4Y0OA

Crystal structure of oxa-58, a carbapenem hydrolyzing class d beta-lactamase from acinetobacter baumanii.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Active-Site Plasticity Is Essential to Carbapenem Hydrolysis by OXA-58 Class D beta-Lactamase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 70
structure length 242
sequence length 243
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4y0oA00
1XPBA 1XKZA 4OP8A 4OPYA 4XUZA 4RA7A 3CJMA 3IWOA 1G68A 2ZQCA 5EVIB 2WGWA 5FAPA 1YT4A 4QJGA 4QD4A 4Y0UA 3VMAA 2H10A 4F94A 2HDRA 1W7FA 1XXMA 4E3LA 3HUNA 4JXVA 1JVJA 5IHVA 5CRFA 1FR1A 1MWUA 1YLTA 4EQIA 2OSUA 1E3UA 1PWCA 1JTGA 3IF6B 1N4OA 1YLPA 4OPZA 3OPRA 2C6WB 1ES2A 2Y2KA 1C3BA 1K54A 3FYZA 3MXRA 4K0XA 1CEGA 3C4OA 5DTKA 4LENA 3VP1A 3W4OA 5E2GA 3ZGAB 5AQBA 3VOZA 4L0LA 1KDWA 1YMSA 3IH9A 1BT5A 5HL1A 5CECA 4HEFA 5FI7A 1N9BA 3DTMA 3IXBA 4DDYA 1SHVA 3PBRA 1MY8A 4XUXA 1VM1A 2JCHA 2G2WA 4FSFA 3PBNA 3WS4A 1IYQA 1K57A 4N1XA 1WYCA 4E3KA 4EUZA 3E2KA 5CTMA 1FSYA 2HDQA 4BLMA 4E6WA 3TG9A 5GL9A 3HLEA 5E2HA 1LHYA 3OPHA 3GTCA 2V1ZA 2X01A 1TDLA 2HP9A 2XGNA 2XK1A 3A3EA 3BM6A 5GHYA 3W4QA 3HREA 1RGYA 3ITAA 1XX2A 5CERA 3ZNYA 1BULA 1BSGA 1MWSA 3HLCA 2XR0A 4UHUA 3WRZA 1Y54A 1ES5A 1FSWA 3MKFA 4JXWA 3WRTA 4KG6A 1FCNA 1ERQA 2DNSA 5HAPA 5A90A 4FCFA 4U0XA 4Y7PA 3OPLA 1J9MA 2XH9A 2HP6A 2JBFA 5F82A 4E3JA 3UE0A 3ZCZA 2EFUA 1XP4A 1CI9A 4QY5A 4YINA 4OPQA 2V20A 3EQVA 1CI8A 4GOGA 3NY4A 3SH8A 3P98A 2ZQDA 1BLSA 1W5DA 3BFCA 3PTEA 3W4PA 4ZJ1A 1AXBA 1SKFA 3DW0A 4RX3A 4JF5A 3W8KA 1FOFA 1PYYA 4R23A 5GLDA 1BLPA 3S4XA 2J8YA 2OLUA 4B88A 4EBLA 4P85A 4HESA 5EE8A 3N4IA 1JWZA 5EVID 4XXRA 3LCEA 3QNBA 1KGEA 4UAAA 5HAIA 2E8IA 4FD8A 5EVLA 1KVMA 4UA9A 2ZC5B 4KQRA 3CMZA 4WMCA 1IYOA 3C4PA 2Y91A 2EXAA 3IHBA 4ZJ3A 3Q1FA 5HAQA 4KZ7A 2XF3A 4KG5A 3IHAA 4E6XA 1XGJA 4N92A 4OLGA 3VFFA 5D3OA 3MXSA 4KZ6A 5EECA 3VFHA 5HARA 2XD1A 1NYMA 4MBHA 4CJNA 2WYXA 1G6AA 3A3JA 3G2ZA 3C5AA 3UE1A 4S2MA 4KG2A 1RCJA 4BD0A 3GSGA 1CK3A 4DXCA 5KZHA 3IXDA 4OP5A 4S2OA 1K54C 5L2FA 1DY6A 4A5RA 4B4ZA 1KE0A 2WKHA 1LLBA 1TDGA 1PI4A 3BEBA 1HTZA 3NC8A 5CTNA 1CEFA 2EX9A 2ZC3B 5HFOA 4JF6A 4X6TA 2ZLYA 3A3DA 3S22A 1ESUA 3G30A 3WS0A 1BUEA 3V3SA 5F1FA 1MXOA 1L2SA 4K0WA 3PAGA 1K57C 2RL3A 1LL5A 4HBUA 3IT9A 3E2LA 5E2FA 5CGWA 3RXXA 4JLFA 2J9PA 2XD5A 3CZDA 1EI5A 1ONGA 4ZAMA 3V3RA 3DWKA 4DE1A 3A3FA 2ZC6B 1KGGA 1EROA 3A3IA 4OQIA 2UWXA 4X69A 5FDHA 5FSRA 4EWFA 3UPPA 2ZM8A 3IH8A 2Z2MB 4WZ4A 3SH9A 3O87A 2EX6A 3ZG5A 1K4EA 5E2EA 4E3OA 1L0GA 3VSKA 1DJAA 2R9XA 4H8RA 2WUQA 4WEJA 1NZUA 4E3NA 4Q8IA 2WGVA 4BL3A 4FH2A 4ZTKA 2QPNA 4X55A 2ZQ7A 1U60A 4DKIA 3WS1A 2J7VA 5FQIA 4PM9A 1L0DA 4WZ5A 2Y2QA 5GLAA 1YLYA 2ZM0A 1RP5A 1HD8A 1GHIA 1BLHA 4MNRA 2WZZA 5A93A 2P9VA 3FV7A 3BFGA 3OPPA 1YM1A 2ZM2A 4CPKA 1SDEA 4ZJ2A 3AGEA 3FZCA 4QB8A 3UNWA 1I5QA 1PIOA 4GN2A 1PW8A 1W8QA 2FFYA 3M2JA 5DF7A 3VP2A 2V2FF 3MZDA 3PBQA 1DJCA 3MZEA 1LL9A 3OCLA 4LV0A 4S2NA 1GCEA 3QHYA 1IKIA 1K56D 1PZPA 3I7JA 3SH7A 1KE3A 4IBXA 5FASA 2A49A 4OQGA 3N6IA 3GMWA 2XLNA 3Q7VA 4WBGA 3UO9A 1TEMA 3N8SA 3G31A 3ZG0A 5FA7A 4GB7A 3V5MA 3G2YA 3M6BA 1IYPA 2Y4AA 1FCMA 1BLCA 5CEBA 2Y2IA 3D4FA 4IVIA 1ZC2A 4JBFA 2ZD8A 2OLVA 4GDBA 3O86A 2XFTA 2Y2HA 4GKUA 3BLMA 3AGFA 3DWZA 5FI6A 2WZXA 3N7WA 5A91A 4GD8A 2WGWB 4OH0A 5FATA 3HUOA 1E4DA 4Y0OA 3VP0A 3ZHHA 4FH4A 4OONA 4X53A 2Y2NA 1NRFA 3NDEA 4RYEA 2ZMAA 2QMIA 3HLFA 4OLDA 5TFQA 1ZKJA 1PI5A 4R3BA 3ITBA 4R3JA 2BG1A 2P74A 4KZ8A 3UE3A 4MEZA 5EVIA 2R9WA 1ZG6A 2WADA 2ZQ9A 3PBSA 2Q9NA 4R4RA 4GD6A 3LY3A 4Y0TA 3ZG7B 5HW3A 3BECA 4KZAA 5E43A 1Q2PA 5AQ9A 1O7EA 3SS5A 4LV2A 5J8XA 1OMEA 5AQAA 1H5XA 2PU4A 3WS2A 1ES4A 2DCFA 4YFMA 3IF6A 2J9OA 2Y2GA 3ZVWA 2PBYA 1JWPA 4KQOA 3EQUA 4NK3A 5A92A 1GHMA 2ZC4B 3WS5A 3ZG8B 2Q9MA 5G18A 2IWBA 1ALQA 4E3MA 2RCXA 1S6RA 1NY0A 5EPHA 3PBTA 4IVKA 2G2UA 5FQMA 4GZBA 1HVBA 1LI9A 1PW1A 4OQ0A 2WK0A 3FKVA 2C5WB 1I2SA 3LY4A 2ZC7A 1XA1A 5GLCA 3S1YA 1RGZA 4GDNA 2WAFA 4WZ5C 3HLWA 3G32A 4M3KA 1KDSA 3HL9A 3BFFA 5FQQA 2IWCA 4P87A 3VSLA 3O3VA 2Y2OA 1XGIA 4O7DA 1BZAA 1ZG4A 4MBFA 3O88A 2XEPA 2CC1A 1YLJA 1JTDA 4P6BA 3GRJA 4Z9QA 4MBKA 1Q2QA 1K4FA 3HVFA 3GR2A 1YMXA 3BFEA 4JPMA 4S2PA 4C75A 3GV9A 4LCMA 5BOHA 2Y2PA 3IWQA 4LV1A 4BJPA 1K55A 4JKTA 4OQHA 4S2NC 1IYSA 2JC7A 3MZFA 2ZQAA 4C6YA 2DRWA 4JXGA 5EOEA 1VQQA 4EV4A 2FFFB 2HPBA 3NBLA 3QNCA 5EOOA 2VGKA 1K25A 3G35A 1IEMA 5JYOA 4PMAA 3IWIA 3VP4A 3BYDA 4X56A 3MKEA 3NIAA 1MWTA 5CXWA 4X68A 1KGFA 4RVAA 5KMWA 4DE3A 1KVLA 3AGDA 3M2KA 1PZOA 3GQZA 4U0TA 1FR6A 3UY6A 3UDFA 2WKEA 1E3UD 3HLDA 3WWXA 3N8RA 2Y59A 1S0WA 3NDGA 2X02A 5M18A 4U3TA 4IEDA 3G34A 4S2KA 1E25A 1LI0A 1NYYA 1SCWA 4S2LA 3TSGA 4C3QA 4D2OA 3GVBA 3ZFZA 4EBPA 2B5RA 5EVIC 4HBTA 3MBZA 5F1GA 4S2IA 4MLLA 5AQ7A 2H5SA 4LCLA 3MFDA 5DTTA 1MWRA 2HDUA 1XA7A 5FI2A 5M1AA 3HLGA 4QHCA 1IELA 1Z6FA 3ZNTA 3RJUA 1NJ4A 3HBRA 1NZOA 5GLBA 3IXGA 1K56A 4KQQA 4QU3A 3Q7ZA 4WYYA 1M6KA 3IF6C 1ESIA 5GHZA 2WAEA 5FQ9A 2EXBA 2I72A 5CHJA 1I2WA 1QMFA 4S2JA 1FQGA 5FAQA 2GDNA 3BLSA 5CGSA 1NXYA 2HP5A 1WYBA 1JWVA 3NI9A 4KZ9A 3FKWA 4LV3A 2Z2LB 2ZJ9A 4UA6A 5GHXA 2WKIA 3ZDJA 3UPOA 2VGJA 2H0YA 3N8LA 4N1HA 4BQMA 1M40A 3SOIA 3UN7A 4JXSA 1GA0A 5FQKA 4PM7A 1IKGA 3NCKA 5DF8A 4DRTA 4OPRA 1W8YA 1YLZA 3OC2A 4PM8A 3SS3A 3VP3A 4KZ4A 2HDSA 4DF6A 1O07A 1H8ZA 1GA9A 5CGXA 1FCOA 4DXBA 2Y2JA 4DE0A 3Q07A 4JF4A 2QZ6A 2XQZA 3OZHA 1YQSA 1BTLA 4QY6A 1H8YA 1L0EA 4KZBA 1K6SA 4WEKA 4N9KA 4P0MA 3V39A 4R1GA 3C7VA 1L0FA 4B4XA 3CG5A 1K55C 4KZ5A 4PM6A 4R4SA 4KZ3A 3FWLA 4UA7A 3Q82A 5TR7A 3P09A 4BENA 3OCNA 3M6HA 4OOYA 2ZQ8A 4WMCD 5TGFA 5FAOA 4R0QA 5KSHA 2P9VB 5DF9A 5CEDA 3IXHA 4OOLA 5F83A 1K6RA 1ONHA 1KE4A 5U47A 5CHMA 4DDSA 2XFSA 3BFDA 2EX8A 4OVDA 4WM9A 2JE5A 3ZG9B 1WE4A 3G4PA 4ID4A 4BD1A 4IBRA 1PWDA 4K91A 5FQJA 5KSCA 3C7UA 5M19A 1W79A 2IWDA 3JYIA 5JYPA 3PBOA 1MBLA 1YLWA 2PU2A 5DTSA 1MKIA 1DJBA 3UDIA 4ZBEA 1TVFA 3HLBA 1QMEA 4KENB 3RXWA 3SS4A 4ZDXA 2OV5A 2Y55A 3B3XA 1MPLA 1SDNA 3Q7VB 1PWGA 3ZVTA 3LEZA 1ES3A 2Y2LA 1HZOA 2H0TA 5HX9A 2X71A 4E3IA 1EWZA 2EX2A 2Y2MA 4DE2A 3V50A 1ERMA 3IF5A 5DVAA 2BLSA 2EFXA 3VOYA 1K38A 5I94A 4OOMA 2A3UA 4BL2A 3IQAA 3PAEA 4EBNA 1GHPA 3UDXA 3UPNA 4PM5A 4WELA 3BRMA 4N9LA 4PPRA 3HUMA 4GNUA 4RX2A 5EUAA 2XDMA 4OKPA 3Q81A 5CHUA 4NETA 3TOIA 2WGIA 3ISGA 3LO7A
chains in the Genus database with same CATH superfamily
1XKZA 4OP8A 2W3EA 2KDKA 2A2LA 5FAPA 5FEGA 4QD4A 2V9AA 4O0PA 3HUNA 4X25A 1FR1A 1MWUA 4EQIA 1E3UA 1PWCA 5IT5A 2Y2KA 1C3BA 3CLOA 4NEED 5DTKA 5HSQA 4QWOA 1ZHHB 2Y8HA 4B9OA 3VV4A 2PR5A 3IXBA 2WKQA 3PBRA 1MY8A 3F1NB 3PBNA 2NUPC 3PXPA 2HDQA 5CTMA 4CLCB 2PRFA 5E2HA 3A3EA 3W4QA 2OWHA 5GHYA 3HREA 1RGYA 1XX2A 1BULA 3JVUA 4UHUA 5KIZA 3JPUA 5HAPA 5MC7A 1T18A 3E4OA 3BQAA 2HP6A 1NWZA 2PD8A 2IA2A 4HQAA 4YINA 3T4JA 2V20A 4MMNA 3EQVA 1CI8A 2O9CA 3W4PA 4ZJ1A 4EEPA 1SKFA 3DW0A 1A0KA 4R23A 1TS6A 3S4XA 2OLUA 4B88A 4EBLA 4P85A 1JWZA 3E4PA 3QNBA 2E8IA 2M1CA 2VGLM 1DP8A 2EXAA 2KOIA 3BY9A 4PHTA 1LSXA 2CMNA 4O01A 2P04A 1NYMA 4MBHA 4CJNA 1G6AA 2WYXA 3G2ZA 3UE1A 4S2MA 1RCJA 4KUKA 4DXCA 4S2OA 1F98A 1KE0A 2OOLA 1T1BA 2R78A 1TDGA 4HOIA 1KOUA 4CLCD 3A3DA 3G30A 1BUEA 1OTAA 1L2SA 3PAGA 2RL3A 5CGWA 3PHYA 3RXXA 1EI5A 1ONGA 4ZAMA 3K3CA 3A3IA 1KGGA 3IX8A 4EESA 3EWKA 5EM0A 3SH9A 2EX6A 5HPFA 3TJZC 2J3TC 4Z1WA 4Q8IA 4E3NA 2VV8A 4BL3A 2QPNA 2ZQ7A 5FEFA 5F68A 3DTIA 4WZ5A 2OAQ1 5FDSA 2J80A 3IS2A 2ZM0A 1MKMA 3LI9A 4HJ6A 3UB9A 4ZJ2A 1XJ6A 2PAVP 2LB5A 4GN2A 5J4EA 1PW8A 5DF7A 4LV0A 3BW6A 3QHYA 3I7JA 2L1MA 3SH7A 2NUTC 3Q7VA 2WKPA 3G31A 5FA7A 3M6BA 1IYPA 5CEBA 3D4FA 2B02A 3LIDA 1ZC2A 2HGVA 2OLVA 2W1TB 1SZVA 4GKUA 4GD8A 2WGWB 3P7NA 5FATA 1FILA 2ZMAA 3FPWA 5TFQA 4KZ8A 4MEZA 1OT6A 2QYBA 3ZG7B 1J3WA 3MQ0A 3BECA 5E43A 1O7EA 3SS5A 1OMEA 5AQAA 2PU4A 3WS2A 1TS7A 2J9OA 3EGXC 3BY8A 2PBYA 3EQUA 4NK3A 1GHMA 2ZC4B 2W3HA 3SW1A 5FQMA 3F1OB 3LIFA 3FKVA 4P6ZM 2C5WB 5GLCA 2WAFA 3F1NA 3HL9A 3BFFA 1WA9A 2Y2OA 1XGIA 4HHDA 4CLCA 4WF0A 3O88A 4D60A 3CUEC 4P6BA 4Z9QA 2L4RA 4MBKA 2QHKA 1YMXA 2GNXA 2Y2PA 3IWQA 4LV1A 1K55A 4S2NC 2PBDP 2JC7A 2ZQAA 4QPRA 4JXGA 5EOEA 3G35A 1IEMA 1V9ZA 4X56A 3MKEA 1KGFA 5KMWA 4DE3A 1KVLA 1PZOA 4Y17A 3WWXA 2Y59A 2W3GA 1N9NA 1Y4OA 4GS9B 3GECA 1MZUA 4C3QA 2B5RA 3MQQA 5EVIC 4HBTA 3MBZA 5F1GA 3L7HA 3ZYTA 4LCLA 1VHMA 2HDUA 2GJ3A 3RJUA 1NJ4A 5GLBA 3MFXA 2V0WA 4MN5A 5L09A 4QU3A 3Q7ZA 2O99A 4ARZB 1QMFA 3T4KA 2JHEA 2GDNA 3UMEA 1WYBA 2P7JA 3NI9A 1XJ4A 1LSVA 2ZJ9A 2XROA 3UPOA 2VGJA 2H0YA 2J3TD 3N8LA 1M40A 3TE8A 4PM7A 3NCKA 5DF8A 4DRTA 2L0WA 4OPRA 1W8YA 3SS3A 2HDSA 1H8ZA 1F9IA 2Y2JA 3K2NA 3MS6A 4B93A 1YQSA 2LB9A 1BTLA 4QY6A 1OTBA 3T4TA 2JKGA 3C7VA 3VE3A 1T1CA 4B4XA 3CG5A 4KZ3A 1X0OA 4BENA 4OOYA 5TGFA 4EERA 2P9VB 3LIBA 5CHMA 2XFSA 3BFDA 1WE4A 4IBRA 5FQJA 3FC7A 1W79A 4LLOB 4NG2A 3PBOA 2PU2A 5DTSA 1TVFA 4KENB 4PKYG 4ZDXA 3B3XA 3T1XA 5L07A 2X71A 2Y2MA 3V50A 2P08A 2BLSA 3NHQA 2A3UA 1VEUB 4PAUA 3BRMA 4GNUA 5EUAA 5G4ZA 4NETA 3TOIA 3TRCA 2W1TA 1Z09A 4XUZA 3CJMA 5EVIB 2WGWA 2I9VA 4QJGA 4Y0UA 2H10A 4F94A 1XXMA 4JXVA 1IOUA 3MXQA 1JTGA 4HIAA 1YLPA 2C6WB 1W63M 3IBRA 4Q0IA 1CEGA 5HPIA 3VP1A 5A8BA 2G7UA 2PYPA 3VOZA 4L0LA 4HEFA 3A0VA 1N9BA 1SHVA 4XUXA 1VM1A 2JCHA 4FSFA 3WS4A 4E3KA 2OAP1 3F1OA 4BLMA 3TG9A 4JGPA 2X01A 1TDLA 2XGNA 3OOVA 3NJAA 5CERA 1BSGA 1MWSA 2Q0OA 2XR0A 1FSWA 3WRTA 1ERQA 1S4SA 3OBFA 3R4KA 5A90A 4FCFA 5DJUA 4YNRA 2JBFA 1CI9A 4QY5A 4GOGA 3P98A 2ZQDA 1BLSA 1W5DA 4I3AA 3E0YA 4YWZA 5F5YA 2YKHA 1FOFA 1BLPA 2J8YA 3EGDC 2OWJA 2W27A 5EE8A 5EVID 4UAAA 3LICA 1XFNA 3MR0A 2ZC5B 4KQRA 1IYOA 2Y91A 1DP9A 5HAQA 4KZ7A 3IHAA 4OLGA 3VFFA 5TBMB 3VFHA 4GS9A 1VB6A 2XD1A 4EEUA 3T4OA 2B18A 1CK3A 3OLOA 5KZHA 5L2FA 1DY6A 2K2NA 5EM1A 4R38A 1PI4A 1HTZA 4X6TA 1OTDA 3V3SA 4EQ1A 4ARZA 1K57C 3E2LA 3FPVA 5E2FA 2J9PA 2XA7S 1GSXA 2EWVA 3V3RA 2GZAA 3T4SA 2UWXA 4EWFA 2Z2MB 4BBTA 4HJ3A 3G6OA 3O87A 1JNUA 4G3VA 5E2EA 5HL6A 4E3OA 4FH2A 4X55A 1U60A 5FQIA 2Y2QA 5GLAA 3T1RA 2WZZA 2P9VA 3BFGA 3CUEA 1SDEA 4MN7A 3FZCA 1I5QA 1LL8A 2VLGA 3M2JA 3P01A 2V2FF 3MZDA 3PBQA 3BQ8A 3KYEA 4S2NA 1GCEA 4CQHA 1K56D 5FASA 4OQGA 1TS8A 3GMWA 4Q0JA 1TEMA 3V5MA 2K7SA 3G2YA 5L10A 3GDIA 2Y2IA 2ZD8A 4GDBA 3O86A 2QKPA 5FI6A 3DWZA 1VEUA 1TD5A 3N7WA 4O8GA 1E4DA 3VP0A 4X53A 3B33A 4IJGA 1S67L 3NDEA 4RYEA 2QMIA 3EEHA 4R3BA 4BBUA 4R3JA 3UE3A 4BBVA 4EUVA 5EVIA 3PBSA 2A24B 4Y0TA 3LYXA 4YFMA 2Y2GA 3SZTA 1JWPA 1ALQA 4DMZA 1S6RA 2UV0E 4IVKA 2G2UA 4GZBA 1HVBA 1LI9A 1PW1A 2WK0A 2ZC7A 1XA1A 4GDNA 3HLWA 2PT7A 3B42A 4I39A 3VSLA 2ZMVA 2XEPA 1YLJA 1JTDA 1IFQA 2XSSA 2VA0A 4BJPA 4OQHA 1IYSA 2DRWA 4EV4A 2HPBA 3QNCA 5EOOA 1K25A 3VOLA 2V1AA 4UQIS 3UB8A 1MWTA 3UY6A 2WKEA 4DJ3A 3NDGA 1MC0A 2VKSA 2VV7A 3G34A 1E25A 1NYYA 1SCWA 3TSGA 4Y15A 3EEAA 3ZFZA 2JKTI 2ACGA 5AQ7A 3LI8A 4I5SA 5TBMA 2ZL1B 5M1AA 3LIEA 3HJIA 2V0UA 1K56A 3IF6C 4BMWA 5FQ9A 1H0MA 5AJGA 2HP5A 1JWVA 1VETB 4F3LB 4PKYA 4UA6A 5GHXA 2WKIA 3ZDJA 2XRNA 4BQMA 3SOIA 1YLZA 3OC2A 4KZ4A 4DF6A 1GA9A 1FCOA 4DE0A 4JF4A 4HI4A 3MQOA 2QZ6A 3OZHA 1H8YA 1L0EA 3QP8A 4R1GA 4R3AA 2V8CA 4KZ5A 4PM6A 3FWLA 3QP4A 3Q82A 4GHIA 3MJQA 4L9FA 1OJ5A 3M6HA 2ZQ8A 5TJJA 5KSHA 5CEDA 3IXHA 5F83A 4I38A 1KE4A 4IUHA 3RTYA 2W1RA 3KSGA 3LGOA 5IS1A 3TW8A 4WM9A 3ZG9B 3G4PA 4K08A 5KSCA 1BYWA 3C7UA 3V67A 5JYPA 1T1AA 3QP5A 1TS0A 1YLWA 4RQ9A 4Y2FA 2Y55A 3CWFA 1MPLA 1XJ2A 3ZVTA 2HJ9C 1ES3A 2Y2LA 4LGWA 5HWTA 2KX6A 4E3IA 1EWZA 4DE2A 2JKRI 1K38A 4OOMA 3PAEA 3UPNA 4PM5A 5C5KA 2EWWA 4NXBA 2XDMA 2XA7M 2WGIA 3ISGA 1XPBA 3QP1A 1D06A 4OPYA 4RA7A 3IWOA 1G68A 2ZQCA 3T4QA 3VMAA 4X1LA 1W7FA 4E3LA 1OTIA 1YLTA 2OSUA 3IF6B 1N4OA 3OPRA 4LRZE 1ES2A 2A24A 3D72A 3MXRA 3T50A 4LENA 3ZGAB 5E2GA 3PR6A 5AQBA 3K3DA 1YMSA 3IH9A 5FI7A 4JGRA 3DTMA 3IX4A 1S1YA 4DDYA 1PNEA 5DFYA 2G2WA 1K57A 4N1XA 3E2KA 3E98A 3MF0A 1FSYA 5GL9A 3KX0X 1LHYA 5AVEA 4WUJA 3NOPC 3C2WA 3BM6A 1ODVA 3KSIA 3ITAA 4EW7A 2QJ5A 4DN0A 2VK3A 3HLCA 3WRZA 3MKFA 4JXWA 2DNSA 2W3FA 4YOFA 1T19A 4U0XA 1PRQA 2JKFA 4Y7PA 1J9MA 5F82A 4E3JA 3UE0A 3NY4A 3SH8A 2K31A 3T12B 4JF5A 1PYYA 5GLDA 1DP6A 5HWWA 1OT9A 4MDZA 3LCEA 1KGEA 5HAIA 4FD8A 5EVLA 4UA9A 2WKRA 3IHBA 4EU0A 1OTEA 1NRJA 2XF3A 4EXOA 4KG5A 2HJEA 4MN6A 4E6XA 4N92A 3UB7A 1G5UA 3KYQA 1LT0A 3C5AA 4KG2A 4NXFA 3H82B 3C38A 4OP5A 1K54C 5F6AA 2ZL1A 4B4ZA 2WKHA 1K0KA 2O0YA 1CEFA 2EX9A 2ZC3B 2VJWA 2ZLYA 4G3WA 3S22A 1UGUA 3S7NA 3S7OA 1ESUA 5F1FA 1MXOA 4K0WA 1LL5A 4HBUA 1YAXA 2FH5A 3LEQA 1VETA 4JLFA 2XD5A 2ZMFA 3CZDA 4F3LA 3DWKA 4DE1A 3A3FA 2ZC6B 5F69A 5FSRA 4X69A 3IH8A 4HP9A 1F2KA 1AWIA 4LFUA 3ZG5A 1K4EA 5DJTA 1L0GA 3VSKA 1DJAA 4L9EA 4IHQA 4H8RA 4WEJA 2WGVA 4II7A 4NKPA 4DKIA 3F1PB 3WS1A 2J7VA 4PM9A 1YLYA 1RP5A 4HY8A 3KSFA 4Y5FA 3FV7A 3OPPA 1YM1A 2JKTM 3AGEA 3UNWA 2ZBBA 1PIOA 4ZRRA 2M7UA 1DJCA 3MZEA 4WN5A 1LL9A 1IKIA 1PZPA 2A49A 1GSVA 3O5YA 1HLUP 3N8SA 3ZG0A 1S4RA 2AVXA 3R7WB 4Y3IA 2Y79A 1FCMA 3MMHA 5DFXA 4IVIA 4JBFA 3AGFA 4OH0A 4Y0OA 4FH4A 4OONA 2Y2NA 5HD3A 3HLFA 1ZKJA 1PI5A 1FIKA 2GX5A 2P74A 2R9WA 2ZQ9A 1YSQA 4R4RA 2Q9NA 3ZQ5A 2HF6A 2VEAA 4KZAA 5AQ9A 1H5XA 1ES4A 2DCFA 3IF6A 3E4QA 4KQOA 4E3MA 2RCXA 1NY0A 1EW0A 3LIAA 3VE4A 2BASA 3LY4A 3S1YA 1RGZA 1KDSA 1CF0A 4P6ZS 3FG8A 4P87A 3LR3A 4O7DA 1BZAA 1ZG4A 4MBFA 2YKFA 2CC1A 2JKRM 2VZWA 4HP4A 4ME4A 1K4FA 3HVFA 1H8MA 3GR2A 3BFEA 4JPMA 4FTXA 4S2PA 4C75A 3GV9A 4JKTA 4BWIA 1SKOB 2FFFB 3NBLA 5J3WA 2VGKA 4GHIB 4PMAA 3IWIA 3VP4A 3BYDA 2M7VA 1P9WA 1TF1A 3NIAA 5CXWA 4RVAA 2V1BA 4U0TA 3GQZA 1FR6A 3HLDA 3N8RA 3DAVA 3IX3A 5M18A 3JVVA 4IEDA 1LI0A 4S2LA 2ZOHA 2W0NA 4D2OA 1LSWA 4EBPA 1L3LA 4MLLA 1H3QA 3MFDA 1XA7A 5FI2A 3HCYA 4QHCA 5DKLA 3ULFA 2FZ0A 3IXGA 3H82A 1OJGA 1M6KA 4CLCE 2JN7A 2EXBA 1I2WA 2HV1A 3BLSA 1NXYA 4KZ9A 3FKWA 1V9YA 4NXEA 2Z2LB 1DRMA 4Q0HA 2PYRA 3KYZA 3BWLA 2Z6DA 3U4LP 5FQKA 1O07A 3CAXA 5CGXA 4DXBA 4LRXC 3UB6A 3Q07A 1YSPA 2XQZA 3CHWP 4WEKA 4KZBA 4N9KA 1L0FA 3A0SA 2O9AA 5AVFA 5TR7A 4HJ4A 3ICYA 4WMCD 5FAOA 2HZ5A 4R0QA 5DF9A 1ONHA 5U47A 3F1PA 4DDSA 2EX8A 4K91A 1YKDA 2IWDA 1MBLA 4ZBEA 3HLBA 1QMEA 3NULA 3DBAA 4ETZA 5L8MA 1PWGA 3NOTC 2PHYA 1S1ZA 3LEZA 1HZOA 2EX2A 1ZTUA 3PYPA 3CI6A 3QP6A 2H28A 5I94A 3IQAA 1GHPA 3CPTB 3UDXA 4N9LA 3HUMA 4JGQA 3R7WA 5CHUA 3S7PA 5HWVA 4H6JB 1YT4A 2O9BA 2HDRA 4M4XA 1UWNX 3CITA 5IHVA 1JVJA 5CRFA 3C30A 4OPZA 1OPXA 1K54A 3FYZA 2ZOIA 4K0XA 3C4OA 3LFVA 3W4OA 1KDWA 5HL1A 1BT5A 5LBRA 5CECA 4GJ4A 3UE6A 5EV0A 2D02A 1IYQA 4IUKA 3T1SA 1WYCA 4EUZA 1D7EA 1XJ3A 4E6WA 3HLEA 3OPHA 3GTCA 2V1ZA 2HP9A 2XK1A 3ZNYA 1Y54A 1ES5A 4I3JA 4KG6A 1FCNA 3D9YA 3OPLA 2XH9A 3ZCZA 2EFUA 1XP4A 3RH8B 4MCWA 4OPQA 5I5LA 2V8FA 1D1JA 3BFCA 3KSHA 3PTEA 4HH3A 1SKOA 1G28A 1AXBA 4XT2B 4RX3A 3W8KA 4E04A 4HESA 3N4IA 2B95A 4XXRA 3H9WA 1KVMA 3CMZA 4WMCA 3C4PA 4ZJ3A 3Q1FA 4GW9A 5FL3A 1XGJA 5D3OA 3MXSA 4KZ6A 5EECA 3W2ZA 2E8JA 5HARA 3A3JA 5HD5A 4HNBA 4BD0A 3GSGA 3IXDA 4A5RA 2EA9A 1P9RA 1LLBA 5CTNA 3BEBA 3NC8A 4AFIA 4ETXA 5HFOA 4JF6A 3WS0A 1G6OA 5EVEA 1UWPX 3IT9A 1P97A 4OQIA 1EROA 4L9GA 5FDHA 3UPPA 2ZM8A 3H7WB 4WZ4A 4KUOA 2J3WA 5HZHA 3C8CA 2R9XA 2DMWA 2WUQA 1NZUA 4ZTKA 1L0DA 4FUWA 3DTEA 4FOFA 1HD8A 1GHIA 1BLHA 4MNRA 5A93A 2ZM2A 2VV6A 4CPKA 2Z6CA 4QB8A 1W8QA 2FFYA 2D01A 3VP2A 3OCLA 1KE3A 1F5MA 4IBXA 3N6IA 2KLIA 2XLNA 4WBGA 3UO9A 4GB7A 3EOIA 2Y4AA 1BLCA 4WL9A 1N9OA 2QJ7A 3UMDA 2XFTA 2Y2HA 3A0RA 3LR4A 3BLMA 3D3OA 2WZXA 5A91A 3CPTA 3HUOA 3ZHHA 1NRFA 4OLDA 2QWSA 3HJKA 3ITBA 2BG1A 2MJ6A 4H6JA 3T4LA 1ZG6A 2WADA 4GD6A 3LY3A 5HW3A 3S7QA 2VGLS 1Q2PA 5J8XA 4LV2A 3DTKA 3ZVWA 1XFQA 5A92A 3WS5A 3ZG8B 2Q9MA 5G18A 2IWBA 3L9KA 5EPHA 3PBTA 4OQ0A 1I2SA 4WZ5C 4NXGA 3G32A 4M3KA 5G4YA 5FQQA 2IWCA 2PDRA 3O3VA 3GRJA 1Q2QA 3T1QB 4LCMA 5HDSA 5BOHA 5EFWA 3MZFA 1CJFA 4C6YA 4UQIM 2W3DA 4LPZA 1VQQA 5JYOA 2PD7A 4XT2A 4X68A 3AGDA 3M2KA 4R70A 5J7EA 3UDFA 1E3UD 1S0WA 2X02A 4X1MA 4U3TA 2VX8A 3LR0A 4S2KA 3GVBA 1ACFA 1W63Q 1NLYA 4S2IA 2H5SA 5DTTA 1MWRA 3HLGA 1IELA 1Z6FA 3ZNTA 3HBRA 1NZOA 4KQQA 4WYYA 4EETB 1S66L 4GLQA 1ESIA 5GHZA 2WAEA 1P0ZA 2I72A 4JGOA 5CHJA 4S2JA 1FQGA 5FAQA 1N9LA 5CGSA 1STZA 3QP2A 5IU1A 5DKKA 4LV3A 3U2AA 2PR6A 5HDDA 4N1HA 3UN7A 4JXSA 1GA0A 1IKGA 3NECA 5CX7A 1Y28A 3UB5P 4PM8A 4LRYC 3VP3A 4G3KA 2BTFP 4GCZA 4CLCC 3NOUC 3V39A 1K6SA 4R6LA 4P0MA 3H7WA 4ESPA 1GSWA 4Y13A 1K55C 4WLAA 3IS2B 4R4SA 1CQAA 4UA7A 4DJ2A 3P09A 3BJNA 3OCNA 4I3IA 4OOLA 1K6RA 1NLZA 4OVDA 2JE5A 4BD1A 4ID4A 3MSHA 1PWDA 3IBJA 4KQDA 3KO6A 5M19A 3JYIA 4UEYA 1MKIA 1DJBA 3B47A 3UDIA 4HH2A 3RXWA 3LR5A 3SS4A 2OV5A 3Q7VB 1SDNA 1PFLA 2INWA 5HX9A 2H0TA 5HDCA 3RFBA 1ERMA 3IF5A 5DVAA 2EFXA 3VOYA 4BL2A 4EBNA 4WELA 4PPRA 5K5BA 1YPRA 4RX2A 4OKPA 3Q81A 3LUQA 3LO7A
chains in the Genus database with same CATH topology
1XPBA 1XKZA 4OP8A 4OPYA 4XUZA 4RA7A 3CJMA 3IWOA 1G68A 2ZQCA 5EVIB 2WGWA 5FAPA 1YT4A 4QJGA 4QD4A 4Y0UA 3VMAA 2H10A 4F94A 2HDRA 1W7FA 1XXMA 4E3LA 3HUNA 4JXVA 1JVJA 5IHVA 5CRFA 1FR1A 1MWUA 1YLTA 4EQIA 2OSUA 1E3UA 1PWCA 1JTGA 3IF6B 1N4OA 1YLPA 4OPZA 3OPRA 2C6WB 1ES2A 2Y2KA 1C3BA 1K54A 3FYZA 3MXRA 4K0XA 1CEGA 3C4OA 5DTKA 4LENA 3VP1A 3W4OA 5E2GA 3ZGAB 5AQBA 3VOZA 4L0LA 1KDWA 1YMSA 3IH9A 1BT5A 5HL1A 5CECA 4HEFA 5FI7A 1N9BA 3DTMA 3IXBA 4DDYA 1SHVA 3PBRA 1MY8A 4XUXA 1VM1A 2JCHA 2G2WA 4FSFA 3PBNA 3WS4A 1IYQA 1K57A 4N1XA 1WYCA 4E3KA 4EUZA 3E2KA 5CTMA 1FSYA 2HDQA 4BLMA 4E6WA 3TG9A 5GL9A 3HLEA 5E2HA 1LHYA 3OPHA 3GTCA 2V1ZA 2X01A 1TDLA 2HP9A 2XGNA 2XK1A 3A3EA 3BM6A 5GHYA 3W4QA 3HREA 1RGYA 3ITAA 1XX2A 5CERA 3ZNYA 1BULA 1BSGA 1MWSA 3HLCA 2XR0A 4UHUA 3WRZA 1Y54A 1ES5A 1FSWA 3MKFA 4JXWA 3WRTA 4KG6A 1FCNA 1ERQA 2DNSA 5HAPA 5A90A 4FCFA 4U0XA 4Y7PA 3OPLA 1J9MA 2XH9A 2HP6A 2JBFA 5F82A 4E3JA 3UE0A 3ZCZA 2EFUA 1XP4A 1CI9A 4QY5A 4YINA 4OPQA 2V20A 3EQVA 1CI8A 4GOGA 3NY4A 3SH8A 3P98A 2ZQDA 1BLSA 1W5DA 3BFCA 3PTEA 3W4PA 4ZJ1A 1AXBA 1SKFA 3DW0A 4RX3A 4JF5A 3W8KA 1FOFA 1PYYA 4R23A 5GLDA 1BLPA 3S4XA 2J8YA 2OLUA 4B88A 4EBLA 4P85A 4HESA 5EE8A 3N4IA 1JWZA 5EVID 4XXRA 3LCEA 3QNBA 1KGEA 4UAAA 5HAIA 2E8IA 4FD8A 5EVLA 1KVMA 4UA9A 2ZC5B 4KQRA 3CMZA 4WMCA 1IYOA 3C4PA 2Y91A 2EXAA 3IHBA 4ZJ3A 3Q1FA 5HAQA 4KZ7A 2XF3A 4KG5A 3IHAA 4E6XA 1XGJA 4N92A 4OLGA 3VFFA 5D3OA 3MXSA 4KZ6A 5EECA 3VFHA 5HARA 2XD1A 1NYMA 4MBHA 4CJNA 2WYXA 1G6AA 3A3JA 3G2ZA 3C5AA 3UE1A 4S2MA 4KG2A 1RCJA 4BD0A 3GSGA 1CK3A 4DXCA 5KZHA 3IXDA 4OP5A 4S2OA 1K54C 5L2FA 1DY6A 4A5RA 4B4ZA 1KE0A 2WKHA 1LLBA 1TDGA 1PI4A 3BEBA 1HTZA 3NC8A 5CTNA 1CEFA 2EX9A 2ZC3B 5HFOA 4JF6A 4X6TA 2ZLYA 3A3DA 3S22A 1ESUA 3G30A 3WS0A 1BUEA 3V3SA 5F1FA 1MXOA 1L2SA 4K0WA 3PAGA 1K57C 2RL3A 1LL5A 4HBUA 3IT9A 3E2LA 5E2FA 5CGWA 3RXXA 4JLFA 2J9PA 2XD5A 3CZDA 1EI5A 1ONGA 4ZAMA 3V3RA 3DWKA 4DE1A 3A3FA 2ZC6B 1KGGA 1EROA 3A3IA 4OQIA 2UWXA 4X69A 5FDHA 5FSRA 4EWFA 3UPPA 2ZM8A 3IH8A 2Z2MB 4WZ4A 3SH9A 3O87A 2EX6A 3ZG5A 1K4EA 5E2EA 4E3OA 1L0GA 3VSKA 1DJAA 2R9XA 4H8RA 2WUQA 4WEJA 1NZUA 4E3NA 4Q8IA 2WGVA 4BL3A 4FH2A 4ZTKA 2QPNA 4X55A 2ZQ7A 1U60A 4DKIA 3WS1A 2J7VA 5FQIA 4PM9A 1L0DA 4WZ5A 2Y2QA 5GLAA 1YLYA 2ZM0A 1RP5A 1HD8A 1GHIA 1BLHA 4MNRA 2WZZA 5A93A 2P9VA 3FV7A 3BFGA 3OPPA 1YM1A 2ZM2A 4CPKA 1SDEA 4ZJ2A 3AGEA 3FZCA 4QB8A 3UNWA 1I5QA 1PIOA 4GN2A 1PW8A 1W8QA 2FFYA 3M2JA 5DF7A 3VP2A 2V2FF 3MZDA 3PBQA 1DJCA 3MZEA 1LL9A 3OCLA 4LV0A 4S2NA 1GCEA 3QHYA 1IKIA 1K56D 1PZPA 3I7JA 3SH7A 1KE3A 4IBXA 5FASA 2A49A 4OQGA 3N6IA 3GMWA 2XLNA 3Q7VA 4WBGA 3UO9A 1TEMA 3N8SA 3G31A 3ZG0A 5FA7A 4GB7A 3V5MA 3G2YA 3M6BA 1IYPA 2Y4AA 1FCMA 1BLCA 5CEBA 2Y2IA 3D4FA 4IVIA 1ZC2A 4JBFA 2ZD8A 2OLVA 4GDBA 3O86A 2XFTA 2Y2HA 4GKUA 3BLMA 3AGFA 3DWZA 5FI6A 2WZXA 3N7WA 5A91A 4GD8A 2WGWB 4OH0A 5FATA 3HUOA 1E4DA 4Y0OA 3VP0A 3ZHHA 4FH4A 4OONA 4X53A 2Y2NA 1NRFA 3NDEA 4RYEA 2ZMAA 2QMIA 3HLFA 4OLDA 5TFQA 1ZKJA 1PI5A 4R3BA 3ITBA 4R3JA 2BG1A 2P74A 4KZ8A 3UE3A 4MEZA 5EVIA 2R9WA 1ZG6A 2WADA 2ZQ9A 3PBSA 2Q9NA 4R4RA 4GD6A 3LY3A 4Y0TA 3ZG7B 5HW3A 3BECA 4KZAA 5E43A 1Q2PA 5AQ9A 1O7EA 3SS5A 4LV2A 5J8XA 1OMEA 5AQAA 1H5XA 2PU4A 3WS2A 1ES4A 2DCFA 4YFMA 3IF6A 2J9OA 2Y2GA 3ZVWA 2PBYA 1JWPA 4KQOA 3EQUA 4NK3A 5A92A 1GHMA 2ZC4B 3WS5A 3ZG8B 2Q9MA 5G18A 2IWBA 1ALQA 4E3MA 2RCXA 1S6RA 1NY0A 5EPHA 3PBTA 4IVKA 2G2UA 5FQMA 4GZBA 1HVBA 1LI9A 1PW1A 4OQ0A 2WK0A 3FKVA 2C5WB 1I2SA 3LY4A 2ZC7A 1XA1A 5GLCA 3S1YA 1RGZA 4GDNA 2WAFA 4WZ5C 3HLWA 3G32A 4M3KA 1KDSA 3HL9A 3BFFA 5FQQA 2IWCA 4P87A 3VSLA 3O3VA 2Y2OA 1XGIA 4O7DA 1BZAA 1ZG4A 4MBFA 3O88A 2XEPA 2CC1A 1YLJA 1JTDA 4P6BA 3GRJA 4Z9QA 4MBKA 1Q2QA 1K4FA 3HVFA 3GR2A 1YMXA 3BFEA 4JPMA 4S2PA 4C75A 3GV9A 4LCMA 5BOHA 2Y2PA 3IWQA 4LV1A 4BJPA 1K55A 4JKTA 4OQHA 4S2NC 1IYSA 2JC7A 3MZFA 2ZQAA 4C6YA 2DRWA 4JXGA 5EOEA 1VQQA 4EV4A 2FFFB 2HPBA 3NBLA 3QNCA 5EOOA 2VGKA 1K25A 3G35A 1IEMA 5JYOA 4PMAA 3IWIA 3VP4A 3BYDA 4X56A 3MKEA 3NIAA 1MWTA 5CXWA 4X68A 1KGFA 4RVAA 5KMWA 4DE3A 1KVLA 3AGDA 3M2KA 1PZOA 3GQZA 4U0TA 1FR6A 3UY6A 3UDFA 2WKEA 1E3UD 3HLDA 3WWXA 3N8RA 2Y59A 1S0WA 3NDGA 2X02A 5M18A 4U3TA 4IEDA 3G34A 4S2KA 1E25A 1LI0A 1NYYA 1SCWA 4S2LA 3TSGA 4C3QA 4D2OA 3GVBA 3ZFZA 4EBPA 2B5RA 5EVIC 4HBTA 3MBZA 5F1GA 4S2IA 4MLLA 5AQ7A 2H5SA 4LCLA 3MFDA 5DTTA 1MWRA 2HDUA 1XA7A 5FI2A 5M1AA 3HLGA 4QHCA 1IELA 1Z6FA 3ZNTA 3RJUA 1NJ4A 3HBRA 1NZOA 5GLBA 3IXGA 1K56A 4KQQA 4QU3A 3Q7ZA 4WYYA 1M6KA 3IF6C 1ESIA 5GHZA 2WAEA 5FQ9A 2EXBA 2I72A 5CHJA 1I2WA 1QMFA 4S2JA 1FQGA 5FAQA 2GDNA 3BLSA 5CGSA 1NXYA 2HP5A 1WYBA 1JWVA 3NI9A 4KZ9A 3FKWA 4LV3A 2Z2LB 2ZJ9A 4UA6A 5GHXA 2WKIA 3ZDJA 3UPOA 2VGJA 2H0YA 3N8LA 4N1HA 4BQMA 1M40A 3SOIA 3UN7A 4JXSA 1GA0A 5FQKA 4PM7A 1IKGA 3NCKA 5DF8A 4DRTA 4OPRA 1W8YA 1YLZA 3OC2A 4PM8A 3SS3A 3VP3A 4KZ4A 2HDSA 4DF6A 1O07A 1H8ZA 1GA9A 5CGXA 1FCOA 4DXBA 2Y2JA 4DE0A 3Q07A 4JF4A 2QZ6A 2XQZA 3OZHA 1YQSA 1BTLA 4QY6A 1H8YA 1L0EA 4KZBA 1K6SA 4WEKA 4N9KA 4P0MA 3V39A 4R1GA 3C7VA 1L0FA 4B4XA 3CG5A 1K55C 4KZ5A 4PM6A 4R4SA 4KZ3A 3FWLA 4UA7A 3Q82A 5TR7A 3P09A 4BENA 3OCNA 3M6HA 4OOYA 2ZQ8A 4WMCD 5TGFA 5FAOA 4R0QA 5KSHA 2P9VB 5DF9A 5CEDA 3IXHA 4OOLA 5F83A 1K6RA 1ONHA 1KE4A 5U47A 5CHMA 4DDSA 2XFSA 3BFDA 2EX8A 4OVDA 4WM9A 2JE5A 3ZG9B 1WE4A 3G4PA 4ID4A 4BD1A 4IBRA 1PWDA 4K91A 5FQJA 5KSCA 3C7UA 5M19A 1W79A 2IWDA 3JYIA 5JYPA 3PBOA 1MBLA 1YLWA 2PU2A 5DTSA 1MKIA 1DJBA 3UDIA 4ZBEA 1TVFA 3HLBA 1QMEA 4KENB 3RXWA 3SS4A 4ZDXA 2OV5A 2Y55A 3B3XA 1MPLA 1SDNA 3Q7VB 1PWGA 3ZVTA 3LEZA 1ES3A 2Y2LA 1HZOA 2H0TA 5HX9A 2X71A 4E3IA 1EWZA 2EX2A 2Y2MA 4DE2A 3V50A 1ERMA 3IF5A 5DVAA 2BLSA 2EFXA 3VOYA 1K38A 5I94A 4OOMA 2A3UA 4BL2A 3IQAA 3PAEA 4EBNA 1GHPA 3UDXA 3UPNA 4PM5A 4WELA 3BRMA 4N9LA 4PPRA 3HUMA 4GNUA 4RX2A 5EUAA 2XDMA 4OKPA 3Q81A 5CHUA 4NETA 3TOIA 2WGIA 3ISGA 3LO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPB A;  1XKZ A;  4OP8 A;  4OPY A;  4XUZ A;  4RA7 A;  3CJM A;  3IWO A;  1G68 A;  2ZQC A;  5EVI B;  2WGW A;  5FAP A;  1YT4 A;  4QJG A;  4QD4 A;  4Y0U A;  3VMA A;  2H10 A;  4F94 A;  2HDR A;  1W7F A;  1XXM A;  4E3L A;  3HUN A;  4JXV A;  1JVJ A;  5IHV A;  5CRF A;  1FR1 A;  1MWU A;  1YLT A;  4EQI A;  2OSU A;  1E3U A;  1PWC A;  1JTG A;  3IF6 B;  1N4O A;  1YLP A;  4OPZ A;  3OPR A;  2C6W B;  1ES2 A;  2Y2K A;  1C3B A;  1K54 A;  3FYZ A;  3MXR A;  4K0X A;  1CEG A;  3C4O A;  5DTK A;  4LEN A;  3VP1 A;  3W4O A;  5E2G A;  3ZGA B;  5AQB A;  3VOZ A;  4L0L A;  1KDW A;  1YMS A;  3IH9 A;  1BT5 A;  5HL1 A;  5CEC A;  4HEF A;  5FI7 A;  1N9B A;  3DTM A;  3IXB A;  4DDY A;  1SHV A;  3PBR A;  1MY8 A;  4XUX A;  1VM1 A;  2JCH A;  2G2W A;  4FSF A;  3PBN A;  3WS4 A;  1IYQ A;  1K57 A;  4N1X A;  1WYC A;  4E3K A;  4EUZ A;  3E2K A;  5CTM A;  1FSY A;  2HDQ A;  4BLM A;  4E6W A;  3TG9 A;  5GL9 A;  3HLE A;  5E2H A;  1LHY A;  3OPH A;  3GTC A;  2V1Z A;  2X01 A;  1TDL A;  2HP9 A;  2XGN A;  2XK1 A;  3A3E A;  3BM6 A;  5GHY A;  3W4Q A;  3HRE A;  1RGY A;  3ITA A;  1XX2 A;  5CER A;  3ZNY A;  1BUL A;  1BSG A;  1MWS A;  3HLC A;  2XR0 A;  4UHU A;  3WRZ A;  1Y54 A;  1ES5 A;  1FSW A;  3MKF A;  4JXW A;  3WRT A;  4KG6 A;  1FCN A;  1ERQ A;  2DNS A;  5HAP A;  5A90 A;  4FCF A;  4U0X A;  4Y7P A;  3OPL A;  1J9M A;  2XH9 A;  2HP6 A;  2JBF A;  5F82 A;  4E3J A;  3UE0 A;  3ZCZ A;  2EFU A;  1XP4 A;  1CI9 A;  4QY5 A;  4YIN A;  4OPQ A;  2V20 A;  3EQV A;  1CI8 A;  4GOG A;  3NY4 A;  3SH8 A;  3P98 A;  2ZQD A;  1BLS A;  1W5D A;  3BFC A;  3PTE A;  3W4P A;  4ZJ1 A;  1AXB A;  1SKF A;  3DW0 A;  4RX3 A;  4JF5 A;  3W8K A;  1FOF A;  1PYY A;  4R23 A;  5GLD A;  1BLP A;  3S4X A;  2J8Y A;  2OLU A;  4B88 A;  4EBL A;  4P85 A;  4HES A;  5EE8 A;  3N4I A;  1JWZ A;  5EVI D;  4XXR A;  3LCE A;  3QNB A;  1KGE A;  4UAA A;  5HAI A;  2E8I A;  4FD8 A;  5EVL A;  1KVM A;  4UA9 A;  2ZC5 B;  4KQR A;  3CMZ A;  4WMC A;  1IYO A;  3C4P A;  2Y91 A;  2EXA A;  3IHB A;  4ZJ3 A;  3Q1F A;  5HAQ A;  4KZ7 A;  2XF3 A;  4KG5 A;  3IHA A;  4E6X A;  1XGJ A;  4N92 A;  4OLG A;  3VFF A;  5D3O A;  3MXS A;  4KZ6 A;  5EEC A;  3VFH A;  5HAR A;  2XD1 A;  1NYM A;  4MBH A;  4CJN A;  2WYX A;  1G6A A;  3A3J A;  3G2Z A;  3C5A A;  3UE1 A;  4S2M A;  4KG2 A;  1RCJ A;  4BD0 A;  3GSG A;  1CK3 A;  4DXC A;  5KZH A;  3IXD A;  4OP5 A;  4S2O A;  1K54 C;  5L2F A;  1DY6 A;  4A5R A;  4B4Z A;  1KE0 A;  2WKH A;  1LLB A;  1TDG A;  1PI4 A;  3BEB A;  1HTZ A;  3NC8 A;  5CTN A;  1CEF A;  2EX9 A;  2ZC3 B;  5HFO A;  4JF6 A;  4X6T A;  2ZLY A;  3A3D A;  3S22 A;  1ESU A;  3G30 A;  3WS0 A;  1BUE A;  3V3S A;  5F1F A;  1MXO A;  1L2S A;  4K0W A;  3PAG A;  1K57 C;  2RL3 A;  1LL5 A;  4HBU A;  3IT9 A;  3E2L A;  5E2F A;  5CGW A;  3RXX A;  4JLF A;  2J9P A;  2XD5 A;  3CZD A;  1EI5 A;  1ONG A;  4ZAM A;  3V3R A;  3DWK A;  4DE1 A;  3A3F A;  2ZC6 B;  1KGG A;  1ERO A;  3A3I A;  4OQI A;  2UWX A;  4X69 A;  5FDH A;  5FSR A;  4EWF A;  3UPP A;  2ZM8 A;  3IH8 A;  2Z2M B;  4WZ4 A;  3SH9 A;  3O87 A;  2EX6 A;  3ZG5 A;  1K4E A;  5E2E A;  4E3O A;  1L0G A;  3VSK A;  1DJA A;  2R9X A;  4H8R A;  2WUQ A;  4WEJ A;  1NZU A;  4E3N A;  4Q8I A;  2WGV A;  4BL3 A;  4FH2 A;  4ZTK A;  2QPN A;  4X55 A;  2ZQ7 A;  1U60 A;  4DKI A;  3WS1 A;  2J7V A;  5FQI A;  4PM9 A;  1L0D A;  4WZ5 A;  2Y2Q A;  5GLA A;  1YLY A;  2ZM0 A;  1RP5 A;  1HD8 A;  1GHI A;  1BLH A;  4MNR A;  2WZZ A;  5A93 A;  2P9V A;  3FV7 A;  3BFG A;  3OPP A;  1YM1 A;  2ZM2 A;  4CPK A;  1SDE A;  4ZJ2 A;  3AGE A;  3FZC A;  4QB8 A;  3UNW A;  1I5Q A;  1PIO A;  4GN2 A;  1PW8 A;  1W8Q A;  2FFY A;  3M2J A;  5DF7 A;  3VP2 A;  2V2F F;  3MZD A;  3PBQ A;  1DJC A;  3MZE A;  1LL9 A;  3OCL A;  4LV0 A;  4S2N A;  1GCE A;  3QHY A;  1IKI A;  1K56 D;  1PZP A;  3I7J A;  3SH7 A;  1KE3 A;  4IBX A;  5FAS A;  2A49 A;  4OQG A;  3N6I A;  3GMW A;  2XLN A;  3Q7V A;  4WBG A;  3UO9 A;  1TEM A;  3N8S A;  3G31 A;  3ZG0 A;  5FA7 A;  4GB7 A;  3V5M A;  3G2Y A;  3M6B A;  1IYP A;  2Y4A A;  1FCM A;  1BLC A;  5CEB A;  2Y2I A;  3D4F A;  4IVI A;  1ZC2 A;  4JBF A;  2ZD8 A;  2OLV A;  4GDB A;  3O86 A;  2XFT A;  2Y2H A;  4GKU A;  3BLM A;  3AGF A;  3DWZ A;  5FI6 A;  2WZX A;  3N7W A;  5A91 A;  4GD8 A;  2WGW B;  4OH0 A;  5FAT A;  3HUO A;  1E4D A;  4Y0O A;  3VP0 A;  3ZHH A;  4FH4 A;  4OON A;  4X53 A;  2Y2N A;  1NRF A;  3NDE A;  4RYE A;  2ZMA A;  2QMI A;  3HLF A;  4OLD A;  5TFQ A;  1ZKJ A;  1PI5 A;  4R3B A;  3ITB A;  4R3J A;  2BG1 A;  2P74 A;  4KZ8 A;  3UE3 A;  4MEZ A;  5EVI A;  2R9W A;  1ZG6 A;  2WAD A;  2ZQ9 A;  3PBS A;  2Q9N A;  4R4R A;  4GD6 A;  3LY3 A;  4Y0T A;  3ZG7 B;  5HW3 A;  3BEC A;  4KZA A;  5E43 A;  1Q2P A;  5AQ9 A;  1O7E A;  3SS5 A;  4LV2 A;  5J8X A;  1OME A;  5AQA A;  1H5X A;  2PU4 A;  3WS2 A;  1ES4 A;  2DCF A;  4YFM A;  3IF6 A;  2J9O A;  2Y2G A;  3ZVW A;  2PBY A;  1JWP A;  4KQO A;  3EQU A;  4NK3 A;  5A92 A;  1GHM A;  2ZC4 B;  3WS5 A;  3ZG8 B;  2Q9M A;  5G18 A;  2IWB A;  1ALQ A;  4E3M A;  2RCX A;  1S6R A;  1NY0 A;  5EPH A;  3PBT A;  4IVK A;  2G2U A;  5FQM A;  4GZB A;  1HVB A;  1LI9 A;  1PW1 A;  4OQ0 A;  2WK0 A;  3FKV A;  2C5W B;  1I2S A;  3LY4 A;  2ZC7 A;  1XA1 A;  5GLC A;  3S1Y A;  1RGZ A;  4GDN A;  2WAF A;  4WZ5 C;  3HLW A;  3G32 A;  4M3K A;  1KDS A;  3HL9 A;  3BFF A;  5FQQ A;  2IWC A;  4P87 A;  3VSL A;  3O3V A;  2Y2O A;  1XGI A;  4O7D A;  1BZA A;  1ZG4 A;  4MBF A;  3O88 A;  2XEP A;  2CC1 A;  1YLJ A;  1JTD A;  4P6B A;  3GRJ A;  4Z9Q A;  4MBK A;  1Q2Q A;  1K4F A;  3HVF A;  3GR2 A;  1YMX A;  3BFE A;  4JPM A;  4S2P A;  4C75 A;  3GV9 A;  4LCM A;  5BOH A;  2Y2P A;  3IWQ A;  4LV1 A;  4BJP A;  1K55 A;  4JKT A;  4OQH A;  4S2N C;  1IYS A;  2JC7 A;  3MZF A;  2ZQA A;  4C6Y A;  2DRW A;  4JXG A;  5EOE A;  1VQQ A;  4EV4 A;  2FFF B;  2HPB A;  3NBL A;  3QNC A;  5EOO A;  2VGK A;  1K25 A;  3G35 A;  1IEM A;  5JYO A;  4PMA A;  3IWI A;  3VP4 A;  3BYD A;  4X56 A;  3MKE A;  3NIA A;  1MWT A;  5CXW A;  4X68 A;  1KGF A;  4RVA A;  5KMW A;  4DE3 A;  1KVL A;  3AGD A;  3M2K A;  1PZO A;  3GQZ A;  4U0T A;  1FR6 A;  3UY6 A;  3UDF A;  2WKE A;  1E3U D;  3HLD A;  3WWX A;  3N8R A;  2Y59 A;  1S0W A;  3NDG A;  2X02 A;  5M18 A;  4U3T A;  4IED A;  3G34 A;  4S2K A;  1E25 A;  1LI0 A;  1NYY A;  1SCW A;  4S2L A;  3TSG A;  4C3Q A;  4D2O A;  3GVB A;  3ZFZ A;  4EBP A;  2B5R A;  5EVI C;  4HBT A;  3MBZ A;  5F1G A;  4S2I A;  4MLL A;  5AQ7 A;  2H5S A;  4LCL A;  3MFD A;  5DTT A;  1MWR A;  2HDU A;  1XA7 A;  5FI2 A;  5M1A A;  3HLG A;  4QHC A;  1IEL A;  1Z6F A;  3ZNT A;  3RJU A;  1NJ4 A;  3HBR A;  1NZO A;  5GLB A;  3IXG A;  1K56 A;  4KQQ A;  4QU3 A;  3Q7Z A;  4WYY A;  1M6K A;  3IF6 C;  1ESI A;  5GHZ A;  2WAE A;  5FQ9 A;  2EXB A;  2I72 A;  5CHJ A;  1I2W A;  1QMF A;  4S2J A;  1FQG A;  5FAQ A;  2GDN A;  3BLS A;  5CGS A;  1NXY A;  2HP5 A;  1WYB A;  1JWV A;  3NI9 A;  4KZ9 A;  3FKW A;  4LV3 A;  2Z2L B;  2ZJ9 A;  4UA6 A;  5GHX A;  2WKI A;  3ZDJ A;  3UPO A;  2VGJ A;  2H0Y A;  3N8L A;  4N1H A;  4BQM A;  1M40 A;  3SOI A;  3UN7 A;  4JXS A;  1GA0 A;  5FQK A;  4PM7 A;  1IKG A;  3NCK A;  5DF8 A;  4DRT A;  4OPR A;  1W8Y A;  1YLZ A;  3OC2 A;  4PM8 A;  3SS3 A;  3VP3 A;  4KZ4 A;  2HDS A;  4DF6 A;  1O07 A;  1H8Z A;  1GA9 A;  5CGX A;  1FCO A;  4DXB A;  2Y2J A;  4DE0 A;  3Q07 A;  4JF4 A;  2QZ6 A;  2XQZ A;  3OZH A;  1YQS A;  1BTL A;  4QY6 A;  1H8Y A;  1L0E A;  4KZB A;  1K6S A;  4WEK A;  4N9K A;  4P0M A;  3V39 A;  4R1G A;  3C7V A;  1L0F A;  4B4X A;  3CG5 A;  1K55 C;  4KZ5 A;  4PM6 A;  4R4S A;  4KZ3 A;  3FWL A;  4UA7 A;  3Q82 A;  5TR7 A;  3P09 A;  4BEN A;  3OCN A;  3M6H A;  4OOY A;  2ZQ8 A;  4WMC D;  5TGF A;  5FAO A;  4R0Q A;  5KSH A;  2P9V B;  5DF9 A;  5CED A;  3IXH A;  4OOL A;  5F83 A;  1K6R A;  1ONH A;  1KE4 A;  5U47 A;  5CHM A;  4DDS A;  2XFS A;  3BFD A;  2EX8 A;  4OVD A;  4WM9 A;  2JE5 A;  3ZG9 B;  1WE4 A;  3G4P A;  4ID4 A;  4BD1 A;  4IBR A;  1PWD A;  4K91 A;  5FQJ A;  5KSC A;  3C7U A;  5M19 A;  1W79 A;  2IWD A;  3JYI A;  5JYP A;  3PBO A;  1MBL A;  1YLW A;  2PU2 A;  5DTS A;  1MKI A;  1DJB A;  3UDI A;  4ZBE A;  1TVF A;  3HLB A;  1QME A;  4KEN B;  3RXW A;  3SS4 A;  4ZDX A;  2OV5 A;  2Y55 A;  3B3X A;  1MPL A;  1SDN A;  3Q7V B;  1PWG A;  3ZVT A;  3LEZ A;  1ES3 A;  2Y2L A;  1HZO A;  2H0T A;  5HX9 A;  2X71 A;  4E3I A;  1EWZ A;  2EX2 A;  2Y2M A;  4DE2 A;  3V50 A;  1ERM A;  3IF5 A;  5DVA A;  2BLS A;  2EFX A;  3VOY A;  1K38 A;  5I94 A;  4OOM A;  2A3U A;  4BL2 A;  3IQA A;  3PAE A;  4EBN A;  1GHP A;  3UDX A;  3UPN A;  4PM5 A;  4WEL A;  3BRM A;  4N9L A;  4PPR A;  3HUM A;  4GNU A;  4RX2 A;  5EUA A;  2XDM A;  4OKP A;  3Q81 A;  5CHU A;  4NET A;  3TOI A;  2WGI A;  3ISG A;  3LO7 A; 
#chains in the Genus database with same CATH topology
 1XKZ A;  4OP8 A;  2W3E A;  2KDK A;  2A2L A;  5FAP A;  5FEG A;  4QD4 A;  2V9A A;  4O0P A;  3HUN A;  4X25 A;  1FR1 A;  1MWU A;  4EQI A;  1E3U A;  1PWC A;  5IT5 A;  2Y2K A;  1C3B A;  3CLO A;  4NEE D;  5DTK A;  5HSQ A;  4QWO A;  1ZHH B;  2Y8H A;  4B9O A;  3VV4 A;  2PR5 A;  3IXB A;  2WKQ A;  3PBR A;  1MY8 A;  3F1N B;  3PBN A;  2NUP C;  3PXP A;  2HDQ A;  5CTM A;  4CLC B;  2PRF A;  5E2H A;  3A3E A;  3W4Q A;  2OWH A;  5GHY A;  3HRE A;  1RGY A;  1XX2 A;  1BUL A;  3JVU A;  4UHU A;  5KIZ A;  3JPU A;  5HAP A;  5MC7 A;  1T18 A;  3E4O A;  3BQA A;  2HP6 A;  1NWZ A;  2PD8 A;  2IA2 A;  4HQA A;  4YIN A;  3T4J A;  2V20 A;  4MMN A;  3EQV A;  1CI8 A;  2O9C A;  3W4P A;  4ZJ1 A;  4EEP A;  1SKF A;  3DW0 A;  1A0K A;  4R23 A;  1TS6 A;  3S4X A;  2OLU A;  4B88 A;  4EBL A;  4P85 A;  1JWZ A;  3E4P A;  3QNB A;  2E8I A;  2M1C A;  2VGL M;  1DP8 A;  2EXA A;  2KOI A;  3BY9 A;  4PHT A;  1LSX A;  2CMN A;  4O01 A;  2P04 A;  1NYM A;  4MBH A;  4CJN A;  1G6A A;  2WYX A;  3G2Z A;  3UE1 A;  4S2M A;  1RCJ A;  4KUK A;  4DXC A;  4S2O A;  1F98 A;  1KE0 A;  2OOL A;  1T1B A;  2R78 A;  1TDG A;  4HOI A;  1KOU A;  4CLC D;  3A3D A;  3G30 A;  1BUE A;  1OTA A;  1L2S A;  3PAG A;  2RL3 A;  5CGW A;  3PHY A;  3RXX A;  1EI5 A;  1ONG A;  4ZAM A;  3K3C A;  3A3I A;  1KGG A;  3IX8 A;  4EES A;  3EWK A;  5EM0 A;  3SH9 A;  2EX6 A;  5HPF A;  3TJZ C;  2J3T C;  4Z1W A;  4Q8I A;  4E3N A;  2VV8 A;  4BL3 A;  2QPN A;  2ZQ7 A;  5FEF A;  5F68 A;  3DTI A;  4WZ5 A;  2OAQ 1;  5FDS A;  2J80 A;  3IS2 A;  2ZM0 A;  1MKM A;  3LI9 A;  4HJ6 A;  3UB9 A;  4ZJ2 A;  1XJ6 A;  2PAV P;  2LB5 A;  4GN2 A;  5J4E A;  1PW8 A;  5DF7 A;  4LV0 A;  3BW6 A;  3QHY A;  3I7J A;  2L1M A;  3SH7 A;  2NUT C;  3Q7V A;  2WKP A;  3G31 A;  5FA7 A;  3M6B A;  1IYP A;  5CEB A;  3D4F A;  2B02 A;  3LID A;  1ZC2 A;  2HGV A;  2OLV A;  2W1T B;  1SZV A;  4GKU A;  4GD8 A;  2WGW B;  3P7N A;  5FAT A;  1FIL A;  2ZMA A;  3FPW A;  5TFQ A;  4KZ8 A;  4MEZ A;  1OT6 A;  2QYB A;  3ZG7 B;  1J3W A;  3MQ0 A;  3BEC A;  5E43 A;  1O7E A;  3SS5 A;  1OME A;  5AQA A;  2PU4 A;  3WS2 A;  1TS7 A;  2J9O A;  3EGX C;  3BY8 A;  2PBY A;  3EQU A;  4NK3 A;  1GHM A;  2ZC4 B;  2W3H A;  3SW1 A;  5FQM A;  3F1O B;  3LIF A;  3FKV A;  4P6Z M;  2C5W B;  5GLC A;  2WAF A;  3F1N A;  3HL9 A;  3BFF A;  1WA9 A;  2Y2O A;  1XGI A;  4HHD A;  4CLC A;  4WF0 A;  3O88 A;  4D60 A;  3CUE C;  4P6B A;  4Z9Q A;  2L4R A;  4MBK A;  2QHK A;  1YMX A;  2GNX A;  2Y2P A;  3IWQ A;  4LV1 A;  1K55 A;  4S2N C;  2PBD P;  2JC7 A;  2ZQA A;  4QPR A;  4JXG A;  5EOE A;  3G35 A;  1IEM A;  1V9Z A;  4X56 A;  3MKE A;  1KGF A;  5KMW A;  4DE3 A;  1KVL A;  1PZO A;  4Y17 A;  3WWX A;  2Y59 A;  2W3G A;  1N9N A;  1Y4O A;  4GS9 B;  3GEC A;  1MZU A;  4C3Q A;  2B5R A;  3MQQ A;  5EVI C;  4HBT A;  3MBZ A;  5F1G A;  3L7H A;  3ZYT A;  4LCL A;  1VHM A;  2HDU A;  2GJ3 A;  3RJU A;  1NJ4 A;  5GLB A;  3MFX A;  2V0W A;  4MN5 A;  5L09 A;  4QU3 A;  3Q7Z A;  2O99 A;  4ARZ B;  1QMF A;  3T4K A;  2JHE A;  2GDN A;  3UME A;  1WYB A;  2P7J A;  3NI9 A;  1XJ4 A;  1LSV A;  2ZJ9 A;  2XRO A;  3UPO A;  2VGJ A;  2H0Y A;  2J3T D;  3N8L A;  1M40 A;  3TE8 A;  4PM7 A;  3NCK A;  5DF8 A;  4DRT A;  2L0W A;  4OPR A;  1W8Y A;  3SS3 A;  2HDS A;  1H8Z A;  1F9I A;  2Y2J A;  3K2N A;  3MS6 A;  4B93 A;  1YQS A;  2LB9 A;  1BTL A;  4QY6 A;  1OTB A;  3T4T A;  2JKG A;  3C7V A;  3VE3 A;  1T1C A;  4B4X A;  3CG5 A;  4KZ3 A;  1X0O A;  4BEN A;  4OOY A;  5TGF A;  4EER A;  2P9V B;  3LIB A;  5CHM A;  2XFS A;  3BFD A;  1WE4 A;  4IBR A;  5FQJ A;  3FC7 A;  1W79 A;  4LLO B;  4NG2 A;  3PBO A;  2PU2 A;  5DTS A;  1TVF A;  4KEN B;  4PKY G;  4ZDX A;  3B3X A;  3T1X A;  5L07 A;  2X71 A;  2Y2M A;  3V50 A;  2P08 A;  2BLS A;  3NHQ A;  2A3U A;  1VEU B;  4PAU A;  3BRM A;  4GNU A;  5EUA A;  5G4Z A;  4NET A;  3TOI A;  3TRC A;  2W1T A;  1Z09 A;  4XUZ A;  3CJM A;  5EVI B;  2WGW A;  2I9V A;  4QJG A;  4Y0U A;  2H10 A;  4F94 A;  1XXM A;  4JXV A;  1IOU A;  3MXQ A;  1JTG A;  4HIA A;  1YLP A;  2C6W B;  1W63 M;  3IBR A;  4Q0I A;  1CEG A;  5HPI A;  3VP1 A;  5A8B A;  2G7U A;  2PYP A;  3VOZ A;  4L0L A;  4HEF A;  3A0V A;  1N9B A;  1SHV A;  4XUX A;  1VM1 A;  2JCH A;  4FSF A;  3WS4 A;  4E3K A;  2OAP 1;  3F1O A;  4BLM A;  3TG9 A;  4JGP A;  2X01 A;  1TDL A;  2XGN A;  3OOV A;  3NJA A;  5CER A;  1BSG A;  1MWS A;  2Q0O A;  2XR0 A;  1FSW A;  3WRT A;  1ERQ A;  1S4S A;  3OBF A;  3R4K A;  5A90 A;  4FCF A;  5DJU A;  4YNR A;  2JBF A;  1CI9 A;  4QY5 A;  4GOG A;  3P98 A;  2ZQD A;  1BLS A;  1W5D A;  4I3A A;  3E0Y A;  4YWZ A;  5F5Y A;  2YKH A;  1FOF A;  1BLP A;  2J8Y A;  3EGD C;  2OWJ A;  2W27 A;  5EE8 A;  5EVI D;  4UAA A;  3LIC A;  1XFN A;  3MR0 A;  2ZC5 B;  4KQR A;  1IYO A;  2Y91 A;  1DP9 A;  5HAQ A;  4KZ7 A;  3IHA A;  4OLG A;  3VFF A;  5TBM B;  3VFH A;  4GS9 A;  1VB6 A;  2XD1 A;  4EEU A;  3T4O A;  2B18 A;  1CK3 A;  3OLO A;  5KZH A;  5L2F A;  1DY6 A;  2K2N A;  5EM1 A;  4R38 A;  1PI4 A;  1HTZ A;  4X6T A;  1OTD A;  3V3S A;  4EQ1 A;  4ARZ A;  1K57 C;  3E2L A;  3FPV A;  5E2F A;  2J9P A;  2XA7 S;  1GSX A;  2EWV A;  3V3R A;  2GZA A;  3T4S A;  2UWX A;  4EWF A;  2Z2M B;  4BBT A;  4HJ3 A;  3G6O A;  3O87 A;  1JNU A;  4G3V A;  5E2E A;  5HL6 A;  4E3O A;  4FH2 A;  4X55 A;  1U60 A;  5FQI A;  2Y2Q A;  5GLA A;  3T1R A;  2WZZ A;  2P9V A;  3BFG A;  3CUE A;  1SDE A;  4MN7 A;  3FZC A;  1I5Q A;  1LL8 A;  2VLG A;  3M2J A;  3P01 A;  2V2F F;  3MZD A;  3PBQ A;  3BQ8 A;  3KYE A;  4S2N A;  1GCE A;  4CQH A;  1K56 D;  5FAS A;  4OQG A;  1TS8 A;  3GMW A;  4Q0J A;  1TEM A;  3V5M A;  2K7S A;  3G2Y A;  5L10 A;  3GDI A;  2Y2I A;  2ZD8 A;  4GDB A;  3O86 A;  2QKP A;  5FI6 A;  3DWZ A;  1VEU A;  1TD5 A;  3N7W A;  4O8G A;  1E4D A;  3VP0 A;  4X53 A;  3B33 A;  4IJG A;  1S67 L;  3NDE A;  4RYE A;  2QMI A;  3EEH A;  4R3B A;  4BBU A;  4R3J A;  3UE3 A;  4BBV A;  4EUV A;  5EVI A;  3PBS A;  2A24 B;  4Y0T A;  3LYX A;  4YFM A;  2Y2G A;  3SZT A;  1JWP A;  1ALQ A;  4DMZ A;  1S6R A;  2UV0 E;  4IVK A;  2G2U A;  4GZB A;  1HVB A;  1LI9 A;  1PW1 A;  2WK0 A;  2ZC7 A;  1XA1 A;  4GDN A;  3HLW A;  2PT7 A;  3B42 A;  4I39 A;  3VSL A;  2ZMV A;  2XEP A;  1YLJ A;  1JTD A;  1IFQ A;  2XSS A;  2VA0 A;  4BJP A;  4OQH A;  1IYS A;  2DRW A;  4EV4 A;  2HPB A;  3QNC A;  5EOO A;  1K25 A;  3VOL A;  2V1A A;  4UQI S;  3UB8 A;  1MWT A;  3UY6 A;  2WKE A;  4DJ3 A;  3NDG A;  1MC0 A;  2VKS A;  2VV7 A;  3G34 A;  1E25 A;  1NYY A;  1SCW A;  3TSG A;  4Y15 A;  3EEA A;  3ZFZ A;  2JKT I;  2ACG A;  5AQ7 A;  3LI8 A;  4I5S A;  5TBM A;  2ZL1 B;  5M1A A;  3LIE A;  3HJI A;  2V0U A;  1K56 A;  3IF6 C;  4BMW A;  5FQ9 A;  1H0M A;  5AJG A;  2HP5 A;  1JWV A;  1VET B;  4F3L B;  4PKY A;  4UA6 A;  5GHX A;  2WKI A;  3ZDJ A;  2XRN A;  4BQM A;  3SOI A;  1YLZ A;  3OC2 A;  4KZ4 A;  4DF6 A;  1GA9 A;  1FCO A;  4DE0 A;  4JF4 A;  4HI4 A;  3MQO A;  2QZ6 A;  3OZH A;  1H8Y A;  1L0E A;  3QP8 A;  4R1G A;  4R3A A;  2V8C A;  4KZ5 A;  4PM6 A;  3FWL A;  3QP4 A;  3Q82 A;  4GHI A;  3MJQ A;  4L9F A;  1OJ5 A;  3M6H A;  2ZQ8 A;  5TJJ A;  5KSH A;  5CED A;  3IXH A;  5F83 A;  4I38 A;  1KE4 A;  4IUH A;  3RTY A;  2W1R A;  3KSG A;  3LGO A;  5IS1 A;  3TW8 A;  4WM9 A;  3ZG9 B;  3G4P A;  4K08 A;  5KSC A;  1BYW A;  3C7U A;  3V67 A;  5JYP A;  1T1A A;  3QP5 A;  1TS0 A;  1YLW A;  4RQ9 A;  4Y2F A;  2Y55 A;  3CWF A;  1MPL A;  1XJ2 A;  3ZVT A;  2HJ9 C;  1ES3 A;  2Y2L A;  4LGW A;  5HWT A;  2KX6 A;  4E3I A;  1EWZ A;  4DE2 A;  2JKR I;  1K38 A;  4OOM A;  3PAE A;  3UPN A;  4PM5 A;  5C5K A;  2EWW A;  4NXB A;  2XDM A;  2XA7 M;  2WGI A;  3ISG A;  1XPB A;  3QP1 A;  1D06 A;  4OPY A;  4RA7 A;  3IWO A;  1G68 A;  2ZQC A;  3T4Q A;  3VMA A;  4X1L A;  1W7F A;  4E3L A;  1OTI A;  1YLT A;  2OSU A;  3IF6 B;  1N4O A;  3OPR A;  4LRZ E;  1ES2 A;  2A24 A;  3D72 A;  3MXR A;  3T50 A;  4LEN A;  3ZGA B;  5E2G A;  3PR6 A;  5AQB A;  3K3D A;  1YMS A;  3IH9 A;  5FI7 A;  4JGR A;  3DTM A;  3IX4 A;  1S1Y A;  4DDY A;  1PNE A;  5DFY A;  2G2W A;  1K57 A;  4N1X A;  3E2K A;  3E98 A;  3MF0 A;  1FSY A;  5GL9 A;  3KX0 X;  1LHY A;  5AVE A;  4WUJ A;  3NOP C;  3C2W A;  3BM6 A;  1ODV A;  3KSI A;  3ITA A;  4EW7 A;  2QJ5 A;  4DN0 A;  2VK3 A;  3HLC A;  3WRZ A;  3MKF A;  4JXW A;  2DNS A;  2W3F A;  4YOF A;  1T19 A;  4U0X A;  1PRQ A;  2JKF A;  4Y7P A;  1J9M A;  5F82 A;  4E3J A;  3UE0 A;  3NY4 A;  3SH8 A;  2K31 A;  3T12 B;  4JF5 A;  1PYY A;  5GLD A;  1DP6 A;  5HWW A;  1OT9 A;  4MDZ A;  3LCE A;  1KGE A;  5HAI A;  4FD8 A;  5EVL A;  4UA9 A;  2WKR A;  3IHB A;  4EU0 A;  1OTE A;  1NRJ A;  2XF3 A;  4EXO A;  4KG5 A;  2HJE A;  4MN6 A;  4E6X A;  4N92 A;  3UB7 A;  1G5U A;  3KYQ A;  1LT0 A;  3C5A A;  4KG2 A;  4NXF A;  3H82 B;  3C38 A;  4OP5 A;  1K54 C;  5F6A A;  2ZL1 A;  4B4Z A;  2WKH A;  1K0K A;  2O0Y A;  1CEF A;  2EX9 A;  2ZC3 B;  2VJW A;  2ZLY A;  4G3W A;  3S22 A;  1UGU A;  3S7N A;  3S7O A;  1ESU A;  5F1F A;  1MXO A;  4K0W A;  1LL5 A;  4HBU A;  1YAX A;  2FH5 A;  3LEQ A;  1VET A;  4JLF A;  2XD5 A;  2ZMF A;  3CZD A;  4F3L A;  3DWK A;  4DE1 A;  3A3F A;  2ZC6 B;  5F69 A;  5FSR A;  4X69 A;  3IH8 A;  4HP9 A;  1F2K A;  1AWI A;  4LFU A;  3ZG5 A;  1K4E A;  5DJT A;  1L0G A;  3VSK A;  1DJA A;  4L9E A;  4IHQ A;  4H8R A;  4WEJ A;  2WGV A;  4II7 A;  4NKP A;  4DKI A;  3F1P B;  3WS1 A;  2J7V A;  4PM9 A;  1YLY A;  1RP5 A;  4HY8 A;  3KSF A;  4Y5F A;  3FV7 A;  3OPP A;  1YM1 A;  2JKT M;  3AGE A;  3UNW A;  2ZBB A;  1PIO A;  4ZRR A;  2M7U A;  1DJC A;  3MZE A;  4WN5 A;  1LL9 A;  1IKI A;  1PZP A;  2A49 A;  1GSV A;  3O5Y A;  1HLU P;  3N8S A;  3ZG0 A;  1S4R A;  2AVX A;  3R7W B;  4Y3I A;  2Y79 A;  1FCM A;  3MMH A;  5DFX A;  4IVI A;  4JBF A;  3AGF A;  4OH0 A;  4Y0O A;  4FH4 A;  4OON A;  2Y2N A;  5HD3 A;  3HLF A;  1ZKJ A;  1PI5 A;  1FIK A;  2GX5 A;  2P74 A;  2R9W A;  2ZQ9 A;  1YSQ A;  4R4R A;  2Q9N A;  3ZQ5 A;  2HF6 A;  2VEA A;  4KZA A;  5AQ9 A;  1H5X A;  1ES4 A;  2DCF A;  3IF6 A;  3E4Q A;  4KQO A;  4E3M A;  2RCX A;  1NY0 A;  1EW0 A;  3LIA A;  3VE4 A;  2BAS A;  3LY4 A;  3S1Y A;  1RGZ A;  1KDS A;  1CF0 A;  4P6Z S;  3FG8 A;  4P87 A;  3LR3 A;  4O7D A;  1BZA A;  1ZG4 A;  4MBF A;  2YKF A;  2CC1 A;  2JKR M;  2VZW A;  4HP4 A;  4ME4 A;  1K4F A;  3HVF A;  1H8M A;  3GR2 A;  3BFE A;  4JPM A;  4FTX A;  4S2P A;  4C75 A;  3GV9 A;  4JKT A;  4BWI A;  1SKO B;  2FFF B;  3NBL A;  5J3W A;  2VGK A;  4GHI B;  4PMA A;  3IWI A;  3VP4 A;  3BYD A;  2M7V A;  1P9W A;  1TF1 A;  3NIA A;  5CXW A;  4RVA A;  2V1B A;  4U0T A;  3GQZ A;  1FR6 A;  3HLD A;  3N8R A;  3DAV A;  3IX3 A;  5M18 A;  3JVV A;  4IED A;  1LI0 A;  4S2L A;  2ZOH A;  2W0N A;  4D2O A;  1LSW A;  4EBP A;  1L3L A;  4MLL A;  1H3Q A;  3MFD A;  1XA7 A;  5FI2 A;  3HCY A;  4QHC A;  5DKL A;  3ULF A;  2FZ0 A;  3IXG A;  3H82 A;  1OJG A;  1M6K A;  4CLC E;  2JN7 A;  2EXB A;  1I2W A;  2HV1 A;  3BLS A;  1NXY A;  4KZ9 A;  3FKW A;  1V9Y A;  4NXE A;  2Z2L B;  1DRM A;  4Q0H A;  2PYR A;  3KYZ A;  3BWL A;  2Z6D A;  3U4L P;  5FQK A;  1O07 A;  3CAX A;  5CGX A;  4DXB A;  4LRX C;  3UB6 A;  3Q07 A;  1YSP A;  2XQZ A;  3CHW P;  4WEK A;  4KZB A;  4N9K A;  1L0F A;  3A0S A;  2O9A A;  5AVF A;  5TR7 A;  4HJ4 A;  3ICY A;  4WMC D;  5FAO A;  2HZ5 A;  4R0Q A;  5DF9 A;  1ONH A;  5U47 A;  3F1P A;  4DDS A;  2EX8 A;  4K91 A;  1YKD A;  2IWD A;  1MBL A;  4ZBE A;  3HLB A;  1QME A;  3NUL A;  3DBA A;  4ETZ A;  5L8M A;  1PWG A;  3NOT C;  2PHY A;  1S1Z A;  3LEZ A;  1HZO A;  2EX2 A;  1ZTU A;  3PYP A;  3CI6 A;  3QP6 A;  2H28 A;  5I94 A;  3IQA A;  1GHP A;  3CPT B;  3UDX A;  4N9L A;  3HUM A;  4JGQ A;  3R7W A;  5CHU A;  3S7P A;  5HWV A;  4H6J B;  1YT4 A;  2O9B A;  2HDR A;  4M4X A;  1UWN X;  3CIT A;  5IHV A;  1JVJ A;  5CRF A;  3C30 A;  4OPZ A;  1OPX A;  1K54 A;  3FYZ A;  2ZOI A;  4K0X A;  3C4O A;  3LFV A;  3W4O A;  1KDW A;  5HL1 A;  1BT5 A;  5LBR A;  5CEC A;  4GJ4 A;  3UE6 A;  5EV0 A;  2D02 A;  1IYQ A;  4IUK A;  3T1S A;  1WYC A;  4EUZ A;  1D7E A;  1XJ3 A;  4E6W A;  3HLE A;  3OPH A;  3GTC A;  2V1Z A;  2HP9 A;  2XK1 A;  3ZNY A;  1Y54 A;  1ES5 A;  4I3J A;  4KG6 A;  1FCN A;  3D9Y A;  3OPL A;  2XH9 A;  3ZCZ A;  2EFU A;  1XP4 A;  3RH8 B;  4MCW A;  4OPQ A;  5I5L A;  2V8F A;  1D1J A;  3BFC A;  3KSH A;  3PTE A;  4HH3 A;  1SKO A;  1G28 A;  1AXB A;  4XT2 B;  4RX3 A;  3W8K A;  4E04 A;  4HES A;  3N4I A;  2B95 A;  4XXR A;  3H9W A;  1KVM A;  3CMZ A;  4WMC A;  3C4P A;  4ZJ3 A;  3Q1F A;  4GW9 A;  5FL3 A;  1XGJ A;  5D3O A;  3MXS A;  4KZ6 A;  5EEC A;  3W2Z A;  2E8J A;  5HAR A;  3A3J A;  5HD5 A;  4HNB A;  4BD0 A;  3GSG A;  3IXD A;  4A5R A;  2EA9 A;  1P9R A;  1LLB A;  5CTN A;  3BEB A;  3NC8 A;  4AFI A;  4ETX A;  5HFO A;  4JF6 A;  3WS0 A;  1G6O A;  5EVE A;  1UWP X;  3IT9 A;  1P97 A;  4OQI A;  1ERO A;  4L9G A;  5FDH A;  3UPP A;  2ZM8 A;  3H7W B;  4WZ4 A;  4KUO A;  2J3W A;  5HZH A;  3C8C A;  2R9X A;  2DMW A;  2WUQ A;  1NZU A;  4ZTK A;  1L0D A;  4FUW A;  3DTE A;  4FOF A;  1HD8 A;  1GHI A;  1BLH A;  4MNR A;  5A93 A;  2ZM2 A;  2VV6 A;  4CPK A;  2Z6C A;  4QB8 A;  1W8Q A;  2FFY A;  2D01 A;  3VP2 A;  3OCL A;  1KE3 A;  1F5M A;  4IBX A;  3N6I A;  2KLI A;  2XLN A;  4WBG A;  3UO9 A;  4GB7 A;  3EOI A;  2Y4A A;  1BLC A;  4WL9 A;  1N9O A;  2QJ7 A;  3UMD A;  2XFT A;  2Y2H A;  3A0R A;  3LR4 A;  3BLM A;  3D3O A;  2WZX A;  5A91 A;  3CPT A;  3HUO A;  3ZHH A;  1NRF A;  4OLD A;  2QWS A;  3HJK A;  3ITB A;  2BG1 A;  2MJ6 A;  4H6J A;  3T4L A;  1ZG6 A;  2WAD A;  4GD6 A;  3LY3 A;  5HW3 A;  3S7Q A;  2VGL S;  1Q2P A;  5J8X A;  4LV2 A;  3DTK A;  3ZVW A;  1XFQ A;  5A92 A;  3WS5 A;  3ZG8 B;  2Q9M A;  5G18 A;  2IWB A;  3L9K A;  5EPH A;  3PBT A;  4OQ0 A;  1I2S A;  4WZ5 C;  4NXG A;  3G32 A;  4M3K A;  5G4Y A;  5FQQ A;  2IWC A;  2PDR A;  3O3V A;  3GRJ A;  1Q2Q A;  3T1Q B;  4LCM A;  5HDS A;  5BOH A;  5EFW A;  3MZF A;  1CJF A;  4C6Y A;  4UQI M;  2W3D A;  4LPZ A;  1VQQ A;  5JYO A;  2PD7 A;  4XT2 A;  4X68 A;  3AGD A;  3M2K A;  4R70 A;  5J7E A;  3UDF A;  1E3U D;  1S0W A;  2X02 A;  4X1M A;  4U3T A;  2VX8 A;  3LR0 A;  4S2K A;  3GVB A;  1ACF A;  1W63 Q;  1NLY A;  4S2I A;  2H5S A;  5DTT A;  1MWR A;  3HLG A;  1IEL A;  1Z6F A;  3ZNT A;  3HBR A;  1NZO A;  4KQQ A;  4WYY A;  4EET B;  1S66 L;  4GLQ A;  1ESI A;  5GHZ A;  2WAE A;  1P0Z A;  2I72 A;  4JGO A;  5CHJ A;  4S2J A;  1FQG A;  5FAQ A;  1N9L A;  5CGS A;  1STZ A;  3QP2 A;  5IU1 A;  5DKK A;  4LV3 A;  3U2A A;  2PR6 A;  5HDD A;  4N1H A;  3UN7 A;  4JXS A;  1GA0 A;  1IKG A;  3NEC A;  5CX7 A;  1Y28 A;  3UB5 P;  4PM8 A;  4LRY C;  3VP3 A;  4G3K A;  2BTF P;  4GCZ A;  4CLC C;  3NOU C;  3V39 A;  1K6S A;  4R6L A;  4P0M A;  3H7W A;  4ESP A;  1GSW A;  4Y13 A;  1K55 C;  4WLA A;  3IS2 B;  4R4S A;  1CQA A;  4UA7 A;  4DJ2 A;  3P09 A;  3BJN A;  3OCN A;  4I3I A;  4OOL A;  1K6R A;  1NLZ A;  4OVD A;  2JE5 A;  4BD1 A;  4ID4 A;  3MSH A;  1PWD A;  3IBJ A;  4KQD A;  3KO6 A;  5M19 A;  3JYI A;  4UEY A;  1MKI A;  1DJB A;  3B47 A;  3UDI A;  4HH2 A;  3RXW A;  3LR5 A;  3SS4 A;  2OV5 A;  3Q7V B;  1SDN A;  1PFL A;  2INW A;  5HX9 A;  2H0T A;  5HDC A;  3RFB A;  1ERM A;  3IF5 A;  5DVA A;  2EFX A;  3VOY A;  4BL2 A;  4EBN A;  4WEL A;  4PPR A;  5K5B A;  1YPR A;  4RX2 A;  4OKP A;  3Q81 A;  3LUQ A;  3LO7 A; 
#chains in the Genus database with same CATH homology
 1XPB A;  1XKZ A;  4OP8 A;  4OPY A;  4XUZ A;  4RA7 A;  3CJM A;  3IWO A;  1G68 A;  2ZQC A;  5EVI B;  2WGW A;  5FAP A;  1YT4 A;  4QJG A;  4QD4 A;  4Y0U A;  3VMA A;  2H10 A;  4F94 A;  2HDR A;  1W7F A;  1XXM A;  4E3L A;  3HUN A;  4JXV A;  1JVJ A;  5IHV A;  5CRF A;  1FR1 A;  1MWU A;  1YLT A;  4EQI A;  2OSU A;  1E3U A;  1PWC A;  1JTG A;  3IF6 B;  1N4O A;  1YLP A;  4OPZ A;  3OPR A;  2C6W B;  1ES2 A;  2Y2K A;  1C3B A;  1K54 A;  3FYZ A;  3MXR A;  4K0X A;  1CEG A;  3C4O A;  5DTK A;  4LEN A;  3VP1 A;  3W4O A;  5E2G A;  3ZGA B;  5AQB A;  3VOZ A;  4L0L A;  1KDW A;  1YMS A;  3IH9 A;  1BT5 A;  5HL1 A;  5CEC A;  4HEF A;  5FI7 A;  1N9B A;  3DTM A;  3IXB A;  4DDY A;  1SHV A;  3PBR A;  1MY8 A;  4XUX A;  1VM1 A;  2JCH A;  2G2W A;  4FSF A;  3PBN A;  3WS4 A;  1IYQ A;  1K57 A;  4N1X A;  1WYC A;  4E3K A;  4EUZ A;  3E2K A;  5CTM A;  1FSY A;  2HDQ A;  4BLM A;  4E6W A;  3TG9 A;  5GL9 A;  3HLE A;  5E2H A;  1LHY A;  3OPH A;  3GTC A;  2V1Z A;  2X01 A;  1TDL A;  2HP9 A;  2XGN A;  2XK1 A;  3A3E A;  3BM6 A;  5GHY A;  3W4Q A;  3HRE A;  1RGY A;  3ITA A;  1XX2 A;  5CER A;  3ZNY A;  1BUL A;  1BSG A;  1MWS A;  3HLC A;  2XR0 A;  4UHU A;  3WRZ A;  1Y54 A;  1ES5 A;  1FSW A;  3MKF A;  4JXW A;  3WRT A;  4KG6 A;  1FCN A;  1ERQ A;  2DNS A;  5HAP A;  5A90 A;  4FCF A;  4U0X A;  4Y7P A;  3OPL A;  1J9M A;  2XH9 A;  2HP6 A;  2JBF A;  5F82 A;  4E3J A;  3UE0 A;  3ZCZ A;  2EFU A;  1XP4 A;  1CI9 A;  4QY5 A;  4YIN A;  4OPQ A;  2V20 A;  3EQV A;  1CI8 A;  4GOG A;  3NY4 A;  3SH8 A;  3P98 A;  2ZQD A;  1BLS A;  1W5D A;  3BFC A;  3PTE A;  3W4P A;  4ZJ1 A;  1AXB A;  1SKF A;  3DW0 A;  4RX3 A;  4JF5 A;  3W8K A;  1FOF A;  1PYY A;  4R23 A;  5GLD A;  1BLP A;  3S4X A;  2J8Y A;  2OLU A;  4B88 A;  4EBL A;  4P85 A;  4HES A;  5EE8 A;  3N4I A;  1JWZ A;  5EVI D;  4XXR A;  3LCE A;  3QNB A;  1KGE A;  4UAA A;  5HAI A;  2E8I A;  4FD8 A;  5EVL A;  1KVM A;  4UA9 A;  2ZC5 B;  4KQR A;  3CMZ A;  4WMC A;  1IYO A;  3C4P A;  2Y91 A;  2EXA A;  3IHB A;  4ZJ3 A;  3Q1F A;  5HAQ A;  4KZ7 A;  2XF3 A;  4KG5 A;  3IHA A;  4E6X A;  1XGJ A;  4N92 A;  4OLG A;  3VFF A;  5D3O A;  3MXS A;  4KZ6 A;  5EEC A;  3VFH A;  5HAR A;  2XD1 A;  1NYM A;  4MBH A;  4CJN A;  2WYX A;  1G6A A;  3A3J A;  3G2Z A;  3C5A A;  3UE1 A;  4S2M A;  4KG2 A;  1RCJ A;  4BD0 A;  3GSG A;  1CK3 A;  4DXC A;  5KZH A;  3IXD A;  4OP5 A;  4S2O A;  1K54 C;  5L2F A;  1DY6 A;  4A5R A;  4B4Z A;  1KE0 A;  2WKH A;  1LLB A;  1TDG A;  1PI4 A;  3BEB A;  1HTZ A;  3NC8 A;  5CTN A;  1CEF A;  2EX9 A;  2ZC3 B;  5HFO A;  4JF6 A;  4X6T A;  2ZLY A;  3A3D A;  3S22 A;  1ESU A;  3G30 A;  3WS0 A;  1BUE A;  3V3S A;  5F1F A;  1MXO A;  1L2S A;  4K0W A;  3PAG A;  1K57 C;  2RL3 A;  1LL5 A;  4HBU A;  3IT9 A;  3E2L A;  5E2F A;  5CGW A;  3RXX A;  4JLF A;  2J9P A;  2XD5 A;  3CZD A;  1EI5 A;  1ONG A;  4ZAM A;  3V3R A;  3DWK A;  4DE1 A;  3A3F A;  2ZC6 B;  1KGG A;  1ERO A;  3A3I A;  4OQI A;  2UWX A;  4X69 A;  5FDH A;  5FSR A;  4EWF A;  3UPP A;  2ZM8 A;  3IH8 A;  2Z2M B;  4WZ4 A;  3SH9 A;  3O87 A;  2EX6 A;  3ZG5 A;  1K4E A;  5E2E A;  4E3O A;  1L0G A;  3VSK A;  1DJA A;  2R9X A;  4H8R A;  2WUQ A;  4WEJ A;  1NZU A;  4E3N A;  4Q8I A;  2WGV A;  4BL3 A;  4FH2 A;  4ZTK A;  2QPN A;  4X55 A;  2ZQ7 A;  1U60 A;  4DKI A;  3WS1 A;  2J7V A;  5FQI A;  4PM9 A;  1L0D A;  4WZ5 A;  2Y2Q A;  5GLA A;  1YLY A;  2ZM0 A;  1RP5 A;  1HD8 A;  1GHI A;  1BLH A;  4MNR A;  2WZZ A;  5A93 A;  2P9V A;  3FV7 A;  3BFG A;  3OPP A;  1YM1 A;  2ZM2 A;  4CPK A;  1SDE A;  4ZJ2 A;  3AGE A;  3FZC A;  4QB8 A;  3UNW A;  1I5Q A;  1PIO A;  4GN2 A;  1PW8 A;  1W8Q A;  2FFY A;  3M2J A;  5DF7 A;  3VP2 A;  2V2F F;  3MZD A;  3PBQ A;  1DJC A;  3MZE A;  1LL9 A;  3OCL A;  4LV0 A;  4S2N A;  1GCE A;  3QHY A;  1IKI A;  1K56 D;  1PZP A;  3I7J A;  3SH7 A;  1KE3 A;  4IBX A;  5FAS A;  2A49 A;  4OQG A;  3N6I A;  3GMW A;  2XLN A;  3Q7V A;  4WBG A;  3UO9 A;  1TEM A;  3N8S A;  3G31 A;  3ZG0 A;  5FA7 A;  4GB7 A;  3V5M A;  3G2Y A;  3M6B A;  1IYP A;  2Y4A A;  1FCM A;  1BLC A;  5CEB A;  2Y2I A;  3D4F A;  4IVI A;  1ZC2 A;  4JBF A;  2ZD8 A;  2OLV A;  4GDB A;  3O86 A;  2XFT A;  2Y2H A;  4GKU A;  3BLM A;  3AGF A;  3DWZ A;  5FI6 A;  2WZX A;  3N7W A;  5A91 A;  4GD8 A;  2WGW B;  4OH0 A;  5FAT A;  3HUO A;  1E4D A;  4Y0O A;  3VP0 A;  3ZHH A;  4FH4 A;  4OON A;  4X53 A;  2Y2N A;  1NRF A;  3NDE A;  4RYE A;  2ZMA A;  2QMI A;  3HLF A;  4OLD A;  5TFQ A;  1ZKJ A;  1PI5 A;  4R3B A;  3ITB A;  4R3J A;  2BG1 A;  2P74 A;  4KZ8 A;  3UE3 A;  4MEZ A;  5EVI A;  2R9W A;  1ZG6 A;  2WAD A;  2ZQ9 A;  3PBS A;  2Q9N A;  4R4R A;  4GD6 A;  3LY3 A;  4Y0T A;  3ZG7 B;  5HW3 A;  3BEC A;  4KZA A;  5E43 A;  1Q2P A;  5AQ9 A;  1O7E A;  3SS5 A;  4LV2 A;  5J8X A;  1OME A;  5AQA A;  1H5X A;  2PU4 A;  3WS2 A;  1ES4 A;  2DCF A;  4YFM A;  3IF6 A;  2J9O A;  2Y2G A;  3ZVW A;  2PBY A;  1JWP A;  4KQO A;  3EQU A;  4NK3 A;  5A92 A;  1GHM A;  2ZC4 B;  3WS5 A;  3ZG8 B;  2Q9M A;  5G18 A;  2IWB A;  1ALQ A;  4E3M A;  2RCX A;  1S6R A;  1NY0 A;  5EPH A;  3PBT A;  4IVK A;  2G2U A;  5FQM A;  4GZB A;  1HVB A;  1LI9 A;  1PW1 A;  4OQ0 A;  2WK0 A;  3FKV A;  2C5W B;  1I2S A;  3LY4 A;  2ZC7 A;  1XA1 A;  5GLC A;  3S1Y A;  1RGZ A;  4GDN A;  2WAF A;  4WZ5 C;  3HLW A;  3G32 A;  4M3K A;  1KDS A;  3HL9 A;  3BFF A;  5FQQ A;  2IWC A;  4P87 A;  3VSL A;  3O3V A;  2Y2O A;  1XGI A;  4O7D A;  1BZA A;  1ZG4 A;  4MBF A;  3O88 A;  2XEP A;  2CC1 A;  1YLJ A;  1JTD A;  4P6B A;  3GRJ A;  4Z9Q A;  4MBK A;  1Q2Q A;  1K4F A;  3HVF A;  3GR2 A;  1YMX A;  3BFE A;  4JPM A;  4S2P A;  4C75 A;  3GV9 A;  4LCM A;  5BOH A;  2Y2P A;  3IWQ A;  4LV1 A;  4BJP A;  1K55 A;  4JKT A;  4OQH A;  4S2N C;  1IYS A;  2JC7 A;  3MZF A;  2ZQA A;  4C6Y A;  2DRW A;  4JXG A;  5EOE A;  1VQQ A;  4EV4 A;  2FFF B;  2HPB A;  3NBL A;  3QNC A;  5EOO A;  2VGK A;  1K25 A;  3G35 A;  1IEM A;  5JYO A;  4PMA A;  3IWI A;  3VP4 A;  3BYD A;  4X56 A;  3MKE A;  3NIA A;  1MWT A;  5CXW A;  4X68 A;  1KGF A;  4RVA A;  5KMW A;  4DE3 A;  1KVL A;  3AGD A;  3M2K A;  1PZO A;  3GQZ A;  4U0T A;  1FR6 A;  3UY6 A;  3UDF A;  2WKE A;  1E3U D;  3HLD A;  3WWX A;  3N8R A;  2Y59 A;  1S0W A;  3NDG A;  2X02 A;  5M18 A;  4U3T A;  4IED A;  3G34 A;  4S2K A;  1E25 A;  1LI0 A;  1NYY A;  1SCW A;  4S2L A;  3TSG A;  4C3Q A;  4D2O A;  3GVB A;  3ZFZ A;  4EBP A;  2B5R A;  5EVI C;  4HBT A;  3MBZ A;  5F1G A;  4S2I A;  4MLL A;  5AQ7 A;  2H5S A;  4LCL A;  3MFD A;  5DTT A;  1MWR A;  2HDU A;  1XA7 A;  5FI2 A;  5M1A A;  3HLG A;  4QHC A;  1IEL A;  1Z6F A;  3ZNT A;  3RJU A;  1NJ4 A;  3HBR A;  1NZO A;  5GLB A;  3IXG A;  1K56 A;  4KQQ A;  4QU3 A;  3Q7Z A;  4WYY A;  1M6K A;  3IF6 C;  1ESI A;  5GHZ A;  2WAE A;  5FQ9 A;  2EXB A;  2I72 A;  5CHJ A;  1I2W A;  1QMF A;  4S2J A;  1FQG A;  5FAQ A;  2GDN A;  3BLS A;  5CGS A;  1NXY A;  2HP5 A;  1WYB A;  1JWV A;  3NI9 A;  4KZ9 A;  3FKW A;  4LV3 A;  2Z2L B;  2ZJ9 A;  4UA6 A;  5GHX A;  2WKI A;  3ZDJ A;  3UPO A;  2VGJ A;  2H0Y A;  3N8L A;  4N1H A;  4BQM A;  1M40 A;  3SOI A;  3UN7 A;  4JXS A;  1GA0 A;  5FQK A;  4PM7 A;  1IKG A;  3NCK A;  5DF8 A;  4DRT A;  4OPR A;  1W8Y A;  1YLZ A;  3OC2 A;  4PM8 A;  3SS3 A;  3VP3 A;  4KZ4 A;  2HDS A;  4DF6 A;  1O07 A;  1H8Z A;  1GA9 A;  5CGX A;  1FCO A;  4DXB A;  2Y2J A;  4DE0 A;  3Q07 A;  4JF4 A;  2QZ6 A;  2XQZ A;  3OZH A;  1YQS A;  1BTL A;  4QY6 A;  1H8Y A;  1L0E A;  4KZB A;  1K6S A;  4WEK A;  4N9K A;  4P0M A;  3V39 A;  4R1G A;  3C7V A;  1L0F A;  4B4X A;  3CG5 A;  1K55 C;  4KZ5 A;  4PM6 A;  4R4S A;  4KZ3 A;  3FWL A;  4UA7 A;  3Q82 A;  5TR7 A;  3P09 A;  4BEN A;  3OCN A;  3M6H A;  4OOY A;  2ZQ8 A;  4WMC D;  5TGF A;  5FAO A;  4R0Q A;  5KSH A;  2P9V B;  5DF9 A;  5CED A;  3IXH A;  4OOL A;  5F83 A;  1K6R A;  1ONH A;  1KE4 A;  5U47 A;  5CHM A;  4DDS A;  2XFS A;  3BFD A;  2EX8 A;  4OVD A;  4WM9 A;  2JE5 A;  3ZG9 B;  1WE4 A;  3G4P A;  4ID4 A;  4BD1 A;  4IBR A;  1PWD A;  4K91 A;  5FQJ A;  5KSC A;  3C7U A;  5M19 A;  1W79 A;  2IWD A;  3JYI A;  5JYP A;  3PBO A;  1MBL A;  1YLW A;  2PU2 A;  5DTS A;  1MKI A;  1DJB A;  3UDI A;  4ZBE A;  1TVF A;  3HLB A;  1QME A;  4KEN B;  3RXW A;  3SS4 A;  4ZDX A;  2OV5 A;  2Y55 A;  3B3X A;  1MPL A;  1SDN A;  3Q7V B;  1PWG A;  3ZVT A;  3LEZ A;  1ES3 A;  2Y2L A;  1HZO A;  2H0T A;  5HX9 A;  2X71 A;  4E3I A;  1EWZ A;  2EX2 A;  2Y2M A;  4DE2 A;  3V50 A;  1ERM A;  3IF5 A;  5DVA A;  2BLS A;  2EFX A;  3VOY A;  1K38 A;  5I94 A;  4OOM A;  2A3U A;  4BL2 A;  3IQA A;  3PAE A;  4EBN A;  1GHP A;  3UDX A;  3UPN A;  4PM5 A;  4WEL A;  3BRM A;  4N9L A;  4PPR A;  3HUM A;  4GNU A;  4RX2 A;  5EUA A;  2XDM A;  4OKP A;  3Q81 A;  5CHU A;  4NET A;  3TOI A;  2WGI A;  3ISG A;  3LO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...