4Y0OA

Crystal structure of oxa-58, a carbapenem hydrolyzing class d beta-lactamase from acinetobacter baumanii.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
242
Chain Sequence
SIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Active-Site Plasticity Is Essential to Carbapenem Hydrolysis by OXA-58 Class D beta-Lactamase of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 70
structure length 242
sequence length 243
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4y0oA00
4EV4A 4PM5A 3FZCA 1W79A 2EXBA 5CHJA 4WZ4A 2QZ6A 2ZQ9A 1Y54A 4JPMA 1SCWA 3CJMA 3LEZA 1IYSA 3IF6B 2PU4A 2G2UA 4ZDXA 2JBFA 3IHBA 5HL1A 1XGJA 1GCEA 4LV3A 1GA9A 4EBPA 3OPRA 3AGEA 2EFUA 4N9LA 1JVJA 3HUOA 4XUZA 3IXHA 1PWDA 1NJ4A 2A49A 4R3JA 1E25A 3MKFA 4GOGA 2ZQDA 2H0TA 3BLMA 4N92A 4Q8IA 4R1GA 5E2FA 2ZJ9A 4CPKA 2V2FF 1I5QA 4S2MA 4UA7A 3SS3A 3QNCA 2G2WA 3DWZA 4JXSA 4OQGA 2WGWB 2EX9A 3A3IA 2EX2A 1YM1A 2FFFB 2RCXA 3BECA 4R4RA 1HD8A 3V3RA 4PM7A 3Q81A 1K4EA 3BFGA 3BFDA 4WZ5C 5J8XA 4C75A 2J8YA 4ZJ1A 5CERA 1YQSA 2Y2QA 5AQ7A 1ESUA 2IWBA 3JYIA 3A3DA 5TFQA 4QJGA 1G68A 2WAFA 5HARA 3Q1FA 4S2IA 2XFTA 4A5RA 3SH9A 1FSWA 1PI5A 3WRTA 1ES5A 2Y55A 3ZDJA 4S2OA 3HLGA 2RL3A 1KVMA 1ZG6A 4MEZA 5EOEA 3G30A 4Y7PA 4FSFA 5DF7A 3OCLA 3SS4A 4XXRA 1M40A 5EE8A 3IH8A 2R9WA 4WBGA 4B88A 4ZJ3A 5CGWA 1KGFA 4HBUA 3QNBA 2Y2IA 3IWIA 3MZEA 3Q07A 2HP9A 2V1ZA 4KQRA 3WWXA 1BLCA 1BLPA 5EUAA 5FI2A 4OPYA 4LCLA 1K38A 3VP3A 3ZHHA 2UWXA 2XD1A 1U60A 1YLWA 4OOLA 4PPRA 2Y2HA 1FSYA 5JYOA 3ZNYA 3NIAA 4QU3A 2Y2MA 3ZGAB 4BL2A 3PBTA 1YMXA 5F82A 4DE1A 4JXGA 4OOYA 2CC1A 3OZHA 1FR1A 4KZ6A 4IBXA 1CI8A 2X02A 2OV5A 5DF8A 5KZHA 1HZOA 2H0YA 3LY3A 3FV7A 3UO9A 5TGFA 5EPHA 3UPOA 3IWQA 5DTKA 4JF4A 3P09A 1YLZA 4UHUA 4EWFA 1LI9A 3SS5A 3ZVWA 5EECA 3FWLA 3GMWA 1L0FA 4YFMA 4BJPA 1MWUA 4H8RA 4Y0OA 2XF3A 5F1GA 1L2SA 4KZ5A 5GL9A 1Q2PA 2Q9NA 4K0WA 4P0MA 3VSLA 1KE0A 4OQHA 1VQQA 4S2JA 4DXCA 1ZG4A 4BQMA 1JTGA 4X68A 3IXDA 3S1YA 3MBZA 4X53A 4F94A 3Q7ZA 2WGIA 1GHMA 1NXYA 4FCFA 4MBHA 1YMSA 2QPNA 3PAEA 3PBSA 3TOIA 4IVIA 1ALQA 1K57A 3IF6A 5GLBA 1K56D 4OLDA 1K54A 1IKGA 3WS4A 4JXWA 1K6RA 4JF5A 4OONA 1QMEA 4PM9A 3V3SA 2EX8A 2JC7A 2WKEA 4JF6A 2PU2A 3HBRA 3W4QA 1BLSA 1RGYA 2J9PA 1G6AA 1XGIA 1FR6A 3G34A 3PBNA 1ERMA 4R23A 1KE3A 3N8SA 2ZC3B 3UY6A 3A3JA 5EVID 3V39A 5A93A 1TDGA 2XEPA 3ZG0A 3UPPA 5D3OA 2ZMAA 3WS1A 5I94A 1K55A 4DKIA 3RXXA 3OPPA 1Q2QA 5EVLA 3N8RA 1BLHA 1MWRA 1BSGA 4N1XA 3O88A 1ERQA 4OPZA 2IWCA 5FI6A 5FQIA 5KSHA 1ONHA 3OPLA 2Y2PA 3C5AA 3UE3A 2ZC4B 4HEFA 4N1HA 4KG2A 3VP4A 2WZZA 4RA7A 3EQVA 2HP6A 4OPQA 1IYOA 3E2KA 4KQOA 4OH0A 4U0XA 3G2ZA 5CGXA 4DRTA 4K91A 3HLWA 3VMAA 3VP2A 4RX2A 2WYXA 2XH9A 2FFYA 4KZBA 4Z9QA 4KZ3A 1SHVA 3TG9A 3UDFA 5KMWA 1E4DA 1ES2A 4KZ8A 5DTTA 4WMCD 4BENA 1XX2A 4WZ5A 3IF5A 1EWZA 3PAGA 1EI5A 4HBTA 4P85A 2I72A 4OLGA 2ZD8A 5FQKA 4PM8A 4S2NA 4GD6A 4P87A 3ISGA 3AGDA 4B4XA 3RXWA 4LV0A 1KGEA 1LI0A 3NDEA 5A91A 1KE4A 1PIOA 3FKVA 4ID4A 4R0QA 3W8KA 1IEMA 2HDRA 1YT4A 1IKIA 4GDNA 1CEFA 5CTMA 3V50A 4DDYA 4S2PA 3ZCZA 3LO7A 1ESIA 3HLBA 4Y0TA 5CEDA 4GNUA 3BRMA 4C6YA 5AQAA 2PBYA 2ZM2A 1W8QA 2XFSA 2ZQCA 4MLLA 3G2YA 5FQQA 5GHXA 1NY0A 3MKEA 1EROA 1PW8A 1ES4A 4QY5A 2DNSA 1NZOA 4K0XA 5GLDA 1RCJA 3C7VA 4WELA 2Q9MA 3MFDA 3HLCA 3O3VA 4ZJ2A 5GLAA 4HESA 3M6HA 4C3QA 5F1FA 4GD8A 1K6SA 3GSGA 4FD8A 4PM6A 1PW1A 2XDMA 3NBLA 5FQJA 5FATA 4X56A 1GA0A 5U47A 5L2FA 2J7VA 3HREA 4OOMA 5HFOA 3P98A 4P6BA 4E3MA 1E3UA 2ZLYA 4OKPA 2P74A 1WYCA 4OQ0A 5GLCA 2X01A 1MWSA 4LENA 1FOFA 3GVBA 1J9MA 1FCNA 1PI4A 3DWKA 3GRJA 1BULA 2C5WB 2H10A 3SH8A 3VOZA 2OSUA 1LL9A 1BUEA 2EX6A 5FAOA 1CI9A 3LY4A 3S4XA 3BFEA 5CEBA 4E6XA 2Y2GA 1KVLA 3O86A 1L0EA 1JWVA 2WUQA 2B5RA 2Y2OA 3G32A 3MXSA 5DVAA 1K56A 1DJCA 2WKHA 4JLFA 4DE0A 3G4PA 1JTDA 5DTSA 5E2EA 2HDSA 1ES3A 3LCEA 3PBQA 3UDIA 1ONGA 1K25A 2OLVA 5HAQA 1YLTA 3MXRA 1CEGA 1L0DA 5FQMA 3PBRA 1W7FA 1JWPA 2P9VB 3CMZA 4O7DA 1ZC2A 4GKUA 2EXAA 2Z2MB 3D4FA 2J9OA 2R9XA 5E2HA 4ZAMA 2DCFA 1L0GA 4JXVA 3WS2A 4EQIA 1SDNA 3IHAA 3BLSA 1TDLA 3UPNA 1DJBA 4GDBA 3N7WA 3VFHA 5EVIC 3MZDA 1YLPA 3C7UA 1MWTA 3M2JA 4E3IA 3G35A 5A90A 3N6IA 4JBFA 4YINA 2VGJA 2VGKA 4QD4A 5F83A 3N8LA 4KQQA 5HX9A 3ZG5A 4GB7A 4IEDA 3M2KA 1QMFA 4E3OA 3B3XA 1Z6FA 3CG5A 5CXWA 1HTZA 3ZFZA 5CRFA 2ZQ8A 1DY6A 3HL9A 2ZM0A 4KG6A 4S2KA 1K57C 2XD5A 3CZDA 3HVFA 3IF6C 2JE5A 4NETA 4FH2A 4E3JA 3C4OA 1I2SA 1MKIA 3PTEA 1NZUA 2C6WB 1H8YA 3UNWA 1WE4A 5DF9A 4CJNA 4WMCA 3FKWA 3M6BA 4MBKA 1XA1A 4E3NA 3ITAA 3IXGA 3HLDA 3N4IA 1S6RA 4WM9A 5M18A 2Y2JA 2V20A 3IT9A 1M6KA 1ZKJA 5A92A 4X69A 1MY8A 5CTNA 1BT5A 4WEJA 3GV9A 3HLFA 4S2LA 2WAEA 3V5MA 4Y0UA 2QMIA 5JYPA 3QHYA 3DTMA 2ZC6B 1K55C 1KGGA 4WYYA 2WADA 3GTCA 3NY4A 5HAIA 1GHPA 3AGFA 3BFCA 4GZBA 4LCMA 3UE0A 4BD1A 1XA7A 5GHYA 1AXBA 3ZVTA 2XQZA 3G31A 1N4OA 5FASA 2Y2LA 3E2LA 3MZFA 4EBNA 3IH9A 4LV2A 2WZXA 2Y4AA 2X71A 1BTLA 5FAPA 4OPRA 2Y2NA 5GHZA 4KG5A 4KENB 2HPBA 3VSKA 2BG1A 2HDUA 2XK1A 2A3UA 1MBLA 3NI9A 1K4FA 4DE3A 3UDXA 5BOHA 1NYMA 5CHUA 5HAPA 3BYDA 1SDEA 1HVBA 1TEMA 3OC2A 3WS0A 4QY6A 4FH4A 1W5DA 3BEBA 5CECA 3UN7A 1XXMA 2ZC7A 3NCKA 4DF6A 4DDSA 5G18A 2HP5A 3OCNA 3PBOA 3ITBA 3HUNA 2P9VA 4S2NC 1OMEA 5EOOA 5KSCA 1O7EA 3GR2A 3I7JA 1XKZA 4X6TA 1W8YA 4U0TA 4BL3A 2ZM8A 1O07A 1YLJA 1C3BA 4RX3A 1GHIA 3VOYA 4WEKA 4EUZA 1IYPA 3WS5A 4IBRA 3C4PA 1PZPA 1JWZA 4NK3A 5TR7A 3NC8A 1I2WA 5FQ9A 1NYYA 3RJUA 4RVAA 4N9KA 3W4OA 3HLEA 4DE2A 3EQUA 3TSGA 5FDHA 1H8ZA 1FCOA 4QB8A 3BM6A 3NDGA 1FQGA 4D2OA 2ZC5B 5FAQA 2H5SA 4KZ4A 3BFFA 1IELA 5HW3A 3IQAA 1SKFA 4L0LA 1XP4A 3HUMA 1RGZA 4UAAA 2ZQ7A 3VP0A 4KZ7A 3A3FA 2ZQAA 4JKTA 4QHCA 4E3LA 3GQZA 4RYEA 2WK0A 4ZTKA 4R3BA 2XR0A 1XPBA 1IYQA 3Q7VA 3ZG7B 4BD0A 1PZOA 3A3EA 1MPLA 1KDSA 5AQ9A 5EVIA 1PYYA 2Y2KA 3VFFA 3W4PA 4E3KA 5FSRA 1PWCA 3VP1A 2Z2LB 2HDQA 1E3UD 4PMAA 5FA7A 3WRZA 1RP5A 1TVFA 4IVKA 2Y59A 1PWGA 1LLBA 4X55A 3ZG9B 5CHMA 4EBLA 1N9BA 1VM1A 4MNRA 5IHVA 3Q82A 5FI7A 4UA6A 4ZBEA 2XLNA 2DRWA 1CK3A 1FCMA 3IWOA 1YLYA 4B4ZA 2BLSA 4OP8A 3O87A 4R4SA 3ZNTA 1NRFA 3OPHA 4MBFA 2Y91A 1DJAA 3SOIA 2GDNA 3IXBA 4LV1A 1MXOA 1S0WA 2XGNA 5CGSA 5E2GA 1BZAA 2WGVA 3DW0A 4M3KA 2JCHA 5AQBA 5M1AA 2E8IA 3Q7VB 1K54C 3ZG8B 4UA9A 4OP5A 4XUXA 3UE1A 3FYZA 2EFXA 5E43A 5EVIB 4E6WA 2IWDA 4DXBA 4KZ9A 1LL5A 3S22A 4OVDA 3SH7A 1H5XA 2WGWA 2WKIA 1KDWA 2OLUA 4GN2A 1WYBA 4OQIA 1LHYA 4U3TA 5M19A 4KZAA 4BLMA
chains in the Genus database with same CATH superfamily
1IFQA 4PM5A 3FZCA 2QZ6A 2WKPA 3CJMA 2W1TA 2G2UA 1TS7A 5HL1A 3V67A 1GCEA 2VX8A 4EBPA 3AGEA 5EM1A 1PWDA 4R3JA 1E25A 3H7WA 3MKFA 3T1QB 3VE3A 4CPKA 1I5QA 4CLCE 3QNCA 2G2WA 4JXSA 2FFFB 3T4KA 2JKGA 1HD8A 2K7SA 4WZ5C 3BFDA 1G6OA 2J8YA 4HH3A 3MR0A 1YQSA 2OAP1 1ESUA 3JYIA 5TFQA 2V0UA 4QJGA 4KUOA 1TS6A 5HARA 1F2KA 2XFTA 4A5RA 4E3LA 1Z09A 4Y7PA 1M40A 5EE8A 4HBUA 4HIAA 2Y2IA 3LYXA 3IWIA 2HP9A 4IJGA 5FI2A 5EUAA 3IBJA 1XFNA 2XD1A 4OOLA 1P9RA 4BL2A 3OOVA 4Q0JA 4DE1A 4OOYA 3OZHA 4I39A 4R3AA 2OV5A 3KSFA 3LY3A 2P7JA 3UO9A 3UPOA 3IWQA 3LFVA 3P09A 3SS5A 3ZVWA 5EECA 3JVUA 1MWUA 4H8RA 4Y0OA 2XF3A 3VSLA 1KE0A 3MBZA 4LPZA 3B42A 2L0WA 4O01A 4NXGA 4MBHA 1YMSA 4JGPA 1ALQA 1K56D 4OLDA 1K6RA 4JF5A 4PM9A 3V3SA 2EX8A 4JF6A 1BLSA 1G6AA 3EEAA 5C5KA 3PBNA 4R23A 1KE3A 3N8SA 3UY6A 3A3JA 2BTFP 4GCZA 1TDGA 4LRYC 3ZG0A 3UPPA 5HPFA 5MC7A 2QKPA 3UB8A 3OPPA 1Q2QA 1MWRA 2PYRA 1ERQA 4OPZA 5FI6A 5FQIA 4HEFA 4EUVA 2WKQA 2WZZA 3T50A 4RA7A 4HJ4A 4OPQA 1IYOA 2Y8HA 1F9IA 4DRTA 3VMAA 2XH9A 1P0ZA 3K3DA 1OTAA 1ES2A 4KZ8A 5DTTA 3RXWA 3S7QA 1KE4A 2XRNA 5CTMA 1YT4A 1IKIA 1CEFA 3NOPC 3EOIA 4LGWA 4WLAA 5CEDA 4GNUA 4C6YA 5AQAA 2INWA 4UEYA 3F1OA 2JKRM 3MFDA 1S67L 1K6SA 4FD8A 3NBLA 1N9OA 4X56A 1GA0A 5U47A 3P98A 1MWSA 3PR6A 5EM0A 4HY8A 3GVBA 2P04A 3GRJA 3SH8A 5FAOA 1BUEA 2VGLS 3BFEA 5CEBA 4YNRA 1L0EA 3G32A 2Y2OA 5DVAA 1K56A 2WKHA 2B95A 3HJIA 3UDIA 1ONGA 1DRMA 1T1CA 3U2AA 5DKLA 1YLTA 2P9VB 2HGVA 5IT5A 3E4QA 2R9XA 4ZAMA 4EQIA 1SDNA 1DJBA 4AFIA 2JKRI 2JKFA 3CI6A 5EVIC 1YLPA 1OTDA 3C7UA 4R38A 2VGJA 2O9BA 2VGKA 5LBRA 4IEDA 3ULFA 3VOLA 1NLYA 2J80A 1DP9A 1Z6FA 3CG5A 3TW8A 4KG6A 3RTYA 4WUJA 2C6WB 1JNUA 5DF9A 4CJNA 3LR5A 1XA1A 4E3NA 2Q0OA 3S7PA 4YOFA 2A24B 2JKTI 4LRXC 1PNEA 3IT9A 4X69A 4HOIA 2W3FA 4HHDA 4EEUA 3V5MA 2DMWA 3QHYA 3DTMA 2WADA 5IU1A 1GHPA 3UE0A 4X25A 5GHYA 3G31A 5FASA 3MZFA 2ZL1B 2Y2NA 3NI9A 4DE3A 3UDXA 4BBUA 1HVBA 3MS6A 3OC2A 5DFXA 4FH4A 1W5DA 1XXMA 2ZC7A 4G3VA 2HP5A 3HUNA 2W1TB 5EOOA 1OMEA 5HL6A 3I7JA 1XKZA 4BMWA 1W8YA 2ZM8A 4DJ3A 1YLJA 1C3BA 4RX3A 1IOUA 3WS5A 3D3OA 1VETA 3C4PA 5HDSA 1I2WA 1F5MA 4B9OA 3HLEA 3EQUA 5FDHA 2V8FA 4D2OA 4KZ4A 1IELA 5HW3A 2HJ9C 3HUMA 1RGZA 2ZQ7A 4JKTA 4QHCA 3ZG7B 2O9AA 5I5LA 1MPLA 3CAXA 1PYYA 5L10A 4Q0IA 1PWCA 3VP1A 2Z2LB 2HDQA 5FA7A 4IVKA 2Y59A 1PWGA 4ETZA 1LLBA 3VE4A 1N9BA 4UA6A 2XLNA 3C30A 1FCMA 5HWWA 3OLOA 1GSVA 5L07A 4R4SA 3ZNTA 4R6LA 3OPHA 3A0SA 1TD5A 4LV1A 1MXOA 5CGSA 2XGNA 5E2GA 5AJGA 5M1AA 1VEUB 2E8JA 1K54C 2HJEA 5FEFA 4UA9A 5F5YA 2VKSA 5EVIB 1LL5A 3S22A 2NUPC 4GN2A 1LHYA 1CQAA 4BBVA 4OPYA 4BLMA 4EV4A 1ACFA 2JBFA 3IHBA 1XGJA 5HD5A 3HUOA 2J3WA 2PAVP 2ZQDA 4GOGA 4N92A 4R1GA 3BJNA 4S2MA 1YM1A 3BECA 4EESA 4PM7A 3BFGA 5J8XA 4C75A 3LIDA 5F68A 2MJ6A 2YKFA 1G68A 5L8MA 2PBDP 2Y55A 5EOEA 2O0YA 3OCLA 4XXRA 2R9WA 5CGWA 1KGFA 3Q07A 3MZEA 3WWXA 2V1ZA 4M4XA 2W3DA 3FG8A 1FIKA 3FC7A 1H0MA 1YLWA 4PPRA 1N9LA 2Y2HA 3ZNYA 4QU3A 1CI8A 2X02A 4L9GA 1CF0A 5DTKA 1H8MA 4GHIA 4UHUA 4EWFA 3FWLA 3W2ZA 2ZMFA 5F1GA 1L2SA 1Q2PA 1T19A 5HZHA 1ZG4A 2K2NA 3F1OB 3IXDA 4F94A 3Q7ZA 4CLCD 1GHMA 1NWZA 4FCFA 2QPNA 3PBSA 3TOIA 1LSXA 4IVIA 3IF6A 3WS4A 3T4SA 4OONA 2JC7A 2PU2A 3HBRA 1F98A 4YWZA 1FR6A 1ERMA 2ZC3B 1ZHHB 5EVID 3V39A 3UMDA 1OT9A 3IBRA 3LEQA 4EW7A 3WS1A 5I94A 5DJUA 3TE8A 1BSGA 3FPVA 3ZYTA 1ONHA 2Y2PA 4N1HA 1K0KA 4MN7A 2HP6A 3G2ZA 1UWNX 5CGXA 4K91A 3HLWA 4H6JB 4HJ3A 2FFYA 3TJZC 1E4DA 3LIAA 4JGOA 2K31A 3PAGA 4BBTA 4HBTA 4P85A 4S2NA 4P87A 1KGEA 3F1PA 3T4TA 1PIOA 3R4KA 2ZOIA 4ID4A 3W8KA 3JPUA 4S2PA 3EGXC 1XFQA 3KSGA 2PBYA 3KYQA 5GHXA 1NY0A 3MKEA 1NLZA 4QY5A 5GLDA 4K0XA 4LRZE 1S1ZA 4ZJ2A 3HLCA 4HESA 5F1FA 4GD8A 2OOLA 3GSGA 5FQJA 1TS8A 4UQIM 5L2FA 3D9YA 5HFOA 4P6BA 4E3MA 2ZLYA 1WYCA 2J3TC 4LENA 3DWKA 1PI4A 2OSUA 1LL9A 1CI9A 4E6XA 2VZWA 2Y2GA 1MC0A 3CUEA 5FDSA 4DE0A 2KX6A 4JLFA 2HV1A 2HZ5A 3G4PA 1JTDA 3PBQA 1XJ4A 4PHTA 2R78A 5HAQA 4O8GA 5FQMA 1L0DA 3SW1A 3PBRA 1W7FA 4EXOA 4O7DA 4GKUA 4E04A 2Z2MB 2J9OA 4JXVA 1VETB 3QP8A 3BLSA 2O99A 3T4OA 3VV4A 3UPNA 3BW6A 4P6ZS 2UV0E 3NOTC 3MF0A 3N6IA 3MMHA 4IUHA 4QD4A 1LSWA 4HJ6A 3H9WA 4X1LA 3M2KA 2D01A 1QMFA 4E3OA 5CRFA 3IF6C 5G4YA 2JE5A 3C4OA 1I2SA 1MKIA 2L4RA 1NZUA 1H8YA 3ITAA 3R7WA 4GS9A 2V20A 3B47A 3T4JA 1MY8A 4WEJA 3GV9A 3RFBA 4DMZA 4Y0UA 2QMIA 5JYPA 2ZC6B 3GTCA 3IS2B 3BFCA 3DAVA 1D7EA 1YAXA 2QYBA 1P97A 1AXBA 3ZVTA 3CITA 3F1NB 4LV2A 5FAPA 4OPRA 2XA7M 2BG1A 2A3UA 2EWVA 5HAPA 3O5YA 1H3QA 3WS0A 3OBFA 4QY6A 1YPRA 3BEBA 3UN7A 3D72A 4DF6A 5G4ZA 5G18A 3PBOA 4S2NC 5KSCA 4WN5A 3QP2A 4F3LB 3BY9A 3P01A 1GHIA 3VOYA 4IBRA 4WL9A 5FQ9A 1OPXA 4HH2A 4K08A 3T4QA 3S7NA 1FCOA 1FQGA 2XROA 2ZC5B 5FAQA 2BASA 4MMNA 2VA0A 4RQ9A 2JKTM 1S4RA 3GDIA 4ZRRA 3GQZA 3E98A 3Q7VA 4BD0A 1PZOA 1NRJA 3A3EA 2PR6A 1KDSA 2Y2KA 4E3KA 5FSRA 1E3UD 4X1MA 4EBLA 2NUTC 1VM1A 5FI7A 1ZTUA 4ZBEA 1YLYA 4B4ZA 2H28A 2BLSA 2XSSA 4MBFA 2Y91A 3SOIA 3QP1A 3MQOA 2JCHA 5AQBA 3KSHA 2EFXA 4E6WA 4OVDA 1LT0A 4MDZA 4OQIA 5E2FA 3B33A 5CHJA 4WZ4A 1D06A 2ZQ9A 4JPMA 1SCWA 3LEZA 1IYSA 3IF6B 4LFUA 3LR4A 3LICA 4NG2A 2EFUA 4N9LA 4XUZA 2V8CA 3IXHA 2A49A 3K2NA 3BLMA 4Q8IA 2OWHA 2ZJ9A 3SS3A 4Y17A 2WGWB 2O9CA 3LI8A 3A3IA 2EX2A 1L3LA 4IUKA 5DFYA 1UWPX 2RCXA 1TS0A 4L9EA 3JVVA 2W3EA 3V3RA 3Q81A 1K4EA 4ZJ1A 2Y2QA 5AQ7A 2IWBA 3A3DA 4D60A 2G7UA 3IX3A 3Q1FA 4I5SA 4S2IA 2M7UA 1PI5A 3WRTA 1ES5A 5J4EA 4Y3IA 3ZDJA 4S2OA 2RL3A 4FSFA 3SS4A 3H7WB 4WBGA 4ZJ3A 5F6AA 5KIZA 4R70A 1BLPA 3ICYA 4Y13A 3PYPA 4LCLA 1K38A 3ZHHA 2UWXA 1U60A 4Y2FA 1FSYA 5JYOA 2Y2MA 3ZGAB 3PBTA 1YMXA 5F82A 3F1PB 4FUWA 3UB9A 3GECA 3P7NA 5DF8A 1LL8A 3FV7A 4I38A 3SZTA 4JF4A 3LIEA 3DBAA 1LI9A 1G5UA 4BJPA 2Q9NA 4K0WA 4EERA 5J7EA 3MSHA 1VQQA 4DXCA 4BQMA 2ACGA 1JTGA 4X68A 3S1YA 1W63M 3PAEA 4ESPA 5AVFA 1K57A 4XT2A 4JXWA 1CJFA 2WKEA 5L09A 3W4QA 1RGYA 1XGIA 1T1BA 2XEPA 2OAQ1 5D3OA 2ZMAA 4KUKA 1SKOA 1K55A 4DKIA 3RXXA 1AWIA 2GNXA 1BLHA 2CMNA 4ARZA 4N1XA 2IWCA 3IX8A 3UE3A 2ZC4B 3EQVA 4Y15A 3BY8A 4OH0A 4NXBA 4U0XA 4RX2A 2IA2A 2P08A 2FH5A 4KZBA 4Z9QA 5J3WA 3TG9A 5KMWA 4HNBA 4WMCD 4BENA 1XX2A 4WZ5A 1EWZA 1EI5A 2I72A 4OLGA 5FQKA 1Y4OA 4PM8A 4GD6A 3ISGA 1LI0A 4R0QA 1IEMA 2HDRA 4GDNA 4GJ4A 4DDYA 3UB6A 3ZCZA 4G3WA 1DP8A 3BRMA 2ZM2A 4GS9B 2Z6CA 1W8QA 2ZQCA 3LR3A 3S7OA 2V1BA 2PRFA 4WELA 1RCJA 3C7VA 3O3VA 2ZMVA 5FATA 2VGLM 2Z6DA 4DJ2A 3HREA 4OOMA 4GW9A 4OQ0A 5HWTA 2V1AA 2X01A 4QWOA 1FOFA 1FCNA 2H10A 2EX6A 3LY4A 1Y28A 1S66L 3LR0A 1JWVA 2WUQA 2B5RA 3MXSA 2PYPA 5DTSA 2HDSA 3LCEA 4NEED 2KOIA 3KSIA 1K25A 3T1XA 2VJWA 3PXPA 3CMZA 1ZC2A 2L1MA 2EXAA 2DCFA 1L0GA 4HQAA 3WS2A 1UGUA 1TDLA 2A24A 2KLIA 2PHYA 4FTXA 3M2JA 4E3IA 2QJ5A 5A90A 5F83A 3ZG5A 4KQQA 4GB7A 2ZOHA 3UE6A 1XJ3A 3B3XA 3ZFZA 2ZQ8A 3HL9A 4S2KA 1K57C 3CZDA 3PHYA 4NETA 2QJ7A 4E3JA 3PTEA 1WE4A 4WMCA 1N9NA 3HLDA 1S6RA 4WM9A 2W3GA 2Y2JA 1ZKJA 2W0NA 5A92A 4EU0A 5CTNA 1BT5A 5K5BA 3HLFA 4S2LA 1VHMA 3H82A 4EETB 1K55C 4WYYA 3NY4A 5HAIA 4LCMA 4BD1A 1XA7A 4QPRA 3QP5A 2Y2LA 4PAUA 3E2LA 4EBNA 3IH9A 2WZXA 2M1CA 2Y4AA 1BTLA 5GHZA 1D1JA 4KENB 3VSKA 2HDUA 2OWJA 1K4FA 1NYMA 5CHUA 1PFLA 3E4OA 3A0RA 5CECA 3MQQA 4DDSA 2W27A 3ITBA 4ETXA 1O7EA 4BL3A 4U0TA 1O07A 4WEKA 4DN0A 2GJ3A 1WA9A 4NK3A 1NYYA 4RVAA 2ZBBA 4N9KA 3W4OA 5HWVA 4DE2A 3TSGA 5HDCA 1H8ZA 5HSQA 4CLCA 1KOUA 4QB8A 3BM6A 3NDGA 3BFFA 3CLOA 5IS1A 4L0LA 3NHQA 3E4PA 3CPTA 3VP0A 4KZ7A 4JGRA 4RYEA 4ZTKA 2XR0A 4PKYG 1LSVA 1VEUA 1XPBA 3VFFA 5EVIA 3UB7A 3WRZA 1TVFA 5HDDA 4X55A 1OTBA 5IHVA 3Q82A 3LUQA 2Y79A 4Z1WA 3BWLA 1NRFA 3U4LP 3QP6A 3IXBA 1BZAA 2WGVA 3DW0A 5EVEA 2VV7A 2KDKA 4XUXA 2LB9A 3UE1A 4DXBA 4KZ9A 2OLUA 3NULA 1WYBA 5A8BA 2EA9A 4U3TA 5M19A 4KZAA 1W79A 4G3KA 2VV6A 2EXBA 1Y54A 4HI4A 2PU4A 4ZDXA 4XT2B 4LV3A 1GA9A 3OPRA 5HD3A 1JVJA 2PD7A 3T12B 3LI9A 3RH8B 1NJ4A 4MCWA 2H0TA 4JGQA 4I3JA 1T18A 2HF6A 2V2FF 4UA7A 3DWZA 4OQGA 5CX7A 2PR5A 2EX9A 4MN6A 1SKOB 4R4RA 2AVXA 4GLQA 5CERA 1V9ZA 4ARZB 2QWSA 1GSWA 2PD8A 2WAFA 3SH9A 1FSWA 3HLGA 1KVMA 1ZG6A 1J3WA 4MEZA 3G30A 5DF7A 2I9VA 3IH8A 4B88A 3QNBA 5TBMA 4KQRA 1BLCA 4NXEA 3K3CA 3VP3A 3IX4A 2V9AA 3NIAA 5HPIA 4JXGA 2CC1A 1FR1A 4KZ6A 4IBXA 4Y5FA 1OJ5A 5KZHA 1HZOA 2H0YA 5TGFA 5EPHA 1YLZA 3GMWA 1L0FA 4YFMA 4KZ5A 5GL9A 3CWFA 5EV0A 4P0MA 3E0YA 4CLCC 1S4SA 1STZA 4OQHA 1XJ2A 4S2JA 4X53A 4EEPA 2VLGA 2WGIA 3CUEC 1NXYA 5GLBA 1K54A 1IKGA 3L7HA 1QMEA 1BYWA 2PDRA 3KO6A 2W3HA 4H6JA 2J9PA 4BWIA 3G34A 4GHIB 5EFWA 1SZVA 3A0VA 2W1RA 5A93A 3G6OA 4NKPA 5EVLA 3N8RA 3KX0X 3ZQ5A 5KSHA 3O88A 1OT6A 3OPLA 3NECA 3EGDC 3C5AA 4KG2A 3VP4A 4KQOA 3E2KA 3VP2A 2WYXA 4KZ3A 2GX5A 3NJAA 1SHVA 3UDFA 2FZ0A 2QHKA 1HLUP 3IF5A 1V9YA 2ZD8A 4O0PA 3AGDA 4HP9A 4B4XA 1DP6A 3UMEA 4LV0A 5DJTA 3NDEA 5A91A 1MZUA 3FKVA 3V50A 4II7A 4Q0HA 3LO7A 4PKYA 1ESIA 3HLBA 4Y0TA 3DTEA 3DTIA 5FL3A 3MQ0A 2V0WA 2XFSA 4MLLA 3G2YA 5FQQA 2WKRA 1EROA 1PW8A 1ES4A 2DNSA 1NZOA 5F69A 3KYEA 2Q9MA 3H82B 5GLAA 3M6HA 4C3QA 4PM6A 1PW1A 2XDMA 2VK3A 3MXQA 2J7VA 1E3UA 4OKPA 2P74A 5GLCA 2JN7A 4I3IA 3CHWP 1J9MA 1BULA 2C5WB 3VOZA 2PT7A 4UQIS 2J3TD 1PRQA 3S4XA 3NOUC 2JHEA 5DKKA 1KVLA 3O86A 2A2LA 2YKHA 1DJCA 3T1RA 1W63Q 5E2EA 3LIBA 1ES3A 2OLVA 3MXRA 1CEGA 3MFXA 1JWPA 4IHQA 3D4FA 4P6ZM 5E2HA 3T1SA 3LIFA 3FPWA 3L9KA 2B02A 3IHAA 4GDBA 1P9WA 3N7WA 3VFHA 3C8CA 3MZDA 1MWTA 2LB5A 3G35A 4CLCB 2EWWA 3HJKA 4JBFA 4YINA 4I3AA 3N8LA 5HX9A 5TJJA 3IS2A 3CPTB 5CXWA 1HTZA 3BQ8A 1DY6A 2ZM0A 2XD5A 3HVFA 4FH2A 3F1NA 3UNWA 2VEAA 3FKWA 3M6BA 3C2WA 3LGOA 4MBKA 1OTEA 1G28A 3IXGA 3N4IA 1VB6A 5M18A 1M6KA 2WAEA 1KGGA 1YSPA 1X0OA 4F3LA 3MJQA 3AGFA 4GZBA 4MN5A 4CQHA 2XQZA 1N4OA 1T1AA 1YKDA 1EW0A 1OTIA 2X71A 4KG5A 2HPBA 3T4LA 4LLOB 2XK1A 3QP4A 1MBLA 5BOHA 3BYDA 3R7WB 1SDEA 1TEMA 3UB5P 3TRCA 4NXFA 3NCKA 2XA7S 3OCNA 2P9VA 1FILA 3GR2A 4X6TA 4EUZA 1IYPA 1PZPA 1JWZA 5TR7A 3NC8A 3RJUA 2GZAA 1YSQA 3DTKA 4FOFA 3HCYA 5FEGA 2H5SA 3IQAA 1SKFA 1XP4A 4EQ1A 4KQDA 1OJGA 4UAAA 1XJ6A 3A3FA 2ZQAA 2WK0A 4R3BA 1IYQA 4L9FA 4HP4A 5AQ9A 3W4PA 5AVEA 4PMAA 1RP5A 5TBMB 1MKMA 3ZG9B 5CHMA 2VV8A 3KYZA 4MNRA 4B93A 1S1YA 2DRWA 1CK3A 3IWOA 4OP8A 3O87A 4WF0A 3EEHA 3BQAA 1DJAA 4ME4A 2GDNA 1S0WA 2M7VA 4M3KA 1ODVA 2E8IA 3Q7VB 3ZG8B 2ZL1A 4OP5A 1GSXA 3FYZA 5E43A 2IWDA 3C38A 3SH7A 1H5XA 3EWKA 2WGWA 1A0KA 2WKIA 1KDWA 2D02A 2B18A 1TF1A
chains in the Genus database with same CATH topology
4EV4A 4PM5A 3FZCA 1W79A 2EXBA 5CHJA 4WZ4A 2QZ6A 2ZQ9A 1Y54A 4JPMA 1SCWA 3CJMA 3LEZA 1IYSA 3IF6B 2PU4A 2G2UA 4ZDXA 2JBFA 3IHBA 5HL1A 1XGJA 1GCEA 4LV3A 1GA9A 4EBPA 3OPRA 3AGEA 2EFUA 4N9LA 1JVJA 3HUOA 4XUZA 3IXHA 1PWDA 1NJ4A 2A49A 4R3JA 1E25A 3MKFA 4GOGA 2ZQDA 2H0TA 3BLMA 4N92A 4Q8IA 4R1GA 5E2FA 2ZJ9A 4CPKA 2V2FF 1I5QA 4S2MA 4UA7A 3SS3A 3QNCA 2G2WA 3DWZA 4JXSA 4OQGA 2WGWB 2EX9A 3A3IA 2EX2A 1YM1A 2FFFB 2RCXA 3BECA 4R4RA 1HD8A 3V3RA 4PM7A 3Q81A 1K4EA 3BFGA 3BFDA 4WZ5C 5J8XA 4C75A 2J8YA 4ZJ1A 5CERA 1YQSA 2Y2QA 5AQ7A 1ESUA 2IWBA 3JYIA 3A3DA 5TFQA 4QJGA 1G68A 2WAFA 5HARA 3Q1FA 4S2IA 2XFTA 4A5RA 3SH9A 1FSWA 1PI5A 3WRTA 1ES5A 2Y55A 3ZDJA 4S2OA 3HLGA 2RL3A 1KVMA 1ZG6A 4MEZA 5EOEA 3G30A 4Y7PA 4FSFA 5DF7A 3OCLA 3SS4A 4XXRA 1M40A 5EE8A 3IH8A 2R9WA 4WBGA 4B88A 4ZJ3A 5CGWA 1KGFA 4HBUA 3QNBA 2Y2IA 3IWIA 3MZEA 3Q07A 2HP9A 2V1ZA 4KQRA 3WWXA 1BLCA 1BLPA 5EUAA 5FI2A 4OPYA 4LCLA 1K38A 3VP3A 3ZHHA 2UWXA 2XD1A 1U60A 1YLWA 4OOLA 4PPRA 2Y2HA 1FSYA 5JYOA 3ZNYA 3NIAA 4QU3A 2Y2MA 3ZGAB 4BL2A 3PBTA 1YMXA 5F82A 4DE1A 4JXGA 4OOYA 2CC1A 3OZHA 1FR1A 4KZ6A 4IBXA 1CI8A 2X02A 2OV5A 5DF8A 5KZHA 1HZOA 2H0YA 3LY3A 3FV7A 3UO9A 5TGFA 5EPHA 3UPOA 3IWQA 5DTKA 4JF4A 3P09A 1YLZA 4UHUA 4EWFA 1LI9A 3SS5A 3ZVWA 5EECA 3FWLA 3GMWA 1L0FA 4YFMA 4BJPA 1MWUA 4H8RA 4Y0OA 2XF3A 5F1GA 1L2SA 4KZ5A 5GL9A 1Q2PA 2Q9NA 4K0WA 4P0MA 3VSLA 1KE0A 4OQHA 1VQQA 4S2JA 4DXCA 1ZG4A 4BQMA 1JTGA 4X68A 3IXDA 3S1YA 3MBZA 4X53A 4F94A 3Q7ZA 2WGIA 1GHMA 1NXYA 4FCFA 4MBHA 1YMSA 2QPNA 3PAEA 3PBSA 3TOIA 4IVIA 1ALQA 1K57A 3IF6A 5GLBA 1K56D 4OLDA 1K54A 1IKGA 3WS4A 4JXWA 1K6RA 4JF5A 4OONA 1QMEA 4PM9A 3V3SA 2EX8A 2JC7A 2WKEA 4JF6A 2PU2A 3HBRA 3W4QA 1BLSA 1RGYA 2J9PA 1G6AA 1XGIA 1FR6A 3G34A 3PBNA 1ERMA 4R23A 1KE3A 3N8SA 2ZC3B 3UY6A 3A3JA 5EVID 3V39A 5A93A 1TDGA 2XEPA 3ZG0A 3UPPA 5D3OA 2ZMAA 3WS1A 5I94A 1K55A 4DKIA 3RXXA 3OPPA 1Q2QA 5EVLA 3N8RA 1BLHA 1MWRA 1BSGA 4N1XA 3O88A 1ERQA 4OPZA 2IWCA 5FI6A 5FQIA 5KSHA 1ONHA 3OPLA 2Y2PA 3C5AA 3UE3A 2ZC4B 4HEFA 4N1HA 4KG2A 3VP4A 2WZZA 4RA7A 3EQVA 2HP6A 4OPQA 1IYOA 3E2KA 4KQOA 4OH0A 4U0XA 3G2ZA 5CGXA 4DRTA 4K91A 3HLWA 3VMAA 3VP2A 4RX2A 2WYXA 2XH9A 2FFYA 4KZBA 4Z9QA 4KZ3A 1SHVA 3TG9A 3UDFA 5KMWA 1E4DA 1ES2A 4KZ8A 5DTTA 4WMCD 4BENA 1XX2A 4WZ5A 3IF5A 1EWZA 3PAGA 1EI5A 4HBTA 4P85A 2I72A 4OLGA 2ZD8A 5FQKA 4PM8A 4S2NA 4GD6A 4P87A 3ISGA 3AGDA 4B4XA 3RXWA 4LV0A 1KGEA 1LI0A 3NDEA 5A91A 1KE4A 1PIOA 3FKVA 4ID4A 4R0QA 3W8KA 1IEMA 2HDRA 1YT4A 1IKIA 4GDNA 1CEFA 5CTMA 3V50A 4DDYA 4S2PA 3ZCZA 3LO7A 1ESIA 3HLBA 4Y0TA 5CEDA 4GNUA 3BRMA 4C6YA 5AQAA 2PBYA 2ZM2A 1W8QA 2XFSA 2ZQCA 4MLLA 3G2YA 5FQQA 5GHXA 1NY0A 3MKEA 1EROA 1PW8A 1ES4A 4QY5A 2DNSA 1NZOA 4K0XA 5GLDA 1RCJA 3C7VA 4WELA 2Q9MA 3MFDA 3HLCA 3O3VA 4ZJ2A 5GLAA 4HESA 3M6HA 4C3QA 5F1FA 4GD8A 1K6SA 3GSGA 4FD8A 4PM6A 1PW1A 2XDMA 3NBLA 5FQJA 5FATA 4X56A 1GA0A 5U47A 5L2FA 2J7VA 3HREA 4OOMA 5HFOA 3P98A 4P6BA 4E3MA 1E3UA 2ZLYA 4OKPA 2P74A 1WYCA 4OQ0A 5GLCA 2X01A 1MWSA 4LENA 1FOFA 3GVBA 1J9MA 1FCNA 1PI4A 3DWKA 3GRJA 1BULA 2C5WB 2H10A 3SH8A 3VOZA 2OSUA 1LL9A 1BUEA 2EX6A 5FAOA 1CI9A 3LY4A 3S4XA 3BFEA 5CEBA 4E6XA 2Y2GA 1KVLA 3O86A 1L0EA 1JWVA 2WUQA 2B5RA 2Y2OA 3G32A 3MXSA 5DVAA 1K56A 1DJCA 2WKHA 4JLFA 4DE0A 3G4PA 1JTDA 5DTSA 5E2EA 2HDSA 1ES3A 3LCEA 3PBQA 3UDIA 1ONGA 1K25A 2OLVA 5HAQA 1YLTA 3MXRA 1CEGA 1L0DA 5FQMA 3PBRA 1W7FA 1JWPA 2P9VB 3CMZA 4O7DA 1ZC2A 4GKUA 2EXAA 2Z2MB 3D4FA 2J9OA 2R9XA 5E2HA 4ZAMA 2DCFA 1L0GA 4JXVA 3WS2A 4EQIA 1SDNA 3IHAA 3BLSA 1TDLA 3UPNA 1DJBA 4GDBA 3N7WA 3VFHA 5EVIC 3MZDA 1YLPA 3C7UA 1MWTA 3M2JA 4E3IA 3G35A 5A90A 3N6IA 4JBFA 4YINA 2VGJA 2VGKA 4QD4A 5F83A 3N8LA 4KQQA 5HX9A 3ZG5A 4GB7A 4IEDA 3M2KA 1QMFA 4E3OA 3B3XA 1Z6FA 3CG5A 5CXWA 1HTZA 3ZFZA 5CRFA 2ZQ8A 1DY6A 3HL9A 2ZM0A 4KG6A 4S2KA 1K57C 2XD5A 3CZDA 3HVFA 3IF6C 2JE5A 4NETA 4FH2A 4E3JA 3C4OA 1I2SA 1MKIA 3PTEA 1NZUA 2C6WB 1H8YA 3UNWA 1WE4A 5DF9A 4CJNA 4WMCA 3FKWA 3M6BA 4MBKA 1XA1A 4E3NA 3ITAA 3IXGA 3HLDA 3N4IA 1S6RA 4WM9A 5M18A 2Y2JA 2V20A 3IT9A 1M6KA 1ZKJA 5A92A 4X69A 1MY8A 5CTNA 1BT5A 4WEJA 3GV9A 3HLFA 4S2LA 2WAEA 3V5MA 4Y0UA 2QMIA 5JYPA 3QHYA 3DTMA 2ZC6B 1K55C 1KGGA 4WYYA 2WADA 3GTCA 3NY4A 5HAIA 1GHPA 3AGFA 3BFCA 4GZBA 4LCMA 3UE0A 4BD1A 1XA7A 5GHYA 1AXBA 3ZVTA 2XQZA 3G31A 1N4OA 5FASA 2Y2LA 3E2LA 3MZFA 4EBNA 3IH9A 4LV2A 2WZXA 2Y4AA 2X71A 1BTLA 5FAPA 4OPRA 2Y2NA 5GHZA 4KG5A 4KENB 2HPBA 3VSKA 2BG1A 2HDUA 2XK1A 2A3UA 1MBLA 3NI9A 1K4FA 4DE3A 3UDXA 5BOHA 1NYMA 5CHUA 5HAPA 3BYDA 1SDEA 1HVBA 1TEMA 3OC2A 3WS0A 4QY6A 4FH4A 1W5DA 3BEBA 5CECA 3UN7A 1XXMA 2ZC7A 3NCKA 4DF6A 4DDSA 5G18A 2HP5A 3OCNA 3PBOA 3ITBA 3HUNA 2P9VA 4S2NC 1OMEA 5EOOA 5KSCA 1O7EA 3GR2A 3I7JA 1XKZA 4X6TA 1W8YA 4U0TA 4BL3A 2ZM8A 1O07A 1YLJA 1C3BA 4RX3A 1GHIA 3VOYA 4WEKA 4EUZA 1IYPA 3WS5A 4IBRA 3C4PA 1PZPA 1JWZA 4NK3A 5TR7A 3NC8A 1I2WA 5FQ9A 1NYYA 3RJUA 4RVAA 4N9KA 3W4OA 3HLEA 4DE2A 3EQUA 3TSGA 5FDHA 1H8ZA 1FCOA 4QB8A 3BM6A 3NDGA 1FQGA 4D2OA 2ZC5B 5FAQA 2H5SA 4KZ4A 3BFFA 1IELA 5HW3A 3IQAA 1SKFA 4L0LA 1XP4A 3HUMA 1RGZA 4UAAA 2ZQ7A 3VP0A 4KZ7A 3A3FA 2ZQAA 4JKTA 4QHCA 4E3LA 3GQZA 4RYEA 2WK0A 4ZTKA 4R3BA 2XR0A 1XPBA 1IYQA 3Q7VA 3ZG7B 4BD0A 1PZOA 3A3EA 1MPLA 1KDSA 5AQ9A 5EVIA 1PYYA 2Y2KA 3VFFA 3W4PA 4E3KA 5FSRA 1PWCA 3VP1A 2Z2LB 2HDQA 1E3UD 4PMAA 5FA7A 3WRZA 1RP5A 1TVFA 4IVKA 2Y59A 1PWGA 1LLBA 4X55A 3ZG9B 5CHMA 4EBLA 1N9BA 1VM1A 4MNRA 5IHVA 3Q82A 5FI7A 4UA6A 4ZBEA 2XLNA 2DRWA 1CK3A 1FCMA 3IWOA 1YLYA 4B4ZA 2BLSA 4OP8A 3O87A 4R4SA 3ZNTA 1NRFA 3OPHA 4MBFA 2Y91A 1DJAA 3SOIA 2GDNA 3IXBA 4LV1A 1MXOA 1S0WA 2XGNA 5CGSA 5E2GA 1BZAA 2WGVA 3DW0A 4M3KA 2JCHA 5AQBA 5M1AA 2E8IA 3Q7VB 1K54C 3ZG8B 4UA9A 4OP5A 4XUXA 3UE1A 3FYZA 2EFXA 5E43A 5EVIB 4E6WA 2IWDA 4DXBA 4KZ9A 1LL5A 3S22A 4OVDA 3SH7A 1H5XA 2WGWA 2WKIA 1KDWA 2OLUA 4GN2A 1WYBA 4OQIA 1LHYA 4U3TA 5M19A 4KZAA 4BLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EV4 A;  4PM5 A;  3FZC A;  1W79 A;  2EXB A;  5CHJ A;  4WZ4 A;  2QZ6 A;  2ZQ9 A;  1Y54 A;  4JPM A;  1SCW A;  3CJM A;  3LEZ A;  1IYS A;  3IF6 B;  2PU4 A;  2G2U A;  4ZDX A;  2JBF A;  3IHB A;  5HL1 A;  1XGJ A;  1GCE A;  4LV3 A;  1GA9 A;  4EBP A;  3OPR A;  3AGE A;  2EFU A;  4N9L A;  1JVJ A;  3HUO A;  4XUZ A;  3IXH A;  1PWD A;  1NJ4 A;  2A49 A;  4R3J A;  1E25 A;  3MKF A;  4GOG A;  2ZQD A;  2H0T A;  3BLM A;  4N92 A;  4Q8I A;  4R1G A;  5E2F A;  2ZJ9 A;  4CPK A;  2V2F F;  1I5Q A;  4S2M A;  4UA7 A;  3SS3 A;  3QNC A;  2G2W A;  3DWZ A;  4JXS A;  4OQG A;  2WGW B;  2EX9 A;  3A3I A;  2EX2 A;  1YM1 A;  2FFF B;  2RCX A;  3BEC A;  4R4R A;  1HD8 A;  3V3R A;  4PM7 A;  3Q81 A;  1K4E A;  3BFG A;  3BFD A;  4WZ5 C;  5J8X A;  4C75 A;  2J8Y A;  4ZJ1 A;  5CER A;  1YQS A;  2Y2Q A;  5AQ7 A;  1ESU A;  2IWB A;  3JYI A;  3A3D A;  5TFQ A;  4QJG A;  1G68 A;  2WAF A;  5HAR A;  3Q1F A;  4S2I A;  2XFT A;  4A5R A;  3SH9 A;  1FSW A;  1PI5 A;  3WRT A;  1ES5 A;  2Y55 A;  3ZDJ A;  4S2O A;  3HLG A;  2RL3 A;  1KVM A;  1ZG6 A;  4MEZ A;  5EOE A;  3G30 A;  4Y7P A;  4FSF A;  5DF7 A;  3OCL A;  3SS4 A;  4XXR A;  1M40 A;  5EE8 A;  3IH8 A;  2R9W A;  4WBG A;  4B88 A;  4ZJ3 A;  5CGW A;  1KGF A;  4HBU A;  3QNB A;  2Y2I A;  3IWI A;  3MZE A;  3Q07 A;  2HP9 A;  2V1Z A;  4KQR A;  3WWX A;  1BLC A;  1BLP A;  5EUA A;  5FI2 A;  4OPY A;  4LCL A;  1K38 A;  3VP3 A;  3ZHH A;  2UWX A;  2XD1 A;  1U60 A;  1YLW A;  4OOL A;  4PPR A;  2Y2H A;  1FSY A;  5JYO A;  3ZNY A;  3NIA A;  4QU3 A;  2Y2M A;  3ZGA B;  4BL2 A;  3PBT A;  1YMX A;  5F82 A;  4DE1 A;  4JXG A;  4OOY A;  2CC1 A;  3OZH A;  1FR1 A;  4KZ6 A;  4IBX A;  1CI8 A;  2X02 A;  2OV5 A;  5DF8 A;  5KZH A;  1HZO A;  2H0Y A;  3LY3 A;  3FV7 A;  3UO9 A;  5TGF A;  5EPH A;  3UPO A;  3IWQ A;  5DTK A;  4JF4 A;  3P09 A;  1YLZ A;  4UHU A;  4EWF A;  1LI9 A;  3SS5 A;  3ZVW A;  5EEC A;  3FWL A;  3GMW A;  1L0F A;  4YFM A;  4BJP A;  1MWU A;  4H8R A;  4Y0O A;  2XF3 A;  5F1G A;  1L2S A;  4KZ5 A;  5GL9 A;  1Q2P A;  2Q9N A;  4K0W A;  4P0M A;  3VSL A;  1KE0 A;  4OQH A;  1VQQ A;  4S2J A;  4DXC A;  1ZG4 A;  4BQM A;  1JTG A;  4X68 A;  3IXD A;  3S1Y A;  3MBZ A;  4X53 A;  4F94 A;  3Q7Z A;  2WGI A;  1GHM A;  1NXY A;  4FCF A;  4MBH A;  1YMS A;  2QPN A;  3PAE A;  3PBS A;  3TOI A;  4IVI A;  1ALQ A;  1K57 A;  3IF6 A;  5GLB A;  1K56 D;  4OLD A;  1K54 A;  1IKG A;  3WS4 A;  4JXW A;  1K6R A;  4JF5 A;  4OON A;  1QME A;  4PM9 A;  3V3S A;  2EX8 A;  2JC7 A;  2WKE A;  4JF6 A;  2PU2 A;  3HBR A;  3W4Q A;  1BLS A;  1RGY A;  2J9P A;  1G6A A;  1XGI A;  1FR6 A;  3G34 A;  3PBN A;  1ERM A;  4R23 A;  1KE3 A;  3N8S A;  2ZC3 B;  3UY6 A;  3A3J A;  5EVI D;  3V39 A;  5A93 A;  1TDG A;  2XEP A;  3ZG0 A;  3UPP A;  5D3O A;  2ZMA A;  3WS1 A;  5I94 A;  1K55 A;  4DKI A;  3RXX A;  3OPP A;  1Q2Q A;  5EVL A;  3N8R A;  1BLH A;  1MWR A;  1BSG A;  4N1X A;  3O88 A;  1ERQ A;  4OPZ A;  2IWC A;  5FI6 A;  5FQI A;  5KSH A;  1ONH A;  3OPL A;  2Y2P A;  3C5A A;  3UE3 A;  2ZC4 B;  4HEF A;  4N1H A;  4KG2 A;  3VP4 A;  2WZZ A;  4RA7 A;  3EQV A;  2HP6 A;  4OPQ A;  1IYO A;  3E2K A;  4KQO A;  4OH0 A;  4U0X A;  3G2Z A;  5CGX A;  4DRT A;  4K91 A;  3HLW A;  3VMA A;  3VP2 A;  4RX2 A;  2WYX A;  2XH9 A;  2FFY A;  4KZB A;  4Z9Q A;  4KZ3 A;  1SHV A;  3TG9 A;  3UDF A;  5KMW A;  1E4D A;  1ES2 A;  4KZ8 A;  5DTT A;  4WMC D;  4BEN A;  1XX2 A;  4WZ5 A;  3IF5 A;  1EWZ A;  3PAG A;  1EI5 A;  4HBT A;  4P85 A;  2I72 A;  4OLG A;  2ZD8 A;  5FQK A;  4PM8 A;  4S2N A;  4GD6 A;  4P87 A;  3ISG A;  3AGD A;  4B4X A;  3RXW A;  4LV0 A;  1KGE A;  1LI0 A;  3NDE A;  5A91 A;  1KE4 A;  1PIO A;  3FKV A;  4ID4 A;  4R0Q A;  3W8K A;  1IEM A;  2HDR A;  1YT4 A;  1IKI A;  4GDN A;  1CEF A;  5CTM A;  3V50 A;  4DDY A;  4S2P A;  3ZCZ A;  3LO7 A;  1ESI A;  3HLB A;  4Y0T A;  5CED A;  4GNU A;  3BRM A;  4C6Y A;  5AQA A;  2PBY A;  2ZM2 A;  1W8Q A;  2XFS A;  2ZQC A;  4MLL A;  3G2Y A;  5FQQ A;  5GHX A;  1NY0 A;  3MKE A;  1ERO A;  1PW8 A;  1ES4 A;  4QY5 A;  2DNS A;  1NZO A;  4K0X A;  5GLD A;  1RCJ A;  3C7V A;  4WEL A;  2Q9M A;  3MFD A;  3HLC A;  3O3V A;  4ZJ2 A;  5GLA A;  4HES A;  3M6H A;  4C3Q A;  5F1F A;  4GD8 A;  1K6S A;  3GSG A;  4FD8 A;  4PM6 A;  1PW1 A;  2XDM A;  3NBL A;  5FQJ A;  5FAT A;  4X56 A;  1GA0 A;  5U47 A;  5L2F A;  2J7V A;  3HRE A;  4OOM A;  5HFO A;  3P98 A;  4P6B A;  4E3M A;  1E3U A;  2ZLY A;  4OKP A;  2P74 A;  1WYC A;  4OQ0 A;  5GLC A;  2X01 A;  1MWS A;  4LEN A;  1FOF A;  3GVB A;  1J9M A;  1FCN A;  1PI4 A;  3DWK A;  3GRJ A;  1BUL A;  2C5W B;  2H10 A;  3SH8 A;  3VOZ A;  2OSU A;  1LL9 A;  1BUE A;  2EX6 A;  5FAO A;  1CI9 A;  3LY4 A;  3S4X A;  3BFE A;  5CEB A;  4E6X A;  2Y2G A;  1KVL A;  3O86 A;  1L0E A;  1JWV A;  2WUQ A;  2B5R A;  2Y2O A;  3G32 A;  3MXS A;  5DVA A;  1K56 A;  1DJC A;  2WKH A;  4JLF A;  4DE0 A;  3G4P A;  1JTD A;  5DTS A;  5E2E A;  2HDS A;  1ES3 A;  3LCE A;  3PBQ A;  3UDI A;  1ONG A;  1K25 A;  2OLV A;  5HAQ A;  1YLT A;  3MXR A;  1CEG A;  1L0D A;  5FQM A;  3PBR A;  1W7F A;  1JWP A;  2P9V B;  3CMZ A;  4O7D A;  1ZC2 A;  4GKU A;  2EXA A;  2Z2M B;  3D4F A;  2J9O A;  2R9X A;  5E2H A;  4ZAM A;  2DCF A;  1L0G A;  4JXV A;  3WS2 A;  4EQI A;  1SDN A;  3IHA A;  3BLS A;  1TDL A;  3UPN A;  1DJB A;  4GDB A;  3N7W A;  3VFH A;  5EVI C;  3MZD A;  1YLP A;  3C7U A;  1MWT A;  3M2J A;  4E3I A;  3G35 A;  5A90 A;  3N6I A;  4JBF A;  4YIN A;  2VGJ A;  2VGK A;  4QD4 A;  5F83 A;  3N8L A;  4KQQ A;  5HX9 A;  3ZG5 A;  4GB7 A;  4IED A;  3M2K A;  1QMF A;  4E3O A;  3B3X A;  1Z6F A;  3CG5 A;  5CXW A;  1HTZ A;  3ZFZ A;  5CRF A;  2ZQ8 A;  1DY6 A;  3HL9 A;  2ZM0 A;  4KG6 A;  4S2K A;  1K57 C;  2XD5 A;  3CZD A;  3HVF A;  3IF6 C;  2JE5 A;  4NET A;  4FH2 A;  4E3J A;  3C4O A;  1I2S A;  1MKI A;  3PTE A;  1NZU A;  2C6W B;  1H8Y A;  3UNW A;  1WE4 A;  5DF9 A;  4CJN A;  4WMC A;  3FKW A;  3M6B A;  4MBK A;  1XA1 A;  4E3N A;  3ITA A;  3IXG A;  3HLD A;  3N4I A;  1S6R A;  4WM9 A;  5M18 A;  2Y2J A;  2V20 A;  3IT9 A;  1M6K A;  1ZKJ A;  5A92 A;  4X69 A;  1MY8 A;  5CTN A;  1BT5 A;  4WEJ A;  3GV9 A;  3HLF A;  4S2L A;  2WAE A;  3V5M A;  4Y0U A;  2QMI A;  5JYP A;  3QHY A;  3DTM A;  2ZC6 B;  1K55 C;  1KGG A;  4WYY A;  2WAD A;  3GTC A;  3NY4 A;  5HAI A;  1GHP A;  3AGF A;  3BFC A;  4GZB A;  4LCM A;  3UE0 A;  4BD1 A;  1XA7 A;  5GHY A;  1AXB A;  3ZVT A;  2XQZ A;  3G31 A;  1N4O A;  5FAS A;  2Y2L A;  3E2L A;  3MZF A;  4EBN A;  3IH9 A;  4LV2 A;  2WZX A;  2Y4A A;  2X71 A;  1BTL A;  5FAP A;  4OPR A;  2Y2N A;  5GHZ A;  4KG5 A;  4KEN B;  2HPB A;  3VSK A;  2BG1 A;  2HDU A;  2XK1 A;  2A3U A;  1MBL A;  3NI9 A;  1K4F A;  4DE3 A;  3UDX A;  5BOH A;  1NYM A;  5CHU A;  5HAP A;  3BYD A;  1SDE A;  1HVB A;  1TEM A;  3OC2 A;  3WS0 A;  4QY6 A;  4FH4 A;  1W5D A;  3BEB A;  5CEC A;  3UN7 A;  1XXM A;  2ZC7 A;  3NCK A;  4DF6 A;  4DDS A;  5G18 A;  2HP5 A;  3OCN A;  3PBO A;  3ITB A;  3HUN A;  2P9V A;  4S2N C;  1OME A;  5EOO A;  5KSC A;  1O7E A;  3GR2 A;  3I7J A;  1XKZ A;  4X6T A;  1W8Y A;  4U0T A;  4BL3 A;  2ZM8 A;  1O07 A;  1YLJ A;  1C3B A;  4RX3 A;  1GHI A;  3VOY A;  4WEK A;  4EUZ A;  1IYP A;  3WS5 A;  4IBR A;  3C4P A;  1PZP A;  1JWZ A;  4NK3 A;  5TR7 A;  3NC8 A;  1I2W A;  5FQ9 A;  1NYY A;  3RJU A;  4RVA A;  4N9K A;  3W4O A;  3HLE A;  4DE2 A;  3EQU A;  3TSG A;  5FDH A;  1H8Z A;  1FCO A;  4QB8 A;  3BM6 A;  3NDG A;  1FQG A;  4D2O A;  2ZC5 B;  5FAQ A;  2H5S A;  4KZ4 A;  3BFF A;  1IEL A;  5HW3 A;  3IQA A;  1SKF A;  4L0L A;  1XP4 A;  3HUM A;  1RGZ A;  4UAA A;  2ZQ7 A;  3VP0 A;  4KZ7 A;  3A3F A;  2ZQA A;  4JKT A;  4QHC A;  4E3L A;  3GQZ A;  4RYE A;  2WK0 A;  4ZTK A;  4R3B A;  2XR0 A;  1XPB A;  1IYQ A;  3Q7V A;  3ZG7 B;  4BD0 A;  1PZO A;  3A3E A;  1MPL A;  1KDS A;  5AQ9 A;  5EVI A;  1PYY A;  2Y2K A;  3VFF A;  3W4P A;  4E3K A;  5FSR A;  1PWC A;  3VP1 A;  2Z2L B;  2HDQ A;  1E3U D;  4PMA A;  5FA7 A;  3WRZ A;  1RP5 A;  1TVF A;  4IVK A;  2Y59 A;  1PWG A;  1LLB A;  4X55 A;  3ZG9 B;  5CHM A;  4EBL A;  1N9B A;  1VM1 A;  4MNR A;  5IHV A;  3Q82 A;  5FI7 A;  4UA6 A;  4ZBE A;  2XLN A;  2DRW A;  1CK3 A;  1FCM A;  3IWO A;  1YLY A;  4B4Z A;  2BLS A;  4OP8 A;  3O87 A;  4R4S A;  3ZNT A;  1NRF A;  3OPH A;  4MBF A;  2Y91 A;  1DJA A;  3SOI A;  2GDN A;  3IXB A;  4LV1 A;  1MXO A;  1S0W A;  2XGN A;  5CGS A;  5E2G A;  1BZA A;  2WGV A;  3DW0 A;  4M3K A;  2JCH A;  5AQB A;  5M1A A;  2E8I A;  3Q7V B;  1K54 C;  3ZG8 B;  4UA9 A;  4OP5 A;  4XUX A;  3UE1 A;  3FYZ A;  2EFX A;  5E43 A;  5EVI B;  4E6W A;  2IWD A;  4DXB A;  4KZ9 A;  1LL5 A;  3S22 A;  4OVD A;  3SH7 A;  1H5X A;  2WGW A;  2WKI A;  1KDW A;  2OLU A;  4GN2 A;  1WYB A;  4OQI A;  1LHY A;  4U3T A;  5M19 A;  4KZA A;  4BLM A; 
#chains in the Genus database with same CATH topology
 1IFQ A;  4PM5 A;  3FZC A;  2QZ6 A;  2WKP A;  3CJM A;  2W1T A;  2G2U A;  1TS7 A;  5HL1 A;  3V67 A;  1GCE A;  2VX8 A;  4EBP A;  3AGE A;  5EM1 A;  1PWD A;  4R3J A;  1E25 A;  3H7W A;  3MKF A;  3T1Q B;  3VE3 A;  4CPK A;  1I5Q A;  4CLC E;  3QNC A;  2G2W A;  4JXS A;  2FFF B;  3T4K A;  2JKG A;  1HD8 A;  2K7S A;  4WZ5 C;  3BFD A;  1G6O A;  2J8Y A;  4HH3 A;  3MR0 A;  1YQS A;  2OAP 1;  1ESU A;  3JYI A;  5TFQ A;  2V0U A;  4QJG A;  4KUO A;  1TS6 A;  5HAR A;  1F2K A;  2XFT A;  4A5R A;  4E3L A;  1Z09 A;  4Y7P A;  1M40 A;  5EE8 A;  4HBU A;  4HIA A;  2Y2I A;  3LYX A;  3IWI A;  2HP9 A;  4IJG A;  5FI2 A;  5EUA A;  3IBJ A;  1XFN A;  2XD1 A;  4OOL A;  1P9R A;  4BL2 A;  3OOV A;  4Q0J A;  4DE1 A;  4OOY A;  3OZH A;  4I39 A;  4R3A A;  2OV5 A;  3KSF A;  3LY3 A;  2P7J A;  3UO9 A;  3UPO A;  3IWQ A;  3LFV A;  3P09 A;  3SS5 A;  3ZVW A;  5EEC A;  3JVU A;  1MWU A;  4H8R A;  4Y0O A;  2XF3 A;  3VSL A;  1KE0 A;  3MBZ A;  4LPZ A;  3B42 A;  2L0W A;  4O01 A;  4NXG A;  4MBH A;  1YMS A;  4JGP A;  1ALQ A;  1K56 D;  4OLD A;  1K6R A;  4JF5 A;  4PM9 A;  3V3S A;  2EX8 A;  4JF6 A;  1BLS A;  1G6A A;  3EEA A;  5C5K A;  3PBN A;  4R23 A;  1KE3 A;  3N8S A;  3UY6 A;  3A3J A;  2BTF P;  4GCZ A;  1TDG A;  4LRY C;  3ZG0 A;  3UPP A;  5HPF A;  5MC7 A;  2QKP A;  3UB8 A;  3OPP A;  1Q2Q A;  1MWR A;  2PYR A;  1ERQ A;  4OPZ A;  5FI6 A;  5FQI A;  4HEF A;  4EUV A;  2WKQ A;  2WZZ A;  3T50 A;  4RA7 A;  4HJ4 A;  4OPQ A;  1IYO A;  2Y8H A;  1F9I A;  4DRT A;  3VMA A;  2XH9 A;  1P0Z A;  3K3D A;  1OTA A;  1ES2 A;  4KZ8 A;  5DTT A;  3RXW A;  3S7Q A;  1KE4 A;  2XRN A;  5CTM A;  1YT4 A;  1IKI A;  1CEF A;  3NOP C;  3EOI A;  4LGW A;  4WLA A;  5CED A;  4GNU A;  4C6Y A;  5AQA A;  2INW A;  4UEY A;  3F1O A;  2JKR M;  3MFD A;  1S67 L;  1K6S A;  4FD8 A;  3NBL A;  1N9O A;  4X56 A;  1GA0 A;  5U47 A;  3P98 A;  1MWS A;  3PR6 A;  5EM0 A;  4HY8 A;  3GVB A;  2P04 A;  3GRJ A;  3SH8 A;  5FAO A;  1BUE A;  2VGL S;  3BFE A;  5CEB A;  4YNR A;  1L0E A;  3G32 A;  2Y2O A;  5DVA A;  1K56 A;  2WKH A;  2B95 A;  3HJI A;  3UDI A;  1ONG A;  1DRM A;  1T1C A;  3U2A A;  5DKL A;  1YLT A;  2P9V B;  2HGV A;  5IT5 A;  3E4Q A;  2R9X A;  4ZAM A;  4EQI A;  1SDN A;  1DJB A;  4AFI A;  2JKR I;  2JKF A;  3CI6 A;  5EVI C;  1YLP A;  1OTD A;  3C7U A;  4R38 A;  2VGJ A;  2O9B A;  2VGK A;  5LBR A;  4IED A;  3ULF A;  3VOL A;  1NLY A;  2J80 A;  1DP9 A;  1Z6F A;  3CG5 A;  3TW8 A;  4KG6 A;  3RTY A;  4WUJ A;  2C6W B;  1JNU A;  5DF9 A;  4CJN A;  3LR5 A;  1XA1 A;  4E3N A;  2Q0O A;  3S7P A;  4YOF A;  2A24 B;  2JKT I;  4LRX C;  1PNE A;  3IT9 A;  4X69 A;  4HOI A;  2W3F A;  4HHD A;  4EEU A;  3V5M A;  2DMW A;  3QHY A;  3DTM A;  2WAD A;  5IU1 A;  1GHP A;  3UE0 A;  4X25 A;  5GHY A;  3G31 A;  5FAS A;  3MZF A;  2ZL1 B;  2Y2N A;  3NI9 A;  4DE3 A;  3UDX A;  4BBU A;  1HVB A;  3MS6 A;  3OC2 A;  5DFX A;  4FH4 A;  1W5D A;  1XXM A;  2ZC7 A;  4G3V A;  2HP5 A;  3HUN A;  2W1T B;  5EOO A;  1OME A;  5HL6 A;  3I7J A;  1XKZ A;  4BMW A;  1W8Y A;  2ZM8 A;  4DJ3 A;  1YLJ A;  1C3B A;  4RX3 A;  1IOU A;  3WS5 A;  3D3O A;  1VET A;  3C4P A;  5HDS A;  1I2W A;  1F5M A;  4B9O A;  3HLE A;  3EQU A;  5FDH A;  2V8F A;  4D2O A;  4KZ4 A;  1IEL A;  5HW3 A;  2HJ9 C;  3HUM A;  1RGZ A;  2ZQ7 A;  4JKT A;  4QHC A;  3ZG7 B;  2O9A A;  5I5L A;  1MPL A;  3CAX A;  1PYY A;  5L10 A;  4Q0I A;  1PWC A;  3VP1 A;  2Z2L B;  2HDQ A;  5FA7 A;  4IVK A;  2Y59 A;  1PWG A;  4ETZ A;  1LLB A;  3VE4 A;  1N9B A;  4UA6 A;  2XLN A;  3C30 A;  1FCM A;  5HWW A;  3OLO A;  1GSV A;  5L07 A;  4R4S A;  3ZNT A;  4R6L A;  3OPH A;  3A0S A;  1TD5 A;  4LV1 A;  1MXO A;  5CGS A;  2XGN A;  5E2G A;  5AJG A;  5M1A A;  1VEU B;  2E8J A;  1K54 C;  2HJE A;  5FEF A;  4UA9 A;  5F5Y A;  2VKS A;  5EVI B;  1LL5 A;  3S22 A;  2NUP C;  4GN2 A;  1LHY A;  1CQA A;  4BBV A;  4OPY A;  4BLM A;  4EV4 A;  1ACF A;  2JBF A;  3IHB A;  1XGJ A;  5HD5 A;  3HUO A;  2J3W A;  2PAV P;  2ZQD A;  4GOG A;  4N92 A;  4R1G A;  3BJN A;  4S2M A;  1YM1 A;  3BEC A;  4EES A;  4PM7 A;  3BFG A;  5J8X A;  4C75 A;  3LID A;  5F68 A;  2MJ6 A;  2YKF A;  1G68 A;  5L8M A;  2PBD P;  2Y55 A;  5EOE A;  2O0Y A;  3OCL A;  4XXR A;  2R9W A;  5CGW A;  1KGF A;  3Q07 A;  3MZE A;  3WWX A;  2V1Z A;  4M4X A;  2W3D A;  3FG8 A;  1FIK A;  3FC7 A;  1H0M A;  1YLW A;  4PPR A;  1N9L A;  2Y2H A;  3ZNY A;  4QU3 A;  1CI8 A;  2X02 A;  4L9G A;  1CF0 A;  5DTK A;  1H8M A;  4GHI A;  4UHU A;  4EWF A;  3FWL A;  3W2Z A;  2ZMF A;  5F1G A;  1L2S A;  1Q2P A;  1T19 A;  5HZH A;  1ZG4 A;  2K2N A;  3F1O B;  3IXD A;  4F94 A;  3Q7Z A;  4CLC D;  1GHM A;  1NWZ A;  4FCF A;  2QPN A;  3PBS A;  3TOI A;  1LSX A;  4IVI A;  3IF6 A;  3WS4 A;  3T4S A;  4OON A;  2JC7 A;  2PU2 A;  3HBR A;  1F98 A;  4YWZ A;  1FR6 A;  1ERM A;  2ZC3 B;  1ZHH B;  5EVI D;  3V39 A;  3UMD A;  1OT9 A;  3IBR A;  3LEQ A;  4EW7 A;  3WS1 A;  5I94 A;  5DJU A;  3TE8 A;  1BSG A;  3FPV A;  3ZYT A;  1ONH A;  2Y2P A;  4N1H A;  1K0K A;  4MN7 A;  2HP6 A;  3G2Z A;  1UWN X;  5CGX A;  4K91 A;  3HLW A;  4H6J B;  4HJ3 A;  2FFY A;  3TJZ C;  1E4D A;  3LIA A;  4JGO A;  2K31 A;  3PAG A;  4BBT A;  4HBT A;  4P85 A;  4S2N A;  4P87 A;  1KGE A;  3F1P A;  3T4T A;  1PIO A;  3R4K A;  2ZOI A;  4ID4 A;  3W8K A;  3JPU A;  4S2P A;  3EGX C;  1XFQ A;  3KSG A;  2PBY A;  3KYQ A;  5GHX A;  1NY0 A;  3MKE A;  1NLZ A;  4QY5 A;  5GLD A;  4K0X A;  4LRZ E;  1S1Z A;  4ZJ2 A;  3HLC A;  4HES A;  5F1F A;  4GD8 A;  2OOL A;  3GSG A;  5FQJ A;  1TS8 A;  4UQI M;  5L2F A;  3D9Y A;  5HFO A;  4P6B A;  4E3M A;  2ZLY A;  1WYC A;  2J3T C;  4LEN A;  3DWK A;  1PI4 A;  2OSU A;  1LL9 A;  1CI9 A;  4E6X A;  2VZW A;  2Y2G A;  1MC0 A;  3CUE A;  5FDS A;  4DE0 A;  2KX6 A;  4JLF A;  2HV1 A;  2HZ5 A;  3G4P A;  1JTD A;  3PBQ A;  1XJ4 A;  4PHT A;  2R78 A;  5HAQ A;  4O8G A;  5FQM A;  1L0D A;  3SW1 A;  3PBR A;  1W7F A;  4EXO A;  4O7D A;  4GKU A;  4E04 A;  2Z2M B;  2J9O A;  4JXV A;  1VET B;  3QP8 A;  3BLS A;  2O99 A;  3T4O A;  3VV4 A;  3UPN A;  3BW6 A;  4P6Z S;  2UV0 E;  3NOT C;  3MF0 A;  3N6I A;  3MMH A;  4IUH A;  4QD4 A;  1LSW A;  4HJ6 A;  3H9W A;  4X1L A;  3M2K A;  2D01 A;  1QMF A;  4E3O A;  5CRF A;  3IF6 C;  5G4Y A;  2JE5 A;  3C4O A;  1I2S A;  1MKI A;  2L4R A;  1NZU A;  1H8Y A;  3ITA A;  3R7W A;  4GS9 A;  2V20 A;  3B47 A;  3T4J A;  1MY8 A;  4WEJ A;  3GV9 A;  3RFB A;  4DMZ A;  4Y0U A;  2QMI A;  5JYP A;  2ZC6 B;  3GTC A;  3IS2 B;  3BFC A;  3DAV A;  1D7E A;  1YAX A;  2QYB A;  1P97 A;  1AXB A;  3ZVT A;  3CIT A;  3F1N B;  4LV2 A;  5FAP A;  4OPR A;  2XA7 M;  2BG1 A;  2A3U A;  2EWV A;  5HAP A;  3O5Y A;  1H3Q A;  3WS0 A;  3OBF A;  4QY6 A;  1YPR A;  3BEB A;  3UN7 A;  3D72 A;  4DF6 A;  5G4Z A;  5G18 A;  3PBO A;  4S2N C;  5KSC A;  4WN5 A;  3QP2 A;  4F3L B;  3BY9 A;  3P01 A;  1GHI A;  3VOY A;  4IBR A;  4WL9 A;  5FQ9 A;  1OPX A;  4HH2 A;  4K08 A;  3T4Q A;  3S7N A;  1FCO A;  1FQG A;  2XRO A;  2ZC5 B;  5FAQ A;  2BAS A;  4MMN A;  2VA0 A;  4RQ9 A;  2JKT M;  1S4R A;  3GDI A;  4ZRR A;  3GQZ A;  3E98 A;  3Q7V A;  4BD0 A;  1PZO A;  1NRJ A;  3A3E A;  2PR6 A;  1KDS A;  2Y2K A;  4E3K A;  5FSR A;  1E3U D;  4X1M A;  4EBL A;  2NUT C;  1VM1 A;  5FI7 A;  1ZTU A;  4ZBE A;  1YLY A;  4B4Z A;  2H28 A;  2BLS A;  2XSS A;  4MBF A;  2Y91 A;  3SOI A;  3QP1 A;  3MQO A;  2JCH A;  5AQB A;  3KSH A;  2EFX A;  4E6W A;  4OVD A;  1LT0 A;  4MDZ A;  4OQI A;  5E2F A;  3B33 A;  5CHJ A;  4WZ4 A;  1D06 A;  2ZQ9 A;  4JPM A;  1SCW A;  3LEZ A;  1IYS A;  3IF6 B;  4LFU A;  3LR4 A;  3LIC A;  4NG2 A;  2EFU A;  4N9L A;  4XUZ A;  2V8C A;  3IXH A;  2A49 A;  3K2N A;  3BLM A;  4Q8I A;  2OWH A;  2ZJ9 A;  3SS3 A;  4Y17 A;  2WGW B;  2O9C A;  3LI8 A;  3A3I A;  2EX2 A;  1L3L A;  4IUK A;  5DFY A;  1UWP X;  2RCX A;  1TS0 A;  4L9E A;  3JVV A;  2W3E A;  3V3R A;  3Q81 A;  1K4E A;  4ZJ1 A;  2Y2Q A;  5AQ7 A;  2IWB A;  3A3D A;  4D60 A;  2G7U A;  3IX3 A;  3Q1F A;  4I5S A;  4S2I A;  2M7U A;  1PI5 A;  3WRT A;  1ES5 A;  5J4E A;  4Y3I A;  3ZDJ A;  4S2O A;  2RL3 A;  4FSF A;  3SS4 A;  3H7W B;  4WBG A;  4ZJ3 A;  5F6A A;  5KIZ A;  4R70 A;  1BLP A;  3ICY A;  4Y13 A;  3PYP A;  4LCL A;  1K38 A;  3ZHH A;  2UWX A;  1U60 A;  4Y2F A;  1FSY A;  5JYO A;  2Y2M A;  3ZGA B;  3PBT A;  1YMX A;  5F82 A;  3F1P B;  4FUW A;  3UB9 A;  3GEC A;  3P7N A;  5DF8 A;  1LL8 A;  3FV7 A;  4I38 A;  3SZT A;  4JF4 A;  3LIE A;  3DBA A;  1LI9 A;  1G5U A;  4BJP A;  2Q9N A;  4K0W A;  4EER A;  5J7E A;  3MSH A;  1VQQ A;  4DXC A;  4BQM A;  2ACG A;  1JTG A;  4X68 A;  3S1Y A;  1W63 M;  3PAE A;  4ESP A;  5AVF A;  1K57 A;  4XT2 A;  4JXW A;  1CJF A;  2WKE A;  5L09 A;  3W4Q A;  1RGY A;  1XGI A;  1T1B A;  2XEP A;  2OAQ 1;  5D3O A;  2ZMA A;  4KUK A;  1SKO A;  1K55 A;  4DKI A;  3RXX A;  1AWI A;  2GNX A;  1BLH A;  2CMN A;  4ARZ A;  4N1X A;  2IWC A;  3IX8 A;  3UE3 A;  2ZC4 B;  3EQV A;  4Y15 A;  3BY8 A;  4OH0 A;  4NXB A;  4U0X A;  4RX2 A;  2IA2 A;  2P08 A;  2FH5 A;  4KZB A;  4Z9Q A;  5J3W A;  3TG9 A;  5KMW A;  4HNB A;  4WMC D;  4BEN A;  1XX2 A;  4WZ5 A;  1EWZ A;  1EI5 A;  2I72 A;  4OLG A;  5FQK A;  1Y4O A;  4PM8 A;  4GD6 A;  3ISG A;  1LI0 A;  4R0Q A;  1IEM A;  2HDR A;  4GDN A;  4GJ4 A;  4DDY A;  3UB6 A;  3ZCZ A;  4G3W A;  1DP8 A;  3BRM A;  2ZM2 A;  4GS9 B;  2Z6C A;  1W8Q A;  2ZQC A;  3LR3 A;  3S7O A;  2V1B A;  2PRF A;  4WEL A;  1RCJ A;  3C7V A;  3O3V A;  2ZMV A;  5FAT A;  2VGL M;  2Z6D A;  4DJ2 A;  3HRE A;  4OOM A;  4GW9 A;  4OQ0 A;  5HWT A;  2V1A A;  2X01 A;  4QWO A;  1FOF A;  1FCN A;  2H10 A;  2EX6 A;  3LY4 A;  1Y28 A;  1S66 L;  3LR0 A;  1JWV A;  2WUQ A;  2B5R A;  3MXS A;  2PYP A;  5DTS A;  2HDS A;  3LCE A;  4NEE D;  2KOI A;  3KSI A;  1K25 A;  3T1X A;  2VJW A;  3PXP A;  3CMZ A;  1ZC2 A;  2L1M A;  2EXA A;  2DCF A;  1L0G A;  4HQA A;  3WS2 A;  1UGU A;  1TDL A;  2A24 A;  2KLI A;  2PHY A;  4FTX A;  3M2J A;  4E3I A;  2QJ5 A;  5A90 A;  5F83 A;  3ZG5 A;  4KQQ A;  4GB7 A;  2ZOH A;  3UE6 A;  1XJ3 A;  3B3X A;  3ZFZ A;  2ZQ8 A;  3HL9 A;  4S2K A;  1K57 C;  3CZD A;  3PHY A;  4NET A;  2QJ7 A;  4E3J A;  3PTE A;  1WE4 A;  4WMC A;  1N9N A;  3HLD A;  1S6R A;  4WM9 A;  2W3G A;  2Y2J A;  1ZKJ A;  2W0N A;  5A92 A;  4EU0 A;  5CTN A;  1BT5 A;  5K5B A;  3HLF A;  4S2L A;  1VHM A;  3H82 A;  4EET B;  1K55 C;  4WYY A;  3NY4 A;  5HAI A;  4LCM A;  4BD1 A;  1XA7 A;  4QPR A;  3QP5 A;  2Y2L A;  4PAU A;  3E2L A;  4EBN A;  3IH9 A;  2WZX A;  2M1C A;  2Y4A A;  1BTL A;  5GHZ A;  1D1J A;  4KEN B;  3VSK A;  2HDU A;  2OWJ A;  1K4F A;  1NYM A;  5CHU A;  1PFL A;  3E4O A;  3A0R A;  5CEC A;  3MQQ A;  4DDS A;  2W27 A;  3ITB A;  4ETX A;  1O7E A;  4BL3 A;  4U0T A;  1O07 A;  4WEK A;  4DN0 A;  2GJ3 A;  1WA9 A;  4NK3 A;  1NYY A;  4RVA A;  2ZBB A;  4N9K A;  3W4O A;  5HWV A;  4DE2 A;  3TSG A;  5HDC A;  1H8Z A;  5HSQ A;  4CLC A;  1KOU A;  4QB8 A;  3BM6 A;  3NDG A;  3BFF A;  3CLO A;  5IS1 A;  4L0L A;  3NHQ A;  3E4P A;  3CPT A;  3VP0 A;  4KZ7 A;  4JGR A;  4RYE A;  4ZTK A;  2XR0 A;  4PKY G;  1LSV A;  1VEU A;  1XPB A;  3VFF A;  5EVI A;  3UB7 A;  3WRZ A;  1TVF A;  5HDD A;  4X55 A;  1OTB A;  5IHV A;  3Q82 A;  3LUQ A;  2Y79 A;  4Z1W A;  3BWL A;  1NRF A;  3U4L P;  3QP6 A;  3IXB A;  1BZA A;  2WGV A;  3DW0 A;  5EVE A;  2VV7 A;  2KDK A;  4XUX A;  2LB9 A;  3UE1 A;  4DXB A;  4KZ9 A;  2OLU A;  3NUL A;  1WYB A;  5A8B A;  2EA9 A;  4U3T A;  5M19 A;  4KZA A;  1W79 A;  4G3K A;  2VV6 A;  2EXB A;  1Y54 A;  4HI4 A;  2PU4 A;  4ZDX A;  4XT2 B;  4LV3 A;  1GA9 A;  3OPR A;  5HD3 A;  1JVJ A;  2PD7 A;  3T12 B;  3LI9 A;  3RH8 B;  1NJ4 A;  4MCW A;  2H0T A;  4JGQ A;  4I3J A;  1T18 A;  2HF6 A;  2V2F F;  4UA7 A;  3DWZ A;  4OQG A;  5CX7 A;  2PR5 A;  2EX9 A;  4MN6 A;  1SKO B;  4R4R A;  2AVX A;  4GLQ A;  5CER A;  1V9Z A;  4ARZ B;  2QWS A;  1GSW A;  2PD8 A;  2WAF A;  3SH9 A;  1FSW A;  3HLG A;  1KVM A;  1ZG6 A;  1J3W A;  4MEZ A;  3G30 A;  5DF7 A;  2I9V A;  3IH8 A;  4B88 A;  3QNB A;  5TBM A;  4KQR A;  1BLC A;  4NXE A;  3K3C A;  3VP3 A;  3IX4 A;  2V9A A;  3NIA A;  5HPI A;  4JXG A;  2CC1 A;  1FR1 A;  4KZ6 A;  4IBX A;  4Y5F A;  1OJ5 A;  5KZH A;  1HZO A;  2H0Y A;  5TGF A;  5EPH A;  1YLZ A;  3GMW A;  1L0F A;  4YFM A;  4KZ5 A;  5GL9 A;  3CWF A;  5EV0 A;  4P0M A;  3E0Y A;  4CLC C;  1S4S A;  1STZ A;  4OQH A;  1XJ2 A;  4S2J A;  4X53 A;  4EEP A;  2VLG A;  2WGI A;  3CUE C;  1NXY A;  5GLB A;  1K54 A;  1IKG A;  3L7H A;  1QME A;  1BYW A;  2PDR A;  3KO6 A;  2W3H A;  4H6J A;  2J9P A;  4BWI A;  3G34 A;  4GHI B;  5EFW A;  1SZV A;  3A0V A;  2W1R A;  5A93 A;  3G6O A;  4NKP A;  5EVL A;  3N8R A;  3KX0 X;  3ZQ5 A;  5KSH A;  3O88 A;  1OT6 A;  3OPL A;  3NEC A;  3EGD C;  3C5A A;  4KG2 A;  3VP4 A;  4KQO A;  3E2K A;  3VP2 A;  2WYX A;  4KZ3 A;  2GX5 A;  3NJA A;  1SHV A;  3UDF A;  2FZ0 A;  2QHK A;  1HLU P;  3IF5 A;  1V9Y A;  2ZD8 A;  4O0P A;  3AGD A;  4HP9 A;  4B4X A;  1DP6 A;  3UME A;  4LV0 A;  5DJT A;  3NDE A;  5A91 A;  1MZU A;  3FKV A;  3V50 A;  4II7 A;  4Q0H A;  3LO7 A;  4PKY A;  1ESI A;  3HLB A;  4Y0T A;  3DTE A;  3DTI A;  5FL3 A;  3MQ0 A;  2V0W A;  2XFS A;  4MLL A;  3G2Y A;  5FQQ A;  2WKR A;  1ERO A;  1PW8 A;  1ES4 A;  2DNS A;  1NZO A;  5F69 A;  3KYE A;  2Q9M A;  3H82 B;  5GLA A;  3M6H A;  4C3Q A;  4PM6 A;  1PW1 A;  2XDM A;  2VK3 A;  3MXQ A;  2J7V A;  1E3U A;  4OKP A;  2P74 A;  5GLC A;  2JN7 A;  4I3I A;  3CHW P;  1J9M A;  1BUL A;  2C5W B;  3VOZ A;  2PT7 A;  4UQI S;  2J3T D;  1PRQ A;  3S4X A;  3NOU C;  2JHE A;  5DKK A;  1KVL A;  3O86 A;  2A2L A;  2YKH A;  1DJC A;  3T1R A;  1W63 Q;  5E2E A;  3LIB A;  1ES3 A;  2OLV A;  3MXR A;  1CEG A;  3MFX A;  1JWP A;  4IHQ A;  3D4F A;  4P6Z M;  5E2H A;  3T1S A;  3LIF A;  3FPW A;  3L9K A;  2B02 A;  3IHA A;  4GDB A;  1P9W A;  3N7W A;  3VFH A;  3C8C A;  3MZD A;  1MWT A;  2LB5 A;  3G35 A;  4CLC B;  2EWW A;  3HJK A;  4JBF A;  4YIN A;  4I3A A;  3N8L A;  5HX9 A;  5TJJ A;  3IS2 A;  3CPT B;  5CXW A;  1HTZ A;  3BQ8 A;  1DY6 A;  2ZM0 A;  2XD5 A;  3HVF A;  4FH2 A;  3F1N A;  3UNW A;  2VEA A;  3FKW A;  3M6B A;  3C2W A;  3LGO A;  4MBK A;  1OTE A;  1G28 A;  3IXG A;  3N4I A;  1VB6 A;  5M18 A;  1M6K A;  2WAE A;  1KGG A;  1YSP A;  1X0O A;  4F3L A;  3MJQ A;  3AGF A;  4GZB A;  4MN5 A;  4CQH A;  2XQZ A;  1N4O A;  1T1A A;  1YKD A;  1EW0 A;  1OTI A;  2X71 A;  4KG5 A;  2HPB A;  3T4L A;  4LLO B;  2XK1 A;  3QP4 A;  1MBL A;  5BOH A;  3BYD A;  3R7W B;  1SDE A;  1TEM A;  3UB5 P;  3TRC A;  4NXF A;  3NCK A;  2XA7 S;  3OCN A;  2P9V A;  1FIL A;  3GR2 A;  4X6T A;  4EUZ A;  1IYP A;  1PZP A;  1JWZ A;  5TR7 A;  3NC8 A;  3RJU A;  2GZA A;  1YSQ A;  3DTK A;  4FOF A;  3HCY A;  5FEG A;  2H5S A;  3IQA A;  1SKF A;  1XP4 A;  4EQ1 A;  4KQD A;  1OJG A;  4UAA A;  1XJ6 A;  3A3F A;  2ZQA A;  2WK0 A;  4R3B A;  1IYQ A;  4L9F A;  4HP4 A;  5AQ9 A;  3W4P A;  5AVE A;  4PMA A;  1RP5 A;  5TBM B;  1MKM A;  3ZG9 B;  5CHM A;  2VV8 A;  3KYZ A;  4MNR A;  4B93 A;  1S1Y A;  2DRW A;  1CK3 A;  3IWO A;  4OP8 A;  3O87 A;  4WF0 A;  3EEH A;  3BQA A;  1DJA A;  4ME4 A;  2GDN A;  1S0W A;  2M7V A;  4M3K A;  1ODV A;  2E8I A;  3Q7V B;  3ZG8 B;  2ZL1 A;  4OP5 A;  1GSX A;  3FYZ A;  5E43 A;  2IWD A;  3C38 A;  3SH7 A;  1H5X A;  3EWK A;  2WGW A;  1A0K A;  2WKI A;  1KDW A;  2D02 A;  2B18 A;  1TF1 A; 
#chains in the Genus database with same CATH homology
 4EV4 A;  4PM5 A;  3FZC A;  1W79 A;  2EXB A;  5CHJ A;  4WZ4 A;  2QZ6 A;  2ZQ9 A;  1Y54 A;  4JPM A;  1SCW A;  3CJM A;  3LEZ A;  1IYS A;  3IF6 B;  2PU4 A;  2G2U A;  4ZDX A;  2JBF A;  3IHB A;  5HL1 A;  1XGJ A;  1GCE A;  4LV3 A;  1GA9 A;  4EBP A;  3OPR A;  3AGE A;  2EFU A;  4N9L A;  1JVJ A;  3HUO A;  4XUZ A;  3IXH A;  1PWD A;  1NJ4 A;  2A49 A;  4R3J A;  1E25 A;  3MKF A;  4GOG A;  2ZQD A;  2H0T A;  3BLM A;  4N92 A;  4Q8I A;  4R1G A;  5E2F A;  2ZJ9 A;  4CPK A;  2V2F F;  1I5Q A;  4S2M A;  4UA7 A;  3SS3 A;  3QNC A;  2G2W A;  3DWZ A;  4JXS A;  4OQG A;  2WGW B;  2EX9 A;  3A3I A;  2EX2 A;  1YM1 A;  2FFF B;  2RCX A;  3BEC A;  4R4R A;  1HD8 A;  3V3R A;  4PM7 A;  3Q81 A;  1K4E A;  3BFG A;  3BFD A;  4WZ5 C;  5J8X A;  4C75 A;  2J8Y A;  4ZJ1 A;  5CER A;  1YQS A;  2Y2Q A;  5AQ7 A;  1ESU A;  2IWB A;  3JYI A;  3A3D A;  5TFQ A;  4QJG A;  1G68 A;  2WAF A;  5HAR A;  3Q1F A;  4S2I A;  2XFT A;  4A5R A;  3SH9 A;  1FSW A;  1PI5 A;  3WRT A;  1ES5 A;  2Y55 A;  3ZDJ A;  4S2O A;  3HLG A;  2RL3 A;  1KVM A;  1ZG6 A;  4MEZ A;  5EOE A;  3G30 A;  4Y7P A;  4FSF A;  5DF7 A;  3OCL A;  3SS4 A;  4XXR A;  1M40 A;  5EE8 A;  3IH8 A;  2R9W A;  4WBG A;  4B88 A;  4ZJ3 A;  5CGW A;  1KGF A;  4HBU A;  3QNB A;  2Y2I A;  3IWI A;  3MZE A;  3Q07 A;  2HP9 A;  2V1Z A;  4KQR A;  3WWX A;  1BLC A;  1BLP A;  5EUA A;  5FI2 A;  4OPY A;  4LCL A;  1K38 A;  3VP3 A;  3ZHH A;  2UWX A;  2XD1 A;  1U60 A;  1YLW A;  4OOL A;  4PPR A;  2Y2H A;  1FSY A;  5JYO A;  3ZNY A;  3NIA A;  4QU3 A;  2Y2M A;  3ZGA B;  4BL2 A;  3PBT A;  1YMX A;  5F82 A;  4DE1 A;  4JXG A;  4OOY A;  2CC1 A;  3OZH A;  1FR1 A;  4KZ6 A;  4IBX A;  1CI8 A;  2X02 A;  2OV5 A;  5DF8 A;  5KZH A;  1HZO A;  2H0Y A;  3LY3 A;  3FV7 A;  3UO9 A;  5TGF A;  5EPH A;  3UPO A;  3IWQ A;  5DTK A;  4JF4 A;  3P09 A;  1YLZ A;  4UHU A;  4EWF A;  1LI9 A;  3SS5 A;  3ZVW A;  5EEC A;  3FWL A;  3GMW A;  1L0F A;  4YFM A;  4BJP A;  1MWU A;  4H8R A;  4Y0O A;  2XF3 A;  5F1G A;  1L2S A;  4KZ5 A;  5GL9 A;  1Q2P A;  2Q9N A;  4K0W A;  4P0M A;  3VSL A;  1KE0 A;  4OQH A;  1VQQ A;  4S2J A;  4DXC A;  1ZG4 A;  4BQM A;  1JTG A;  4X68 A;  3IXD A;  3S1Y A;  3MBZ A;  4X53 A;  4F94 A;  3Q7Z A;  2WGI A;  1GHM A;  1NXY A;  4FCF A;  4MBH A;  1YMS A;  2QPN A;  3PAE A;  3PBS A;  3TOI A;  4IVI A;  1ALQ A;  1K57 A;  3IF6 A;  5GLB A;  1K56 D;  4OLD A;  1K54 A;  1IKG A;  3WS4 A;  4JXW A;  1K6R A;  4JF5 A;  4OON A;  1QME A;  4PM9 A;  3V3S A;  2EX8 A;  2JC7 A;  2WKE A;  4JF6 A;  2PU2 A;  3HBR A;  3W4Q A;  1BLS A;  1RGY A;  2J9P A;  1G6A A;  1XGI A;  1FR6 A;  3G34 A;  3PBN A;  1ERM A;  4R23 A;  1KE3 A;  3N8S A;  2ZC3 B;  3UY6 A;  3A3J A;  5EVI D;  3V39 A;  5A93 A;  1TDG A;  2XEP A;  3ZG0 A;  3UPP A;  5D3O A;  2ZMA A;  3WS1 A;  5I94 A;  1K55 A;  4DKI A;  3RXX A;  3OPP A;  1Q2Q A;  5EVL A;  3N8R A;  1BLH A;  1MWR A;  1BSG A;  4N1X A;  3O88 A;  1ERQ A;  4OPZ A;  2IWC A;  5FI6 A;  5FQI A;  5KSH A;  1ONH A;  3OPL A;  2Y2P A;  3C5A A;  3UE3 A;  2ZC4 B;  4HEF A;  4N1H A;  4KG2 A;  3VP4 A;  2WZZ A;  4RA7 A;  3EQV A;  2HP6 A;  4OPQ A;  1IYO A;  3E2K A;  4KQO A;  4OH0 A;  4U0X A;  3G2Z A;  5CGX A;  4DRT A;  4K91 A;  3HLW A;  3VMA A;  3VP2 A;  4RX2 A;  2WYX A;  2XH9 A;  2FFY A;  4KZB A;  4Z9Q A;  4KZ3 A;  1SHV A;  3TG9 A;  3UDF A;  5KMW A;  1E4D A;  1ES2 A;  4KZ8 A;  5DTT A;  4WMC D;  4BEN A;  1XX2 A;  4WZ5 A;  3IF5 A;  1EWZ A;  3PAG A;  1EI5 A;  4HBT A;  4P85 A;  2I72 A;  4OLG A;  2ZD8 A;  5FQK A;  4PM8 A;  4S2N A;  4GD6 A;  4P87 A;  3ISG A;  3AGD A;  4B4X A;  3RXW A;  4LV0 A;  1KGE A;  1LI0 A;  3NDE A;  5A91 A;  1KE4 A;  1PIO A;  3FKV A;  4ID4 A;  4R0Q A;  3W8K A;  1IEM A;  2HDR A;  1YT4 A;  1IKI A;  4GDN A;  1CEF A;  5CTM A;  3V50 A;  4DDY A;  4S2P A;  3ZCZ A;  3LO7 A;  1ESI A;  3HLB A;  4Y0T A;  5CED A;  4GNU A;  3BRM A;  4C6Y A;  5AQA A;  2PBY A;  2ZM2 A;  1W8Q A;  2XFS A;  2ZQC A;  4MLL A;  3G2Y A;  5FQQ A;  5GHX A;  1NY0 A;  3MKE A;  1ERO A;  1PW8 A;  1ES4 A;  4QY5 A;  2DNS A;  1NZO A;  4K0X A;  5GLD A;  1RCJ A;  3C7V A;  4WEL A;  2Q9M A;  3MFD A;  3HLC A;  3O3V A;  4ZJ2 A;  5GLA A;  4HES A;  3M6H A;  4C3Q A;  5F1F A;  4GD8 A;  1K6S A;  3GSG A;  4FD8 A;  4PM6 A;  1PW1 A;  2XDM A;  3NBL A;  5FQJ A;  5FAT A;  4X56 A;  1GA0 A;  5U47 A;  5L2F A;  2J7V A;  3HRE A;  4OOM A;  5HFO A;  3P98 A;  4P6B A;  4E3M A;  1E3U A;  2ZLY A;  4OKP A;  2P74 A;  1WYC A;  4OQ0 A;  5GLC A;  2X01 A;  1MWS A;  4LEN A;  1FOF A;  3GVB A;  1J9M A;  1FCN A;  1PI4 A;  3DWK A;  3GRJ A;  1BUL A;  2C5W B;  2H10 A;  3SH8 A;  3VOZ A;  2OSU A;  1LL9 A;  1BUE A;  2EX6 A;  5FAO A;  1CI9 A;  3LY4 A;  3S4X A;  3BFE A;  5CEB A;  4E6X A;  2Y2G A;  1KVL A;  3O86 A;  1L0E A;  1JWV A;  2WUQ A;  2B5R A;  2Y2O A;  3G32 A;  3MXS A;  5DVA A;  1K56 A;  1DJC A;  2WKH A;  4JLF A;  4DE0 A;  3G4P A;  1JTD A;  5DTS A;  5E2E A;  2HDS A;  1ES3 A;  3LCE A;  3PBQ A;  3UDI A;  1ONG A;  1K25 A;  2OLV A;  5HAQ A;  1YLT A;  3MXR A;  1CEG A;  1L0D A;  5FQM A;  3PBR A;  1W7F A;  1JWP A;  2P9V B;  3CMZ A;  4O7D A;  1ZC2 A;  4GKU A;  2EXA A;  2Z2M B;  3D4F A;  2J9O A;  2R9X A;  5E2H A;  4ZAM A;  2DCF A;  1L0G A;  4JXV A;  3WS2 A;  4EQI A;  1SDN A;  3IHA A;  3BLS A;  1TDL A;  3UPN A;  1DJB A;  4GDB A;  3N7W A;  3VFH A;  5EVI C;  3MZD A;  1YLP A;  3C7U A;  1MWT A;  3M2J A;  4E3I A;  3G35 A;  5A90 A;  3N6I A;  4JBF A;  4YIN A;  2VGJ A;  2VGK A;  4QD4 A;  5F83 A;  3N8L A;  4KQQ A;  5HX9 A;  3ZG5 A;  4GB7 A;  4IED A;  3M2K A;  1QMF A;  4E3O A;  3B3X A;  1Z6F A;  3CG5 A;  5CXW A;  1HTZ A;  3ZFZ A;  5CRF A;  2ZQ8 A;  1DY6 A;  3HL9 A;  2ZM0 A;  4KG6 A;  4S2K A;  1K57 C;  2XD5 A;  3CZD A;  3HVF A;  3IF6 C;  2JE5 A;  4NET A;  4FH2 A;  4E3J A;  3C4O A;  1I2S A;  1MKI A;  3PTE A;  1NZU A;  2C6W B;  1H8Y A;  3UNW A;  1WE4 A;  5DF9 A;  4CJN A;  4WMC A;  3FKW A;  3M6B A;  4MBK A;  1XA1 A;  4E3N A;  3ITA A;  3IXG A;  3HLD A;  3N4I A;  1S6R A;  4WM9 A;  5M18 A;  2Y2J A;  2V20 A;  3IT9 A;  1M6K A;  1ZKJ A;  5A92 A;  4X69 A;  1MY8 A;  5CTN A;  1BT5 A;  4WEJ A;  3GV9 A;  3HLF A;  4S2L A;  2WAE A;  3V5M A;  4Y0U A;  2QMI A;  5JYP A;  3QHY A;  3DTM A;  2ZC6 B;  1K55 C;  1KGG A;  4WYY A;  2WAD A;  3GTC A;  3NY4 A;  5HAI A;  1GHP A;  3AGF A;  3BFC A;  4GZB A;  4LCM A;  3UE0 A;  4BD1 A;  1XA7 A;  5GHY A;  1AXB A;  3ZVT A;  2XQZ A;  3G31 A;  1N4O A;  5FAS A;  2Y2L A;  3E2L A;  3MZF A;  4EBN A;  3IH9 A;  4LV2 A;  2WZX A;  2Y4A A;  2X71 A;  1BTL A;  5FAP A;  4OPR A;  2Y2N A;  5GHZ A;  4KG5 A;  4KEN B;  2HPB A;  3VSK A;  2BG1 A;  2HDU A;  2XK1 A;  2A3U A;  1MBL A;  3NI9 A;  1K4F A;  4DE3 A;  3UDX A;  5BOH A;  1NYM A;  5CHU A;  5HAP A;  3BYD A;  1SDE A;  1HVB A;  1TEM A;  3OC2 A;  3WS0 A;  4QY6 A;  4FH4 A;  1W5D A;  3BEB A;  5CEC A;  3UN7 A;  1XXM A;  2ZC7 A;  3NCK A;  4DF6 A;  4DDS A;  5G18 A;  2HP5 A;  3OCN A;  3PBO A;  3ITB A;  3HUN A;  2P9V A;  4S2N C;  1OME A;  5EOO A;  5KSC A;  1O7E A;  3GR2 A;  3I7J A;  1XKZ A;  4X6T A;  1W8Y A;  4U0T A;  4BL3 A;  2ZM8 A;  1O07 A;  1YLJ A;  1C3B A;  4RX3 A;  1GHI A;  3VOY A;  4WEK A;  4EUZ A;  1IYP A;  3WS5 A;  4IBR A;  3C4P A;  1PZP A;  1JWZ A;  4NK3 A;  5TR7 A;  3NC8 A;  1I2W A;  5FQ9 A;  1NYY A;  3RJU A;  4RVA A;  4N9K A;  3W4O A;  3HLE A;  4DE2 A;  3EQU A;  3TSG A;  5FDH A;  1H8Z A;  1FCO A;  4QB8 A;  3BM6 A;  3NDG A;  1FQG A;  4D2O A;  2ZC5 B;  5FAQ A;  2H5S A;  4KZ4 A;  3BFF A;  1IEL A;  5HW3 A;  3IQA A;  1SKF A;  4L0L A;  1XP4 A;  3HUM A;  1RGZ A;  4UAA A;  2ZQ7 A;  3VP0 A;  4KZ7 A;  3A3F A;  2ZQA A;  4JKT A;  4QHC A;  4E3L A;  3GQZ A;  4RYE A;  2WK0 A;  4ZTK A;  4R3B A;  2XR0 A;  1XPB A;  1IYQ A;  3Q7V A;  3ZG7 B;  4BD0 A;  1PZO A;  3A3E A;  1MPL A;  1KDS A;  5AQ9 A;  5EVI A;  1PYY A;  2Y2K A;  3VFF A;  3W4P A;  4E3K A;  5FSR A;  1PWC A;  3VP1 A;  2Z2L B;  2HDQ A;  1E3U D;  4PMA A;  5FA7 A;  3WRZ A;  1RP5 A;  1TVF A;  4IVK A;  2Y59 A;  1PWG A;  1LLB A;  4X55 A;  3ZG9 B;  5CHM A;  4EBL A;  1N9B A;  1VM1 A;  4MNR A;  5IHV A;  3Q82 A;  5FI7 A;  4UA6 A;  4ZBE A;  2XLN A;  2DRW A;  1CK3 A;  1FCM A;  3IWO A;  1YLY A;  4B4Z A;  2BLS A;  4OP8 A;  3O87 A;  4R4S A;  3ZNT A;  1NRF A;  3OPH A;  4MBF A;  2Y91 A;  1DJA A;  3SOI A;  2GDN A;  3IXB A;  4LV1 A;  1MXO A;  1S0W A;  2XGN A;  5CGS A;  5E2G A;  1BZA A;  2WGV A;  3DW0 A;  4M3K A;  2JCH A;  5AQB A;  5M1A A;  2E8I A;  3Q7V B;  1K54 C;  3ZG8 B;  4UA9 A;  4OP5 A;  4XUX A;  3UE1 A;  3FYZ A;  2EFX A;  5E43 A;  5EVI B;  4E6W A;  2IWD A;  4DXB A;  4KZ9 A;  1LL5 A;  3S22 A;  4OVD A;  3SH7 A;  1H5X A;  2WGW A;  2WKI A;  1KDW A;  2OLU A;  4GN2 A;  1WYB A;  4OQI A;  1LHY A;  4U3T A;  5M19 A;  4KZA A;  4BLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...