1KE4A

X-ray crystal structure of ampc beta-lactamase from e. coli
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
publication title Structure-based approach for binding site identification on AmpC beta-lactamase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 113
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ke4A00
3WS0A 1JWVA 4N1XA 4UAAA 1XPBA 4S2LA 1Z6FA 3N8SA 3ZG5A 4OKPA 5CTNA 5FQJA 3C7VA 3PTEA 1XP4A 4E6WA 3UDIA 4DXBA 2IWDA 1MPLA 1CEFA 4OOMA 1K54A 3BLSA 3IHAA 4E3OA 4C6YA 3IF6A 2E8IA 4F94A 5FSRA 3WS5A 1K25A 3G34A 4OLGA 4PM9A 2G2WA 3HL9A 4S2NA 5EOEA 5HFOA 2ZMAA 3M6HA 3FKVA 2EXAA 3ZDJA 4GZBA 4OLDA 3M6BA 3C4OA 1W5DA 2ZQDA 2WKIA 3D4FA 4R1GA 2ZD8A 5EVID 4DE3A 2ZM8A 1RGYA 3HLBA 1W7FA 2Q9NA 1EI5A 3PAGA 4KG5A 1YLTA 3GMWA 1IYQA 3MFDA 2XH9A 3PBSA 4R23A 4S2KA 1NXYA 5G18A 3GVBA 3N8RA 2X02A 4QY5A 5HAQA 4XXRA 2EX6A 3TSGA 4LENA 3IXDA 1OMEA 5CHMA 4OQIA 3SH8A 5F1GA 3GQZA 5FATA 4MEZA 1C3BA 2XGNA 1IYPA 3G2ZA 2DRWA 1ZG4A 5AQ7A 1IELA 1TDGA 1HZOA 1BLCA 2OLUA 4R4SA 1PZPA 4EBNA 3GSGA 1YT4A 3VP0A 5FQQA 3CMZA 2Y2QA 4R3BA 4WZ4A 4QJGA 3EQVA 3Q7ZA 5E43A 4KZBA 3VP3A 1YLZA 4FSFA 3RXXA 4KG6A 4BL3A 3OPLA 4BL2A 1DJAA 2JCHA 4DKIA 2EFXA 4KQQA 5AQ9A 3IF6B 2Y2OA 4WYYA 1CK3A 4KZ7A 1E4DA 1QMEA 1VM1A 3SH9A 4Y0OA 4NK3A 5F83A 1WYCA 5BOHA 3S22A 4EBLA 1I2WA 2EXBA 4PMAA 3Q82A 4KQRA 1TEMA 4P0MA 5L2FA 4X69A 1FOFA 5GLBA 1JTGA 4HBTA 4OPQA 2WKHA 2XK1A 2ZJ9A 4OH0A 3HUOA 3V3RA 4QY6A 3TG9A 2R9XA 3IXHA 5EUAA 4ZJ1A 5TR7A 3O88A 1BULA 3LY4A 3AGDA 4OPRA 5U47A 1K56A 3SS3A 3W4PA 2ZLYA 3OC2A 4PM6A 1SDNA 4UA9A 1MWTA 4S2IA 4UA7A 4LV2A 1MKIA 5DVAA 3UPNA 1ESIA 1FCNA 3FV7A 3PBRA 1L0FA 4QU3A 4WZ5A 4JXSA 4EWFA 2XQZA 1FCMA 4JXWA 1NZOA 1N4OA 3CJMA 4OOYA 5AQBA 1CI9A 2CC1A 1ES5A 3HLFA 2WZXA 5AQAA 4Z9QA 5FQKA 1H8YA 1K4EA 1K55C 3CG5A 2OLVA 5EVLA 1MWRA 5CERA 3UDFA 2B5RA 3WS4A 3HLGA 4H8RA 1GHMA 3IXBA 4FH4A 1SDEA 3SS4A 4JBFA 5CTMA 2IWCA 2Y2GA 2ZC7A 5KSCA 4OPZA 3IWIA 5DF9A 1XA7A 4N9KA 4XUZA 5HX9A 3UNWA 3SS5A 4C3QA 1IKGA 1JTDA 1FSWA 4QD4A 4DDYA 1ES4A 2XD1A 4R4RA 5M1AA 5E2FA 1RGZA 2XD5A 5HW3A 4EV4A 3M2KA 4OQGA 4P6BA 1K38A 4QHCA 5M18A 4GB7A 4D2OA 2ZC3B 4C75A 2H10A 4RX2A 5IHVA 3WWXA 5A90A 5J8XA 3A3FA 4GNUA 2JC7A 2ZC6B 4KENB 4JF6A 2C5WB 2XFTA 4WMCA 3W4QA 3ZCZA 3O86A 4IBRA 2PBYA 1K57A 4BENA 4R0QA 4ZJ3A 1MBLA 2XF3A 4GKUA 3E2KA 1YM1A 3LEZA 4BLMA 1NJ4A 4ZAMA 2PU2A 5FA7A 3MZEA 1H8ZA 3UO9A 1BT5A 3VMAA 2XEPA 1O7EA 1ZG6A 5EECA 1ERQA 1FCOA 1WYBA 3W4OA 2EX8A 4Y0TA 1H5XA 1LHYA 4BQMA 3QNCA 2HP5A 4N9LA 1K54C 3BEBA 1G6AA 4ID4A 2HPBA 3E2LA 1E3UA 2ZQAA 3N8LA 1KGFA 4K0WA 1FR1A 2EX2A 4KG2A 4S2NC 1S0WA 4YFMA 2WZZA 3TOIA 1BSGA 1LL9A 4KZAA 4WM9A 1ONGA 2X01A 5D3OA 5EVIB 4DRTA 4DXCA 2Y2MA 2Y2IA 4JF5A 3ZG9B 3ZVWA 1HD8A 2ZM2A 2OSUA 4S2PA 5FDHA 5TGFA 1ALQA 4WBGA 5DTKA 1L0EA 2RCXA 3ZHHA 3GR2A 1PZOA 3A3JA 4LV3A 3AGEA 3LY3A 4JXVA 1PW1A 2HDUA 3V50A 1ES3A 1GCEA 3IF5A 4DE1A 5CGXA 1SCWA 3IXGA 4HEFA 5E2EA 3FZCA 5FAQA 4OVDA 2VGKA 1XGIA 1PI4A 5A93A 2Y2NA 4OP8A 2P9VA 2EFUA 3BFGA 3G32A 5CHUA 2WGWA 5FASA 1NRFA 3PBTA 4HESA 3PBOA 3SH7A 3DWKA 1EROA 2HDSA 4IEDA 1PI5A 4JPMA 5FI7A 3ZG0A 3AGFA 1ES2A 4LCMA 3BYDA 2WK0A 2WGVA 2Y2LA 5HAPA 2DNSA 2ZC4B 3G2YA 3GRJA 3NI9A 1K4FA 4X53A 3C5AA 3UN7A 1FR6A 1BLSA 2Y2PA 4GDBA 3VP2A 4WEJA 3MXSA 5KMWA 1N9BA 5HARA 3RJUA 1KDSA 1DJCA 1ESUA 1XX2A 1MWUA 1YLJA 1YMXA 1LI0A 1MXOA 2GDNA 3OZHA 5F82A 5FQIA 5A92A 1WE4A 4EQIA 3FYZA 2G2UA 2Y91A 5FQ9A 2JBFA 3G4PA 4ZBEA 3UE1A 1MY8A 3ZNTA 3HLEA 4FCFA 4UA6A 5DF7A 1O07A 4P85A 2V20A 4KZ3A 1GA9A 1L2SA 1KDWA 3UPPA 1K6SA 4FD8A 1FQGA 3N6IA 4OONA 3ITBA 4S2JA 4YINA 4EBPA 3HLCA 3MBZA 5CRFA 3DTMA 3HUNA 1ONHA 4X56A 1KE4A 1NYMA 5CHJA 3NCKA 3HVFA 4MLLA 2PU4A 4B4XA 3PAEA 1LI9A 5EPHA 1XA1A 3G30A 5GHXA 4WZ5C 4B4ZA 4LV0A 4XUXA 4DF6A 4S2MA 4E3KA 2P9VB 5EVIA 1KE3A 1G68A 1DJBA 3M2JA 2OV5A 3S1YA 2WGWB 4ZDXA 3GTCA 3WS1A 3ZVTA 2WAFA 4JKTA 3VSKA 5FQMA 1JVJA 3VP4A 5EOOA 5CGSA 4CPKA 4JXGA 5GLAA 1M6KA 1BUEA 1Q2QA 3HUMA 3A3IA 4LV1A 2Y4AA 4MBHA 5FAPA 4Q8IA 4K91A 4Y0UA 1YMSA 1W8QA 3NDEA 4OQ0A 1CEGA 4OPYA 1K56D 1LLBA 4E3MA 3MXRA 4MBFA 5CECA 4MBKA 3IHBA 5CXWA 2H0YA 5GLCA 1YLPA 3VOZA 1SKFA 3NY4A 3I7JA 5DF8A 5DTTA 3IWOA 2WYXA 2X71A 5CEBA 4MNRA 1GHIA 3OPHA 3OCNA 3Q7VB 4E3NA 3NDGA 2XLNA 4PM8A 4BD1A 4BJPA 2Y2KA 4GD6A 1HTZA 4NETA 5TFQA 5GLDA 2FFYA 1BZAA 4DE0A 4O7DA 1M40A 2EX9A 1GHPA 3DWZA 3IF6C 3WS2A 2P74A 2XFSA 1K57C 3VOYA 4KZ6A 3BFFA 3VFFA 2J8YA 1XKZA 2XDMA 2HP9A 1NYYA 4RVAA 2RL3A 3EQUA 3HBRA 3NC8A 2BLSA 4JF4A 1HVBA 1W8YA 4GOGA 4IVKA 3OPPA 1XGJA 3BFDA 4CJNA 5JYOA 4RYEA 4U0XA 1YLWA 3A3DA 3BFCA 3BLMA 3N4IA 2V1ZA 3G31A 5GHZA 1IKIA 3HLWA 3ISGA 3UPOA 1Y54A 3HREA 4KQOA 2V2FF 4BD0A 3V39A 1PWGA 4E3IA 4PM5A 1ERMA 3CZDA 3V5MA 3IQAA 4GDNA 4X55A 2WUQA 3LCEA 4LCLA 4UHUA 4E6XA 4PM7A 2WADA 3P98A 3MKFA 4S2OA 3VSLA 3C4PA 4M3KA 1TVFA 2FFFB 3SOIA 1L0GA 4DE2A 4WMCD 1U60A 3PBQA 3DW0A 5A91A 4KZ4A 4RX3A 4R3JA 1AXBA 4P87A 5CGWA 4PPRA 3Q1FA 5FI2A 2IWBA 2A3UA 5E2HA 5FI6A 4A5RA 2WKEA 1KGGA 3IH8A 4QB8A 5CEDA 3UE3A 2HDRA 1GA0A 3QNBA 1I5QA 5FAOA 4ZTKA 3ZFZA 1PW8A 2WAEA 3GV9A 2H0TA 3BRMA 4KZ5A 4GD8A 4OQHA 4Y7PA 3FKWA 3B3XA 1MWSA 1IYOA 3S4XA 4WELA 3WRTA 1L0DA 2R9WA 1FSYA 2Y59A 4E3JA 3W8KA 1E3UD 1Q2PA 1YQSA 3IH9A 2WGIA 3UY6A 3O3VA 4DDSA 2XR0A 3RXWA 1E25A 1PWCA 1DY6A 3G35A 2BG1A 2C6WB 1BLPA 1XXMA 3PBNA 2J9OA 1TDLA 1RP5A 4KZ9A 3ZNYA 4E3LA 5F1FA 4OP5A 4N1HA 1KE0A 3IWQA 2ZQCA 2QPNA 4RA7A 2VGJA 1ZC2A 5EE8A 4IBXA 2HDQA 3N7WA 5GL9A 5KZHA 2Y2JA 1K55A 3Q7VA 3P09A 4IVIA 4U3TA 5HAIA 3ZG8B 1I2SA 2UWXA 1JWZA 2JE5A 3VFHA 1S6RA 1K6RA 3FWLA 1KGEA 2J9PA 3HLDA 3C7UA 2HP6A 2ZQ7A 4L0LA 1IEMA 3MKEA 3O87A 5M19A 4U0TA 2QMIA 1BTLA 3MZFA 4EUZA 1KVMA 1PIOA 3QHYA 5E2GA 2Y55A 1YLYA 3OPRA 4WEKA 5KSHA 5GHYA 4ZJ2A 2ZQ8A 3VP1A 4K0XA 3V3SA 2Q9MA 4N92A 3WRZA 3A3EA 2Z2MB 4OOLA 1JWPA 2H5SA 5JYPA 1SHVA 1W79A 1PWDA 1PYYA 2ZQ9A 3OCLA 4GN2A 5DTSA 1KVLA 3BM6A 3Q07A 3ZGAB 1EWZA 1VQQA 1J9MA 3LO7A 4KZ8A 1BLHA 3UDXA 1RCJA 4FH2A 3ITAA 3Q81A 5I94A 3NBLA 1NY0A 2DCFA 4X68A 3NIAA 4HBUA 2I72A 1IYSA 3UE0A 1QMFA 3JYIA 2ZM0A 2Z2LB 3ZG7B 1CI8A 3IT9A 5HL1A 2ZC5B 1NZUA 2A49A 3BECA 4X6TA 3BFEA 2J7VA 2QZ6A 2Y2HA 5EVIC 1ZKJA 4B88A 3MZDA 4JLFA 1LL5A
chains in the Genus database with same CATH superfamily
1JWVA 3BQAA 1XPBA 4G3KA 4HQAA 3C7VA 3PTEA 4E6WA 2IWDA 4OOMA 3IHAA 4E3OA 2W3GA 4C6YA 5FSRA 1Z09A 4WLAA 1K25A 4PM9A 2G2WA 2PAVP 4GZBA 4EETB 4JGPA 5AJGA 2WKIA 4MN6A 4R1GA 1RGYA 1H3QA 3NECA 3GMWA 1IYQA 3MFDA 2VKSA 2XH9A 3CUEA 5G18A 3GVBA 3N8RA 5HAQA 4QY5A 2M7VA 2XROA 3D9YA 3SH8A 4MMNA 1C3BA 3E98A 2P04A 1IYPA 2YKHA 1ZG4A 2L1MA 4EBNA 1HZOA 4G3VA 1YT4A 3VP0A 4HH3A 4WZ4A 4QJGA 3C38A 3EQVA 4B93A 5E43A 4BL3A 3IX3A 1DJAA 2EFXA 3IF6B 2Y2OA 3UB6A 5L09A 1YSPA 1WYCA 4HJ4A 1I2WA 2EXBA 2V9AA 5L2FA 4DJ2A 4OPQA 2XK1A 4OH0A 3V3RA 3O88A 3W4PA 1V9YA 2BTFP 4JXSA 4EWFA 4HI4A 3NOPC 1NZOA 1W63M 1UWNX 5AQBA 1CI9A 5AQAA 1ES5A 3HCYA 2W1RA 4Z9QA 1H8YA 3S7OA 5CERA 5EVLA 3UDFA 3LIDA 3H9WA 3WS4A 3HLGA 3SS4A 5CTMA 4MDZA 3VE3A 2ZC7A 5KSCA 3IWIA 1VEUA 3UNWA 1T1BA 3SS5A 5EM1A 1S1YA 4DDYA 4R4RA 2XD5A 2WKQA 4P6BA 5M18A 2GX5A 2R78A 4GB7A 3BWLA 4C75A 3RTYA 5A90A 4GNUA 4KENB 3R4KA 4WMCA 3ZCZA 4IBRA 2J3TC 2PBYA 3LEZA 4GS9A 1H8ZA 1O7EA 4PKYA 4LFUA 1WYBA 3W4OA 1H5XA 2HP5A 2V1AA 2EX2A 2P7JA 4QPRA 2D01A 3UE6A 5TGFA 1H0MA 5DTKA 5J7EA 1TS0A 3BQ8A 2QKPA 1PW1A 1ES3A 3MS6A 4DE1A 2V8CA 2VGKA 4MN7A 3EWKA 1PI4A 1XJ2A 2A24B 1XJ3A 2QYBA 2WKRA 3BFGA 4YNRA 1EROA 1PI5A 3AGFA 1ES2A 4NG2A 2WK0A 2HV1A 3DTIA 1K4FA 4NKPA 4YOFA 5KMWA 5HARA 3RJUA 1YMXA 4I38A 1YLJA 2GDNA 3OZHA 1A0KA 4EQIA 3FYZA 5FQ9A 2JBFA 2LB5A 4B9OA 4IJGA 4UA6A 4EU0A 2V20A 4EBPA 4S2JA 1MZUA 1D7EA 4KUOA 1CQAA 3NCKA 4B4XA 4MLLA 3UB9A 1LI9A 5EPHA 1XA1A 4WZ5C 4DF6A 4GHIB 4X1LA 2GJ3A 5FQMA 3VP4A 5EOOA 3NOUC 4MBHA 5FAPA 4CLCD 3NHQA 4OPYA 1K56D 4E3MA 1OJ5A 3KX0X 2OOLA 2H0YA 2W3DA 5DTTA 2Y79A 2OAQ1 3OBFA 5TBMB 3LR5A 1HTZA 1N9OA 3T4LA 3OLOA 1GHPA 4ARZB 4L9EA 2W1TB 3WS2A 3ZYTA 2XFSA 1K57C 4KZ6A 3E4QA 4FTXA 1XKZA 4HNBA 2XDMA 4RVAA 3EQUA 2XRNA 1HVBA 3IBJA 4GOGA 5K5BA 4IVKA 1H8MA 1XGJA 3LEQA 2V1ZA 3HLWA 2IA2A 1Y54A 4E3IA 4DMZA 4GLQA 3V5MA 3IQAA 2ZOHA 3KYZA 4UHUA 3VSLA 2V0UA 3SOIA 1OPXA 1L0GA 4R6LA 1U60A 3S7NA 5A91A 4P87A 5IT5A 3IS2B 3A0SA 2WKEA 3IH8A 5FAOA 4ZTKA 2WAEA 3GV9A 2H0TA 4KZ5A 3LYXA 3FKWA 3B3XA 1IFQA 1IYOA 3W2ZA 3GDIA 4E3JA 3W8KA 3UY6A 2WGIA 2XR0A 3K2NA 3RXWA 4ETXA 2BG1A 1S1ZA 3IWQA 4RA7A 2ZQCA 5KZHA 2HDQA 4WUJA 2VEAA 4IVIA 3T4QA 3ZG8B 1K6RA 3HLDA 1OTAA 3FWLA 3C7UA 5M19A 4U0TA 2QMIA 4ARZA 2INWA 4Y15A 5E2GA 2Y55A 1YLYA 4WEKA 2O0YA 3E4PA 5JYPA 1JWPA 3OCLA 5DTSA 4GN2A 3Q07A 3ICYA 1VQQA 1BLHA 3UDXA 2VGLS 1RCJA 3ITAA 5I94A 3S7QA 1IYSA 2ZM0A 2M7UA 2VA0A 3IT9A 4B88A 3MZDA 3F1OB 1NLYA 4UAAA 2ZL1A 1Z6FA 1OJGA 4PKYG 4OKPA 5CTNA 5FQJA 3OOVA 3UDIA 4DXBA 1CEFA 2EWVA 4OLGA 5EOEA 5HFOA 2EXAA 1P97A 4OLDA 3M6BA 1W5DA 3D4FA 3LUQA 2ZD8A 1T18A 5EVID 5L10A 2B18A 2Q0OA 2H28A 1T19A 1DP9A 1W7FA 2Q9NA 3MF0A 4EXOA 3PBSA 3UMDA 4S2KA 2X02A 3VV4A 4XXRA 2EX6A 3TSGA 1N9NA 4FOFA 4LENA 3T1SA 2P08A 1OMEA 5FATA 2XGNA 3KSFA 1TDGA 2OLUA 3IX4A 5F6AA 5FQQA 4HOIA 4BBVA 4EERA 4Y2FA 3Q7ZA 1YLZA 4FSFA 3RXXA 4DKIA 5AQ9A 4WYYA 1CK3A 1E4DA 1QMEA 4LPZA 2HJ9C 1NRJA 1VM1A 3SH9A 3R7WB 5F83A 2VX8A 5BOHA 3S22A 4EBLA 4NEED 3Q82A 4P0MA 4K08A 4X69A 4CQHA 1FOFA 5GLBA 1JTGA 4PHTA 3HUOA 2Y8HA 3IXHA 5EUAA 4ZJ1A 3LY4A 3SS3A 2ZLYA 1SDNA 4UA9A 1MWTA 4S2IA 4UA7A 5DVAA 5I5LA 4BBUA 3PBRA 4WZ5A 1FCMA 3CJMA 3T4SA 3HLFA 2WZXA 5FQKA 1AWIA 1K55C 1MWRA 1GHMA 1SDEA 4JBFA 4Y5FA 2IWCA 4OPZA 5DF9A 3CPTB 4N9KA 2OWHA 4XUZA 5F68A 2PR6A 3L7HA 3JVVA 1ES4A 5M1AA 1K38A 5HD5A 3EEAA 5AVFA 2O9AA 2ZC3B 4XT2A 5IHVA 3WWXA 5J8XA 2ZC6B 4Q0JA 1K57A 5G4YA 4ZJ3A 3R7WA 3MZEA 3UO9A 1BT5A 2EX8A 1K54C 1TF1A 3FG8A 3N8LA 1FR1A 4KG2A 4S2NC 4YFMA 3E0YA 4F3LB 5FEGA 1VEUB 1ONGA 4JGOA 4Y17A 4DRTA 2Y2MA 4JF5A 3ZVWA 5FDHA 1ALQA 4WBGA 2GZAA 1PZOA 1CJFA 3AGEA 3QP4A 5DFYA 2O99A 1JNUA 1GCEA 5E2EA 2AVXA 4MCWA 4OVDA 3CPTA 4OP8A 4GS9B 4Y3IA 5CHUA 5FASA 3SH7A 3PBOA 2JKRI 5HDSA 4IEDA 4LCMA 3U4LP 4DJ3A 5HAPA 2M1CA 3GRJA 1ZTUA 1NWZA 3C5AA 3UN7A 2ZMVA 2I9VA 3VP2A 3MXSA 1GSXA 4IUKA 1KDSA 1MWUA 5F82A 1STZA 3H82A 3P7NA 4Q0HA 5HPFA 2HJEA 2PDRA 4P85A 2JKFA 3C2WA 4KZ3A 3UPPA 2KDKA 1FQGA 3UB8A 3B42A 3MBZA 5CRFA 1S67L 3HUNA 1ONHA 1KE4A 1NYMA 3HVFA 2PU4A 3PAEA 4F3LA 4B4ZA 4S2MA 4I3IA 1KE3A 2EA9A 1G68A 3H7WB 1DJBA 1P9RA 3S1YA 4L9GA 1G6OA 3WS1A 1IOUA 2W3EA 2VGLM 3IBRA 4CPKA 4JXGA 3VE4A 3A3IA 4LV1A 2PYPA 4GW9A 1W8QA 3MXRA 1HLUP 4Z1WA 3ZQ5A 5DF8A 3IWOA 2WYXA 5CEBA 4YWZA 3Q7VB 3TRCA 1NLZA 4NETA 3DTKA 1BZAA 4O7DA 3JVUA 4P6ZM 3VOYA 1F9IA 3VFFA 1VETA 2J8YA 1D06A 3EGDC 5EVEA 1W8YA 3OPPA 3LR4A 4RYEA 4U0XA 3G31A 1IKIA 1OTIA 3QP2A 1N9LA 3LIFA 3UPOA 3HREA 4KQOA 4PM5A 3V39A 2CMNA 3CZDA 4QWOA 3LCEA 4I39A 1VHMA 4LCLA 3MKFA 1G5UA 4WMCD 5DFXA 3PBQA 3SZTA 3H7WA 4R3JA 5CGWA 3L9KA 4PPRA 3Q1FA 5EV0A 2FH5A 2A3UA 1KGGA 5CEDA 2E8JA 2KOIA 3T1RA 5FL3A 3WRTA 3S4XA 2R9WA 2B95A 1Q2PA 1YQSA 3CWFA 3UB5P 4DDSA 1DY6A 2Z6CA 4LRZE 4JGQA 1BLPA 4HJ6A 4IHQA 5F1FA 1KE0A 3KYQA 2JKGA 3HJKA 2HZ5A 1ZC2A 4IBXA 3N7WA 1K55A 3Q7VA 3P09A 4U3TA 2UWXA 2JE5A 2J9PA 4L0LA 4X1MA 2UV0E 2MJ6A 2ZQ7A 3MKEA 1BTLA 1OT9A 5KSHA 2ZQ8A 3VP1A 4K0XA 2Q9MA 4N92A 3WRZA 5HPIA 3A3EA 2H5SA 3PYPA 4R3AA 2ZQ9A 1S66L 1KVLA 3BM6A 3F1NB 3FC7A 1J9MA 1F98A 5HL6A 3EOIA 2OAP1 3Q81A 1P9WA 1NY0A 3NIAA 3MQOA 3TE8A 3UE0A 3JYIA 4BMWA 5HL1A 1CI8A 1T1CA 1SKOB 2A49A 4X6TA 3WS0A 3VOLA 4N1XA 1D1JA 3N8SA 1EW0A 1MPLA 1K54A 4GJ4A 5TJJA 3BLSA 1XFQA 3WS5A 3G34A 4S2NA 4DN0A 2ZMAA 3M6HA 3FKVA 3ZDJA 3KYEA 1SZVA 5HD3A 3K3CA 1TS6A 3T4KA 3CITA 2ZM8A 3T12B 3B47A 2JKTI 3HLBA 1EI5A 3JPUA 1YLTA 2ZMFA 1PNEA 5HDDA 3F1PB 1VB6A 4UQIM 5CHMA 5F1GA 3GQZA 3NJAA 3UMEA 3G2ZA 4ETZA 1IELA 2ZL1B 1PZPA 3GSGA 5FDSA 3CMZA 3S7PA 4H6JA 3F1NA 1KOUA 3OPLA 3SW1A 4HP4A 2JCHA 4KQQA 4KZ7A 1SKOA 4Y0OA 3MJQA 4KQRA 1TEMA 5EM0A 5HDCA 4HBTA 2WKHA 3TG9A 5TR7A 1BULA 4OPRA 3AGDA 4NXFA 3K3DA 2VV7A 1F5MA 4LV2A 3TJZC 3FV7A 4NXGA 1L0FA 1N4OA 5MC7A 2CC1A 1K4EA 3CG5A 2OLVA 1X0OA 4FH4A 5F5YA 3QP8A 2EWWA 3MQQA 2PR5A 3F1PA 5HX9A 4C3QA 1IKGA 4QD4A 1FILA 3HJIA 2VK3A 5HZHA 5HW3A 3M2KA 4QHCA 1S4SA 2JC7A 2NUTC 1F2KA 3LGOA 4HIAA 2XFTA 3W4QA 3O86A 4HJ3A 4P6ZS 4BENA 1MBLA 3E2KA 1YM1A 4BLMA 1NJ4A 2W3FA 2PU2A 1J3WA 4I3AA 4ZAMA 5FA7A 2VV6A 5FEFA 3VMAA 2XEPA 1ZG6A 5EECA 1ERQA 1FCOA 4Y0TA 2VLGA 1LT0A 3FPVA 4BQMA 3A0VA 3BEBA 2QHKA 3E2LA 1E3UA 2K2NA 4WM9A 2PHYA 4DXCA 1DRMA 2Y2IA 2J3TD 2OSUA 3A0RA 2PBDP 3GR2A 5L07A 1LSWA 3A3JA 4LV3A 3QP5A 4XT2B 5KIZA 3NOTC 2HDUA 3V50A 1OTEA 3IF5A 5EFWA 1SCWA 4HEFA 1Y28A 3LI9A 1XGIA 2L4RA 5A93A 1G28A 2QJ7A 2P9VA 1PFLA 2EFUA 2YKFA 1UGUA 2WGWA 4NXBA 1NRFA 4HESA 2VV8A 3C8CA 2HDSA 3ZG0A 2W0NA 5L8MA 2NUPC 2Y2LA 2DNSA 2ZC4B 3LICA 3EEHA 3GECA 1BLSA 3PXPA 3LI8A 2ZBBA 1GSVA 4WEJA 4EW7A 4FH2A 1ESUA 2G2UA 2Y91A 2PT7A 1LL8A 3G4PA 4ZBEA 1MY8A 3HLEA 1O07A 1YPRA 4CLCC 1L2SA 1KDWA 5F69A 4FD8A 4OONA 3N6IA 4YINA 1WA9A 5J4EA 4UEYA 3DTMA 3LR0A 5LBRA 4X56A 5GHXA 4LV0A 2OWJA 3O5YA 4XUXA 1S4RA 3BY9A 2OV5A 5DJTA 4JKTA 1L3LA 2PYRA 5CGSA 1T1AA 2D02A 1CF0A 3LIAA 1M6KA 2Y4AA 4Q8IA 1YMSA 2W3HA 3NDEA 1CEGA 2QWSA 1LLBA 4EUVA 5CECA 3H82B 5CXWA 5GLCA 3VOZA 1YLPA 5J3WA 3NY4A 2X71A 4MNRA 3OPHA 4O8GA 4E3NA 3NDGA 4Y13A 2XLNA 4PM8A 4BD1A 4BJPA 4GD6A 5TFQA 5GLDA 4DE0A 2BASA 3RH8B 2EX9A 3DWZA 4ZRRA 3CI6A 3BFFA 1OTDA 4UQIS 4EQ1A 4JF4A 2KLIA 3BFDA 5JYOA 3A3DA 1XJ4A 3ISGA 2V2FF 4BD0A 1PWGA 1ERMA 2WUQA 3PHYA 4E6XA 4PM7A 3P98A 3C4PA 1YKDA 3DW0A 4RX3A 2PRFA 4WL9A 3D3OA 4A5RA 4QB8A 3UE3A 2XA7S 2HDRA 1GA0A 3ZFZA 1PW8A 4GD8A 2B02A 2JKRM 4OQHA 3PR6A 1L0DA 1FSYA 2Y59A 2V1BA 3IH9A 4II7A 3O3VA 2L0WA 1E25A 1PWCA 1VETB 2C6WB 1XXMA 1TDLA 1RP5A 3ZNYA 4E3LA 3BY8A 4N1HA 5IU1A 2VGJA 5EE8A 5GL9A 2Y2JA 5HAIA 1I2SA 1JWZA 1S6RA 4JGRA 3O87A 4EUZA 3MZFA 1KVMA 3CHWP 1PIOA 2K31A 3QHYA 4X25A 3V3SA 3MR0A 2DMWA 2LB9A 3UB7A 2Z2MB 1SHVA 1PWDA 3ZGAB 3LO7A 4KZ8A 5DKKA 5HWWA 5DKLA 1LSVA 2DCFA 4MN5A 1QMFA 3ZG7B 3BFEA 2J7VA 2QZ6A 2Y2HA 2ACGA 1ZKJA 3B33A 5EVIC 3MMHA 1FIKA 4LLOB 4S2LA 1ACFA 3ZG5A 1XP4A 4CLCB 3FPWA 3IF6A 2E8IA 4F94A 3HL9A 2JHEA 3LIEA 3C4OA 2ZQDA 3T4TA 4DE3A 3LIBA 1MKMA 3PAGA 4KG5A 4R23A 1K0KA 1NXYA 5DJUA 3DTEA 3KSIA 3IXDA 4OQIA 4MEZA 4CLCE 3T50A 2DRWA 5AQ7A 3BJNA 2FZ0A 3DAVA 3LR3A 1BLCA 4R4SA 2Y2QA 4R3BA 4O01A 4KZBA 3VP3A 4NXEA 4KG6A 4O0PA 4BL2A 1UWPX 1DP6A 3U2AA 3D72A 3T4JA 4NK3A 1DP8A 3G6OA 4PMAA 4R70A 2ZJ9A 4CLCA 2V0WA 4QY6A 1PRQA 2R9XA 4L9FA 5U47A 1K56A 5CX7A 3OC2A 4PM6A 3UPNA 1MKIA 2KX6A 1ESIA 1FCNA 4AFIA 4QU3A 1GSWA 2XQZA 4JXWA 4OOYA 2VZWA 3EGXC 1OT6A 4H6JB 2B5RA 4H8RA 5HWVA 3IXBA 2Y2GA 1XFNA 4D60A 4I3JA 3CAXA 1XA7A 1V9ZA 1JTDA 1YSQA 1FSWA 2XD1A 4RQ9A 5E2FA 1RGZA 4EV4A 4OQGA 4D2OA 3CLOA 2H10A 4RX2A 3A3FA 2K7SA 4FUWA 4JF6A 2C5WB 1Y4OA 2V8FA 4R0QA 2JN7A 2XF3A 2Z6DA 2A24A 4GKUA 4LGWA 4KQDA 3MFXA 2XSSA 1LHYA 3QNCA 4IUHA 4N9LA 2GNXA 1G6AA 1W63Q 2WKPA 2JKTM 4ID4A 2HPBA 3RFBA 3E4OA 2ZQAA 1KGFA 1YAXA 4K0WA 1S0WA 2WZZA 3TOIA 1BSGA 1LL9A 4KZAA 2X01A 5D3OA 5EVIB 3ZG9B 1HD8A 2ZM2A 4EEUA 4S2PA 1L0EA 2RCXA 3ZHHA 4HH2A 3CUEC 3LY3A 4JXVA 3KO6A 2VJWA 5CGXA 3IXGA 3FZCA 5FAQA 2J3WA 3KSGA 2Y2NA 3QP6A 4GHIA 3G32A 1LSXA 3PBTA 4PAUA 3DBAA 3DWKA 3NULA 2XA7M 5FI7A 4JPMA 4EESA 3BYDA 2WGVA 3G2YA 3NI9A 4X53A 1FR6A 2Y2PA 4GDBA 3QP1A 1N9BA 1DJCA 1XX2A 5FQIA 1LI0A 1MXOA 5A92A 1WE4A 2O9CA 2A2LA 3ULFA 3UE1A 3ZNTA 4FCFA 4ESPA 5DF7A 1TS8A 5TBMA 1GA9A 1K6SA 4WN5A 4BWIA 3ITBA 3HLCA 1TS7A 4Q0IA 2W1TA 5CHJA 2QJ5A 3G30A 4E3KA 3MQ0A 2P9VB 5EVIA 2HF6A 3M2JA 2HGVA 2WGWB 4ZDXA 4M4XA 3GTCA 3ZVTA 2WAFA 2ZOIA 1XJ6A 4KUKA 3VSKA 1JVJA 3C30A 2W27A 5GLAA 1BUEA 1Q2QA 5G4ZA 3HUMA 4EEPA 4K91A 4Y0UA 4OQ0A 4MBFA 4MBKA 3IHBA 5HSQA 1BYWA 1SKFA 3I7JA 3IS2A 1TD5A 1GHIA 3OCNA 3MXQA 3MSHA 2Y2KA 2FFYA 1M40A 1OTBA 3IF6C 3TW8A 2P74A 4WF0A 4HP9A 1NYYA 2HP9A 2PD7A 2RL3A 3HBRA 3NC8A 2BLSA 4LRXC 2J80A 4CJNA 4BBTA 1YLWA 3BFCA 3BLMA 3N4IA 5GHZA 4I5SA 4GCZA 4R38A 4GDNA 4X55A 2WADA 4S2OA 3V67A 4M3KA 1P0ZA 1TVFA 2FFFB 3IX8A 3KSHA 4DE2A 4KZ4A 5A8BA 3T4OA 5IS1A 1AXBA 2IWBA 5FI2A 5HWTA 1ODVA 5E2HA 5FI6A 3QNBA 1I5QA 2PD8A 4E04A 3LFVA 3BRMA 4Y7PA 1MWSA 4WELA 1E3UD 3G35A 3F1OA 3PBNA 2J9OA 4KZ9A 4OP5A 4G3WA 4LRYC 2QPNA 1MC0A 5C5KA 3T1XA 2O9BA 3VFHA 1KGEA 2HP6A 1IEMA 3OPRA 4ME4A 3BW6A 5GHYA 4ZJ2A 5AVEA 4OOLA 1W79A 1PYYA 3P01A 3T1QB 1EWZA 3NBLA 2G7UA 4X68A 4HBUA 4HY8A 2I72A 1ZHHB 2Z2LB 2ZC5B 1NZUA 3BECA 4HHDA 4JLFA 1LL5A
chains in the Genus database with same CATH topology
3WS0A 1JWVA 4N1XA 4UAAA 1XPBA 4S2LA 1Z6FA 3N8SA 3ZG5A 4OKPA 5CTNA 5FQJA 3C7VA 3PTEA 1XP4A 4E6WA 3UDIA 4DXBA 2IWDA 1MPLA 1CEFA 4OOMA 1K54A 3BLSA 3IHAA 4E3OA 4C6YA 3IF6A 2E8IA 4F94A 5FSRA 3WS5A 1K25A 3G34A 4OLGA 4PM9A 2G2WA 3HL9A 4S2NA 5EOEA 5HFOA 2ZMAA 3M6HA 3FKVA 2EXAA 3ZDJA 4GZBA 4OLDA 3M6BA 3C4OA 1W5DA 2ZQDA 2WKIA 3D4FA 4R1GA 2ZD8A 5EVID 4DE3A 2ZM8A 1RGYA 3HLBA 1W7FA 2Q9NA 1EI5A 3PAGA 4KG5A 1YLTA 3GMWA 1IYQA 3MFDA 2XH9A 3PBSA 4R23A 4S2KA 1NXYA 5G18A 3GVBA 3N8RA 2X02A 4QY5A 5HAQA 4XXRA 2EX6A 3TSGA 4LENA 3IXDA 1OMEA 5CHMA 4OQIA 3SH8A 5F1GA 3GQZA 5FATA 4MEZA 1C3BA 2XGNA 1IYPA 3G2ZA 2DRWA 1ZG4A 5AQ7A 1IELA 1TDGA 1HZOA 1BLCA 2OLUA 4R4SA 1PZPA 4EBNA 3GSGA 1YT4A 3VP0A 5FQQA 3CMZA 2Y2QA 4R3BA 4WZ4A 4QJGA 3EQVA 3Q7ZA 5E43A 4KZBA 3VP3A 1YLZA 4FSFA 3RXXA 4KG6A 4BL3A 3OPLA 4BL2A 1DJAA 2JCHA 4DKIA 2EFXA 4KQQA 5AQ9A 3IF6B 2Y2OA 4WYYA 1CK3A 4KZ7A 1E4DA 1QMEA 1VM1A 3SH9A 4Y0OA 4NK3A 5F83A 1WYCA 5BOHA 3S22A 4EBLA 1I2WA 2EXBA 4PMAA 3Q82A 4KQRA 1TEMA 4P0MA 5L2FA 4X69A 1FOFA 5GLBA 1JTGA 4HBTA 4OPQA 2WKHA 2XK1A 2ZJ9A 4OH0A 3HUOA 3V3RA 4QY6A 3TG9A 2R9XA 3IXHA 5EUAA 4ZJ1A 5TR7A 3O88A 1BULA 3LY4A 3AGDA 4OPRA 5U47A 1K56A 3SS3A 3W4PA 2ZLYA 3OC2A 4PM6A 1SDNA 4UA9A 1MWTA 4S2IA 4UA7A 4LV2A 1MKIA 5DVAA 3UPNA 1ESIA 1FCNA 3FV7A 3PBRA 1L0FA 4QU3A 4WZ5A 4JXSA 4EWFA 2XQZA 1FCMA 4JXWA 1NZOA 1N4OA 3CJMA 4OOYA 5AQBA 1CI9A 2CC1A 1ES5A 3HLFA 2WZXA 5AQAA 4Z9QA 5FQKA 1H8YA 1K4EA 1K55C 3CG5A 2OLVA 5EVLA 1MWRA 5CERA 3UDFA 2B5RA 3WS4A 3HLGA 4H8RA 1GHMA 3IXBA 4FH4A 1SDEA 3SS4A 4JBFA 5CTMA 2IWCA 2Y2GA 2ZC7A 5KSCA 4OPZA 3IWIA 5DF9A 1XA7A 4N9KA 4XUZA 5HX9A 3UNWA 3SS5A 4C3QA 1IKGA 1JTDA 1FSWA 4QD4A 4DDYA 1ES4A 2XD1A 4R4RA 5M1AA 5E2FA 1RGZA 2XD5A 5HW3A 4EV4A 3M2KA 4OQGA 4P6BA 1K38A 4QHCA 5M18A 4GB7A 4D2OA 2ZC3B 4C75A 2H10A 4RX2A 5IHVA 3WWXA 5A90A 5J8XA 3A3FA 4GNUA 2JC7A 2ZC6B 4KENB 4JF6A 2C5WB 2XFTA 4WMCA 3W4QA 3ZCZA 3O86A 4IBRA 2PBYA 1K57A 4BENA 4R0QA 4ZJ3A 1MBLA 2XF3A 4GKUA 3E2KA 1YM1A 3LEZA 4BLMA 1NJ4A 4ZAMA 2PU2A 5FA7A 3MZEA 1H8ZA 3UO9A 1BT5A 3VMAA 2XEPA 1O7EA 1ZG6A 5EECA 1ERQA 1FCOA 1WYBA 3W4OA 2EX8A 4Y0TA 1H5XA 1LHYA 4BQMA 3QNCA 2HP5A 4N9LA 1K54C 3BEBA 1G6AA 4ID4A 2HPBA 3E2LA 1E3UA 2ZQAA 3N8LA 1KGFA 4K0WA 1FR1A 2EX2A 4KG2A 4S2NC 1S0WA 4YFMA 2WZZA 3TOIA 1BSGA 1LL9A 4KZAA 4WM9A 1ONGA 2X01A 5D3OA 5EVIB 4DRTA 4DXCA 2Y2MA 2Y2IA 4JF5A 3ZG9B 3ZVWA 1HD8A 2ZM2A 2OSUA 4S2PA 5FDHA 5TGFA 1ALQA 4WBGA 5DTKA 1L0EA 2RCXA 3ZHHA 3GR2A 1PZOA 3A3JA 4LV3A 3AGEA 3LY3A 4JXVA 1PW1A 2HDUA 3V50A 1ES3A 1GCEA 3IF5A 4DE1A 5CGXA 1SCWA 3IXGA 4HEFA 5E2EA 3FZCA 5FAQA 4OVDA 2VGKA 1XGIA 1PI4A 5A93A 2Y2NA 4OP8A 2P9VA 2EFUA 3BFGA 3G32A 5CHUA 2WGWA 5FASA 1NRFA 3PBTA 4HESA 3PBOA 3SH7A 3DWKA 1EROA 2HDSA 4IEDA 1PI5A 4JPMA 5FI7A 3ZG0A 3AGFA 1ES2A 4LCMA 3BYDA 2WK0A 2WGVA 2Y2LA 5HAPA 2DNSA 2ZC4B 3G2YA 3GRJA 3NI9A 1K4FA 4X53A 3C5AA 3UN7A 1FR6A 1BLSA 2Y2PA 4GDBA 3VP2A 4WEJA 3MXSA 5KMWA 1N9BA 5HARA 3RJUA 1KDSA 1DJCA 1ESUA 1XX2A 1MWUA 1YLJA 1YMXA 1LI0A 1MXOA 2GDNA 3OZHA 5F82A 5FQIA 5A92A 1WE4A 4EQIA 3FYZA 2G2UA 2Y91A 5FQ9A 2JBFA 3G4PA 4ZBEA 3UE1A 1MY8A 3ZNTA 3HLEA 4FCFA 4UA6A 5DF7A 1O07A 4P85A 2V20A 4KZ3A 1GA9A 1L2SA 1KDWA 3UPPA 1K6SA 4FD8A 1FQGA 3N6IA 4OONA 3ITBA 4S2JA 4YINA 4EBPA 3HLCA 3MBZA 5CRFA 3DTMA 3HUNA 1ONHA 4X56A 1KE4A 1NYMA 5CHJA 3NCKA 3HVFA 4MLLA 2PU4A 4B4XA 3PAEA 1LI9A 5EPHA 1XA1A 3G30A 5GHXA 4WZ5C 4B4ZA 4LV0A 4XUXA 4DF6A 4S2MA 4E3KA 2P9VB 5EVIA 1KE3A 1G68A 1DJBA 3M2JA 2OV5A 3S1YA 2WGWB 4ZDXA 3GTCA 3WS1A 3ZVTA 2WAFA 4JKTA 3VSKA 5FQMA 1JVJA 3VP4A 5EOOA 5CGSA 4CPKA 4JXGA 5GLAA 1M6KA 1BUEA 1Q2QA 3HUMA 3A3IA 4LV1A 2Y4AA 4MBHA 5FAPA 4Q8IA 4K91A 4Y0UA 1YMSA 1W8QA 3NDEA 4OQ0A 1CEGA 4OPYA 1K56D 1LLBA 4E3MA 3MXRA 4MBFA 5CECA 4MBKA 3IHBA 5CXWA 2H0YA 5GLCA 1YLPA 3VOZA 1SKFA 3NY4A 3I7JA 5DF8A 5DTTA 3IWOA 2WYXA 2X71A 5CEBA 4MNRA 1GHIA 3OPHA 3OCNA 3Q7VB 4E3NA 3NDGA 2XLNA 4PM8A 4BD1A 4BJPA 2Y2KA 4GD6A 1HTZA 4NETA 5TFQA 5GLDA 2FFYA 1BZAA 4DE0A 4O7DA 1M40A 2EX9A 1GHPA 3DWZA 3IF6C 3WS2A 2P74A 2XFSA 1K57C 3VOYA 4KZ6A 3BFFA 3VFFA 2J8YA 1XKZA 2XDMA 2HP9A 1NYYA 4RVAA 2RL3A 3EQUA 3HBRA 3NC8A 2BLSA 4JF4A 1HVBA 1W8YA 4GOGA 4IVKA 3OPPA 1XGJA 3BFDA 4CJNA 5JYOA 4RYEA 4U0XA 1YLWA 3A3DA 3BFCA 3BLMA 3N4IA 2V1ZA 3G31A 5GHZA 1IKIA 3HLWA 3ISGA 3UPOA 1Y54A 3HREA 4KQOA 2V2FF 4BD0A 3V39A 1PWGA 4E3IA 4PM5A 1ERMA 3CZDA 3V5MA 3IQAA 4GDNA 4X55A 2WUQA 3LCEA 4LCLA 4UHUA 4E6XA 4PM7A 2WADA 3P98A 3MKFA 4S2OA 3VSLA 3C4PA 4M3KA 1TVFA 2FFFB 3SOIA 1L0GA 4DE2A 4WMCD 1U60A 3PBQA 3DW0A 5A91A 4KZ4A 4RX3A 4R3JA 1AXBA 4P87A 5CGWA 4PPRA 3Q1FA 5FI2A 2IWBA 2A3UA 5E2HA 5FI6A 4A5RA 2WKEA 1KGGA 3IH8A 4QB8A 5CEDA 3UE3A 2HDRA 1GA0A 3QNBA 1I5QA 5FAOA 4ZTKA 3ZFZA 1PW8A 2WAEA 3GV9A 2H0TA 3BRMA 4KZ5A 4GD8A 4OQHA 4Y7PA 3FKWA 3B3XA 1MWSA 1IYOA 3S4XA 4WELA 3WRTA 1L0DA 2R9WA 1FSYA 2Y59A 4E3JA 3W8KA 1E3UD 1Q2PA 1YQSA 3IH9A 2WGIA 3UY6A 3O3VA 4DDSA 2XR0A 3RXWA 1E25A 1PWCA 1DY6A 3G35A 2BG1A 2C6WB 1BLPA 1XXMA 3PBNA 2J9OA 1TDLA 1RP5A 4KZ9A 3ZNYA 4E3LA 5F1FA 4OP5A 4N1HA 1KE0A 3IWQA 2ZQCA 2QPNA 4RA7A 2VGJA 1ZC2A 5EE8A 4IBXA 2HDQA 3N7WA 5GL9A 5KZHA 2Y2JA 1K55A 3Q7VA 3P09A 4IVIA 4U3TA 5HAIA 3ZG8B 1I2SA 2UWXA 1JWZA 2JE5A 3VFHA 1S6RA 1K6RA 3FWLA 1KGEA 2J9PA 3HLDA 3C7UA 2HP6A 2ZQ7A 4L0LA 1IEMA 3MKEA 3O87A 5M19A 4U0TA 2QMIA 1BTLA 3MZFA 4EUZA 1KVMA 1PIOA 3QHYA 5E2GA 2Y55A 1YLYA 3OPRA 4WEKA 5KSHA 5GHYA 4ZJ2A 2ZQ8A 3VP1A 4K0XA 3V3SA 2Q9MA 4N92A 3WRZA 3A3EA 2Z2MB 4OOLA 1JWPA 2H5SA 5JYPA 1SHVA 1W79A 1PWDA 1PYYA 2ZQ9A 3OCLA 4GN2A 5DTSA 1KVLA 3BM6A 3Q07A 3ZGAB 1EWZA 1VQQA 1J9MA 3LO7A 4KZ8A 1BLHA 3UDXA 1RCJA 4FH2A 3ITAA 3Q81A 5I94A 3NBLA 1NY0A 2DCFA 4X68A 3NIAA 4HBUA 2I72A 1IYSA 3UE0A 1QMFA 3JYIA 2ZM0A 2Z2LB 3ZG7B 1CI8A 3IT9A 5HL1A 2ZC5B 1NZUA 2A49A 3BECA 4X6TA 3BFEA 2J7VA 2QZ6A 2Y2HA 5EVIC 1ZKJA 4B88A 3MZDA 4JLFA 1LL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS0 A;  1JWV A;  4N1X A;  4UAA A;  1XPB A;  4S2L A;  1Z6F A;  3N8S A;  3ZG5 A;  4OKP A;  5CTN A;  5FQJ A;  3C7V A;  3PTE A;  1XP4 A;  4E6W A;  3UDI A;  4DXB A;  2IWD A;  1MPL A;  1CEF A;  4OOM A;  1K54 A;  3BLS A;  3IHA A;  4E3O A;  4C6Y A;  3IF6 A;  2E8I A;  4F94 A;  5FSR A;  3WS5 A;  1K25 A;  3G34 A;  4OLG A;  4PM9 A;  2G2W A;  3HL9 A;  4S2N A;  5EOE A;  5HFO A;  2ZMA A;  3M6H A;  3FKV A;  2EXA A;  3ZDJ A;  4GZB A;  4OLD A;  3M6B A;  3C4O A;  1W5D A;  2ZQD A;  2WKI A;  3D4F A;  4R1G A;  2ZD8 A;  5EVI D;  4DE3 A;  2ZM8 A;  1RGY A;  3HLB A;  1W7F A;  2Q9N A;  1EI5 A;  3PAG A;  4KG5 A;  1YLT A;  3GMW A;  1IYQ A;  3MFD A;  2XH9 A;  3PBS A;  4R23 A;  4S2K A;  1NXY A;  5G18 A;  3GVB A;  3N8R A;  2X02 A;  4QY5 A;  5HAQ A;  4XXR A;  2EX6 A;  3TSG A;  4LEN A;  3IXD A;  1OME A;  5CHM A;  4OQI A;  3SH8 A;  5F1G A;  3GQZ A;  5FAT A;  4MEZ A;  1C3B A;  2XGN A;  1IYP A;  3G2Z A;  2DRW A;  1ZG4 A;  5AQ7 A;  1IEL A;  1TDG A;  1HZO A;  1BLC A;  2OLU A;  4R4S A;  1PZP A;  4EBN A;  3GSG A;  1YT4 A;  3VP0 A;  5FQQ A;  3CMZ A;  2Y2Q A;  4R3B A;  4WZ4 A;  4QJG A;  3EQV A;  3Q7Z A;  5E43 A;  4KZB A;  3VP3 A;  1YLZ A;  4FSF A;  3RXX A;  4KG6 A;  4BL3 A;  3OPL A;  4BL2 A;  1DJA A;  2JCH A;  4DKI A;  2EFX A;  4KQQ A;  5AQ9 A;  3IF6 B;  2Y2O A;  4WYY A;  1CK3 A;  4KZ7 A;  1E4D A;  1QME A;  1VM1 A;  3SH9 A;  4Y0O A;  4NK3 A;  5F83 A;  1WYC A;  5BOH A;  3S22 A;  4EBL A;  1I2W A;  2EXB A;  4PMA A;  3Q82 A;  4KQR A;  1TEM A;  4P0M A;  5L2F A;  4X69 A;  1FOF A;  5GLB A;  1JTG A;  4HBT A;  4OPQ A;  2WKH A;  2XK1 A;  2ZJ9 A;  4OH0 A;  3HUO A;  3V3R A;  4QY6 A;  3TG9 A;  2R9X A;  3IXH A;  5EUA A;  4ZJ1 A;  5TR7 A;  3O88 A;  1BUL A;  3LY4 A;  3AGD A;  4OPR A;  5U47 A;  1K56 A;  3SS3 A;  3W4P A;  2ZLY A;  3OC2 A;  4PM6 A;  1SDN A;  4UA9 A;  1MWT A;  4S2I A;  4UA7 A;  4LV2 A;  1MKI A;  5DVA A;  3UPN A;  1ESI A;  1FCN A;  3FV7 A;  3PBR A;  1L0F A;  4QU3 A;  4WZ5 A;  4JXS A;  4EWF A;  2XQZ A;  1FCM A;  4JXW A;  1NZO A;  1N4O A;  3CJM A;  4OOY A;  5AQB A;  1CI9 A;  2CC1 A;  1ES5 A;  3HLF A;  2WZX A;  5AQA A;  4Z9Q A;  5FQK A;  1H8Y A;  1K4E A;  1K55 C;  3CG5 A;  2OLV A;  5EVL A;  1MWR A;  5CER A;  3UDF A;  2B5R A;  3WS4 A;  3HLG A;  4H8R A;  1GHM A;  3IXB A;  4FH4 A;  1SDE A;  3SS4 A;  4JBF A;  5CTM A;  2IWC A;  2Y2G A;  2ZC7 A;  5KSC A;  4OPZ A;  3IWI A;  5DF9 A;  1XA7 A;  4N9K A;  4XUZ A;  5HX9 A;  3UNW A;  3SS5 A;  4C3Q A;  1IKG A;  1JTD A;  1FSW A;  4QD4 A;  4DDY A;  1ES4 A;  2XD1 A;  4R4R A;  5M1A A;  5E2F A;  1RGZ A;  2XD5 A;  5HW3 A;  4EV4 A;  3M2K A;  4OQG A;  4P6B A;  1K38 A;  4QHC A;  5M18 A;  4GB7 A;  4D2O A;  2ZC3 B;  4C75 A;  2H10 A;  4RX2 A;  5IHV A;  3WWX A;  5A90 A;  5J8X A;  3A3F A;  4GNU A;  2JC7 A;  2ZC6 B;  4KEN B;  4JF6 A;  2C5W B;  2XFT A;  4WMC A;  3W4Q A;  3ZCZ A;  3O86 A;  4IBR A;  2PBY A;  1K57 A;  4BEN A;  4R0Q A;  4ZJ3 A;  1MBL A;  2XF3 A;  4GKU A;  3E2K A;  1YM1 A;  3LEZ A;  4BLM A;  1NJ4 A;  4ZAM A;  2PU2 A;  5FA7 A;  3MZE A;  1H8Z A;  3UO9 A;  1BT5 A;  3VMA A;  2XEP A;  1O7E A;  1ZG6 A;  5EEC A;  1ERQ A;  1FCO A;  1WYB A;  3W4O A;  2EX8 A;  4Y0T A;  1H5X A;  1LHY A;  4BQM A;  3QNC A;  2HP5 A;  4N9L A;  1K54 C;  3BEB A;  1G6A A;  4ID4 A;  2HPB A;  3E2L A;  1E3U A;  2ZQA A;  3N8L A;  1KGF A;  4K0W A;  1FR1 A;  2EX2 A;  4KG2 A;  4S2N C;  1S0W A;  4YFM A;  2WZZ A;  3TOI A;  1BSG A;  1LL9 A;  4KZA A;  4WM9 A;  1ONG A;  2X01 A;  5D3O A;  5EVI B;  4DRT A;  4DXC A;  2Y2M A;  2Y2I A;  4JF5 A;  3ZG9 B;  3ZVW A;  1HD8 A;  2ZM2 A;  2OSU A;  4S2P A;  5FDH A;  5TGF A;  1ALQ A;  4WBG A;  5DTK A;  1L0E A;  2RCX A;  3ZHH A;  3GR2 A;  1PZO A;  3A3J A;  4LV3 A;  3AGE A;  3LY3 A;  4JXV A;  1PW1 A;  2HDU A;  3V50 A;  1ES3 A;  1GCE A;  3IF5 A;  4DE1 A;  5CGX A;  1SCW A;  3IXG A;  4HEF A;  5E2E A;  3FZC A;  5FAQ A;  4OVD A;  2VGK A;  1XGI A;  1PI4 A;  5A93 A;  2Y2N A;  4OP8 A;  2P9V A;  2EFU A;  3BFG A;  3G32 A;  5CHU A;  2WGW A;  5FAS A;  1NRF A;  3PBT A;  4HES A;  3PBO A;  3SH7 A;  3DWK A;  1ERO A;  2HDS A;  4IED A;  1PI5 A;  4JPM A;  5FI7 A;  3ZG0 A;  3AGF A;  1ES2 A;  4LCM A;  3BYD A;  2WK0 A;  2WGV A;  2Y2L A;  5HAP A;  2DNS A;  2ZC4 B;  3G2Y A;  3GRJ A;  3NI9 A;  1K4F A;  4X53 A;  3C5A A;  3UN7 A;  1FR6 A;  1BLS A;  2Y2P A;  4GDB A;  3VP2 A;  4WEJ A;  3MXS A;  5KMW A;  1N9B A;  5HAR A;  3RJU A;  1KDS A;  1DJC A;  1ESU A;  1XX2 A;  1MWU A;  1YLJ A;  1YMX A;  1LI0 A;  1MXO A;  2GDN A;  3OZH A;  5F82 A;  5FQI A;  5A92 A;  1WE4 A;  4EQI A;  3FYZ A;  2G2U A;  2Y91 A;  5FQ9 A;  2JBF A;  3G4P A;  4ZBE A;  3UE1 A;  1MY8 A;  3ZNT A;  3HLE A;  4FCF A;  4UA6 A;  5DF7 A;  1O07 A;  4P85 A;  2V20 A;  4KZ3 A;  1GA9 A;  1L2S A;  1KDW A;  3UPP A;  1K6S A;  4FD8 A;  1FQG A;  3N6I A;  4OON A;  3ITB A;  4S2J A;  4YIN A;  4EBP A;  3HLC A;  3MBZ A;  5CRF A;  3DTM A;  3HUN A;  1ONH A;  4X56 A;  1KE4 A;  1NYM A;  5CHJ A;  3NCK A;  3HVF A;  4MLL A;  2PU4 A;  4B4X A;  3PAE A;  1LI9 A;  5EPH A;  1XA1 A;  3G30 A;  5GHX A;  4WZ5 C;  4B4Z A;  4LV0 A;  4XUX A;  4DF6 A;  4S2M A;  4E3K A;  2P9V B;  5EVI A;  1KE3 A;  1G68 A;  1DJB A;  3M2J A;  2OV5 A;  3S1Y A;  2WGW B;  4ZDX A;  3GTC A;  3WS1 A;  3ZVT A;  2WAF A;  4JKT A;  3VSK A;  5FQM A;  1JVJ A;  3VP4 A;  5EOO A;  5CGS A;  4CPK A;  4JXG A;  5GLA A;  1M6K A;  1BUE A;  1Q2Q A;  3HUM A;  3A3I A;  4LV1 A;  2Y4A A;  4MBH A;  5FAP A;  4Q8I A;  4K91 A;  4Y0U A;  1YMS A;  1W8Q A;  3NDE A;  4OQ0 A;  1CEG A;  4OPY A;  1K56 D;  1LLB A;  4E3M A;  3MXR A;  4MBF A;  5CEC A;  4MBK A;  3IHB A;  5CXW A;  2H0Y A;  5GLC A;  1YLP A;  3VOZ A;  1SKF A;  3NY4 A;  3I7J A;  5DF8 A;  5DTT A;  3IWO A;  2WYX A;  2X71 A;  5CEB A;  4MNR A;  1GHI A;  3OPH A;  3OCN A;  3Q7V B;  4E3N A;  3NDG A;  2XLN A;  4PM8 A;  4BD1 A;  4BJP A;  2Y2K A;  4GD6 A;  1HTZ A;  4NET A;  5TFQ A;  5GLD A;  2FFY A;  1BZA A;  4DE0 A;  4O7D A;  1M40 A;  2EX9 A;  1GHP A;  3DWZ A;  3IF6 C;  3WS2 A;  2P74 A;  2XFS A;  1K57 C;  3VOY A;  4KZ6 A;  3BFF A;  3VFF A;  2J8Y A;  1XKZ A;  2XDM A;  2HP9 A;  1NYY A;  4RVA A;  2RL3 A;  3EQU A;  3HBR A;  3NC8 A;  2BLS A;  4JF4 A;  1HVB A;  1W8Y A;  4GOG A;  4IVK A;  3OPP A;  1XGJ A;  3BFD A;  4CJN A;  5JYO A;  4RYE A;  4U0X A;  1YLW A;  3A3D A;  3BFC A;  3BLM A;  3N4I A;  2V1Z A;  3G31 A;  5GHZ A;  1IKI A;  3HLW A;  3ISG A;  3UPO A;  1Y54 A;  3HRE A;  4KQO A;  2V2F F;  4BD0 A;  3V39 A;  1PWG A;  4E3I A;  4PM5 A;  1ERM A;  3CZD A;  3V5M A;  3IQA A;  4GDN A;  4X55 A;  2WUQ A;  3LCE A;  4LCL A;  4UHU A;  4E6X A;  4PM7 A;  2WAD A;  3P98 A;  3MKF A;  4S2O A;  3VSL A;  3C4P A;  4M3K A;  1TVF A;  2FFF B;  3SOI A;  1L0G A;  4DE2 A;  4WMC D;  1U60 A;  3PBQ A;  3DW0 A;  5A91 A;  4KZ4 A;  4RX3 A;  4R3J A;  1AXB A;  4P87 A;  5CGW A;  4PPR A;  3Q1F A;  5FI2 A;  2IWB A;  2A3U A;  5E2H A;  5FI6 A;  4A5R A;  2WKE A;  1KGG A;  3IH8 A;  4QB8 A;  5CED A;  3UE3 A;  2HDR A;  1GA0 A;  3QNB A;  1I5Q A;  5FAO A;  4ZTK A;  3ZFZ A;  1PW8 A;  2WAE A;  3GV9 A;  2H0T A;  3BRM A;  4KZ5 A;  4GD8 A;  4OQH A;  4Y7P A;  3FKW A;  3B3X A;  1MWS A;  1IYO A;  3S4X A;  4WEL A;  3WRT A;  1L0D A;  2R9W A;  1FSY A;  2Y59 A;  4E3J A;  3W8K A;  1E3U D;  1Q2P A;  1YQS A;  3IH9 A;  2WGI A;  3UY6 A;  3O3V A;  4DDS A;  2XR0 A;  3RXW A;  1E25 A;  1PWC A;  1DY6 A;  3G35 A;  2BG1 A;  2C6W B;  1BLP A;  1XXM A;  3PBN A;  2J9O A;  1TDL A;  1RP5 A;  4KZ9 A;  3ZNY A;  4E3L A;  5F1F A;  4OP5 A;  4N1H A;  1KE0 A;  3IWQ A;  2ZQC A;  2QPN A;  4RA7 A;  2VGJ A;  1ZC2 A;  5EE8 A;  4IBX A;  2HDQ A;  3N7W A;  5GL9 A;  5KZH A;  2Y2J A;  1K55 A;  3Q7V A;  3P09 A;  4IVI A;  4U3T A;  5HAI A;  3ZG8 B;  1I2S A;  2UWX A;  1JWZ A;  2JE5 A;  3VFH A;  1S6R A;  1K6R A;  3FWL A;  1KGE A;  2J9P A;  3HLD A;  3C7U A;  2HP6 A;  2ZQ7 A;  4L0L A;  1IEM A;  3MKE A;  3O87 A;  5M19 A;  4U0T A;  2QMI A;  1BTL A;  3MZF A;  4EUZ A;  1KVM A;  1PIO A;  3QHY A;  5E2G A;  2Y55 A;  1YLY A;  3OPR A;  4WEK A;  5KSH A;  5GHY A;  4ZJ2 A;  2ZQ8 A;  3VP1 A;  4K0X A;  3V3S A;  2Q9M A;  4N92 A;  3WRZ A;  3A3E A;  2Z2M B;  4OOL A;  1JWP A;  2H5S A;  5JYP A;  1SHV A;  1W79 A;  1PWD A;  1PYY A;  2ZQ9 A;  3OCL A;  4GN2 A;  5DTS A;  1KVL A;  3BM6 A;  3Q07 A;  3ZGA B;  1EWZ A;  1VQQ A;  1J9M A;  3LO7 A;  4KZ8 A;  1BLH A;  3UDX A;  1RCJ A;  4FH2 A;  3ITA A;  3Q81 A;  5I94 A;  3NBL A;  1NY0 A;  2DCF A;  4X68 A;  3NIA A;  4HBU A;  2I72 A;  1IYS A;  3UE0 A;  1QMF A;  3JYI A;  2ZM0 A;  2Z2L B;  3ZG7 B;  1CI8 A;  3IT9 A;  5HL1 A;  2ZC5 B;  1NZU A;  2A49 A;  3BEC A;  4X6T A;  3BFE A;  2J7V A;  2QZ6 A;  2Y2H A;  5EVI C;  1ZKJ A;  4B88 A;  3MZD A;  4JLF A;  1LL5 A; 
#chains in the Genus database with same CATH topology
 1JWV A;  3BQA A;  1XPB A;  4G3K A;  4HQA A;  3C7V A;  3PTE A;  4E6W A;  2IWD A;  4OOM A;  3IHA A;  4E3O A;  2W3G A;  4C6Y A;  5FSR A;  1Z09 A;  4WLA A;  1K25 A;  4PM9 A;  2G2W A;  2PAV P;  4GZB A;  4EET B;  4JGP A;  5AJG A;  2WKI A;  4MN6 A;  4R1G A;  1RGY A;  1H3Q A;  3NEC A;  3GMW A;  1IYQ A;  3MFD A;  2VKS A;  2XH9 A;  3CUE A;  5G18 A;  3GVB A;  3N8R A;  5HAQ A;  4QY5 A;  2M7V A;  2XRO A;  3D9Y A;  3SH8 A;  4MMN A;  1C3B A;  3E98 A;  2P04 A;  1IYP A;  2YKH A;  1ZG4 A;  2L1M A;  4EBN A;  1HZO A;  4G3V A;  1YT4 A;  3VP0 A;  4HH3 A;  4WZ4 A;  4QJG A;  3C38 A;  3EQV A;  4B93 A;  5E43 A;  4BL3 A;  3IX3 A;  1DJA A;  2EFX A;  3IF6 B;  2Y2O A;  3UB6 A;  5L09 A;  1YSP A;  1WYC A;  4HJ4 A;  1I2W A;  2EXB A;  2V9A A;  5L2F A;  4DJ2 A;  4OPQ A;  2XK1 A;  4OH0 A;  3V3R A;  3O88 A;  3W4P A;  1V9Y A;  2BTF P;  4JXS A;  4EWF A;  4HI4 A;  3NOP C;  1NZO A;  1W63 M;  1UWN X;  5AQB A;  1CI9 A;  5AQA A;  1ES5 A;  3HCY A;  2W1R A;  4Z9Q A;  1H8Y A;  3S7O A;  5CER A;  5EVL A;  3UDF A;  3LID A;  3H9W A;  3WS4 A;  3HLG A;  3SS4 A;  5CTM A;  4MDZ A;  3VE3 A;  2ZC7 A;  5KSC A;  3IWI A;  1VEU A;  3UNW A;  1T1B A;  3SS5 A;  5EM1 A;  1S1Y A;  4DDY A;  4R4R A;  2XD5 A;  2WKQ A;  4P6B A;  5M18 A;  2GX5 A;  2R78 A;  4GB7 A;  3BWL A;  4C75 A;  3RTY A;  5A90 A;  4GNU A;  4KEN B;  3R4K A;  4WMC A;  3ZCZ A;  4IBR A;  2J3T C;  2PBY A;  3LEZ A;  4GS9 A;  1H8Z A;  1O7E A;  4PKY A;  4LFU A;  1WYB A;  3W4O A;  1H5X A;  2HP5 A;  2V1A A;  2EX2 A;  2P7J A;  4QPR A;  2D01 A;  3UE6 A;  5TGF A;  1H0M A;  5DTK A;  5J7E A;  1TS0 A;  3BQ8 A;  2QKP A;  1PW1 A;  1ES3 A;  3MS6 A;  4DE1 A;  2V8C A;  2VGK A;  4MN7 A;  3EWK A;  1PI4 A;  1XJ2 A;  2A24 B;  1XJ3 A;  2QYB A;  2WKR A;  3BFG A;  4YNR A;  1ERO A;  1PI5 A;  3AGF A;  1ES2 A;  4NG2 A;  2WK0 A;  2HV1 A;  3DTI A;  1K4F A;  4NKP A;  4YOF A;  5KMW A;  5HAR A;  3RJU A;  1YMX A;  4I38 A;  1YLJ A;  2GDN A;  3OZH A;  1A0K A;  4EQI A;  3FYZ A;  5FQ9 A;  2JBF A;  2LB5 A;  4B9O A;  4IJG A;  4UA6 A;  4EU0 A;  2V20 A;  4EBP A;  4S2J A;  1MZU A;  1D7E A;  4KUO A;  1CQA A;  3NCK A;  4B4X A;  4MLL A;  3UB9 A;  1LI9 A;  5EPH A;  1XA1 A;  4WZ5 C;  4DF6 A;  4GHI B;  4X1L A;  2GJ3 A;  5FQM A;  3VP4 A;  5EOO A;  3NOU C;  4MBH A;  5FAP A;  4CLC D;  3NHQ A;  4OPY A;  1K56 D;  4E3M A;  1OJ5 A;  3KX0 X;  2OOL A;  2H0Y A;  2W3D A;  5DTT A;  2Y79 A;  2OAQ 1;  3OBF A;  5TBM B;  3LR5 A;  1HTZ A;  1N9O A;  3T4L A;  3OLO A;  1GHP A;  4ARZ B;  4L9E A;  2W1T B;  3WS2 A;  3ZYT A;  2XFS A;  1K57 C;  4KZ6 A;  3E4Q A;  4FTX A;  1XKZ A;  4HNB A;  2XDM A;  4RVA A;  3EQU A;  2XRN A;  1HVB A;  3IBJ A;  4GOG A;  5K5B A;  4IVK A;  1H8M A;  1XGJ A;  3LEQ A;  2V1Z A;  3HLW A;  2IA2 A;  1Y54 A;  4E3I A;  4DMZ A;  4GLQ A;  3V5M A;  3IQA A;  2ZOH A;  3KYZ A;  4UHU A;  3VSL A;  2V0U A;  3SOI A;  1OPX A;  1L0G A;  4R6L A;  1U60 A;  3S7N A;  5A91 A;  4P87 A;  5IT5 A;  3IS2 B;  3A0S A;  2WKE A;  3IH8 A;  5FAO A;  4ZTK A;  2WAE A;  3GV9 A;  2H0T A;  4KZ5 A;  3LYX A;  3FKW A;  3B3X A;  1IFQ A;  1IYO A;  3W2Z A;  3GDI A;  4E3J A;  3W8K A;  3UY6 A;  2WGI A;  2XR0 A;  3K2N A;  3RXW A;  4ETX A;  2BG1 A;  1S1Z A;  3IWQ A;  4RA7 A;  2ZQC A;  5KZH A;  2HDQ A;  4WUJ A;  2VEA A;  4IVI A;  3T4Q A;  3ZG8 B;  1K6R A;  3HLD A;  1OTA A;  3FWL A;  3C7U A;  5M19 A;  4U0T A;  2QMI A;  4ARZ A;  2INW A;  4Y15 A;  5E2G A;  2Y55 A;  1YLY A;  4WEK A;  2O0Y A;  3E4P A;  5JYP A;  1JWP A;  3OCL A;  5DTS A;  4GN2 A;  3Q07 A;  3ICY A;  1VQQ A;  1BLH A;  3UDX A;  2VGL S;  1RCJ A;  3ITA A;  5I94 A;  3S7Q A;  1IYS A;  2ZM0 A;  2M7U A;  2VA0 A;  3IT9 A;  4B88 A;  3MZD A;  3F1O B;  1NLY A;  4UAA A;  2ZL1 A;  1Z6F A;  1OJG A;  4PKY G;  4OKP A;  5CTN A;  5FQJ A;  3OOV A;  3UDI A;  4DXB A;  1CEF A;  2EWV A;  4OLG A;  5EOE A;  5HFO A;  2EXA A;  1P97 A;  4OLD A;  3M6B A;  1W5D A;  3D4F A;  3LUQ A;  2ZD8 A;  1T18 A;  5EVI D;  5L10 A;  2B18 A;  2Q0O A;  2H28 A;  1T19 A;  1DP9 A;  1W7F A;  2Q9N A;  3MF0 A;  4EXO A;  3PBS A;  3UMD A;  4S2K A;  2X02 A;  3VV4 A;  4XXR A;  2EX6 A;  3TSG A;  1N9N A;  4FOF A;  4LEN A;  3T1S A;  2P08 A;  1OME A;  5FAT A;  2XGN A;  3KSF A;  1TDG A;  2OLU A;  3IX4 A;  5F6A A;  5FQQ A;  4HOI A;  4BBV A;  4EER A;  4Y2F A;  3Q7Z A;  1YLZ A;  4FSF A;  3RXX A;  4DKI A;  5AQ9 A;  4WYY A;  1CK3 A;  1E4D A;  1QME A;  4LPZ A;  2HJ9 C;  1NRJ A;  1VM1 A;  3SH9 A;  3R7W B;  5F83 A;  2VX8 A;  5BOH A;  3S22 A;  4EBL A;  4NEE D;  3Q82 A;  4P0M A;  4K08 A;  4X69 A;  4CQH A;  1FOF A;  5GLB A;  1JTG A;  4PHT A;  3HUO A;  2Y8H A;  3IXH A;  5EUA A;  4ZJ1 A;  3LY4 A;  3SS3 A;  2ZLY A;  1SDN A;  4UA9 A;  1MWT A;  4S2I A;  4UA7 A;  5DVA A;  5I5L A;  4BBU A;  3PBR A;  4WZ5 A;  1FCM A;  3CJM A;  3T4S A;  3HLF A;  2WZX A;  5FQK A;  1AWI A;  1K55 C;  1MWR A;  1GHM A;  1SDE A;  4JBF A;  4Y5F A;  2IWC A;  4OPZ A;  5DF9 A;  3CPT B;  4N9K A;  2OWH A;  4XUZ A;  5F68 A;  2PR6 A;  3L7H A;  3JVV A;  1ES4 A;  5M1A A;  1K38 A;  5HD5 A;  3EEA A;  5AVF A;  2O9A A;  2ZC3 B;  4XT2 A;  5IHV A;  3WWX A;  5J8X A;  2ZC6 B;  4Q0J A;  1K57 A;  5G4Y A;  4ZJ3 A;  3R7W A;  3MZE A;  3UO9 A;  1BT5 A;  2EX8 A;  1K54 C;  1TF1 A;  3FG8 A;  3N8L A;  1FR1 A;  4KG2 A;  4S2N C;  4YFM A;  3E0Y A;  4F3L B;  5FEG A;  1VEU B;  1ONG A;  4JGO A;  4Y17 A;  4DRT A;  2Y2M A;  4JF5 A;  3ZVW A;  5FDH A;  1ALQ A;  4WBG A;  2GZA A;  1PZO A;  1CJF A;  3AGE A;  3QP4 A;  5DFY A;  2O99 A;  1JNU A;  1GCE A;  5E2E A;  2AVX A;  4MCW A;  4OVD A;  3CPT A;  4OP8 A;  4GS9 B;  4Y3I A;  5CHU A;  5FAS A;  3SH7 A;  3PBO A;  2JKR I;  5HDS A;  4IED A;  4LCM A;  3U4L P;  4DJ3 A;  5HAP A;  2M1C A;  3GRJ A;  1ZTU A;  1NWZ A;  3C5A A;  3UN7 A;  2ZMV A;  2I9V A;  3VP2 A;  3MXS A;  1GSX A;  4IUK A;  1KDS A;  1MWU A;  5F82 A;  1STZ A;  3H82 A;  3P7N A;  4Q0H A;  5HPF A;  2HJE A;  2PDR A;  4P85 A;  2JKF A;  3C2W A;  4KZ3 A;  3UPP A;  2KDK A;  1FQG A;  3UB8 A;  3B42 A;  3MBZ A;  5CRF A;  1S67 L;  3HUN A;  1ONH A;  1KE4 A;  1NYM A;  3HVF A;  2PU4 A;  3PAE A;  4F3L A;  4B4Z A;  4S2M A;  4I3I A;  1KE3 A;  2EA9 A;  1G68 A;  3H7W B;  1DJB A;  1P9R A;  3S1Y A;  4L9G A;  1G6O A;  3WS1 A;  1IOU A;  2W3E A;  2VGL M;  3IBR A;  4CPK A;  4JXG A;  3VE4 A;  3A3I A;  4LV1 A;  2PYP A;  4GW9 A;  1W8Q A;  3MXR A;  1HLU P;  4Z1W A;  3ZQ5 A;  5DF8 A;  3IWO A;  2WYX A;  5CEB A;  4YWZ A;  3Q7V B;  3TRC A;  1NLZ A;  4NET A;  3DTK A;  1BZA A;  4O7D A;  3JVU A;  4P6Z M;  3VOY A;  1F9I A;  3VFF A;  1VET A;  2J8Y A;  1D06 A;  3EGD C;  5EVE A;  1W8Y A;  3OPP A;  3LR4 A;  4RYE A;  4U0X A;  3G31 A;  1IKI A;  1OTI A;  3QP2 A;  1N9L A;  3LIF A;  3UPO A;  3HRE A;  4KQO A;  4PM5 A;  3V39 A;  2CMN A;  3CZD A;  4QWO A;  3LCE A;  4I39 A;  1VHM A;  4LCL A;  3MKF A;  1G5U A;  4WMC D;  5DFX A;  3PBQ A;  3SZT A;  3H7W A;  4R3J A;  5CGW A;  3L9K A;  4PPR A;  3Q1F A;  5EV0 A;  2FH5 A;  2A3U A;  1KGG A;  5CED A;  2E8J A;  2KOI A;  3T1R A;  5FL3 A;  3WRT A;  3S4X A;  2R9W A;  2B95 A;  1Q2P A;  1YQS A;  3CWF A;  3UB5 P;  4DDS A;  1DY6 A;  2Z6C A;  4LRZ E;  4JGQ A;  1BLP A;  4HJ6 A;  4IHQ A;  5F1F A;  1KE0 A;  3KYQ A;  2JKG A;  3HJK A;  2HZ5 A;  1ZC2 A;  4IBX A;  3N7W A;  1K55 A;  3Q7V A;  3P09 A;  4U3T A;  2UWX A;  2JE5 A;  2J9P A;  4L0L A;  4X1M A;  2UV0 E;  2MJ6 A;  2ZQ7 A;  3MKE A;  1BTL A;  1OT9 A;  5KSH A;  2ZQ8 A;  3VP1 A;  4K0X A;  2Q9M A;  4N92 A;  3WRZ A;  5HPI A;  3A3E A;  2H5S A;  3PYP A;  4R3A A;  2ZQ9 A;  1S66 L;  1KVL A;  3BM6 A;  3F1N B;  3FC7 A;  1J9M A;  1F98 A;  5HL6 A;  3EOI A;  2OAP 1;  3Q81 A;  1P9W A;  1NY0 A;  3NIA A;  3MQO A;  3TE8 A;  3UE0 A;  3JYI A;  4BMW A;  5HL1 A;  1CI8 A;  1T1C A;  1SKO B;  2A49 A;  4X6T A;  3WS0 A;  3VOL A;  4N1X A;  1D1J A;  3N8S A;  1EW0 A;  1MPL A;  1K54 A;  4GJ4 A;  5TJJ A;  3BLS A;  1XFQ A;  3WS5 A;  3G34 A;  4S2N A;  4DN0 A;  2ZMA A;  3M6H A;  3FKV A;  3ZDJ A;  3KYE A;  1SZV A;  5HD3 A;  3K3C A;  1TS6 A;  3T4K A;  3CIT A;  2ZM8 A;  3T12 B;  3B47 A;  2JKT I;  3HLB A;  1EI5 A;  3JPU A;  1YLT A;  2ZMF A;  1PNE A;  5HDD A;  3F1P B;  1VB6 A;  4UQI M;  5CHM A;  5F1G A;  3GQZ A;  3NJA A;  3UME A;  3G2Z A;  4ETZ A;  1IEL A;  2ZL1 B;  1PZP A;  3GSG A;  5FDS A;  3CMZ A;  3S7P A;  4H6J A;  3F1N A;  1KOU A;  3OPL A;  3SW1 A;  4HP4 A;  2JCH A;  4KQQ A;  4KZ7 A;  1SKO A;  4Y0O A;  3MJQ A;  4KQR A;  1TEM A;  5EM0 A;  5HDC A;  4HBT A;  2WKH A;  3TG9 A;  5TR7 A;  1BUL A;  4OPR A;  3AGD A;  4NXF A;  3K3D A;  2VV7 A;  1F5M A;  4LV2 A;  3TJZ C;  3FV7 A;  4NXG A;  1L0F A;  1N4O A;  5MC7 A;  2CC1 A;  1K4E A;  3CG5 A;  2OLV A;  1X0O A;  4FH4 A;  5F5Y A;  3QP8 A;  2EWW A;  3MQQ A;  2PR5 A;  3F1P A;  5HX9 A;  4C3Q A;  1IKG A;  4QD4 A;  1FIL A;  3HJI A;  2VK3 A;  5HZH A;  5HW3 A;  3M2K A;  4QHC A;  1S4S A;  2JC7 A;  2NUT C;  1F2K A;  3LGO A;  4HIA A;  2XFT A;  3W4Q A;  3O86 A;  4HJ3 A;  4P6Z S;  4BEN A;  1MBL A;  3E2K A;  1YM1 A;  4BLM A;  1NJ4 A;  2W3F A;  2PU2 A;  1J3W A;  4I3A A;  4ZAM A;  5FA7 A;  2VV6 A;  5FEF A;  3VMA A;  2XEP A;  1ZG6 A;  5EEC A;  1ERQ A;  1FCO A;  4Y0T A;  2VLG A;  1LT0 A;  3FPV A;  4BQM A;  3A0V A;  3BEB A;  2QHK A;  3E2L A;  1E3U A;  2K2N A;  4WM9 A;  2PHY A;  4DXC A;  1DRM A;  2Y2I A;  2J3T D;  2OSU A;  3A0R A;  2PBD P;  3GR2 A;  5L07 A;  1LSW A;  3A3J A;  4LV3 A;  3QP5 A;  4XT2 B;  5KIZ A;  3NOT C;  2HDU A;  3V50 A;  1OTE A;  3IF5 A;  5EFW A;  1SCW A;  4HEF A;  1Y28 A;  3LI9 A;  1XGI A;  2L4R A;  5A93 A;  1G28 A;  2QJ7 A;  2P9V A;  1PFL A;  2EFU A;  2YKF A;  1UGU A;  2WGW A;  4NXB A;  1NRF A;  4HES A;  2VV8 A;  3C8C A;  2HDS A;  3ZG0 A;  2W0N A;  5L8M A;  2NUP C;  2Y2L A;  2DNS A;  2ZC4 B;  3LIC A;  3EEH A;  3GEC A;  1BLS A;  3PXP A;  3LI8 A;  2ZBB A;  1GSV A;  4WEJ A;  4EW7 A;  4FH2 A;  1ESU A;  2G2U A;  2Y91 A;  2PT7 A;  1LL8 A;  3G4P A;  4ZBE A;  1MY8 A;  3HLE A;  1O07 A;  1YPR A;  4CLC C;  1L2S A;  1KDW A;  5F69 A;  4FD8 A;  4OON A;  3N6I A;  4YIN A;  1WA9 A;  5J4E A;  4UEY A;  3DTM A;  3LR0 A;  5LBR A;  4X56 A;  5GHX A;  4LV0 A;  2OWJ A;  3O5Y A;  4XUX A;  1S4R A;  3BY9 A;  2OV5 A;  5DJT A;  4JKT A;  1L3L A;  2PYR A;  5CGS A;  1T1A A;  2D02 A;  1CF0 A;  3LIA A;  1M6K A;  2Y4A A;  4Q8I A;  1YMS A;  2W3H A;  3NDE A;  1CEG A;  2QWS A;  1LLB A;  4EUV A;  5CEC A;  3H82 B;  5CXW A;  5GLC A;  3VOZ A;  1YLP A;  5J3W A;  3NY4 A;  2X71 A;  4MNR A;  3OPH A;  4O8G A;  4E3N A;  3NDG A;  4Y13 A;  2XLN A;  4PM8 A;  4BD1 A;  4BJP A;  4GD6 A;  5TFQ A;  5GLD A;  4DE0 A;  2BAS A;  3RH8 B;  2EX9 A;  3DWZ A;  4ZRR A;  3CI6 A;  3BFF A;  1OTD A;  4UQI S;  4EQ1 A;  4JF4 A;  2KLI A;  3BFD A;  5JYO A;  3A3D A;  1XJ4 A;  3ISG A;  2V2F F;  4BD0 A;  1PWG A;  1ERM A;  2WUQ A;  3PHY A;  4E6X A;  4PM7 A;  3P98 A;  3C4P A;  1YKD A;  3DW0 A;  4RX3 A;  2PRF A;  4WL9 A;  3D3O A;  4A5R A;  4QB8 A;  3UE3 A;  2XA7 S;  2HDR A;  1GA0 A;  3ZFZ A;  1PW8 A;  4GD8 A;  2B02 A;  2JKR M;  4OQH A;  3PR6 A;  1L0D A;  1FSY A;  2Y59 A;  2V1B A;  3IH9 A;  4II7 A;  3O3V A;  2L0W A;  1E25 A;  1PWC A;  1VET B;  2C6W B;  1XXM A;  1TDL A;  1RP5 A;  3ZNY A;  4E3L A;  3BY8 A;  4N1H A;  5IU1 A;  2VGJ A;  5EE8 A;  5GL9 A;  2Y2J A;  5HAI A;  1I2S A;  1JWZ A;  1S6R A;  4JGR A;  3O87 A;  4EUZ A;  3MZF A;  1KVM A;  3CHW P;  1PIO A;  2K31 A;  3QHY A;  4X25 A;  3V3S A;  3MR0 A;  2DMW A;  2LB9 A;  3UB7 A;  2Z2M B;  1SHV A;  1PWD A;  3ZGA B;  3LO7 A;  4KZ8 A;  5DKK A;  5HWW A;  5DKL A;  1LSV A;  2DCF A;  4MN5 A;  1QMF A;  3ZG7 B;  3BFE A;  2J7V A;  2QZ6 A;  2Y2H A;  2ACG A;  1ZKJ A;  3B33 A;  5EVI C;  3MMH A;  1FIK A;  4LLO B;  4S2L A;  1ACF A;  3ZG5 A;  1XP4 A;  4CLC B;  3FPW A;  3IF6 A;  2E8I A;  4F94 A;  3HL9 A;  2JHE A;  3LIE A;  3C4O A;  2ZQD A;  3T4T A;  4DE3 A;  3LIB A;  1MKM A;  3PAG A;  4KG5 A;  4R23 A;  1K0K A;  1NXY A;  5DJU A;  3DTE A;  3KSI A;  3IXD A;  4OQI A;  4MEZ A;  4CLC E;  3T50 A;  2DRW A;  5AQ7 A;  3BJN A;  2FZ0 A;  3DAV A;  3LR3 A;  1BLC A;  4R4S A;  2Y2Q A;  4R3B A;  4O01 A;  4KZB A;  3VP3 A;  4NXE A;  4KG6 A;  4O0P A;  4BL2 A;  1UWP X;  1DP6 A;  3U2A A;  3D72 A;  3T4J A;  4NK3 A;  1DP8 A;  3G6O A;  4PMA A;  4R70 A;  2ZJ9 A;  4CLC A;  2V0W A;  4QY6 A;  1PRQ A;  2R9X A;  4L9F A;  5U47 A;  1K56 A;  5CX7 A;  3OC2 A;  4PM6 A;  3UPN A;  1MKI A;  2KX6 A;  1ESI A;  1FCN A;  4AFI A;  4QU3 A;  1GSW A;  2XQZ A;  4JXW A;  4OOY A;  2VZW A;  3EGX C;  1OT6 A;  4H6J B;  2B5R A;  4H8R A;  5HWV A;  3IXB A;  2Y2G A;  1XFN A;  4D60 A;  4I3J A;  3CAX A;  1XA7 A;  1V9Z A;  1JTD A;  1YSQ A;  1FSW A;  2XD1 A;  4RQ9 A;  5E2F A;  1RGZ A;  4EV4 A;  4OQG A;  4D2O A;  3CLO A;  2H10 A;  4RX2 A;  3A3F A;  2K7S A;  4FUW A;  4JF6 A;  2C5W B;  1Y4O A;  2V8F A;  4R0Q A;  2JN7 A;  2XF3 A;  2Z6D A;  2A24 A;  4GKU A;  4LGW A;  4KQD A;  3MFX A;  2XSS A;  1LHY A;  3QNC A;  4IUH A;  4N9L A;  2GNX A;  1G6A A;  1W63 Q;  2WKP A;  2JKT M;  4ID4 A;  2HPB A;  3RFB A;  3E4O A;  2ZQA A;  1KGF A;  1YAX A;  4K0W A;  1S0W A;  2WZZ A;  3TOI A;  1BSG A;  1LL9 A;  4KZA A;  2X01 A;  5D3O A;  5EVI B;  3ZG9 B;  1HD8 A;  2ZM2 A;  4EEU A;  4S2P A;  1L0E A;  2RCX A;  3ZHH A;  4HH2 A;  3CUE C;  3LY3 A;  4JXV A;  3KO6 A;  2VJW A;  5CGX A;  3IXG A;  3FZC A;  5FAQ A;  2J3W A;  3KSG A;  2Y2N A;  3QP6 A;  4GHI A;  3G32 A;  1LSX A;  3PBT A;  4PAU A;  3DBA A;  3DWK A;  3NUL A;  2XA7 M;  5FI7 A;  4JPM A;  4EES A;  3BYD A;  2WGV A;  3G2Y A;  3NI9 A;  4X53 A;  1FR6 A;  2Y2P A;  4GDB A;  3QP1 A;  1N9B A;  1DJC A;  1XX2 A;  5FQI A;  1LI0 A;  1MXO A;  5A92 A;  1WE4 A;  2O9C A;  2A2L A;  3ULF A;  3UE1 A;  3ZNT A;  4FCF A;  4ESP A;  5DF7 A;  1TS8 A;  5TBM A;  1GA9 A;  1K6S A;  4WN5 A;  4BWI A;  3ITB A;  3HLC A;  1TS7 A;  4Q0I A;  2W1T A;  5CHJ A;  2QJ5 A;  3G30 A;  4E3K A;  3MQ0 A;  2P9V B;  5EVI A;  2HF6 A;  3M2J A;  2HGV A;  2WGW B;  4ZDX A;  4M4X A;  3GTC A;  3ZVT A;  2WAF A;  2ZOI A;  1XJ6 A;  4KUK A;  3VSK A;  1JVJ A;  3C30 A;  2W27 A;  5GLA A;  1BUE A;  1Q2Q A;  5G4Z A;  3HUM A;  4EEP A;  4K91 A;  4Y0U A;  4OQ0 A;  4MBF A;  4MBK A;  3IHB A;  5HSQ A;  1BYW A;  1SKF A;  3I7J A;  3IS2 A;  1TD5 A;  1GHI A;  3OCN A;  3MXQ A;  3MSH A;  2Y2K A;  2FFY A;  1M40 A;  1OTB A;  3IF6 C;  3TW8 A;  2P74 A;  4WF0 A;  4HP9 A;  1NYY A;  2HP9 A;  2PD7 A;  2RL3 A;  3HBR A;  3NC8 A;  2BLS A;  4LRX C;  2J80 A;  4CJN A;  4BBT A;  1YLW A;  3BFC A;  3BLM A;  3N4I A;  5GHZ A;  4I5S A;  4GCZ A;  4R38 A;  4GDN A;  4X55 A;  2WAD A;  4S2O A;  3V67 A;  4M3K A;  1P0Z A;  1TVF A;  2FFF B;  3IX8 A;  3KSH A;  4DE2 A;  4KZ4 A;  5A8B A;  3T4O A;  5IS1 A;  1AXB A;  2IWB A;  5FI2 A;  5HWT A;  1ODV A;  5E2H A;  5FI6 A;  3QNB A;  1I5Q A;  2PD8 A;  4E04 A;  3LFV A;  3BRM A;  4Y7P A;  1MWS A;  4WEL A;  1E3U D;  3G35 A;  3F1O A;  3PBN A;  2J9O A;  4KZ9 A;  4OP5 A;  4G3W A;  4LRY C;  2QPN A;  1MC0 A;  5C5K A;  3T1X A;  2O9B A;  3VFH A;  1KGE A;  2HP6 A;  1IEM A;  3OPR A;  4ME4 A;  3BW6 A;  5GHY A;  4ZJ2 A;  5AVE A;  4OOL A;  1W79 A;  1PYY A;  3P01 A;  3T1Q B;  1EWZ A;  3NBL A;  2G7U A;  4X68 A;  4HBU A;  4HY8 A;  2I72 A;  1ZHH B;  2Z2L B;  2ZC5 B;  1NZU A;  3BEC A;  4HHD A;  4JLF A;  1LL5 A; 
#chains in the Genus database with same CATH homology
 3WS0 A;  1JWV A;  4N1X A;  4UAA A;  1XPB A;  4S2L A;  1Z6F A;  3N8S A;  3ZG5 A;  4OKP A;  5CTN A;  5FQJ A;  3C7V A;  3PTE A;  1XP4 A;  4E6W A;  3UDI A;  4DXB A;  2IWD A;  1MPL A;  1CEF A;  4OOM A;  1K54 A;  3BLS A;  3IHA A;  4E3O A;  4C6Y A;  3IF6 A;  2E8I A;  4F94 A;  5FSR A;  3WS5 A;  1K25 A;  3G34 A;  4OLG A;  4PM9 A;  2G2W A;  3HL9 A;  4S2N A;  5EOE A;  5HFO A;  2ZMA A;  3M6H A;  3FKV A;  2EXA A;  3ZDJ A;  4GZB A;  4OLD A;  3M6B A;  3C4O A;  1W5D A;  2ZQD A;  2WKI A;  3D4F A;  4R1G A;  2ZD8 A;  5EVI D;  4DE3 A;  2ZM8 A;  1RGY A;  3HLB A;  1W7F A;  2Q9N A;  1EI5 A;  3PAG A;  4KG5 A;  1YLT A;  3GMW A;  1IYQ A;  3MFD A;  2XH9 A;  3PBS A;  4R23 A;  4S2K A;  1NXY A;  5G18 A;  3GVB A;  3N8R A;  2X02 A;  4QY5 A;  5HAQ A;  4XXR A;  2EX6 A;  3TSG A;  4LEN A;  3IXD A;  1OME A;  5CHM A;  4OQI A;  3SH8 A;  5F1G A;  3GQZ A;  5FAT A;  4MEZ A;  1C3B A;  2XGN A;  1IYP A;  3G2Z A;  2DRW A;  1ZG4 A;  5AQ7 A;  1IEL A;  1TDG A;  1HZO A;  1BLC A;  2OLU A;  4R4S A;  1PZP A;  4EBN A;  3GSG A;  1YT4 A;  3VP0 A;  5FQQ A;  3CMZ A;  2Y2Q A;  4R3B A;  4WZ4 A;  4QJG A;  3EQV A;  3Q7Z A;  5E43 A;  4KZB A;  3VP3 A;  1YLZ A;  4FSF A;  3RXX A;  4KG6 A;  4BL3 A;  3OPL A;  4BL2 A;  1DJA A;  2JCH A;  4DKI A;  2EFX A;  4KQQ A;  5AQ9 A;  3IF6 B;  2Y2O A;  4WYY A;  1CK3 A;  4KZ7 A;  1E4D A;  1QME A;  1VM1 A;  3SH9 A;  4Y0O A;  4NK3 A;  5F83 A;  1WYC A;  5BOH A;  3S22 A;  4EBL A;  1I2W A;  2EXB A;  4PMA A;  3Q82 A;  4KQR A;  1TEM A;  4P0M A;  5L2F A;  4X69 A;  1FOF A;  5GLB A;  1JTG A;  4HBT A;  4OPQ A;  2WKH A;  2XK1 A;  2ZJ9 A;  4OH0 A;  3HUO A;  3V3R A;  4QY6 A;  3TG9 A;  2R9X A;  3IXH A;  5EUA A;  4ZJ1 A;  5TR7 A;  3O88 A;  1BUL A;  3LY4 A;  3AGD A;  4OPR A;  5U47 A;  1K56 A;  3SS3 A;  3W4P A;  2ZLY A;  3OC2 A;  4PM6 A;  1SDN A;  4UA9 A;  1MWT A;  4S2I A;  4UA7 A;  4LV2 A;  1MKI A;  5DVA A;  3UPN A;  1ESI A;  1FCN A;  3FV7 A;  3PBR A;  1L0F A;  4QU3 A;  4WZ5 A;  4JXS A;  4EWF A;  2XQZ A;  1FCM A;  4JXW A;  1NZO A;  1N4O A;  3CJM A;  4OOY A;  5AQB A;  1CI9 A;  2CC1 A;  1ES5 A;  3HLF A;  2WZX A;  5AQA A;  4Z9Q A;  5FQK A;  1H8Y A;  1K4E A;  1K55 C;  3CG5 A;  2OLV A;  5EVL A;  1MWR A;  5CER A;  3UDF A;  2B5R A;  3WS4 A;  3HLG A;  4H8R A;  1GHM A;  3IXB A;  4FH4 A;  1SDE A;  3SS4 A;  4JBF A;  5CTM A;  2IWC A;  2Y2G A;  2ZC7 A;  5KSC A;  4OPZ A;  3IWI A;  5DF9 A;  1XA7 A;  4N9K A;  4XUZ A;  5HX9 A;  3UNW A;  3SS5 A;  4C3Q A;  1IKG A;  1JTD A;  1FSW A;  4QD4 A;  4DDY A;  1ES4 A;  2XD1 A;  4R4R A;  5M1A A;  5E2F A;  1RGZ A;  2XD5 A;  5HW3 A;  4EV4 A;  3M2K A;  4OQG A;  4P6B A;  1K38 A;  4QHC A;  5M18 A;  4GB7 A;  4D2O A;  2ZC3 B;  4C75 A;  2H10 A;  4RX2 A;  5IHV A;  3WWX A;  5A90 A;  5J8X A;  3A3F A;  4GNU A;  2JC7 A;  2ZC6 B;  4KEN B;  4JF6 A;  2C5W B;  2XFT A;  4WMC A;  3W4Q A;  3ZCZ A;  3O86 A;  4IBR A;  2PBY A;  1K57 A;  4BEN A;  4R0Q A;  4ZJ3 A;  1MBL A;  2XF3 A;  4GKU A;  3E2K A;  1YM1 A;  3LEZ A;  4BLM A;  1NJ4 A;  4ZAM A;  2PU2 A;  5FA7 A;  3MZE A;  1H8Z A;  3UO9 A;  1BT5 A;  3VMA A;  2XEP A;  1O7E A;  1ZG6 A;  5EEC A;  1ERQ A;  1FCO A;  1WYB A;  3W4O A;  2EX8 A;  4Y0T A;  1H5X A;  1LHY A;  4BQM A;  3QNC A;  2HP5 A;  4N9L A;  1K54 C;  3BEB A;  1G6A A;  4ID4 A;  2HPB A;  3E2L A;  1E3U A;  2ZQA A;  3N8L A;  1KGF A;  4K0W A;  1FR1 A;  2EX2 A;  4KG2 A;  4S2N C;  1S0W A;  4YFM A;  2WZZ A;  3TOI A;  1BSG A;  1LL9 A;  4KZA A;  4WM9 A;  1ONG A;  2X01 A;  5D3O A;  5EVI B;  4DRT A;  4DXC A;  2Y2M A;  2Y2I A;  4JF5 A;  3ZG9 B;  3ZVW A;  1HD8 A;  2ZM2 A;  2OSU A;  4S2P A;  5FDH A;  5TGF A;  1ALQ A;  4WBG A;  5DTK A;  1L0E A;  2RCX A;  3ZHH A;  3GR2 A;  1PZO A;  3A3J A;  4LV3 A;  3AGE A;  3LY3 A;  4JXV A;  1PW1 A;  2HDU A;  3V50 A;  1ES3 A;  1GCE A;  3IF5 A;  4DE1 A;  5CGX A;  1SCW A;  3IXG A;  4HEF A;  5E2E A;  3FZC A;  5FAQ A;  4OVD A;  2VGK A;  1XGI A;  1PI4 A;  5A93 A;  2Y2N A;  4OP8 A;  2P9V A;  2EFU A;  3BFG A;  3G32 A;  5CHU A;  2WGW A;  5FAS A;  1NRF A;  3PBT A;  4HES A;  3PBO A;  3SH7 A;  3DWK A;  1ERO A;  2HDS A;  4IED A;  1PI5 A;  4JPM A;  5FI7 A;  3ZG0 A;  3AGF A;  1ES2 A;  4LCM A;  3BYD A;  2WK0 A;  2WGV A;  2Y2L A;  5HAP A;  2DNS A;  2ZC4 B;  3G2Y A;  3GRJ A;  3NI9 A;  1K4F A;  4X53 A;  3C5A A;  3UN7 A;  1FR6 A;  1BLS A;  2Y2P A;  4GDB A;  3VP2 A;  4WEJ A;  3MXS A;  5KMW A;  1N9B A;  5HAR A;  3RJU A;  1KDS A;  1DJC A;  1ESU A;  1XX2 A;  1MWU A;  1YLJ A;  1YMX A;  1LI0 A;  1MXO A;  2GDN A;  3OZH A;  5F82 A;  5FQI A;  5A92 A;  1WE4 A;  4EQI A;  3FYZ A;  2G2U A;  2Y91 A;  5FQ9 A;  2JBF A;  3G4P A;  4ZBE A;  3UE1 A;  1MY8 A;  3ZNT A;  3HLE A;  4FCF A;  4UA6 A;  5DF7 A;  1O07 A;  4P85 A;  2V20 A;  4KZ3 A;  1GA9 A;  1L2S A;  1KDW A;  3UPP A;  1K6S A;  4FD8 A;  1FQG A;  3N6I A;  4OON A;  3ITB A;  4S2J A;  4YIN A;  4EBP A;  3HLC A;  3MBZ A;  5CRF A;  3DTM A;  3HUN A;  1ONH A;  4X56 A;  1KE4 A;  1NYM A;  5CHJ A;  3NCK A;  3HVF A;  4MLL A;  2PU4 A;  4B4X A;  3PAE A;  1LI9 A;  5EPH A;  1XA1 A;  3G30 A;  5GHX A;  4WZ5 C;  4B4Z A;  4LV0 A;  4XUX A;  4DF6 A;  4S2M A;  4E3K A;  2P9V B;  5EVI A;  1KE3 A;  1G68 A;  1DJB A;  3M2J A;  2OV5 A;  3S1Y A;  2WGW B;  4ZDX A;  3GTC A;  3WS1 A;  3ZVT A;  2WAF A;  4JKT A;  3VSK A;  5FQM A;  1JVJ A;  3VP4 A;  5EOO A;  5CGS A;  4CPK A;  4JXG A;  5GLA A;  1M6K A;  1BUE A;  1Q2Q A;  3HUM A;  3A3I A;  4LV1 A;  2Y4A A;  4MBH A;  5FAP A;  4Q8I A;  4K91 A;  4Y0U A;  1YMS A;  1W8Q A;  3NDE A;  4OQ0 A;  1CEG A;  4OPY A;  1K56 D;  1LLB A;  4E3M A;  3MXR A;  4MBF A;  5CEC A;  4MBK A;  3IHB A;  5CXW A;  2H0Y A;  5GLC A;  1YLP A;  3VOZ A;  1SKF A;  3NY4 A;  3I7J A;  5DF8 A;  5DTT A;  3IWO A;  2WYX A;  2X71 A;  5CEB A;  4MNR A;  1GHI A;  3OPH A;  3OCN A;  3Q7V B;  4E3N A;  3NDG A;  2XLN A;  4PM8 A;  4BD1 A;  4BJP A;  2Y2K A;  4GD6 A;  1HTZ A;  4NET A;  5TFQ A;  5GLD A;  2FFY A;  1BZA A;  4DE0 A;  4O7D A;  1M40 A;  2EX9 A;  1GHP A;  3DWZ A;  3IF6 C;  3WS2 A;  2P74 A;  2XFS A;  1K57 C;  3VOY A;  4KZ6 A;  3BFF A;  3VFF A;  2J8Y A;  1XKZ A;  2XDM A;  2HP9 A;  1NYY A;  4RVA A;  2RL3 A;  3EQU A;  3HBR A;  3NC8 A;  2BLS A;  4JF4 A;  1HVB A;  1W8Y A;  4GOG A;  4IVK A;  3OPP A;  1XGJ A;  3BFD A;  4CJN A;  5JYO A;  4RYE A;  4U0X A;  1YLW A;  3A3D A;  3BFC A;  3BLM A;  3N4I A;  2V1Z A;  3G31 A;  5GHZ A;  1IKI A;  3HLW A;  3ISG A;  3UPO A;  1Y54 A;  3HRE A;  4KQO A;  2V2F F;  4BD0 A;  3V39 A;  1PWG A;  4E3I A;  4PM5 A;  1ERM A;  3CZD A;  3V5M A;  3IQA A;  4GDN A;  4X55 A;  2WUQ A;  3LCE A;  4LCL A;  4UHU A;  4E6X A;  4PM7 A;  2WAD A;  3P98 A;  3MKF A;  4S2O A;  3VSL A;  3C4P A;  4M3K A;  1TVF A;  2FFF B;  3SOI A;  1L0G A;  4DE2 A;  4WMC D;  1U60 A;  3PBQ A;  3DW0 A;  5A91 A;  4KZ4 A;  4RX3 A;  4R3J A;  1AXB A;  4P87 A;  5CGW A;  4PPR A;  3Q1F A;  5FI2 A;  2IWB A;  2A3U A;  5E2H A;  5FI6 A;  4A5R A;  2WKE A;  1KGG A;  3IH8 A;  4QB8 A;  5CED A;  3UE3 A;  2HDR A;  1GA0 A;  3QNB A;  1I5Q A;  5FAO A;  4ZTK A;  3ZFZ A;  1PW8 A;  2WAE A;  3GV9 A;  2H0T A;  3BRM A;  4KZ5 A;  4GD8 A;  4OQH A;  4Y7P A;  3FKW A;  3B3X A;  1MWS A;  1IYO A;  3S4X A;  4WEL A;  3WRT A;  1L0D A;  2R9W A;  1FSY A;  2Y59 A;  4E3J A;  3W8K A;  1E3U D;  1Q2P A;  1YQS A;  3IH9 A;  2WGI A;  3UY6 A;  3O3V A;  4DDS A;  2XR0 A;  3RXW A;  1E25 A;  1PWC A;  1DY6 A;  3G35 A;  2BG1 A;  2C6W B;  1BLP A;  1XXM A;  3PBN A;  2J9O A;  1TDL A;  1RP5 A;  4KZ9 A;  3ZNY A;  4E3L A;  5F1F A;  4OP5 A;  4N1H A;  1KE0 A;  3IWQ A;  2ZQC A;  2QPN A;  4RA7 A;  2VGJ A;  1ZC2 A;  5EE8 A;  4IBX A;  2HDQ A;  3N7W A;  5GL9 A;  5KZH A;  2Y2J A;  1K55 A;  3Q7V A;  3P09 A;  4IVI A;  4U3T A;  5HAI A;  3ZG8 B;  1I2S A;  2UWX A;  1JWZ A;  2JE5 A;  3VFH A;  1S6R A;  1K6R A;  3FWL A;  1KGE A;  2J9P A;  3HLD A;  3C7U A;  2HP6 A;  2ZQ7 A;  4L0L A;  1IEM A;  3MKE A;  3O87 A;  5M19 A;  4U0T A;  2QMI A;  1BTL A;  3MZF A;  4EUZ A;  1KVM A;  1PIO A;  3QHY A;  5E2G A;  2Y55 A;  1YLY A;  3OPR A;  4WEK A;  5KSH A;  5GHY A;  4ZJ2 A;  2ZQ8 A;  3VP1 A;  4K0X A;  3V3S A;  2Q9M A;  4N92 A;  3WRZ A;  3A3E A;  2Z2M B;  4OOL A;  1JWP A;  2H5S A;  5JYP A;  1SHV A;  1W79 A;  1PWD A;  1PYY A;  2ZQ9 A;  3OCL A;  4GN2 A;  5DTS A;  1KVL A;  3BM6 A;  3Q07 A;  3ZGA B;  1EWZ A;  1VQQ A;  1J9M A;  3LO7 A;  4KZ8 A;  1BLH A;  3UDX A;  1RCJ A;  4FH2 A;  3ITA A;  3Q81 A;  5I94 A;  3NBL A;  1NY0 A;  2DCF A;  4X68 A;  3NIA A;  4HBU A;  2I72 A;  1IYS A;  3UE0 A;  1QMF A;  3JYI A;  2ZM0 A;  2Z2L B;  3ZG7 B;  1CI8 A;  3IT9 A;  5HL1 A;  2ZC5 B;  1NZU A;  2A49 A;  3BEC A;  4X6T A;  3BFE A;  2J7V A;  2QZ6 A;  2Y2H A;  5EVI C;  1ZKJ A;  4B88 A;  3MZD A;  4JLF A;  1LL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...