1NY0A

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (nbf)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Recognition and Resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 98
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ny0A00
4GZBA 2Z2LB 4X55A 4BENA 4NETA 3A3DA 2IWBA 1K4EA 3QNBA 5FA7A 1N4OA 1PWCA 3MKEA 4HBUA 1NY0A 3GTCA 1JVJA 2HDUA 3W4OA 5HL1A 4UA7A 4BD0A 4HEFA 3HVFA 3SS3A 3ZNTA 1YMSA 1CK3A 1QMFA 2UWXA 3HUMA 4GKUA 4JLFA 4WEKA 1ERQA 4WM9A 4N1HA 5GLAA 4DKIA 2WZXA 2ZQAA 2XF3A 3A3EA 4H8RA 1WYCA 5CERA 5CHMA 5EVIC 2VGKA 1PZPA 1PW1A 4WEJA 4R3JA 4QJGA 4E6WA 2XFSA 4BL2A 3V50A 5J8XA 2XLNA 4S2MA 1N9BA 3HUOA 3N7WA 1E25A 5CHUA 4DXBA 4FSFA 5AQAA 3NCKA 1W5DA 4UA9A 3O87A 3O88A 1MXOA 1MWUA 1NYYA 3QHYA 5F83A 3VSKA 4KZAA 3VP4A 4MNRA 4S2OA 4KZ8A 1Y54A 2E8IA 1TDLA 4ZAMA 4BLMA 4JF6A 3C7UA 1OMEA 1YLYA 5E2FA 3IWOA 5E2GA 1E4DA 3UO9A 3EQVA 2WYXA 2WKEA 2ZC7A 4OKPA 2XEPA 3BFCA 3MBZA 4MBFA 3ZG7B 4DDYA 4JXSA 5HARA 4K0XA 2VGJA 4IEDA 1NZOA 3TSGA 1PZOA 4JKTA 3GSGA 4DDSA 4KQOA 3UDIA 3IXBA 4OOLA 4FH4A 5F1GA 3GRJA 5KMWA 1W8QA 3WS5A 3QNCA 3LY4A 1ES5A 1I2SA 3SOIA 4EBLA 1XP4A 1K55C 5CGWA 4PPRA 1E3UD 5GLDA 3V3RA 3P09A 4E3JA 2X01A 1EROA 1C3BA 5DF7A 1BSGA 3OCNA 5EVIA 1FSYA 1KE3A 4Y0UA 2Y2OA 4K91A 2C5WB 4OP5A 3BFFA 1MWSA 2R9WA 2RL3A 4IVKA 1K54C 1LLBA 3BM6A 1HVBA 4C75A 5KZHA 4EWFA 4B88A 4R3BA 4E3OA 3M6HA 2ZM2A 4K0WA 2XD5A 1S0WA 3BFEA 4HESA 3LO7A 1K57A 2FFYA 3IWQA 4E3IA 5TR7A 3IF6B 5A92A 1FSWA 1ZKJA 1QMEA 3UDFA 1YM1A 3SH9A 3BEBA 2H5SA 3HLGA 4ZBEA 5HX9A 5HAQA 4WZ4A 2HP6A 1XX2A 2Z2MB 2JCHA 3MZFA 2Y2KA 4QD4A 1K56D 2DNSA 2IWDA 2WAFA 5AQ9A 5FSRA 4LCMA 1XPBA 2EX2A 2XR0A 5HW3A 1BUEA 3V3SA 5DTSA 2J9OA 4R0QA 4IBXA 1KDSA 5DF9A 3UE1A 4RX2A 1ZC2A 2ZC4B 3N6IA 4N9LA 4IVIA 3DTMA 4X68A 3HBRA 4X69A 4D2OA 3NDGA 1W8YA 2V2FF 1YT4A 3OPPA 3GQZA 4KQRA 2ZQCA 4DE1A 5GL9A 5CGXA 4CPKA 4E3KA 3PAGA 1GA0A 4PM9A 1YQSA 1K55A 4ID4A 1IYOA 3FZCA 1L2SA 2XFTA 4KZBA 3MZDA 2B5RA 1DY6A 1Z6FA 1LI9A 3VOYA 1J9MA 2HP5A 2Q9MA 4UAAA 3S4XA 2I72A 3ZG9B 3GR2A 5FI6A 1M6KA 5CEBA 5GHYA 5FAOA 3I7JA 5FQQA 2EXAA 3G32A 1EI5A 4UHUA 1HTZA 1U60A 4WBGA 4YFMA 4ZJ1A 1LL5A 1DJBA 4OVDA 5FQ9A 1K54A 1BLCA 2Y2GA 2HDSA 3ZGAB 4BJPA 1KDWA 2P74A 3UPNA 4WELA 2QZ6A 2ZQ9A 1PW8A 3CZDA 1K4FA 3Q7VB 4YINA 2WGIA 1YMXA 2Y2PA 4P6BA 2EX8A 3Q7VA 1FOFA 3BFDA 3MFDA 4E3MA 3MXSA 3LEZA 1SDNA 2IWCA 3IXDA 5M19A 2OSUA 3W4PA 1I2WA 4S2IA 4IBRA 2P9VA 4OQIA 4HBTA 2V1ZA 4LV2A 2DRWA 1PI4A 4S2PA 4LV3A 3HLDA 5KSHA 4CJNA 2ZJ9A 2XK1A 3UY6A 3HLEA 4KG2A 4XUZA 4S2JA 1JTDA 4S2KA 1GHPA 3FYZA 4QU3A 5TGFA 3E2KA 5CEDA 1L0EA 1VQQA 3MXRA 1KVLA 5D3OA 3ITBA 4DE2A 3V5MA 1ES3A 3BLMA 3V39A 2WUQA 5CTMA 1LHYA 5A93A 2HDRA 2OLVA 4E3LA 4PM5A 3UE3A 2ZC5B 1FQGA 5FQMA 4GOGA 2ZQ7A 3A3FA 4NK3A 1KE0A 3C4OA 3TG9A 2HP9A 1GCEA 1MWTA 3AGDA 3D4FA 3A3JA 4JXVA 4OOMA 1G68A 5E43A 1IKIA 1MWRA 5EUAA 3VP0A 4QY6A 1ALQA 1IYSA 3BFGA 1NRFA 3G31A 5CGSA 1MKIA 1JTGA 5EOEA 3UN7A 4ZTKA 4OONA 3ZVWA 1KVMA 4UA6A 2A3UA 5FQKA 3Q1FA 1NZUA 1ES4A 1SKFA 4MBKA 4PM6A 2WAEA 1MY8A 2EFXA 3UPPA 3MZEA 4EBNA 2ZM8A 3NC8A 3PBSA 2ZM0A 1DJCA 1XGJA 5EVIB 3NDEA 3JYIA 4JPMA 2JE5A 5IHVA 3WS4A 1GA9A 3GVBA 2A49A 4Y0OA 3MKFA 4R23A 2J8YA 1SCWA 2EX9A 4QB8A 1XKZA 2V20A 3HLWA 3HLFA 2Y2LA 5FI7A 3WS1A 4OPZA 5EECA 1O7EA 1BZAA 1SDEA 1VM1A 2WKHA 3G2ZA 3IF5A 3VFFA 3CG5A 1ESUA 4OP8A 5FATA 5EOOA 1TEMA 2WGWA 3ZCZA 3FKVA 1W7FA 4OLDA 2BLSA 4LCLA 1ZG4A 4KQQA 5A91A 3VP2A 1ESIA 5HFOA 1BT5A 4ZJ3A 1SHVA 3OCLA 1BLHA 3P98A 4P87A 1KGFA 5CRFA 3RXXA 1E3UA 2Y2NA 1Q2PA 4KZ7A 3FKWA 2J7VA 3BECA 4KZ5A 4Q8IA 1KGEA 2ZC6B 3FV7A 3ZG0A 3PTEA 3O3VA 3ITAA 3ZVTA 4XUXA 1H5XA 4N9KA 3S1YA 3IT9A 2H0YA 3C4PA 4P85A 4BL3A 4MLLA 1XA7A 4OPQA 3CJMA 1RGZA 2PU4A 1GHMA 2XDMA 3DW0A 3LCEA 1K25A 3W4QA 5EE8A 2G2WA 4Y7PA 1PYYA 4FD8A 1CEFA 3WWXA 2EFUA 3WS2A 1IYQA 4GD6A 1PWGA 1NJ4A 5DF8A 5GHZA 2BG1A 4WMCA 4X6TA 3VSLA 4DE3A 1JWVA 2CC1A 3N8RA 1K56A 5M1AA 4DRTA 5FI2A 3EQUA 3VP1A 5FDHA 4GDNA 1RGYA 4LV0A 2X71A 5E2EA 1ES2A 5I94A 3PBTA 3SH7A 5GLBA 4MBHA 1KE4A 3B3XA 2ZMAA 4KG5A 1AXBA 2HPBA 3OZHA 4XXRA 3IHAA 1FR6A 2P9VB 3M2KA 1XA1A 1K6RA 5CHJA 1IELA 4EBPA 3G30A 3M6BA 4QY5A 5DTTA 4OQGA 4U0XA 4S2NC 3RJUA 2JBFA 4GDBA 1NYMA 1FCOA 3ZHHA 2R9XA 3ISGA 1ONGA 1RCJA 1FCMA 2XD1A 5FAPA 4OQ0A 4KZ3A 5FQJA 1H8YA 1TVFA 5KSCA 3BLSA 3N4IA 4C6YA 4R4RA 3S22A 2JC7A 5E2HA 5GLCA 4N1XA 4U0TA 2H10A 2HDQA 1L0FA 2DCFA 5DTKA 1WYBA 1CEGA 1LL9A 4E3NA 4U3TA 4Y0TA 3VOZA 3PBRA 4S2LA 3Q81A 1WE4A 4GNUA 2QMIA 2WGVA 1O07A 3Q7ZA 2H0TA 4FCFA 3N8LA 4OPRA 1XXMA 3WRTA 1L0DA 1CI9A 3PBQA 1BTLA 1YLTA 3OPRA 5CECA 1IEMA 3IHBA 5F82A 5JYOA 1TDGA 4DF6A 4E6XA 1K57C 5EVID 2Y91A 2ZQ8A 4RX3A 2Y2QA 5G18A 2QPNA 5M18A 4WZ5C 2Q9NA 3IF6C 3N8SA 2GDNA 4FH2A 5GHXA 5TFQA 4X53A 5BOHA 5CTNA 2RCXA 4M3KA 4JBFA 4EQIA 1ZG6A 4KZ4A 1MPLA 1NXYA 1FR1A 1Q2QA 3UNWA 2PBYA 4BQMA 4BD1A 3A3IA 3NI9A 2Y2HA 3ZNYA 3DWZA 4KZ9A 4WYYA 5L2FA 3IXGA 1DJAA 4S2NA 2ZD8A 4B4ZA 4LV1A 4R1GA 3G35A 1PIOA 1JWPA 3DWKA 1YLZA 2WK0A 3UPOA 1L0GA 1S6RA 2WGWB 3PBOA 3HLCA 3G2YA 2J9PA 3IQAA 1G6AA 4A5RA 3FWLA 3Q82A 4GB7A 1HZOA 5JYPA 2WZZA 5EVLA 3OPHA 3UE0A 3C5AA 4ZDXA 3IWIA 2WKIA 3PAEA 1RP5A 1CI8A 1M40A 1MBLA 3WRZA 1ONHA 3AGFA 4EV4A 2G2UA 4ZJ2A 3ZFZA 2XGNA 4X56A 3AGEA 1JWZA 5F1FA 3IXHA 1K6SA 2Y2IA 3HUNA 4KG6A 3E2LA 3HL9A 4O7DA 5AQ7A 2ZQDA 4B4XA 5FQIA 3M2JA 5A90A 1BLSA 2ZLYA 2OLUA 3ZDJA 3ZG8B 4GN2A 3O86A 4JF5A 2OV5A 1LI0A 2ZC3B 4PM8A 5HAIA 2PU2A 4RA7A 1I5QA 1W79A 3IF6A 4WZ5A 2EXBA 4OOYA 1YLWA 3SH8A 3PBNA 4WMCD 1ERMA 3CMZA 4RYEA 4JXGA 4N92A 3OC2A 1YLJA 4JF4A 4OLGA 5U47A 4JXWA 4PMAA 3GV9A 3VP3A 4OPYA 4C3QA 3NBLA 4EUZA 3ZG5A 5DVAA 5EPHA 3VMAA 3LY3A 4KENB 4P0MA 3W8KA 1H8ZA 3BRMA 1PWDA 2Y59A 4Z9QA 1EWZA 5FASA 3UDXA 1IYPA 1BLPA 2WADA 1IKGA 4MEZA 5CXWA 3HREA 1YLPA 3HLBA 1HD8A 2XH9A 3IH9A 3RXWA 3SS5A 3WS0A 5HAPA 1FCNA 2Y55A 2C6WB 3G34A 2X02A 4OQHA 3SS4A 3C7VA 4R4SA 4DE0A 1BULA 3NIAA 3OPLA 2Y4AA 3IH8A 3TOIA 4PM7A 1PI5A 1GHIA 3NY4A 3Q07A 4KZ6A 4GD8A 4OH0A 3G4PA 2Y2MA 4RVAA 3BYDA 4L0LA 5AQBA 4F94A 2EX6A 1XGIA 1K38A 2XQZA 3GMWA 4QHCA 1KGGA 2FFFB 3VFHA 4DXCA 4LENA 2Y2JA 5FAQA
chains in the Genus database with same CATH superfamily
4YWZA 1PWCA 4HEFA 1CK3A 3H9WA 5HPFA 2WZXA 2QHKA 2XF3A 1WYCA 2VGKA 2XFSA 1MKMA 3V50A 4BL2A 2PDRA 4S2MA 2L1MA 1N9BA 3BQ8A 4DXBA 4FSFA 5AQAA 3NCKA 1G6OA 1MXOA 1MWUA 1T1CA 4KZAA 5HD5A 1YAXA 3LIDA 3EGDC 1NLYA 4JF6A 5E2FA 3EQVA 5HWWA 5AVEA 3LYXA 4DDSA 2WKQA 4OOLA 4FH4A 5F1GA 5HL6A 4HP4A 5KMWA 4CLCE 3WS5A 3LY4A 1I2SA 4EBLA 5L09A 2JKRM 2WKRA 3BY8A 1LL8A 4KQDA 4HI4A 3V3RA 3P09A 2J3TC 2X01A 1EROA 1C3BA 1KE3A 2W1TA 3H7WA 4PHTA 4Y0UA 3NJAA 2HJ9C 2C5WB 4OP5A 1OTEA 3BFFA 1MWSA 3MQOA 4Q0HA 1K54C 1LLBA 3ICYA 4C75A 1TS6A 4K0WA 5A92A 4HESA 3IWQA 2XROA 5TR7A 1FSWA 3UDFA 1YM1A 3BEBA 3HJIA 4LGWA 2HP6A 1ZTUA 4QD4A 2DNSA 3LEQA 1XPBA 1BUEA 4R0QA 1CQAA 4IBXA 4RX2A 2ZC4B 4R3AA 3ZYTA 3P7NA 1P9RA 1W8YA 2VV8A 3OPPA 3GQZA 4KQRA 4L9EA 4E3KA 5DJUA 4ESPA 1K55A 5J4EA 4KZBA 5EM1A 1DY6A 1Z6FA 2Q9MA 3S4XA 4UAAA 4I3IA 5DKKA 5FAOA 5FQQA 1U60A 4YFMA 4ZJ1A 1DJBA 1BLCA 5MC7A 2GX5A 4WELA 2ZQ9A 1PW8A 3Q7VB 2WGIA 4NXGA 2D02A 4UEYA 3MFDA 3T4KA 3T4SA 3IXDA 1I2WA 3D3OA 4BWIA 4L9FA 4LV2A 4S2PA 1SZVA 2EWVA 3KYQA 5TGFA 3E2KA 3MXRA 4DE2A 2ACGA 1X0OA 5CTMA 1J3WA 3NECA 5A93A 2GJ3A 2OLVA 4BBUA 2PYPA 4EETB 2KOIA 3T1RA 3BY9A 4QY6A 3G31A 3MQ0A 5CGSA 1JTGA 2HGVA 4OONA 1KVMA 3Q1FA 2EFXA 4NKPA 4HJ4A 1F2KA 5EVIB 3JYIA 4JPMA 4P6ZS 1GA9A 1XKZA 5EECA 2VA0A 2OWJA 3CG5A 3JVVA 5FATA 2ZL1A 2OOLA 2VV7A 3ZCZA 2VLGA 1W7FA 4OLDA 3UB8A 5A91A 4KQQA 3VP2A 1ESIA 5HFOA 1P0ZA 3OCLA 3P98A 1E3UA 5DKLA 3UB6A 2J7VA 1T1AA 4EW7A 1KOUA 4MN5A 3ITAA 3ZVTA 3S1YA 4O0PA 4F3LA 1P9WA 1GHMA 3LCEA 4DJ2A 1VEUA 2EFUA 1XJ6A 2BG1A 3VSLA 1JWVA 1LSVA 5M1AA 3CPTB 5FDHA 4LV0A 1D06A 1ES2A 1S4SA 5GLBA 1KE4A 3B3XA 2ZMAA 2ZBBA 5F69A 3OZHA 4XXRA 1IELA 2HZ5A 3M6BA 5DTTA 2NUPC 3RJUA 1FCOA 1FCMA 2XD1A 5FQJA 5KSCA 4C6YA 3N4IA 5LBRA 4R4RA 2JC7A 3KSGA 5GLCA 2M7VA 2HDQA 3KSFA 2DCFA 5HDSA 1CEGA 4E3NA 4U3TA 3VOZA 5HDDA 4GHIA 3Q7ZA 2H0TA 1CI9A 3T4OA 1V9YA 1K0KA 4E6XA 1K57C 2J3WA 2Y2QA 1SKOA 4FH2A 5GHXA 5CTNA 4M3KA 4JBFA 1MPLA 1NXYA 4XT2B 4BQMA 1P97A 3EOIA 3DWZA 5L2FA 3IXGA 4S2NA 2ZD8A 4LV1A 3OLOA 3G35A 1W63M 3DWKA 2WGWB 3IQAA 1G6AA 4HH2A 2DMWA 1HZOA 3LI9A 5JYPA 2WZZA 1L3LA 1T1BA 2V1AA 2UV0E 3VOLA 4ZJ2A 1K6SA 2Y2IA 3B42A 3EWKA 3E2LA 3HL9A 2ZQDA 2OLUA 1Z09A 4JF5A 4WZ5A 4ZRRA 3H82A 3ULFA 2EXBA 5F68A 3GV9A 4EUZA 5EPHA 3LY3A 4LRXC 2Y59A 3E4QA 1IYPA 3VV4A 2WADA 3SS5A 3FG8A 3HREA 1YLPA 3RXWA 3WS0A 5FEFA 1FCNA 5HAPA 3SS4A 1FILA 2L4RA 4Y3IA 3Q07A 4GD8A 3LR4A 3BYDA 4DXCA 3GMWA 4QHCA 2FFFB 5FAQA 1NWZA 2GNXA 2Z2LB 4GZBA 4X55A 2Z6CA 3QNBA 3MKEA 2PYRA 3SS3A 4GKUA 4DKIA 1ERQA 4N1HA 5CERA 5CHMA 5EM0A 5EVIC 1PZPA 4E6WA 2HF6A 4MN6A 5CHUA 4R70A 4UA9A 3VSKA 3U2AA 3KSHA 5F83A 3ZQ5A 3VP4A 4MNRA 4S2OA 2V9AA 5TBMB 1TDLA 4ZAMA 1DRMA 2JN7A 1OMEA 3JVUA 3IWOA 3UO9A 4LRZE 1PFLA 3BFCA 3MBZA 4MBFA 5TJJA 4JGPA 4DDYA 3LFVA 4IEDA 1NZOA 4HJ3A 3TSGA 4JKTA 4NXBA 1DP6A 4KQOA 3IXBA 4UQIS 3GRJA 1W8QA 3QNCA 1TD5A 2P7JA 2E8JA 2VKSA 2A24B 4PPRA 2W27A 3IX4A 2Y2OA 4GS9B 2RL3A 4HIAA 3BM6A 3LR3A 4EWFA 4B88A 3S7NA 1DP8A 3TJZC 4IUHA 2ZM2A 3LR0A 4E3IA 4Q0JA 1XJ3A 3SH9A 4Z1WA 2Y2KA 1G28A 1K56D 5HW3A 2PHYA 5DF9A 3A0SA 4GCZA 3DTMA 3HBRA 2W0NA 1A0KA 2ZMVA 2ZQCA 3MS6A 4IHQA 4DE1A 3LI8A 5GL9A 5EV0A 1YQSA 4LPZA 4ID4A 3FZCA 1L2SA 1LI9A 3F1NB 1WA9A 5FI6A 1M6KA 2A2LA 5GHYA 4BBVA 4MCWA 5CEBA 1EI5A 1HTZA 4WBGA 3GECA 1S4RA 2OAQ1 5DJTA 1K54A 2HDSA 3ZGAB 2P74A 1K4FA 1FOFA 3BFDA 4BBTA 3LEZA 2OSUA 3W4PA 3TW8A 3MSHA 1F5MA 3HLDA 5KSHA 4CJNA 2PAVP 4KG2A 4HNBA 5CEDA 4BMWA 1L0EA 5D3OA 3ITBA 1ES3A 3V39A 3R7WB 2B95A 1ODVA 1FQGA 3KYZA 5FQMA 5I5LA 4Y13A 3A3FA 4H6JA 4NK3A 1KE0A 3C4OA 1N9OA 3TG9A 2HP9A 1GCEA 1MWTA 3A3JA 4LLOB 4G3VA 1OTIA 1IYSA 3BFGA 5EOEA 4KUOA 2FZ0A 3KO6A 5FQKA 2JKTI 1ES4A 2O9CA 1MY8A 3UPPA 4EBNA 1OT9A 1G5UA 3NDEA 3WS4A 3K3DA 4Y0OA 4P6ZM 4LRYC 2J8YA 1SCWA 3CI6A 3D72A 2VJWA 5L07A 4WLAA 4Y5FA 3P01A 1GSWA 2Y2LA 5G4YA 1O7EA 1SDEA 3FC7A 2G7UA 4OP8A 1OT6A 5EOOA 3LIFA 2INWA 4ZJ3A 1BLHA 1KGFA 2D01A 2O0YA 2Y2NA 3LGOA 3FV7A 2K31A 4GW9A 3PTEA 4XUXA 1H5XA 4N9KA 4FTXA 5AJGA 1OTDA 2H0YA 2ZMFA 4FUWA 4DJ3A 2CMNA 1RGZA 4MMNA 1K25A 3W4QA 4Y7PA 4JGRA 3WS2A 2VX8A 5DF8A 4X6TA 4WMCA 3N8RA 3MR0A 3W2ZA 4DRTA 5FI2A 1OTBA 1RGYA 3EGXC 3SH7A 3CLOA 4MBHA 4KG5A 1AXBA 3IHAA 1FR6A 2P9VB 3T1XA 5CHJA 4EBPA 4QY5A 3F1OB 3LUQA 4EESA 2HV1A 4GDBA 1NYMA 1F98A 3ZHHA 4EEUA 3ISGA 4FOFA 3QP1A 4OQ0A 1W63Q 1H8MA 1H8YA 2H28A 1S1YA 3GDIA 3EEHA 2L0WA 2PR6A 1LSWA 1L0FA 5DTKA 1T19A 1WYBA 5HDCA 2PR5A 4S2LA 2QMIA 1N9LA 2HJEA 4FCFA 3QP2A 3WRTA 3PBQA 5CECA 1YLTA 3NOUC 4X25A 4DF6A 1CJFA 1ACFA 1UWPX 2ZQ8A 5G18A 4RX3A 5M18A 4X53A 3RH8B 4EQIA 1FR1A 3UNWA 2O9BA 4BD1A 3IX3A 3UMDA 2PT7A 1OPXA 1PIOA 2OWHA 3V67A 3DTIA 1YLZA 1S6RA 1TF1A 3PBOA 4EXOA 4G3WA 3FWLA 3Q82A 4GB7A 2BASA 5EVLA 4HH3A 3PAEA 4K08A 5HZHA 2V0WA 4KG6A 3C2WA 1XFQA 1V9ZA 3T12B 2ZLYA 3UB5P 4Y17A 5HAIA 1I5QA 4WMCD 4Y15A 4RYEA 4JXGA 4R6LA 4N92A 1YLJA 4OLGA 1TS7A 3CUEC 4JXWA 4CLCA 1S67L 5DVAA 4B9OA 3E98A 4KENB 4P0MA 3BRMA 4Z9QA 1N9NA 5CXWA 2XH9A 4ETZA 1LSXA 1S66L 3KYEA 1BULA 3NIAA 3OPLA 3IH8A 3TOIA 4PM7A 1GHIA 3IBRA 4E04A 2NUTC 5AQBA 5FL3A 4OOMA 4LENA 2Y2JA 2QYBA 3A3DA 2IWBA 1K4EA 5FA7A 2LB5A 3U4LP 3GTCA 3W4OA 5HL1A 3HVFA 1QMFA 4HJ6A 3A3EA 4WEJA 4R3JA 1GSXA 2JKGA 2XLNA 2W3GA 3VE4A 3N7WA 1W5DA 3QHYA 3O88A 4BLMA 4HHDA 5CX7A 3C7UA 5E2GA 1E4DA 2WYXA 2ZC7A 3FPWA 3TRCA 4OKPA 3ZG7B 3F1PB 5HARA 4K0XA 2VGJA 4M4XA 2P08A 3IS2B 3B47A 3UDIA 4UQIM 3SOIA 1XP4A 5F6AA 1E3UD 4E3JA 5FDSA 1BSGA 3LIAA 3OCNA 5EVIA 4I38A 4GLQA 4K91A 4I3JA 4HQAA 4IVKA 5KZHA 1HVBA 1XJ4A 3FPVA 1CF0A 4YOFA 3UB7A 1S0WA 4IUKA 4CLCD 3IF6B 2VGLS 1QMEA 5HAQA 1YSQA 3HLGA 2H5SA 3PXPA 4ZBEA 5HX9A 4WZ4A 3MFXA 1OJ5A 1VETB 2JCHA 3T4LA 3MZFA 4HP9A 2WAFA 2IWDA 5HPIA 2EX2A 2M1CA 3V3SA 3UE1A 1KDSA 3N6IA 2W3EA 1Y4OA 4D2OA 4X69A 3NDGA 2V0UA 3L7HA 4CPKA 4DN0A 3PAGA 1GA0A 2XFTA 1NLZA 3MXQA 1J9MA 2HP5A 3LIEA 3LR5A 2I72A 4MN7A 3ZG9B 4MDZA 3I7JA 3G32A 4QWOA 2LB9A 4OVDA 3LICA 2JKTM 2Y2GA 2EA9A 1KDWA 3UPNA 2JKFA 2QZ6A 1GSVA 3KSIA 3CPTA 1YMXA 2EX8A 3IBJA 2VZWA 1SDNA 2IWCA 4IJGA 5M19A 5IU1A 3BW6A 3NHQA 4IBRA 3T4JA 4HBTA 4B93A 5HSQA 4LV3A 2ZJ9A 2GZAA 4XUZA 4S2JA 1JTDA 5AVFA 4PKYA 1GHPA 3FYZA 1VQQA 4I39A 1KVLA 2FH5A 3SW1A 3CITA 3BLMA 4EUVA 5FEGA 1STZA 4E3LA 4PM5A 2ZC5B 4GOGA 2ZQ7A 1EW0A 3D4FA 5EUAA 1G68A 5E43A 1IKIA 1ALQA 1HLUP 4ZTKA 3ZVWA 4UA6A 2A3UA 4EEPA 1SKFA 3MZEA 3BWLA 3NC8A 3PBSA 1XGJA 4DMZA 5IHVA 3GVBA 2W1TB 3H7WB 4XT2A 2AVXA 2A49A 4R23A 4JGOA 2V20A 3HLFA 5FI7A 3WS1A 4OPZA 1BZAA 2WKHA 3G2ZA 2VEAA 1TEMA 2WGWA 3S7QA 5DFYA 5EVEA 5KIZA 3E4OA 2BLSA 1ZG4A 1BT5A 3RXXA 1Q2PA 3FKWA 4Q8IA 1KGEA 3B33A 1UGUA 1PNEA 3O3VA 2W3FA 3KX0X 1YKDA 3A0RA 2K2NA 3MJQA 3C4PA 3RFBA 4BL3A 1XA7A 4L9GA 4OPQA 2PU4A 2XDMA 3DW0A 5EE8A 1PYYA 1CEFA 3WWXA 1IYQA 4GD6A 1PWGA 1NJ4A 5GHZA 4DE3A 2CC1A 3EQUA 4GDNA 2X71A 5E2EA 5I94A 2JHEA 3PYPA 2HPBA 4HY8A 3M2KA 1XA1A 2Y79A 5IT5A 3G30A 4OQGA 4U0XA 2VV6A 2KDKA 2R9XA 1ONGA 4D60A 1H3QA 4KZ3A 4NXFA 1TVFA 2OAP1 3S22A 5E2HA 5F5YA 4U0TA 4Y0TA 3PBRA 1T18A 4GNUA 4OPRA 1L0DA 4YNRA 3L9KA 3IHBA 5JYOA 1TDGA 4WF0A 5IS1A 4PAUA 2QPNA 3IF6C 4AFIA 5BOHA 5TBMA 2RCXA 4KZ4A 1Q2QA 4R38A 3NI9A 2Y2HA 1OTAA 4WYYA 1DJAA 3MF0A 4WUJA 2XA7S 3NOTC 4R1GA 1JWPA 3SZTA 2ZL1B 3CAXA 3G2YA 4A5RA 2A24A 3OPHA 3UE0A 3IWIA 2WKIA 4RQ9A 2PD8A 3WRZA 1ONHA 2G2UA 3ZFZA 2XGNA 4X56A 3D9YA 3AGEA 1JWZA 2XRNA 5F1FA 4O7DA 2W1RA 5AQ7A 3HCYA 4GS9A 3M2JA 5A90A 2J3TD 1BLSA 3R4KA 5EFWA 3ZG8B 4GN2A 3O86A 3QP6A 1PRQA 2OV5A 4ARZA 1LI0A 2ZC3B 2PU2A 4RA7A 1W79A 4F3LB 4OOYA 3SH8A 1ERMA 3CMZA 2ZOHA 3E4PA 1H0MA 4CLCB 3OC2A 5U47A 4PMAA 3VP3A 4OPYA 1VEUB 3ZG5A 1IFQA 3VMAA 4GJ4A 1PWDA 3UDXA 1BLPA 1IKGA 3HLBA 1VHMA 3IH9A 2W3HA 2EWWA 2Y55A 2C6WB 4HOIA 2V1BA 3C7VA 4R4SA 4DE0A 2Y4AA 1PI5A 3NY4A 4KZ6A 3F1NA 1LT0A 3G4PA 2Y2MA 3MMHA 4RVAA 2XQZA 1K38A 4BENA 4NETA 2PBDP 2I9VA 1N4OA 4HBUA 1NY0A 1JVJA 2HDUA 2M7UA 4UA7A 4BD0A 3ZNTA 1YMSA 4JLFA 2UWXA 4PKYG 3HUMA 3ZG0A 4WM9A 4WEKA 5GLAA 2ZQAA 3QP4A 4H8RA 1PW1A 4GHIB 4QJGA 5J8XA 3CUEA 3T4QA 3HUOA 1E25A 3O87A 2PD7A 1NYYA 1XJ2A 5K5BA 5HWTA 5J7EA 1SKOB 4KZ8A 1JNUA 1Y54A 5HD3A 2E8IA 3R7WA 5C5KA 2BTFP 1YLYA 2WKEA 2XEPA 3HJKA 4JXSA 1PZOA 3GSGA 2Z6DA 1ES5A 1K55C 5CGWA 1OJGA 3EEAA 3C38A 1NRJA 3A0VA 5GLDA 3IX8A 2XSSA 2QJ5A 5DF7A 2MJ6A 1FSYA 3T1QB 4O8GA 5L8MA 2R9WA 2IA2A 2KLIA 4R3BA 4E3OA 3M6HA 1TS0A 2XD5A 3BFEA 3LO7A 1K57A 2FFYA 3H82B 1ZKJA 2VGLM 1XX2A 2Z2MB 1UWNX 4WN5A 1DP9A 5AQ9A 5FSRA 4LCMA 2XR0A 3PHYA 5DTSA 2J9OA 5DFXA 3OBFA 1ZC2A 4N9LA 4IVIA 4X68A 2V2FF 1YT4A 4JGQA 3RTYA 4X1MA 5CGXA 4PM9A 2JKRI 1AWIA 1IYOA 2Y8HA 4Q0IA 3MZDA 2B5RA 3VOYA 2ZOIA 4ME4A 3GR2A 2EXAA 4UHUA 4EQ1A 1LL5A 3OOVA 5FQ9A 3DTEA 4BJPA 4YINA 3CZDA 2Y2PA 4P6BA 3Q7VA 4E3MA 3MXSA 4S2IA 3QP5A 2P9VA 4NEED 4OQIA 2V1ZA 2DRWA 1PI4A 2XK1A 3UY6A 3HLEA 3F1OA 4G3KA 4S2KA 4QU3A 4LFUA 3V5MA 2WUQA 1LHYA 2HDRA 3UE3A 3T4TA 3AGDA 4CQHA 4JXVA 1MWRA 2B18A 3VP0A 1NRFA 1MKIA 3UN7A 4ETXA 4WL9A 1NZUA 4MBKA 4PM6A 2QKPA 2WAEA 1ZHHB 2B02A 3K3CA 2ZM8A 2ZM0A 1DJCA 2J80A 2JE5A 4CLCC 2O99A 4NG2A 3CWFA 3MKFA 2QWSA 3UB9A 2EX9A 1S1ZA 4QB8A 3HLWA 3S7PA 3VFFA 1VM1A 3IF5A 4EERA 1ESUA 3DAVA 4X1LA 5L10A 3FKVA 1MZUA 1D7EA 4LCLA 3UMEA 3CHWP 1SHVA 4P87A 5CRFA 4KZ7A 3BECA 4KZ5A 2QJ7A 2ZC6B 3O5YA 4O01A 2K7SA 2P04A 2YKFA 3MQQA 3IT9A 4P85A 4MLLA 3TE8A 3CJMA 4EU0A 1MC0A 2G2WA 4FD8A 2KX6A 4QPRA 1K56A 3VP1A 1FIKA 3K2NA 3PBTA 1K6RA 3VE3A 3PR6A 2W3DA 4S2NC 2JBFA 1RCJA 5FAPA 3T50A 2R78A 3BLSA 2YKHA 3BJNA 4N1XA 2H10A 3UE6A 3LIBA 4H6JB 1IOUA 1LL9A 4I3AA 3Q81A 1WE4A 1F9IA 2WGVA 1BYWA 1O07A 3N8LA 1XXMA 1BTLA 3OPRA 5G4ZA 1IEMA 5F82A 4Y2FA 4NXEA 3NULA 5EVID 2Y91A 4WZ5C 2Q9NA 3N8SA 2GDNA 5TFQA 5A8BA 3T1SA 1ZG6A 2PBYA 4KUKA 3A3IA 1XFNA 3ZNYA 4KZ9A 3F1PA 3NOPC 3QP8A 5J3WA 4B4ZA 3G6OA 3IS2A 2XA7M 1Y28A 2WK0A 3UPOA 1L0GA 2V8CA 3HLCA 2J9PA 5HWVA 3E0YA 3C8CA 2Q0OA 3DTKA 3C5AA 4ZDXA 1RP5A 1CI8A 1M40A 1MBLA 3AGFA 4EV4A 3IXHA 3HUNA 3JPUA 3C30A 4B4XA 5FQIA 4ARZB 3ZDJA 1TS8A 4PM8A 1YSPA 3IF6A 1YLWA 4II7A 3PBNA 3S7OA 1VETA 4JF4A 1YPRA 4C3QA 3NBLA 2PRFA 2V8FA 3W8KA 1H8ZA 1EWZA 5FASA 1D1JA 4MEZA 1HD8A 3BQAA 3G34A 2X02A 4OQHA 2VK3A 4I5SA 4OH0A 2WKPA 3DBAA 1VB6A 4L0LA 4F94A 2EX6A 1XGIA 2O9AA 1KGGA 3VFHA
chains in the Genus database with same CATH topology
4GZBA 2Z2LB 4X55A 4BENA 4NETA 3A3DA 2IWBA 1K4EA 3QNBA 5FA7A 1N4OA 1PWCA 3MKEA 4HBUA 1NY0A 3GTCA 1JVJA 2HDUA 3W4OA 5HL1A 4UA7A 4BD0A 4HEFA 3HVFA 3SS3A 3ZNTA 1YMSA 1CK3A 1QMFA 2UWXA 3HUMA 4GKUA 4JLFA 4WEKA 1ERQA 4WM9A 4N1HA 5GLAA 4DKIA 2WZXA 2ZQAA 2XF3A 3A3EA 4H8RA 1WYCA 5CERA 5CHMA 5EVIC 2VGKA 1PZPA 1PW1A 4WEJA 4R3JA 4QJGA 4E6WA 2XFSA 4BL2A 3V50A 5J8XA 2XLNA 4S2MA 1N9BA 3HUOA 3N7WA 1E25A 5CHUA 4DXBA 4FSFA 5AQAA 3NCKA 1W5DA 4UA9A 3O87A 3O88A 1MXOA 1MWUA 1NYYA 3QHYA 5F83A 3VSKA 4KZAA 3VP4A 4MNRA 4S2OA 4KZ8A 1Y54A 2E8IA 1TDLA 4ZAMA 4BLMA 4JF6A 3C7UA 1OMEA 1YLYA 5E2FA 3IWOA 5E2GA 1E4DA 3UO9A 3EQVA 2WYXA 2WKEA 2ZC7A 4OKPA 2XEPA 3BFCA 3MBZA 4MBFA 3ZG7B 4DDYA 4JXSA 5HARA 4K0XA 2VGJA 4IEDA 1NZOA 3TSGA 1PZOA 4JKTA 3GSGA 4DDSA 4KQOA 3UDIA 3IXBA 4OOLA 4FH4A 5F1GA 3GRJA 5KMWA 1W8QA 3WS5A 3QNCA 3LY4A 1ES5A 1I2SA 3SOIA 4EBLA 1XP4A 1K55C 5CGWA 4PPRA 1E3UD 5GLDA 3V3RA 3P09A 4E3JA 2X01A 1EROA 1C3BA 5DF7A 1BSGA 3OCNA 5EVIA 1FSYA 1KE3A 4Y0UA 2Y2OA 4K91A 2C5WB 4OP5A 3BFFA 1MWSA 2R9WA 2RL3A 4IVKA 1K54C 1LLBA 3BM6A 1HVBA 4C75A 5KZHA 4EWFA 4B88A 4R3BA 4E3OA 3M6HA 2ZM2A 4K0WA 2XD5A 1S0WA 3BFEA 4HESA 3LO7A 1K57A 2FFYA 3IWQA 4E3IA 5TR7A 3IF6B 5A92A 1FSWA 1ZKJA 1QMEA 3UDFA 1YM1A 3SH9A 3BEBA 2H5SA 3HLGA 4ZBEA 5HX9A 5HAQA 4WZ4A 2HP6A 1XX2A 2Z2MB 2JCHA 3MZFA 2Y2KA 4QD4A 1K56D 2DNSA 2IWDA 2WAFA 5AQ9A 5FSRA 4LCMA 1XPBA 2EX2A 2XR0A 5HW3A 1BUEA 3V3SA 5DTSA 2J9OA 4R0QA 4IBXA 1KDSA 5DF9A 3UE1A 4RX2A 1ZC2A 2ZC4B 3N6IA 4N9LA 4IVIA 3DTMA 4X68A 3HBRA 4X69A 4D2OA 3NDGA 1W8YA 2V2FF 1YT4A 3OPPA 3GQZA 4KQRA 2ZQCA 4DE1A 5GL9A 5CGXA 4CPKA 4E3KA 3PAGA 1GA0A 4PM9A 1YQSA 1K55A 4ID4A 1IYOA 3FZCA 1L2SA 2XFTA 4KZBA 3MZDA 2B5RA 1DY6A 1Z6FA 1LI9A 3VOYA 1J9MA 2HP5A 2Q9MA 4UAAA 3S4XA 2I72A 3ZG9B 3GR2A 5FI6A 1M6KA 5CEBA 5GHYA 5FAOA 3I7JA 5FQQA 2EXAA 3G32A 1EI5A 4UHUA 1HTZA 1U60A 4WBGA 4YFMA 4ZJ1A 1LL5A 1DJBA 4OVDA 5FQ9A 1K54A 1BLCA 2Y2GA 2HDSA 3ZGAB 4BJPA 1KDWA 2P74A 3UPNA 4WELA 2QZ6A 2ZQ9A 1PW8A 3CZDA 1K4FA 3Q7VB 4YINA 2WGIA 1YMXA 2Y2PA 4P6BA 2EX8A 3Q7VA 1FOFA 3BFDA 3MFDA 4E3MA 3MXSA 3LEZA 1SDNA 2IWCA 3IXDA 5M19A 2OSUA 3W4PA 1I2WA 4S2IA 4IBRA 2P9VA 4OQIA 4HBTA 2V1ZA 4LV2A 2DRWA 1PI4A 4S2PA 4LV3A 3HLDA 5KSHA 4CJNA 2ZJ9A 2XK1A 3UY6A 3HLEA 4KG2A 4XUZA 4S2JA 1JTDA 4S2KA 1GHPA 3FYZA 4QU3A 5TGFA 3E2KA 5CEDA 1L0EA 1VQQA 3MXRA 1KVLA 5D3OA 3ITBA 4DE2A 3V5MA 1ES3A 3BLMA 3V39A 2WUQA 5CTMA 1LHYA 5A93A 2HDRA 2OLVA 4E3LA 4PM5A 3UE3A 2ZC5B 1FQGA 5FQMA 4GOGA 2ZQ7A 3A3FA 4NK3A 1KE0A 3C4OA 3TG9A 2HP9A 1GCEA 1MWTA 3AGDA 3D4FA 3A3JA 4JXVA 4OOMA 1G68A 5E43A 1IKIA 1MWRA 5EUAA 3VP0A 4QY6A 1ALQA 1IYSA 3BFGA 1NRFA 3G31A 5CGSA 1MKIA 1JTGA 5EOEA 3UN7A 4ZTKA 4OONA 3ZVWA 1KVMA 4UA6A 2A3UA 5FQKA 3Q1FA 1NZUA 1ES4A 1SKFA 4MBKA 4PM6A 2WAEA 1MY8A 2EFXA 3UPPA 3MZEA 4EBNA 2ZM8A 3NC8A 3PBSA 2ZM0A 1DJCA 1XGJA 5EVIB 3NDEA 3JYIA 4JPMA 2JE5A 5IHVA 3WS4A 1GA9A 3GVBA 2A49A 4Y0OA 3MKFA 4R23A 2J8YA 1SCWA 2EX9A 4QB8A 1XKZA 2V20A 3HLWA 3HLFA 2Y2LA 5FI7A 3WS1A 4OPZA 5EECA 1O7EA 1BZAA 1SDEA 1VM1A 2WKHA 3G2ZA 3IF5A 3VFFA 3CG5A 1ESUA 4OP8A 5FATA 5EOOA 1TEMA 2WGWA 3ZCZA 3FKVA 1W7FA 4OLDA 2BLSA 4LCLA 1ZG4A 4KQQA 5A91A 3VP2A 1ESIA 5HFOA 1BT5A 4ZJ3A 1SHVA 3OCLA 1BLHA 3P98A 4P87A 1KGFA 5CRFA 3RXXA 1E3UA 2Y2NA 1Q2PA 4KZ7A 3FKWA 2J7VA 3BECA 4KZ5A 4Q8IA 1KGEA 2ZC6B 3FV7A 3ZG0A 3PTEA 3O3VA 3ITAA 3ZVTA 4XUXA 1H5XA 4N9KA 3S1YA 3IT9A 2H0YA 3C4PA 4P85A 4BL3A 4MLLA 1XA7A 4OPQA 3CJMA 1RGZA 2PU4A 1GHMA 2XDMA 3DW0A 3LCEA 1K25A 3W4QA 5EE8A 2G2WA 4Y7PA 1PYYA 4FD8A 1CEFA 3WWXA 2EFUA 3WS2A 1IYQA 4GD6A 1PWGA 1NJ4A 5DF8A 5GHZA 2BG1A 4WMCA 4X6TA 3VSLA 4DE3A 1JWVA 2CC1A 3N8RA 1K56A 5M1AA 4DRTA 5FI2A 3EQUA 3VP1A 5FDHA 4GDNA 1RGYA 4LV0A 2X71A 5E2EA 1ES2A 5I94A 3PBTA 3SH7A 5GLBA 4MBHA 1KE4A 3B3XA 2ZMAA 4KG5A 1AXBA 2HPBA 3OZHA 4XXRA 3IHAA 1FR6A 2P9VB 3M2KA 1XA1A 1K6RA 5CHJA 1IELA 4EBPA 3G30A 3M6BA 4QY5A 5DTTA 4OQGA 4U0XA 4S2NC 3RJUA 2JBFA 4GDBA 1NYMA 1FCOA 3ZHHA 2R9XA 3ISGA 1ONGA 1RCJA 1FCMA 2XD1A 5FAPA 4OQ0A 4KZ3A 5FQJA 1H8YA 1TVFA 5KSCA 3BLSA 3N4IA 4C6YA 4R4RA 3S22A 2JC7A 5E2HA 5GLCA 4N1XA 4U0TA 2H10A 2HDQA 1L0FA 2DCFA 5DTKA 1WYBA 1CEGA 1LL9A 4E3NA 4U3TA 4Y0TA 3VOZA 3PBRA 4S2LA 3Q81A 1WE4A 4GNUA 2QMIA 2WGVA 1O07A 3Q7ZA 2H0TA 4FCFA 3N8LA 4OPRA 1XXMA 3WRTA 1L0DA 1CI9A 3PBQA 1BTLA 1YLTA 3OPRA 5CECA 1IEMA 3IHBA 5F82A 5JYOA 1TDGA 4DF6A 4E6XA 1K57C 5EVID 2Y91A 2ZQ8A 4RX3A 2Y2QA 5G18A 2QPNA 5M18A 4WZ5C 2Q9NA 3IF6C 3N8SA 2GDNA 4FH2A 5GHXA 5TFQA 4X53A 5BOHA 5CTNA 2RCXA 4M3KA 4JBFA 4EQIA 1ZG6A 4KZ4A 1MPLA 1NXYA 1FR1A 1Q2QA 3UNWA 2PBYA 4BQMA 4BD1A 3A3IA 3NI9A 2Y2HA 3ZNYA 3DWZA 4KZ9A 4WYYA 5L2FA 3IXGA 1DJAA 4S2NA 2ZD8A 4B4ZA 4LV1A 4R1GA 3G35A 1PIOA 1JWPA 3DWKA 1YLZA 2WK0A 3UPOA 1L0GA 1S6RA 2WGWB 3PBOA 3HLCA 3G2YA 2J9PA 3IQAA 1G6AA 4A5RA 3FWLA 3Q82A 4GB7A 1HZOA 5JYPA 2WZZA 5EVLA 3OPHA 3UE0A 3C5AA 4ZDXA 3IWIA 2WKIA 3PAEA 1RP5A 1CI8A 1M40A 1MBLA 3WRZA 1ONHA 3AGFA 4EV4A 2G2UA 4ZJ2A 3ZFZA 2XGNA 4X56A 3AGEA 1JWZA 5F1FA 3IXHA 1K6SA 2Y2IA 3HUNA 4KG6A 3E2LA 3HL9A 4O7DA 5AQ7A 2ZQDA 4B4XA 5FQIA 3M2JA 5A90A 1BLSA 2ZLYA 2OLUA 3ZDJA 3ZG8B 4GN2A 3O86A 4JF5A 2OV5A 1LI0A 2ZC3B 4PM8A 5HAIA 2PU2A 4RA7A 1I5QA 1W79A 3IF6A 4WZ5A 2EXBA 4OOYA 1YLWA 3SH8A 3PBNA 4WMCD 1ERMA 3CMZA 4RYEA 4JXGA 4N92A 3OC2A 1YLJA 4JF4A 4OLGA 5U47A 4JXWA 4PMAA 3GV9A 3VP3A 4OPYA 4C3QA 3NBLA 4EUZA 3ZG5A 5DVAA 5EPHA 3VMAA 3LY3A 4KENB 4P0MA 3W8KA 1H8ZA 3BRMA 1PWDA 2Y59A 4Z9QA 1EWZA 5FASA 3UDXA 1IYPA 1BLPA 2WADA 1IKGA 4MEZA 5CXWA 3HREA 1YLPA 3HLBA 1HD8A 2XH9A 3IH9A 3RXWA 3SS5A 3WS0A 5HAPA 1FCNA 2Y55A 2C6WB 3G34A 2X02A 4OQHA 3SS4A 3C7VA 4R4SA 4DE0A 1BULA 3NIAA 3OPLA 2Y4AA 3IH8A 3TOIA 4PM7A 1PI5A 1GHIA 3NY4A 3Q07A 4KZ6A 4GD8A 4OH0A 3G4PA 2Y2MA 4RVAA 3BYDA 4L0LA 5AQBA 4F94A 2EX6A 1XGIA 1K38A 2XQZA 3GMWA 4QHCA 1KGGA 2FFFB 3VFHA 4DXCA 4LENA 2Y2JA 5FAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZB A;  2Z2L B;  4X55 A;  4BEN A;  4NET A;  3A3D A;  2IWB A;  1K4E A;  3QNB A;  5FA7 A;  1N4O A;  1PWC A;  3MKE A;  4HBU A;  1NY0 A;  3GTC A;  1JVJ A;  2HDU A;  3W4O A;  5HL1 A;  4UA7 A;  4BD0 A;  4HEF A;  3HVF A;  3SS3 A;  3ZNT A;  1YMS A;  1CK3 A;  1QMF A;  2UWX A;  3HUM A;  4GKU A;  4JLF A;  4WEK A;  1ERQ A;  4WM9 A;  4N1H A;  5GLA A;  4DKI A;  2WZX A;  2ZQA A;  2XF3 A;  3A3E A;  4H8R A;  1WYC A;  5CER A;  5CHM A;  5EVI C;  2VGK A;  1PZP A;  1PW1 A;  4WEJ A;  4R3J A;  4QJG A;  4E6W A;  2XFS A;  4BL2 A;  3V50 A;  5J8X A;  2XLN A;  4S2M A;  1N9B A;  3HUO A;  3N7W A;  1E25 A;  5CHU A;  4DXB A;  4FSF A;  5AQA A;  3NCK A;  1W5D A;  4UA9 A;  3O87 A;  3O88 A;  1MXO A;  1MWU A;  1NYY A;  3QHY A;  5F83 A;  3VSK A;  4KZA A;  3VP4 A;  4MNR A;  4S2O A;  4KZ8 A;  1Y54 A;  2E8I A;  1TDL A;  4ZAM A;  4BLM A;  4JF6 A;  3C7U A;  1OME A;  1YLY A;  5E2F A;  3IWO A;  5E2G A;  1E4D A;  3UO9 A;  3EQV A;  2WYX A;  2WKE A;  2ZC7 A;  4OKP A;  2XEP A;  3BFC A;  3MBZ A;  4MBF A;  3ZG7 B;  4DDY A;  4JXS A;  5HAR A;  4K0X A;  2VGJ A;  4IED A;  1NZO A;  3TSG A;  1PZO A;  4JKT A;  3GSG A;  4DDS A;  4KQO A;  3UDI A;  3IXB A;  4OOL A;  4FH4 A;  5F1G A;  3GRJ A;  5KMW A;  1W8Q A;  3WS5 A;  3QNC A;  3LY4 A;  1ES5 A;  1I2S A;  3SOI A;  4EBL A;  1XP4 A;  1K55 C;  5CGW A;  4PPR A;  1E3U D;  5GLD A;  3V3R A;  3P09 A;  4E3J A;  2X01 A;  1ERO A;  1C3B A;  5DF7 A;  1BSG A;  3OCN A;  5EVI A;  1FSY A;  1KE3 A;  4Y0U A;  2Y2O A;  4K91 A;  2C5W B;  4OP5 A;  3BFF A;  1MWS A;  2R9W A;  2RL3 A;  4IVK A;  1K54 C;  1LLB A;  3BM6 A;  1HVB A;  4C75 A;  5KZH A;  4EWF A;  4B88 A;  4R3B A;  4E3O A;  3M6H A;  2ZM2 A;  4K0W A;  2XD5 A;  1S0W A;  3BFE A;  4HES A;  3LO7 A;  1K57 A;  2FFY A;  3IWQ A;  4E3I A;  5TR7 A;  3IF6 B;  5A92 A;  1FSW A;  1ZKJ A;  1QME A;  3UDF A;  1YM1 A;  3SH9 A;  3BEB A;  2H5S A;  3HLG A;  4ZBE A;  5HX9 A;  5HAQ A;  4WZ4 A;  2HP6 A;  1XX2 A;  2Z2M B;  2JCH A;  3MZF A;  2Y2K A;  4QD4 A;  1K56 D;  2DNS A;  2IWD A;  2WAF A;  5AQ9 A;  5FSR A;  4LCM A;  1XPB A;  2EX2 A;  2XR0 A;  5HW3 A;  1BUE A;  3V3S A;  5DTS A;  2J9O A;  4R0Q A;  4IBX A;  1KDS A;  5DF9 A;  3UE1 A;  4RX2 A;  1ZC2 A;  2ZC4 B;  3N6I A;  4N9L A;  4IVI A;  3DTM A;  4X68 A;  3HBR A;  4X69 A;  4D2O A;  3NDG A;  1W8Y A;  2V2F F;  1YT4 A;  3OPP A;  3GQZ A;  4KQR A;  2ZQC A;  4DE1 A;  5GL9 A;  5CGX A;  4CPK A;  4E3K A;  3PAG A;  1GA0 A;  4PM9 A;  1YQS A;  1K55 A;  4ID4 A;  1IYO A;  3FZC A;  1L2S A;  2XFT A;  4KZB A;  3MZD A;  2B5R A;  1DY6 A;  1Z6F A;  1LI9 A;  3VOY A;  1J9M A;  2HP5 A;  2Q9M A;  4UAA A;  3S4X A;  2I72 A;  3ZG9 B;  3GR2 A;  5FI6 A;  1M6K A;  5CEB A;  5GHY A;  5FAO A;  3I7J A;  5FQQ A;  2EXA A;  3G32 A;  1EI5 A;  4UHU A;  1HTZ A;  1U60 A;  4WBG A;  4YFM A;  4ZJ1 A;  1LL5 A;  1DJB A;  4OVD A;  5FQ9 A;  1K54 A;  1BLC A;  2Y2G A;  2HDS A;  3ZGA B;  4BJP A;  1KDW A;  2P74 A;  3UPN A;  4WEL A;  2QZ6 A;  2ZQ9 A;  1PW8 A;  3CZD A;  1K4F A;  3Q7V B;  4YIN A;  2WGI A;  1YMX A;  2Y2P A;  4P6B A;  2EX8 A;  3Q7V A;  1FOF A;  3BFD A;  3MFD A;  4E3M A;  3MXS A;  3LEZ A;  1SDN A;  2IWC A;  3IXD A;  5M19 A;  2OSU A;  3W4P A;  1I2W A;  4S2I A;  4IBR A;  2P9V A;  4OQI A;  4HBT A;  2V1Z A;  4LV2 A;  2DRW A;  1PI4 A;  4S2P A;  4LV3 A;  3HLD A;  5KSH A;  4CJN A;  2ZJ9 A;  2XK1 A;  3UY6 A;  3HLE A;  4KG2 A;  4XUZ A;  4S2J A;  1JTD A;  4S2K A;  1GHP A;  3FYZ A;  4QU3 A;  5TGF A;  3E2K A;  5CED A;  1L0E A;  1VQQ A;  3MXR A;  1KVL A;  5D3O A;  3ITB A;  4DE2 A;  3V5M A;  1ES3 A;  3BLM A;  3V39 A;  2WUQ A;  5CTM A;  1LHY A;  5A93 A;  2HDR A;  2OLV A;  4E3L A;  4PM5 A;  3UE3 A;  2ZC5 B;  1FQG A;  5FQM A;  4GOG A;  2ZQ7 A;  3A3F A;  4NK3 A;  1KE0 A;  3C4O A;  3TG9 A;  2HP9 A;  1GCE A;  1MWT A;  3AGD A;  3D4F A;  3A3J A;  4JXV A;  4OOM A;  1G68 A;  5E43 A;  1IKI A;  1MWR A;  5EUA A;  3VP0 A;  4QY6 A;  1ALQ A;  1IYS A;  3BFG A;  1NRF A;  3G31 A;  5CGS A;  1MKI A;  1JTG A;  5EOE A;  3UN7 A;  4ZTK A;  4OON A;  3ZVW A;  1KVM A;  4UA6 A;  2A3U A;  5FQK A;  3Q1F A;  1NZU A;  1ES4 A;  1SKF A;  4MBK A;  4PM6 A;  2WAE A;  1MY8 A;  2EFX A;  3UPP A;  3MZE A;  4EBN A;  2ZM8 A;  3NC8 A;  3PBS A;  2ZM0 A;  1DJC A;  1XGJ A;  5EVI B;  3NDE A;  3JYI A;  4JPM A;  2JE5 A;  5IHV A;  3WS4 A;  1GA9 A;  3GVB A;  2A49 A;  4Y0O A;  3MKF A;  4R23 A;  2J8Y A;  1SCW A;  2EX9 A;  4QB8 A;  1XKZ A;  2V20 A;  3HLW A;  3HLF A;  2Y2L A;  5FI7 A;  3WS1 A;  4OPZ A;  5EEC A;  1O7E A;  1BZA A;  1SDE A;  1VM1 A;  2WKH A;  3G2Z A;  3IF5 A;  3VFF A;  3CG5 A;  1ESU A;  4OP8 A;  5FAT A;  5EOO A;  1TEM A;  2WGW A;  3ZCZ A;  3FKV A;  1W7F A;  4OLD A;  2BLS A;  4LCL A;  1ZG4 A;  4KQQ A;  5A91 A;  3VP2 A;  1ESI A;  5HFO A;  1BT5 A;  4ZJ3 A;  1SHV A;  3OCL A;  1BLH A;  3P98 A;  4P87 A;  1KGF A;  5CRF A;  3RXX A;  1E3U A;  2Y2N A;  1Q2P A;  4KZ7 A;  3FKW A;  2J7V A;  3BEC A;  4KZ5 A;  4Q8I A;  1KGE A;  2ZC6 B;  3FV7 A;  3ZG0 A;  3PTE A;  3O3V A;  3ITA A;  3ZVT A;  4XUX A;  1H5X A;  4N9K A;  3S1Y A;  3IT9 A;  2H0Y A;  3C4P A;  4P85 A;  4BL3 A;  4MLL A;  1XA7 A;  4OPQ A;  3CJM A;  1RGZ A;  2PU4 A;  1GHM A;  2XDM A;  3DW0 A;  3LCE A;  1K25 A;  3W4Q A;  5EE8 A;  2G2W A;  4Y7P A;  1PYY A;  4FD8 A;  1CEF A;  3WWX A;  2EFU A;  3WS2 A;  1IYQ A;  4GD6 A;  1PWG A;  1NJ4 A;  5DF8 A;  5GHZ A;  2BG1 A;  4WMC A;  4X6T A;  3VSL A;  4DE3 A;  1JWV A;  2CC1 A;  3N8R A;  1K56 A;  5M1A A;  4DRT A;  5FI2 A;  3EQU A;  3VP1 A;  5FDH A;  4GDN A;  1RGY A;  4LV0 A;  2X71 A;  5E2E A;  1ES2 A;  5I94 A;  3PBT A;  3SH7 A;  5GLB A;  4MBH A;  1KE4 A;  3B3X A;  2ZMA A;  4KG5 A;  1AXB A;  2HPB A;  3OZH A;  4XXR A;  3IHA A;  1FR6 A;  2P9V B;  3M2K A;  1XA1 A;  1K6R A;  5CHJ A;  1IEL A;  4EBP A;  3G30 A;  3M6B A;  4QY5 A;  5DTT A;  4OQG A;  4U0X A;  4S2N C;  3RJU A;  2JBF A;  4GDB A;  1NYM A;  1FCO A;  3ZHH A;  2R9X A;  3ISG A;  1ONG A;  1RCJ A;  1FCM A;  2XD1 A;  5FAP A;  4OQ0 A;  4KZ3 A;  5FQJ A;  1H8Y A;  1TVF A;  5KSC A;  3BLS A;  3N4I A;  4C6Y A;  4R4R A;  3S22 A;  2JC7 A;  5E2H A;  5GLC A;  4N1X A;  4U0T A;  2H10 A;  2HDQ A;  1L0F A;  2DCF A;  5DTK A;  1WYB A;  1CEG A;  1LL9 A;  4E3N A;  4U3T A;  4Y0T A;  3VOZ A;  3PBR A;  4S2L A;  3Q81 A;  1WE4 A;  4GNU A;  2QMI A;  2WGV A;  1O07 A;  3Q7Z A;  2H0T A;  4FCF A;  3N8L A;  4OPR A;  1XXM A;  3WRT A;  1L0D A;  1CI9 A;  3PBQ A;  1BTL A;  1YLT A;  3OPR A;  5CEC A;  1IEM A;  3IHB A;  5F82 A;  5JYO A;  1TDG A;  4DF6 A;  4E6X A;  1K57 C;  5EVI D;  2Y91 A;  2ZQ8 A;  4RX3 A;  2Y2Q A;  5G18 A;  2QPN A;  5M18 A;  4WZ5 C;  2Q9N A;  3IF6 C;  3N8S A;  2GDN A;  4FH2 A;  5GHX A;  5TFQ A;  4X53 A;  5BOH A;  5CTN A;  2RCX A;  4M3K A;  4JBF A;  4EQI A;  1ZG6 A;  4KZ4 A;  1MPL A;  1NXY A;  1FR1 A;  1Q2Q A;  3UNW A;  2PBY A;  4BQM A;  4BD1 A;  3A3I A;  3NI9 A;  2Y2H A;  3ZNY A;  3DWZ A;  4KZ9 A;  4WYY A;  5L2F A;  3IXG A;  1DJA A;  4S2N A;  2ZD8 A;  4B4Z A;  4LV1 A;  4R1G A;  3G35 A;  1PIO A;  1JWP A;  3DWK A;  1YLZ A;  2WK0 A;  3UPO A;  1L0G A;  1S6R A;  2WGW B;  3PBO A;  3HLC A;  3G2Y A;  2J9P A;  3IQA A;  1G6A A;  4A5R A;  3FWL A;  3Q82 A;  4GB7 A;  1HZO A;  5JYP A;  2WZZ A;  5EVL A;  3OPH A;  3UE0 A;  3C5A A;  4ZDX A;  3IWI A;  2WKI A;  3PAE A;  1RP5 A;  1CI8 A;  1M40 A;  1MBL A;  3WRZ A;  1ONH A;  3AGF A;  4EV4 A;  2G2U A;  4ZJ2 A;  3ZFZ A;  2XGN A;  4X56 A;  3AGE A;  1JWZ A;  5F1F A;  3IXH A;  1K6S A;  2Y2I A;  3HUN A;  4KG6 A;  3E2L A;  3HL9 A;  4O7D A;  5AQ7 A;  2ZQD A;  4B4X A;  5FQI A;  3M2J A;  5A90 A;  1BLS A;  2ZLY A;  2OLU A;  3ZDJ A;  3ZG8 B;  4GN2 A;  3O86 A;  4JF5 A;  2OV5 A;  1LI0 A;  2ZC3 B;  4PM8 A;  5HAI A;  2PU2 A;  4RA7 A;  1I5Q A;  1W79 A;  3IF6 A;  4WZ5 A;  2EXB A;  4OOY A;  1YLW A;  3SH8 A;  3PBN A;  4WMC D;  1ERM A;  3CMZ A;  4RYE A;  4JXG A;  4N92 A;  3OC2 A;  1YLJ A;  4JF4 A;  4OLG A;  5U47 A;  4JXW A;  4PMA A;  3GV9 A;  3VP3 A;  4OPY A;  4C3Q A;  3NBL A;  4EUZ A;  3ZG5 A;  5DVA A;  5EPH A;  3VMA A;  3LY3 A;  4KEN B;  4P0M A;  3W8K A;  1H8Z A;  3BRM A;  1PWD A;  2Y59 A;  4Z9Q A;  1EWZ A;  5FAS A;  3UDX A;  1IYP A;  1BLP A;  2WAD A;  1IKG A;  4MEZ A;  5CXW A;  3HRE A;  1YLP A;  3HLB A;  1HD8 A;  2XH9 A;  3IH9 A;  3RXW A;  3SS5 A;  3WS0 A;  5HAP A;  1FCN A;  2Y55 A;  2C6W B;  3G34 A;  2X02 A;  4OQH A;  3SS4 A;  3C7V A;  4R4S A;  4DE0 A;  1BUL A;  3NIA A;  3OPL A;  2Y4A A;  3IH8 A;  3TOI A;  4PM7 A;  1PI5 A;  1GHI A;  3NY4 A;  3Q07 A;  4KZ6 A;  4GD8 A;  4OH0 A;  3G4P A;  2Y2M A;  4RVA A;  3BYD A;  4L0L A;  5AQB A;  4F94 A;  2EX6 A;  1XGI A;  1K38 A;  2XQZ A;  3GMW A;  4QHC A;  1KGG A;  2FFF B;  3VFH A;  4DXC A;  4LEN A;  2Y2J A;  5FAQ A; 
#chains in the Genus database with same CATH topology
 4YWZ A;  1PWC A;  4HEF A;  1CK3 A;  3H9W A;  5HPF A;  2WZX A;  2QHK A;  2XF3 A;  1WYC A;  2VGK A;  2XFS A;  1MKM A;  3V50 A;  4BL2 A;  2PDR A;  4S2M A;  2L1M A;  1N9B A;  3BQ8 A;  4DXB A;  4FSF A;  5AQA A;  3NCK A;  1G6O A;  1MXO A;  1MWU A;  1T1C A;  4KZA A;  5HD5 A;  1YAX A;  3LID A;  3EGD C;  1NLY A;  4JF6 A;  5E2F A;  3EQV A;  5HWW A;  5AVE A;  3LYX A;  4DDS A;  2WKQ A;  4OOL A;  4FH4 A;  5F1G A;  5HL6 A;  4HP4 A;  5KMW A;  4CLC E;  3WS5 A;  3LY4 A;  1I2S A;  4EBL A;  5L09 A;  2JKR M;  2WKR A;  3BY8 A;  1LL8 A;  4KQD A;  4HI4 A;  3V3R A;  3P09 A;  2J3T C;  2X01 A;  1ERO A;  1C3B A;  1KE3 A;  2W1T A;  3H7W A;  4PHT A;  4Y0U A;  3NJA A;  2HJ9 C;  2C5W B;  4OP5 A;  1OTE A;  3BFF A;  1MWS A;  3MQO A;  4Q0H A;  1K54 C;  1LLB A;  3ICY A;  4C75 A;  1TS6 A;  4K0W A;  5A92 A;  4HES A;  3IWQ A;  2XRO A;  5TR7 A;  1FSW A;  3UDF A;  1YM1 A;  3BEB A;  3HJI A;  4LGW A;  2HP6 A;  1ZTU A;  4QD4 A;  2DNS A;  3LEQ A;  1XPB A;  1BUE A;  4R0Q A;  1CQA A;  4IBX A;  4RX2 A;  2ZC4 B;  4R3A A;  3ZYT A;  3P7N A;  1P9R A;  1W8Y A;  2VV8 A;  3OPP A;  3GQZ A;  4KQR A;  4L9E A;  4E3K A;  5DJU A;  4ESP A;  1K55 A;  5J4E A;  4KZB A;  5EM1 A;  1DY6 A;  1Z6F A;  2Q9M A;  3S4X A;  4UAA A;  4I3I A;  5DKK A;  5FAO A;  5FQQ A;  1U60 A;  4YFM A;  4ZJ1 A;  1DJB A;  1BLC A;  5MC7 A;  2GX5 A;  4WEL A;  2ZQ9 A;  1PW8 A;  3Q7V B;  2WGI A;  4NXG A;  2D02 A;  4UEY A;  3MFD A;  3T4K A;  3T4S A;  3IXD A;  1I2W A;  3D3O A;  4BWI A;  4L9F A;  4LV2 A;  4S2P A;  1SZV A;  2EWV A;  3KYQ A;  5TGF A;  3E2K A;  3MXR A;  4DE2 A;  2ACG A;  1X0O A;  5CTM A;  1J3W A;  3NEC A;  5A93 A;  2GJ3 A;  2OLV A;  4BBU A;  2PYP A;  4EET B;  2KOI A;  3T1R A;  3BY9 A;  4QY6 A;  3G31 A;  3MQ0 A;  5CGS A;  1JTG A;  2HGV A;  4OON A;  1KVM A;  3Q1F A;  2EFX A;  4NKP A;  4HJ4 A;  1F2K A;  5EVI B;  3JYI A;  4JPM A;  4P6Z S;  1GA9 A;  1XKZ A;  5EEC A;  2VA0 A;  2OWJ A;  3CG5 A;  3JVV A;  5FAT A;  2ZL1 A;  2OOL A;  2VV7 A;  3ZCZ A;  2VLG A;  1W7F A;  4OLD A;  3UB8 A;  5A91 A;  4KQQ A;  3VP2 A;  1ESI A;  5HFO A;  1P0Z A;  3OCL A;  3P98 A;  1E3U A;  5DKL A;  3UB6 A;  2J7V A;  1T1A A;  4EW7 A;  1KOU A;  4MN5 A;  3ITA A;  3ZVT A;  3S1Y A;  4O0P A;  4F3L A;  1P9W A;  1GHM A;  3LCE A;  4DJ2 A;  1VEU A;  2EFU A;  1XJ6 A;  2BG1 A;  3VSL A;  1JWV A;  1LSV A;  5M1A A;  3CPT B;  5FDH A;  4LV0 A;  1D06 A;  1ES2 A;  1S4S A;  5GLB A;  1KE4 A;  3B3X A;  2ZMA A;  2ZBB A;  5F69 A;  3OZH A;  4XXR A;  1IEL A;  2HZ5 A;  3M6B A;  5DTT A;  2NUP C;  3RJU A;  1FCO A;  1FCM A;  2XD1 A;  5FQJ A;  5KSC A;  4C6Y A;  3N4I A;  5LBR A;  4R4R A;  2JC7 A;  3KSG A;  5GLC A;  2M7V A;  2HDQ A;  3KSF A;  2DCF A;  5HDS A;  1CEG A;  4E3N A;  4U3T A;  3VOZ A;  5HDD A;  4GHI A;  3Q7Z A;  2H0T A;  1CI9 A;  3T4O A;  1V9Y A;  1K0K A;  4E6X A;  1K57 C;  2J3W A;  2Y2Q A;  1SKO A;  4FH2 A;  5GHX A;  5CTN A;  4M3K A;  4JBF A;  1MPL A;  1NXY A;  4XT2 B;  4BQM A;  1P97 A;  3EOI A;  3DWZ A;  5L2F A;  3IXG A;  4S2N A;  2ZD8 A;  4LV1 A;  3OLO A;  3G35 A;  1W63 M;  3DWK A;  2WGW B;  3IQA A;  1G6A A;  4HH2 A;  2DMW A;  1HZO A;  3LI9 A;  5JYP A;  2WZZ A;  1L3L A;  1T1B A;  2V1A A;  2UV0 E;  3VOL A;  4ZJ2 A;  1K6S A;  2Y2I A;  3B42 A;  3EWK A;  3E2L A;  3HL9 A;  2ZQD A;  2OLU A;  1Z09 A;  4JF5 A;  4WZ5 A;  4ZRR A;  3H82 A;  3ULF A;  2EXB A;  5F68 A;  3GV9 A;  4EUZ A;  5EPH A;  3LY3 A;  4LRX C;  2Y59 A;  3E4Q A;  1IYP A;  3VV4 A;  2WAD A;  3SS5 A;  3FG8 A;  3HRE A;  1YLP A;  3RXW A;  3WS0 A;  5FEF A;  1FCN A;  5HAP A;  3SS4 A;  1FIL A;  2L4R A;  4Y3I A;  3Q07 A;  4GD8 A;  3LR4 A;  3BYD A;  4DXC A;  3GMW A;  4QHC A;  2FFF B;  5FAQ A;  1NWZ A;  2GNX A;  2Z2L B;  4GZB A;  4X55 A;  2Z6C A;  3QNB A;  3MKE A;  2PYR A;  3SS3 A;  4GKU A;  4DKI A;  1ERQ A;  4N1H A;  5CER A;  5CHM A;  5EM0 A;  5EVI C;  1PZP A;  4E6W A;  2HF6 A;  4MN6 A;  5CHU A;  4R70 A;  4UA9 A;  3VSK A;  3U2A A;  3KSH A;  5F83 A;  3ZQ5 A;  3VP4 A;  4MNR A;  4S2O A;  2V9A A;  5TBM B;  1TDL A;  4ZAM A;  1DRM A;  2JN7 A;  1OME A;  3JVU A;  3IWO A;  3UO9 A;  4LRZ E;  1PFL A;  3BFC A;  3MBZ A;  4MBF A;  5TJJ A;  4JGP A;  4DDY A;  3LFV A;  4IED A;  1NZO A;  4HJ3 A;  3TSG A;  4JKT A;  4NXB A;  1DP6 A;  4KQO A;  3IXB A;  4UQI S;  3GRJ A;  1W8Q A;  3QNC A;  1TD5 A;  2P7J A;  2E8J A;  2VKS A;  2A24 B;  4PPR A;  2W27 A;  3IX4 A;  2Y2O A;  4GS9 B;  2RL3 A;  4HIA A;  3BM6 A;  3LR3 A;  4EWF A;  4B88 A;  3S7N A;  1DP8 A;  3TJZ C;  4IUH A;  2ZM2 A;  3LR0 A;  4E3I A;  4Q0J A;  1XJ3 A;  3SH9 A;  4Z1W A;  2Y2K A;  1G28 A;  1K56 D;  5HW3 A;  2PHY A;  5DF9 A;  3A0S A;  4GCZ A;  3DTM A;  3HBR A;  2W0N A;  1A0K A;  2ZMV A;  2ZQC A;  3MS6 A;  4IHQ A;  4DE1 A;  3LI8 A;  5GL9 A;  5EV0 A;  1YQS A;  4LPZ A;  4ID4 A;  3FZC A;  1L2S A;  1LI9 A;  3F1N B;  1WA9 A;  5FI6 A;  1M6K A;  2A2L A;  5GHY A;  4BBV A;  4MCW A;  5CEB A;  1EI5 A;  1HTZ A;  4WBG A;  3GEC A;  1S4R A;  2OAQ 1;  5DJT A;  1K54 A;  2HDS A;  3ZGA B;  2P74 A;  1K4F A;  1FOF A;  3BFD A;  4BBT A;  3LEZ A;  2OSU A;  3W4P A;  3TW8 A;  3MSH A;  1F5M A;  3HLD A;  5KSH A;  4CJN A;  2PAV P;  4KG2 A;  4HNB A;  5CED A;  4BMW A;  1L0E A;  5D3O A;  3ITB A;  1ES3 A;  3V39 A;  3R7W B;  2B95 A;  1ODV A;  1FQG A;  3KYZ A;  5FQM A;  5I5L A;  4Y13 A;  3A3F A;  4H6J A;  4NK3 A;  1KE0 A;  3C4O A;  1N9O A;  3TG9 A;  2HP9 A;  1GCE A;  1MWT A;  3A3J A;  4LLO B;  4G3V A;  1OTI A;  1IYS A;  3BFG A;  5EOE A;  4KUO A;  2FZ0 A;  3KO6 A;  5FQK A;  2JKT I;  1ES4 A;  2O9C A;  1MY8 A;  3UPP A;  4EBN A;  1OT9 A;  1G5U A;  3NDE A;  3WS4 A;  3K3D A;  4Y0O A;  4P6Z M;  4LRY C;  2J8Y A;  1SCW A;  3CI6 A;  3D72 A;  2VJW A;  5L07 A;  4WLA A;  4Y5F A;  3P01 A;  1GSW A;  2Y2L A;  5G4Y A;  1O7E A;  1SDE A;  3FC7 A;  2G7U A;  4OP8 A;  1OT6 A;  5EOO A;  3LIF A;  2INW A;  4ZJ3 A;  1BLH A;  1KGF A;  2D01 A;  2O0Y A;  2Y2N A;  3LGO A;  3FV7 A;  2K31 A;  4GW9 A;  3PTE A;  4XUX A;  1H5X A;  4N9K A;  4FTX A;  5AJG A;  1OTD A;  2H0Y A;  2ZMF A;  4FUW A;  4DJ3 A;  2CMN A;  1RGZ A;  4MMN A;  1K25 A;  3W4Q A;  4Y7P A;  4JGR A;  3WS2 A;  2VX8 A;  5DF8 A;  4X6T A;  4WMC A;  3N8R A;  3MR0 A;  3W2Z A;  4DRT A;  5FI2 A;  1OTB A;  1RGY A;  3EGX C;  3SH7 A;  3CLO A;  4MBH A;  4KG5 A;  1AXB A;  3IHA A;  1FR6 A;  2P9V B;  3T1X A;  5CHJ A;  4EBP A;  4QY5 A;  3F1O B;  3LUQ A;  4EES A;  2HV1 A;  4GDB A;  1NYM A;  1F98 A;  3ZHH A;  4EEU A;  3ISG A;  4FOF A;  3QP1 A;  4OQ0 A;  1W63 Q;  1H8M A;  1H8Y A;  2H28 A;  1S1Y A;  3GDI A;  3EEH A;  2L0W A;  2PR6 A;  1LSW A;  1L0F A;  5DTK A;  1T19 A;  1WYB A;  5HDC A;  2PR5 A;  4S2L A;  2QMI A;  1N9L A;  2HJE A;  4FCF A;  3QP2 A;  3WRT A;  3PBQ A;  5CEC A;  1YLT A;  3NOU C;  4X25 A;  4DF6 A;  1CJF A;  1ACF A;  1UWP X;  2ZQ8 A;  5G18 A;  4RX3 A;  5M18 A;  4X53 A;  3RH8 B;  4EQI A;  1FR1 A;  3UNW A;  2O9B A;  4BD1 A;  3IX3 A;  3UMD A;  2PT7 A;  1OPX A;  1PIO A;  2OWH A;  3V67 A;  3DTI A;  1YLZ A;  1S6R A;  1TF1 A;  3PBO A;  4EXO A;  4G3W A;  3FWL A;  3Q82 A;  4GB7 A;  2BAS A;  5EVL A;  4HH3 A;  3PAE A;  4K08 A;  5HZH A;  2V0W A;  4KG6 A;  3C2W A;  1XFQ A;  1V9Z A;  3T12 B;  2ZLY A;  3UB5 P;  4Y17 A;  5HAI A;  1I5Q A;  4WMC D;  4Y15 A;  4RYE A;  4JXG A;  4R6L A;  4N92 A;  1YLJ A;  4OLG A;  1TS7 A;  3CUE C;  4JXW A;  4CLC A;  1S67 L;  5DVA A;  4B9O A;  3E98 A;  4KEN B;  4P0M A;  3BRM A;  4Z9Q A;  1N9N A;  5CXW A;  2XH9 A;  4ETZ A;  1LSX A;  1S66 L;  3KYE A;  1BUL A;  3NIA A;  3OPL A;  3IH8 A;  3TOI A;  4PM7 A;  1GHI A;  3IBR A;  4E04 A;  2NUT C;  5AQB A;  5FL3 A;  4OOM A;  4LEN A;  2Y2J A;  2QYB A;  3A3D A;  2IWB A;  1K4E A;  5FA7 A;  2LB5 A;  3U4L P;  3GTC A;  3W4O A;  5HL1 A;  3HVF A;  1QMF A;  4HJ6 A;  3A3E A;  4WEJ A;  4R3J A;  1GSX A;  2JKG A;  2XLN A;  2W3G A;  3VE4 A;  3N7W A;  1W5D A;  3QHY A;  3O88 A;  4BLM A;  4HHD A;  5CX7 A;  3C7U A;  5E2G A;  1E4D A;  2WYX A;  2ZC7 A;  3FPW A;  3TRC A;  4OKP A;  3ZG7 B;  3F1P B;  5HAR A;  4K0X A;  2VGJ A;  4M4X A;  2P08 A;  3IS2 B;  3B47 A;  3UDI A;  4UQI M;  3SOI A;  1XP4 A;  5F6A A;  1E3U D;  4E3J A;  5FDS A;  1BSG A;  3LIA A;  3OCN A;  5EVI A;  4I38 A;  4GLQ A;  4K91 A;  4I3J A;  4HQA A;  4IVK A;  5KZH A;  1HVB A;  1XJ4 A;  3FPV A;  1CF0 A;  4YOF A;  3UB7 A;  1S0W A;  4IUK A;  4CLC D;  3IF6 B;  2VGL S;  1QME A;  5HAQ A;  1YSQ A;  3HLG A;  2H5S A;  3PXP A;  4ZBE A;  5HX9 A;  4WZ4 A;  3MFX A;  1OJ5 A;  1VET B;  2JCH A;  3T4L A;  3MZF A;  4HP9 A;  2WAF A;  2IWD A;  5HPI A;  2EX2 A;  2M1C A;  3V3S A;  3UE1 A;  1KDS A;  3N6I A;  2W3E A;  1Y4O A;  4D2O A;  4X69 A;  3NDG A;  2V0U A;  3L7H A;  4CPK A;  4DN0 A;  3PAG A;  1GA0 A;  2XFT A;  1NLZ A;  3MXQ A;  1J9M A;  2HP5 A;  3LIE A;  3LR5 A;  2I72 A;  4MN7 A;  3ZG9 B;  4MDZ A;  3I7J A;  3G32 A;  4QWO A;  2LB9 A;  4OVD A;  3LIC A;  2JKT M;  2Y2G A;  2EA9 A;  1KDW A;  3UPN A;  2JKF A;  2QZ6 A;  1GSV A;  3KSI A;  3CPT A;  1YMX A;  2EX8 A;  3IBJ A;  2VZW A;  1SDN A;  2IWC A;  4IJG A;  5M19 A;  5IU1 A;  3BW6 A;  3NHQ A;  4IBR A;  3T4J A;  4HBT A;  4B93 A;  5HSQ A;  4LV3 A;  2ZJ9 A;  2GZA A;  4XUZ A;  4S2J A;  1JTD A;  5AVF A;  4PKY A;  1GHP A;  3FYZ A;  1VQQ A;  4I39 A;  1KVL A;  2FH5 A;  3SW1 A;  3CIT A;  3BLM A;  4EUV A;  5FEG A;  1STZ A;  4E3L A;  4PM5 A;  2ZC5 B;  4GOG A;  2ZQ7 A;  1EW0 A;  3D4F A;  5EUA A;  1G68 A;  5E43 A;  1IKI A;  1ALQ A;  1HLU P;  4ZTK A;  3ZVW A;  4UA6 A;  2A3U A;  4EEP A;  1SKF A;  3MZE A;  3BWL A;  3NC8 A;  3PBS A;  1XGJ A;  4DMZ A;  5IHV A;  3GVB A;  2W1T B;  3H7W B;  4XT2 A;  2AVX A;  2A49 A;  4R23 A;  4JGO A;  2V20 A;  3HLF A;  5FI7 A;  3WS1 A;  4OPZ A;  1BZA A;  2WKH A;  3G2Z A;  2VEA A;  1TEM A;  2WGW A;  3S7Q A;  5DFY A;  5EVE A;  5KIZ A;  3E4O A;  2BLS A;  1ZG4 A;  1BT5 A;  3RXX A;  1Q2P A;  3FKW A;  4Q8I A;  1KGE A;  3B33 A;  1UGU A;  1PNE A;  3O3V A;  2W3F A;  3KX0 X;  1YKD A;  3A0R A;  2K2N A;  3MJQ A;  3C4P A;  3RFB A;  4BL3 A;  1XA7 A;  4L9G A;  4OPQ A;  2PU4 A;  2XDM A;  3DW0 A;  5EE8 A;  1PYY A;  1CEF A;  3WWX A;  1IYQ A;  4GD6 A;  1PWG A;  1NJ4 A;  5GHZ A;  4DE3 A;  2CC1 A;  3EQU A;  4GDN A;  2X71 A;  5E2E A;  5I94 A;  2JHE A;  3PYP A;  2HPB A;  4HY8 A;  3M2K A;  1XA1 A;  2Y79 A;  5IT5 A;  3G30 A;  4OQG A;  4U0X A;  2VV6 A;  2KDK A;  2R9X A;  1ONG A;  4D60 A;  1H3Q A;  4KZ3 A;  4NXF A;  1TVF A;  2OAP 1;  3S22 A;  5E2H A;  5F5Y A;  4U0T A;  4Y0T A;  3PBR A;  1T18 A;  4GNU A;  4OPR A;  1L0D A;  4YNR A;  3L9K A;  3IHB A;  5JYO A;  1TDG A;  4WF0 A;  5IS1 A;  4PAU A;  2QPN A;  3IF6 C;  4AFI A;  5BOH A;  5TBM A;  2RCX A;  4KZ4 A;  1Q2Q A;  4R38 A;  3NI9 A;  2Y2H A;  1OTA A;  4WYY A;  1DJA A;  3MF0 A;  4WUJ A;  2XA7 S;  3NOT C;  4R1G A;  1JWP A;  3SZT A;  2ZL1 B;  3CAX A;  3G2Y A;  4A5R A;  2A24 A;  3OPH A;  3UE0 A;  3IWI A;  2WKI A;  4RQ9 A;  2PD8 A;  3WRZ A;  1ONH A;  2G2U A;  3ZFZ A;  2XGN A;  4X56 A;  3D9Y A;  3AGE A;  1JWZ A;  2XRN A;  5F1F A;  4O7D A;  2W1R A;  5AQ7 A;  3HCY A;  4GS9 A;  3M2J A;  5A90 A;  2J3T D;  1BLS A;  3R4K A;  5EFW A;  3ZG8 B;  4GN2 A;  3O86 A;  3QP6 A;  1PRQ A;  2OV5 A;  4ARZ A;  1LI0 A;  2ZC3 B;  2PU2 A;  4RA7 A;  1W79 A;  4F3L B;  4OOY A;  3SH8 A;  1ERM A;  3CMZ A;  2ZOH A;  3E4P A;  1H0M A;  4CLC B;  3OC2 A;  5U47 A;  4PMA A;  3VP3 A;  4OPY A;  1VEU B;  3ZG5 A;  1IFQ A;  3VMA A;  4GJ4 A;  1PWD A;  3UDX A;  1BLP A;  1IKG A;  3HLB A;  1VHM A;  3IH9 A;  2W3H A;  2EWW A;  2Y55 A;  2C6W B;  4HOI A;  2V1B A;  3C7V A;  4R4S A;  4DE0 A;  2Y4A A;  1PI5 A;  3NY4 A;  4KZ6 A;  3F1N A;  1LT0 A;  3G4P A;  2Y2M A;  3MMH A;  4RVA A;  2XQZ A;  1K38 A;  4BEN A;  4NET A;  2PBD P;  2I9V A;  1N4O A;  4HBU A;  1NY0 A;  1JVJ A;  2HDU A;  2M7U A;  4UA7 A;  4BD0 A;  3ZNT A;  1YMS A;  4JLF A;  2UWX A;  4PKY G;  3HUM A;  3ZG0 A;  4WM9 A;  4WEK A;  5GLA A;  2ZQA A;  3QP4 A;  4H8R A;  1PW1 A;  4GHI B;  4QJG A;  5J8X A;  3CUE A;  3T4Q A;  3HUO A;  1E25 A;  3O87 A;  2PD7 A;  1NYY A;  1XJ2 A;  5K5B A;  5HWT A;  5J7E A;  1SKO B;  4KZ8 A;  1JNU A;  1Y54 A;  5HD3 A;  2E8I A;  3R7W A;  5C5K A;  2BTF P;  1YLY A;  2WKE A;  2XEP A;  3HJK A;  4JXS A;  1PZO A;  3GSG A;  2Z6D A;  1ES5 A;  1K55 C;  5CGW A;  1OJG A;  3EEA A;  3C38 A;  1NRJ A;  3A0V A;  5GLD A;  3IX8 A;  2XSS A;  2QJ5 A;  5DF7 A;  2MJ6 A;  1FSY A;  3T1Q B;  4O8G A;  5L8M A;  2R9W A;  2IA2 A;  2KLI A;  4R3B A;  4E3O A;  3M6H A;  1TS0 A;  2XD5 A;  3BFE A;  3LO7 A;  1K57 A;  2FFY A;  3H82 B;  1ZKJ A;  2VGL M;  1XX2 A;  2Z2M B;  1UWN X;  4WN5 A;  1DP9 A;  5AQ9 A;  5FSR A;  4LCM A;  2XR0 A;  3PHY A;  5DTS A;  2J9O A;  5DFX A;  3OBF A;  1ZC2 A;  4N9L A;  4IVI A;  4X68 A;  2V2F F;  1YT4 A;  4JGQ A;  3RTY A;  4X1M A;  5CGX A;  4PM9 A;  2JKR I;  1AWI A;  1IYO A;  2Y8H A;  4Q0I A;  3MZD A;  2B5R A;  3VOY A;  2ZOI A;  4ME4 A;  3GR2 A;  2EXA A;  4UHU A;  4EQ1 A;  1LL5 A;  3OOV A;  5FQ9 A;  3DTE A;  4BJP A;  4YIN A;  3CZD A;  2Y2P A;  4P6B A;  3Q7V A;  4E3M A;  3MXS A;  4S2I A;  3QP5 A;  2P9V A;  4NEE D;  4OQI A;  2V1Z A;  2DRW A;  1PI4 A;  2XK1 A;  3UY6 A;  3HLE A;  3F1O A;  4G3K A;  4S2K A;  4QU3 A;  4LFU A;  3V5M A;  2WUQ A;  1LHY A;  2HDR A;  3UE3 A;  3T4T A;  3AGD A;  4CQH A;  4JXV A;  1MWR A;  2B18 A;  3VP0 A;  1NRF A;  1MKI A;  3UN7 A;  4ETX A;  4WL9 A;  1NZU A;  4MBK A;  4PM6 A;  2QKP A;  2WAE A;  1ZHH B;  2B02 A;  3K3C A;  2ZM8 A;  2ZM0 A;  1DJC A;  2J80 A;  2JE5 A;  4CLC C;  2O99 A;  4NG2 A;  3CWF A;  3MKF A;  2QWS A;  3UB9 A;  2EX9 A;  1S1Z A;  4QB8 A;  3HLW A;  3S7P A;  3VFF A;  1VM1 A;  3IF5 A;  4EER A;  1ESU A;  3DAV A;  4X1L A;  5L10 A;  3FKV A;  1MZU A;  1D7E A;  4LCL A;  3UME A;  3CHW P;  1SHV A;  4P87 A;  5CRF A;  4KZ7 A;  3BEC A;  4KZ5 A;  2QJ7 A;  2ZC6 B;  3O5Y A;  4O01 A;  2K7S A;  2P04 A;  2YKF A;  3MQQ A;  3IT9 A;  4P85 A;  4MLL A;  3TE8 A;  3CJM A;  4EU0 A;  1MC0 A;  2G2W A;  4FD8 A;  2KX6 A;  4QPR A;  1K56 A;  3VP1 A;  1FIK A;  3K2N A;  3PBT A;  1K6R A;  3VE3 A;  3PR6 A;  2W3D A;  4S2N C;  2JBF A;  1RCJ A;  5FAP A;  3T50 A;  2R78 A;  3BLS A;  2YKH A;  3BJN A;  4N1X A;  2H10 A;  3UE6 A;  3LIB A;  4H6J B;  1IOU A;  1LL9 A;  4I3A A;  3Q81 A;  1WE4 A;  1F9I A;  2WGV A;  1BYW A;  1O07 A;  3N8L A;  1XXM A;  1BTL A;  3OPR A;  5G4Z A;  1IEM A;  5F82 A;  4Y2F A;  4NXE A;  3NUL A;  5EVI D;  2Y91 A;  4WZ5 C;  2Q9N A;  3N8S A;  2GDN A;  5TFQ A;  5A8B A;  3T1S A;  1ZG6 A;  2PBY A;  4KUK A;  3A3I A;  1XFN A;  3ZNY A;  4KZ9 A;  3F1P A;  3NOP C;  3QP8 A;  5J3W A;  4B4Z A;  3G6O A;  3IS2 A;  2XA7 M;  1Y28 A;  2WK0 A;  3UPO A;  1L0G A;  2V8C A;  3HLC A;  2J9P A;  5HWV A;  3E0Y A;  3C8C A;  2Q0O A;  3DTK A;  3C5A A;  4ZDX A;  1RP5 A;  1CI8 A;  1M40 A;  1MBL A;  3AGF A;  4EV4 A;  3IXH A;  3HUN A;  3JPU A;  3C30 A;  4B4X A;  5FQI A;  4ARZ B;  3ZDJ A;  1TS8 A;  4PM8 A;  1YSP A;  3IF6 A;  1YLW A;  4II7 A;  3PBN A;  3S7O A;  1VET A;  4JF4 A;  1YPR A;  4C3Q A;  3NBL A;  2PRF A;  2V8F A;  3W8K A;  1H8Z A;  1EWZ A;  5FAS A;  1D1J A;  4MEZ A;  1HD8 A;  3BQA A;  3G34 A;  2X02 A;  4OQH A;  2VK3 A;  4I5S A;  4OH0 A;  2WKP A;  3DBA A;  1VB6 A;  4L0L A;  4F94 A;  2EX6 A;  1XGI A;  2O9A A;  1KGG A;  3VFH A; 
#chains in the Genus database with same CATH homology
 4GZB A;  2Z2L B;  4X55 A;  4BEN A;  4NET A;  3A3D A;  2IWB A;  1K4E A;  3QNB A;  5FA7 A;  1N4O A;  1PWC A;  3MKE A;  4HBU A;  1NY0 A;  3GTC A;  1JVJ A;  2HDU A;  3W4O A;  5HL1 A;  4UA7 A;  4BD0 A;  4HEF A;  3HVF A;  3SS3 A;  3ZNT A;  1YMS A;  1CK3 A;  1QMF A;  2UWX A;  3HUM A;  4GKU A;  4JLF A;  4WEK A;  1ERQ A;  4WM9 A;  4N1H A;  5GLA A;  4DKI A;  2WZX A;  2ZQA A;  2XF3 A;  3A3E A;  4H8R A;  1WYC A;  5CER A;  5CHM A;  5EVI C;  2VGK A;  1PZP A;  1PW1 A;  4WEJ A;  4R3J A;  4QJG A;  4E6W A;  2XFS A;  4BL2 A;  3V50 A;  5J8X A;  2XLN A;  4S2M A;  1N9B A;  3HUO A;  3N7W A;  1E25 A;  5CHU A;  4DXB A;  4FSF A;  5AQA A;  3NCK A;  1W5D A;  4UA9 A;  3O87 A;  3O88 A;  1MXO A;  1MWU A;  1NYY A;  3QHY A;  5F83 A;  3VSK A;  4KZA A;  3VP4 A;  4MNR A;  4S2O A;  4KZ8 A;  1Y54 A;  2E8I A;  1TDL A;  4ZAM A;  4BLM A;  4JF6 A;  3C7U A;  1OME A;  1YLY A;  5E2F A;  3IWO A;  5E2G A;  1E4D A;  3UO9 A;  3EQV A;  2WYX A;  2WKE A;  2ZC7 A;  4OKP A;  2XEP A;  3BFC A;  3MBZ A;  4MBF A;  3ZG7 B;  4DDY A;  4JXS A;  5HAR A;  4K0X A;  2VGJ A;  4IED A;  1NZO A;  3TSG A;  1PZO A;  4JKT A;  3GSG A;  4DDS A;  4KQO A;  3UDI A;  3IXB A;  4OOL A;  4FH4 A;  5F1G A;  3GRJ A;  5KMW A;  1W8Q A;  3WS5 A;  3QNC A;  3LY4 A;  1ES5 A;  1I2S A;  3SOI A;  4EBL A;  1XP4 A;  1K55 C;  5CGW A;  4PPR A;  1E3U D;  5GLD A;  3V3R A;  3P09 A;  4E3J A;  2X01 A;  1ERO A;  1C3B A;  5DF7 A;  1BSG A;  3OCN A;  5EVI A;  1FSY A;  1KE3 A;  4Y0U A;  2Y2O A;  4K91 A;  2C5W B;  4OP5 A;  3BFF A;  1MWS A;  2R9W A;  2RL3 A;  4IVK A;  1K54 C;  1LLB A;  3BM6 A;  1HVB A;  4C75 A;  5KZH A;  4EWF A;  4B88 A;  4R3B A;  4E3O A;  3M6H A;  2ZM2 A;  4K0W A;  2XD5 A;  1S0W A;  3BFE A;  4HES A;  3LO7 A;  1K57 A;  2FFY A;  3IWQ A;  4E3I A;  5TR7 A;  3IF6 B;  5A92 A;  1FSW A;  1ZKJ A;  1QME A;  3UDF A;  1YM1 A;  3SH9 A;  3BEB A;  2H5S A;  3HLG A;  4ZBE A;  5HX9 A;  5HAQ A;  4WZ4 A;  2HP6 A;  1XX2 A;  2Z2M B;  2JCH A;  3MZF A;  2Y2K A;  4QD4 A;  1K56 D;  2DNS A;  2IWD A;  2WAF A;  5AQ9 A;  5FSR A;  4LCM A;  1XPB A;  2EX2 A;  2XR0 A;  5HW3 A;  1BUE A;  3V3S A;  5DTS A;  2J9O A;  4R0Q A;  4IBX A;  1KDS A;  5DF9 A;  3UE1 A;  4RX2 A;  1ZC2 A;  2ZC4 B;  3N6I A;  4N9L A;  4IVI A;  3DTM A;  4X68 A;  3HBR A;  4X69 A;  4D2O A;  3NDG A;  1W8Y A;  2V2F F;  1YT4 A;  3OPP A;  3GQZ A;  4KQR A;  2ZQC A;  4DE1 A;  5GL9 A;  5CGX A;  4CPK A;  4E3K A;  3PAG A;  1GA0 A;  4PM9 A;  1YQS A;  1K55 A;  4ID4 A;  1IYO A;  3FZC A;  1L2S A;  2XFT A;  4KZB A;  3MZD A;  2B5R A;  1DY6 A;  1Z6F A;  1LI9 A;  3VOY A;  1J9M A;  2HP5 A;  2Q9M A;  4UAA A;  3S4X A;  2I72 A;  3ZG9 B;  3GR2 A;  5FI6 A;  1M6K A;  5CEB A;  5GHY A;  5FAO A;  3I7J A;  5FQQ A;  2EXA A;  3G32 A;  1EI5 A;  4UHU A;  1HTZ A;  1U60 A;  4WBG A;  4YFM A;  4ZJ1 A;  1LL5 A;  1DJB A;  4OVD A;  5FQ9 A;  1K54 A;  1BLC A;  2Y2G A;  2HDS A;  3ZGA B;  4BJP A;  1KDW A;  2P74 A;  3UPN A;  4WEL A;  2QZ6 A;  2ZQ9 A;  1PW8 A;  3CZD A;  1K4F A;  3Q7V B;  4YIN A;  2WGI A;  1YMX A;  2Y2P A;  4P6B A;  2EX8 A;  3Q7V A;  1FOF A;  3BFD A;  3MFD A;  4E3M A;  3MXS A;  3LEZ A;  1SDN A;  2IWC A;  3IXD A;  5M19 A;  2OSU A;  3W4P A;  1I2W A;  4S2I A;  4IBR A;  2P9V A;  4OQI A;  4HBT A;  2V1Z A;  4LV2 A;  2DRW A;  1PI4 A;  4S2P A;  4LV3 A;  3HLD A;  5KSH A;  4CJN A;  2ZJ9 A;  2XK1 A;  3UY6 A;  3HLE A;  4KG2 A;  4XUZ A;  4S2J A;  1JTD A;  4S2K A;  1GHP A;  3FYZ A;  4QU3 A;  5TGF A;  3E2K A;  5CED A;  1L0E A;  1VQQ A;  3MXR A;  1KVL A;  5D3O A;  3ITB A;  4DE2 A;  3V5M A;  1ES3 A;  3BLM A;  3V39 A;  2WUQ A;  5CTM A;  1LHY A;  5A93 A;  2HDR A;  2OLV A;  4E3L A;  4PM5 A;  3UE3 A;  2ZC5 B;  1FQG A;  5FQM A;  4GOG A;  2ZQ7 A;  3A3F A;  4NK3 A;  1KE0 A;  3C4O A;  3TG9 A;  2HP9 A;  1GCE A;  1MWT A;  3AGD A;  3D4F A;  3A3J A;  4JXV A;  4OOM A;  1G68 A;  5E43 A;  1IKI A;  1MWR A;  5EUA A;  3VP0 A;  4QY6 A;  1ALQ A;  1IYS A;  3BFG A;  1NRF A;  3G31 A;  5CGS A;  1MKI A;  1JTG A;  5EOE A;  3UN7 A;  4ZTK A;  4OON A;  3ZVW A;  1KVM A;  4UA6 A;  2A3U A;  5FQK A;  3Q1F A;  1NZU A;  1ES4 A;  1SKF A;  4MBK A;  4PM6 A;  2WAE A;  1MY8 A;  2EFX A;  3UPP A;  3MZE A;  4EBN A;  2ZM8 A;  3NC8 A;  3PBS A;  2ZM0 A;  1DJC A;  1XGJ A;  5EVI B;  3NDE A;  3JYI A;  4JPM A;  2JE5 A;  5IHV A;  3WS4 A;  1GA9 A;  3GVB A;  2A49 A;  4Y0O A;  3MKF A;  4R23 A;  2J8Y A;  1SCW A;  2EX9 A;  4QB8 A;  1XKZ A;  2V20 A;  3HLW A;  3HLF A;  2Y2L A;  5FI7 A;  3WS1 A;  4OPZ A;  5EEC A;  1O7E A;  1BZA A;  1SDE A;  1VM1 A;  2WKH A;  3G2Z A;  3IF5 A;  3VFF A;  3CG5 A;  1ESU A;  4OP8 A;  5FAT A;  5EOO A;  1TEM A;  2WGW A;  3ZCZ A;  3FKV A;  1W7F A;  4OLD A;  2BLS A;  4LCL A;  1ZG4 A;  4KQQ A;  5A91 A;  3VP2 A;  1ESI A;  5HFO A;  1BT5 A;  4ZJ3 A;  1SHV A;  3OCL A;  1BLH A;  3P98 A;  4P87 A;  1KGF A;  5CRF A;  3RXX A;  1E3U A;  2Y2N A;  1Q2P A;  4KZ7 A;  3FKW A;  2J7V A;  3BEC A;  4KZ5 A;  4Q8I A;  1KGE A;  2ZC6 B;  3FV7 A;  3ZG0 A;  3PTE A;  3O3V A;  3ITA A;  3ZVT A;  4XUX A;  1H5X A;  4N9K A;  3S1Y A;  3IT9 A;  2H0Y A;  3C4P A;  4P85 A;  4BL3 A;  4MLL A;  1XA7 A;  4OPQ A;  3CJM A;  1RGZ A;  2PU4 A;  1GHM A;  2XDM A;  3DW0 A;  3LCE A;  1K25 A;  3W4Q A;  5EE8 A;  2G2W A;  4Y7P A;  1PYY A;  4FD8 A;  1CEF A;  3WWX A;  2EFU A;  3WS2 A;  1IYQ A;  4GD6 A;  1PWG A;  1NJ4 A;  5DF8 A;  5GHZ A;  2BG1 A;  4WMC A;  4X6T A;  3VSL A;  4DE3 A;  1JWV A;  2CC1 A;  3N8R A;  1K56 A;  5M1A A;  4DRT A;  5FI2 A;  3EQU A;  3VP1 A;  5FDH A;  4GDN A;  1RGY A;  4LV0 A;  2X71 A;  5E2E A;  1ES2 A;  5I94 A;  3PBT A;  3SH7 A;  5GLB A;  4MBH A;  1KE4 A;  3B3X A;  2ZMA A;  4KG5 A;  1AXB A;  2HPB A;  3OZH A;  4XXR A;  3IHA A;  1FR6 A;  2P9V B;  3M2K A;  1XA1 A;  1K6R A;  5CHJ A;  1IEL A;  4EBP A;  3G30 A;  3M6B A;  4QY5 A;  5DTT A;  4OQG A;  4U0X A;  4S2N C;  3RJU A;  2JBF A;  4GDB A;  1NYM A;  1FCO A;  3ZHH A;  2R9X A;  3ISG A;  1ONG A;  1RCJ A;  1FCM A;  2XD1 A;  5FAP A;  4OQ0 A;  4KZ3 A;  5FQJ A;  1H8Y A;  1TVF A;  5KSC A;  3BLS A;  3N4I A;  4C6Y A;  4R4R A;  3S22 A;  2JC7 A;  5E2H A;  5GLC A;  4N1X A;  4U0T A;  2H10 A;  2HDQ A;  1L0F A;  2DCF A;  5DTK A;  1WYB A;  1CEG A;  1LL9 A;  4E3N A;  4U3T A;  4Y0T A;  3VOZ A;  3PBR A;  4S2L A;  3Q81 A;  1WE4 A;  4GNU A;  2QMI A;  2WGV A;  1O07 A;  3Q7Z A;  2H0T A;  4FCF A;  3N8L A;  4OPR A;  1XXM A;  3WRT A;  1L0D A;  1CI9 A;  3PBQ A;  1BTL A;  1YLT A;  3OPR A;  5CEC A;  1IEM A;  3IHB A;  5F82 A;  5JYO A;  1TDG A;  4DF6 A;  4E6X A;  1K57 C;  5EVI D;  2Y91 A;  2ZQ8 A;  4RX3 A;  2Y2Q A;  5G18 A;  2QPN A;  5M18 A;  4WZ5 C;  2Q9N A;  3IF6 C;  3N8S A;  2GDN A;  4FH2 A;  5GHX A;  5TFQ A;  4X53 A;  5BOH A;  5CTN A;  2RCX A;  4M3K A;  4JBF A;  4EQI A;  1ZG6 A;  4KZ4 A;  1MPL A;  1NXY A;  1FR1 A;  1Q2Q A;  3UNW A;  2PBY A;  4BQM A;  4BD1 A;  3A3I A;  3NI9 A;  2Y2H A;  3ZNY A;  3DWZ A;  4KZ9 A;  4WYY A;  5L2F A;  3IXG A;  1DJA A;  4S2N A;  2ZD8 A;  4B4Z A;  4LV1 A;  4R1G A;  3G35 A;  1PIO A;  1JWP A;  3DWK A;  1YLZ A;  2WK0 A;  3UPO A;  1L0G A;  1S6R A;  2WGW B;  3PBO A;  3HLC A;  3G2Y A;  2J9P A;  3IQA A;  1G6A A;  4A5R A;  3FWL A;  3Q82 A;  4GB7 A;  1HZO A;  5JYP A;  2WZZ A;  5EVL A;  3OPH A;  3UE0 A;  3C5A A;  4ZDX A;  3IWI A;  2WKI A;  3PAE A;  1RP5 A;  1CI8 A;  1M40 A;  1MBL A;  3WRZ A;  1ONH A;  3AGF A;  4EV4 A;  2G2U A;  4ZJ2 A;  3ZFZ A;  2XGN A;  4X56 A;  3AGE A;  1JWZ A;  5F1F A;  3IXH A;  1K6S A;  2Y2I A;  3HUN A;  4KG6 A;  3E2L A;  3HL9 A;  4O7D A;  5AQ7 A;  2ZQD A;  4B4X A;  5FQI A;  3M2J A;  5A90 A;  1BLS A;  2ZLY A;  2OLU A;  3ZDJ A;  3ZG8 B;  4GN2 A;  3O86 A;  4JF5 A;  2OV5 A;  1LI0 A;  2ZC3 B;  4PM8 A;  5HAI A;  2PU2 A;  4RA7 A;  1I5Q A;  1W79 A;  3IF6 A;  4WZ5 A;  2EXB A;  4OOY A;  1YLW A;  3SH8 A;  3PBN A;  4WMC D;  1ERM A;  3CMZ A;  4RYE A;  4JXG A;  4N92 A;  3OC2 A;  1YLJ A;  4JF4 A;  4OLG A;  5U47 A;  4JXW A;  4PMA A;  3GV9 A;  3VP3 A;  4OPY A;  4C3Q A;  3NBL A;  4EUZ A;  3ZG5 A;  5DVA A;  5EPH A;  3VMA A;  3LY3 A;  4KEN B;  4P0M A;  3W8K A;  1H8Z A;  3BRM A;  1PWD A;  2Y59 A;  4Z9Q A;  1EWZ A;  5FAS A;  3UDX A;  1IYP A;  1BLP A;  2WAD A;  1IKG A;  4MEZ A;  5CXW A;  3HRE A;  1YLP A;  3HLB A;  1HD8 A;  2XH9 A;  3IH9 A;  3RXW A;  3SS5 A;  3WS0 A;  5HAP A;  1FCN A;  2Y55 A;  2C6W B;  3G34 A;  2X02 A;  4OQH A;  3SS4 A;  3C7V A;  4R4S A;  4DE0 A;  1BUL A;  3NIA A;  3OPL A;  2Y4A A;  3IH8 A;  3TOI A;  4PM7 A;  1PI5 A;  1GHI A;  3NY4 A;  3Q07 A;  4KZ6 A;  4GD8 A;  4OH0 A;  3G4P A;  2Y2M A;  4RVA A;  3BYD A;  4L0L A;  5AQB A;  4F94 A;  2EX6 A;  1XGI A;  1K38 A;  2XQZ A;  3GMW A;  4QHC A;  1KGG A;  2FFF B;  3VFH A;  4DXC A;  4LEN A;  2Y2J A;  5FAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...