Y0UA 1L0DA 2IWCA 4S2LA 1XPBA 4WZ5A 5KMWA 1EI5A 1KGGA 2ZC4B 1BLCA 3RJUA 3O88A 2OV5A 4JXGA 1PWDA 1QMEA 2WZXA 1HD8A 2ZC7A 4CPKA 1BLSA 1KDWA 3FZCA 1LI9A 5HARA 1KE3A 3UY6A 4DE1A 5GLDA 5CGXA 1Y54A 4DRTA 4NETA 5CECA 4DE0A 1K57C 4N1HA 1YT4A 3PAGA 4OH0A 4BENA 3PTEA 4C6YA 1L0EA 3VP0A 1K38A 2Y59A 1ZG4A 1BULA 2V20A 4UA9A 1GHPA 1NYYA 1Q2QA 1MWSA 5FQIA 1MBLA 4BD0A 4RX3A 1ZG6A 1K55C 3PBSA 3BEBA 4DE2A 1NRFA 1QMFA 2FFFB 4S2JA 4E3IA 3P09A 3IXGA 2HDSA 3ZGAB 3IWOA 4L0LA 5DF8A 4JLFA 4PMAA 4S2NC 1JTGA 1YLWA 2WK0A 2Y55A 4OPZA 5EVLA 5F1GA 3UE1A 3NDEA 4OQGA 2XEPA 5FATA 2WAFA 4X6TA 3S4XA 1KGFA 1Z6FA 1W79A 3WS0A 3IWIA 4BQMA 1W8YA 1FCMA 3A3DA 3BYDA 3C4PA 3HLEA 5GHYA 1U60A 4WELA 1IKIA 5FASA 3V50A 3C7VA 2XH9A 5AQ7A 5CTNA 1HZOA 4S2PA 5JYOA 2VGKA 4DDYA 1PZPA 4MBKA 3ZVTA 3BM6A 4E3JA 1XA7A 5E2GA 2Y4AA 2OLUA 5GLCA 1K4FA 2ZQAA 2XQZA 5E43A 5F82A 5FAQA 3M2KA 4BL2A 1C3BA 3DW0A 3IT9A 2OLVA 4IVKA 5HX9A 5A93A 1GA0A 1YLZA 3UDXA 4C75A 1CI9A 1YLPA 3N6IA 3B3XA 4E6XA 3ITAA 4R3BA 4Z9QA 2A49A 3I7JA 1NXYA 3BFGA 3HUMA 3ZNYA 4B4ZA 4BD1A 4BJPA 1ERQA 2QMIA 5DTKA 4E3KA 3GQZA 3NI9A 5TFQA 3OC2A 2H0TA 4UAAA 3EQUA 2P9VA 3G4PA 4E6WA 3N8RA 1MKIA 3M6BA 1FR1A 1J9MA 1PWGA 5GLBA 1ALQA 4N1XA 4QY6A 4S2MA 5FAPA 5HL1A 1SHVA 2XD1A 1YLYA 5U47A 3IWQA 1BZAA 1TVFA 2UWXA 5DF7A 1MWUA 1ZKJA 1GCEA 1TDLA 3BRMA 3HLWA 5FA7A 5KZHA 1M6KA 1ES4A 5EECA 1XKZA 5E2EA 2XDMA 2Y2GA 3PBNA 4GDNA 5FQKA 1CI8A 2JBFA 4X53A 1BLPA 2BG1A 2EFXA 3C7UA 4MNRA 4OP8A 4K91A 1N4OA 3G32A 1BSGA 3MKEA 4H8RA 4N9KA 4EV4A 3WRTA 3O87A 3OPRA 2ZQ9A 3JYIA 1E25A 1KE4A 5GL9A 1W7FA 4KENB 1LI0A 4UA6A 3UDFA 2JC7A 5FQMA 4KZAA 4R4RA 4JXVA 1CK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSG A;  1ESI A;  5EE8 A;  2OSU A;  2Y2N A;  2ZC6 B;  3HLC A;  4QHC A;  1PZO A;  4X56 A;  4JBF A;  3OCL A;  1K57 A;  4ZTK A;  1L0G A;  3SS3 A;  4R0Q A;  1RGZ A;  3NDG A;  4P85 A;  1MWT A;  3SS5 A;  1ERO A;  4S2I A;  4WEK A;  3OPL A;  4PM9 A;  3C4O A;  1E4D A;  4GD8 A;  1BT5 A;  2J7V A;  2ZLY A;  2XFT A;  2ZMA A;  3FKW A;  1KE0 A;  4PM7 A;  2EX8 A;  4XUX A;  4R3J A;  4PM8 A;  5CGW A;  5HAI A;  3VOY A;  2XGN A;  3W8K A;  4IED A;  5FQJ A;  1KVL A;  3P98 A;  2Y2Q A;  3CG5 A;  3V3R A;  2Z2M B;  4O7D A;  1ERM A;  2X02 A;  1G6A A;  3HUN A;  5HW3 A;  1ES3 A;  4UHU A;  4A5R A;  2I72 A;  3BFC A;  4KG6 A;  3GVB A;  3TG9 A;  2WGV A;  3N8L A;  4E3O A;  2RL3 A;  1S0W A;  2EXB A;  4RA7 A;  2IWD A;  3SOI A;  3VSK A;  1GHI A;  3GR2 A;  1FOF A;  4HEF A;  2Y2J A;  3FKV A;  3UPO A;  5EPH A;  4KZB A;  3IHA A;  3PBR A;  4KZ4 A;  4Q8I A;  3Q7Z A;  1TDG A;  1WE4 A;  4ID4 A;  5EVI A;  4X69 A;  3MZF A;  4DF6 A;  2EX2 A;  4XUZ A;  5CHJ A;  2XD5 A;  1E3U A;  3HLB A;  3ZDJ A;  3GRJ A;  4Y7P A;  1ZC2 A;  3WS1 A;  1IYQ A;  1K56 D;  2P9V B;  5HFO A;  1MWR A;  3BFD A;  3IH8 A;  2XR0 A;  4IBX A;  5FQQ A;  3UDI A;  5A91 A;  1LL5 A;  5KSC A;  4F94 A;  4EUZ A;  2XLN A;  3CMZ A;  3UPN A;  5IHV A;  1JWZ A;  5GLA A;  4E3L A;  2V2F F;  4HES A;  2WGI A;  3BEC A;  1W8Q A;  3IXD A;  3NBL A;  1L0F A;  1CEG A;  2HP6 A;  3Q81 A;  3LO7 A;  5D3O A;  5EOE A;  3ZG5 A;  4R23 A;  4U3T A;  3HLD A;  4PM5 A;  3G2Z A;  1HVB A;  3OCN A;  3PAE A;  2RCX A;  3EQV A;  3GV9 A;  4FH4 A;  4QU3 A;  1DY6 A;  1FSY A;  3HBR A;  3RXW A;  3Q1F A;  5FAO A;  5FI7 A;  4ZDX A;  3G31 A;  5EVI B;  3SS4 A;  2Y2K A;  1BLH A;  5CTM A;  1K6R A;  4WM9 A;  1I2S A;  5CHM A;  3HUO A;  4EQI A;  3ISG A;  4MLL A;  1YLT A;  1RP5 A;  3A3J A;  4GB7 A;  4KQR A;  3PBQ A;  4Y0T A;  1FQG A;  5F1F A;  4LCM A;  1PW8 A;  3UO9 A;  1EWZ A;  3SH8 A;  2ZM0 A;  3BFF A;  4D2O A;  4KZ7 A;  3AGE A;  2Z2L B;  5M1A A;  1FR6 A;  1FSW A;  1KVM A;  4CJN A;  3OPH A;  2ZQ8 A;  3BFE A;  5A92 A;  1LL9 A;  4K0W A;  4GN2 A;  4FSF A;  4YIN A;  5AQ9 A;  3Q82 A;  1O07 A;  4KG5 A;  2Y2L A;  5DVA A;  2WKE A;  1SCW A;  5A90 A;  5M18 A;  4BL3 A;  2Y91 A;  1PI5 A;  3W4P A;  2ZD8 A;  4JXS A;  3FYZ A;  4QD4 A;  2HP5 A;  2XFS A;  3IF6 A;  1NZO A;  5DF9 A;  2HDR A;  3VP2 A;  2Q9M A;  2Y2H A;  4OON A;  1MY8 A;  3LEZ A;  1K54 C;  3M6H A;  5CGS A;  4ZAM A;  1IYS A;  4C3Q A;  5EOO A;  5TGF A;  2JE5 A;  3GTC A;  1PYY A;  3OZH A;  3AGF A;  3WRZ A;  2DRW A;  4JF4 A;  1MXO A;  2DCF A;  4LEN A;  4E3M A;  1DJA A;  1W5D A;  2BLS A;  2E8I A;  2PBY A;  4KZ9 A;  2EX9 A;  3IQA A;  3HVF A;  3N7W A;  1ES2 A;  4EBN A;  5J8X A;  1JWP A;  4GZB A;  2HPB A;  1K55 A;  4JPM A;  3QNC A;  2H5S A;  4R4S A;  3UN7 A;  3HL9 A;  3NIA A;  3VP1 A;  2H0Y A;  1WYC A;  3QNB A;  1XGJ A;  2WGW B;  3MXS A;  3MFD A;  4N92 A;  1ESU A;  3SH9 A;  3WS5 A;  4QY5 A;  3VMA A;  3TOI A;  4QB8 A;  2A3U A;  5F83 A;  1LLB A;  2ZM8 A;  4WMC D;  4HBU A;  3WS2 A;  4IVI A;  3NY4 A;  4RX2 A;  2J9O A;  5I94 A;  1SDE A;  1BTL A;  2H10 A;  4GOG A;  4GNU A;  4HBT A;  3VSL A;  3Q7V A;  2Q9N A;  1ONG A;  1G68 A;  4GDB A;  4R1G A;  4UA7 A;  4DE3 A;  5FDH A;  1DJC A;  1CEF A;  1SKF A;  4FCF A;  3ZG7 B;  2IWB A;  4X55 A;  1K6S A;  5EVI C;  3G2Y A;  2PU2 A;  2G2U A;  2WAE A;  5EUA A;  1JTD A;  1YM1 A;  3BLM A;  3S1Y A;  4KZ3 A;  4B88 A;  4LV1 A;  2EX6 A;  3LY3 A;  3V39 A;  1DJB A;  1N9B A;  4WBG A;  2R9W A;  4DDS A;  4N9L A;  1MPL A;  2ZQD A;  1K54 A;  3IF6 C;  1E3U D;  2JCH A;  1H8Y A;  2WYX A;  2FFY A;  4WYY A;  3QHY A;  4E3N A;  4KG2 A;  1IYO A;  2R9X A;  3GSG A;  4LCL A;  1BUE A;  2J9P A;  3V3S A;  3PBT A;  4KZ5 A;  3IXH A;  1PW1 A;  5L2F A;  1H5X A;  5FSR A;  5BOH A;  3IF5 A;  5KSH A;  2ZC5 B;  3FV7 A;  2ZQC A;  2WZZ A;  3UE3 A;  4ZBE A;  1WYB A;  3HRE A;  2EXA A;  5DTS A;  4DXB A;  3WWX A;  1VQQ A;  3HLF A;  1YMX A;  1PI4 A;  3N8S A;  3ZG9 B;  3DWZ A;  4DXC A;  4QJG A;  4KQO A;  4GKU A;  4X68 A;  1ES5 A;  2QPN A;  3ITB A;  5CHU A;  2XF3 A;  4OLD A;  4P0M A;  3ZCZ A;  5E2F A;  3Q7V B;  3G35 A;  3MZE A;  1YQS A;  3WS4 A;  1YMS A;  2Y2M A;  4BLM A;  1FCN A;  1I5Q A;  1XGI A;  1XX2 A;  1O7E A;  3IF6 B;  3S22 A;  1RCJ A;  4GD6 A;  4OPY A;  2X01 A;  4JF5 A;  2ZC3 B;  1GA9 A;  1IYP A;  3VOZ A;  3NC8 A;  2WGW A;  4WZ5 C;  2XK1 A;  3IHB A;  3UNW A;  5EVI D;  5CED A;  3E2L A;  2HDU A;  4EWF A;  3LCE A;  1KGE A;  3ZG0 A;  4KQQ A;  2WUQ A;  1IEL A;  3G30 A;  2EFU A;  3MZD A;  1SDN A;  4WZ4 A;  1RGY A;  4IBR A;  3GMW A;  3UE0 A;  2GDN A;  1IEM A;  3OPP A;  4PM6 A;  3A3E A;  4FD8 A;  1OME A;  2QZ6 A;  3ZHH A;  5HAP A;  2Y2P A;  1LHY A;  1Q2P A;  4OP5 A;  1PWC A;  3A3I A;  3IH9 A;  5FI6 A;  1K25 A;  4MEZ A;  1AXB A;  3ZVW A;  4OKP A;  5JYP A;  4WEJ A;  4OQH A;  2C5W B;  3CZD A;  5DTT A;  2ZQ7 A;  4WMC A;  3MXR A;  1GHM A;  2ZM2 A;  5E2H A;  1HTZ A;  3V5M A;  3E2K A;  4OPR A;  5FI2 A;  5M19 A;  5FQ9 A;  4P87 A;  4YFM A;  3RXX A;  3NCK A;  1L2S A;  3MKF A;  4U0X A;  3ZG8 B;  4JKT A;  3W4Q A;  4ZJ3 A;  1XA1 A;  1S6R A;  1NZU A;  4OOY A;  4LV2 A;  1VM1 A;  3HLG A;  4KZ8 A;  4OPQ A;  5HAQ A;  2CC1 A;  5G18 A;  1K56 A;  1KDS A;  1PIO A;  4NK3 A;  2WKI A;  3M2J A;  4JXW A;  5GHZ A;  1IKG A;  3W4O A;  3AGD A;  1I2W A;  3O86 A;  4OOM A;  3ZFZ A;  3D4F A;  2J8Y A;  5CRF A;  3PBO A;  2V1Z A;  2HP9 A;  3UPP A;  4S2O A;  4B4X A;  2P74 A;  2WKH A;  1NYM A;  3VFH A;  1JWV A;  4M3K A;  1TEM A;  4ZJ2 A;  4S2K A;  2DNS A;  3O3V A;  2ZJ9 A;  1JVJ A;  4DKI A;  3CJM A;  4OQ0 A;  3LY4 A;  4MBF A;  4FH2 A;  4JF6 A;  1M40 A;  1H8Z A;  2X71 A;  4LV0 A;  4OVD A;  4EBP A;  3DTM A;  2PU4 A;  4ZJ1 A;  3VP3 A;  3SH7 A;  4OOL A;  5TR7 A;  1NJ4 A;  2VGJ A;  3C5A A;  4OQI A;  1K4E A;  4P6B A;  4U0T A;  4EBL A;  4PPR A;  1XXM A;  4OLG A;  4K0X A;  4S2N A;  2WAD A;  2G2W A;  1XP4 A;  3FWL A;  3MBZ A;  4KZ6 A;  2C6W B;  1YLJ A;  5AQA A;  2B5R A;  5AQB A;  5CEB A;  1FCO A;  3N4I A;  5CER A;  2Y2I A;  4XXR A;  5CXW A;  4LV3 A;  4RYE A;  4RVA A;  1ONH A;  5GHX A;  4MBH A;  3G34 A;  3IXB A;  3Q07 A;  3BLS A;  3A3F A;  4Y0O A;  3VP4 A;  2Y2O A;  3ZNT A;  3DWK A;  1NY0 A;  2HDQ A;  3VFF A;  4Y0U A;  1L0D A;  2IWC A;  4S2L A;  1XPB A;  4WZ5 A;  5KMW A;  1EI5 A;  1KGG A;  2ZC4 B;  1BLC A;  3RJU A;  3O88 A;  2OV5 A;  4JXG A;  1PWD A;  1QME A;  2WZX A;  1HD8 A;  2ZC7 A;  4CPK A;  1BLS A;  1KDW A;  3FZC A;  1LI9 A;  5HAR A;  1KE3 A;  3UY6 A;  4DE1 A;  5GLD A;  5CGX A;  1Y54 A;  4DRT A;  4NET A;  5CEC A;  4DE0 A;  1K57 C;  4N1H A;  1YT4 A;  3PAG A;  4OH0 A;  4BEN A;  3PTE A;  4C6Y A;  1L0E A;  3VP0 A;  1K38 A;  2Y59 A;  1ZG4 A;  1BUL A;  2V20 A;  4UA9 A;  1GHP A;  1NYY A;  1Q2Q A;  1MWS A;  5FQI A;  1MBL A;  4BD0 A;  4RX3 A;  1ZG6 A;  1K55 C;  3PBS A;  3BEB A;  4DE2 A;  1NRF A;  1QMF A;  2FFF B;  4S2J A;  4E3I A;  3P09 A;  3IXG A;  2HDS A;  3ZGA B;  3IWO A;  4L0L A;  5DF8 A;  4JLF A;  4PMA A;  4S2N C;  1JTG A;  1YLW A;  2WK0 A;  2Y55 A;  4OPZ A;  5EVL A;  5F1G A;  3UE1 A;  3NDE A;  4OQG A;  2XEP A;  5FAT A;  2WAF A;  4X6T A;  3S4X A;  1KGF A;  1Z6F A;  1W79 A;  3WS0 A;  3IWI A;  4BQM A;  1W8Y A;  1FCM A;  3A3D A;  3BYD A;  3C4P A;  3HLE A;  5GHY A;  1U60 A;  4WEL A;  1IKI A;  5FAS A;  3V50 A;  3C7V A;  2XH9 A;  5AQ7 A;  5CTN A;  1HZO A;  4S2P A;  5JYO A;  2VGK A;  4DDY A;  1PZP A;  4MBK A;  3ZVT A;  3BM6 A;  4E3J A;  1XA7 A;  5E2G A;  2Y4A A;  2OLU A;  5GLC A;  1K4F A;  2ZQA A;  2XQZ A;  5E43 A;  5F82 A;  5FAQ A;  3M2K A;  4BL2 A;  1C3B A;  3DW0 A;  3IT9 A;  2OLV A;  4IVK A;  5HX9 A;  5A93 A;  1GA0 A;  1YLZ A;  3UDX A;  4C75 A;  1CI9 A;  1YLP A;  3N6I A;  3B3X A;  4E6X A;  3ITA A;  4R3B A;  4Z9Q A;  2A49 A;  3I7J A;  1NXY A;  3BFG A;  3HUM A;  3ZNY A;  4B4Z A;  4BD1 A;  4BJP A;  1ERQ A;  2QMI A;  5DTK A;  4E3K A;  3GQZ A;  3NI9 A;  5TFQ A;  3OC2 A;  2H0T A;  4UAA A;  3EQU A;  2P9V A;  3G4P A;  4E6W A;  3N8R A;  1MKI A;  3M6B A;  1FR1 A;  1J9M A;  1PWG A;  5GLB A;  1ALQ A;  4N1X A;  4QY6 A;  4S2M A;  5FAP A;  5HL1 A;  1SHV A;  2XD1 A;  1YLY A;  5U47 A;  3IWQ A;  1BZA A;  1TVF A;  2UWX A;  5DF7 A;  1MWU A;  1ZKJ A;  1GCE A;  1TDL A;  3BRM A;  3HLW A;  5FA7 A;  5KZH A;  1M6K A;  1ES4 A;  5EEC A;  1XKZ A;  5E2E A;  2XDM A;  2Y2G A;  3PBN A;  4GDN A;  5FQK A;  1CI8 A;  2JBF A;  4X53 A;  1BLP A;  2BG1 A;  2EFX A;  3C7U A;  4MNR A;  4OP8 A;  4K91 A;  1N4O A;  3G32 A;  1BSG A;  3MKE A;  4H8R A;  4N9K A;  4EV4 A;  3WRT A;  3O87 A;  3OPR A;  2ZQ9 A;  3JYI A;  1E25 A;  1KE4 A;  5GL9 A;  1W7F A;  4KEN B;  1LI0 A;  4UA6 A;  3UDF A;  2JC7 A;  5FQM A;  4KZA A;  4R4R A;  4JXV A;  1CK3 A; 
#chains in the Genus database with same CATH topology
 3LGO A;  2Y2N A;  3HLC A;  4QHC A;  1L0G A;  4JBF A;  5L8M A;  3B33 A;  3PR6 A;  4R0Q A;  3U4L P;  2BAS A;  4ARZ A;  4GD8 A;  3FC7 A;  5F69 A;  3FKW A;  2XFT A;  2ZMA A;  1F9I A;  2EX8 A;  4H6J A;  4GJ4 A;  3W8K A;  3GEC A;  3EEH A;  3CG5 A;  1ERM A;  4A5R A;  2I72 A;  3BFC A;  4KG6 A;  4NXF A;  2WGV A;  3UMD A;  2KX6 A;  2IWD A;  1GHI A;  3JVU A;  2DMW A;  3GR2 A;  4QWO A;  2Y2J A;  3FKV A;  3PBR A;  4Q8I A;  1WE4 A;  4X69 A;  3MZF A;  4DF6 A;  5CHJ A;  4BBV A;  3ZDJ A;  4PKY G;  1S4S A;  2UV0 E;  2WKQ A;  3IH8 A;  4HY8 A;  3UDI A;  1LL5 A;  4EUZ A;  3VV4 A;  5DFX A;  1JWZ A;  3E4Q A;  5GLA A;  2WGI A;  1F2K A;  2GJ3 A;  3Q81 A;  5D3O A;  2PD8 A;  1OTD A;  4U3T A;  4PM5 A;  5TJJ A;  2OAQ 1;  2L0W A;  3PAE A;  2RCX A;  3GV9 A;  1DY6 A;  3HBR A;  3Q1F A;  3LR5 A;  1NRJ A;  5EVI B;  3SS4 A;  4RQ9 A;  4EQI A;  3ISG A;  4MLL A;  4GB7 A;  2M7V A;  5F1F A;  3KYE A;  3VE3 A;  2ZM0 A;  3BFF A;  4KZ7 A;  2Z2L B;  1S67 L;  5A92 A;  4X25 A;  4GN2 A;  3NOU C;  3Q82 A;  4KG5 A;  3W4P A;  3R4K A;  4EER A;  5DF9 A;  3IF6 A;  1NZO A;  2HDR A;  3LEZ A;  1K54 C;  4ZAM A;  5CGS A;  1EW0 A;  4O0P A;  5EOO A;  4DMZ A;  3GTC A;  3CUE C;  3OZH A;  2DRW A;  3TJZ C;  2DCF A;  4E3M A;  4UQI S;  2EX9 A;  3HVF A;  5HDC A;  1ES2 A;  2HPB A;  4G3V A;  4JPM A;  3QNB A;  1XGJ A;  3MFD A;  3SH9 A;  1LLB A;  4IVI A;  5F5Y A;  2H10 A;  4GNU A;  3Q7V A;  2Q9N A;  1ONG A;  3IS2 B;  1SKF A;  3UME A;  4X55 A;  5EVI C;  2PU2 A;  3T1Q B;  3KSH A;  1JTD A;  3BLM A;  3FPV A;  1DJB A;  4N9L A;  3IF6 C;  4R70 A;  4HQA A;  2JCH A;  2WYX A;  4E3N A;  2FFY A;  3QHY A;  4KG2 A;  3GSG A;  2Q0O A;  1GSW A;  2J9P A;  1PW1 A;  3S7O A;  5BOH A;  5KSH A;  2ZC5 B;  2ZQC A;  3UE3 A;  1WYB A;  4I3A A;  3CHW P;  3ZG9 B;  1X0O A;  3KSI A;  4DXC A;  3C30 A;  4GKU A;  3ITB A;  5J4E A;  3T12 B;  5AVF A;  1OTB A;  1D7E A;  2PT7 A;  4BLM A;  1G5U A;  4D60 A;  3IF6 B;  1O7E A;  3S7N A;  4JF5 A;  1GA9 A;  2WGW A;  5CED A;  3W2Z A;  4HJ6 A;  2O9B A;  4NXG A;  3MZD A;  4WZ4 A;  1RGY A;  3UE0 A;  2JKR I;  1IEM A;  2GDN A;  1OJG A;  3ZHH A;  2JKR M;  3B42 A;  4EUV A;  4OP5 A;  3EWK A;  5FI6 A;  1H8M A;  1K25 A;  3C38 A;  2P7J A;  4OKP A;  5JYP A;  5DTT A;  2ZM2 A;  5FI2 A;  5FQ9 A;  1OT6 A;  4Y3I A;  1L2S A;  4U0X A;  3T4J A;  2A2L A;  4OPQ A;  5G18 A;  1KDS A;  2Y79 A;  3ULF A;  3KSG A;  3LUQ A;  4OOM A;  3ZFZ A;  3PBO A;  4S2O A;  5FL3 A;  3D9Y A;  1JWV A;  2JKF A;  4ZJ2 A;  2ZJ9 A;  1JVJ A;  4OQ0 A;  4JF6 A;  3U2A A;  2X71 A;  4CLC B;  3DTM A;  4R6L A;  3VP3 A;  2J3T C;  5TR7 A;  1NJ4 A;  4PPR A;  1XXM A;  4K0X A;  4S2N A;  3LI8 A;  1CF0 A;  1YLJ A;  3KO6 A;  2B5R A;  1MZU A;  2Y2I A;  4XXR A;  4RVA A;  3IXB A;  3Q07 A;  3VP4 A;  2LB9 A;  3ZNT A;  3KSF A;  4XT2 A;  3T1R A;  3V67 A;  3CIT A;  4WZ5 A;  1EI5 A;  3RJU A;  1BLC A;  1VB6 A;  2ZC7 A;  4CPK A;  1KDW A;  1KE3 A;  3F1N A;  5LBR A;  1Y54 A;  1K57 C;  3E4O A;  1YT4 A;  2OWJ A;  3CI6 A;  4OH0 A;  3PTE A;  1K38 A;  1ZG4 A;  4UA9 A;  1MWS A;  1FIL A;  2W1R A;  4BD0 A;  1K55 C;  4DE2 A;  1QMF A;  4P6Z S;  4E3I A;  3P09 A;  1OTA A;  3JPU A;  5DF8 A;  3T4Q A;  4JLF A;  2Y55 A;  1TD5 A;  5F1G A;  2D01 A;  3NDE A;  4X6T A;  1D1J A;  1W79 A;  3LIE A;  4BQM A;  5IU1 A;  1FCM A;  3BYD A;  3HLE A;  5IS1 A;  3NOT C;  4MMN A;  4MBK A;  2O9A A;  3BM6 A;  1UWN X;  1XA7 A;  2V1A A;  1OJ5 A;  5GLC A;  2ZOI A;  3M2K A;  4IVK A;  3LR0 A;  3UDX A;  4EQ1 A;  3B3X A;  2ZMV A;  4Z9Q A;  2A49 A;  2PBD P;  3F1N B;  3ZNY A;  4ETX A;  4BD1 A;  4UAA A;  5F68 A;  3N8R A;  1PWG A;  1ALQ A;  4N1X A;  4QY6 A;  5HL1 A;  1SHV A;  4XT2 B;  2XD1 A;  1YLY A;  3IWQ A;  1BZA A;  2UWX A;  4HIA A;  1ZKJ A;  5AVE A;  3BRM A;  3HCY A;  1DP9 A;  2XRO A;  5EEC A;  1BLP A;  1Z09 A;  1N4O A;  3G32 A;  4N9K A;  5IT5 A;  2ZQ9 A;  1CJF A;  1G28 A;  3LI9 A;  4R4R A;  3TSG A;  1ESI A;  5HDS A;  2ZC6 B;  4X56 A;  3UB5 P;  5EM1 A;  4I38 A;  3BQA A;  1RGZ A;  4WEK A;  1LL8 A;  2VLG A;  1E4D A;  2PR6 A;  5HWV A;  2J7V A;  1KE0 A;  2XGN A;  2J3W A;  4IED A;  4PKY A;  2Y2Q A;  4WLA A;  3V3R A;  1UGU A;  2Z2M B;  2XA7 S;  5HW3 A;  4UHU A;  3TG9 A;  3B47 A;  2RL3 A;  1S0W A;  2EXB A;  2W3E A;  3UPO A;  1LSV A;  3C2W A;  4ID4 A;  5EVI A;  3HJI A;  4P6Z M;  4XUZ A;  4Y7P A;  3WS1 A;  2W1T A;  1MWR A;  3BY8 A;  3SZT A;  5FQQ A;  3MR0 A;  5A91 A;  3BY9 A;  3PXP A;  3CMZ A;  1YSP A;  4HH3 A;  3BEC A;  1W8Q A;  1L0F A;  3HLD A;  3G2Z A;  3K2N A;  3OCN A;  4ZRR A;  1XFQ A;  5FAO A;  2PHY A;  4ZDX A;  2Y2K A;  5CTM A;  1K6R A;  4WM9 A;  4NKP A;  4KQR A;  3A3J A;  4Y0T A;  1FQG A;  1PW8 A;  3UE6 A;  3UO9 A;  3SH8 A;  4GHI B;  5J7E A;  1FR6 A;  3QP1 A;  2ZQ8 A;  3BFE A;  4K0W A;  3GDI A;  4YIN A;  5AQ9 A;  5DVA A;  2WKE A;  1SCW A;  2XRN A;  5A90 A;  4CQH A;  2ZD8 A;  1MY8 A;  4HH2 A;  4C3Q A;  2JE5 A;  3BWL A;  3WRZ A;  1DJA A;  3QP2 A;  1W5D A;  2BLS A;  2E8I A;  4IHQ A;  4KZ9 A;  4EBN A;  1JWP A;  1K55 A;  3QNC A;  5FEG A;  2H5S A;  4R4S A;  3MXQ A;  2WGW B;  3MXS A;  4HHD A;  4QY5 A;  3H82 A;  5F83 A;  4HBU A;  3E0Y A;  3NY4 A;  4RX2 A;  3HJK A;  4UA7 A;  4GS9 A;  4HOI A;  1IOU A;  2G2U A;  1FIK A;  5EUA A;  1YM1 A;  4B88 A;  4KZ3 A;  5DFY A;  2GNX A;  4LV1 A;  3LY3 A;  3V39 A;  1OPX A;  2HZ5 A;  4WYY A;  1IYO A;  4LCL A;  1H5X A;  5FSR A;  3IF5 A;  2WZZ A;  3NHQ A;  5DTS A;  1T1B A;  1XJ2 A;  1CQA A;  3N8S A;  4QJG A;  1ODV A;  4EET B;  4X68 A;  1ES5 A;  3DTI A;  2OAP 1;  3EOI A;  2XF3 A;  4I39 A;  4O8G A;  3Q7V B;  2HJE A;  3MZE A;  1YQS A;  3F1P A;  2Y2M A;  1I5Q A;  4X1L A;  3P7N A;  2PRF A;  1RCJ A;  2ZC3 B;  1IYP A;  1V9Y A;  3MQQ A;  3VOZ A;  4WZ5 C;  3T4S A;  2W3F A;  4F3L A;  4EWF A;  1KGE A;  3ZG0 A;  2WUQ A;  1IEL A;  2EFU A;  2V1B A;  1SDN A;  3BQ8 A;  4IBR A;  3OPP A;  3A3E A;  2Y8H A;  2QZ6 A;  5HAP A;  2Y2P A;  1LHY A;  1Q2P A;  1SZV A;  2XA7 M;  5HDD A;  4OQH A;  3CZD A;  2INW A;  3LFV A;  3MXR A;  1GHM A;  1N9L A;  5E2H A;  2R78 A;  3G6O A;  4HJ4 A;  4YFM A;  3NCK A;  3MQ0 A;  4JKT A;  2JN7 A;  3MF0 A;  1NZU A;  4OOY A;  4LV2 A;  3HLG A;  2LB5 A;  4NK3 A;  3M2J A;  3E4P A;  5GHZ A;  4I5S A;  1I2W A;  5CRF A;  2V1Z A;  3IX3 A;  3UPP A;  2P74 A;  3DAV A;  4DKI A;  3O3V A;  3LY4 A;  1M40 A;  2Z6C A;  4JGO A;  3C5A A;  4P6B A;  2WAD A;  4JGR A;  1XJ4 A;  1Y4O A;  3MBZ A;  3BJN A;  4KUO A;  4LV3 A;  2L4R A;  5L09 A;  1NY0 A;  4Y0U A;  2IWC A;  1XPB A;  2OV5 A;  1JNU A;  4DJ3 A;  1LI9 A;  3UY6 A;  5GLD A;  2W27 A;  1P0Z A;  4N1H A;  1KOU A;  4BEN A;  1L0E A;  3VP0 A;  2Y59 A;  1Q2Q A;  2BTF P;  5AJG A;  4RX3 A;  3PYP A;  2ZMF A;  1NRF A;  2V0U A;  2YKF A;  2VZW A;  1S1Y A;  2XSS A;  4PMA A;  1JTG A;  1YLW A;  2V8C A;  4OQG A;  5FAT A;  3IWI A;  1W8Y A;  2VA0 A;  3OBF A;  2PD7 A;  2HJ9 C;  2XH9 A;  5CTN A;  5JYO A;  4IUK A;  2Z6D A;  2Y4A A;  2OLU A;  3T1S A;  2XQZ A;  5E43 A;  1S4R A;  1C3B A;  2OLV A;  5A93 A;  5HPI A;  2PAV P;  3N6I A;  4E6X A;  3T50 A;  3ITA A;  4ME4 A;  3I7J A;  1F98 A;  3BFG A;  3HUM A;  3EQU A;  1MKI A;  3M6B A;  4LGW A;  1VHM A;  5EVE A;  1DRM A;  4S2M A;  2H28 A;  2V0W A;  3IBR A;  5DF7 A;  4R38 A;  5EV0 A;  1GCE A;  1TDL A;  3HLW A;  1M6K A;  3EEA A;  2JHE A;  1XKZ A;  5E2E A;  2Y2G A;  3PBN A;  4X53 A;  3K3C A;  1W63 M;  4K91 A;  4BMW A;  4EV4 A;  3WRT A;  4JGQ A;  2J80 A;  3T4T A;  1L3L A;  1E25 A;  1KE4 A;  5HL6 A;  3UDF A;  2JC7 A;  2HGV A;  4JXV A;  1CK3 A;  1S1Z A;  5EE8 A;  1PZO A;  5CX7 A;  4ZTK A;  1K57 A;  3SS3 A;  3NDG A;  1MWT A;  1A0K A;  1ERO A;  4S2I A;  4WUJ A;  3SS5 A;  3OPL A;  4KQD A;  4PM9 A;  2EA9 A;  5C5K A;  2ZLY A;  4XUX A;  3VOY A;  5HAI A;  1DP6 A;  5FQJ A;  1KVL A;  2CMN A;  2ZL1 B;  2A24 B;  5TBM B;  3UB8 A;  1ES3 A;  4UEY A;  3GVB A;  3MJQ A;  3SOI A;  4BBT A;  4G3K A;  4RA7 A;  3VSK A;  5HWT A;  1FOF A;  4HEF A;  4Y2F A;  4KZB A;  3IHA A;  4KZ4 A;  3Q7Z A;  4I3I A;  2EX2 A;  1VET B;  2ZOH A;  1ZC2 A;  2P9V B;  2W3H A;  3BFD A;  4IBX A;  1TS8 A;  2OOL A;  3CWF A;  4YNR A;  1VEU B;  4EW7 A;  2XLN A;  3CUE A;  4E3L A;  3IXD A;  3NBL A;  3T4L A;  2HP6 A;  3H7W B;  1MKM A;  4IUH A;  4FH4 A;  3RXW A;  3LID A;  5FI7 A;  5FDS A;  4CLC C;  2ACG A;  3T4K A;  2M1C A;  5F6A A;  1I2S A;  1RP5 A;  1T1C A;  4LCM A;  4AFI A;  2VGL S;  1KVM A;  4CJN A;  2KLI A;  3OPH A;  4GW9 A;  4FSF A;  1O07 A;  2Y2L A;  5M18 A;  4BL3 A;  5DKL A;  2Y91 A;  1PI5 A;  5EM0 A;  4IJG A;  2XFS A;  4FOF A;  1D06 A;  2EWW A;  3VP2 A;  2Y2H A;  1T19 A;  5EFW A;  4L9F A;  2B95 A;  2IA2 A;  1PYY A;  2HF6 A;  2VEA A;  4LEN A;  4LPZ A;  2PBY A;  3N7W A;  4Y15 A;  3UN7 A;  3VP1 A;  3HL9 A;  3NIA A;  3A0V A;  2H0Y A;  4N92 A;  3WS5 A;  3NOP C;  1SKO A;  3TOI A;  4Y5F A;  4WMC D;  2J9O A;  5I94 A;  4GOG A;  3MQO A;  3IX4 A;  2NUT C;  3VSL A;  4R1G A;  2QJ7 A;  4DE3 A;  1ACF A;  3EGX C;  3LR4 A;  4H6J B;  1TS7 A;  2IWB A;  3ZG7 B;  3G2Y A;  3UB6 A;  1XFN A;  1GSV A;  4ARZ B;  2EX6 A;  3DTE A;  4GS9 B;  1N9B A;  2V8F A;  4WBG A;  2R9W A;  4B93 A;  4DDS A;  1MPL A;  2ZQD A;  4NXE A;  1E3U D;  2R9X A;  1BUE A;  5G4Z A;  3V3S A;  3PBT A;  5DJT A;  3IXH A;  1LSW A;  4ZBE A;  3HRE A;  4YOF A;  4DXB A;  3HLF A;  2QHK A;  1YMX A;  1PI4 A;  3DWZ A;  4ESP A;  2VK3 A;  5CHU A;  2ZBB A;  4P0M A;  1YKD A;  3G35 A;  1XJ6 A;  3WS4 A;  1YMS A;  1XGI A;  2W1T B;  2K7S A;  4OPY A;  4GD6 A;  1P97 A;  3MFX A;  2FH5 A;  2XK1 A;  3UNW A;  2HDU A;  1TS6 A;  3LCE A;  2G7U A;  3G30 A;  3D72 A;  4GHI A;  4FD8 A;  1OME A;  4I3J A;  3DTK A;  3A3I A;  1PRQ A;  5DJU A;  4MEZ A;  4EU0 A;  1AXB A;  1UWP X;  4WEJ A;  4HP9 A;  2C5W B;  4WMC A;  1HTZ A;  3V5M A;  3MKF A;  2QWS A;  3ZG8 B;  3W4Q A;  2M7U A;  1S6R A;  4MN6 A;  1VM1 A;  4EEU A;  5DKK A;  5HAQ A;  1BYW A;  2CC1 A;  2VJW A;  4JXW A;  3AGD A;  3O86 A;  3TW8 A;  3D4F A;  3MS6 A;  2B18 A;  1NYM A;  3QP4 A;  2DNS A;  5TBM A;  2VX8 A;  2VGL M;  2VV7 A;  5FEF A;  4OVD A;  1S66 L;  2PU4 A;  4OQI A;  1K4E A;  5L10 A;  4WF0 A;  4QPR A;  1MC0 A;  1XP4 A;  3FPW A;  3FWL A;  2C6W B;  4EES A;  5AQA A;  5AQB A;  1FCO A;  3N4I A;  4WL9 A;  4DJ2 A;  5CER A;  2PYP A;  2QYB A;  5CXW A;  5I5L A;  4Y0O A;  3LIB A;  3E98 A;  3DWK A;  3ZYT A;  2HDQ A;  1LSX A;  3NEC A;  4S2L A;  4Y17 A;  2EWV A;  4JXG A;  1PWD A;  2L1M A;  3RFB A;  1BLS A;  3FZC A;  5HAR A;  4DE1 A;  3R7W A;  4DE0 A;  3PAG A;  1AWI A;  1BUL A;  2V20 A;  1GHP A;  1NYY A;  2K31 A;  4LFU A;  3PHY A;  1MBL A;  2E8J A;  3QP6 A;  3IX8 A;  1YAX A;  2FFF B;  4S2J A;  2HDS A;  3IWO A;  1WA9 A;  4S2N C;  2WK0 A;  2VV8 A;  4MDZ A;  3S4X A;  1KGF A;  1Z6F A;  3ICY A;  4BWI A;  5GHY A;  1U60 A;  5AQ7 A;  4S2P A;  2JKG A;  2VGK A;  4DDY A;  4NG2 A;  3ZVT A;  1F5M A;  3A0R A;  4LRY C;  1K4F A;  2ZQA A;  4JGP A;  5F82 A;  5FAQ A;  1H3Q A;  5HX9 A;  4EXO A;  1GA0 A;  1TS0 A;  1YLZ A;  2PYR A;  3CAX A;  1NLZ A;  1CI9 A;  4R3B A;  3F1O B;  1NXY A;  4B4Z A;  4BJP A;  2QMI A;  5DTK A;  3NI9 A;  5TFQ A;  3RTY A;  3MMH A;  2P9V A;  1J9M A;  3FG8 A;  2GZA A;  5FAP A;  5U47 A;  1TVF A;  4K08 A;  1MWU A;  1PFL A;  5FA7 A;  3QP5 A;  4HJ3 A;  1J3W A;  4HP4 A;  2XDM A;  4GDN A;  3CPT B;  1CI8 A;  4M4X A;  4MNR A;  4OP8 A;  4GCZ A;  1BSG A;  3O87 A;  3OPR A;  3JYI A;  5GL9 A;  1W7F A;  5G4Y A;  1G6O A;  1LI0 A;  5FQM A;  3LEQ A;  3A0S A;  5MC7 A;  2OSU A;  3EGD C;  1YSQ A;  3OCL A;  3O5Y A;  4P85 A;  4YWZ A;  2GX5 A;  3C4O A;  4HI4 A;  1BT5 A;  3KYZ A;  4PM7 A;  4MN5 A;  4R3J A;  4PM8 A;  5CGW A;  3P98 A;  4CLC A;  4O7D A;  2X02 A;  1T1A A;  5HSQ A;  1G6A A;  3HUN A;  3N8L A;  4E3O A;  3JVV A;  3ZQ5 A;  3KYQ A;  5EPH A;  3CLO A;  1TDG A;  3T1X A;  1NLY A;  2JKT I;  2XD5 A;  1E3U A;  3HLB A;  3GRJ A;  4LRX C;  1IYQ A;  1K56 D;  5HFO A;  2JKT M;  2XR0 A;  5K5B A;  2K2N A;  5KSC A;  4F94 A;  3UPN A;  5IHV A;  1V9Z A;  2V2F F;  4HES A;  1T18 A;  1CEG A;  5EOE A;  2QJ5 A;  3LO7 A;  3ZG5 A;  1ZTU A;  4R23 A;  1HVB A;  2I9V A;  3EQV A;  4QU3 A;  4DN0 A;  1VET A;  1FSY A;  3LIF A;  3G31 A;  1IFQ A;  1BLH A;  5CHM A;  3HUO A;  1YLT A;  3PBQ A;  1NWZ A;  3T4O A;  1EWZ A;  4D2O A;  3AGE A;  2PR5 A;  5M1A A;  3L7H A;  1FSW A;  1ZHH B;  1OTE A;  1LL9 A;  4CLC D;  1W63 Q;  4F3L B;  3IS2 A;  4JXS A;  3FYZ A;  4QD4 A;  2HP5 A;  4NXB A;  2Q9M A;  4OON A;  3M6H A;  1IYS A;  4BBU A;  5TGF A;  3R7W B;  3AGF A;  4JF4 A;  1MXO A;  2W0N A;  5HWW A;  1H0M A;  3IQA A;  1GSX A;  5J8X A;  4GZB A;  5A8B A;  1WYC A;  1P9W A;  1ESU A;  3UB7 A;  3NUL A;  3P01 A;  3VMA A;  4QB8 A;  2A3U A;  2ZM8 A;  3WS2 A;  1SKO B;  1SDE A;  1BTL A;  4HBT A;  2QKP A;  3H82 B;  1G68 A;  4GDB A;  4MN7 A;  5FDH A;  1DJC A;  1CEF A;  4FCF A;  2ZL1 A;  1K6S A;  2WAE A;  2OWH A;  3S1Y A;  4Z1W A;  3S7Q A;  3SW1 A;  1K54 A;  1H8Y A;  3LIC A;  3OLO A;  1N9O A;  4KZ5 A;  4L9E A;  5L2F A;  2W3D A;  3FV7 A;  2EXA A;  3WWX A;  1VQQ A;  2WKP A;  4LLO B;  4KQO A;  5HPF A;  3CPT A;  2QPN A;  1PNE A;  2P04 A;  4OLD A;  1DP8 A;  3S7P A;  3ZCZ A;  3UB9 A;  5E2F A;  2FZ0 A;  1FCN A;  4PAU A;  1XX2 A;  3S22 A;  2X01 A;  1YPR A;  3NC8 A;  2J3T D;  3IHB A;  5EVI D;  3E2L A;  4WN5 A;  4KUK A;  4KQQ A;  3GMW A;  4FUW A;  4PM6 A;  4Y13 A;  3F1O A;  1VEU A;  1OT9 A;  1PWC A;  1OTI A;  3IH9 A;  4O01 A;  2W3G A;  4E04 A;  3ZVW A;  5KIZ A;  2D02 A;  3QP8 A;  2ZQ7 A;  4B9O A;  2HV1 A;  4EEP A;  3E2K A;  4OPR A;  3VE4 A;  5M19 A;  4P87 A;  3RXX A;  3LR3 A;  3F1P B;  4ZJ3 A;  1XA1 A;  4KZ8 A;  2A24 A;  4II7 A;  2WKR A;  1K56 A;  1PIO A;  4Q0H A;  2WKI A;  2PDR A;  5J3W A;  1IKG A;  3W4O A;  2J8Y A;  3L9K A;  2HP9 A;  2AVX A;  1LT0 A;  1N9N A;  4B4X A;  2WKH A;  3VFH A;  3H7W A;  2VV6 A;  1TEM A;  4M3K A;  4S2K A;  3RH8 B;  3CJM A;  4HNB A;  2O99 A;  4MBF A;  3K3D A;  4FH2 A;  1H8Z A;  2KOI A;  4LV0 A;  4EBP A;  5HZH A;  4ZJ1 A;  3SH7 A;  4OOL A;  2VGJ A;  4EBL A;  4U0T A;  3KX0 X;  4OLG A;  3DBA A;  2G2W A;  4KZ6 A;  5CEB A;  4Q0I A;  1STZ A;  5GHX A;  4RYE A;  1ONH A;  4MBH A;  3G34 A;  3BLS A;  3A3F A;  2Y2O A;  4X1M A;  2B02 A;  3VFF A;  1TF1 A;  1L0D A;  2YKH A;  5KMW A;  1KGG A;  2ZC4 B;  3O88 A;  3NJA A;  2KDK A;  2O9C A;  1QME A;  2WZX A;  1HD8 A;  5HD3 A;  4MCW A;  5CGX A;  4DRT A;  1Y28 A;  4NET A;  4G3W A;  5CEC A;  4C6Y A;  2NUP C;  4Q0J A;  5HD5 A;  1XJ3 A;  3C8C A;  5FQI A;  1ZG6 A;  3PBS A;  3BEB A;  3BW6 A;  3IXG A;  3ZGA B;  4L0L A;  3OOV A;  4OPZ A;  5EVL A;  3UE1 A;  2VKS A;  2XEP A;  2WAF A;  3WS0 A;  3TRC A;  4PHT A;  4CLC E;  3A3D A;  3C4P A;  4WEL A;  4ETZ A;  1IKI A;  5FAS A;  3V50 A;  3C7V A;  1HLU P;  2O0Y A;  3LYX A;  4UQI M;  1HZO A;  1PZP A;  4NEE D;  4FTX A;  4E3J A;  5E2G A;  3IBJ A;  3H9W A;  4BL2 A;  3DW0 A;  3IT9 A;  4R3A A;  1YLP A;  2V9A A;  4L9G A;  3MSH A;  4LRZ E;  1ERQ A;  4E3K A;  3GQZ A;  3OC2 A;  2H0T A;  3TE8 A;  4GLQ A;  3G4P A;  4E6W A;  1K0K A;  1FR1 A;  5GLB A;  3VOL A;  3D3O A;  3LIA A;  5KZH A;  1ES4 A;  2MJ6 A;  5FQK A;  2JBF A;  2BG1 A;  2EFX A;  3C7U A;  5L07 A;  2P08 A;  3MKE A;  4H8R A;  4KEN B;  1P9R A;  4UA6 A;  4KZA A;  4C75 A; 
#chains in the Genus database with same CATH homology
 3TSG A;  1ESI A;  5EE8 A;  2OSU A;  2Y2N A;  2ZC6 B;  3HLC A;  4QHC A;  1PZO A;  4X56 A;  4JBF A;  3OCL A;  1K57 A;  4ZTK A;  1L0G A;  3SS3 A;  4R0Q A;  1RGZ A;  3NDG A;  4P85 A;  1MWT A;  3SS5 A;  1ERO A;  4S2I A;  4WEK A;  3OPL A;  4PM9 A;  3C4O A;  1E4D A;  4GD8 A;  1BT5 A;  2J7V A;  2ZLY A;  2XFT A;  2ZMA A;  3FKW A;  1KE0 A;  4PM7 A;  2EX8 A;  4XUX A;  4R3J A;  4PM8 A;  5CGW A;  5HAI A;  3VOY A;  2XGN A;  3W8K A;  4IED A;  5FQJ A;  1KVL A;  3P98 A;  2Y2Q A;  3CG5 A;  3V3R A;  2Z2M B;  4O7D A;  1ERM A;  2X02 A;  1G6A A;  3HUN A;  5HW3 A;  1ES3 A;  4UHU A;  4A5R A;  2I72 A;  3BFC A;  4KG6 A;  3GVB A;  3TG9 A;  2WGV A;  3N8L A;  4E3O A;  2RL3 A;  1S0W A;  2EXB A;  4RA7 A;  2IWD A;  3SOI A;  3VSK A;  1GHI A;  3GR2 A;  1FOF A;  4HEF A;  2Y2J A;  3FKV A;  3UPO A;  5EPH A;  4KZB A;  3IHA A;  3PBR A;  4KZ4 A;  4Q8I A;  3Q7Z A;  1TDG A;  1WE4 A;  4ID4 A;  5EVI A;  4X69 A;  3MZF A;  4DF6 A;  2EX2 A;  4XUZ A;  5CHJ A;  2XD5 A;  1E3U A;  3HLB A;  3ZDJ A;  3GRJ A;  4Y7P A;  1ZC2 A;  3WS1 A;  1IYQ A;  1K56 D;  2P9V B;  5HFO A;  1MWR A;  3BFD A;  3IH8 A;  2XR0 A;  4IBX A;  5FQQ A;  3UDI A;  5A91 A;  1LL5 A;  5KSC A;  4F94 A;  4EUZ A;  2XLN A;  3CMZ A;  3UPN A;  5IHV A;  1JWZ A;  5GLA A;  4E3L A;  2V2F F;  4HES A;  2WGI A;  3BEC A;  1W8Q A;  3IXD A;  3NBL A;  1L0F A;  1CEG A;  2HP6 A;  3Q81 A;  3LO7 A;  5D3O A;  5EOE A;  3ZG5 A;  4R23 A;  4U3T A;  3HLD A;  4PM5 A;  3G2Z A;  1HVB A;  3OCN A;  3PAE A;  2RCX A;  3EQV A;  3GV9 A;  4FH4 A;  4QU3 A;  1DY6 A;  1FSY A;  3HBR A;  3RXW A;  3Q1F A;  5FAO A;  5FI7 A;  4ZDX A;  3G31 A;  5EVI B;  3SS4 A;  2Y2K A;  1BLH A;  5CTM A;  1K6R A;  4WM9 A;  1I2S A;  5CHM A;  3HUO A;  4EQI A;  3ISG A;  4MLL A;  1YLT A;  1RP5 A;  3A3J A;  4GB7 A;  4KQR A;  3PBQ A;  4Y0T A;  1FQG A;  5F1F A;  4LCM A;  1PW8 A;  3UO9 A;  1EWZ A;  3SH8 A;  2ZM0 A;  3BFF A;  4D2O A;  4KZ7 A;  3AGE A;  2Z2L B;  5M1A A;  1FR6 A;  1FSW A;  1KVM A;  4CJN A;  3OPH A;  2ZQ8 A;  3BFE A;  5A92 A;  1LL9 A;  4K0W A;  4GN2 A;  4FSF A;  4YIN A;  5AQ9 A;  3Q82 A;  1O07 A;  4KG5 A;  2Y2L A;  5DVA A;  2WKE A;  1SCW A;  5A90 A;  5M18 A;  4BL3 A;  2Y91 A;  1PI5 A;  3W4P A;  2ZD8 A;  4JXS A;  3FYZ A;  4QD4 A;  2HP5 A;  2XFS A;  3IF6 A;  1NZO A;  5DF9 A;  2HDR A;  3VP2 A;  2Q9M A;  2Y2H A;  4OON A;  1MY8 A;  3LEZ A;  1K54 C;  3M6H A;  5CGS A;  4ZAM A;  1IYS A;  4C3Q A;  5EOO A;  5TGF A;  2JE5 A;  3GTC A;  1PYY A;  3OZH A;  3AGF A;  3WRZ A;  2DRW A;  4JF4 A;  1MXO A;  2DCF A;  4LEN A;  4E3M A;  1DJA A;  1W5D A;  2BLS A;  2E8I A;  2PBY A;  4KZ9 A;  2EX9 A;  3IQA A;  3HVF A;  3N7W A;  1ES2 A;  4EBN A;  5J8X A;  1JWP A;  4GZB A;  2HPB A;  1K55 A;  4JPM A;  3QNC A;  2H5S A;  4R4S A;  3UN7 A;  3HL9 A;  3NIA A;  3VP1 A;  2H0Y A;  1WYC A;  3QNB A;  1XGJ A;  2WGW B;  3MXS A;  3MFD A;  4N92 A;  1ESU A;  3SH9 A;  3WS5 A;  4QY5 A;  3VMA A;  3TOI A;  4QB8 A;  2A3U A;  5F83 A;  1LLB A;  2ZM8 A;  4WMC D;  4HBU A;  3WS2 A;  4IVI A;  3NY4 A;  4RX2 A;  2J9O A;  5I94 A;  1SDE A;  1BTL A;  2H10 A;  4GOG A;  4GNU A;  4HBT A;  3VSL A;  3Q7V A;  2Q9N A;  1ONG A;  1G68 A;  4GDB A;  4R1G A;  4UA7 A;  4DE3 A;  5FDH A;  1DJC A;  1CEF A;  1SKF A;  4FCF A;  3ZG7 B;  2IWB A;  4X55 A;  1K6S A;  5EVI C;  3G2Y A;  2PU2 A;  2G2U A;  2WAE A;  5EUA A;  1JTD A;  1YM1 A;  3BLM A;  3S1Y A;  4KZ3 A;  4B88 A;  4LV1 A;  2EX6 A;  3LY3 A;  3V39 A;  1DJB A;  1N9B A;  4WBG A;  2R9W A;  4DDS A;  4N9L A;  1MPL A;  2ZQD A;  1K54 A;  3IF6 C;  1E3U D;  2JCH A;  1H8Y A;  2WYX A;  2FFY A;  4WYY A;  3QHY A;  4E3N A;  4KG2 A;  1IYO A;  2R9X A;  3GSG A;  4LCL A;  1BUE A;  2J9P A;  3V3S A;  3PBT A;  4KZ5 A;  3IXH A;  1PW1 A;  5L2F A;  1H5X A;  5FSR A;  5BOH A;  3IF5 A;  5KSH A;  2ZC5 B;  3FV7 A;  2ZQC A;  2WZZ A;  3UE3 A;  4ZBE A;  1WYB A;  3HRE A;  2EXA A;  5DTS A;  4DXB A;  3WWX A;  1VQQ A;  3HLF A;  1YMX A;  1PI4 A;  3N8S A;  3ZG9 B;  3DWZ A;  4DXC A;  4QJG A;  4KQO A;  4GKU A;  4X68 A;  1ES5 A;  2QPN A;  3ITB A;  5CHU A;  2XF3 A;  4OLD A;  4P0M A;  3ZCZ A;  5E2F A;  3Q7V B;  3G35 A;  3MZE A;  1YQS A;  3WS4 A;  1YMS A;  2Y2M A;  4BLM A;  1FCN A;  1I5Q A;  1XGI A;  1XX2 A;  1O7E A;  3IF6 B;  3S22 A;  1RCJ A;  4GD6 A;  4OPY A;  2X01 A;  4JF5 A;  2ZC3 B;  1GA9 A;  1IYP A;  3VOZ A;  3NC8 A;  2WGW A;  4WZ5 C;  2XK1 A;  3IHB A;  3UNW A;  5EVI D;  5CED A;  3E2L A;  2HDU A;  4EWF A;  3LCE A;  1KGE A;  3ZG0 A;  4KQQ A;  2WUQ A;  1IEL A;  3G30 A;  2EFU A;  3MZD A;  1SDN A;  4WZ4 A;  1RGY A;  4IBR A;  3GMW A;  3UE0 A;  2GDN A;  1IEM A;  3OPP A;  4PM6 A;  3A3E A;  4FD8 A;  1OME A;  2QZ6 A;  3ZHH A;  5HAP A;  2Y2P A;  1LHY A;  1Q2P A;  4OP5 A;  1PWC A;  3A3I A;  3IH9 A;  5FI6 A;  1K25 A;  4MEZ A;  1AXB A;  3ZVW A;  4OKP A;  5JYP A;  4WEJ A;  4OQH A;  2C5W B;  3CZD A;  5DTT A;  2ZQ7 A;  4WMC A;  3MXR A;  1GHM A;  2ZM2 A;  5E2H A;  1HTZ A;  3V5M A;  3E2K A;  4OPR A;  5FI2 A;  5M19 A;  5FQ9 A;  4P87 A;  4YFM A;  3RXX A;  3NCK A;  1L2S A;  3MKF A;  4U0X A;  3ZG8 B;  4JKT A;  3W4Q A;  4ZJ3 A;  1XA1 A;  1S6R A;  1NZU A;  4OOY A;  4LV2 A;  1VM1 A;  3HLG A;  4KZ8 A;  4OPQ A;  5HAQ A;  2CC1 A;  5G18 A;  1K56 A;  1KDS A;  1PIO A;  4NK3 A;  2WKI A;  3M2J A;  4JXW A;  5GHZ A;  1IKG A;  3W4O A;  3AGD A;  1I2W A;  3O86 A;  4OOM A;  3ZFZ A;  3D4F A;  2J8Y A;  5CRF A;  3PBO A;  2V1Z A;  2HP9 A;  3UPP A;  4S2O A;  4B4X A;  2P74 A;  2WKH A;  1NYM A;  3VFH A;  1JWV A;  4M3K A;  1TEM A;  4ZJ2 A;  4S2K A;  2DNS A;  3O3V A;  2ZJ9 A;  1JVJ A;  4DKI A;  3CJM A;  4OQ0 A;  3LY4 A;  4MBF A;  4FH2 A;  4JF6 A;  1M40 A;  1H8Z A;  2X71 A;  4LV0 A;  4OVD A;  4EBP A;  3DTM A;  2PU4 A;  4ZJ1 A;  3VP3 A;  3SH7 A;  4OOL A;  5TR7 A;  1NJ4 A;  2VGJ A;  3C5A A;  4OQI A;  1K4E A;  4P6B A;  4U0T A;  4EBL A;  4PPR A;  1XXM A;  4OLG A;  4K0X A;  4S2N A;  2WAD A;  2G2W A;  1XP4 A;  3FWL A;  3MBZ A;  4KZ6 A;  2C6W B;  1YLJ A;  5AQA A;  2B5R A;  5AQB A;  5CEB A;  1FCO A;  3N4I A;  5CER A;  2Y2I A;  4XXR A;  5CXW A;  4LV3 A;  4RYE A;  4RVA A;  1ONH A;  5GHX A;  4MBH A;  3G34 A;  3IXB A;  3Q07 A;  3BLS A;  3A3F A;  4Y0O A;  3VP4 A;  2Y2O A;  3ZNT A;  3DWK A;  1NY0 A;  2HDQ A;  3VFF A;  4Y0U A;  1L0D A;  2IWC A;  4S2L A;  1XPB A;  4WZ5 A;  5KMW A;  1EI5 A;  1KGG A;  2ZC4 B;  1BLC A;  3RJU A;  3O88 A;  2OV5 A;  4JXG A;  1PWD A;  1QME A;  2WZX A;  1HD8 A;  2ZC7 A;  4CPK A;  1BLS A;  1KDW A;  3FZC A;  1LI9 A;  5HAR A;  1KE3 A;  3UY6 A;  4DE1 A;  5GLD A;  5CGX A;  1Y54 A;  4DRT A;  4NET A;  5CEC A;  4DE0 A;  1K57 C;  4N1H A;  1YT4 A;  3PAG A;  4OH0 A;  4BEN A;  3PTE A;  4C6Y A;  1L0E A;  3VP0 A;  1K38 A;  2Y59 A;  1ZG4 A;  1BUL A;  2V20 A;  4UA9 A;  1GHP A;  1NYY A;  1Q2Q A;  1MWS A;  5FQI A;  1MBL A;  4BD0 A;  4RX3 A;  1ZG6 A;  1K55 C;  3PBS A;  3BEB A;  4DE2 A;  1NRF A;  1QMF A;  2FFF B;  4S2J A;  4E3I A;  3P09 A;  3IXG A;  2HDS A;  3ZGA B;  3IWO A;  4L0L A;  5DF8 A;  4JLF A;  4PMA A;  4S2N C;  1JTG A;  1YLW A;  2WK0 A;  2Y55 A;  4OPZ A;  5EVL A;  5F1G A;  3UE1 A;  3NDE A;  4OQG A;  2XEP A;  5FAT A;  2WAF A;  4X6T A;  3S4X A;  1KGF A;  1Z6F A;  1W79 A;  3WS0 A;  3IWI A;  4BQM A;  1W8Y A;  1FCM A;  3A3D A;  3BYD A;  3C4P A;  3HLE A;  5GHY A;  1U60 A;  4WEL A;  1IKI A;  5FAS A;  3V50 A;  3C7V A;  2XH9 A;  5AQ7 A;  5CTN A;  1HZO A;  4S2P A;  5JYO A;  2VGK A;  4DDY A;  1PZP A;  4MBK A;  3ZVT A;  3BM6 A;  4E3J A;  1XA7 A;  5E2G A;  2Y4A A;  2OLU A;  5GLC A;  1K4F A;  2ZQA A;  2XQZ A;  5E43 A;  5F82 A;  5FAQ A;  3M2K A;  4BL2 A;  1C3B A;  3DW0 A;  3IT9 A;  2OLV A;  4IVK A;  5HX9 A;  5A93 A;  1GA0 A;  1YLZ A;  3UDX A;  4C75 A;  1CI9 A;  1YLP A;  3N6I A;  3B3X A;  4E6X A;  3ITA A;  4R3B A;  4Z9Q A;  2A49 A;  3I7J A;  1NXY A;  3BFG A;  3HUM A;  3ZNY A;  4B4Z A;  4BD1 A;  4BJP A;  1ERQ A;  2QMI A;  5DTK A;  4E3K A;  3GQZ A;  3NI9 A;  5TFQ A;  3OC2 A;  2H0T A;  4UAA A;  3EQU A;  2P9V A;  3G4P A;  4E6W A;  3N8R A;  1MKI A;  3M6B A;  1FR1 A;  1J9M A;  1PWG A;  5GLB A;  1ALQ A;  4N1X A;  4QY6 A;  4S2M A;  5FAP A;  5HL1 A;  1SHV A;  2XD1 A;  1YLY A;  5U47 A;  3IWQ A;  1BZA A;  1TVF A;  2UWX A;  5DF7 A;  1MWU A;  1ZKJ A;  1GCE A;  1TDL A;  3BRM A;  3HLW A;  5FA7 A;  5KZH A;  1M6K A;  1ES4 A;  5EEC A;  1XKZ A;  5E2E A;  2XDM A;  2Y2G A;  3PBN A;  4GDN A;  5FQK A;  1CI8 A;  2JBF A;  4X53 A;  1BLP A;  2BG1 A;  2EFX A;  3C7U A;  4MNR A;  4OP8 A;  4K91 A;  1N4O A;  3G32 A;  1BSG A;  3MKE A;  4H8R A;  4N9K A;  4EV4 A;  3WRT A;  3O87 A;  3OPR A;  2ZQ9 A;  3JYI A;  1E25 A;  1KE4 A;  5GL9 A;  1W7F A;  4KEN B;  1LI0 A;  4UA6 A;  3UDF A;  2JC7 A;  5FQM A;  4KZA A;  4R4R A;  4JXV A;  1CK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...