4Y0OA

Crystal structure of oxa-58, a carbapenem hydrolyzing class d beta-lactamase from acinetobacter baumanii.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Active-Site Plasticity Is Essential to Carbapenem Hydrolysis by OXA-58 Class D beta-Lactamase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 70
structure length 242
sequence length 243
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4y0oA00
1KVLA 2GDNA 2ZQ9A 1TEMA 3ZVTA 1NJ4A 2XD5A 1BTLA 3A3IA 5L2FA 1O7EA 2XD1A 2A3UA 1ES4A 3PBRA 4GDBA 4GNUA 2V2FF 1K54A 2EX9A 1XXMA 3UE3A 3GRJA 3SS5A 5F82A 3V5MA 4OOMA 5M19A 4GD8A 5EVIA 3LCEA 4UHUA 3ITAA 4HBTA 3VP2A 2HP5A 3FZCA 3GVBA 2XF3A 1VM1A 3O87A 4RA7A 2WKHA 1DJCA 2XFTA 5EUAA 1SHVA 3RXXA 3A3JA 5DTSA 4RX2A 4B88A 1S0WA 3C4OA 3IXDA 5CGSA 3NY4A 2JE5A 1SDNA 2C6WB 4R23A 2WZZA 2WADA 3G2YA 5U47A 1XA7A 1YLWA 4NETA 3Q7VB 1Q2QA 1VQQA 2I72A 4GKUA 1RGYA 1BLHA 4Z9QA 4KG2A 2Z2MB 4ZBEA 1RP5A 2P74A 4OPRA 1MWUA 1W79A 2WGVA 4EBLA 2EX6A 5CTNA 5D3OA 4BL3A 4KZ8A 3A3DA 4NK3A 5CHJA 3S1YA 2ZM0A 1FCOA 4Y0TA 1DJBA 4QY5A 1L0EA 2X71A 2ZQ7A 1ZG4A 1W7FA 3PBOA 5A91A 1K54C 1KDSA 2VGJA 2ZQDA 3P98A 1MWSA 1U60A 1W8YA 4N9KA 5HFOA 4X55A 4WBGA 1QMEA 4N92A 5EVIC 3OPHA 4JPMA 3NIAA 4MBKA 4PMAA 1M6KA 1IKGA 4OH0A 1FQGA 4OOLA 5FQ9A 4KQOA 3UPPA 1G6AA 3PBQA 1BZAA 1YLTA 3ZHHA 5CHMA 4KZ9A 3WS4A 3ZGAB 3MKEA 1GCEA 2HDSA 4WEJA 3Q82A 4ZDXA 4EV4A 1GA9A 4WEKA 3IXGA 2QZ6A 1FR6A 3AGFA 4KQQA 4GN2A 4S2MA 5CGWA 3N7WA 5KSCA 1GHMA 1KDWA 2WKEA 1MPLA 3IH8A 3OPRA 1KGFA 1FCMA 3WS5A 5F1GA 4R4SA 3RJUA 1PZOA 2XLNA 3IF6A 4PM9A 1I2WA 2EFXA 1NYYA 2JCHA 4BENA 4A5RA 1MWRA 4CJNA 2HDRA 3FWLA 4KZBA 2PBYA 1L0DA 2DCFA 2XEPA 4P6BA 1H8YA 4X69A 4ZTKA 2Q9MA 4S2LA 1PI5A 4YFMA 3V3SA 4OVDA 5FQIA 3N6IA 2PU2A 4Y0UA 3DTMA 4X53A 3BFGA 4DE3A 3SOIA 4JXWA 3UDFA 4PM5A 3HREA 1PI4A 1PWCA 5EPHA 2WAFA 4IBRA 5F83A 3QNCA 1Y54A 3NI9A 4BL2A 1FOFA 1LL9A 4OQ0A 4DXCA 2RL3A 2HDUA 2EX2A 2VGKA 2G2UA 1K4FA 4U3TA 4Q8IA 1MWTA 2XR0A 1BULA 2ZMAA 3IF6B 4K91A 1MKIA 5HX9A 1YLJA 1I2SA 2V20A 4Y0OA 1TDLA 2OLUA 2ZLYA 1JWZA 3HBRA 4IBXA 3ZFZA 2Z2LB 4E3NA 2V1ZA 1W8QA 4B4ZA 1CEGA 1DJAA 4U0TA 2WKIA 3N4IA 3OCLA 3VOZA 4C3QA 4S2NA 4ZJ2A 3IF6C 4Y7PA 4EWFA 3ZG8B 4UA9A 1SDEA 4MBFA 3MKFA 1LI9A 4E6XA 2Y2HA 2IWDA 3A3EA 1SCWA 2EXAA 5IHVA 1KGEA 4WELA 3Q7VA 2ZD8A 3BFEA 3Q7ZA 1NRFA 4E3LA 2X02A 4JXSA 5FSRA 2Y55A 5FQMA 4DKIA 1K56D 2BLSA 3GTCA 5EOEA 1KGGA 3NDGA 1YLPA 2G2WA 5AQ7A 1RGZA 2EX8A 3BECA 2OLVA 3CZDA 4F94A 5CEDA 1XX2A 4P85A 1ZC2A 4UAAA 4E6WA 3S4XA 4IVKA 1XKZA 3BFDA 3E2KA 3G2ZA 3SH7A 4DE2A 4DE1A 3WS1A 3Q1FA 1KE4A 1N9BA 4DXBA 5M1AA 5M18A 5GLAA 4BD1A 3G34A 3IH9A 3IHBA 1LHYA 2ZM8A 4B4XA 3IHAA 3BYDA 1C3BA 1K6SA 3D4FA 4R3BA 4WMCD 3TOIA 5KMWA 2RCXA 4GD6A 2X01A 1E3UA 3IQAA 1LI0A 4BQMA 3UN7A 4UA6A 4S2NC 2ZJ9A 1BSGA 5FAPA 4C75A 1ONHA 4M3KA 3UE0A 3LY4A 1WE4A 2IWBA 1IEMA 2Y91A 5E2FA 2QPNA 1KE3A 1PW1A 4PM8A 1G68A 3G31A 5AQAA 3OC2A 3VSKA 1M40A 2FFFB 3WS2A 3TSGA 3S22A 1MXOA 3WS0A 4ID4A 3VFFA 4WM9A 5E2HA 3ZCZA 2DNSA 4PM6A 4X56A 2J9OA 2XK1A 2ZQCA 5FI6A 1PWDA 3P09A 4GDNA 5FA7A 3HLWA 3HUNA 4LENA 3QNBA 4N1HA 1CI8A 2PU4A 5EECA 1ZKJA 4N9LA 1L2SA 1O07A 3M2KA 3ZDJA 3BFCA 1YQSA 4OPQA 4JF4A 1MY8A 3VSLA 5DF9A 2WZXA 3GSGA 4LV3A 4OPYA 4DRTA 2R9XA 2C5WB 2UWXA 1XPBA 1QMFA 5I94A 4JKTA 3Q07A 4MBHA 3HL9A 3FYZA 4R1GA 3HLDA 1WYBA 5FAOA 4OQIA 4S2PA 2HP9A 3V50A 2Y2IA 3ZG0A 2A49A 1IYPA 4X68A 4E3JA 5BOHA 1GA0A 4FCFA 5DVAA 4QB8A 5FAQA 1GHIA 1ES5A 3FKVA 4R3JA 1BLCA 3OPLA 1RCJA 2WGWB 4GZBA 4EUZA 3MXSA 4QU3A 3UDXA 3DW0A 2Y2KA 3SS4A 3GR2A 4FD8A 5CXWA 5E43A 1ERQA 1EWZA 2Y2MA 5GHXA 5GHYA 2XH9A 2Q9NA 1YLZA 3BFFA 3C4PA 3Q81A 2CC1A 3AGEA 1YMSA 4UA7A 5DTKA 1YMXA 5EVID 3MZDA 1IYSA 3ITBA 5CRFA 4O7DA 3LEZA 1LL5A 1PWGA 3NC8A 1EROA 4K0XA 3N8RA 4FSFA 5EE8A 4JXVA 5E2EA 3TG9A 4KZ5A 3A3FA 3MFDA 3PAEA 3PAGA 2BG1A 3NCKA 5DF7A 4XUZA 2HDQA 4S2KA 1BLSA 1IYQA 5TR7A 2ZM2A 3C7UA 3GV9A 4KZAA 2Y2PA 4EBNA 3N8LA 1PYYA 5GHZA 2FFYA 4WZ4A 4XUXA 4X6TA 3W4PA 1XP4A 3BLMA 3G4PA 3IF5A 1PW8A 4MNRA 1E4DA 1IYOA 3LO7A 3DWKA 4K0WA 4OLDA 4LV0A 2J8YA 3BM6A 3MBZA 2ZC4B 5DTTA 4DDSA 5CECA 3VOYA 3CG5A 5FQJA 1BT5A 3HVFA 5CTMA 2XFSA 4OPZA 2EXBA 5HARA 3UPOA 2WK0A 5CHUA 2Y4AA 3LY3A 5A93A 3PBTA 4OP5A 1E25A 4KENB 1ERMA 2XQZA 4IEDA 3O3VA 1HTZA 4KZ7A 4EBPA 5E2GA 4RVAA 3O86A 3ISGA 2ZQAA 4KZ4A 5EOOA 2J7VA 3VFHA 3ZVWA 3FKWA 4KZ6A 1H8ZA 4LCLA 3IXHA 5FQKA 3EQUA 4S2JA 4S2OA 4OOYA 3PBNA 1K25A 3MZFA 3OZHA 5G18A 2HP6A 4FH2A 1N4OA 3M6HA 2QMIA 5GL9A 5GLCA 1DY6A 5A92A 4JLFA 1IKIA 1JWVA 1PIOA 1Z6FA 1J9MA 3FV7A 1Q2PA 3VP3A 4E3KA 4FH4A 1OMEA 1ES3A 4OP8A 3C5AA 3PBSA 1IELA 4PM7A 5AQ9A 3BEBA 4IVIA 2IWCA 1FCNA 1HVBA 3IWQA 1W5DA 2ZQ8A 4LV1A 4QY6A 4DDYA 3HUMA 3QHYA 3RXWA 4JXGA 3WRTA 3M2JA 4HESA 5HAPA 1NZUA 1WYCA 3EQVA 5FQQA 1YLYA 4RX3A 4S2IA 5DF8A 1CI9A 4LCMA 5HAIA 4QJGA 2WUQA 4ZJ1A 1K55A 3BRMA 3B3XA 4HEFA 3ZG9B 1CK3A 3IWIA 1ONGA 2ZC7A 4U0XA 5TGFA 1JVJA 3W4OA 1LLBA 3G35A 3VP4A 5GLDA 5AQBA 2WGWA 3HLCA 2JC7A 3IWOA 5HW3A 2OSUA 3AGDA 4JF6A 4QHCA 4ZJ3A 5EVIB 3CJMA 1K57A 3VP0A 5A90A 1L0GA 1TDGA 4N1XA 5FI2A 2Y2OA 3M6BA 3IT9A 4E3IA 1H5XA 1NYMA 1ESUA 1ALQA 3UO9A 3V3RA 3UY6A 2ZC3B 4KG6A 1NXYA 5FASA 5CGXA 4CPKA 1K56A 3E2LA 4WZ5A 1BLPA 3VP1A 3G32A 3HLBA 4OQHA 4RYEA 3OPPA 3GMWA 1FSWA 2XDMA 4EQIA 1ZG6A 2E8IA 1ESIA 4JF5A 3VMAA 4KG5A 5JYOA 2B5RA 4MEZA 1SKFA 3ZNYA 5FATA 2EFUA 4D2OA 2H10A 2WAEA 3ZNTA 5JYPA 3MXRA 1HD8A 3HLEA 5FDHA 4HBUA 2DRWA 4BLMA 2WYXA 1K4EA 4OONA 1JWPA 4XXRA 4WYYA 4E3MA 1K55C 3CMZA 4OLGA 4WMCA 3ZG7B 1HZOA 2R9WA 2ZC6B 1JTDA 2Y59A 3O88A 3DWZA 4ZAMA 1L0FA 2JBFA 4KZ3A 4JBFA 2WGIA 4OKPA 1KE0A 3HLGA 1K57C 1AXBA 1NY0A 4DF6A 5HAQA 4R0QA 4E3OA 1CEFA 5HL1A 3WWXA 2XGNA 5FI7A 3W8KA 1XA1A 2Y2LA 3N8SA 5EVLA 2P9VA 4L0LA 1TVFA 5J8XA 1K6RA 3UDIA 1S6RA 4WZ5C 5GLBA 4LV2A 1BUEA 1K38A 2Y2QA 4BJPA 1I5QA 1JTGA 3UE1A 1FR1A 4R4RA 5TFQA 1E3UD 3NDEA 4KQRA 5KSHA 5CEBA 1GHPA 1YM1A 3IXBA 1YT4A 3HUOA 1ES2A 4PPRA 3HLFA 4GOGA 4P87A 3I7JA 3MZEA 5KZHA 1EI5A 3NBLA 5F1FA 3OCNA 4BD0A 4QD4A 2Y2NA 4GB7A 1PZPA 4P0MA 3PTEA 3SH9A 2OV5A 4MLLA 3G30A 3C7VA 3GQZA 4C6YA 1XGJA 2Y2GA 3BLSA 2H0TA 3W4QA 3WRZA 3V39A 2HPBA 3SH8A 3ZG5A 4DE0A 2J9PA 2Y2JA 1NZOA 2H5SA 2P9VB 2ZC5B 3UNWA 2H0YA 4YINA 5CERA 1FSYA 4H8RA 3UPNA 3JYIA 3SS3A 1MBLA 1XGIA 1KVMA 4OQGA
chains in the Genus database with same CATH superfamily
1TEMA 2XD5A 3A3IA 1G28A 2A3UA 1ES4A 3PBRA 4GNUA 1YSQA 2EX9A 4BBTA 4AFIA 3DBAA 5A8BA 3KO6A 3F1PA 2HP5A 3NULA 2XF3A 3MQ0A 2WKHA 1TD5A 5DTSA 4RX2A 3QP1A 2JE5A 2R78A 1XA7A 4NETA 1VQQA 1RGYA 3T1RA 1D1JA 4OPRA 4MN7A 1ZHHB 2EX6A 2ZM0A 3MXQA 3LR3A 4Y0TA 2X71A 1ZG4A 2K31A 3PBOA 1KDSA 4JPMA 3F1OB 4KQOA 1D06A 1GSXA 3ZHHA 1YLTA 1VEUA 1V9YA 4G3KA 3ZGAB 4B93A 4GS9A 4YOFA 3CI6A 2QYBA 4GN2A 5KSCA 5AJGA 3DAVA 2E8JA 3R7WA 4X1MA 2XLNA 1NYYA 4QPRA 1MWRA 2P08A 4WLAA 3LEQA 3C38A 3S7OA 1H8YA 3CWFA 4GHIB 4ZTKA 5G4ZA 4GJ4A 5DJUA 4YFMA 3N6IA 4LFUA 2WAFA 5F83A 1Y54A 3NI9A 5IS1A 1FOFA 1MWTA 4K91A 2OLUA 1JWZA 1DP9A 3IF6C 4Y7PA 1T1CA 2HGVA 4E6XA 4PKYA 1IFQA 2KLIA 1T19A 1NRFA 3P01A 1N9LA 4JXSA 3D72A 5FQMA 3NDGA 4DJ2A 4LGWA 3CZDA 4DN0A 3S4XA 1XJ3A 4DE2A 3G2ZA 3T4QA 2ZM8A 3IHAA 4R3BA 3BJNA 2RCXA 4GD6A 3C8CA 4UA6A 1WE4A 2IWBA 5E2FA 2QPNA 1M40A 3MJQA 1OTAA 1MXOA 3WS0A 3PXPA 3ZCZA 2VLGA 1TS6A 2DNSA 4PM6A 1XJ6A 2ZQCA 1Z09A 5AVFA 5FI6A 1PWDA 5FA7A 1DP8A 3HLWA 3P7NA 4N1HA 4N9LA 5KIZA 2UV0E 2O0YA 1MY8A 4NXGA 5DF9A 4LV3A 2C5WB 3OLOA 1TS7A 4NXFA 4EUVA 5HWWA 4K08A 3BWLA 2HP9A 4MMNA 2A49A 2Y8HA 3OOVA 5BOHA 3IX3A 5DVAA 1GSVA 4GZBA 3IX4A 3GR2A 4FD8A 5CXWA 5F69A 3TW8A 1ERQA 5GHXA 2XH9A 3C4PA 3SW1A 1MZUA 3JVVA 1LL5A 3NC8A 4HHDA 5L10A 3N8RA 3K2NA 2K7SA 1EW0A 2IA2A 4KZ5A 3PAEA 4L9GA 3PAGA 5HWTA 1LT0A 1BLSA 2HJEA 5TR7A 2ZM2A 3GV9A 3N8LA 2ZOHA 2OOLA 2FFYA 4XUXA 4X6TA 3IS2B 4MNRA 3UB8A 1IYOA 3LR0A 4K0WA 4LV0A 3VOYA 5CTMA 2EXBA 2Y4AA 3PBTA 2XQZA 4IEDA 5E2GA 4ETZA 3O86A 5EOOA 2LB5A 3VFHA 3LR5A 4KZ6A 1H8ZA 4BBUA 3TE8A 3EQUA 2PD7A 1K25A 4FH2A 2PAVP 2KOIA 2QMIA 5GLCA 5L07A 4R6LA 1IKIA 1JWVA 2JN7A 3FV7A 4UQIM 4FH4A 1IELA 1ZTUA 4ARZA 2VV8A 4LV1A 3RXWA 2V0UA 4PKYG 3M2JA 2PR5A 2B95A 5FQQA 5HAIA 3T4KA 4ZJ1A 3BRMA 2LB9A 1CK3A 4LRXC 1ONGA 2ZC7A 5TGFA 3W4OA 4X1LA 5GLDA 5AQBA 3IWOA 2OSUA 4ZJ3A 4N1XA 5FI2A 3IT9A 3F1PB 1TF1A 3V3RA 1ALQA 3UY6A 3OBFA 4CPKA 4YWZA 3HLBA 1VHMA 4EQIA 4JF5A 3LIEA 5EFWA 5JYOA 2B5RA 1SKFA 3ZNYA 5FATA 2EFUA 4Q0JA 2EWWA 4D2OA 3MXRA 1HD8A 2ZL1B 4BLMA 3LICA 5C5KA 4WYYA 1K55C 3CMZA 4YNRA 1JTDA 2Y59A 3O88A 3DWZA 4Y2FA 4ZAMA 2D01A 4KZ3A 4JBFA 4EERA 3KYQA 2XGNA 5FI7A 3N8SA 5IU1A 5EVLA 5J8XA 1TVFA 4WZ5C 4LV2A 3U2AA 2Y2QA 3UMEA 4HOIA 4BJPA 1JTGA 3UE1A 1E3UD 3NDEA 4KQRA 2A2LA 1YM1A 3GDIA 3UB7A 3HUOA 1ES2A 5KZHA 4ME4A 1F5MA 2Y2NA 3RFBA 1PZPA 4P0MA 2OWHA 2OV5A 3G30A 1XGJA 3WRZA 3V39A 3ZG5A 4DE0A 1NZOA 2H5SA 2ZC5B 4YINA 5CERA 3T1QB 2VJWA 3JYIA 5I5LA 3SS3A 4EU0A 2PD8A 1MBLA 4HEFA 3ZVTA 2ZQ9A 5L2FA 1O7EA 2XD1A 4GDBA 5F68A 1XXMA 3UE3A 5EM0A 5F82A 4OOMA 2NUTC 3H7WB 3ITAA 4HBTA 3NOPC 4F3LA 2W27A 1P9RA 2VV6A 2PRFA 4RA7A 1DJCA 3A3JA 1S0WA 2J3TC 3IXDA 5CGSA 3NY4A 4R23A 1SDNA 2WZZA 3G2YA 4XT2B 5U47A 2W3FA 5TJJA 1Q2QA 2I72A 2Z2MB 3CUEC 3KSFA 1RP5A 2P74A 3E4QA 4HP9A 4EBLA 3S1YA 3G6OA 2ZQ7A 1W7FA 3P98A 1MWSA 2VX8A 4N9KA 4WUJA 4WBGA 4MBKA 1M6KA 4FTXA 4O8GA 3BY8A 2ZMVA 3ZQ5A 4UQIS 1W63M 1DRMA 4KZ9A 1GCEA 1YAXA 4I3AA 4ZDXA 4EV4A 1GA9A 2YKHA 2AVXA 3IXGA 2QZ6A 3AGFA 4S2MA 5CGWA 1YKDA 2WKEA 4ESPA 1FILA 3WS5A 3RJUA 3KX0X 1I2WA 2EFXA 2JCHA 1F2KA 4BENA 4CJNA 2HDRA 4P6BA 4I38A 1PI5A 5HD5A 1KOUA 3V3SA 4HY8A 5FQIA 4Y0UA 3DTMA 3H9WA 3SOIA 2WKRA 4PM5A 3HREA 1S67L 2PBDP 4L9EA 3MMHA 4OQ0A 2RL3A 5HD3A 2G2UA 4Q8IA 4U3TA 3IF6B 1BULA 1MKIA 5HX9A 2V20A 1TDLA 1N9OA 3ZFZA 1W8QA 1DJAA 4U0TA 4ZJ2A 3EWKA 4EWFA 3ZG8B 1SDEA 5TBMA 1SCWA 2EXAA 5IHVA 1KGEA 4ETXA 5FSRA 1K56D 5AQ7A 1YLPA 1RGZA 4P85A 1ZC2A 4E6WA 4HH3A 2WKQA 1XFNA 3E2KA 3SH7A 3IBJA 1KE4A 1N9BA 4DXBA 1SKOA 3CHWP 3G34A 1VETA 3IH9A 3IHBA 2OAP1 3PYPA 1C3BA 2W3EA 4WMCD 5KMWA 3B33A 1LI0A 3UN7A 2ZJ9A 1BSGA 4JGPA 3LIAA 1KE3A 1PW1A 1G68A 3OC2A 2FFFB 5EVEA 3TSGA 2V1BA 1H0MA 3VFFA 4WM9A 3BW6A 5E2HA 4X56A 2J9OA 2XK1A 3P09A 4FUWA 2KX6A 3LFVA 1CI8A 2PU4A 1ZKJA 1L2SA 1O07A 3ZDJA 3E4PA 1OTBA 2WZXA 3GSGA 4OPYA 1T1BA 2UWXA 1CF0A 2J3TD 4JKTA 4R1GA 4HQAA 4OQIA 3D9YA 1S66L 4G3WA 1GA0A 2M1CA 1GHIA 1ES5A 3FKVA 1BLCA 3EGDC 3MXSA 3UDXA 2Y2MA 5IT5A 3BFFA 3Q81A 1YMXA 3T4JA 1IYSA 3ITBA 5G4YA 2VZWA 4O7DA 3LEZA 2L0WA 5E2EA 2PDRA 4XUZA 2HDQA 2Y2PA 1PYYA 1F98A 3W4PA 2W3GA 3FC7A 4HJ3A 1ACFA 2J8YA 3LI8A 3BM6A 2J80A 3MBZA 4DDSA 4HIAA 2V8FA 3HVFA 4WN5A 5HARA 4KENB 1TS8A 3VE3A 3O3VA 1LSWA 3CAXA 5DJTA 2PYRA 4LCLA 4S2OA 3NOTC 3OZHA 2HP6A 3BQ8A 3JPUA 1T1AA 1DY6A 5A92A 3HJIA 4JLFA 4R3AA 3VV4A 2VA0A 3VP3A 4NG2A 4OP8A 2G7UA 4PM7A 5AQ9A 4KUOA 1FCNA 3IWQA 2QJ7A 2ZQ8A 5L8MA 3WRTA 4HESA 5HAPA 1WYCA 5DF8A 1CI9A 5HSQA 3B3XA 3IWIA 2PYPA 3G35A 2WGWA 5HW3A 3AGDA 4JF6A 1TDGA 3M6BA 1H5XA 1NYMA 3UO9A 2ZC3B 4F3LB 2V9AA 5FASA 1BLPA 4OQHA 4RYEA 3GMWA 2XDMA 1ZG6A 1ESIA 3F1NB 1ODVA 1W63Q 4MDZA 1UWNX 2H10A 3HLEA 1J3WA 2WYXA 1JWPA 1S1YA 2JKFA 4OLGA 2R9WA 2BTFP 4CLCA 1L0FA 2JBFA 3CPTA 3T4OA 2ZMFA 4DF6A 5HAQA 5DFXA 1XA1A 3T50A 2P9VA 4JGQA 4L0LA 2W3HA 1K6RA 5GLBA 5TFQA 5CEBA 1GHPA 4HJ4A 4Y13A 3IXBA 4PPRA 3HLFA 4GOGA 4P87A 4EETB 4KUKA 4HJ6A 3C7VA 2HV1A 2M7UA 2GZAA 2VK3A 3S7QA 2J9PA 3UNWA 3U4LP 3UB5P 2H0YA 1FSYA 3QP2A 3UPNA 4Y5FA 1XGIA 1G6OA 2L1MA 4OQGA 1KVLA 2GDNA 3SZTA 1BTLA 3MFXA 1K54A 4MCWA 3SS5A 2VKSA 1S1ZA 5EVIA 3LCEA 3FZCA 5CX7A 3GVBA 2GX5A 5DFYA 1P97A 3LIFA 1SHVA 3RXXA 3W2ZA 3F1OA 2C6WB 2WADA 2L4RA 1YLWA 3FG8A 4GKUA 4KG2A 4ZBEA 2J3WA 1G5UA 4RQ9A 1MWUA 2V8CA 2WGVA 2EWVA 5CTNA 4BL3A 4NK3A 3S7NA 1DJBA 5HPFA 2VGJA 2ZQDA 1W8YA 5HFOA 1SKOB 4N92A 3O5YA 1VETB 3NIAA 1IKGA 4EW7A 1BZAA 4GHIA 3MKEA 4UEYA 2HDSA 2Z6DA 3UB9A 3Q82A 2MJ6A 1NLYA 4KQDA 4WEKA 1JNUA 3RH8B 1FR6A 2PR6A 2XSSA 3N7WA 1KDWA 1P9WA 1MPLA 3IH8A 3OPRA 1KGFA 3UMDA 4R4SA 4PHTA 1PZOA 4PM9A 2HZ5A 4KZBA 1OTEA 2PBYA 2DCFA 1VEUB 2XEPA 4IHQA 2Q9MA 4M4XA 4S2LA 4GS9B 2PU2A 4X53A 4DE3A 2HF6A 4JXWA 3UDFA 4BMWA 2HJ9C 1PWCA 5EPHA 4IBRA 4EEUA 4BL2A 1LL9A 4DJ3A 5F5YA 2HDUA 2W1RA 3R7WB 2NUPC 3LIBA 1YLJA 2JKTM 3KYZA 1I2SA 2ZLYA 2DMWA 3HBRA 2Z2LB 2V1ZA 4ZRRA 4B4ZA 1CEGA 1Y4OA 3N4IA 3OCLA 3VOZA 4S2NA 5HDDA 3CITA 3B42A 4UA9A 4MBFA 3MKFA 1TS0A 2Y2HA 2IWDA 3A3EA 3Q7VA 4E3LA 1H3QA 4LRYC 4EESA 5EV0A 4WL9A 3GTCA 4O01A 1KGGA 4L9FA 5HWVA 2EX8A 3BECA 4F94A 5CEDA 1XX2A 4UAAA 3NHQA 2Y79A 4DE1A 4PAUA 3WS1A 3Q1FA 3T1XA 5GLAA 4BD1A 4B4XA 1K6SA 2X01A 3IQAA 3H82A 4BQMA 4C75A 1OPXA 5FAPA 2M7VA 4M3KA 3UE0A 2QHKA 4LRZE 1IEMA 2P04A 4PM8A 3G31A 5AQAA 1LSXA 3VSKA 4GCZA 3S22A 2B02A 2BASA 5FL3A 3HUNA 5EECA 3HCYA 4B9OA 4OPQA 4Q0HA 2R9XA 3Q07A 3HLDA 1WYBA 2VV7A 3V50A 2Y2IA 4X68A 4E3JA 4R3JA 3NOUC 4EUZA 1RCJA 2WGWB 4QU3A 4HH2A 3SS4A 3IS2A 5E43A 2QKPA 1T18A 2A24A 5GHYA 2Q9NA 2CC1A 3AGEA 5DTKA 4UA7A 5CRFA 3V67A 4Q0IA 4EEPA 3A3FA 3NCKA 1XFQA 3FPVA 3FPWA 3C7UA 4KZAA 4EBNA 3QP8A 5GHZA 4WZ4A 4QWOA 1XP4A 3BLMA 3G4PA 1PW8A 3A0VA 1E4DA 5AVEA 3R4KA 3MS6A 2ZC4B 5DTTA 3EEAA 5J7EA 3CG5A 5FQJA 1BT5A 2WK0A 5A93A 3LY3A 1E25A 1ERMA 3B47A 4WF0A 1HTZA 4KZ4A 3ISGA 2ZQAA 2J7VA 3FKWA 1VB6A 3IXHA 5FQKA 4OOYA 5G18A 4NEED 4G3VA 1N4OA 3M6HA 2W1TA 2Z6CA 1HLUP 3L7HA 3UE6A 1PIOA 1Z6FA 3RTYA 1Q2PA 1OMEA 1ES3A 3C5AA 3EEHA 4IVIA 1NRJA 4DDYA 3HUMA 3QHYA 3KSHA 1NZUA 3EQVA 1YLYA 4RX3A 2VEAA 4LCMA 1GSWA 3L9KA 1JVJA 1LLBA 1NWZA 3VP4A 3HLCA 2ZL1A 3HJKA 5EVIB 3MSHA 3CJMA 4NKPA 1K57A 4ARZB 4I39A 4E3IA 2Y2OA 1OTDA 1ESUA 4KG6A 4HI4A 1NXYA 3E2LA 2JKGA 3G32A 3T12B 4E04A 5L09A 1FSWA 5FDSA 3VMAA 4I5SA 3ZNTA 5JYPA 1YSPA 2FZ0A 2H28A 3A0RA 5FDHA 1LSVA 1K4EA 4OONA 2VGLS 4XXRA 4E3MA 4IUKA 3ZG7B 2ZC6B 3E4OA 3KYEA 4Y15A 3QP4A 3VE4A 4H6JA 4OKPA 1KE0A 3HLGA 1AXBA 1NY0A 2XRNA 3KSGA 5HL1A 2Y2LA 3UDIA 1S6RA 4Y3IA 4DMZA 3TRCA 1K38A 1I5QA 5DKLA 1FR1A 5KSHA 4R38A 3QP5A 1YPRA 1YT4A 3DTEA 3I7JA 4P6ZM 4CQHA 5F1FA 3OCNA 4GB7A 1FIKA 3PTEA 3SH9A 2PHYA 3T4TA 4MLLA 4D60A 3GQZA 3H7WA 2OWJA 4C6YA 2Y2GA 1PRQA 2H0TA 2QWSA 4BBVA 2ACGA 4CLCC 3D3OA 1P0ZA 3LI9A 2JKTI 1NJ4A 3TJZC 4XT2A 3DTKA 2V2FF 3LIDA 3GRJA 3T4SA 3V5MA 4JGOA 5M19A 4GD8A 4UHUA 5MC7A 3VP2A 1VM1A 3EOIA 3O87A 2XFTA 5EUAA 1CQAA 4B88A 3C4OA 4IUHA 2V1AA 3Q7VB 4NXEA 1BLHA 4Z9QA 1N9NA 4MN6A 1WA9A 1W79A 5D3OA 4I3JA 3A3DA 4KZ8A 5CHJA 1FCOA 4QY5A 1L0EA 5A91A 5FEGA 1K54C 1STZA 4BWIA 1U60A 1X0OA 4X55A 1QMEA 5EVIC 2D02A 3OPHA 4PMAA 4OH0A 1FQGA 4OOLA 5FQ9A 3UPPA 1G6AA 3PBQA 5CHMA 3H82B 3WS4A 3NECA 4WEJA 2JKRI 3T1SA 4LLOB 5HZHA 4KQQA 4EQ1A 1GHMA 1FCMA 5F1GA 1XJ4A 5LBRA 3IF6A 1NLZA 4A5RA 3FWLA 1L0DA 4X69A 2K2NA 4OVDA 3IBRA 3NJAA 3BFGA 1PI4A 1S4SA 3QNCA 4DXCA 2VGKA 2EX2A 1K4FA 2XR0A 2ZMAA 2QJ5A 3EGXC 1S4RA 4Y0OA 4IBXA 4E3NA 2WKIA 4C3QA 3IX8A 2KDKA 2A24B 2O9AA 2INWA 1LI9A 2GJ3A 2I9VA 4Y17A 4WELA 2ZD8A 3BFEA 3Q7ZA 2X02A 4JGRA 2Y55A 4DKIA 2BLSA 3C30A 5EOEA 2G2WA 2OLVA 2XROA 3ZYTA 4IVKA 1L3LA 1XKZA 3BFDA 1A0KA 1OT9A 5M1AA 5M18A 2XA7M 1LHYA 4P6ZS 3QP6A 3BYDA 3D4FA 2FH5A 3TOIA 3GECA 3K3DA 5TBMB 1E3UA 4S2NC 2O9BA 1ONHA 4CLCD 3LY4A 2Y91A 4MN5A 5HDCA 1CJFA 1V9ZA 3WS2A 2EA9A 4ID4A 2W1TB 1OJ5A 2OAQ1 4GDNA 4LENA 3QNBA 2PT7A 2WKPA 3VOLA 3M2KA 3BQAA 4EXOA 3BFCA 1YQSA 4JF4A 3MR0A 3VSLA 4DRTA 4X25A 5HPIA 1XPBA 1QMFA 5I94A 5HDSA 4MBHA 3HL9A 3FYZA 5FAOA 3A0SA 4S2PA 3ZG0A 1IYPA 4HNBA 4HP4A 4FCFA 4QB8A 5FAQA 3OPLA 3DW0A 2Y2KA 1UWPX 1EWZA 1YLZA 3LUQA 1YMSA 5EVID 3MZDA 1BYWA 1PWGA 1EROA 4K0XA 5DKKA 5HL6A 4FSFA 5EE8A 4JXVA 3TG9A 1OT6A 3MFDA 2BG1A 3E0YA 5DF7A 3PR6A 1K0KA 4S2KA 1IYQA 5F6AA 3IF5A 3LO7A 3DWKA 4OLDA 2YKFA 3BY9A 4I3IA 5CECA 2XFSA 4H6JB 2B18A 1MC0A 4OPZA 3UPOA 5CHUA 1AWIA 4OP5A 4KZ7A 2JHEA 4EBPA 4RVAA 5J3WA 3ZVWA 1Y28A 2Q0OA 4S2JA 3PBNA 4O0PA 3MZFA 5GL9A 1IOUA 2GNXA 1J9MA 1XJ2A 4E3KA 3PBSA 3BEBA 2IWCA 1HVBA 1W5DA 4QY6A 1DP6A 3LGOA 3JVUA 4JXGA 3S7PA 2VGLM 3MQOA 4QJGA 2WUQA 4GW9A 3MQQA 1K55A 3F1NA 4IJGA 4FOFA 3ZG9B 4NXBA 4CLCE 3ULFA 4U0XA 2JKRM 3K3CA 2JC7A 4QHCA 3T4LA 3VP0A 5A90A 1L0GA 2ZOIA 5CGXA 1K56A 4WZ5A 3VP1A 2XA7S 3OPPA 5EM1A 2E8IA 2W3DA 2O9CA 3KSIA 4KG5A 2V0WA 4MEZA 3UB6A 2WAEA 5FEFA 4HBUA 2DRWA 1LL8A 3E98A 4WMCA 1HZOA 1H8MA 3PHYA 4Z1WA 5J4EA 3MF0A 3CLOA 2W0NA 4R70A 2WGIA 2O99A 2ZBBA 1K57C 4R0QA 4E3OA 1CEFA 1F9IA 2CMNA 3WWXA 2P7JA 3W8KA 4LPZA 1SZVA 1BUEA 1PFLA 4R4RA 1D7EA 4II7A 4GLQA 3MZEA 1EI5A 3NBLA 4BD0A 4QD4A 4CLCB 3CPTB 3LYXA 1UGUA 3DTIA 3BLSA 3W4QA 1MKMA 2HPBA 1PNEA 3SH8A 2Y2JA 2P9VB 1OJGA 5K5BA 3ICYA 3LR4A 3C2WA 4H8RA 3CUEA 1OTIA 1KVMA 4S2IA
chains in the Genus database with same CATH topology
1KVLA 2GDNA 2ZQ9A 1TEMA 3ZVTA 1NJ4A 2XD5A 1BTLA 3A3IA 5L2FA 1O7EA 2XD1A 2A3UA 1ES4A 3PBRA 4GDBA 4GNUA 2V2FF 1K54A 2EX9A 1XXMA 3UE3A 3GRJA 3SS5A 5F82A 3V5MA 4OOMA 5M19A 4GD8A 5EVIA 3LCEA 4UHUA 3ITAA 4HBTA 3VP2A 2HP5A 3FZCA 3GVBA 2XF3A 1VM1A 3O87A 4RA7A 2WKHA 1DJCA 2XFTA 5EUAA 1SHVA 3RXXA 3A3JA 5DTSA 4RX2A 4B88A 1S0WA 3C4OA 3IXDA 5CGSA 3NY4A 2JE5A 1SDNA 2C6WB 4R23A 2WZZA 2WADA 3G2YA 5U47A 1XA7A 1YLWA 4NETA 3Q7VB 1Q2QA 1VQQA 2I72A 4GKUA 1RGYA 1BLHA 4Z9QA 4KG2A 2Z2MB 4ZBEA 1RP5A 2P74A 4OPRA 1MWUA 1W79A 2WGVA 4EBLA 2EX6A 5CTNA 5D3OA 4BL3A 4KZ8A 3A3DA 4NK3A 5CHJA 3S1YA 2ZM0A 1FCOA 4Y0TA 1DJBA 4QY5A 1L0EA 2X71A 2ZQ7A 1ZG4A 1W7FA 3PBOA 5A91A 1K54C 1KDSA 2VGJA 2ZQDA 3P98A 1MWSA 1U60A 1W8YA 4N9KA 5HFOA 4X55A 4WBGA 1QMEA 4N92A 5EVIC 3OPHA 4JPMA 3NIAA 4MBKA 4PMAA 1M6KA 1IKGA 4OH0A 1FQGA 4OOLA 5FQ9A 4KQOA 3UPPA 1G6AA 3PBQA 1BZAA 1YLTA 3ZHHA 5CHMA 4KZ9A 3WS4A 3ZGAB 3MKEA 1GCEA 2HDSA 4WEJA 3Q82A 4ZDXA 4EV4A 1GA9A 4WEKA 3IXGA 2QZ6A 1FR6A 3AGFA 4KQQA 4GN2A 4S2MA 5CGWA 3N7WA 5KSCA 1GHMA 1KDWA 2WKEA 1MPLA 3IH8A 3OPRA 1KGFA 1FCMA 3WS5A 5F1GA 4R4SA 3RJUA 1PZOA 2XLNA 3IF6A 4PM9A 1I2WA 2EFXA 1NYYA 2JCHA 4BENA 4A5RA 1MWRA 4CJNA 2HDRA 3FWLA 4KZBA 2PBYA 1L0DA 2DCFA 2XEPA 4P6BA 1H8YA 4X69A 4ZTKA 2Q9MA 4S2LA 1PI5A 4YFMA 3V3SA 4OVDA 5FQIA 3N6IA 2PU2A 4Y0UA 3DTMA 4X53A 3BFGA 4DE3A 3SOIA 4JXWA 3UDFA 4PM5A 3HREA 1PI4A 1PWCA 5EPHA 2WAFA 4IBRA 5F83A 3QNCA 1Y54A 3NI9A 4BL2A 1FOFA 1LL9A 4OQ0A 4DXCA 2RL3A 2HDUA 2EX2A 2VGKA 2G2UA 1K4FA 4U3TA 4Q8IA 1MWTA 2XR0A 1BULA 2ZMAA 3IF6B 4K91A 1MKIA 5HX9A 1YLJA 1I2SA 2V20A 4Y0OA 1TDLA 2OLUA 2ZLYA 1JWZA 3HBRA 4IBXA 3ZFZA 2Z2LB 4E3NA 2V1ZA 1W8QA 4B4ZA 1CEGA 1DJAA 4U0TA 2WKIA 3N4IA 3OCLA 3VOZA 4C3QA 4S2NA 4ZJ2A 3IF6C 4Y7PA 4EWFA 3ZG8B 4UA9A 1SDEA 4MBFA 3MKFA 1LI9A 4E6XA 2Y2HA 2IWDA 3A3EA 1SCWA 2EXAA 5IHVA 1KGEA 4WELA 3Q7VA 2ZD8A 3BFEA 3Q7ZA 1NRFA 4E3LA 2X02A 4JXSA 5FSRA 2Y55A 5FQMA 4DKIA 1K56D 2BLSA 3GTCA 5EOEA 1KGGA 3NDGA 1YLPA 2G2WA 5AQ7A 1RGZA 2EX8A 3BECA 2OLVA 3CZDA 4F94A 5CEDA 1XX2A 4P85A 1ZC2A 4UAAA 4E6WA 3S4XA 4IVKA 1XKZA 3BFDA 3E2KA 3G2ZA 3SH7A 4DE2A 4DE1A 3WS1A 3Q1FA 1KE4A 1N9BA 4DXBA 5M1AA 5M18A 5GLAA 4BD1A 3G34A 3IH9A 3IHBA 1LHYA 2ZM8A 4B4XA 3IHAA 3BYDA 1C3BA 1K6SA 3D4FA 4R3BA 4WMCD 3TOIA 5KMWA 2RCXA 4GD6A 2X01A 1E3UA 3IQAA 1LI0A 4BQMA 3UN7A 4UA6A 4S2NC 2ZJ9A 1BSGA 5FAPA 4C75A 1ONHA 4M3KA 3UE0A 3LY4A 1WE4A 2IWBA 1IEMA 2Y91A 5E2FA 2QPNA 1KE3A 1PW1A 4PM8A 1G68A 3G31A 5AQAA 3OC2A 3VSKA 1M40A 2FFFB 3WS2A 3TSGA 3S22A 1MXOA 3WS0A 4ID4A 3VFFA 4WM9A 5E2HA 3ZCZA 2DNSA 4PM6A 4X56A 2J9OA 2XK1A 2ZQCA 5FI6A 1PWDA 3P09A 4GDNA 5FA7A 3HLWA 3HUNA 4LENA 3QNBA 4N1HA 1CI8A 2PU4A 5EECA 1ZKJA 4N9LA 1L2SA 1O07A 3M2KA 3ZDJA 3BFCA 1YQSA 4OPQA 4JF4A 1MY8A 3VSLA 5DF9A 2WZXA 3GSGA 4LV3A 4OPYA 4DRTA 2R9XA 2C5WB 2UWXA 1XPBA 1QMFA 5I94A 4JKTA 3Q07A 4MBHA 3HL9A 3FYZA 4R1GA 3HLDA 1WYBA 5FAOA 4OQIA 4S2PA 2HP9A 3V50A 2Y2IA 3ZG0A 2A49A 1IYPA 4X68A 4E3JA 5BOHA 1GA0A 4FCFA 5DVAA 4QB8A 5FAQA 1GHIA 1ES5A 3FKVA 4R3JA 1BLCA 3OPLA 1RCJA 2WGWB 4GZBA 4EUZA 3MXSA 4QU3A 3UDXA 3DW0A 2Y2KA 3SS4A 3GR2A 4FD8A 5CXWA 5E43A 1ERQA 1EWZA 2Y2MA 5GHXA 5GHYA 2XH9A 2Q9NA 1YLZA 3BFFA 3C4PA 3Q81A 2CC1A 3AGEA 1YMSA 4UA7A 5DTKA 1YMXA 5EVID 3MZDA 1IYSA 3ITBA 5CRFA 4O7DA 3LEZA 1LL5A 1PWGA 3NC8A 1EROA 4K0XA 3N8RA 4FSFA 5EE8A 4JXVA 5E2EA 3TG9A 4KZ5A 3A3FA 3MFDA 3PAEA 3PAGA 2BG1A 3NCKA 5DF7A 4XUZA 2HDQA 4S2KA 1BLSA 1IYQA 5TR7A 2ZM2A 3C7UA 3GV9A 4KZAA 2Y2PA 4EBNA 3N8LA 1PYYA 5GHZA 2FFYA 4WZ4A 4XUXA 4X6TA 3W4PA 1XP4A 3BLMA 3G4PA 3IF5A 1PW8A 4MNRA 1E4DA 1IYOA 3LO7A 3DWKA 4K0WA 4OLDA 4LV0A 2J8YA 3BM6A 3MBZA 2ZC4B 5DTTA 4DDSA 5CECA 3VOYA 3CG5A 5FQJA 1BT5A 3HVFA 5CTMA 2XFSA 4OPZA 2EXBA 5HARA 3UPOA 2WK0A 5CHUA 2Y4AA 3LY3A 5A93A 3PBTA 4OP5A 1E25A 4KENB 1ERMA 2XQZA 4IEDA 3O3VA 1HTZA 4KZ7A 4EBPA 5E2GA 4RVAA 3O86A 3ISGA 2ZQAA 4KZ4A 5EOOA 2J7VA 3VFHA 3ZVWA 3FKWA 4KZ6A 1H8ZA 4LCLA 3IXHA 5FQKA 3EQUA 4S2JA 4S2OA 4OOYA 3PBNA 1K25A 3MZFA 3OZHA 5G18A 2HP6A 4FH2A 1N4OA 3M6HA 2QMIA 5GL9A 5GLCA 1DY6A 5A92A 4JLFA 1IKIA 1JWVA 1PIOA 1Z6FA 1J9MA 3FV7A 1Q2PA 3VP3A 4E3KA 4FH4A 1OMEA 1ES3A 4OP8A 3C5AA 3PBSA 1IELA 4PM7A 5AQ9A 3BEBA 4IVIA 2IWCA 1FCNA 1HVBA 3IWQA 1W5DA 2ZQ8A 4LV1A 4QY6A 4DDYA 3HUMA 3QHYA 3RXWA 4JXGA 3WRTA 3M2JA 4HESA 5HAPA 1NZUA 1WYCA 3EQVA 5FQQA 1YLYA 4RX3A 4S2IA 5DF8A 1CI9A 4LCMA 5HAIA 4QJGA 2WUQA 4ZJ1A 1K55A 3BRMA 3B3XA 4HEFA 3ZG9B 1CK3A 3IWIA 1ONGA 2ZC7A 4U0XA 5TGFA 1JVJA 3W4OA 1LLBA 3G35A 3VP4A 5GLDA 5AQBA 2WGWA 3HLCA 2JC7A 3IWOA 5HW3A 2OSUA 3AGDA 4JF6A 4QHCA 4ZJ3A 5EVIB 3CJMA 1K57A 3VP0A 5A90A 1L0GA 1TDGA 4N1XA 5FI2A 2Y2OA 3M6BA 3IT9A 4E3IA 1H5XA 1NYMA 1ESUA 1ALQA 3UO9A 3V3RA 3UY6A 2ZC3B 4KG6A 1NXYA 5FASA 5CGXA 4CPKA 1K56A 3E2LA 4WZ5A 1BLPA 3VP1A 3G32A 3HLBA 4OQHA 4RYEA 3OPPA 3GMWA 1FSWA 2XDMA 4EQIA 1ZG6A 2E8IA 1ESIA 4JF5A 3VMAA 4KG5A 5JYOA 2B5RA 4MEZA 1SKFA 3ZNYA 5FATA 2EFUA 4D2OA 2H10A 2WAEA 3ZNTA 5JYPA 3MXRA 1HD8A 3HLEA 5FDHA 4HBUA 2DRWA 4BLMA 2WYXA 1K4EA 4OONA 1JWPA 4XXRA 4WYYA 4E3MA 1K55C 3CMZA 4OLGA 4WMCA 3ZG7B 1HZOA 2R9WA 2ZC6B 1JTDA 2Y59A 3O88A 3DWZA 4ZAMA 1L0FA 2JBFA 4KZ3A 4JBFA 2WGIA 4OKPA 1KE0A 3HLGA 1K57C 1AXBA 1NY0A 4DF6A 5HAQA 4R0QA 4E3OA 1CEFA 5HL1A 3WWXA 2XGNA 5FI7A 3W8KA 1XA1A 2Y2LA 3N8SA 5EVLA 2P9VA 4L0LA 1TVFA 5J8XA 1K6RA 3UDIA 1S6RA 4WZ5C 5GLBA 4LV2A 1BUEA 1K38A 2Y2QA 4BJPA 1I5QA 1JTGA 3UE1A 1FR1A 4R4RA 5TFQA 1E3UD 3NDEA 4KQRA 5KSHA 5CEBA 1GHPA 1YM1A 3IXBA 1YT4A 3HUOA 1ES2A 4PPRA 3HLFA 4GOGA 4P87A 3I7JA 3MZEA 5KZHA 1EI5A 3NBLA 5F1FA 3OCNA 4BD0A 4QD4A 2Y2NA 4GB7A 1PZPA 4P0MA 3PTEA 3SH9A 2OV5A 4MLLA 3G30A 3C7VA 3GQZA 4C6YA 1XGJA 2Y2GA 3BLSA 2H0TA 3W4QA 3WRZA 3V39A 2HPBA 3SH8A 3ZG5A 4DE0A 2J9PA 2Y2JA 1NZOA 2H5SA 2P9VB 2ZC5B 3UNWA 2H0YA 4YINA 5CERA 1FSYA 4H8RA 3UPNA 3JYIA 3SS3A 1MBLA 1XGIA 1KVMA 4OQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KVL A;  2GDN A;  2ZQ9 A;  1TEM A;  3ZVT A;  1NJ4 A;  2XD5 A;  1BTL A;  3A3I A;  5L2F A;  1O7E A;  2XD1 A;  2A3U A;  1ES4 A;  3PBR A;  4GDB A;  4GNU A;  2V2F F;  1K54 A;  2EX9 A;  1XXM A;  3UE3 A;  3GRJ A;  3SS5 A;  5F82 A;  3V5M A;  4OOM A;  5M19 A;  4GD8 A;  5EVI A;  3LCE A;  4UHU A;  3ITA A;  4HBT A;  3VP2 A;  2HP5 A;  3FZC A;  3GVB A;  2XF3 A;  1VM1 A;  3O87 A;  4RA7 A;  2WKH A;  1DJC A;  2XFT A;  5EUA A;  1SHV A;  3RXX A;  3A3J A;  5DTS A;  4RX2 A;  4B88 A;  1S0W A;  3C4O A;  3IXD A;  5CGS A;  3NY4 A;  2JE5 A;  1SDN A;  2C6W B;  4R23 A;  2WZZ A;  2WAD A;  3G2Y A;  5U47 A;  1XA7 A;  1YLW A;  4NET A;  3Q7V B;  1Q2Q A;  1VQQ A;  2I72 A;  4GKU A;  1RGY A;  1BLH A;  4Z9Q A;  4KG2 A;  2Z2M B;  4ZBE A;  1RP5 A;  2P74 A;  4OPR A;  1MWU A;  1W79 A;  2WGV A;  4EBL A;  2EX6 A;  5CTN A;  5D3O A;  4BL3 A;  4KZ8 A;  3A3D A;  4NK3 A;  5CHJ A;  3S1Y A;  2ZM0 A;  1FCO A;  4Y0T A;  1DJB A;  4QY5 A;  1L0E A;  2X71 A;  2ZQ7 A;  1ZG4 A;  1W7F A;  3PBO A;  5A91 A;  1K54 C;  1KDS A;  2VGJ A;  2ZQD A;  3P98 A;  1MWS A;  1U60 A;  1W8Y A;  4N9K A;  5HFO A;  4X55 A;  4WBG A;  1QME A;  4N92 A;  5EVI C;  3OPH A;  4JPM A;  3NIA A;  4MBK A;  4PMA A;  1M6K A;  1IKG A;  4OH0 A;  1FQG A;  4OOL A;  5FQ9 A;  4KQO A;  3UPP A;  1G6A A;  3PBQ A;  1BZA A;  1YLT A;  3ZHH A;  5CHM A;  4KZ9 A;  3WS4 A;  3ZGA B;  3MKE A;  1GCE A;  2HDS A;  4WEJ A;  3Q82 A;  4ZDX A;  4EV4 A;  1GA9 A;  4WEK A;  3IXG A;  2QZ6 A;  1FR6 A;  3AGF A;  4KQQ A;  4GN2 A;  4S2M A;  5CGW A;  3N7W A;  5KSC A;  1GHM A;  1KDW A;  2WKE A;  1MPL A;  3IH8 A;  3OPR A;  1KGF A;  1FCM A;  3WS5 A;  5F1G A;  4R4S A;  3RJU A;  1PZO A;  2XLN A;  3IF6 A;  4PM9 A;  1I2W A;  2EFX A;  1NYY A;  2JCH A;  4BEN A;  4A5R A;  1MWR A;  4CJN A;  2HDR A;  3FWL A;  4KZB A;  2PBY A;  1L0D A;  2DCF A;  2XEP A;  4P6B A;  1H8Y A;  4X69 A;  4ZTK A;  2Q9M A;  4S2L A;  1PI5 A;  4YFM A;  3V3S A;  4OVD A;  5FQI A;  3N6I A;  2PU2 A;  4Y0U A;  3DTM A;  4X53 A;  3BFG A;  4DE3 A;  3SOI A;  4JXW A;  3UDF A;  4PM5 A;  3HRE A;  1PI4 A;  1PWC A;  5EPH A;  2WAF A;  4IBR A;  5F83 A;  3QNC A;  1Y54 A;  3NI9 A;  4BL2 A;  1FOF A;  1LL9 A;  4OQ0 A;  4DXC A;  2RL3 A;  2HDU A;  2EX2 A;  2VGK A;  2G2U A;  1K4F A;  4U3T A;  4Q8I A;  1MWT A;  2XR0 A;  1BUL A;  2ZMA A;  3IF6 B;  4K91 A;  1MKI A;  5HX9 A;  1YLJ A;  1I2S A;  2V20 A;  4Y0O A;  1TDL A;  2OLU A;  2ZLY A;  1JWZ A;  3HBR A;  4IBX A;  3ZFZ A;  2Z2L B;  4E3N A;  2V1Z A;  1W8Q A;  4B4Z A;  1CEG A;  1DJA A;  4U0T A;  2WKI A;  3N4I A;  3OCL A;  3VOZ A;  4C3Q A;  4S2N A;  4ZJ2 A;  3IF6 C;  4Y7P A;  4EWF A;  3ZG8 B;  4UA9 A;  1SDE A;  4MBF A;  3MKF A;  1LI9 A;  4E6X A;  2Y2H A;  2IWD A;  3A3E A;  1SCW A;  2EXA A;  5IHV A;  1KGE A;  4WEL A;  3Q7V A;  2ZD8 A;  3BFE A;  3Q7Z A;  1NRF A;  4E3L A;  2X02 A;  4JXS A;  5FSR A;  2Y55 A;  5FQM A;  4DKI A;  1K56 D;  2BLS A;  3GTC A;  5EOE A;  1KGG A;  3NDG A;  1YLP A;  2G2W A;  5AQ7 A;  1RGZ A;  2EX8 A;  3BEC A;  2OLV A;  3CZD A;  4F94 A;  5CED A;  1XX2 A;  4P85 A;  1ZC2 A;  4UAA A;  4E6W A;  3S4X A;  4IVK A;  1XKZ A;  3BFD A;  3E2K A;  3G2Z A;  3SH7 A;  4DE2 A;  4DE1 A;  3WS1 A;  3Q1F A;  1KE4 A;  1N9B A;  4DXB A;  5M1A A;  5M18 A;  5GLA A;  4BD1 A;  3G34 A;  3IH9 A;  3IHB A;  1LHY A;  2ZM8 A;  4B4X A;  3IHA A;  3BYD A;  1C3B A;  1K6S A;  3D4F A;  4R3B A;  4WMC D;  3TOI A;  5KMW A;  2RCX A;  4GD6 A;  2X01 A;  1E3U A;  3IQA A;  1LI0 A;  4BQM A;  3UN7 A;  4UA6 A;  4S2N C;  2ZJ9 A;  1BSG A;  5FAP A;  4C75 A;  1ONH A;  4M3K A;  3UE0 A;  3LY4 A;  1WE4 A;  2IWB A;  1IEM A;  2Y91 A;  5E2F A;  2QPN A;  1KE3 A;  1PW1 A;  4PM8 A;  1G68 A;  3G31 A;  5AQA A;  3OC2 A;  3VSK A;  1M40 A;  2FFF B;  3WS2 A;  3TSG A;  3S22 A;  1MXO A;  3WS0 A;  4ID4 A;  3VFF A;  4WM9 A;  5E2H A;  3ZCZ A;  2DNS A;  4PM6 A;  4X56 A;  2J9O A;  2XK1 A;  2ZQC A;  5FI6 A;  1PWD A;  3P09 A;  4GDN A;  5FA7 A;  3HLW A;  3HUN A;  4LEN A;  3QNB A;  4N1H A;  1CI8 A;  2PU4 A;  5EEC A;  1ZKJ A;  4N9L A;  1L2S A;  1O07 A;  3M2K A;  3ZDJ A;  3BFC A;  1YQS A;  4OPQ A;  4JF4 A;  1MY8 A;  3VSL A;  5DF9 A;  2WZX A;  3GSG A;  4LV3 A;  4OPY A;  4DRT A;  2R9X A;  2C5W B;  2UWX A;  1XPB A;  1QMF A;  5I94 A;  4JKT A;  3Q07 A;  4MBH A;  3HL9 A;  3FYZ A;  4R1G A;  3HLD A;  1WYB A;  5FAO A;  4OQI A;  4S2P A;  2HP9 A;  3V50 A;  2Y2I A;  3ZG0 A;  2A49 A;  1IYP A;  4X68 A;  4E3J A;  5BOH A;  1GA0 A;  4FCF A;  5DVA A;  4QB8 A;  5FAQ A;  1GHI A;  1ES5 A;  3FKV A;  4R3J A;  1BLC A;  3OPL A;  1RCJ A;  2WGW B;  4GZB A;  4EUZ A;  3MXS A;  4QU3 A;  3UDX A;  3DW0 A;  2Y2K A;  3SS4 A;  3GR2 A;  4FD8 A;  5CXW A;  5E43 A;  1ERQ A;  1EWZ A;  2Y2M A;  5GHX A;  5GHY A;  2XH9 A;  2Q9N A;  1YLZ A;  3BFF A;  3C4P A;  3Q81 A;  2CC1 A;  3AGE A;  1YMS A;  4UA7 A;  5DTK A;  1YMX A;  5EVI D;  3MZD A;  1IYS A;  3ITB A;  5CRF A;  4O7D A;  3LEZ A;  1LL5 A;  1PWG A;  3NC8 A;  1ERO A;  4K0X A;  3N8R A;  4FSF A;  5EE8 A;  4JXV A;  5E2E A;  3TG9 A;  4KZ5 A;  3A3F A;  3MFD A;  3PAE A;  3PAG A;  2BG1 A;  3NCK A;  5DF7 A;  4XUZ A;  2HDQ A;  4S2K A;  1BLS A;  1IYQ A;  5TR7 A;  2ZM2 A;  3C7U A;  3GV9 A;  4KZA A;  2Y2P A;  4EBN A;  3N8L A;  1PYY A;  5GHZ A;  2FFY A;  4WZ4 A;  4XUX A;  4X6T A;  3W4P A;  1XP4 A;  3BLM A;  3G4P A;  3IF5 A;  1PW8 A;  4MNR A;  1E4D A;  1IYO A;  3LO7 A;  3DWK A;  4K0W A;  4OLD A;  4LV0 A;  2J8Y A;  3BM6 A;  3MBZ A;  2ZC4 B;  5DTT A;  4DDS A;  5CEC A;  3VOY A;  3CG5 A;  5FQJ A;  1BT5 A;  3HVF A;  5CTM A;  2XFS A;  4OPZ A;  2EXB A;  5HAR A;  3UPO A;  2WK0 A;  5CHU A;  2Y4A A;  3LY3 A;  5A93 A;  3PBT A;  4OP5 A;  1E25 A;  4KEN B;  1ERM A;  2XQZ A;  4IED A;  3O3V A;  1HTZ A;  4KZ7 A;  4EBP A;  5E2G A;  4RVA A;  3O86 A;  3ISG A;  2ZQA A;  4KZ4 A;  5EOO A;  2J7V A;  3VFH A;  3ZVW A;  3FKW A;  4KZ6 A;  1H8Z A;  4LCL A;  3IXH A;  5FQK A;  3EQU A;  4S2J A;  4S2O A;  4OOY A;  3PBN A;  1K25 A;  3MZF A;  3OZH A;  5G18 A;  2HP6 A;  4FH2 A;  1N4O A;  3M6H A;  2QMI A;  5GL9 A;  5GLC A;  1DY6 A;  5A92 A;  4JLF A;  1IKI A;  1JWV A;  1PIO A;  1Z6F A;  1J9M A;  3FV7 A;  1Q2P A;  3VP3 A;  4E3K A;  4FH4 A;  1OME A;  1ES3 A;  4OP8 A;  3C5A A;  3PBS A;  1IEL A;  4PM7 A;  5AQ9 A;  3BEB A;  4IVI A;  2IWC A;  1FCN A;  1HVB A;  3IWQ A;  1W5D A;  2ZQ8 A;  4LV1 A;  4QY6 A;  4DDY A;  3HUM A;  3QHY A;  3RXW A;  4JXG A;  3WRT A;  3M2J A;  4HES A;  5HAP A;  1NZU A;  1WYC A;  3EQV A;  5FQQ A;  1YLY A;  4RX3 A;  4S2I A;  5DF8 A;  1CI9 A;  4LCM A;  5HAI A;  4QJG A;  2WUQ A;  4ZJ1 A;  1K55 A;  3BRM A;  3B3X A;  4HEF A;  3ZG9 B;  1CK3 A;  3IWI A;  1ONG A;  2ZC7 A;  4U0X A;  5TGF A;  1JVJ A;  3W4O A;  1LLB A;  3G35 A;  3VP4 A;  5GLD A;  5AQB A;  2WGW A;  3HLC A;  2JC7 A;  3IWO A;  5HW3 A;  2OSU A;  3AGD A;  4JF6 A;  4QHC A;  4ZJ3 A;  5EVI B;  3CJM A;  1K57 A;  3VP0 A;  5A90 A;  1L0G A;  1TDG A;  4N1X A;  5FI2 A;  2Y2O A;  3M6B A;  3IT9 A;  4E3I A;  1H5X A;  1NYM A;  1ESU A;  1ALQ A;  3UO9 A;  3V3R A;  3UY6 A;  2ZC3 B;  4KG6 A;  1NXY A;  5FAS A;  5CGX A;  4CPK A;  1K56 A;  3E2L A;  4WZ5 A;  1BLP A;  3VP1 A;  3G32 A;  3HLB A;  4OQH A;  4RYE A;  3OPP A;  3GMW A;  1FSW A;  2XDM A;  4EQI A;  1ZG6 A;  2E8I A;  1ESI A;  4JF5 A;  3VMA A;  4KG5 A;  5JYO A;  2B5R A;  4MEZ A;  1SKF A;  3ZNY A;  5FAT A;  2EFU A;  4D2O A;  2H10 A;  2WAE A;  3ZNT A;  5JYP A;  3MXR A;  1HD8 A;  3HLE A;  5FDH A;  4HBU A;  2DRW A;  4BLM A;  2WYX A;  1K4E A;  4OON A;  1JWP A;  4XXR A;  4WYY A;  4E3M A;  1K55 C;  3CMZ A;  4OLG A;  4WMC A;  3ZG7 B;  1HZO A;  2R9W A;  2ZC6 B;  1JTD A;  2Y59 A;  3O88 A;  3DWZ A;  4ZAM A;  1L0F A;  2JBF A;  4KZ3 A;  4JBF A;  2WGI A;  4OKP A;  1KE0 A;  3HLG A;  1K57 C;  1AXB A;  1NY0 A;  4DF6 A;  5HAQ A;  4R0Q A;  4E3O A;  1CEF A;  5HL1 A;  3WWX A;  2XGN A;  5FI7 A;  3W8K A;  1XA1 A;  2Y2L A;  3N8S A;  5EVL A;  2P9V A;  4L0L A;  1TVF A;  5J8X A;  1K6R A;  3UDI A;  1S6R A;  4WZ5 C;  5GLB A;  4LV2 A;  1BUE A;  1K38 A;  2Y2Q A;  4BJP A;  1I5Q A;  1JTG A;  3UE1 A;  1FR1 A;  4R4R A;  5TFQ A;  1E3U D;  3NDE A;  4KQR A;  5KSH A;  5CEB A;  1GHP A;  1YM1 A;  3IXB A;  1YT4 A;  3HUO A;  1ES2 A;  4PPR A;  3HLF A;  4GOG A;  4P87 A;  3I7J A;  3MZE A;  5KZH A;  1EI5 A;  3NBL A;  5F1F A;  3OCN A;  4BD0 A;  4QD4 A;  2Y2N A;  4GB7 A;  1PZP A;  4P0M A;  3PTE A;  3SH9 A;  2OV5 A;  4MLL A;  3G30 A;  3C7V A;  3GQZ A;  4C6Y A;  1XGJ A;  2Y2G A;  3BLS A;  2H0T A;  3W4Q A;  3WRZ A;  3V39 A;  2HPB A;  3SH8 A;  3ZG5 A;  4DE0 A;  2J9P A;  2Y2J A;  1NZO A;  2H5S A;  2P9V B;  2ZC5 B;  3UNW A;  2H0Y A;  4YIN A;  5CER A;  1FSY A;  4H8R A;  3UPN A;  3JYI A;  3SS3 A;  1MBL A;  1XGI A;  1KVM A;  4OQG A; 
#chains in the Genus database with same CATH topology
 1TEM A;  2XD5 A;  3A3I A;  1G28 A;  2A3U A;  1ES4 A;  3PBR A;  4GNU A;  1YSQ A;  2EX9 A;  4BBT A;  4AFI A;  3DBA A;  5A8B A;  3KO6 A;  3F1P A;  2HP5 A;  3NUL A;  2XF3 A;  3MQ0 A;  2WKH A;  1TD5 A;  5DTS A;  4RX2 A;  3QP1 A;  2JE5 A;  2R78 A;  1XA7 A;  4NET A;  1VQQ A;  1RGY A;  3T1R A;  1D1J A;  4OPR A;  4MN7 A;  1ZHH B;  2EX6 A;  2ZM0 A;  3MXQ A;  3LR3 A;  4Y0T A;  2X71 A;  1ZG4 A;  2K31 A;  3PBO A;  1KDS A;  4JPM A;  3F1O B;  4KQO A;  1D06 A;  1GSX A;  3ZHH A;  1YLT A;  1VEU A;  1V9Y A;  4G3K A;  3ZGA B;  4B93 A;  4GS9 A;  4YOF A;  3CI6 A;  2QYB A;  4GN2 A;  5KSC A;  5AJG A;  3DAV A;  2E8J A;  3R7W A;  4X1M A;  2XLN A;  1NYY A;  4QPR A;  1MWR A;  2P08 A;  4WLA A;  3LEQ A;  3C38 A;  3S7O A;  1H8Y A;  3CWF A;  4GHI B;  4ZTK A;  5G4Z A;  4GJ4 A;  5DJU A;  4YFM A;  3N6I A;  4LFU A;  2WAF A;  5F83 A;  1Y54 A;  3NI9 A;  5IS1 A;  1FOF A;  1MWT A;  4K91 A;  2OLU A;  1JWZ A;  1DP9 A;  3IF6 C;  4Y7P A;  1T1C A;  2HGV A;  4E6X A;  4PKY A;  1IFQ A;  2KLI A;  1T19 A;  1NRF A;  3P01 A;  1N9L A;  4JXS A;  3D72 A;  5FQM A;  3NDG A;  4DJ2 A;  4LGW A;  3CZD A;  4DN0 A;  3S4X A;  1XJ3 A;  4DE2 A;  3G2Z A;  3T4Q A;  2ZM8 A;  3IHA A;  4R3B A;  3BJN A;  2RCX A;  4GD6 A;  3C8C A;  4UA6 A;  1WE4 A;  2IWB A;  5E2F A;  2QPN A;  1M40 A;  3MJQ A;  1OTA A;  1MXO A;  3WS0 A;  3PXP A;  3ZCZ A;  2VLG A;  1TS6 A;  2DNS A;  4PM6 A;  1XJ6 A;  2ZQC A;  1Z09 A;  5AVF A;  5FI6 A;  1PWD A;  5FA7 A;  1DP8 A;  3HLW A;  3P7N A;  4N1H A;  4N9L A;  5KIZ A;  2UV0 E;  2O0Y A;  1MY8 A;  4NXG A;  5DF9 A;  4LV3 A;  2C5W B;  3OLO A;  1TS7 A;  4NXF A;  4EUV A;  5HWW A;  4K08 A;  3BWL A;  2HP9 A;  4MMN A;  2A49 A;  2Y8H A;  3OOV A;  5BOH A;  3IX3 A;  5DVA A;  1GSV A;  4GZB A;  3IX4 A;  3GR2 A;  4FD8 A;  5CXW A;  5F69 A;  3TW8 A;  1ERQ A;  5GHX A;  2XH9 A;  3C4P A;  3SW1 A;  1MZU A;  3JVV A;  1LL5 A;  3NC8 A;  4HHD A;  5L10 A;  3N8R A;  3K2N A;  2K7S A;  1EW0 A;  2IA2 A;  4KZ5 A;  3PAE A;  4L9G A;  3PAG A;  5HWT A;  1LT0 A;  1BLS A;  2HJE A;  5TR7 A;  2ZM2 A;  3GV9 A;  3N8L A;  2ZOH A;  2OOL A;  2FFY A;  4XUX A;  4X6T A;  3IS2 B;  4MNR A;  3UB8 A;  1IYO A;  3LR0 A;  4K0W A;  4LV0 A;  3VOY A;  5CTM A;  2EXB A;  2Y4A A;  3PBT A;  2XQZ A;  4IED A;  5E2G A;  4ETZ A;  3O86 A;  5EOO A;  2LB5 A;  3VFH A;  3LR5 A;  4KZ6 A;  1H8Z A;  4BBU A;  3TE8 A;  3EQU A;  2PD7 A;  1K25 A;  4FH2 A;  2PAV P;  2KOI A;  2QMI A;  5GLC A;  5L07 A;  4R6L A;  1IKI A;  1JWV A;  2JN7 A;  3FV7 A;  4UQI M;  4FH4 A;  1IEL A;  1ZTU A;  4ARZ A;  2VV8 A;  4LV1 A;  3RXW A;  2V0U A;  4PKY G;  3M2J A;  2PR5 A;  2B95 A;  5FQQ A;  5HAI A;  3T4K A;  4ZJ1 A;  3BRM A;  2LB9 A;  1CK3 A;  4LRX C;  1ONG A;  2ZC7 A;  5TGF A;  3W4O A;  4X1L A;  5GLD A;  5AQB A;  3IWO A;  2OSU A;  4ZJ3 A;  4N1X A;  5FI2 A;  3IT9 A;  3F1P B;  1TF1 A;  3V3R A;  1ALQ A;  3UY6 A;  3OBF A;  4CPK A;  4YWZ A;  3HLB A;  1VHM A;  4EQI A;  4JF5 A;  3LIE A;  5EFW A;  5JYO A;  2B5R A;  1SKF A;  3ZNY A;  5FAT A;  2EFU A;  4Q0J A;  2EWW A;  4D2O A;  3MXR A;  1HD8 A;  2ZL1 B;  4BLM A;  3LIC A;  5C5K A;  4WYY A;  1K55 C;  3CMZ A;  4YNR A;  1JTD A;  2Y59 A;  3O88 A;  3DWZ A;  4Y2F A;  4ZAM A;  2D01 A;  4KZ3 A;  4JBF A;  4EER A;  3KYQ A;  2XGN A;  5FI7 A;  3N8S A;  5IU1 A;  5EVL A;  5J8X A;  1TVF A;  4WZ5 C;  4LV2 A;  3U2A A;  2Y2Q A;  3UME A;  4HOI A;  4BJP A;  1JTG A;  3UE1 A;  1E3U D;  3NDE A;  4KQR A;  2A2L A;  1YM1 A;  3GDI A;  3UB7 A;  3HUO A;  1ES2 A;  5KZH A;  4ME4 A;  1F5M A;  2Y2N A;  3RFB A;  1PZP A;  4P0M A;  2OWH A;  2OV5 A;  3G30 A;  1XGJ A;  3WRZ A;  3V39 A;  3ZG5 A;  4DE0 A;  1NZO A;  2H5S A;  2ZC5 B;  4YIN A;  5CER A;  3T1Q B;  2VJW A;  3JYI A;  5I5L A;  3SS3 A;  4EU0 A;  2PD8 A;  1MBL A;  4HEF A;  3ZVT A;  2ZQ9 A;  5L2F A;  1O7E A;  2XD1 A;  4GDB A;  5F68 A;  1XXM A;  3UE3 A;  5EM0 A;  5F82 A;  4OOM A;  2NUT C;  3H7W B;  3ITA A;  4HBT A;  3NOP C;  4F3L A;  2W27 A;  1P9R A;  2VV6 A;  2PRF A;  4RA7 A;  1DJC A;  3A3J A;  1S0W A;  2J3T C;  3IXD A;  5CGS A;  3NY4 A;  4R23 A;  1SDN A;  2WZZ A;  3G2Y A;  4XT2 B;  5U47 A;  2W3F A;  5TJJ A;  1Q2Q A;  2I72 A;  2Z2M B;  3CUE C;  3KSF A;  1RP5 A;  2P74 A;  3E4Q A;  4HP9 A;  4EBL A;  3S1Y A;  3G6O A;  2ZQ7 A;  1W7F A;  3P98 A;  1MWS A;  2VX8 A;  4N9K A;  4WUJ A;  4WBG A;  4MBK A;  1M6K A;  4FTX A;  4O8G A;  3BY8 A;  2ZMV A;  3ZQ5 A;  4UQI S;  1W63 M;  1DRM A;  4KZ9 A;  1GCE A;  1YAX A;  4I3A A;  4ZDX A;  4EV4 A;  1GA9 A;  2YKH A;  2AVX A;  3IXG A;  2QZ6 A;  3AGF A;  4S2M A;  5CGW A;  1YKD A;  2WKE A;  4ESP A;  1FIL A;  3WS5 A;  3RJU A;  3KX0 X;  1I2W A;  2EFX A;  2JCH A;  1F2K A;  4BEN A;  4CJN A;  2HDR A;  4P6B A;  4I38 A;  1PI5 A;  5HD5 A;  1KOU A;  3V3S A;  4HY8 A;  5FQI A;  4Y0U A;  3DTM A;  3H9W A;  3SOI A;  2WKR A;  4PM5 A;  3HRE A;  1S67 L;  2PBD P;  4L9E A;  3MMH A;  4OQ0 A;  2RL3 A;  5HD3 A;  2G2U A;  4Q8I A;  4U3T A;  3IF6 B;  1BUL A;  1MKI A;  5HX9 A;  2V20 A;  1TDL A;  1N9O A;  3ZFZ A;  1W8Q A;  1DJA A;  4U0T A;  4ZJ2 A;  3EWK A;  4EWF A;  3ZG8 B;  1SDE A;  5TBM A;  1SCW A;  2EXA A;  5IHV A;  1KGE A;  4ETX A;  5FSR A;  1K56 D;  5AQ7 A;  1YLP A;  1RGZ A;  4P85 A;  1ZC2 A;  4E6W A;  4HH3 A;  2WKQ A;  1XFN A;  3E2K A;  3SH7 A;  3IBJ A;  1KE4 A;  1N9B A;  4DXB A;  1SKO A;  3CHW P;  3G34 A;  1VET A;  3IH9 A;  3IHB A;  2OAP 1;  3PYP A;  1C3B A;  2W3E A;  4WMC D;  5KMW A;  3B33 A;  1LI0 A;  3UN7 A;  2ZJ9 A;  1BSG A;  4JGP A;  3LIA A;  1KE3 A;  1PW1 A;  1G68 A;  3OC2 A;  2FFF B;  5EVE A;  3TSG A;  2V1B A;  1H0M A;  3VFF A;  4WM9 A;  3BW6 A;  5E2H A;  4X56 A;  2J9O A;  2XK1 A;  3P09 A;  4FUW A;  2KX6 A;  3LFV A;  1CI8 A;  2PU4 A;  1ZKJ A;  1L2S A;  1O07 A;  3ZDJ A;  3E4P A;  1OTB A;  2WZX A;  3GSG A;  4OPY A;  1T1B A;  2UWX A;  1CF0 A;  2J3T D;  4JKT A;  4R1G A;  4HQA A;  4OQI A;  3D9Y A;  1S66 L;  4G3W A;  1GA0 A;  2M1C A;  1GHI A;  1ES5 A;  3FKV A;  1BLC A;  3EGD C;  3MXS A;  3UDX A;  2Y2M A;  5IT5 A;  3BFF A;  3Q81 A;  1YMX A;  3T4J A;  1IYS A;  3ITB A;  5G4Y A;  2VZW A;  4O7D A;  3LEZ A;  2L0W A;  5E2E A;  2PDR A;  4XUZ A;  2HDQ A;  2Y2P A;  1PYY A;  1F98 A;  3W4P A;  2W3G A;  3FC7 A;  4HJ3 A;  1ACF A;  2J8Y A;  3LI8 A;  3BM6 A;  2J80 A;  3MBZ A;  4DDS A;  4HIA A;  2V8F A;  3HVF A;  4WN5 A;  5HAR A;  4KEN B;  1TS8 A;  3VE3 A;  3O3V A;  1LSW A;  3CAX A;  5DJT A;  2PYR A;  4LCL A;  4S2O A;  3NOT C;  3OZH A;  2HP6 A;  3BQ8 A;  3JPU A;  1T1A A;  1DY6 A;  5A92 A;  3HJI A;  4JLF A;  4R3A A;  3VV4 A;  2VA0 A;  3VP3 A;  4NG2 A;  4OP8 A;  2G7U A;  4PM7 A;  5AQ9 A;  4KUO A;  1FCN A;  3IWQ A;  2QJ7 A;  2ZQ8 A;  5L8M A;  3WRT A;  4HES A;  5HAP A;  1WYC A;  5DF8 A;  1CI9 A;  5HSQ A;  3B3X A;  3IWI A;  2PYP A;  3G35 A;  2WGW A;  5HW3 A;  3AGD A;  4JF6 A;  1TDG A;  3M6B A;  1H5X A;  1NYM A;  3UO9 A;  2ZC3 B;  4F3L B;  2V9A A;  5FAS A;  1BLP A;  4OQH A;  4RYE A;  3GMW A;  2XDM A;  1ZG6 A;  1ESI A;  3F1N B;  1ODV A;  1W63 Q;  4MDZ A;  1UWN X;  2H10 A;  3HLE A;  1J3W A;  2WYX A;  1JWP A;  1S1Y A;  2JKF A;  4OLG A;  2R9W A;  2BTF P;  4CLC A;  1L0F A;  2JBF A;  3CPT A;  3T4O A;  2ZMF A;  4DF6 A;  5HAQ A;  5DFX A;  1XA1 A;  3T50 A;  2P9V A;  4JGQ A;  4L0L A;  2W3H A;  1K6R A;  5GLB A;  5TFQ A;  5CEB A;  1GHP A;  4HJ4 A;  4Y13 A;  3IXB A;  4PPR A;  3HLF A;  4GOG A;  4P87 A;  4EET B;  4KUK A;  4HJ6 A;  3C7V A;  2HV1 A;  2M7U A;  2GZA A;  2VK3 A;  3S7Q A;  2J9P A;  3UNW A;  3U4L P;  3UB5 P;  2H0Y A;  1FSY A;  3QP2 A;  3UPN A;  4Y5F A;  1XGI A;  1G6O A;  2L1M A;  4OQG A;  1KVL A;  2GDN A;  3SZT A;  1BTL A;  3MFX A;  1K54 A;  4MCW A;  3SS5 A;  2VKS A;  1S1Z A;  5EVI A;  3LCE A;  3FZC A;  5CX7 A;  3GVB A;  2GX5 A;  5DFY A;  1P97 A;  3LIF A;  1SHV A;  3RXX A;  3W2Z A;  3F1O A;  2C6W B;  2WAD A;  2L4R A;  1YLW A;  3FG8 A;  4GKU A;  4KG2 A;  4ZBE A;  2J3W A;  1G5U A;  4RQ9 A;  1MWU A;  2V8C A;  2WGV A;  2EWV A;  5CTN A;  4BL3 A;  4NK3 A;  3S7N A;  1DJB A;  5HPF A;  2VGJ A;  2ZQD A;  1W8Y A;  5HFO A;  1SKO B;  4N92 A;  3O5Y A;  1VET B;  3NIA A;  1IKG A;  4EW7 A;  1BZA A;  4GHI A;  3MKE A;  4UEY A;  2HDS A;  2Z6D A;  3UB9 A;  3Q82 A;  2MJ6 A;  1NLY A;  4KQD A;  4WEK A;  1JNU A;  3RH8 B;  1FR6 A;  2PR6 A;  2XSS A;  3N7W A;  1KDW A;  1P9W A;  1MPL A;  3IH8 A;  3OPR A;  1KGF A;  3UMD A;  4R4S A;  4PHT A;  1PZO A;  4PM9 A;  2HZ5 A;  4KZB A;  1OTE A;  2PBY A;  2DCF A;  1VEU B;  2XEP A;  4IHQ A;  2Q9M A;  4M4X A;  4S2L A;  4GS9 B;  2PU2 A;  4X53 A;  4DE3 A;  2HF6 A;  4JXW A;  3UDF A;  4BMW A;  2HJ9 C;  1PWC A;  5EPH A;  4IBR A;  4EEU A;  4BL2 A;  1LL9 A;  4DJ3 A;  5F5Y A;  2HDU A;  2W1R A;  3R7W B;  2NUP C;  3LIB A;  1YLJ A;  2JKT M;  3KYZ A;  1I2S A;  2ZLY A;  2DMW A;  3HBR A;  2Z2L B;  2V1Z A;  4ZRR A;  4B4Z A;  1CEG A;  1Y4O A;  3N4I A;  3OCL A;  3VOZ A;  4S2N A;  5HDD A;  3CIT A;  3B42 A;  4UA9 A;  4MBF A;  3MKF A;  1TS0 A;  2Y2H A;  2IWD A;  3A3E A;  3Q7V A;  4E3L A;  1H3Q A;  4LRY C;  4EES A;  5EV0 A;  4WL9 A;  3GTC A;  4O01 A;  1KGG A;  4L9F A;  5HWV A;  2EX8 A;  3BEC A;  4F94 A;  5CED A;  1XX2 A;  4UAA A;  3NHQ A;  2Y79 A;  4DE1 A;  4PAU A;  3WS1 A;  3Q1F A;  3T1X A;  5GLA A;  4BD1 A;  4B4X A;  1K6S A;  2X01 A;  3IQA A;  3H82 A;  4BQM A;  4C75 A;  1OPX A;  5FAP A;  2M7V A;  4M3K A;  3UE0 A;  2QHK A;  4LRZ E;  1IEM A;  2P04 A;  4PM8 A;  3G31 A;  5AQA A;  1LSX A;  3VSK A;  4GCZ A;  3S22 A;  2B02 A;  2BAS A;  5FL3 A;  3HUN A;  5EEC A;  3HCY A;  4B9O A;  4OPQ A;  4Q0H A;  2R9X A;  3Q07 A;  3HLD A;  1WYB A;  2VV7 A;  3V50 A;  2Y2I A;  4X68 A;  4E3J A;  4R3J A;  3NOU C;  4EUZ A;  1RCJ A;  2WGW B;  4QU3 A;  4HH2 A;  3SS4 A;  3IS2 A;  5E43 A;  2QKP A;  1T18 A;  2A24 A;  5GHY A;  2Q9N A;  2CC1 A;  3AGE A;  5DTK A;  4UA7 A;  5CRF A;  3V67 A;  4Q0I A;  4EEP A;  3A3F A;  3NCK A;  1XFQ A;  3FPV A;  3FPW A;  3C7U A;  4KZA A;  4EBN A;  3QP8 A;  5GHZ A;  4WZ4 A;  4QWO A;  1XP4 A;  3BLM A;  3G4P A;  1PW8 A;  3A0V A;  1E4D A;  5AVE A;  3R4K A;  3MS6 A;  2ZC4 B;  5DTT A;  3EEA A;  5J7E A;  3CG5 A;  5FQJ A;  1BT5 A;  2WK0 A;  5A93 A;  3LY3 A;  1E25 A;  1ERM A;  3B47 A;  4WF0 A;  1HTZ A;  4KZ4 A;  3ISG A;  2ZQA A;  2J7V A;  3FKW A;  1VB6 A;  3IXH A;  5FQK A;  4OOY A;  5G18 A;  4NEE D;  4G3V A;  1N4O A;  3M6H A;  2W1T A;  2Z6C A;  1HLU P;  3L7H A;  3UE6 A;  1PIO A;  1Z6F A;  3RTY A;  1Q2P A;  1OME A;  1ES3 A;  3C5A A;  3EEH A;  4IVI A;  1NRJ A;  4DDY A;  3HUM A;  3QHY A;  3KSH A;  1NZU A;  3EQV A;  1YLY A;  4RX3 A;  2VEA A;  4LCM A;  1GSW A;  3L9K A;  1JVJ A;  1LLB A;  1NWZ A;  3VP4 A;  3HLC A;  2ZL1 A;  3HJK A;  5EVI B;  3MSH A;  3CJM A;  4NKP A;  1K57 A;  4ARZ B;  4I39 A;  4E3I A;  2Y2O A;  1OTD A;  1ESU A;  4KG6 A;  4HI4 A;  1NXY A;  3E2L A;  2JKG A;  3G32 A;  3T12 B;  4E04 A;  5L09 A;  1FSW A;  5FDS A;  3VMA A;  4I5S A;  3ZNT A;  5JYP A;  1YSP A;  2FZ0 A;  2H28 A;  3A0R A;  5FDH A;  1LSV A;  1K4E A;  4OON A;  2VGL S;  4XXR A;  4E3M A;  4IUK A;  3ZG7 B;  2ZC6 B;  3E4O A;  3KYE A;  4Y15 A;  3QP4 A;  3VE4 A;  4H6J A;  4OKP A;  1KE0 A;  3HLG A;  1AXB A;  1NY0 A;  2XRN A;  3KSG A;  5HL1 A;  2Y2L A;  3UDI A;  1S6R A;  4Y3I A;  4DMZ A;  3TRC A;  1K38 A;  1I5Q A;  5DKL A;  1FR1 A;  5KSH A;  4R38 A;  3QP5 A;  1YPR A;  1YT4 A;  3DTE A;  3I7J A;  4P6Z M;  4CQH A;  5F1F A;  3OCN A;  4GB7 A;  1FIK A;  3PTE A;  3SH9 A;  2PHY A;  3T4T A;  4MLL A;  4D60 A;  3GQZ A;  3H7W A;  2OWJ A;  4C6Y A;  2Y2G A;  1PRQ A;  2H0T A;  2QWS A;  4BBV A;  2ACG A;  4CLC C;  3D3O A;  1P0Z A;  3LI9 A;  2JKT I;  1NJ4 A;  3TJZ C;  4XT2 A;  3DTK A;  2V2F F;  3LID A;  3GRJ A;  3T4S A;  3V5M A;  4JGO A;  5M19 A;  4GD8 A;  4UHU A;  5MC7 A;  3VP2 A;  1VM1 A;  3EOI A;  3O87 A;  2XFT A;  5EUA A;  1CQA A;  4B88 A;  3C4O A;  4IUH A;  2V1A A;  3Q7V B;  4NXE A;  1BLH A;  4Z9Q A;  1N9N A;  4MN6 A;  1WA9 A;  1W79 A;  5D3O A;  4I3J A;  3A3D A;  4KZ8 A;  5CHJ A;  1FCO A;  4QY5 A;  1L0E A;  5A91 A;  5FEG A;  1K54 C;  1STZ A;  4BWI A;  1U60 A;  1X0O A;  4X55 A;  1QME A;  5EVI C;  2D02 A;  3OPH A;  4PMA A;  4OH0 A;  1FQG A;  4OOL A;  5FQ9 A;  3UPP A;  1G6A A;  3PBQ A;  5CHM A;  3H82 B;  3WS4 A;  3NEC A;  4WEJ A;  2JKR I;  3T1S A;  4LLO B;  5HZH A;  4KQQ A;  4EQ1 A;  1GHM A;  1FCM A;  5F1G A;  1XJ4 A;  5LBR A;  3IF6 A;  1NLZ A;  4A5R A;  3FWL A;  1L0D A;  4X69 A;  2K2N A;  4OVD A;  3IBR A;  3NJA A;  3BFG A;  1PI4 A;  1S4S A;  3QNC A;  4DXC A;  2VGK A;  2EX2 A;  1K4F A;  2XR0 A;  2ZMA A;  2QJ5 A;  3EGX C;  1S4R A;  4Y0O A;  4IBX A;  4E3N A;  2WKI A;  4C3Q A;  3IX8 A;  2KDK A;  2A24 B;  2O9A A;  2INW A;  1LI9 A;  2GJ3 A;  2I9V A;  4Y17 A;  4WEL A;  2ZD8 A;  3BFE A;  3Q7Z A;  2X02 A;  4JGR A;  2Y55 A;  4DKI A;  2BLS A;  3C30 A;  5EOE A;  2G2W A;  2OLV A;  2XRO A;  3ZYT A;  4IVK A;  1L3L A;  1XKZ A;  3BFD A;  1A0K A;  1OT9 A;  5M1A A;  5M18 A;  2XA7 M;  1LHY A;  4P6Z S;  3QP6 A;  3BYD A;  3D4F A;  2FH5 A;  3TOI A;  3GEC A;  3K3D A;  5TBM B;  1E3U A;  4S2N C;  2O9B A;  1ONH A;  4CLC D;  3LY4 A;  2Y91 A;  4MN5 A;  5HDC A;  1CJF A;  1V9Z A;  3WS2 A;  2EA9 A;  4ID4 A;  2W1T B;  1OJ5 A;  2OAQ 1;  4GDN A;  4LEN A;  3QNB A;  2PT7 A;  2WKP A;  3VOL A;  3M2K A;  3BQA A;  4EXO A;  3BFC A;  1YQS A;  4JF4 A;  3MR0 A;  3VSL A;  4DRT A;  4X25 A;  5HPI A;  1XPB A;  1QMF A;  5I94 A;  5HDS A;  4MBH A;  3HL9 A;  3FYZ A;  5FAO A;  3A0S A;  4S2P A;  3ZG0 A;  1IYP A;  4HNB A;  4HP4 A;  4FCF A;  4QB8 A;  5FAQ A;  3OPL A;  3DW0 A;  2Y2K A;  1UWP X;  1EWZ A;  1YLZ A;  3LUQ A;  1YMS A;  5EVI D;  3MZD A;  1BYW A;  1PWG A;  1ERO A;  4K0X A;  5DKK A;  5HL6 A;  4FSF A;  5EE8 A;  4JXV A;  3TG9 A;  1OT6 A;  3MFD A;  2BG1 A;  3E0Y A;  5DF7 A;  3PR6 A;  1K0K A;  4S2K A;  1IYQ A;  5F6A A;  3IF5 A;  3LO7 A;  3DWK A;  4OLD A;  2YKF A;  3BY9 A;  4I3I A;  5CEC A;  2XFS A;  4H6J B;  2B18 A;  1MC0 A;  4OPZ A;  3UPO A;  5CHU A;  1AWI A;  4OP5 A;  4KZ7 A;  2JHE A;  4EBP A;  4RVA A;  5J3W A;  3ZVW A;  1Y28 A;  2Q0O A;  4S2J A;  3PBN A;  4O0P A;  3MZF A;  5GL9 A;  1IOU A;  2GNX A;  1J9M A;  1XJ2 A;  4E3K A;  3PBS A;  3BEB A;  2IWC A;  1HVB A;  1W5D A;  4QY6 A;  1DP6 A;  3LGO A;  3JVU A;  4JXG A;  3S7P A;  2VGL M;  3MQO A;  4QJG A;  2WUQ A;  4GW9 A;  3MQQ A;  1K55 A;  3F1N A;  4IJG A;  4FOF A;  3ZG9 B;  4NXB A;  4CLC E;  3ULF A;  4U0X A;  2JKR M;  3K3C A;  2JC7 A;  4QHC A;  3T4L A;  3VP0 A;  5A90 A;  1L0G A;  2ZOI A;  5CGX A;  1K56 A;  4WZ5 A;  3VP1 A;  2XA7 S;  3OPP A;  5EM1 A;  2E8I A;  2W3D A;  2O9C A;  3KSI A;  4KG5 A;  2V0W A;  4MEZ A;  3UB6 A;  2WAE A;  5FEF A;  4HBU A;  2DRW A;  1LL8 A;  3E98 A;  4WMC A;  1HZO A;  1H8M A;  3PHY A;  4Z1W A;  5J4E A;  3MF0 A;  3CLO A;  2W0N A;  4R70 A;  2WGI A;  2O99 A;  2ZBB A;  1K57 C;  4R0Q A;  4E3O A;  1CEF A;  1F9I A;  2CMN A;  3WWX A;  2P7J A;  3W8K A;  4LPZ A;  1SZV A;  1BUE A;  1PFL A;  4R4R A;  1D7E A;  4II7 A;  4GLQ A;  3MZE A;  1EI5 A;  3NBL A;  4BD0 A;  4QD4 A;  4CLC B;  3CPT B;  3LYX A;  1UGU A;  3DTI A;  3BLS A;  3W4Q A;  1MKM A;  2HPB A;  1PNE A;  3SH8 A;  2Y2J A;  2P9V B;  1OJG A;  5K5B A;  3ICY A;  3LR4 A;  3C2W A;  4H8R A;  3CUE A;  1OTI A;  1KVM A;  4S2I A; 
#chains in the Genus database with same CATH homology
 1KVL A;  2GDN A;  2ZQ9 A;  1TEM A;  3ZVT A;  1NJ4 A;  2XD5 A;  1BTL A;  3A3I A;  5L2F A;  1O7E A;  2XD1 A;  2A3U A;  1ES4 A;  3PBR A;  4GDB A;  4GNU A;  2V2F F;  1K54 A;  2EX9 A;  1XXM A;  3UE3 A;  3GRJ A;  3SS5 A;  5F82 A;  3V5M A;  4OOM A;  5M19 A;  4GD8 A;  5EVI A;  3LCE A;  4UHU A;  3ITA A;  4HBT A;  3VP2 A;  2HP5 A;  3FZC A;  3GVB A;  2XF3 A;  1VM1 A;  3O87 A;  4RA7 A;  2WKH A;  1DJC A;  2XFT A;  5EUA A;  1SHV A;  3RXX A;  3A3J A;  5DTS A;  4RX2 A;  4B88 A;  1S0W A;  3C4O A;  3IXD A;  5CGS A;  3NY4 A;  2JE5 A;  1SDN A;  2C6W B;  4R23 A;  2WZZ A;  2WAD A;  3G2Y A;  5U47 A;  1XA7 A;  1YLW A;  4NET A;  3Q7V B;  1Q2Q A;  1VQQ A;  2I72 A;  4GKU A;  1RGY A;  1BLH A;  4Z9Q A;  4KG2 A;  2Z2M B;  4ZBE A;  1RP5 A;  2P74 A;  4OPR A;  1MWU A;  1W79 A;  2WGV A;  4EBL A;  2EX6 A;  5CTN A;  5D3O A;  4BL3 A;  4KZ8 A;  3A3D A;  4NK3 A;  5CHJ A;  3S1Y A;  2ZM0 A;  1FCO A;  4Y0T A;  1DJB A;  4QY5 A;  1L0E A;  2X71 A;  2ZQ7 A;  1ZG4 A;  1W7F A;  3PBO A;  5A91 A;  1K54 C;  1KDS A;  2VGJ A;  2ZQD A;  3P98 A;  1MWS A;  1U60 A;  1W8Y A;  4N9K A;  5HFO A;  4X55 A;  4WBG A;  1QME A;  4N92 A;  5EVI C;  3OPH A;  4JPM A;  3NIA A;  4MBK A;  4PMA A;  1M6K A;  1IKG A;  4OH0 A;  1FQG A;  4OOL A;  5FQ9 A;  4KQO A;  3UPP A;  1G6A A;  3PBQ A;  1BZA A;  1YLT A;  3ZHH A;  5CHM A;  4KZ9 A;  3WS4 A;  3ZGA B;  3MKE A;  1GCE A;  2HDS A;  4WEJ A;  3Q82 A;  4ZDX A;  4EV4 A;  1GA9 A;  4WEK A;  3IXG A;  2QZ6 A;  1FR6 A;  3AGF A;  4KQQ A;  4GN2 A;  4S2M A;  5CGW A;  3N7W A;  5KSC A;  1GHM A;  1KDW A;  2WKE A;  1MPL A;  3IH8 A;  3OPR A;  1KGF A;  1FCM A;  3WS5 A;  5F1G A;  4R4S A;  3RJU A;  1PZO A;  2XLN A;  3IF6 A;  4PM9 A;  1I2W A;  2EFX A;  1NYY A;  2JCH A;  4BEN A;  4A5R A;  1MWR A;  4CJN A;  2HDR A;  3FWL A;  4KZB A;  2PBY A;  1L0D A;  2DCF A;  2XEP A;  4P6B A;  1H8Y A;  4X69 A;  4ZTK A;  2Q9M A;  4S2L A;  1PI5 A;  4YFM A;  3V3S A;  4OVD A;  5FQI A;  3N6I A;  2PU2 A;  4Y0U A;  3DTM A;  4X53 A;  3BFG A;  4DE3 A;  3SOI A;  4JXW A;  3UDF A;  4PM5 A;  3HRE A;  1PI4 A;  1PWC A;  5EPH A;  2WAF A;  4IBR A;  5F83 A;  3QNC A;  1Y54 A;  3NI9 A;  4BL2 A;  1FOF A;  1LL9 A;  4OQ0 A;  4DXC A;  2RL3 A;  2HDU A;  2EX2 A;  2VGK A;  2G2U A;  1K4F A;  4U3T A;  4Q8I A;  1MWT A;  2XR0 A;  1BUL A;  2ZMA A;  3IF6 B;  4K91 A;  1MKI A;  5HX9 A;  1YLJ A;  1I2S A;  2V20 A;  4Y0O A;  1TDL A;  2OLU A;  2ZLY A;  1JWZ A;  3HBR A;  4IBX A;  3ZFZ A;  2Z2L B;  4E3N A;  2V1Z A;  1W8Q A;  4B4Z A;  1CEG A;  1DJA A;  4U0T A;  2WKI A;  3N4I A;  3OCL A;  3VOZ A;  4C3Q A;  4S2N A;  4ZJ2 A;  3IF6 C;  4Y7P A;  4EWF A;  3ZG8 B;  4UA9 A;  1SDE A;  4MBF A;  3MKF A;  1LI9 A;  4E6X A;  2Y2H A;  2IWD A;  3A3E A;  1SCW A;  2EXA A;  5IHV A;  1KGE A;  4WEL A;  3Q7V A;  2ZD8 A;  3BFE A;  3Q7Z A;  1NRF A;  4E3L A;  2X02 A;  4JXS A;  5FSR A;  2Y55 A;  5FQM A;  4DKI A;  1K56 D;  2BLS A;  3GTC A;  5EOE A;  1KGG A;  3NDG A;  1YLP A;  2G2W A;  5AQ7 A;  1RGZ A;  2EX8 A;  3BEC A;  2OLV A;  3CZD A;  4F94 A;  5CED A;  1XX2 A;  4P85 A;  1ZC2 A;  4UAA A;  4E6W A;  3S4X A;  4IVK A;  1XKZ A;  3BFD A;  3E2K A;  3G2Z A;  3SH7 A;  4DE2 A;  4DE1 A;  3WS1 A;  3Q1F A;  1KE4 A;  1N9B A;  4DXB A;  5M1A A;  5M18 A;  5GLA A;  4BD1 A;  3G34 A;  3IH9 A;  3IHB A;  1LHY A;  2ZM8 A;  4B4X A;  3IHA A;  3BYD A;  1C3B A;  1K6S A;  3D4F A;  4R3B A;  4WMC D;  3TOI A;  5KMW A;  2RCX A;  4GD6 A;  2X01 A;  1E3U A;  3IQA A;  1LI0 A;  4BQM A;  3UN7 A;  4UA6 A;  4S2N C;  2ZJ9 A;  1BSG A;  5FAP A;  4C75 A;  1ONH A;  4M3K A;  3UE0 A;  3LY4 A;  1WE4 A;  2IWB A;  1IEM A;  2Y91 A;  5E2F A;  2QPN A;  1KE3 A;  1PW1 A;  4PM8 A;  1G68 A;  3G31 A;  5AQA A;  3OC2 A;  3VSK A;  1M40 A;  2FFF B;  3WS2 A;  3TSG A;  3S22 A;  1MXO A;  3WS0 A;  4ID4 A;  3VFF A;  4WM9 A;  5E2H A;  3ZCZ A;  2DNS A;  4PM6 A;  4X56 A;  2J9O A;  2XK1 A;  2ZQC A;  5FI6 A;  1PWD A;  3P09 A;  4GDN A;  5FA7 A;  3HLW A;  3HUN A;  4LEN A;  3QNB A;  4N1H A;  1CI8 A;  2PU4 A;  5EEC A;  1ZKJ A;  4N9L A;  1L2S A;  1O07 A;  3M2K A;  3ZDJ A;  3BFC A;  1YQS A;  4OPQ A;  4JF4 A;  1MY8 A;  3VSL A;  5DF9 A;  2WZX A;  3GSG A;  4LV3 A;  4OPY A;  4DRT A;  2R9X A;  2C5W B;  2UWX A;  1XPB A;  1QMF A;  5I94 A;  4JKT A;  3Q07 A;  4MBH A;  3HL9 A;  3FYZ A;  4R1G A;  3HLD A;  1WYB A;  5FAO A;  4OQI A;  4S2P A;  2HP9 A;  3V50 A;  2Y2I A;  3ZG0 A;  2A49 A;  1IYP A;  4X68 A;  4E3J A;  5BOH A;  1GA0 A;  4FCF A;  5DVA A;  4QB8 A;  5FAQ A;  1GHI A;  1ES5 A;  3FKV A;  4R3J A;  1BLC A;  3OPL A;  1RCJ A;  2WGW B;  4GZB A;  4EUZ A;  3MXS A;  4QU3 A;  3UDX A;  3DW0 A;  2Y2K A;  3SS4 A;  3GR2 A;  4FD8 A;  5CXW A;  5E43 A;  1ERQ A;  1EWZ A;  2Y2M A;  5GHX A;  5GHY A;  2XH9 A;  2Q9N A;  1YLZ A;  3BFF A;  3C4P A;  3Q81 A;  2CC1 A;  3AGE A;  1YMS A;  4UA7 A;  5DTK A;  1YMX A;  5EVI D;  3MZD A;  1IYS A;  3ITB A;  5CRF A;  4O7D A;  3LEZ A;  1LL5 A;  1PWG A;  3NC8 A;  1ERO A;  4K0X A;  3N8R A;  4FSF A;  5EE8 A;  4JXV A;  5E2E A;  3TG9 A;  4KZ5 A;  3A3F A;  3MFD A;  3PAE A;  3PAG A;  2BG1 A;  3NCK A;  5DF7 A;  4XUZ A;  2HDQ A;  4S2K A;  1BLS A;  1IYQ A;  5TR7 A;  2ZM2 A;  3C7U A;  3GV9 A;  4KZA A;  2Y2P A;  4EBN A;  3N8L A;  1PYY A;  5GHZ A;  2FFY A;  4WZ4 A;  4XUX A;  4X6T A;  3W4P A;  1XP4 A;  3BLM A;  3G4P A;  3IF5 A;  1PW8 A;  4MNR A;  1E4D A;  1IYO A;  3LO7 A;  3DWK A;  4K0W A;  4OLD A;  4LV0 A;  2J8Y A;  3BM6 A;  3MBZ A;  2ZC4 B;  5DTT A;  4DDS A;  5CEC A;  3VOY A;  3CG5 A;  5FQJ A;  1BT5 A;  3HVF A;  5CTM A;  2XFS A;  4OPZ A;  2EXB A;  5HAR A;  3UPO A;  2WK0 A;  5CHU A;  2Y4A A;  3LY3 A;  5A93 A;  3PBT A;  4OP5 A;  1E25 A;  4KEN B;  1ERM A;  2XQZ A;  4IED A;  3O3V A;  1HTZ A;  4KZ7 A;  4EBP A;  5E2G A;  4RVA A;  3O86 A;  3ISG A;  2ZQA A;  4KZ4 A;  5EOO A;  2J7V A;  3VFH A;  3ZVW A;  3FKW A;  4KZ6 A;  1H8Z A;  4LCL A;  3IXH A;  5FQK A;  3EQU A;  4S2J A;  4S2O A;  4OOY A;  3PBN A;  1K25 A;  3MZF A;  3OZH A;  5G18 A;  2HP6 A;  4FH2 A;  1N4O A;  3M6H A;  2QMI A;  5GL9 A;  5GLC A;  1DY6 A;  5A92 A;  4JLF A;  1IKI A;  1JWV A;  1PIO A;  1Z6F A;  1J9M A;  3FV7 A;  1Q2P A;  3VP3 A;  4E3K A;  4FH4 A;  1OME A;  1ES3 A;  4OP8 A;  3C5A A;  3PBS A;  1IEL A;  4PM7 A;  5AQ9 A;  3BEB A;  4IVI A;  2IWC A;  1FCN A;  1HVB A;  3IWQ A;  1W5D A;  2ZQ8 A;  4LV1 A;  4QY6 A;  4DDY A;  3HUM A;  3QHY A;  3RXW A;  4JXG A;  3WRT A;  3M2J A;  4HES A;  5HAP A;  1NZU A;  1WYC A;  3EQV A;  5FQQ A;  1YLY A;  4RX3 A;  4S2I A;  5DF8 A;  1CI9 A;  4LCM A;  5HAI A;  4QJG A;  2WUQ A;  4ZJ1 A;  1K55 A;  3BRM A;  3B3X A;  4HEF A;  3ZG9 B;  1CK3 A;  3IWI A;  1ONG A;  2ZC7 A;  4U0X A;  5TGF A;  1JVJ A;  3W4O A;  1LLB A;  3G35 A;  3VP4 A;  5GLD A;  5AQB A;  2WGW A;  3HLC A;  2JC7 A;  3IWO A;  5HW3 A;  2OSU A;  3AGD A;  4JF6 A;  4QHC A;  4ZJ3 A;  5EVI B;  3CJM A;  1K57 A;  3VP0 A;  5A90 A;  1L0G A;  1TDG A;  4N1X A;  5FI2 A;  2Y2O A;  3M6B A;  3IT9 A;  4E3I A;  1H5X A;  1NYM A;  1ESU A;  1ALQ A;  3UO9 A;  3V3R A;  3UY6 A;  2ZC3 B;  4KG6 A;  1NXY A;  5FAS A;  5CGX A;  4CPK A;  1K56 A;  3E2L A;  4WZ5 A;  1BLP A;  3VP1 A;  3G32 A;  3HLB A;  4OQH A;  4RYE A;  3OPP A;  3GMW A;  1FSW A;  2XDM A;  4EQI A;  1ZG6 A;  2E8I A;  1ESI A;  4JF5 A;  3VMA A;  4KG5 A;  5JYO A;  2B5R A;  4MEZ A;  1SKF A;  3ZNY A;  5FAT A;  2EFU A;  4D2O A;  2H10 A;  2WAE A;  3ZNT A;  5JYP A;  3MXR A;  1HD8 A;  3HLE A;  5FDH A;  4HBU A;  2DRW A;  4BLM A;  2WYX A;  1K4E A;  4OON A;  1JWP A;  4XXR A;  4WYY A;  4E3M A;  1K55 C;  3CMZ A;  4OLG A;  4WMC A;  3ZG7 B;  1HZO A;  2R9W A;  2ZC6 B;  1JTD A;  2Y59 A;  3O88 A;  3DWZ A;  4ZAM A;  1L0F A;  2JBF A;  4KZ3 A;  4JBF A;  2WGI A;  4OKP A;  1KE0 A;  3HLG A;  1K57 C;  1AXB A;  1NY0 A;  4DF6 A;  5HAQ A;  4R0Q A;  4E3O A;  1CEF A;  5HL1 A;  3WWX A;  2XGN A;  5FI7 A;  3W8K A;  1XA1 A;  2Y2L A;  3N8S A;  5EVL A;  2P9V A;  4L0L A;  1TVF A;  5J8X A;  1K6R A;  3UDI A;  1S6R A;  4WZ5 C;  5GLB A;  4LV2 A;  1BUE A;  1K38 A;  2Y2Q A;  4BJP A;  1I5Q A;  1JTG A;  3UE1 A;  1FR1 A;  4R4R A;  5TFQ A;  1E3U D;  3NDE A;  4KQR A;  5KSH A;  5CEB A;  1GHP A;  1YM1 A;  3IXB A;  1YT4 A;  3HUO A;  1ES2 A;  4PPR A;  3HLF A;  4GOG A;  4P87 A;  3I7J A;  3MZE A;  5KZH A;  1EI5 A;  3NBL A;  5F1F A;  3OCN A;  4BD0 A;  4QD4 A;  2Y2N A;  4GB7 A;  1PZP A;  4P0M A;  3PTE A;  3SH9 A;  2OV5 A;  4MLL A;  3G30 A;  3C7V A;  3GQZ A;  4C6Y A;  1XGJ A;  2Y2G A;  3BLS A;  2H0T A;  3W4Q A;  3WRZ A;  3V39 A;  2HPB A;  3SH8 A;  3ZG5 A;  4DE0 A;  2J9P A;  2Y2J A;  1NZO A;  2H5S A;  2P9V B;  2ZC5 B;  3UNW A;  2H0Y A;  4YIN A;  5CER A;  1FSY A;  4H8R A;  3UPN A;  3JYI A;  3SS3 A;  1MBL A;  1XGI A;  1KVM A;  4OQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...