1NY0A

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (nbf)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and Resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 98
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ny0A00
2Q9NA 4BD1A 5CERA 5F1FA 1K38A 1GHIA 1KE0A 3OPLA 2J8YA 3MBZA 4U0XA 3C7UA 1DY6A 3OPRA 4Q8IA 1TDLA 4JLFA 3OCNA 1E4DA 5KZHA 3OPHA 3WWXA 2FFFB 2EX8A 3Q7VB 5CHMA 3ZCZA 1K6RA 2VGKA 1FSYA 2X02A 3FV7A 5CTMA 1PI4A 5CEDA 4BJPA 4KZ7A 3GRJA 1BLPA 1E3UD 1OMEA 4EBPA 2X01A 5E2FA 4DE2A 5FDHA 3G35A 3LEZA 4MEZA 4Y7PA 1I2WA 3CJMA 5EVID 1Z6FA 4JXSA 3BFFA 1AXBA 1LI0A 3BFEA 2WKIA 1L0EA 4N9KA 5GLAA 2XEPA 4LV2A 4OQGA 4BQMA 2P9VA 1RGZA 3SS5A 4C3QA 3HVFA 3BFDA 2UWXA 1NYYA 4OVDA 1ZKJA 3WS5A 2WKEA 5CHJA 5A91A 4RYEA 3Q81A 5HX9A 3IT9A 2HP9A 4ZJ1A 1ESUA 1NJ4A 4FCFA 4Y0OA 5HFOA 2JE5A 4ZDXA 3WS0A 2EX9A 5KSHA 3IXBA 1YM1A 1BZAA 3RXXA 1BLCA 4N1XA 2HPBA 4P87A 3IWOA 2ZM8A 1ZG6A 3N8RA 1ES3A 1PWCA 1PWDA 2HDUA 4DE1A 4S2JA 4XUZA 4KZAA 3A3IA 3HREA 4PM7A 1VQQA 2HP6A 4IBRA 3BLSA 3GSGA 4OPRA 5FAPA 3VP0A 5CXWA 3Q82A 4B4ZA 1O7EA 3ZG9B 1XA1A 4JF6A 4UA9A 1H5XA 4KQQA 4C6YA 2Z2MB 1N9BA 2ZQDA 4Z9QA 2WK0A 3BM6A 4N9LA 4IEDA 1TDGA 3IWQA 4BD0A 1FQGA 1MWRA 4N92A 4KZ4A 5FSRA 3B3XA 5KMWA 4DE3A 5JYOA 3VOYA 3W4PA 3PBNA 3A3FA 3GVBA 4BL2A 4WZ5A 5EVIA 2IWCA 4WBGA 3W8KA 3ZGAB 2PU2A 1ES4A 2PU4A 4WZ4A 4CJNA 2A49A 3IF5A 4PPRA 3RXWA 5CGSA 3DTMA 3BFGA 2H5SA 2R9XA 4E6WA 3G4PA 3GV9A 2H0TA 4PMAA 2ZC5B 4X69A 5IHVA 5CEBA 4LV1A 4R1GA 2ZC3B 4RA7A 4E3LA 3ZNYA 1K4EA 4X55A 4X68A 5AQAA 3CZDA 3HLDA 1ESIA 4X53A 3UO9A 5CRFA 2WKHA 2DNSA 1U60A 1J9MA 5DF8A 4U0TA 5CGXA 4JPMA 1PZOA 3FWLA 3Q7VA 5DTSA 5E2GA 4EQIA 3BFCA 3UE1A 3VOZA 1K55C 3ZG0A 5FA7A 4S2MA 4LENA 4E3OA 3IWIA 1KVLA 4KZ8A 4EV4A 2JC7A 1Q2PA 4OPZA 1EROA 1KE4A 3ZFZA 1ZG4A 5FAQA 3ZNTA 1HD8A 3VP3A 5FQIA 2Y2PA 1NXYA 4B88A 2ZQAA 4S2PA 3EQVA 4OPYA 2XFSA 5D3OA 4KG2A 3NIAA 5G18A 2WAEA 4EBNA 1LLBA 1NY0A 1IEMA 4P6BA 2XR0A 1IYSA 1PYYA 3NDGA 4C75A 4X6TA 1DJCA 4OQHA 3HL9A 1JWZA 1Y54A 1K25A 5F82A 3N7WA 1FCNA 5CHUA 3D4FA 4NETA 1MWSA 3G2ZA 1XX2A 1GA0A 4K91A 3TG9A 3EQUA 4JKTA 4KENB 4LV3A 3DWKA 5DTTA 3SS4A 1RGYA 3V3SA 3AGDA 1YLTA 3G34A 2Y2KA 1IYPA 1K57C 3NC8A 3NI9A 3VFFA 3WRTA 2Y59A 1Q2QA 1QMEA 1IKIA 1KVMA 3C5AA 3MFDA 4KZ6A 1NZUA 4K0WA 4M3KA 3ZG8B 2ZD8A 5L2FA 2XQZA 1YLPA 1KE3A 3UPOA 3LY3A 5M1AA 3GMWA 1LL9A 3N8LA 1S6RA 1YQSA 1BLHA 1HVBA 3G31A 2Q9MA 1CK3A 1WYBA 3VP1A 3HLGA 2H0YA 3JYIA 5AQBA 4U3TA 3C4OA 5CGWA 4E3IA 4JF4A 4S2LA 1N4OA 2OLUA 5FASA 3ZHHA 3FZCA 3IH8A 2WZXA 5DVAA 4QJGA 2HDRA 2ZC7A 3IF6B 3M6BA 4P0MA 4RVAA 5FQKA 3MZFA 2Z2LB 3HUMA 3PBRA 4O7DA 3PBQA 2WGIA 2WGVA 3G32A 5GLCA 2V1ZA 3MZEA 4E3NA 2J9PA 1MWTA 4JXGA 1FCOA 4KQOA 2Y2JA 2WGWB 3FKVA 2XGNA 4ZTKA 5FI2A 1BT5A 4IVIA 2DCFA 2WADA 3VFHA 2HDSA 1NRFA 3N4IA 2RCXA 3TSGA 2EFXA 2G2UA 3RJUA 4PM8A 5TFQA 1XPBA 3PTEA 5HAPA 1ONGA 4KG5A 3SH7A 4B4XA 5HAIA 3ISGA 3UDFA 4HESA 1K56A 4L0LA 3HLBA 3SS3A 4MBHA 3UN7A 1W5DA 5CECA 1RCJA 2P9VB 1MPLA 4E3MA 4YINA 4OOYA 1XA7A 4OLGA 1TVFA 3V3RA 1FR1A 3WS2A 5FQMA 2EXBA 2ZLYA 5EVIC 3TOIA 3P09A 1L2SA 3PAEA 4R23A 1K55A 2PBYA 3MKEA 4BENA 1HTZA 1CI9A 3ZVTA 3ZVWA 3PBOA 1FCMA 3IXGA 1JTDA 5A92A 4XXRA 3LY4A 2J9OA 1KGGA 1KDSA 3FKWA 1BLSA 2QPNA 3BLMA 5EOEA 5EE8A 3W4QA 4DXCA 3IHAA 5KSCA 4OPQA 1H8ZA 2ZQ8A 3QHYA 3NY4A 4WEJA 3A3DA 1O07A 4FSFA 1I5QA 5DF9A 3VSLA 3DWZA 1K56D 5GL9A 4P85A 2Y2HA 5I94A 5E43A 2ZQCA 4LCMA 1NYMA 1CI8A 4GZBA 3VMAA 3PAGA 1MKIA 4H8RA 1GHMA 2Y2GA 4WELA 2RL3A 5FQQA 2BG1A 3CG5A 4BLMA 1W79A 1K54C 3S22A 3UE0A 2G2WA 3NCKA 2EXAA 4GKUA 4EUZA 4QY5A 2Y55A 1MY8A 2H10A 2Y91A 5F83A 1LI9A 3WS1A 4IBXA 2B5RA 1YT4A 1L0GA 3WRZA 3BEBA 5HARA 2Y4AA 1BUEA 2XLNA 3NDEA 3ZG7B 3ZDJA 5GHYA 3V50A 4OKPA 4S2IA 1LL5A 2XDMA 1SDNA 2ZC4B 2R9WA 4QD4A 4RX3A 3IQAA 4E3KA 1BTLA 4MBFA 5HW3A 4UA6A 1K54A 3E2KA 3Q07A 3VP4A 4Y0TA 1G6AA 2C5WB 5A90A 1BULA 2XFTA 2ZQ9A 3BYDA 5TR7A 1XKZA 1JWVA 1YMSA 3E2LA 3GR2A 3ZG5A 4FH4A 3HLFA 4FD8A 4KZ3A 3ITAA 1FR6A 1W8QA 4R3BA 1JVJA 1ZC2A 3QNBA 3OC2A 2JBFA 3O86A 4PM9A 4UAAA 1YMXA 2DRWA 4OONA 3SH9A 5GHXA 2I72A 3UPNA 4WMCD 4EBLA 4F94A 4HEFA 4ZBEA 1KGEA 2ZJ9A 3IF6C 3IXDA 1E25A 3O87A 2CC1A 4QHCA 3M2JA 3M2KA 4ZAMA 4DDYA 3I7JA 5CTNA 3VP2A 1BSGA 1LHYA 4WM9A 1EWZA 1L0DA 1MXOA 1ONHA 5JYPA 5EVLA 2WGWA 3AGEA 3G2YA 1SCWA 3W4OA 1GHPA 5EPHA 5FI7A 5EECA 5GHZA 2ZM0A 5EVIB 1XP4A 4E3JA 2QZ6A 4A5RA 2X71A 1FSWA 5FAOA 4Y0UA 4DF6A 1K57A 3BRMA 3UPPA 2C6WB 4DRTA 4KG6A 3HUOA 2ZMAA 1DJBA 4MBKA 1ALQA 1SKFA 5AQ9A 4BL3A 2ZM2A 3HLWA 3MXRA 1SDEA 2FFYA 1M40A 4D2OA 4ZJ2A 4DKIA 1IKGA 1ERMA 3SOIA 1ES5A 1PW1A 5EUAA 1WYCA 5TGFA 1RP5A 5A93A 2Y2NA 3A3JA 3V39A 4JF5A 2ZC6B 1PZPA 3IHBA 2V20A 2IWBA 2WAFA 2A3UA 3GQZA 5AQ7A 3Q1FA 1CEFA 5E2HA 4KZ9A 2EX2A 4ZJ3A 1G68A 3HLCA 3UDIA 5DF7A 4PM5A 4S2NC 5HAQA 1HZOA 4IVKA 1KGFA 2IWDA 3N6IA 5FQJA 2QMIA 3ITBA 3O88A 3SH8A 1YLZA 4GDNA 2Y2OA 5M19A 3M6HA 4WYYA 3FYZA 3CMZA 2OLVA 1JWPA 1PWGA 3PBSA 4JXWA 1K4FA 1TEMA 1I2SA 3GTCA 3DW0A 3IXHA 2XK1A 4UHUA 3UDXA 3BECA 4FH2A 4X56A 4LV0A 1NZOA 3V5MA 2HDQA 1ES2A 3HBRA 3HUNA 4GD6A 4OLDA 1PIOA 5F1GA 5GLDA 1XGJA 2HP5A 4UA7A 5GLBA 1GCEA 2V2FF 4HBUA 4OQIA 5EOOA 1XGIA 2WYXA 2EX6A 2OSUA 5BOHA 4JXVA 3Q7ZA 4KZBA 4LCLA 4PM6A 1ERQA 2Y2IA 3AGFA 3LO7A 4GNUA 3OCLA 3P98A 4XUXA 1L0FA 4QB8A 1K6SA 3LCEA 3IH9A 3O3VA 4CPKA 2GDNA 1IYQA 2WZZA 1C3BA 2OV5A 4OP8A 1PI5A 4YFMA 5J8XA 4S2NA 4RX2A 1YLYA 1M6KA 4KZ5A 1IYOA 2XD5A 1VM1A 2Y2QA 2Y2MA 3HLEA 4OOLA 1SHVA 1GA9A 1W8YA 4GDBA 1WE4A 4ID4A 1YLWA 4QU3A 5E2EA 2EFUA 4MLLA 1YLJA 5FATA 2P74A 5U47A 3UNWA 5HL1A 3QNCA 3PBTA 3A3EA 1IELA 1EI5A 1JTGA 4OOMA 3WS4A 4GD8A 4R4RA 1QMFA 1W7FA 1DJAA 4QY6A 4OH0A 3C4PA 2JCHA 4GOGA 3C7VA 4MNRA 4JBFA 4GB7A 4E6XA 1MBLA 4GN2A 2ZQ7A 3NBLA 4WZ5C 2Y2LA 1PW8A 3S4XA 2XD1A 2XH9A 1MWUA 4S2OA 4R0QA 3OZHA 1S0WA 2BLSA 2J7VA 4WEKA 4HBTA 4DXBA 3UY6A 3MKFA 4EWFA 2VGJA 4DE0A 1H8YA 3OPPA 2E8IA 3MZDA 1FOFA 4NK3A 4R3JA 3VSKA 1CEGA 4K0XA 4KQRA 4DDSA 2XF3A 3MXSA 4OP5A 3G30A 1KDWA 4OQ0A 3UE3A 4N1HA 4R4SA 1XXMA 4WMCA 5DTKA 5FI6A 1E3UA 5FQ9A 4S2KA 5M18A 3N8SA 2WUQA 3IF6A 3S1YA
chains in the Genus database with same CATH superfamily
4BD1A 2D01A 1K38A 4BBUA 3OPLA 2J8YA 3ICYA 3MBZA 1DY6A 4HOIA 4JLFA 1OJGA 1G6OA 1NLZA 2VGKA 4JGPA 5DFXA 3FV7A 4KZ7A 2ZOHA 3GRJA 1BLPA 3K3CA 3W2ZA 4I39A 3MMHA 3LEZA 2VX8A 4MEZA 1I2WA 3PR6A 4X1MA 4Y5FA 4EEUA 3BY9A 2P9VA 1RGZA 3HVFA 2VGLM 5A91A 4RYEA 3Q81A 1Z09A 4Y0OA 3VV4A 2K31A 4LPZA 3RXXA 1TS8A 2ZM8A 1ZG6A 3E4PA 3TRCA 4PM7A 4IBRA 2KX6A 4B4ZA 3GDIA 4UA9A 3S7NA 1H5XA 4KQQA 2PHYA 1D1JA 4Z9QA 2ZQDA 3BM6A 3MS6A 3P7NA 4BD0A 4Q0JA 1MWRA 1GSWA 3W4PA 3PBNA 5HWVA 3GVBA 1F2KA 2O9AA 4WBGA 4CJNA 4WZ4A 5IS1A 4PPRA 2PBDP 5CGSA 3BFGA 2R9XA 2FH5A 4E6WA 3GV9A 2H0TA 4PMAA 4HI4A 1NWZA 4E3LA 3BQ8A 3UE6A 3OBFA 5DKKA 5AQAA 2WKQA 1J9MA 5DTSA 3BFCA 1HLUP 1Y28A 3BJNA 2JKGA 1K55C 4S2MA 1KVLA 2VEAA 4KZ8A 3MQ0A 4JGQA 1KE4A 3ZNTA 1CJFA 4ETXA 2V9AA 2ZQAA 2XFSA 4KG2A 2XR0A 1IYSA 4X6TA 3JPUA 3B42A 3HL9A 1JWZA 1Y4OA 1OPXA 2KOIA 4K91A 4JKTA 3MF0A 4LV3A 1G28A 3G34A 1QMEA 3C5AA 4KZ6A 4K0WA 1LSVA 4M4XA 2XQZA 3UPOA 4DJ3A 1HVBA 2D02A 1JNUA 2JKFA 4U3TA 5CGWA 4I38A 4S2LA 1N4OA 2OLUA 4EU0A 1S67L 5L10A 3HUMA 1N9NA 2V1BA 4IUKA 1FCOA 2XGNA 4G3WA 3KSIA 1SZVA 2HDSA 3CLOA 2EFXA 2G2UA 3RJUA 5TFQA 3D9YA 3E98A 3F1PB 4XT2B 4OOYA 2WKPA 1TVFA 1FR1A 5EVIC 1L2SA 2PBYA 2ZL1B 5HDDA 2MJ6A 2OAP1 2QJ7A 3EOIA 2B18A 2HJEA 3D3OA 5A92A 2J9OA 2IA2A 1KGGA 1KDSA 3FKWA 1J3WA 3W4QA 3BLMA 5EOEA 3A3DA 1I5QA 3R7WA 5HPFA 3VSLA 1K56D 2H28A 5E43A 2ZQCA 2JKRM 3LEQA 4QWOA 3VMAA 3LIEA 1MKIA 1OTDA 2RL3A 2BG1A 2K7SA 2UV0E 1K54C 3CWFA 3S22A 3NCKA 2Y55A 2Y91A 4HH2A 2LB5A 2QYBA 2O0YA 3BEBA 2XLNA 3PHYA 4S2IA 3IQAA 4EUVA 2AVXA 4Y0TA 1G6AA 5HL6A 3KYEA 1JWVA 3GR2A 3E2LA 1PRQA 3HLFA 4FD8A 4KZ3A 4KUKA 3UMDA 2JBFA 1YMXA 2DRWA 3H7WA 4I3JA 2VJWA 5A8BA 4F94A 3IXDA 2JKTI 2J3TC 3M2JA 2HF6A 1LHYA 4WUJA 1XJ4A 5J3WA 5G4YA 5EECA 5EVIB 3KSHA 1LL8A 2XSSA 2C6WB 4KG6A 3BQAA 4MBKA 4BL3A 2HJ9C 3MXRA 1M40A 5EM1A 1IKGA 4Y13A 1PW1A 3A3JA 3UB6A 3V39A 4B9OA 1PZPA 2V20A 3GQZA 3Q1FA 3UDIA 1G68A 4PM5A 4S2NC 1TS0A 3O88A 2HGVA 2Q0OA 5M19A 3ULFA 3M6HA 3QP5A 4CLCD 3FYZA 2OLVA 1F98A 3GTCA 3IXHA 5F69A 1D06A 2HDQA 3HUNA 5GLDA 2HP5A 4PHTA 4OQIA 1YSQA 4UQIS 1VETB 4JXVA 3SZTA 4KZBA 4PM6A 3NULA 4QB8A 3IH9A 2XRNA 1T1AA 2GDNA 4OP8A 5J8XA 2XA7M 4S2NA 4RX2A 1IYOA 5L8MA 1SHVA 5E2EA 1GA9A 5L2FA 1YLWA 3B33A 5U47A 2A2LA 3A3EA 1IELA 1JTGA 3WS4A 4R4RA 3CAXA 1W7FA 1DJAA 4QY6A 4R6LA 3T1SA 4JBFA 4GB7A 1VETA 1MBLA 5TBMA 3RFBA 4WZ5C 3T1XA 2Y2LA 4S2OA 2BLSA 4DXBA 4WEKA 2OWJA 4NK3A 4L9GA 4R3JA 3VSKA 4KQRA 3T4TA 4Y17A 2XF3A 3MXSA 4HJ6A 1LSWA 4WMCA 5FQ9A 1E3UA 5M18A 4BWIA 2P04A 4MN6A 3S1YA 1CF0A 5CERA 5F1FA 1MZUA 5AVFA 3C7UA 3OPRA 1OTBA 3K3DA 1E4DA 2WKRA 4R70A 2FFFB 2EX8A 1FSYA 5CEDA 3H9WA 2EWVA 4CLCB 1E3UD 5FDHA 3CJMA 3DTKA 1AXBA 1LI0A 2VGLS 1L0EA 4LV2A 3JVVA 3WS5A 2WKEA 5CHJA 5HX9A 3IT9A 2HP9A 4ZJ1A 4FCFA 5HFOA 3LR4A 2JE5A 3NOUC 1DP8A 2EX9A 4P87A 2GJ3A 3N8RA 1P9RA 1PWCA 3H7WB 2HDUA 4S2JA 4MCWA 3FPWA 3HREA 3BLSA 3MSHA 3VP0A 5CXWA 3Q82A 4K08A 1NRJA 4C6YA 4G3VA 4YWZA 3PXPA 1FQGA 1TD5A 3LIBA 4Y3IA 2PU4A 3IF5A 3DTMA 4EETB 4X69A 4R1GA 2ZC3B 4RA7A 1YSPA 3ZNYA 1K4EA 2KDKA 3HLDA 4X53A 1ESIA 5CRFA 1PZOA 3FWLA 3UE1A 1UWNX 4HIAA 2VV6A 3ZG0A 5FA7A 4LENA 2Y8HA 3IWIA 4GW9A 1Q2PA 1FILA 2VA0A 3VP3A 4FUWA 3CUEA 3T4QA 2WAEA 1LLBA 3FC7A 3NDGA 2P7JA 4OQHA 2PRFA 3D4FA 3G2ZA 2YKHA 1N9LA 3VOLA 3TG9A 4CQHA 1RGYA 3LI8A 3AGDA 1K57C 3WRTA 3VFFA 2BTFP 1NZUA 4M3KA 1YLPA 1KE3A 1LL9A 3N8LA 1S4SA 3L7HA 1BLHA 5HDCA 2GNXA 3HLGA 2H0YA 5AQBA 3E4OA 5FL3A 5DVAA 4MDZA 4P0MA 3QP2A 2Z2LB 3C8CA 3MXQA 3F1NA 4E3NA 4ETZA 2Y2JA 4ZTKA 5FI2A 5DKLA 4MMNA 4IVIA 2WADA 4HP4A 3N4IA 1EW0A 2RCXA 4PM8A 1XPBA 5HAPA 4KG5A 3SH7A 4B4XA 3ISGA 4HESA 1K56A 4L0LA 5CECA 5C5KA 3LR3A 1MPLA 2L4RA 1XA7A 3V3RA 4R23A 4BENA 1HTZA 1CI9A 2ZL1A 5HZHA 2JKRI 3BW6A 4XXRA 3UB5P 1BLSA 2ACGA 2J3WA 3VE3A 5EE8A 3IHAA 5KSCA 1YKDA 1H8ZA 3QHYA 3NY4A 1XJ6A 3DWZA 2Y2HA 2NUTC 4LCMA 1NYMA 3ZQ5A 4GZBA 5EM0A 5F68A 2Y2GA 5FQQA 1SKOB 1W79A 3UE0A 2G2WA 2EXAA 4GKUA 3CPTB 5F83A 3WS1A 3LFVA 2M7UA 1YT4A 3DTEA 5HARA 1BUEA 3LGOA 3V50A 1P0ZA 1LL5A 2LB9A 1SDNA 4JGRA 1BTLA 2NUPC 5HW3A 2OWHA 1ACFA 3Q07A 3VP4A 4IUHA 2L1MA 4B93A 2PT7A 3ZG5A 4FH4A 5EFWA 1ZC2A 4DJ2A 3O86A 4PM9A 4UAAA 4GLQA 3SH9A 3UPNA 4WMCD 4HEFA 3O87A 3M2KA 3KO6A 5HDSA 4WM9A 1MXOA 3W4OA 5FI7A 4EQ1A 4AFIA 5GHZA 1GSVA 1N9OA 4CLCA 4E3JA 1OT6A 4L9EA 4Y0UA 2L0WA 3ZYTA 5HD3A 2ZMAA 4KQDA 1SKFA 2W27A 3HLWA 2FFYA 4ZJ2A 2V8FA 1ERMA 2B95A 5A93A 4JGOA 2WAFA 2A3UA 5AQ7A 1CEFA 1UWPX 4KZ9A 2EX2A 5DF7A 5HAQA 1XJ2A 1KGFA 2IWDA 4RQ9A 4BBVA 2K2NA 2INWA 3UB9A 2GX5A 4FTXA 2Y2OA 1YPRA 1PWGA 4FH2A 4X56A 1DP9A 3F1OB 1BYWA 5F1GA 2WYXA 3Q7ZA 3AGFA 2Y2IA 3R7WB 3KYZA 4GNUA 3OCLA 4E04A 4XUXA 2XA7S 3RTYA 3IBRA 5DJTA 4CPKA 4Z1WA 4NXFA 3T4KA 4YFMA 1PI5A 1FIKA 2VKSA 2Y2MA 1OJ5A 4OOLA 2J3TD 5F5YA 3HLEA 5FATA 1OTIA 5HL1A 1SKOA 1EI5A 4NXBA 1P9WA 4E6XA 2ZQ7A 3KYQA 3S4XA 1PW8A 1V9ZA 1MWUA 4R0QA 1S0WA 4EWFA 4HBTA 3UY6A 3TE8A 2VGJA 4DE0A 1H8YA 2E8IA 3MZDA 4DMZA 5HPIA 5J7EA 4K0XA 4DDSA 2W3HA 3G30A 4OP5A 1OTAA 4R4SA 5DTKA 3QP8A 1XJ3A 4GS9A 4N92A 1KE0A 4LGWA 3OCNA 3OPHA 3WWXA 3IX3A 2DMWA 5CTMA 1PI4A 4EERA 4BJPA 4KUOA 5IU1A 2G7UA 2QJ5A 4EBPA 3LIDA 4P6ZS 4Y7PA 3KSFA 5EVID 2A24A 1Z6FA 4JXSA 2PYRA 4I3IA 3BFFA 2WKIA 5GLAA 2XEPA 2OOLA 3F1OA 4OQGA 1K0KA 4XT2A 4HJ4A 3SS5A 3BFDA 2UWXA 1ZKJA 2W1RA 3F1NB 2W0NA 1ESUA 1NJ4A 3WS0A 5LBRA 3IXBA 1YM1A 1ZHHB 3BY8A 1BLCA 3LYXA 3LR0A 1ES3A 1PWDA 1PNEA 4L9FA 3A3IA 3CITA 3GSGA 2O9CA 5FAPA 5DJUA 1O7EA 1XA1A 3NECA 3QP4A 4N9LA 4IEDA 1TDGA 3IWQA 2PR5A 2ZMFA 2HV1A 3IX8A 5MC7A 4KZ4A 5KMWA 4DE3A 5JYOA 3A3FA 3UB7A 5EVEA 3T1QB 2PU2A 1ES4A 3RXWA 2I9VA 2H5SA 2GZAA 2PR6A 3G4PA 2OAQ1 4G3KA 4HY8A 4LV1A 5L09A 4X55A 4X25A 2V1AA 4GJ4A 3CZDA 3UO9A 2WKHA 4ESPA 1U60A 4JPMA 3Q7VA 4EQIA 5E2GA 1T1CA 3DTIA 1GSXA 2ZOIA 2JC7A 3OLOA 4OPZA 1F5MA 1WA9A 3ZFZA 1ZG4A 5FAQA 1HD8A 4PAUA 2Y2PA 4S2PA 3EQVA 4OPYA 3EEHA 5G18A 3NIAA 1NY0A 1IEMA 1TS7A 4C75A 3H82B 1DJCA 5F82A 1FCNA 5HD5A 3U4LP 5CHUA 3A0SA 4NETA 1XX2A 1GA0A 3C38A 1ZTUA 3DWKA 1G5UA 3V3SA 4EXOA 2Y2KA 1IYPA 1OTEA 2VV7A 1Q2QA 3TW8A 1KVMA 3MFDA 4LRXC 4ME4A 3T4OA 5M1AA 1S6RA 1YQSA 3G31A 2Q9MA 5HWTA 3C4OA 5IT5A 4E3IA 2W3EA 3CUEC 4JF4A 5FASA 3IH8A 2WZXA 4WL9A 4QJGA 2HDRA 2ZC7A 3IF6B 3M6BA 4RVAA 5FQKA 3MZFA 2CMNA 5TJJA 3PBRA 4O7DA 3PBQA 2WGIA 3S7OA 4NKPA 5GLCA 2V1ZA 3MZEA 3IS2A 1MWTA 4JXGA 2WGWB 2PAVP 3NOPC 1NRFA 3UMEA 3TSGA 2Z6CA 3VE4A 1X0OA 3E4QA 3UN7A 1VHMA 3P01A 2P9VB 4E3MA 2EXBA 3TOIA 5FEFA 4DN0A 3PAEA 4EW7A 3PBOA 1FCMA 3IXGA 1JTDA 3LY4A 4LRZE 4OPQA 1O07A 2Y79A 5DF9A 5GL9A 4P85A 3FPVA 4ARZB 1CI8A 3PAGA 3CI6A 1PFLA 1S4RA 4H8RA 3S7QA 4WELA 3K2NA 1MY8A 2H10A 3IBJA 1LI9A 2W3GA 3WRZA 2Y4AA 3ZDJA 2P08A 2ZBBA 3UB8A 4OKPA 2XDMA 4D60A 4RX3A 4QD4A 2R9WA 4E3KA 3V67A 4UA6A 1K54A 3E2KA 5A90A 2V0UA 1BULA 2XFTA 5TR7A 2ZQ9A 4CLCE 4GS9B 4R3BA 1JVJA 3QNBA 3OC2A 5GHXA 2I72A 4EBLA 5G4ZA 4ZBEA 1KGEA 3IF6C 2B02A 4QHCA 5KIZA 4ZAMA 5CTNA 1BSGA 5F6AA 4H6JB 3G2YA 1IOUA 3EEAA 2W3FA 1XP4A 2QZ6A 4A5RA 2X71A 4NG2A 4IJGA 1K57A 3BRMA 3UPPA 4DRTA 3LIAA 5AQ9A 1DJBA 1ALQA 2V8CA 2JKTM 2ZM2A 1SDEA 4D2OA 2XROA 1ES5A 5TGFA 2Y2NA 4DF6A 4JF5A 2ZC6B 4UEYA 2IWBA 5E2HA 5AJGA 2E8JA 4IVKA 3NOTC 5FQJA 3ITBA 1A0KA 3SH8A 1YLZA 4GDNA 3MFXA 2EWWA 4I5SA 4WYYA 3CMZA 1JWPA 3PBSA 3DW0A 2XK1A 3BECA 3F1PA 4LV0A 1F9IA 1ES2A 3HJIA 1NLYA 1XGJA 3OOVA 1XFNA 3PYPA 1GCEA 4HBUA 2OSUA 1ERQA 3EWKA 3O5YA 2WZZA 2OV5A 3GECA 3FG8A 4KZ5A 1W8YA 4GDBA 4ID4A 3HCYA 2EFUA 4MLLA 2P74A 3QNCA 3PBTA 2W3DA 1QMFA 3C4PA 2O9BA 4WN5A 2XD1A 4O0PA 4HHDA 3OZHA 4LFUA 1VEUA 3MKFA 2M7VA 4LLOB 3IS2B 1CEGA 1W63Q 1LSXA 1KDWA 4OQ0A 4N1HA 1XXMA 4PKYG 4S2KA 2WUQA 3IF6A 2Q9NA 1GHIA 2V0WA 5DFYA 3T50A 4U0XA 4Q8IA 1TDLA 5KZHA 3ZCZA 3Q7VB 5CHMA 1K6RA 2FZ0A 2X02A 1DP6A 2PD8A 1OMEA 2X01A 1KOUA 5E2FA 4DE2A 3G35A 3U2AA 4GHIB 3BFEA 4UQIM 3CPTA 4N9KA 1T18A 4BQMA 4C3QA 1NYYA 4OVDA 4H6JA 4I3AA 1TF1A 4ZDXA 5KSHA 1BZAA 4N1XA 2HPBA 3IWOA 3T4JA 4DE1A 4XUZA 3A0VA 4KZAA 4Q0HA 5AVEA 1VQQA 2HP6A 4OPRA 2EA9A 3ZG9B 4JF6A 2Z2MB 3KSGA 4HQAA 1N9BA 5CX7A 2WK0A 4II7A 4PKYA 5FSRA 1S1YA 1VB6A 3B3XA 3VOYA 4CLCC 4BL2A 1VEUB 4WZ5A 5EVIA 2IWCA 3W8KA 3ZGAB 3QP1A 1P97A 2A49A 3LICA 4YOFA 5L07A 1TS6A 3T1RA 2ZC5B 5CEBA 5IHVA 4X68A 2O99A 2DNSA 5DF8A 3SW1A 4U0TA 5CGXA 4NEED 2M1CA 2QKPA 4EEPA 4P6ZM 3VOZA 3G6OA 4E3OA 4EV4A 4HH3A 1T1BA 1EROA 1S66L 4X1LA 3LUQA 5FQIA 2YKFA 1NXYA 4B88A 5D3OA 4EBNA 4P6BA 5J4EA 1PYYA 4FOFA 1Y54A 1K25A 3N7WA 1MWSA 1IFQA 2KLIA 3EQUA 4KENB 3E0YA 3B47A 4MN5A 5DTTA 3SS4A 1YLTA 4O8GA 2VK3A 3NC8A 3NI9A 2Y59A 1IKIA 3ZG8B 2ZD8A 4Y2FA 2J80A 3LY3A 3T4LA 3GMWA 3VP1A 2W1TB 1CK3A 1WYBA 2QHKA 3JYIA 4O01A 3ZHHA 3C30A 3FZCA 3DBAA 3LR5A 2WGVA 3G32A 1UGUA 2J9PA 1H3QA 4KQOA 3HJKA 3FKVA 1BT5A 2DCFA 3VFHA 4HJ3A 4LRYC 4YNRA 3BWLA 2HZ5A 3PTEA 1ONGA 4IHQA 5HAIA 3UDFA 3HLBA 3SS3A 4MBHA 1LT0A 1W5DA 1RCJA 4YINA 4OLGA 3WS2A 5FQMA 2ZLYA 3P09A 1K55A 3MQQA 3MKEA 4HP9A 3ZVTA 3ZVWA 4WLAA 3R4KA 1S1ZA 2QPNA 4DXCA 4F3LB 2ZQ8A 4WEJA 4FSFA 2BASA 3DAVA 5I94A 4GCZA 4Q0IA 5I5LA 4ZRRA 1GHMA 3L9KA 1H0MA 3CG5A 4BLMA 3S7PA 4WF0A 4NXEA 3NJAA 4EUZA 4QY5A 4IBXA 2B5RA 4EESA 1L0GA 3LI9A 4R3AA 2VZWA 3NDEA 3ZG7B 5GHYA 2VLGA 2ZC4B 1V9YA 4MBFA 3A0RA 2Z6DA 3KX0X 2C5WB 3T4SA 3D72A 5FDSA 3BYDA 3MJQA 5EV0A 1XKZA 1YMSA 3NHQA 3ITAA 1FR6A 1W8QA 1XFQA 3C2WA 4Y15A 5HSQA 2ZMVA 3MR0A 4OONA 4R38A 2ZJ9A 1E25A 2CC1A 3JVUA 4GHIA 4DDYA 5TBMB 3I7JA 3RH8B 3VP2A 1EWZA 1L0DA 1ONHA 5JYPA 5EVLA 2WGWA 3AGEA 1SCWA 1CQAA 1GHPA 5EPHA 2ZM0A 3IX4A 2R78A 1FSWA 5FAOA 1ODVA 1DRMA 3HUOA 4NXGA 2A24B 1OT9A 4DKIA 1L3LA 3TJZC 3SOIA 5K5BA 5EUAA 1WYCA 1RP5A 3IHBA 1H8MA 2W1TA 4ZJ3A 3T12B 3HLCA 1HZOA 2VV8A 3N6IA 2QMIA 1STZA 3EGDC 4HNBA 3QP6A 4MN7A 2QWSA 4JXWA 1K4FA 1YAXA 1TEMA 1I2SA 4UHUA 1AWIA 3UDXA 4QPRA 1NZOA 3EGXC 3V5MA 3HBRA 1D7EA 4GD6A 4OLDA 1PIOA 3H82A 4ARZA 1T19A 4UA7A 5GLBA 2V2FF 5EOOA 1XGIA 4BMWA 2EX6A 5BOHA 4LCLA 3LIFA 5FEGA 3LO7A 3P98A 1L0FA 1K6SA 3LCEA 3O3VA 1IYQA 1C3BA 1YLYA 1M6KA 1MC0A 2PYPA 2XD5A 1VM1A 2Y2QA 3CHWP 3MQOA 4QU3A 1WE4A 2PD7A 3UNWA 1YLJA 2JHEA 4OOMA 4GD8A 4BBTA 1W63M 4OH0A 5HWWA 2JCHA 4GOGA 3C7VA 4MNRA 2JN7A 4GN2A 3NBLA 2PDRA 2XH9A 2J7VA 3OPPA 1FOFA 4F3LA 3UE3A 5FI6A 3N8SA 1MKMA
chains in the Genus database with same CATH topology
2Q9NA 4BD1A 5CERA 5F1FA 1K38A 1GHIA 1KE0A 3OPLA 2J8YA 3MBZA 4U0XA 3C7UA 1DY6A 3OPRA 4Q8IA 1TDLA 4JLFA 3OCNA 1E4DA 5KZHA 3OPHA 3WWXA 2FFFB 2EX8A 3Q7VB 5CHMA 3ZCZA 1K6RA 2VGKA 1FSYA 2X02A 3FV7A 5CTMA 1PI4A 5CEDA 4BJPA 4KZ7A 3GRJA 1BLPA 1E3UD 1OMEA 4EBPA 2X01A 5E2FA 4DE2A 5FDHA 3G35A 3LEZA 4MEZA 4Y7PA 1I2WA 3CJMA 5EVID 1Z6FA 4JXSA 3BFFA 1AXBA 1LI0A 3BFEA 2WKIA 1L0EA 4N9KA 5GLAA 2XEPA 4LV2A 4OQGA 4BQMA 2P9VA 1RGZA 3SS5A 4C3QA 3HVFA 3BFDA 2UWXA 1NYYA 4OVDA 1ZKJA 3WS5A 2WKEA 5CHJA 5A91A 4RYEA 3Q81A 5HX9A 3IT9A 2HP9A 4ZJ1A 1ESUA 1NJ4A 4FCFA 4Y0OA 5HFOA 2JE5A 4ZDXA 3WS0A 2EX9A 5KSHA 3IXBA 1YM1A 1BZAA 3RXXA 1BLCA 4N1XA 2HPBA 4P87A 3IWOA 2ZM8A 1ZG6A 3N8RA 1ES3A 1PWCA 1PWDA 2HDUA 4DE1A 4S2JA 4XUZA 4KZAA 3A3IA 3HREA 4PM7A 1VQQA 2HP6A 4IBRA 3BLSA 3GSGA 4OPRA 5FAPA 3VP0A 5CXWA 3Q82A 4B4ZA 1O7EA 3ZG9B 1XA1A 4JF6A 4UA9A 1H5XA 4KQQA 4C6YA 2Z2MB 1N9BA 2ZQDA 4Z9QA 2WK0A 3BM6A 4N9LA 4IEDA 1TDGA 3IWQA 4BD0A 1FQGA 1MWRA 4N92A 4KZ4A 5FSRA 3B3XA 5KMWA 4DE3A 5JYOA 3VOYA 3W4PA 3PBNA 3A3FA 3GVBA 4BL2A 4WZ5A 5EVIA 2IWCA 4WBGA 3W8KA 3ZGAB 2PU2A 1ES4A 2PU4A 4WZ4A 4CJNA 2A49A 3IF5A 4PPRA 3RXWA 5CGSA 3DTMA 3BFGA 2H5SA 2R9XA 4E6WA 3G4PA 3GV9A 2H0TA 4PMAA 2ZC5B 4X69A 5IHVA 5CEBA 4LV1A 4R1GA 2ZC3B 4RA7A 4E3LA 3ZNYA 1K4EA 4X55A 4X68A 5AQAA 3CZDA 3HLDA 1ESIA 4X53A 3UO9A 5CRFA 2WKHA 2DNSA 1U60A 1J9MA 5DF8A 4U0TA 5CGXA 4JPMA 1PZOA 3FWLA 3Q7VA 5DTSA 5E2GA 4EQIA 3BFCA 3UE1A 3VOZA 1K55C 3ZG0A 5FA7A 4S2MA 4LENA 4E3OA 3IWIA 1KVLA 4KZ8A 4EV4A 2JC7A 1Q2PA 4OPZA 1EROA 1KE4A 3ZFZA 1ZG4A 5FAQA 3ZNTA 1HD8A 3VP3A 5FQIA 2Y2PA 1NXYA 4B88A 2ZQAA 4S2PA 3EQVA 4OPYA 2XFSA 5D3OA 4KG2A 3NIAA 5G18A 2WAEA 4EBNA 1LLBA 1NY0A 1IEMA 4P6BA 2XR0A 1IYSA 1PYYA 3NDGA 4C75A 4X6TA 1DJCA 4OQHA 3HL9A 1JWZA 1Y54A 1K25A 5F82A 3N7WA 1FCNA 5CHUA 3D4FA 4NETA 1MWSA 3G2ZA 1XX2A 1GA0A 4K91A 3TG9A 3EQUA 4JKTA 4KENB 4LV3A 3DWKA 5DTTA 3SS4A 1RGYA 3V3SA 3AGDA 1YLTA 3G34A 2Y2KA 1IYPA 1K57C 3NC8A 3NI9A 3VFFA 3WRTA 2Y59A 1Q2QA 1QMEA 1IKIA 1KVMA 3C5AA 3MFDA 4KZ6A 1NZUA 4K0WA 4M3KA 3ZG8B 2ZD8A 5L2FA 2XQZA 1YLPA 1KE3A 3UPOA 3LY3A 5M1AA 3GMWA 1LL9A 3N8LA 1S6RA 1YQSA 1BLHA 1HVBA 3G31A 2Q9MA 1CK3A 1WYBA 3VP1A 3HLGA 2H0YA 3JYIA 5AQBA 4U3TA 3C4OA 5CGWA 4E3IA 4JF4A 4S2LA 1N4OA 2OLUA 5FASA 3ZHHA 3FZCA 3IH8A 2WZXA 5DVAA 4QJGA 2HDRA 2ZC7A 3IF6B 3M6BA 4P0MA 4RVAA 5FQKA 3MZFA 2Z2LB 3HUMA 3PBRA 4O7DA 3PBQA 2WGIA 2WGVA 3G32A 5GLCA 2V1ZA 3MZEA 4E3NA 2J9PA 1MWTA 4JXGA 1FCOA 4KQOA 2Y2JA 2WGWB 3FKVA 2XGNA 4ZTKA 5FI2A 1BT5A 4IVIA 2DCFA 2WADA 3VFHA 2HDSA 1NRFA 3N4IA 2RCXA 3TSGA 2EFXA 2G2UA 3RJUA 4PM8A 5TFQA 1XPBA 3PTEA 5HAPA 1ONGA 4KG5A 3SH7A 4B4XA 5HAIA 3ISGA 3UDFA 4HESA 1K56A 4L0LA 3HLBA 3SS3A 4MBHA 3UN7A 1W5DA 5CECA 1RCJA 2P9VB 1MPLA 4E3MA 4YINA 4OOYA 1XA7A 4OLGA 1TVFA 3V3RA 1FR1A 3WS2A 5FQMA 2EXBA 2ZLYA 5EVIC 3TOIA 3P09A 1L2SA 3PAEA 4R23A 1K55A 2PBYA 3MKEA 4BENA 1HTZA 1CI9A 3ZVTA 3ZVWA 3PBOA 1FCMA 3IXGA 1JTDA 5A92A 4XXRA 3LY4A 2J9OA 1KGGA 1KDSA 3FKWA 1BLSA 2QPNA 3BLMA 5EOEA 5EE8A 3W4QA 4DXCA 3IHAA 5KSCA 4OPQA 1H8ZA 2ZQ8A 3QHYA 3NY4A 4WEJA 3A3DA 1O07A 4FSFA 1I5QA 5DF9A 3VSLA 3DWZA 1K56D 5GL9A 4P85A 2Y2HA 5I94A 5E43A 2ZQCA 4LCMA 1NYMA 1CI8A 4GZBA 3VMAA 3PAGA 1MKIA 4H8RA 1GHMA 2Y2GA 4WELA 2RL3A 5FQQA 2BG1A 3CG5A 4BLMA 1W79A 1K54C 3S22A 3UE0A 2G2WA 3NCKA 2EXAA 4GKUA 4EUZA 4QY5A 2Y55A 1MY8A 2H10A 2Y91A 5F83A 1LI9A 3WS1A 4IBXA 2B5RA 1YT4A 1L0GA 3WRZA 3BEBA 5HARA 2Y4AA 1BUEA 2XLNA 3NDEA 3ZG7B 3ZDJA 5GHYA 3V50A 4OKPA 4S2IA 1LL5A 2XDMA 1SDNA 2ZC4B 2R9WA 4QD4A 4RX3A 3IQAA 4E3KA 1BTLA 4MBFA 5HW3A 4UA6A 1K54A 3E2KA 3Q07A 3VP4A 4Y0TA 1G6AA 2C5WB 5A90A 1BULA 2XFTA 2ZQ9A 3BYDA 5TR7A 1XKZA 1JWVA 1YMSA 3E2LA 3GR2A 3ZG5A 4FH4A 3HLFA 4FD8A 4KZ3A 3ITAA 1FR6A 1W8QA 4R3BA 1JVJA 1ZC2A 3QNBA 3OC2A 2JBFA 3O86A 4PM9A 4UAAA 1YMXA 2DRWA 4OONA 3SH9A 5GHXA 2I72A 3UPNA 4WMCD 4EBLA 4F94A 4HEFA 4ZBEA 1KGEA 2ZJ9A 3IF6C 3IXDA 1E25A 3O87A 2CC1A 4QHCA 3M2JA 3M2KA 4ZAMA 4DDYA 3I7JA 5CTNA 3VP2A 1BSGA 1LHYA 4WM9A 1EWZA 1L0DA 1MXOA 1ONHA 5JYPA 5EVLA 2WGWA 3AGEA 3G2YA 1SCWA 3W4OA 1GHPA 5EPHA 5FI7A 5EECA 5GHZA 2ZM0A 5EVIB 1XP4A 4E3JA 2QZ6A 4A5RA 2X71A 1FSWA 5FAOA 4Y0UA 4DF6A 1K57A 3BRMA 3UPPA 2C6WB 4DRTA 4KG6A 3HUOA 2ZMAA 1DJBA 4MBKA 1ALQA 1SKFA 5AQ9A 4BL3A 2ZM2A 3HLWA 3MXRA 1SDEA 2FFYA 1M40A 4D2OA 4ZJ2A 4DKIA 1IKGA 1ERMA 3SOIA 1ES5A 1PW1A 5EUAA 1WYCA 5TGFA 1RP5A 5A93A 2Y2NA 3A3JA 3V39A 4JF5A 2ZC6B 1PZPA 3IHBA 2V20A 2IWBA 2WAFA 2A3UA 3GQZA 5AQ7A 3Q1FA 1CEFA 5E2HA 4KZ9A 2EX2A 4ZJ3A 1G68A 3HLCA 3UDIA 5DF7A 4PM5A 4S2NC 5HAQA 1HZOA 4IVKA 1KGFA 2IWDA 3N6IA 5FQJA 2QMIA 3ITBA 3O88A 3SH8A 1YLZA 4GDNA 2Y2OA 5M19A 3M6HA 4WYYA 3FYZA 3CMZA 2OLVA 1JWPA 1PWGA 3PBSA 4JXWA 1K4FA 1TEMA 1I2SA 3GTCA 3DW0A 3IXHA 2XK1A 4UHUA 3UDXA 3BECA 4FH2A 4X56A 4LV0A 1NZOA 3V5MA 2HDQA 1ES2A 3HBRA 3HUNA 4GD6A 4OLDA 1PIOA 5F1GA 5GLDA 1XGJA 2HP5A 4UA7A 5GLBA 1GCEA 2V2FF 4HBUA 4OQIA 5EOOA 1XGIA 2WYXA 2EX6A 2OSUA 5BOHA 4JXVA 3Q7ZA 4KZBA 4LCLA 4PM6A 1ERQA 2Y2IA 3AGFA 3LO7A 4GNUA 3OCLA 3P98A 4XUXA 1L0FA 4QB8A 1K6SA 3LCEA 3IH9A 3O3VA 4CPKA 2GDNA 1IYQA 2WZZA 1C3BA 2OV5A 4OP8A 1PI5A 4YFMA 5J8XA 4S2NA 4RX2A 1YLYA 1M6KA 4KZ5A 1IYOA 2XD5A 1VM1A 2Y2QA 2Y2MA 3HLEA 4OOLA 1SHVA 1GA9A 1W8YA 4GDBA 1WE4A 4ID4A 1YLWA 4QU3A 5E2EA 2EFUA 4MLLA 1YLJA 5FATA 2P74A 5U47A 3UNWA 5HL1A 3QNCA 3PBTA 3A3EA 1IELA 1EI5A 1JTGA 4OOMA 3WS4A 4GD8A 4R4RA 1QMFA 1W7FA 1DJAA 4QY6A 4OH0A 3C4PA 2JCHA 4GOGA 3C7VA 4MNRA 4JBFA 4GB7A 4E6XA 1MBLA 4GN2A 2ZQ7A 3NBLA 4WZ5C 2Y2LA 1PW8A 3S4XA 2XD1A 2XH9A 1MWUA 4S2OA 4R0QA 3OZHA 1S0WA 2BLSA 2J7VA 4WEKA 4HBTA 4DXBA 3UY6A 3MKFA 4EWFA 2VGJA 4DE0A 1H8YA 3OPPA 2E8IA 3MZDA 1FOFA 4NK3A 4R3JA 3VSKA 1CEGA 4K0XA 4KQRA 4DDSA 2XF3A 3MXSA 4OP5A 3G30A 1KDWA 4OQ0A 3UE3A 4N1HA 4R4SA 1XXMA 4WMCA 5DTKA 5FI6A 1E3UA 5FQ9A 4S2KA 5M18A 3N8SA 2WUQA 3IF6A 3S1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9N A;  4BD1 A;  5CER A;  5F1F A;  1K38 A;  1GHI A;  1KE0 A;  3OPL A;  2J8Y A;  3MBZ A;  4U0X A;  3C7U A;  1DY6 A;  3OPR A;  4Q8I A;  1TDL A;  4JLF A;  3OCN A;  1E4D A;  5KZH A;  3OPH A;  3WWX A;  2FFF B;  2EX8 A;  3Q7V B;  5CHM A;  3ZCZ A;  1K6R A;  2VGK A;  1FSY A;  2X02 A;  3FV7 A;  5CTM A;  1PI4 A;  5CED A;  4BJP A;  4KZ7 A;  3GRJ A;  1BLP A;  1E3U D;  1OME A;  4EBP A;  2X01 A;  5E2F A;  4DE2 A;  5FDH A;  3G35 A;  3LEZ A;  4MEZ A;  4Y7P A;  1I2W A;  3CJM A;  5EVI D;  1Z6F A;  4JXS A;  3BFF A;  1AXB A;  1LI0 A;  3BFE A;  2WKI A;  1L0E A;  4N9K A;  5GLA A;  2XEP A;  4LV2 A;  4OQG A;  4BQM A;  2P9V A;  1RGZ A;  3SS5 A;  4C3Q A;  3HVF A;  3BFD A;  2UWX A;  1NYY A;  4OVD A;  1ZKJ A;  3WS5 A;  2WKE A;  5CHJ A;  5A91 A;  4RYE A;  3Q81 A;  5HX9 A;  3IT9 A;  2HP9 A;  4ZJ1 A;  1ESU A;  1NJ4 A;  4FCF A;  4Y0O A;  5HFO A;  2JE5 A;  4ZDX A;  3WS0 A;  2EX9 A;  5KSH A;  3IXB A;  1YM1 A;  1BZA A;  3RXX A;  1BLC A;  4N1X A;  2HPB A;  4P87 A;  3IWO A;  2ZM8 A;  1ZG6 A;  3N8R A;  1ES3 A;  1PWC A;  1PWD A;  2HDU A;  4DE1 A;  4S2J A;  4XUZ A;  4KZA A;  3A3I A;  3HRE A;  4PM7 A;  1VQQ A;  2HP6 A;  4IBR A;  3BLS A;  3GSG A;  4OPR A;  5FAP A;  3VP0 A;  5CXW A;  3Q82 A;  4B4Z A;  1O7E A;  3ZG9 B;  1XA1 A;  4JF6 A;  4UA9 A;  1H5X A;  4KQQ A;  4C6Y A;  2Z2M B;  1N9B A;  2ZQD A;  4Z9Q A;  2WK0 A;  3BM6 A;  4N9L A;  4IED A;  1TDG A;  3IWQ A;  4BD0 A;  1FQG A;  1MWR A;  4N92 A;  4KZ4 A;  5FSR A;  3B3X A;  5KMW A;  4DE3 A;  5JYO A;  3VOY A;  3W4P A;  3PBN A;  3A3F A;  3GVB A;  4BL2 A;  4WZ5 A;  5EVI A;  2IWC A;  4WBG A;  3W8K A;  3ZGA B;  2PU2 A;  1ES4 A;  2PU4 A;  4WZ4 A;  4CJN A;  2A49 A;  3IF5 A;  4PPR A;  3RXW A;  5CGS A;  3DTM A;  3BFG A;  2H5S A;  2R9X A;  4E6W A;  3G4P A;  3GV9 A;  2H0T A;  4PMA A;  2ZC5 B;  4X69 A;  5IHV A;  5CEB A;  4LV1 A;  4R1G A;  2ZC3 B;  4RA7 A;  4E3L A;  3ZNY A;  1K4E A;  4X55 A;  4X68 A;  5AQA A;  3CZD A;  3HLD A;  1ESI A;  4X53 A;  3UO9 A;  5CRF A;  2WKH A;  2DNS A;  1U60 A;  1J9M A;  5DF8 A;  4U0T A;  5CGX A;  4JPM A;  1PZO A;  3FWL A;  3Q7V A;  5DTS A;  5E2G A;  4EQI A;  3BFC A;  3UE1 A;  3VOZ A;  1K55 C;  3ZG0 A;  5FA7 A;  4S2M A;  4LEN A;  4E3O A;  3IWI A;  1KVL A;  4KZ8 A;  4EV4 A;  2JC7 A;  1Q2P A;  4OPZ A;  1ERO A;  1KE4 A;  3ZFZ A;  1ZG4 A;  5FAQ A;  3ZNT A;  1HD8 A;  3VP3 A;  5FQI A;  2Y2P A;  1NXY A;  4B88 A;  2ZQA A;  4S2P A;  3EQV A;  4OPY A;  2XFS A;  5D3O A;  4KG2 A;  3NIA A;  5G18 A;  2WAE A;  4EBN A;  1LLB A;  1NY0 A;  1IEM A;  4P6B A;  2XR0 A;  1IYS A;  1PYY A;  3NDG A;  4C75 A;  4X6T A;  1DJC A;  4OQH A;  3HL9 A;  1JWZ A;  1Y54 A;  1K25 A;  5F82 A;  3N7W A;  1FCN A;  5CHU A;  3D4F A;  4NET A;  1MWS A;  3G2Z A;  1XX2 A;  1GA0 A;  4K91 A;  3TG9 A;  3EQU A;  4JKT A;  4KEN B;  4LV3 A;  3DWK A;  5DTT A;  3SS4 A;  1RGY A;  3V3S A;  3AGD A;  1YLT A;  3G34 A;  2Y2K A;  1IYP A;  1K57 C;  3NC8 A;  3NI9 A;  3VFF A;  3WRT A;  2Y59 A;  1Q2Q A;  1QME A;  1IKI A;  1KVM A;  3C5A A;  3MFD A;  4KZ6 A;  1NZU A;  4K0W A;  4M3K A;  3ZG8 B;  2ZD8 A;  5L2F A;  2XQZ A;  1YLP A;  1KE3 A;  3UPO A;  3LY3 A;  5M1A A;  3GMW A;  1LL9 A;  3N8L A;  1S6R A;  1YQS A;  1BLH A;  1HVB A;  3G31 A;  2Q9M A;  1CK3 A;  1WYB A;  3VP1 A;  3HLG A;  2H0Y A;  3JYI A;  5AQB A;  4U3T A;  3C4O A;  5CGW A;  4E3I A;  4JF4 A;  4S2L A;  1N4O A;  2OLU A;  5FAS A;  3ZHH A;  3FZC A;  3IH8 A;  2WZX A;  5DVA A;  4QJG A;  2HDR A;  2ZC7 A;  3IF6 B;  3M6B A;  4P0M A;  4RVA A;  5FQK A;  3MZF A;  2Z2L B;  3HUM A;  3PBR A;  4O7D A;  3PBQ A;  2WGI A;  2WGV A;  3G32 A;  5GLC A;  2V1Z A;  3MZE A;  4E3N A;  2J9P A;  1MWT A;  4JXG A;  1FCO A;  4KQO A;  2Y2J A;  2WGW B;  3FKV A;  2XGN A;  4ZTK A;  5FI2 A;  1BT5 A;  4IVI A;  2DCF A;  2WAD A;  3VFH A;  2HDS A;  1NRF A;  3N4I A;  2RCX A;  3TSG A;  2EFX A;  2G2U A;  3RJU A;  4PM8 A;  5TFQ A;  1XPB A;  3PTE A;  5HAP A;  1ONG A;  4KG5 A;  3SH7 A;  4B4X A;  5HAI A;  3ISG A;  3UDF A;  4HES A;  1K56 A;  4L0L A;  3HLB A;  3SS3 A;  4MBH A;  3UN7 A;  1W5D A;  5CEC A;  1RCJ A;  2P9V B;  1MPL A;  4E3M A;  4YIN A;  4OOY A;  1XA7 A;  4OLG A;  1TVF A;  3V3R A;  1FR1 A;  3WS2 A;  5FQM A;  2EXB A;  2ZLY A;  5EVI C;  3TOI A;  3P09 A;  1L2S A;  3PAE A;  4R23 A;  1K55 A;  2PBY A;  3MKE A;  4BEN A;  1HTZ A;  1CI9 A;  3ZVT A;  3ZVW A;  3PBO A;  1FCM A;  3IXG A;  1JTD A;  5A92 A;  4XXR A;  3LY4 A;  2J9O A;  1KGG A;  1KDS A;  3FKW A;  1BLS A;  2QPN A;  3BLM A;  5EOE A;  5EE8 A;  3W4Q A;  4DXC A;  3IHA A;  5KSC A;  4OPQ A;  1H8Z A;  2ZQ8 A;  3QHY A;  3NY4 A;  4WEJ A;  3A3D A;  1O07 A;  4FSF A;  1I5Q A;  5DF9 A;  3VSL A;  3DWZ A;  1K56 D;  5GL9 A;  4P85 A;  2Y2H A;  5I94 A;  5E43 A;  2ZQC A;  4LCM A;  1NYM A;  1CI8 A;  4GZB A;  3VMA A;  3PAG A;  1MKI A;  4H8R A;  1GHM A;  2Y2G A;  4WEL A;  2RL3 A;  5FQQ A;  2BG1 A;  3CG5 A;  4BLM A;  1W79 A;  1K54 C;  3S22 A;  3UE0 A;  2G2W A;  3NCK A;  2EXA A;  4GKU A;  4EUZ A;  4QY5 A;  2Y55 A;  1MY8 A;  2H10 A;  2Y91 A;  5F83 A;  1LI9 A;  3WS1 A;  4IBX A;  2B5R A;  1YT4 A;  1L0G A;  3WRZ A;  3BEB A;  5HAR A;  2Y4A A;  1BUE A;  2XLN A;  3NDE A;  3ZG7 B;  3ZDJ A;  5GHY A;  3V50 A;  4OKP A;  4S2I A;  1LL5 A;  2XDM A;  1SDN A;  2ZC4 B;  2R9W A;  4QD4 A;  4RX3 A;  3IQA A;  4E3K A;  1BTL A;  4MBF A;  5HW3 A;  4UA6 A;  1K54 A;  3E2K A;  3Q07 A;  3VP4 A;  4Y0T A;  1G6A A;  2C5W B;  5A90 A;  1BUL A;  2XFT A;  2ZQ9 A;  3BYD A;  5TR7 A;  1XKZ A;  1JWV A;  1YMS A;  3E2L A;  3GR2 A;  3ZG5 A;  4FH4 A;  3HLF A;  4FD8 A;  4KZ3 A;  3ITA A;  1FR6 A;  1W8Q A;  4R3B A;  1JVJ A;  1ZC2 A;  3QNB A;  3OC2 A;  2JBF A;  3O86 A;  4PM9 A;  4UAA A;  1YMX A;  2DRW A;  4OON A;  3SH9 A;  5GHX A;  2I72 A;  3UPN A;  4WMC D;  4EBL A;  4F94 A;  4HEF A;  4ZBE A;  1KGE A;  2ZJ9 A;  3IF6 C;  3IXD A;  1E25 A;  3O87 A;  2CC1 A;  4QHC A;  3M2J A;  3M2K A;  4ZAM A;  4DDY A;  3I7J A;  5CTN A;  3VP2 A;  1BSG A;  1LHY A;  4WM9 A;  1EWZ A;  1L0D A;  1MXO A;  1ONH A;  5JYP A;  5EVL A;  2WGW A;  3AGE A;  3G2Y A;  1SCW A;  3W4O A;  1GHP A;  5EPH A;  5FI7 A;  5EEC A;  5GHZ A;  2ZM0 A;  5EVI B;  1XP4 A;  4E3J A;  2QZ6 A;  4A5R A;  2X71 A;  1FSW A;  5FAO A;  4Y0U A;  4DF6 A;  1K57 A;  3BRM A;  3UPP A;  2C6W B;  4DRT A;  4KG6 A;  3HUO A;  2ZMA A;  1DJB A;  4MBK A;  1ALQ A;  1SKF A;  5AQ9 A;  4BL3 A;  2ZM2 A;  3HLW A;  3MXR A;  1SDE A;  2FFY A;  1M40 A;  4D2O A;  4ZJ2 A;  4DKI A;  1IKG A;  1ERM A;  3SOI A;  1ES5 A;  1PW1 A;  5EUA A;  1WYC A;  5TGF A;  1RP5 A;  5A93 A;  2Y2N A;  3A3J A;  3V39 A;  4JF5 A;  2ZC6 B;  1PZP A;  3IHB A;  2V20 A;  2IWB A;  2WAF A;  2A3U A;  3GQZ A;  5AQ7 A;  3Q1F A;  1CEF A;  5E2H A;  4KZ9 A;  2EX2 A;  4ZJ3 A;  1G68 A;  3HLC A;  3UDI A;  5DF7 A;  4PM5 A;  4S2N C;  5HAQ A;  1HZO A;  4IVK A;  1KGF A;  2IWD A;  3N6I A;  5FQJ A;  2QMI A;  3ITB A;  3O88 A;  3SH8 A;  1YLZ A;  4GDN A;  2Y2O A;  5M19 A;  3M6H A;  4WYY A;  3FYZ A;  3CMZ A;  2OLV A;  1JWP A;  1PWG A;  3PBS A;  4JXW A;  1K4F A;  1TEM A;  1I2S A;  3GTC A;  3DW0 A;  3IXH A;  2XK1 A;  4UHU A;  3UDX A;  3BEC A;  4FH2 A;  4X56 A;  4LV0 A;  1NZO A;  3V5M A;  2HDQ A;  1ES2 A;  3HBR A;  3HUN A;  4GD6 A;  4OLD A;  1PIO A;  5F1G A;  5GLD A;  1XGJ A;  2HP5 A;  4UA7 A;  5GLB A;  1GCE A;  2V2F F;  4HBU A;  4OQI A;  5EOO A;  1XGI A;  2WYX A;  2EX6 A;  2OSU A;  5BOH A;  4JXV A;  3Q7Z A;  4KZB A;  4LCL A;  4PM6 A;  1ERQ A;  2Y2I A;  3AGF A;  3LO7 A;  4GNU A;  3OCL A;  3P98 A;  4XUX A;  1L0F A;  4QB8 A;  1K6S A;  3LCE A;  3IH9 A;  3O3V A;  4CPK A;  2GDN A;  1IYQ A;  2WZZ A;  1C3B A;  2OV5 A;  4OP8 A;  1PI5 A;  4YFM A;  5J8X A;  4S2N A;  4RX2 A;  1YLY A;  1M6K A;  4KZ5 A;  1IYO A;  2XD5 A;  1VM1 A;  2Y2Q A;  2Y2M A;  3HLE A;  4OOL A;  1SHV A;  1GA9 A;  1W8Y A;  4GDB A;  1WE4 A;  4ID4 A;  1YLW A;  4QU3 A;  5E2E A;  2EFU A;  4MLL A;  1YLJ A;  5FAT A;  2P74 A;  5U47 A;  3UNW A;  5HL1 A;  3QNC A;  3PBT A;  3A3E A;  1IEL A;  1EI5 A;  1JTG A;  4OOM A;  3WS4 A;  4GD8 A;  4R4R A;  1QMF A;  1W7F A;  1DJA A;  4QY6 A;  4OH0 A;  3C4P A;  2JCH A;  4GOG A;  3C7V A;  4MNR A;  4JBF A;  4GB7 A;  4E6X A;  1MBL A;  4GN2 A;  2ZQ7 A;  3NBL A;  4WZ5 C;  2Y2L A;  1PW8 A;  3S4X A;  2XD1 A;  2XH9 A;  1MWU A;  4S2O A;  4R0Q A;  3OZH A;  1S0W A;  2BLS A;  2J7V A;  4WEK A;  4HBT A;  4DXB A;  3UY6 A;  3MKF A;  4EWF A;  2VGJ A;  4DE0 A;  1H8Y A;  3OPP A;  2E8I A;  3MZD A;  1FOF A;  4NK3 A;  4R3J A;  3VSK A;  1CEG A;  4K0X A;  4KQR A;  4DDS A;  2XF3 A;  3MXS A;  4OP5 A;  3G30 A;  1KDW A;  4OQ0 A;  3UE3 A;  4N1H A;  4R4S A;  1XXM A;  4WMC A;  5DTK A;  5FI6 A;  1E3U A;  5FQ9 A;  4S2K A;  5M18 A;  3N8S A;  2WUQ A;  3IF6 A;  3S1Y A; 
#chains in the Genus database with same CATH topology
 4BD1 A;  2D01 A;  1K38 A;  4BBU A;  3OPL A;  2J8Y A;  3ICY A;  3MBZ A;  1DY6 A;  4HOI A;  4JLF A;  1OJG A;  1G6O A;  1NLZ A;  2VGK A;  4JGP A;  5DFX A;  3FV7 A;  4KZ7 A;  2ZOH A;  3GRJ A;  1BLP A;  3K3C A;  3W2Z A;  4I39 A;  3MMH A;  3LEZ A;  2VX8 A;  4MEZ A;  1I2W A;  3PR6 A;  4X1M A;  4Y5F A;  4EEU A;  3BY9 A;  2P9V A;  1RGZ A;  3HVF A;  2VGL M;  5A91 A;  4RYE A;  3Q81 A;  1Z09 A;  4Y0O A;  3VV4 A;  2K31 A;  4LPZ A;  3RXX A;  1TS8 A;  2ZM8 A;  1ZG6 A;  3E4P A;  3TRC A;  4PM7 A;  4IBR A;  2KX6 A;  4B4Z A;  3GDI A;  4UA9 A;  3S7N A;  1H5X A;  4KQQ A;  2PHY A;  1D1J A;  4Z9Q A;  2ZQD A;  3BM6 A;  3MS6 A;  3P7N A;  4BD0 A;  4Q0J A;  1MWR A;  1GSW A;  3W4P A;  3PBN A;  5HWV A;  3GVB A;  1F2K A;  2O9A A;  4WBG A;  4CJN A;  4WZ4 A;  5IS1 A;  4PPR A;  2PBD P;  5CGS A;  3BFG A;  2R9X A;  2FH5 A;  4E6W A;  3GV9 A;  2H0T A;  4PMA A;  4HI4 A;  1NWZ A;  4E3L A;  3BQ8 A;  3UE6 A;  3OBF A;  5DKK A;  5AQA A;  2WKQ A;  1J9M A;  5DTS A;  3BFC A;  1HLU P;  1Y28 A;  3BJN A;  2JKG A;  1K55 C;  4S2M A;  1KVL A;  2VEA A;  4KZ8 A;  3MQ0 A;  4JGQ A;  1KE4 A;  3ZNT A;  1CJF A;  4ETX A;  2V9A A;  2ZQA A;  2XFS A;  4KG2 A;  2XR0 A;  1IYS A;  4X6T A;  3JPU A;  3B42 A;  3HL9 A;  1JWZ A;  1Y4O A;  1OPX A;  2KOI A;  4K91 A;  4JKT A;  3MF0 A;  4LV3 A;  1G28 A;  3G34 A;  1QME A;  3C5A A;  4KZ6 A;  4K0W A;  1LSV A;  4M4X A;  2XQZ A;  3UPO A;  4DJ3 A;  1HVB A;  2D02 A;  1JNU A;  2JKF A;  4U3T A;  5CGW A;  4I38 A;  4S2L A;  1N4O A;  2OLU A;  4EU0 A;  1S67 L;  5L10 A;  3HUM A;  1N9N A;  2V1B A;  4IUK A;  1FCO A;  2XGN A;  4G3W A;  3KSI A;  1SZV A;  2HDS A;  3CLO A;  2EFX A;  2G2U A;  3RJU A;  5TFQ A;  3D9Y A;  3E98 A;  3F1P B;  4XT2 B;  4OOY A;  2WKP A;  1TVF A;  1FR1 A;  5EVI C;  1L2S A;  2PBY A;  2ZL1 B;  5HDD A;  2MJ6 A;  2OAP 1;  2QJ7 A;  3EOI A;  2B18 A;  2HJE A;  3D3O A;  5A92 A;  2J9O A;  2IA2 A;  1KGG A;  1KDS A;  3FKW A;  1J3W A;  3W4Q A;  3BLM A;  5EOE A;  3A3D A;  1I5Q A;  3R7W A;  5HPF A;  3VSL A;  1K56 D;  2H28 A;  5E43 A;  2ZQC A;  2JKR M;  3LEQ A;  4QWO A;  3VMA A;  3LIE A;  1MKI A;  1OTD A;  2RL3 A;  2BG1 A;  2K7S A;  2UV0 E;  1K54 C;  3CWF A;  3S22 A;  3NCK A;  2Y55 A;  2Y91 A;  4HH2 A;  2LB5 A;  2QYB A;  2O0Y A;  3BEB A;  2XLN A;  3PHY A;  4S2I A;  3IQA A;  4EUV A;  2AVX A;  4Y0T A;  1G6A A;  5HL6 A;  3KYE A;  1JWV A;  3GR2 A;  3E2L A;  1PRQ A;  3HLF A;  4FD8 A;  4KZ3 A;  4KUK A;  3UMD A;  2JBF A;  1YMX A;  2DRW A;  3H7W A;  4I3J A;  2VJW A;  5A8B A;  4F94 A;  3IXD A;  2JKT I;  2J3T C;  3M2J A;  2HF6 A;  1LHY A;  4WUJ A;  1XJ4 A;  5J3W A;  5G4Y A;  5EEC A;  5EVI B;  3KSH A;  1LL8 A;  2XSS A;  2C6W B;  4KG6 A;  3BQA A;  4MBK A;  4BL3 A;  2HJ9 C;  3MXR A;  1M40 A;  5EM1 A;  1IKG A;  4Y13 A;  1PW1 A;  3A3J A;  3UB6 A;  3V39 A;  4B9O A;  1PZP A;  2V20 A;  3GQZ A;  3Q1F A;  3UDI A;  1G68 A;  4PM5 A;  4S2N C;  1TS0 A;  3O88 A;  2HGV A;  2Q0O A;  5M19 A;  3ULF A;  3M6H A;  3QP5 A;  4CLC D;  3FYZ A;  2OLV A;  1F98 A;  3GTC A;  3IXH A;  5F69 A;  1D06 A;  2HDQ A;  3HUN A;  5GLD A;  2HP5 A;  4PHT A;  4OQI A;  1YSQ A;  4UQI S;  1VET B;  4JXV A;  3SZT A;  4KZB A;  4PM6 A;  3NUL A;  4QB8 A;  3IH9 A;  2XRN A;  1T1A A;  2GDN A;  4OP8 A;  5J8X A;  2XA7 M;  4S2N A;  4RX2 A;  1IYO A;  5L8M A;  1SHV A;  5E2E A;  1GA9 A;  5L2F A;  1YLW A;  3B33 A;  5U47 A;  2A2L A;  3A3E A;  1IEL A;  1JTG A;  3WS4 A;  4R4R A;  3CAX A;  1W7F A;  1DJA A;  4QY6 A;  4R6L A;  3T1S A;  4JBF A;  4GB7 A;  1VET A;  1MBL A;  5TBM A;  3RFB A;  4WZ5 C;  3T1X A;  2Y2L A;  4S2O A;  2BLS A;  4DXB A;  4WEK A;  2OWJ A;  4NK3 A;  4L9G A;  4R3J A;  3VSK A;  4KQR A;  3T4T A;  4Y17 A;  2XF3 A;  3MXS A;  4HJ6 A;  1LSW A;  4WMC A;  5FQ9 A;  1E3U A;  5M18 A;  4BWI A;  2P04 A;  4MN6 A;  3S1Y A;  1CF0 A;  5CER A;  5F1F A;  1MZU A;  5AVF A;  3C7U A;  3OPR A;  1OTB A;  3K3D A;  1E4D A;  2WKR A;  4R70 A;  2FFF B;  2EX8 A;  1FSY A;  5CED A;  3H9W A;  2EWV A;  4CLC B;  1E3U D;  5FDH A;  3CJM A;  3DTK A;  1AXB A;  1LI0 A;  2VGL S;  1L0E A;  4LV2 A;  3JVV A;  3WS5 A;  2WKE A;  5CHJ A;  5HX9 A;  3IT9 A;  2HP9 A;  4ZJ1 A;  4FCF A;  5HFO A;  3LR4 A;  2JE5 A;  3NOU C;  1DP8 A;  2EX9 A;  4P87 A;  2GJ3 A;  3N8R A;  1P9R A;  1PWC A;  3H7W B;  2HDU A;  4S2J A;  4MCW A;  3FPW A;  3HRE A;  3BLS A;  3MSH A;  3VP0 A;  5CXW A;  3Q82 A;  4K08 A;  1NRJ A;  4C6Y A;  4G3V A;  4YWZ A;  3PXP A;  1FQG A;  1TD5 A;  3LIB A;  4Y3I A;  2PU4 A;  3IF5 A;  3DTM A;  4EET B;  4X69 A;  4R1G A;  2ZC3 B;  4RA7 A;  1YSP A;  3ZNY A;  1K4E A;  2KDK A;  3HLD A;  4X53 A;  1ESI A;  5CRF A;  1PZO A;  3FWL A;  3UE1 A;  1UWN X;  4HIA A;  2VV6 A;  3ZG0 A;  5FA7 A;  4LEN A;  2Y8H A;  3IWI A;  4GW9 A;  1Q2P A;  1FIL A;  2VA0 A;  3VP3 A;  4FUW A;  3CUE A;  3T4Q A;  2WAE A;  1LLB A;  3FC7 A;  3NDG A;  2P7J A;  4OQH A;  2PRF A;  3D4F A;  3G2Z A;  2YKH A;  1N9L A;  3VOL A;  3TG9 A;  4CQH A;  1RGY A;  3LI8 A;  3AGD A;  1K57 C;  3WRT A;  3VFF A;  2BTF P;  1NZU A;  4M3K A;  1YLP A;  1KE3 A;  1LL9 A;  3N8L A;  1S4S A;  3L7H A;  1BLH A;  5HDC A;  2GNX A;  3HLG A;  2H0Y A;  5AQB A;  3E4O A;  5FL3 A;  5DVA A;  4MDZ A;  4P0M A;  3QP2 A;  2Z2L B;  3C8C A;  3MXQ A;  3F1N A;  4E3N A;  4ETZ A;  2Y2J A;  4ZTK A;  5FI2 A;  5DKL A;  4MMN A;  4IVI A;  2WAD A;  4HP4 A;  3N4I A;  1EW0 A;  2RCX A;  4PM8 A;  1XPB A;  5HAP A;  4KG5 A;  3SH7 A;  4B4X A;  3ISG A;  4HES A;  1K56 A;  4L0L A;  5CEC A;  5C5K A;  3LR3 A;  1MPL A;  2L4R A;  1XA7 A;  3V3R A;  4R23 A;  4BEN A;  1HTZ A;  1CI9 A;  2ZL1 A;  5HZH A;  2JKR I;  3BW6 A;  4XXR A;  3UB5 P;  1BLS A;  2ACG A;  2J3W A;  3VE3 A;  5EE8 A;  3IHA A;  5KSC A;  1YKD A;  1H8Z A;  3QHY A;  3NY4 A;  1XJ6 A;  3DWZ A;  2Y2H A;  2NUT C;  4LCM A;  1NYM A;  3ZQ5 A;  4GZB A;  5EM0 A;  5F68 A;  2Y2G A;  5FQQ A;  1SKO B;  1W79 A;  3UE0 A;  2G2W A;  2EXA A;  4GKU A;  3CPT B;  5F83 A;  3WS1 A;  3LFV A;  2M7U A;  1YT4 A;  3DTE A;  5HAR A;  1BUE A;  3LGO A;  3V50 A;  1P0Z A;  1LL5 A;  2LB9 A;  1SDN A;  4JGR A;  1BTL A;  2NUP C;  5HW3 A;  2OWH A;  1ACF A;  3Q07 A;  3VP4 A;  4IUH A;  2L1M A;  4B93 A;  2PT7 A;  3ZG5 A;  4FH4 A;  5EFW A;  1ZC2 A;  4DJ2 A;  3O86 A;  4PM9 A;  4UAA A;  4GLQ A;  3SH9 A;  3UPN A;  4WMC D;  4HEF A;  3O87 A;  3M2K A;  3KO6 A;  5HDS A;  4WM9 A;  1MXO A;  3W4O A;  5FI7 A;  4EQ1 A;  4AFI A;  5GHZ A;  1GSV A;  1N9O A;  4CLC A;  4E3J A;  1OT6 A;  4L9E A;  4Y0U A;  2L0W A;  3ZYT A;  5HD3 A;  2ZMA A;  4KQD A;  1SKF A;  2W27 A;  3HLW A;  2FFY A;  4ZJ2 A;  2V8F A;  1ERM A;  2B95 A;  5A93 A;  4JGO A;  2WAF A;  2A3U A;  5AQ7 A;  1CEF A;  1UWP X;  4KZ9 A;  2EX2 A;  5DF7 A;  5HAQ A;  1XJ2 A;  1KGF A;  2IWD A;  4RQ9 A;  4BBV A;  2K2N A;  2INW A;  3UB9 A;  2GX5 A;  4FTX A;  2Y2O A;  1YPR A;  1PWG A;  4FH2 A;  4X56 A;  1DP9 A;  3F1O B;  1BYW A;  5F1G A;  2WYX A;  3Q7Z A;  3AGF A;  2Y2I A;  3R7W B;  3KYZ A;  4GNU A;  3OCL A;  4E04 A;  4XUX A;  2XA7 S;  3RTY A;  3IBR A;  5DJT A;  4CPK A;  4Z1W A;  4NXF A;  3T4K A;  4YFM A;  1PI5 A;  1FIK A;  2VKS A;  2Y2M A;  1OJ5 A;  4OOL A;  2J3T D;  5F5Y A;  3HLE A;  5FAT A;  1OTI A;  5HL1 A;  1SKO A;  1EI5 A;  4NXB A;  1P9W A;  4E6X A;  2ZQ7 A;  3KYQ A;  3S4X A;  1PW8 A;  1V9Z A;  1MWU A;  4R0Q A;  1S0W A;  4EWF A;  4HBT A;  3UY6 A;  3TE8 A;  2VGJ A;  4DE0 A;  1H8Y A;  2E8I A;  3MZD A;  4DMZ A;  5HPI A;  5J7E A;  4K0X A;  4DDS A;  2W3H A;  3G30 A;  4OP5 A;  1OTA A;  4R4S A;  5DTK A;  3QP8 A;  1XJ3 A;  4GS9 A;  4N92 A;  1KE0 A;  4LGW A;  3OCN A;  3OPH A;  3WWX A;  3IX3 A;  2DMW A;  5CTM A;  1PI4 A;  4EER A;  4BJP A;  4KUO A;  5IU1 A;  2G7U A;  2QJ5 A;  4EBP A;  3LID A;  4P6Z S;  4Y7P A;  3KSF A;  5EVI D;  2A24 A;  1Z6F A;  4JXS A;  2PYR A;  4I3I A;  3BFF A;  2WKI A;  5GLA A;  2XEP A;  2OOL A;  3F1O A;  4OQG A;  1K0K A;  4XT2 A;  4HJ4 A;  3SS5 A;  3BFD A;  2UWX A;  1ZKJ A;  2W1R A;  3F1N B;  2W0N A;  1ESU A;  1NJ4 A;  3WS0 A;  5LBR A;  3IXB A;  1YM1 A;  1ZHH B;  3BY8 A;  1BLC A;  3LYX A;  3LR0 A;  1ES3 A;  1PWD A;  1PNE A;  4L9F A;  3A3I A;  3CIT A;  3GSG A;  2O9C A;  5FAP A;  5DJU A;  1O7E A;  1XA1 A;  3NEC A;  3QP4 A;  4N9L A;  4IED A;  1TDG A;  3IWQ A;  2PR5 A;  2ZMF A;  2HV1 A;  3IX8 A;  5MC7 A;  4KZ4 A;  5KMW A;  4DE3 A;  5JYO A;  3A3F A;  3UB7 A;  5EVE A;  3T1Q B;  2PU2 A;  1ES4 A;  3RXW A;  2I9V A;  2H5S A;  2GZA A;  2PR6 A;  3G4P A;  2OAQ 1;  4G3K A;  4HY8 A;  4LV1 A;  5L09 A;  4X55 A;  4X25 A;  2V1A A;  4GJ4 A;  3CZD A;  3UO9 A;  2WKH A;  4ESP A;  1U60 A;  4JPM A;  3Q7V A;  4EQI A;  5E2G A;  1T1C A;  3DTI A;  1GSX A;  2ZOI A;  2JC7 A;  3OLO A;  4OPZ A;  1F5M A;  1WA9 A;  3ZFZ A;  1ZG4 A;  5FAQ A;  1HD8 A;  4PAU A;  2Y2P A;  4S2P A;  3EQV A;  4OPY A;  3EEH A;  5G18 A;  3NIA A;  1NY0 A;  1IEM A;  1TS7 A;  4C75 A;  3H82 B;  1DJC A;  5F82 A;  1FCN A;  5HD5 A;  3U4L P;  5CHU A;  3A0S A;  4NET A;  1XX2 A;  1GA0 A;  3C38 A;  1ZTU A;  3DWK A;  1G5U A;  3V3S A;  4EXO A;  2Y2K A;  1IYP A;  1OTE A;  2VV7 A;  1Q2Q A;  3TW8 A;  1KVM A;  3MFD A;  4LRX C;  4ME4 A;  3T4O A;  5M1A A;  1S6R A;  1YQS A;  3G31 A;  2Q9M A;  5HWT A;  3C4O A;  5IT5 A;  4E3I A;  2W3E A;  3CUE C;  4JF4 A;  5FAS A;  3IH8 A;  2WZX A;  4WL9 A;  4QJG A;  2HDR A;  2ZC7 A;  3IF6 B;  3M6B A;  4RVA A;  5FQK A;  3MZF A;  2CMN A;  5TJJ A;  3PBR A;  4O7D A;  3PBQ A;  2WGI A;  3S7O A;  4NKP A;  5GLC A;  2V1Z A;  3MZE A;  3IS2 A;  1MWT A;  4JXG A;  2WGW B;  2PAV P;  3NOP C;  1NRF A;  3UME A;  3TSG A;  2Z6C A;  3VE4 A;  1X0O A;  3E4Q A;  3UN7 A;  1VHM A;  3P01 A;  2P9V B;  4E3M A;  2EXB A;  3TOI A;  5FEF A;  4DN0 A;  3PAE A;  4EW7 A;  3PBO A;  1FCM A;  3IXG A;  1JTD A;  3LY4 A;  4LRZ E;  4OPQ A;  1O07 A;  2Y79 A;  5DF9 A;  5GL9 A;  4P85 A;  3FPV A;  4ARZ B;  1CI8 A;  3PAG A;  3CI6 A;  1PFL A;  1S4R A;  4H8R A;  3S7Q A;  4WEL A;  3K2N A;  1MY8 A;  2H10 A;  3IBJ A;  1LI9 A;  2W3G A;  3WRZ A;  2Y4A A;  3ZDJ A;  2P08 A;  2ZBB A;  3UB8 A;  4OKP A;  2XDM A;  4D60 A;  4RX3 A;  4QD4 A;  2R9W A;  4E3K A;  3V67 A;  4UA6 A;  1K54 A;  3E2K A;  5A90 A;  2V0U A;  1BUL A;  2XFT A;  5TR7 A;  2ZQ9 A;  4CLC E;  4GS9 B;  4R3B A;  1JVJ A;  3QNB A;  3OC2 A;  5GHX A;  2I72 A;  4EBL A;  5G4Z A;  4ZBE A;  1KGE A;  3IF6 C;  2B02 A;  4QHC A;  5KIZ A;  4ZAM A;  5CTN A;  1BSG A;  5F6A A;  4H6J B;  3G2Y A;  1IOU A;  3EEA A;  2W3F A;  1XP4 A;  2QZ6 A;  4A5R A;  2X71 A;  4NG2 A;  4IJG A;  1K57 A;  3BRM A;  3UPP A;  4DRT A;  3LIA A;  5AQ9 A;  1DJB A;  1ALQ A;  2V8C A;  2JKT M;  2ZM2 A;  1SDE A;  4D2O A;  2XRO A;  1ES5 A;  5TGF A;  2Y2N A;  4DF6 A;  4JF5 A;  2ZC6 B;  4UEY A;  2IWB A;  5E2H A;  5AJG A;  2E8J A;  4IVK A;  3NOT C;  5FQJ A;  3ITB A;  1A0K A;  3SH8 A;  1YLZ A;  4GDN A;  3MFX A;  2EWW A;  4I5S A;  4WYY A;  3CMZ A;  1JWP A;  3PBS A;  3DW0 A;  2XK1 A;  3BEC A;  3F1P A;  4LV0 A;  1F9I A;  1ES2 A;  3HJI A;  1NLY A;  1XGJ A;  3OOV A;  1XFN A;  3PYP A;  1GCE A;  4HBU A;  2OSU A;  1ERQ A;  3EWK A;  3O5Y A;  2WZZ A;  2OV5 A;  3GEC A;  3FG8 A;  4KZ5 A;  1W8Y A;  4GDB A;  4ID4 A;  3HCY A;  2EFU A;  4MLL A;  2P74 A;  3QNC A;  3PBT A;  2W3D A;  1QMF A;  3C4P A;  2O9B A;  4WN5 A;  2XD1 A;  4O0P A;  4HHD A;  3OZH A;  4LFU A;  1VEU A;  3MKF A;  2M7V A;  4LLO B;  3IS2 B;  1CEG A;  1W63 Q;  1LSX A;  1KDW A;  4OQ0 A;  4N1H A;  1XXM A;  4PKY G;  4S2K A;  2WUQ A;  3IF6 A;  2Q9N A;  1GHI A;  2V0W A;  5DFY A;  3T50 A;  4U0X A;  4Q8I A;  1TDL A;  5KZH A;  3ZCZ A;  3Q7V B;  5CHM A;  1K6R A;  2FZ0 A;  2X02 A;  1DP6 A;  2PD8 A;  1OME A;  2X01 A;  1KOU A;  5E2F A;  4DE2 A;  3G35 A;  3U2A A;  4GHI B;  3BFE A;  4UQI M;  3CPT A;  4N9K A;  1T18 A;  4BQM A;  4C3Q A;  1NYY A;  4OVD A;  4H6J A;  4I3A A;  1TF1 A;  4ZDX A;  5KSH A;  1BZA A;  4N1X A;  2HPB A;  3IWO A;  3T4J A;  4DE1 A;  4XUZ A;  3A0V A;  4KZA A;  4Q0H A;  5AVE A;  1VQQ A;  2HP6 A;  4OPR A;  2EA9 A;  3ZG9 B;  4JF6 A;  2Z2M B;  3KSG A;  4HQA A;  1N9B A;  5CX7 A;  2WK0 A;  4II7 A;  4PKY A;  5FSR A;  1S1Y A;  1VB6 A;  3B3X A;  3VOY A;  4CLC C;  4BL2 A;  1VEU B;  4WZ5 A;  5EVI A;  2IWC A;  3W8K A;  3ZGA B;  3QP1 A;  1P97 A;  2A49 A;  3LIC A;  4YOF A;  5L07 A;  1TS6 A;  3T1R A;  2ZC5 B;  5CEB A;  5IHV A;  4X68 A;  2O99 A;  2DNS A;  5DF8 A;  3SW1 A;  4U0T A;  5CGX A;  4NEE D;  2M1C A;  2QKP A;  4EEP A;  4P6Z M;  3VOZ A;  3G6O A;  4E3O A;  4EV4 A;  4HH3 A;  1T1B A;  1ERO A;  1S66 L;  4X1L A;  3LUQ A;  5FQI A;  2YKF A;  1NXY A;  4B88 A;  5D3O A;  4EBN A;  4P6B A;  5J4E A;  1PYY A;  4FOF A;  1Y54 A;  1K25 A;  3N7W A;  1MWS A;  1IFQ A;  2KLI A;  3EQU A;  4KEN B;  3E0Y A;  3B47 A;  4MN5 A;  5DTT A;  3SS4 A;  1YLT A;  4O8G A;  2VK3 A;  3NC8 A;  3NI9 A;  2Y59 A;  1IKI A;  3ZG8 B;  2ZD8 A;  4Y2F A;  2J80 A;  3LY3 A;  3T4L A;  3GMW A;  3VP1 A;  2W1T B;  1CK3 A;  1WYB A;  2QHK A;  3JYI A;  4O01 A;  3ZHH A;  3C30 A;  3FZC A;  3DBA A;  3LR5 A;  2WGV A;  3G32 A;  1UGU A;  2J9P A;  1H3Q A;  4KQO A;  3HJK A;  3FKV A;  1BT5 A;  2DCF A;  3VFH A;  4HJ3 A;  4LRY C;  4YNR A;  3BWL A;  2HZ5 A;  3PTE A;  1ONG A;  4IHQ A;  5HAI A;  3UDF A;  3HLB A;  3SS3 A;  4MBH A;  1LT0 A;  1W5D A;  1RCJ A;  4YIN A;  4OLG A;  3WS2 A;  5FQM A;  2ZLY A;  3P09 A;  1K55 A;  3MQQ A;  3MKE A;  4HP9 A;  3ZVT A;  3ZVW A;  4WLA A;  3R4K A;  1S1Z A;  2QPN A;  4DXC A;  4F3L B;  2ZQ8 A;  4WEJ A;  4FSF A;  2BAS A;  3DAV A;  5I94 A;  4GCZ A;  4Q0I A;  5I5L A;  4ZRR A;  1GHM A;  3L9K A;  1H0M A;  3CG5 A;  4BLM A;  3S7P A;  4WF0 A;  4NXE A;  3NJA A;  4EUZ A;  4QY5 A;  4IBX A;  2B5R A;  4EES A;  1L0G A;  3LI9 A;  4R3A A;  2VZW A;  3NDE A;  3ZG7 B;  5GHY A;  2VLG A;  2ZC4 B;  1V9Y A;  4MBF A;  3A0R A;  2Z6D A;  3KX0 X;  2C5W B;  3T4S A;  3D72 A;  5FDS A;  3BYD A;  3MJQ A;  5EV0 A;  1XKZ A;  1YMS A;  3NHQ A;  3ITA A;  1FR6 A;  1W8Q A;  1XFQ A;  3C2W A;  4Y15 A;  5HSQ A;  2ZMV A;  3MR0 A;  4OON A;  4R38 A;  2ZJ9 A;  1E25 A;  2CC1 A;  3JVU A;  4GHI A;  4DDY A;  5TBM B;  3I7J A;  3RH8 B;  3VP2 A;  1EWZ A;  1L0D A;  1ONH A;  5JYP A;  5EVL A;  2WGW A;  3AGE A;  1SCW A;  1CQA A;  1GHP A;  5EPH A;  2ZM0 A;  3IX4 A;  2R78 A;  1FSW A;  5FAO A;  1ODV A;  1DRM A;  3HUO A;  4NXG A;  2A24 B;  1OT9 A;  4DKI A;  1L3L A;  3TJZ C;  3SOI A;  5K5B A;  5EUA A;  1WYC A;  1RP5 A;  3IHB A;  1H8M A;  2W1T A;  4ZJ3 A;  3T12 B;  3HLC A;  1HZO A;  2VV8 A;  3N6I A;  2QMI A;  1STZ A;  3EGD C;  4HNB A;  3QP6 A;  4MN7 A;  2QWS A;  4JXW A;  1K4F A;  1YAX A;  1TEM A;  1I2S A;  4UHU A;  1AWI A;  3UDX A;  4QPR A;  1NZO A;  3EGX C;  3V5M A;  3HBR A;  1D7E A;  4GD6 A;  4OLD A;  1PIO A;  3H82 A;  4ARZ A;  1T19 A;  4UA7 A;  5GLB A;  2V2F F;  5EOO A;  1XGI A;  4BMW A;  2EX6 A;  5BOH A;  4LCL A;  3LIF A;  5FEG A;  3LO7 A;  3P98 A;  1L0F A;  1K6S A;  3LCE A;  3O3V A;  1IYQ A;  1C3B A;  1YLY A;  1M6K A;  1MC0 A;  2PYP A;  2XD5 A;  1VM1 A;  2Y2Q A;  3CHW P;  3MQO A;  4QU3 A;  1WE4 A;  2PD7 A;  3UNW A;  1YLJ A;  2JHE A;  4OOM A;  4GD8 A;  4BBT A;  1W63 M;  4OH0 A;  5HWW A;  2JCH A;  4GOG A;  3C7V A;  4MNR A;  2JN7 A;  4GN2 A;  3NBL A;  2PDR A;  2XH9 A;  2J7V A;  3OPP A;  1FOF A;  4F3L A;  3UE3 A;  5FI6 A;  3N8S A;  1MKM A; 
#chains in the Genus database with same CATH homology
 2Q9N A;  4BD1 A;  5CER A;  5F1F A;  1K38 A;  1GHI A;  1KE0 A;  3OPL A;  2J8Y A;  3MBZ A;  4U0X A;  3C7U A;  1DY6 A;  3OPR A;  4Q8I A;  1TDL A;  4JLF A;  3OCN A;  1E4D A;  5KZH A;  3OPH A;  3WWX A;  2FFF B;  2EX8 A;  3Q7V B;  5CHM A;  3ZCZ A;  1K6R A;  2VGK A;  1FSY A;  2X02 A;  3FV7 A;  5CTM A;  1PI4 A;  5CED A;  4BJP A;  4KZ7 A;  3GRJ A;  1BLP A;  1E3U D;  1OME A;  4EBP A;  2X01 A;  5E2F A;  4DE2 A;  5FDH A;  3G35 A;  3LEZ A;  4MEZ A;  4Y7P A;  1I2W A;  3CJM A;  5EVI D;  1Z6F A;  4JXS A;  3BFF A;  1AXB A;  1LI0 A;  3BFE A;  2WKI A;  1L0E A;  4N9K A;  5GLA A;  2XEP A;  4LV2 A;  4OQG A;  4BQM A;  2P9V A;  1RGZ A;  3SS5 A;  4C3Q A;  3HVF A;  3BFD A;  2UWX A;  1NYY A;  4OVD A;  1ZKJ A;  3WS5 A;  2WKE A;  5CHJ A;  5A91 A;  4RYE A;  3Q81 A;  5HX9 A;  3IT9 A;  2HP9 A;  4ZJ1 A;  1ESU A;  1NJ4 A;  4FCF A;  4Y0O A;  5HFO A;  2JE5 A;  4ZDX A;  3WS0 A;  2EX9 A;  5KSH A;  3IXB A;  1YM1 A;  1BZA A;  3RXX A;  1BLC A;  4N1X A;  2HPB A;  4P87 A;  3IWO A;  2ZM8 A;  1ZG6 A;  3N8R A;  1ES3 A;  1PWC A;  1PWD A;  2HDU A;  4DE1 A;  4S2J A;  4XUZ A;  4KZA A;  3A3I A;  3HRE A;  4PM7 A;  1VQQ A;  2HP6 A;  4IBR A;  3BLS A;  3GSG A;  4OPR A;  5FAP A;  3VP0 A;  5CXW A;  3Q82 A;  4B4Z A;  1O7E A;  3ZG9 B;  1XA1 A;  4JF6 A;  4UA9 A;  1H5X A;  4KQQ A;  4C6Y A;  2Z2M B;  1N9B A;  2ZQD A;  4Z9Q A;  2WK0 A;  3BM6 A;  4N9L A;  4IED A;  1TDG A;  3IWQ A;  4BD0 A;  1FQG A;  1MWR A;  4N92 A;  4KZ4 A;  5FSR A;  3B3X A;  5KMW A;  4DE3 A;  5JYO A;  3VOY A;  3W4P A;  3PBN A;  3A3F A;  3GVB A;  4BL2 A;  4WZ5 A;  5EVI A;  2IWC A;  4WBG A;  3W8K A;  3ZGA B;  2PU2 A;  1ES4 A;  2PU4 A;  4WZ4 A;  4CJN A;  2A49 A;  3IF5 A;  4PPR A;  3RXW A;  5CGS A;  3DTM A;  3BFG A;  2H5S A;  2R9X A;  4E6W A;  3G4P A;  3GV9 A;  2H0T A;  4PMA A;  2ZC5 B;  4X69 A;  5IHV A;  5CEB A;  4LV1 A;  4R1G A;  2ZC3 B;  4RA7 A;  4E3L A;  3ZNY A;  1K4E A;  4X55 A;  4X68 A;  5AQA A;  3CZD A;  3HLD A;  1ESI A;  4X53 A;  3UO9 A;  5CRF A;  2WKH A;  2DNS A;  1U60 A;  1J9M A;  5DF8 A;  4U0T A;  5CGX A;  4JPM A;  1PZO A;  3FWL A;  3Q7V A;  5DTS A;  5E2G A;  4EQI A;  3BFC A;  3UE1 A;  3VOZ A;  1K55 C;  3ZG0 A;  5FA7 A;  4S2M A;  4LEN A;  4E3O A;  3IWI A;  1KVL A;  4KZ8 A;  4EV4 A;  2JC7 A;  1Q2P A;  4OPZ A;  1ERO A;  1KE4 A;  3ZFZ A;  1ZG4 A;  5FAQ A;  3ZNT A;  1HD8 A;  3VP3 A;  5FQI A;  2Y2P A;  1NXY A;  4B88 A;  2ZQA A;  4S2P A;  3EQV A;  4OPY A;  2XFS A;  5D3O A;  4KG2 A;  3NIA A;  5G18 A;  2WAE A;  4EBN A;  1LLB A;  1NY0 A;  1IEM A;  4P6B A;  2XR0 A;  1IYS A;  1PYY A;  3NDG A;  4C75 A;  4X6T A;  1DJC A;  4OQH A;  3HL9 A;  1JWZ A;  1Y54 A;  1K25 A;  5F82 A;  3N7W A;  1FCN A;  5CHU A;  3D4F A;  4NET A;  1MWS A;  3G2Z A;  1XX2 A;  1GA0 A;  4K91 A;  3TG9 A;  3EQU A;  4JKT A;  4KEN B;  4LV3 A;  3DWK A;  5DTT A;  3SS4 A;  1RGY A;  3V3S A;  3AGD A;  1YLT A;  3G34 A;  2Y2K A;  1IYP A;  1K57 C;  3NC8 A;  3NI9 A;  3VFF A;  3WRT A;  2Y59 A;  1Q2Q A;  1QME A;  1IKI A;  1KVM A;  3C5A A;  3MFD A;  4KZ6 A;  1NZU A;  4K0W A;  4M3K A;  3ZG8 B;  2ZD8 A;  5L2F A;  2XQZ A;  1YLP A;  1KE3 A;  3UPO A;  3LY3 A;  5M1A A;  3GMW A;  1LL9 A;  3N8L A;  1S6R A;  1YQS A;  1BLH A;  1HVB A;  3G31 A;  2Q9M A;  1CK3 A;  1WYB A;  3VP1 A;  3HLG A;  2H0Y A;  3JYI A;  5AQB A;  4U3T A;  3C4O A;  5CGW A;  4E3I A;  4JF4 A;  4S2L A;  1N4O A;  2OLU A;  5FAS A;  3ZHH A;  3FZC A;  3IH8 A;  2WZX A;  5DVA A;  4QJG A;  2HDR A;  2ZC7 A;  3IF6 B;  3M6B A;  4P0M A;  4RVA A;  5FQK A;  3MZF A;  2Z2L B;  3HUM A;  3PBR A;  4O7D A;  3PBQ A;  2WGI A;  2WGV A;  3G32 A;  5GLC A;  2V1Z A;  3MZE A;  4E3N A;  2J9P A;  1MWT A;  4JXG A;  1FCO A;  4KQO A;  2Y2J A;  2WGW B;  3FKV A;  2XGN A;  4ZTK A;  5FI2 A;  1BT5 A;  4IVI A;  2DCF A;  2WAD A;  3VFH A;  2HDS A;  1NRF A;  3N4I A;  2RCX A;  3TSG A;  2EFX A;  2G2U A;  3RJU A;  4PM8 A;  5TFQ A;  1XPB A;  3PTE A;  5HAP A;  1ONG A;  4KG5 A;  3SH7 A;  4B4X A;  5HAI A;  3ISG A;  3UDF A;  4HES A;  1K56 A;  4L0L A;  3HLB A;  3SS3 A;  4MBH A;  3UN7 A;  1W5D A;  5CEC A;  1RCJ A;  2P9V B;  1MPL A;  4E3M A;  4YIN A;  4OOY A;  1XA7 A;  4OLG A;  1TVF A;  3V3R A;  1FR1 A;  3WS2 A;  5FQM A;  2EXB A;  2ZLY A;  5EVI C;  3TOI A;  3P09 A;  1L2S A;  3PAE A;  4R23 A;  1K55 A;  2PBY A;  3MKE A;  4BEN A;  1HTZ A;  1CI9 A;  3ZVT A;  3ZVW A;  3PBO A;  1FCM A;  3IXG A;  1JTD A;  5A92 A;  4XXR A;  3LY4 A;  2J9O A;  1KGG A;  1KDS A;  3FKW A;  1BLS A;  2QPN A;  3BLM A;  5EOE A;  5EE8 A;  3W4Q A;  4DXC A;  3IHA A;  5KSC A;  4OPQ A;  1H8Z A;  2ZQ8 A;  3QHY A;  3NY4 A;  4WEJ A;  3A3D A;  1O07 A;  4FSF A;  1I5Q A;  5DF9 A;  3VSL A;  3DWZ A;  1K56 D;  5GL9 A;  4P85 A;  2Y2H A;  5I94 A;  5E43 A;  2ZQC A;  4LCM A;  1NYM A;  1CI8 A;  4GZB A;  3VMA A;  3PAG A;  1MKI A;  4H8R A;  1GHM A;  2Y2G A;  4WEL A;  2RL3 A;  5FQQ A;  2BG1 A;  3CG5 A;  4BLM A;  1W79 A;  1K54 C;  3S22 A;  3UE0 A;  2G2W A;  3NCK A;  2EXA A;  4GKU A;  4EUZ A;  4QY5 A;  2Y55 A;  1MY8 A;  2H10 A;  2Y91 A;  5F83 A;  1LI9 A;  3WS1 A;  4IBX A;  2B5R A;  1YT4 A;  1L0G A;  3WRZ A;  3BEB A;  5HAR A;  2Y4A A;  1BUE A;  2XLN A;  3NDE A;  3ZG7 B;  3ZDJ A;  5GHY A;  3V50 A;  4OKP A;  4S2I A;  1LL5 A;  2XDM A;  1SDN A;  2ZC4 B;  2R9W A;  4QD4 A;  4RX3 A;  3IQA A;  4E3K A;  1BTL A;  4MBF A;  5HW3 A;  4UA6 A;  1K54 A;  3E2K A;  3Q07 A;  3VP4 A;  4Y0T A;  1G6A A;  2C5W B;  5A90 A;  1BUL A;  2XFT A;  2ZQ9 A;  3BYD A;  5TR7 A;  1XKZ A;  1JWV A;  1YMS A;  3E2L A;  3GR2 A;  3ZG5 A;  4FH4 A;  3HLF A;  4FD8 A;  4KZ3 A;  3ITA A;  1FR6 A;  1W8Q A;  4R3B A;  1JVJ A;  1ZC2 A;  3QNB A;  3OC2 A;  2JBF A;  3O86 A;  4PM9 A;  4UAA A;  1YMX A;  2DRW A;  4OON A;  3SH9 A;  5GHX A;  2I72 A;  3UPN A;  4WMC D;  4EBL A;  4F94 A;  4HEF A;  4ZBE A;  1KGE A;  2ZJ9 A;  3IF6 C;  3IXD A;  1E25 A;  3O87 A;  2CC1 A;  4QHC A;  3M2J A;  3M2K A;  4ZAM A;  4DDY A;  3I7J A;  5CTN A;  3VP2 A;  1BSG A;  1LHY A;  4WM9 A;  1EWZ A;  1L0D A;  1MXO A;  1ONH A;  5JYP A;  5EVL A;  2WGW A;  3AGE A;  3G2Y A;  1SCW A;  3W4O A;  1GHP A;  5EPH A;  5FI7 A;  5EEC A;  5GHZ A;  2ZM0 A;  5EVI B;  1XP4 A;  4E3J A;  2QZ6 A;  4A5R A;  2X71 A;  1FSW A;  5FAO A;  4Y0U A;  4DF6 A;  1K57 A;  3BRM A;  3UPP A;  2C6W B;  4DRT A;  4KG6 A;  3HUO A;  2ZMA A;  1DJB A;  4MBK A;  1ALQ A;  1SKF A;  5AQ9 A;  4BL3 A;  2ZM2 A;  3HLW A;  3MXR A;  1SDE A;  2FFY A;  1M40 A;  4D2O A;  4ZJ2 A;  4DKI A;  1IKG A;  1ERM A;  3SOI A;  1ES5 A;  1PW1 A;  5EUA A;  1WYC A;  5TGF A;  1RP5 A;  5A93 A;  2Y2N A;  3A3J A;  3V39 A;  4JF5 A;  2ZC6 B;  1PZP A;  3IHB A;  2V20 A;  2IWB A;  2WAF A;  2A3U A;  3GQZ A;  5AQ7 A;  3Q1F A;  1CEF A;  5E2H A;  4KZ9 A;  2EX2 A;  4ZJ3 A;  1G68 A;  3HLC A;  3UDI A;  5DF7 A;  4PM5 A;  4S2N C;  5HAQ A;  1HZO A;  4IVK A;  1KGF A;  2IWD A;  3N6I A;  5FQJ A;  2QMI A;  3ITB A;  3O88 A;  3SH8 A;  1YLZ A;  4GDN A;  2Y2O A;  5M19 A;  3M6H A;  4WYY A;  3FYZ A;  3CMZ A;  2OLV A;  1JWP A;  1PWG A;  3PBS A;  4JXW A;  1K4F A;  1TEM A;  1I2S A;  3GTC A;  3DW0 A;  3IXH A;  2XK1 A;  4UHU A;  3UDX A;  3BEC A;  4FH2 A;  4X56 A;  4LV0 A;  1NZO A;  3V5M A;  2HDQ A;  1ES2 A;  3HBR A;  3HUN A;  4GD6 A;  4OLD A;  1PIO A;  5F1G A;  5GLD A;  1XGJ A;  2HP5 A;  4UA7 A;  5GLB A;  1GCE A;  2V2F F;  4HBU A;  4OQI A;  5EOO A;  1XGI A;  2WYX A;  2EX6 A;  2OSU A;  5BOH A;  4JXV A;  3Q7Z A;  4KZB A;  4LCL A;  4PM6 A;  1ERQ A;  2Y2I A;  3AGF A;  3LO7 A;  4GNU A;  3OCL A;  3P98 A;  4XUX A;  1L0F A;  4QB8 A;  1K6S A;  3LCE A;  3IH9 A;  3O3V A;  4CPK A;  2GDN A;  1IYQ A;  2WZZ A;  1C3B A;  2OV5 A;  4OP8 A;  1PI5 A;  4YFM A;  5J8X A;  4S2N A;  4RX2 A;  1YLY A;  1M6K A;  4KZ5 A;  1IYO A;  2XD5 A;  1VM1 A;  2Y2Q A;  2Y2M A;  3HLE A;  4OOL A;  1SHV A;  1GA9 A;  1W8Y A;  4GDB A;  1WE4 A;  4ID4 A;  1YLW A;  4QU3 A;  5E2E A;  2EFU A;  4MLL A;  1YLJ A;  5FAT A;  2P74 A;  5U47 A;  3UNW A;  5HL1 A;  3QNC A;  3PBT A;  3A3E A;  1IEL A;  1EI5 A;  1JTG A;  4OOM A;  3WS4 A;  4GD8 A;  4R4R A;  1QMF A;  1W7F A;  1DJA A;  4QY6 A;  4OH0 A;  3C4P A;  2JCH A;  4GOG A;  3C7V A;  4MNR A;  4JBF A;  4GB7 A;  4E6X A;  1MBL A;  4GN2 A;  2ZQ7 A;  3NBL A;  4WZ5 C;  2Y2L A;  1PW8 A;  3S4X A;  2XD1 A;  2XH9 A;  1MWU A;  4S2O A;  4R0Q A;  3OZH A;  1S0W A;  2BLS A;  2J7V A;  4WEK A;  4HBT A;  4DXB A;  3UY6 A;  3MKF A;  4EWF A;  2VGJ A;  4DE0 A;  1H8Y A;  3OPP A;  2E8I A;  3MZD A;  1FOF A;  4NK3 A;  4R3J A;  3VSK A;  1CEG A;  4K0X A;  4KQR A;  4DDS A;  2XF3 A;  3MXS A;  4OP5 A;  3G30 A;  1KDW A;  4OQ0 A;  3UE3 A;  4N1H A;  4R4S A;  1XXM A;  4WMC A;  5DTK A;  5FI6 A;  1E3U A;  5FQ9 A;  4S2K A;  5M18 A;  3N8S A;  2WUQ A;  3IF6 A;  3S1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...