1NY0A

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (nbf)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Recognition and Resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 98
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ny0A00
4N1XA 3EQUA 3ZHHA 1BULA 3N8RA 1CK3A 1L2SA 3A3IA 5FAOA 3SS4A 3V39A 1K38A 4X69A 1RGZA 5F82A 3VSLA 3UE0A 3W4PA 1PW8A 4KZ6A 5G18A 5J8XA 4R1GA 2XH9A 1ALQA 1W5DA 3N6IA 4KZ7A 5EOOA 3LCEA 5A93A 3PAGA 1O07A 5GHZA 4RX2A 5FDHA 1Y54A 4N1HA 3BFEA 3QNCA 4LV0A 1K54C 2PU4A 3G30A 3RXWA 3N7WA 1GA9A 3NCKA 3PAEA 1K54A 2RL3A 3IF6C 3IH8A 4KG2A 4OPQA 1ZG4A 5FQ9A 1GHPA 1XA1A 3VP2A 4CJNA 3GVBA 2DRWA 1EWZA 3NC8A 3PBSA 4QY5A 3IF6A 4NETA 5KZHA 1RGYA 3HREA 4EWFA 2Q9MA 1XP4A 1ES4A 4XUXA 4OLGA 2WKEA 4R3JA 4H8RA 3RXXA 3QNBA 1PI5A 1K6SA 1MXOA 1IKIA 1YQSA 5CGSA 5F83A 5JYOA 1IYPA 1ERQA 1Q2QA 1VQQA 3AGFA 1W8YA 3UDFA 2G2UA 5DF7A 2Z2MB 4GKUA 2HDQA 3UY6A 1N9BA 4LCLA 4LV1A 3PBQA 2X71A 4LV3A 1LL5A 1ESUA 1KGFA 3HL9A 4YINA 4KZ5A 5U47A 3WS5A 4R4RA 4U3TA 2ZQ7A 1ZG6A 2GDNA 3S22A 1Q2PA 4OOLA 4FD8A 4S2PA 5D3OA 5CEBA 3BEBA 2XFSA 3G4PA 3N8LA 4X55A 4NK3A 1G68A 2Y91A 4S2LA 4S2OA 1W79A 3PTEA 5FAQA 5EVID 5GLAA 3NDEA 1GA0A 3A3FA 2VGKA 3DW0A 4R0QA 3C4OA 2XDMA 3GTCA 3FWLA 1L0FA 4A5RA 4E3LA 4P85A 3Q7VB 5A90A 5EPHA 4E3KA 2DNSA 2HDRA 2PU2A 3WS2A 4LV2A 4OKPA 2Y2OA 3IHAA 3C5AA 4KG5A 5KMWA 3GRJA 2ZM8A 1J9MA 4E3MA 3IQAA 2EFUA 1NZOA 2EX9A 5KSHA 3V3RA 5DVAA 1KVMA 1YT4A 1MBLA 1JTDA 3G32A 5HL1A 2H5SA 1IKGA 2IWDA 3ZNYA 3CZDA 3G35A 4FH4A 1FCMA 2JE5A 3E2KA 4K0XA 4RYEA 5E2EA 2WAFA 1E3UD 3VP4A 3WS4A 4E6WA 1XXMA 5A92A 1K4FA 4OPRA 1CEGA 1LL9A 1YLPA 1PYYA 4LENA 4S2MA 1E25A 5HAQA 1BLCA 1EI5A 3ZG5A 2V1ZA 3S4XA 3GV9A 1KDSA 1O7EA 4C75A 4PM5A 2ZC6B 1BLSA 1WYBA 5EOEA 2X01A 1SDNA 2Y2NA 1IYSA 4OOMA 5FQIA 3OPHA 3TG9A 2VGJA 3B3XA 2XR0A 5EE8A 3GQZA 4JXVA 3G34A 3IXBA 3P98A 5FSRA 2EXBA 2P9VB 3BECA 4K0WA 1XX2A 1MPLA 4KG6A 4JF6A 5AQBA 4X6TA 4JXWA 1M40A 1MY8A 5AQ9A 5EUAA 3UPNA 4U0XA 5EVIB 1YMSA 4KZAA 4JKTA 1BZAA 4JXGA 4KQQA 2ZD8A 3E2LA 2ZMAA 2ZM2A 3C4PA 2QZ6A 1JVJA 2J9OA 1ZKJA 4ZJ2A 1ESIA 4R3BA 4X53A 5FI2A 4BQMA 4KQOA 3OC2A 4S2KA 1FSWA 2A3UA 2WKIA 4JF4A 4KENB 5CTMA 5E2FA 3VOYA 5DTSA 5CRFA 1MWTA 3FZCA 4GN2A 3Q82A 5FATA 1RP5A 4KZ9A 3VFHA 3MFDA 3OPPA 3BRMA 2A49A 2ZC3B 3VOZA 5FQKA 1BLHA 2HDSA 3HLBA 4Z9QA 1SKFA 2JC7A 4GOGA 3W4OA 2G2WA 3OPLA 1AXBA 3CJMA 4ZJ1A 4MEZA 4BENA 5DF8A 2HDUA 2HP9A 4ZDXA 1NXYA 1EROA 5DTTA 3WRTA 2WGWB 5CHMA 4E3OA 3SH9A 3VP1A 5GLBA 4BL2A 3D4FA 4UA6A 1I2WA 1BUEA 3O3VA 5CERA 4DKIA 4PPRA 1JWZA 4RA7A 1L0GA 3GSGA 3MZFA 2OLVA 1ONHA 3BLMA 4EUZA 1BTLA 1PW1A 2BLSA 3CMZA 3IHBA 2ZC5B 4ZBEA 3BFFA 2XFTA 2EX2A 3ZNTA 1H8ZA 4DRTA 4EBPA 3HUOA 3VMAA 3LY4A 2FFYA 5AQ7A 2BG1A 1DY6A 5HW3A 1HTZA 2H0YA 2XK1A 1DJBA 1GCEA 3V50A 3WS0A 4OVDA 3A3DA 3SS5A 1RCJA 1PI4A 3O88A 4GZBA 2ZQAA 3BFGA 2ZQDA 4MBFA 1Z6FA 3Q07A 1FR6A 3WS1A 4E3JA 1LHYA 4OOYA 3HLWA 4F94A 1KE4A 1N4OA 3FKVA 3OPRA 3C7UA 3FV7A 4S2IA 5EECA 3UDIA 4B88A 4BL3A 3OZHA 1W8QA 5F1FA 2XF3A 5FAPA 4O7DA 4BD1A 2FFFB 5IHVA 3HUNA 2HPBA 4FCFA 4WELA 4ZTKA 1SHVA 2R9WA 3JYIA 3M2JA 3UDXA 1ES3A 4N9LA 3A3EA 4KZ3A 1YLYA 3NIAA 1KGGA 1IEMA 1L0DA 3VSKA 1E4DA 5FQJA 1YLJA 2JBFA 4IBXA 4S2JA 5CGXA 1I5QA 3G2ZA 3PBRA 4OLDA 3PBTA 2OSUA 4PM7A 3Q7VA 3P09A 5DF9A 2WGIA 3GR2A 3NY4A 1QMFA 2V20A 2WYXA 4WBGA 3UE1A 5M1AA 5GLDA 1IYQA 3UNWA 3ZDJA 1TEMA 3BM6A 5GL9A 2Y2HA 1K6RA 5GHXA 1GHMA 2J7VA 4Q8IA 3ZG9B 4C3QA 3IXHA 5A91A 3UN7A 1K56A 2H10A 3AGEA 2J9PA 4M3KA 5AQAA 5FI7A 3ISGA 4GD8A 1XPBA 4XUZA 1KVLA 2B5RA 5CXWA 1XKZA 4OPYA 1U60A 1NJ4A 1WE4A 2Q9NA 2Y2MA 4QJGA 1VM1A 2E8IA 3HUMA 3IWQA 3IT9A 3V3SA 3BLSA 4E3NA 2WZXA 1K4EA 4P0MA 3HLEA 1TDLA 3UPOA 4WYYA 2RCXA 3PBOA 2C6WB 2ZQ8A 4U0TA 5CECA 2CC1A 4WMCA 5FA7A 1TDGA 3TOIA 3NI9A 4ZAMA 4DE1A 2EFXA 1I2SA 1W7FA 1XGJA 1HZOA 3M6BA 5KSCA 1ZC2A 3IH9A 3IF5A 4GDBA 3QHYA 4MLLA 2WK0A 3BFCA 1L0EA 4Y7PA 2P9VA 3SH7A 4KQRA 1KE0A 3ZVTA 4ID4A 4OQHA 5EVIC 2XGNA 4N92A 4PM6A 3MKEA 5DTKA 3DWZA 5CGWA 3O86A 1BLPA 3UE3A 1BSGA 5EVIA 4DDSA 4QY6A 2WKHA 4WZ5C 5E43A 2EX8A 3FKWA 4UHUA 1MWUA 1ERMA 1M6KA 4WZ5A 4HESA 1LI9A 4D2OA 3MZEA 4JXSA 4BJPA 4EBNA 1FSYA 1JWVA 2Y4AA 2WGVA 3Q7ZA 4WEKA 2IWBA 4N9KA 3O87A 2WADA 3LO7A 1NY0A 2Y2KA 2ZQCA 3I7JA 1NYMA 1GHIA 3IWIA 5FI6A 3HLDA 5CEDA 3Q1FA 5M19A 2XD5A 3W8KA 1FQGA 4EBLA 4HBUA 1PIOA 4L0LA 4RVAA 3ZFZA 5BOHA 3V5MA 2DCFA 3VP3A 4R4SA 4JF5A 4DXCA 2Y2PA 1E3UA 5M18A 4PM8A 1KDWA 1HD8A 2WGWA 3C7VA 4B4XA 2R9XA 1PZOA 5EVLA 5HX9A 3SH8A 2QPNA 4OPZA 3OCNA 4HEFA 1IYOA 1XGIA 1NZUA 1S6RA 1BT5A 2JCHA 2Y2GA 1K55C 1YLWA 3BFDA 4E3IA 3IF6B 5FASA 3MXSA 1K56D 3IXGA 1K55A 4DDYA 4LCMA 2P74A 2V2FF 4ZJ3A 3Q81A 3ITAA 3FYZA 4IBRA 4E6XA 5FQMA 4WEJA 1IELA 3WRZA 1C3BA 5FQQA 1JTGA 1MKIA 2WUQA 3HLFA 1FCOA 1WYCA 2Y55A 4K91A 4FH2A 4MNRA 3GMWA 5TFQA 1ES2A 4DXBA 4BD0A 2HP5A 1CEFA 4JBFA 2C5WB 2XEPA 4IVIA 3ZCZA 4Y0TA 4OP5A 4XXRA 4DE3A 3M6HA 4R23A 2HP6A 4DF6A 4B4ZA 2XLNA 2Z2LB 4GDNA 4QHCA 4IEDA 4MBHA 4WMCD 4C6YA 1PWGA 3AGDA 4X68A 2ZLYA 2EX6A 2EXAA 3M2KA 2ZQ9A 3VFFA 3ZG7B 4DE2A 4OQIA 2ZM0A 4P6BA 1PWCA 1SDEA 2ZC7A 3BYDA 4Y0UA 5CTNA 1K57C 4QU3A 4KZ4A 2XQZA 4KZ8A 4OH0A 1PWDA 1KE3A 4HBTA 1K57A 4KZBA 5GLCA 2Y2IA 1K25A 2Y2LA 4JLFA 3VP0A 2X02A 4RX3A 1LLBA 1S0WA 4QD4A 1PZPA 4CPKA 1H5XA 1NYYA 5CHUA 4Y0OA 1SCWA 1YMXA 4P87A 3RJUA 3NDGA 3CG5A 3IWOA 4WZ4A 5E2HA 3N8SA 4GB7A 2QMIA 3SS3A 3UPPA 1KGEA 4BLMA 1CI8A 1H8YA 4X56A 5L2FA 2WZZA 3ZVWA 4QB8A 4UAAA 4EQIA 2WAEA 2Y2QA 4PM9A 3MXRA 1CI9A 3IXDA 1YLTA 4PMAA 5HFOA 1FR1A 3LY3A 5F1GA 3ZGAB 2I72A 3W4QA 5CHJA 3MBZA 1OMEA 2UWXA 2XD1A 2Y2JA 4OONA 3G2YA 5HARA 2ZJ9A 3ZG0A 2IWCA 4OQGA 4EV4A 4OP8A 4GD6A 3PBNA 4IVKA 4OQ0A 2OLUA 4MBKA 1FOFA 4S2NC 1FCNA 3N4IA 4WM9A 3TSGA 3UO9A 1JWPA 2Y59A 2J8YA 5GHYA 1MWSA 3HVFA 4S2NA 3WWXA 1G6AA 2PBYA 3EQVA 4GNUA 1DJCA 2ZC4B 3HLGA 5TR7A 4FSFA 3HLCA 5E2GA 4YFMA 4UA9A 3G31A 3OCLA 3DTMA 3LEZA 3ITBA 4DE0A 5I94A 1ONGA 5JYPA 1DJAA 1HVBA 5TGFA 1NRFA 3S1YA 1YLZA 1QMEA 3DWKA 1TVFA 2H0TA 2OV5A 3MKFA 3A3JA 3SOIA 3ZG8B 4JPMA 1ES5A 1MWRA 1YM1A 3HBRA 3NBLA 4UA7A 5HAPA 3MZDA 1LI0A 5HAIA 1XA7A
chains in the Genus database with same CATH superfamily
3T1XA 1BULA 1ZHHB 3IBRA 1K38A 4X69A 3W4PA 3UE0A 1ACFA 2XH9A 4N1HA 3BFEA 3QNCA 4LV0A 4Q0HA 2P7JA 2PU4A 3G30A 1PNEA 4OPQA 3VP2A 4HI4A 1GHPA 1EWZA 4EWFA 1D7EA 3QNBA 1PI5A 1IKIA 5CGSA 5JYOA 5HSQA 1ERQA 3UDFA 2Z2MB 1F5MA 2HDQA 3L7HA 5HDSA 4LV3A 3UB5P 4IJGA 1ESUA 1KGFA 1UGUA 2ZMFA 4Z1WA 2ZQ7A 2MJ6A 4FD8A 4S2PA 2XFSA 4S2LA 3U4LP 4R0QA 3C4OA 3LIAA 3FWLA 3IHAA 2Y8HA 3C5AA 4KG5A 3T4LA 3GRJA 5F68A 4R6LA 4NKPA 2EX9A 2OWJA 4HJ6A 1V9YA 3V3RA 1IKGA 4R3AA 4R70A 3WS4A 1VHMA 5A92A 5EM1A 5HAQA 2Y79A 3FPWA 4IUHA 4X1LA 3LI9A 3QP4A 1T19A 5HL6A 2X01A 3OPHA 2XR0A 3IX3A 3R7WB 1MPLA 4JXWA 4U0XA 1YMSA 1BZAA 3E2LA 3C4PA 1JVJA 1STZA 3OC2A 5I5LA 4S2KA 3VOYA 5DTSA 3FZCA 3Q82A 3MF0A 4KZ9A 3MFDA 3OPPA 3BRMA 3CPTB 1BLHA 4WLAA 3HLBA 5A8BA 2JC7A 3W4OA 3A0VA 2HV1A 1AWIA 3BW6A 3WRTA 3LR3A 4E3OA 3NOTC 5HD5A 1L0GA 3GSGA 3MZFA 1ONHA 4EUZA 1BTLA 2ZC5B 4ZBEA 3KX0X 1DP9A 4YWZA 1TD5A 4LPZA 2WKRA 3WS0A 1YPRA 4H6JA 4GZBA 4E3JA 3BFGA 2ZQDA 3WS1A 1FR6A 4OOYA 4GW9A 1KE4A 3PXPA 3OPRA 3C7UA 4B88A 2XF3A 2NUTC 4WELA 4ZTKA 3FPVA 3JYIA 2R9WA 3M2JA 5DFXA 1ES3A 3A3EA 1KGGA 1L0DA 3EGXC 4IBXA 3CUEA 3SW1A 4M4XA 2JHEA 3P09A 2KDKA 3GR2A 4WBGA 5M1AA 2PBDP 3UNWA 3MQOA 4O0PA 3G6OA 2ZMVA 4C3QA 3CI6A 2H10A 3B47A 2K7SA 2B5RA 5CXWA 4D60A 4NXEA 3DTEA 4QJGA 2E8IA 3IWQA 1NWZA 4EEPA 1TDLA 2VJWA 1GSWA 5CECA 3JPUA 5DJTA 3TOIA 3NI9A 4DE1A 2EFXA 1W7FA 1XGJA 1HZOA 4MLLA 3ZQ5A 2WK0A 1L0EA 2P9VA 1P0ZA 4OQHA 4UQIM 1YSQA 3MKEA 1BLPA 1S67L 4QY6A 1XFNA 4UHUA 1MWUA 4D2OA 5J4EA 1FSYA 1JWVA 2Y4AA 3Q7ZA 5CEDA 1GHIA 5FEFA 4FOFA 4RVAA 3V5MA 2DCFA 4DXCA 1KDWA 3C7VA 3FG8A 4OPZA 3OCNA 4HEFA 2Z6DA 2Y2GA 1OPXA 2W1TA 4E3IA 2V8FA 5FASA 1K56D 1P97A 3ITAA 3E4OA 1H0MA 2XA7S 3S7QA 3WRZA 4MNRA 3MQ0A 4FH2A 1F98A 3GMWA 4DXBA 3ZCZA 2GNXA 4OP5A 4XXRA 4DE3A 3OLOA 2HP6A 4B4ZA 2XLNA 2WKQA 4X68A 2ZLYA 2EXAA 1N9OA 4X1MA 4OQIA 2ZM0A 3T1QB 5K5BA 2QHKA 1OTBA 2Y2LA 4PHTA 5F69A 1SCWA 3RJUA 2W1RA 1TS0A 2QMIA 2P08A 5G4YA 4BLMA 1H8YA 4X56A 1XJ2A 2WZZA 3ZVWA 1CI9A 1YLTA 3E4PA 3ZGAB 1A0KA 5HARA 5HPIA 4OQGA 4EV4A 3TRCA 3PYPA 4IVKA 3UO9A 3TSGA 1JWPA 2Y59A 2J8YA 3HVFA 4S2NA 4JGPA 3F1PA 1LSWA 3LYXA 3MR0A 3IS2A 1JNUA 2NUPC 4LLOB 3ITBA 4DE0A 1HVBA 1QMEA 4Q0JA 2JKRM 4Y5FA 4JPMA 1ES5A 4UA7A 1HLUP 2QYBA 2L1MA 1LI0A 5HAIA 3GTCA 5AQAA 4N1XA 3EQUA 3UE6A 3ZHHA 1L2SA 5FAOA 2ZOIA 3V39A 4EEUA 5HWWA 2W3HA 2B02A 5G18A 5J8XA 1ALQA 4KZ7A 5EOOA 1O07A 5GHZA 4PKYA 4LGWA 1GSVA 3K3DA 1GA9A 3NCKA 2RL3A 3IH8A 1TS7A 4KG2A 5FQ9A 1ZG4A 4CJNA 4QY5A 4KUKA 4NETA 4Y17A 4OLGA 4R3JA 1XJ6A 4H8RA 1K6SA 3OBFA 1Z09A 4H6JB 4GLQA 4LCLA 4LV1A 3V67A 1LL5A 1UWNX 2VA0A 4KZ5A 1D1JA 4U3TA 1ZG6A 2GDNA 5D3OA 4IUKA 3N8LA 4X55A 4NK3A 2Y91A 1W79A 5EVID 3KSIA 3T4JA 4EU0A 3DW0A 4A5RA 2ZOHA 5EPHA 5A90A 1D06A 4JGQA 3WS2A 5KMWA 3IQAA 5KSHA 5DVAA 3T50A 4KUOA 5HL1A 3E2KA 4E6WA 1XXMA 4OPRA 1LL9A 1E25A 3ZG5A 3S4XA 1KDSA 1O7EA 3H7WA 1WYBA 5EOEA 2Y2NA 1IYSA 4OOMA 3TG9A 2J3TD 3LGOA 1XJ4A 3G34A 3T4KA 2P9VB 3BECA 4K0WA 2XROA 4KG6A 5AQBA 5EUAA 1M40A 3BJNA 2W3GA 4JXGA 2M7UA 1TS8A 4KQQA 4WL9A 2ZD8A 1T18A 2QZ6A 4X53A 2A3UA 4I3IA 4JF4A 5E2FA 1MWTA 1OTIA 2AVXA 1S4SA 3F1NA 3VFHA 5FEGA 2A49A 2ZC3B 2D02A 4NXGA 4GOGA 5TJJA 3HJIA 1AXBA 4BENA 5CX7A 4I3AA 3VP1A 4BL2A 4UA6A 1I2WA 1T1BA 1JWZA 3MJQA 2PD7A 1VEUA 2OLVA 3RH8B 2W1TB 2A24A 3IHBA 3BFFA 1MKMA 2EX2A 2JKGA 1LL8A 4EBPA 1G5UA 3CAXA 5AQ7A 5HW3A 4MCWA 2XK1A 1DJBA 3SS5A 2IA2A 1RCJA 1CF0A 5HD3A 3P7NA 3F1OA 3O88A 1LHYA 3HLWA 4O01A 4F94A 4FTXA 2JKTI 3FKVA 2J80A 1XFQA 3EWKA 3FV7A 4S2IA 5EECA 3UDIA 5L07A 3OZHA 2QWSA 5FAPA 4ETXA 2FFFB 3HUNA 4DJ2A 2KLIA 3LUQA 2V1BA 1MC0A 1UWPX 4KZ3A 4LRXC 1YLYA 2XA7M 3NIAA 3VSKA 3CUEC 2O9AA 2JBFA 4S2JA 5CGXA 1I5QA 1K0KA 3G2ZA 3HJKA 5EM0A 2OSUA 3Q7VA 3KSGA 2WGIA 2W0NA 3UE1A 2V20A 2Z6CA 1TEMA 1H8MA 1K6RA 2P04A 2J7VA 2M7VA 3IXHA 5L10A 3DTKA 2VGLS 3AGEA 4B9OA 5FI7A 3LICA 4GD8A 5G4ZA 2HJEA 4BWIA 2PD8A 1U60A 3QP6A 2Y2MA 1VM1A 3UB6A 3A0RA 3BLSA 4E3NA 2WZXA 4XT2B 3HLEA 3UPOA 4CQHA 3A0SA 2RCXA 3PBOA 2CC1A 4WMCA 5FA7A 1XJ3A 1I2SA 1J3WA 5KSCA 4GDBA 1OTDA 4MN7A 3RTYA 3F1PB 3BFCA 3IS2B 1KE0A 3ZVTA 4ID4A 3EEHA 2K2NA 2XGNA 4N92A 4PM6A 5DTKA 1BSGA 5EVIA 4DDSA 3LEQA 5E43A 5IS1A 5AVEA 1ERMA 4WZ5A 2HF6A 3MZEA 4G3VA 4BJPA 4GJ4A 2WGVA 2IWBA 3O5YA 2WADA 2EWVA 3IWIA 1NYMA 1X0OA 3Q1FA 1WA9A 4NXFA 4HBUA 4L0LA 3ZFZA 4R4SA 2O9BA 2Y2PA 2WGWA 3VE4A 4B4XA 2R9XA 5EVLA 5HX9A 2QPNA 1XGIA 4I38A 1NZUA 1S6RA 3UB7A 5L09A 1FIKA 3MSHA 3TW8A 3RFBA 4GHIA 2V2FF 4IBRA 2H28A 2V1AA 3R4KA 5MC7A 3HLFA 1IFQA 3VV4A 1CEFA 2XEPA 2D01A 3M6HA 3D9YA 1PWGA 3E0YA 4HH3A 2ZQ9A 1BYWA 1VETA 1N9LA 2O99A 3KYQA 4P6BA 1PWCA 5HWVA 5CTNA 4CLCD 4YNRA 4OH0A 4KZBA 4HBTA 1K57A 2Y2IA 3C30A 2OOLA 4RX3A 1S1ZA 4P6ZS 2OAP1 1PZPA 3GDIA 5HPFA 1NYYA 5CHUA 4Y0OA 5AVFA 4P87A 3NECA 3CG5A 3UMEA 3SS3A 4HIAA 1KGEA 3LI8A 3MXRA 5HFOA 5F1GA 2I72A 5CHJA 2YKHA 1OT6A 4OONA 3H7WB 1IOUA 2IWCA 5HZHA 4OQ0A 4GD6A 4S2NC 4WM9A 3N4IA 3PHYA 3NOUC 3VOLA 4HJ4A 3VE3A 2PBYA 3EQVA 4ZRRA 4GNUA 2GX5A 2ZC4B 4BBVA 1V9ZA 4FSFA 5E2GA 3G31A 5I94A 5JYPA 5HWTA 5L8MA 3DWKA 4G3KA 4JGOA 4LRYC 2OV5A 3T4SA 2VZWA 3F1NB 1MWRA 3MZDA 3N8RA 3A3IA 1RGZA 3VSLA 3KSHA 1PW8A 4EUVA 3N6IA 5A93A 2ZBBA 3PAGA 4L9FA 1VEUB 3T12B 3QP1A 2A24B 3RXWA 3PAEA 1K54A 2KOIA 1EW0A 5IT5A 1XA1A 3D72A 3GVBA 3NC8A 3IF6A 1RGYA 3HREA 1XP4A 3RXXA 1MXOA 1YQSA 5F83A 3F1OB 1Q2QA 2QJ7A 3AGFA 2G2UA 3S7OA 3UY6A 2X71A 3HL9A 4YINA 4Y15A 3S7NA 3WS5A 4R4RA 1Q2PA 3BEBA 3G4PA 5FAQA 3NDEA 1GA0A 2VGKA 2XDMA 3QP5A 4P85A 3Q7VB 3JVUA 4E3KA 2DNSA 1T1AA 5DFYA 2K31A 2W3FA 2L4RA 2Y2OA 2ZM8A 4HP9A 3UMDA 2EFUA 3U2AA 3HCYA 2W3EA 3G32A 1JTDA 2H5SA 3G35A 3UB8A 3CLOA 4K0XA 1K4FA 1CEGA 1PYYA 4DN0A 4S2MA 4BMWA 4XT2A 2V1ZA 3GV9A 4HNBA 5EE8A 4JXVA 5AJGA 3LR5A 2JN7A 3UPNA 1DP8A 1MY8A 5EVIB 4KZAA 1P9WA 3H82A 2ZM2A 1ZKJA 1ESIA 4R3BA 2WKIA 4KENB 4ARZA 3DAVA 2UV0E 4GN2A 3D3OA 1RP5A 4DJ3A 3VOZA 4Z9QA 3OPLA 3CJMA 3T4OA 5DF8A 2HDUA 2HP9A 1EROA 5DTTA 2WGWB 3SH9A 5GLBA 1DRMA 3O3VA 4PPRA 4R38A 3BLMA 1PW1A 3H9WA 2FH5A 2BLSA 3CMZA 1YAXA 1G6OA 2EA9A 5F5YA 4GHIB 2XFTA 1H8ZA 4DRTA 3HUOA 3LY4A 2FFYA 1DY6A 4MMNA 1HTZA 2H0YA 4WUJA 4ESPA 4Y2FA 3V50A 4OVDA 3A3DA 3UB9A 3L9KA 1PI4A 5FDSA 4MBFA 4Y13A 1SZVA 2BASA 2PT7A 1N4OA 3C8CA 3CHWP 2ZL1A 2YKFA 5EFWA 4BL3A 1W8QA 5F1FA 1L3LA 4O7DA 4BD1A 5IHVA 4EQ1A 1CQAA 1VETB 1SHVA 1YLJA 1OT9A 3PBRA 3PBTA 4PM7A 3NY4A 1QMFA 2WYXA 1IYQA 2Y2HA 1GHMA 4BBUA 2Q0OA 5A91A 3UN7A 1K56A 3EOIA 4HY8A 4M3KA 3BY9A 3ISGA 1XPBA 4XUZA 1XKZA 4G3WA 4BBTA 2L0WA 4DMZA 4OPYA 1NJ4A 3HUMA 3IBJA 4P0MA 1OJGA 4UQIS 1ODVA 3NULA 1TDGA 2PR5A 5TBMA 3IF5A 1TF1A 4Y7PA 4QWOA 4KQRA 5EVIC 5CGWA 3O86A 4IHQA 4WZ5C 2EX8A 2QJ5A 3FKWA 1M6KA 4HESA 1LI9A 1KOUA 3TE8A 4JXSA 3IX8A 4EBNA 4N9KA 3LO7A 3ZYTA 2B18A 1NY0A 4NXBA 2JKTM 4ETZA 2XD5A 1FQGA 2VKSA 1PIOA 2VX8A 3LR0A 5BOHA 4JF5A 3KYEA 3MXQA 3SH8A 4WN5A 3LR4A 2JCHA 3IF6B 2GZAA 2INWA 3MXSA 3IXGA 1K55A 2J3TC 3Q81A 4E6XA 2M1CA 5FQQA 1JTGA 1FCOA 1WYCA 1ES2A 1PFLA 2HP5A 4IVIA 4Y0TA 4DF6A 4GDNA 2Z2LB 4C6YA 4IEDA 4MBHA 3QP2A 3ULFA 3M2KA 3VFFA 3T1RA 4HHDA 1SDEA 2ZC7A 4Y0UA 1K57C 1YSPA 5DKKA 1PWDA 1KE3A 4JLFA 2X02A 1LLBA 1S0WA 1H5XA 1YMXA 3NDGA 5FL3A 3IWOA 4WZ4A 5E2HA 4NG2A 4GB7A 1OJ5A 2E8JA 1CI8A 2PDRA 4QB8A 4UAAA 2J3WA 3IXDA 3LY3A 3W4QA 4EERA 3BQ8A 3MBZA 4X25A 5J3WA 3ZG0A 1OTAA 4OP8A 2OLUA 4GS9A 1FOFA 1FCNA 1OTEA 3E98A 1MWSA 5J7EA 4QPRA 1G6AA 3IX4A 1LT0A 4F3LA 5IU1A 3S7PA 1PRQA 3C2WA 5TR7A 3CITA 3HLCA 4UA9A 3BWLA 3OCLA 3DTMA 3LEZA 4CLCB 3H82B 1DJAA 4EW7A 5TGFA 1NRFA 3S1YA 1YLZA 2PYRA 5DKLA 4ARZB 1TVFA 3MKFA 4L9EA 1GSXA 3CWFA 4AFIA 1F9IA 4CPKA 4MN6A 3SS4A 1CK3A 2V8CA 5F82A 4KZ6A 2O0YA 4R1GA 3NJAA 1W5DA 3LCEA 4RX2A 5FDHA 1Y54A 4NEED 1K54C 3KYZA 3N7WA 3IF6C 2DMWA 2VEAA 2DRWA 3PBSA 5KZHA 1N9NA 2Q9MA 1ES4A 4XUXA 2WKEA 5DJUA 3LIBA 4MN5A 1IYPA 1VQQA 2CMNA 1W8YA 5LBRA 5DF7A 2V9AA 2ZL1B 4GKUA 1N9BA 3T4TA 3PBQA 2B95A 1W63Q 5U47A 3C38A 4I3JA 3S22A 2PRFA 4OOLA 5CEBA 1G68A 4S2OA 3PTEA 5GLAA 3A3FA 3GECA 4MDZA 4ME4A 1L0FA 4E3LA 5EVEA 4JGRA 2HDRA 2PU2A 4LV2A 4OKPA 3EGDC 4PAUA 2OWHA 3SZTA 4WF0A 1J9MA 4E3MA 2V0WA 1NZOA 2BTFP 1KVMA 1YT4A 2XSSA 1MBLA 2IWDA 3ZNYA 3CZDA 4FH4A 1FCMA 2JE5A 5E2EA 4II7A 4RYEA 3VP4A 2WAFA 1E3UD 1YLPA 2VV6A 5KIZA 4LENA 3MMHA 1BLCA 1EI5A 4C75A 4HJ3A 4PM5A 2ZC6B 2VK3A 1BLSA 1SDNA 1Y28A 3BQAA 5FQIA 2VGJA 4B93A 3B3XA 3ICYA 5TBMB 3GQZA 3IXBA 3P98A 5FSRA 2EXBA 1XX2A 4JF6A 4X6TA 5AQ9A 3W2ZA 4JKTA 3DBAA 4CLCC 3NOPC 4K08A 2ZMAA 4PKYG 2J9OA 1DP6A 3LFVA 5FI2A 4ZJ2A 4BQMA 1NLYA 2VV7A 4KQOA 1FSWA 5CTMA 4E04A 5CRFA 2G7UA 5FATA 2FZ0A 1SKOA 2PAVP 5FQKA 2HDSA 3DTIA 4KQDA 1SKFA 4HP4A 2G2WA 4ZJ1A 4HOIA 4MEZA 2W27A 3LIEA 4ZDXA 1NXYA 5CHMA 3D4FA 1BUEA 2A2LA 5CERA 3KO6A 4DKIA 1VB6A 4RA7A 1S1YA 3LIFA 5C5KA 2R78A 4YOFA 2HJ9C 3TJZC 3K2NA 4I5SA 4L9GA 2PR6A 4LRZE 3ZNTA 3MFXA 3VMAA 5HDDA 2BG1A 1GCEA 1ZTUA 4EETB 2ZQAA 3E4QA 1Z6FA 3Q07A 2QKPA 2HPBA 2LB5A 4I39A 4FCFA 3UDXA 4N9LA 1IEMA 3LIDA 1E4DA 5FQJA 4HH2A 4OLDA 5DF9A 5GLDA 3ZDJA 3BM6A 5GL9A 5EV0A 5GHXA 4Q8IA 3ZG9B 4CLCE 2J9PA 1F2KA 1KVLA 2WKPA 4Y3IA 2I9VA 3QP8A 1WE4A 2Q9NA 1H3QA 3IT9A 3V3SA 2VV8A 4Q0IA 1K4EA 2VGLM 1G28A 1CJFA 2O9CA 4WYYA 3P01A 2LB9A 4GS9B 2C6WB 2ZQ8A 4U0TA 2KX6A 4ZAMA 3MQQA 3M6BA 1FILA 4F3LB 1ZC2A 3IH9A 3QHYA 3R7WA 3SH7A 4CLCA 3DWZA 3UE3A 2EWWA 3OOVA 2W3DA 2WKHA 2ACGA 1NLZA 4WEKA 2HGVA 3O87A 2Y2KA 2ZQCA 3I7JA 5FI6A 3HLDA 3CPTA 5M19A 3W8KA 4EBLA 1S66L 3EEAA 3VP3A 1E3UA 5M18A 4PM8A 1HD8A 1PZOA 3B33A 3K3CA 3NHQA 1IYOA 3T4QA 5F6AA 1BT5A 4HQAA 1K55C 1YLWA 3BFDA 4DDYA 4LCMA 2P74A 4ZJ3A 3FYZA 1T1CA 5FQMA 4WEJA 1IELA 2JKRI 1C3BA 1TS6A 4FUWA 1MKIA 2WUQA 4O8GA 4K91A 2Y55A 5HDCA 5TFQA 4BD0A 4JBFA 1MZUA 2C5WB 3MS6A 4R23A 1NRJA 4EXOA 3JVVA 4QHCA 4WMCD 3AGDA 2EX6A 1LSXA 3ZG7B 4DE2A 1YKDA 3BYDA 2XRNA 4QU3A 4KZ4A 2XQZA 2OAQ1 4KZ8A 5GLCA 3VP0A 1K25A 4QD4A 1P9RA 4EESA 3T1SA 2PHYA 3PR6A 2VLGA 3N8SA 3FC7A 3UPPA 5L2FA 1Y4OA 4EQIA 2WAEA 2Y2QA 4PM9A 4P6ZM 4PMAA 1FR1A 2JKFA 4GCZA 1OMEA 2UWXA 2XD1A 2Y2JA 3G2YA 2HZ5A 1LSVA 2ZJ9A 3BY8A 3PBNA 4MBKA 5GHYA 3WWXA 1DJCA 3HLGA 4LFUA 3B42A 4YFMA 1ONGA 4UEYA 4RQ9A 1W63M 2V0UA 2GJ3A 2H0TA 3A3JA 3SOIA 3ZG8B 1YM1A 3NBLA 3HBRA 1S4RA 1SKOB 5HAPA 3KSFA 2PYPA 1XA7A
chains in the Genus database with same CATH topology
4N1XA 3EQUA 3ZHHA 1BULA 3N8RA 1CK3A 1L2SA 3A3IA 5FAOA 3SS4A 3V39A 1K38A 4X69A 1RGZA 5F82A 3VSLA 3UE0A 3W4PA 1PW8A 4KZ6A 5G18A 5J8XA 4R1GA 2XH9A 1ALQA 1W5DA 3N6IA 4KZ7A 5EOOA 3LCEA 5A93A 3PAGA 1O07A 5GHZA 4RX2A 5FDHA 1Y54A 4N1HA 3BFEA 3QNCA 4LV0A 1K54C 2PU4A 3G30A 3RXWA 3N7WA 1GA9A 3NCKA 3PAEA 1K54A 2RL3A 3IF6C 3IH8A 4KG2A 4OPQA 1ZG4A 5FQ9A 1GHPA 1XA1A 3VP2A 4CJNA 3GVBA 2DRWA 1EWZA 3NC8A 3PBSA 4QY5A 3IF6A 4NETA 5KZHA 1RGYA 3HREA 4EWFA 2Q9MA 1XP4A 1ES4A 4XUXA 4OLGA 2WKEA 4R3JA 4H8RA 3RXXA 3QNBA 1PI5A 1K6SA 1MXOA 1IKIA 1YQSA 5CGSA 5F83A 5JYOA 1IYPA 1ERQA 1Q2QA 1VQQA 3AGFA 1W8YA 3UDFA 2G2UA 5DF7A 2Z2MB 4GKUA 2HDQA 3UY6A 1N9BA 4LCLA 4LV1A 3PBQA 2X71A 4LV3A 1LL5A 1ESUA 1KGFA 3HL9A 4YINA 4KZ5A 5U47A 3WS5A 4R4RA 4U3TA 2ZQ7A 1ZG6A 2GDNA 3S22A 1Q2PA 4OOLA 4FD8A 4S2PA 5D3OA 5CEBA 3BEBA 2XFSA 3G4PA 3N8LA 4X55A 4NK3A 1G68A 2Y91A 4S2LA 4S2OA 1W79A 3PTEA 5FAQA 5EVID 5GLAA 3NDEA 1GA0A 3A3FA 2VGKA 3DW0A 4R0QA 3C4OA 2XDMA 3GTCA 3FWLA 1L0FA 4A5RA 4E3LA 4P85A 3Q7VB 5A90A 5EPHA 4E3KA 2DNSA 2HDRA 2PU2A 3WS2A 4LV2A 4OKPA 2Y2OA 3IHAA 3C5AA 4KG5A 5KMWA 3GRJA 2ZM8A 1J9MA 4E3MA 3IQAA 2EFUA 1NZOA 2EX9A 5KSHA 3V3RA 5DVAA 1KVMA 1YT4A 1MBLA 1JTDA 3G32A 5HL1A 2H5SA 1IKGA 2IWDA 3ZNYA 3CZDA 3G35A 4FH4A 1FCMA 2JE5A 3E2KA 4K0XA 4RYEA 5E2EA 2WAFA 1E3UD 3VP4A 3WS4A 4E6WA 1XXMA 5A92A 1K4FA 4OPRA 1CEGA 1LL9A 1YLPA 1PYYA 4LENA 4S2MA 1E25A 5HAQA 1BLCA 1EI5A 3ZG5A 2V1ZA 3S4XA 3GV9A 1KDSA 1O7EA 4C75A 4PM5A 2ZC6B 1BLSA 1WYBA 5EOEA 2X01A 1SDNA 2Y2NA 1IYSA 4OOMA 5FQIA 3OPHA 3TG9A 2VGJA 3B3XA 2XR0A 5EE8A 3GQZA 4JXVA 3G34A 3IXBA 3P98A 5FSRA 2EXBA 2P9VB 3BECA 4K0WA 1XX2A 1MPLA 4KG6A 4JF6A 5AQBA 4X6TA 4JXWA 1M40A 1MY8A 5AQ9A 5EUAA 3UPNA 4U0XA 5EVIB 1YMSA 4KZAA 4JKTA 1BZAA 4JXGA 4KQQA 2ZD8A 3E2LA 2ZMAA 2ZM2A 3C4PA 2QZ6A 1JVJA 2J9OA 1ZKJA 4ZJ2A 1ESIA 4R3BA 4X53A 5FI2A 4BQMA 4KQOA 3OC2A 4S2KA 1FSWA 2A3UA 2WKIA 4JF4A 4KENB 5CTMA 5E2FA 3VOYA 5DTSA 5CRFA 1MWTA 3FZCA 4GN2A 3Q82A 5FATA 1RP5A 4KZ9A 3VFHA 3MFDA 3OPPA 3BRMA 2A49A 2ZC3B 3VOZA 5FQKA 1BLHA 2HDSA 3HLBA 4Z9QA 1SKFA 2JC7A 4GOGA 3W4OA 2G2WA 3OPLA 1AXBA 3CJMA 4ZJ1A 4MEZA 4BENA 5DF8A 2HDUA 2HP9A 4ZDXA 1NXYA 1EROA 5DTTA 3WRTA 2WGWB 5CHMA 4E3OA 3SH9A 3VP1A 5GLBA 4BL2A 3D4FA 4UA6A 1I2WA 1BUEA 3O3VA 5CERA 4DKIA 4PPRA 1JWZA 4RA7A 1L0GA 3GSGA 3MZFA 2OLVA 1ONHA 3BLMA 4EUZA 1BTLA 1PW1A 2BLSA 3CMZA 3IHBA 2ZC5B 4ZBEA 3BFFA 2XFTA 2EX2A 3ZNTA 1H8ZA 4DRTA 4EBPA 3HUOA 3VMAA 3LY4A 2FFYA 5AQ7A 2BG1A 1DY6A 5HW3A 1HTZA 2H0YA 2XK1A 1DJBA 1GCEA 3V50A 3WS0A 4OVDA 3A3DA 3SS5A 1RCJA 1PI4A 3O88A 4GZBA 2ZQAA 3BFGA 2ZQDA 4MBFA 1Z6FA 3Q07A 1FR6A 3WS1A 4E3JA 1LHYA 4OOYA 3HLWA 4F94A 1KE4A 1N4OA 3FKVA 3OPRA 3C7UA 3FV7A 4S2IA 5EECA 3UDIA 4B88A 4BL3A 3OZHA 1W8QA 5F1FA 2XF3A 5FAPA 4O7DA 4BD1A 2FFFB 5IHVA 3HUNA 2HPBA 4FCFA 4WELA 4ZTKA 1SHVA 2R9WA 3JYIA 3M2JA 3UDXA 1ES3A 4N9LA 3A3EA 4KZ3A 1YLYA 3NIAA 1KGGA 1IEMA 1L0DA 3VSKA 1E4DA 5FQJA 1YLJA 2JBFA 4IBXA 4S2JA 5CGXA 1I5QA 3G2ZA 3PBRA 4OLDA 3PBTA 2OSUA 4PM7A 3Q7VA 3P09A 5DF9A 2WGIA 3GR2A 3NY4A 1QMFA 2V20A 2WYXA 4WBGA 3UE1A 5M1AA 5GLDA 1IYQA 3UNWA 3ZDJA 1TEMA 3BM6A 5GL9A 2Y2HA 1K6RA 5GHXA 1GHMA 2J7VA 4Q8IA 3ZG9B 4C3QA 3IXHA 5A91A 3UN7A 1K56A 2H10A 3AGEA 2J9PA 4M3KA 5AQAA 5FI7A 3ISGA 4GD8A 1XPBA 4XUZA 1KVLA 2B5RA 5CXWA 1XKZA 4OPYA 1U60A 1NJ4A 1WE4A 2Q9NA 2Y2MA 4QJGA 1VM1A 2E8IA 3HUMA 3IWQA 3IT9A 3V3SA 3BLSA 4E3NA 2WZXA 1K4EA 4P0MA 3HLEA 1TDLA 3UPOA 4WYYA 2RCXA 3PBOA 2C6WB 2ZQ8A 4U0TA 5CECA 2CC1A 4WMCA 5FA7A 1TDGA 3TOIA 3NI9A 4ZAMA 4DE1A 2EFXA 1I2SA 1W7FA 1XGJA 1HZOA 3M6BA 5KSCA 1ZC2A 3IH9A 3IF5A 4GDBA 3QHYA 4MLLA 2WK0A 3BFCA 1L0EA 4Y7PA 2P9VA 3SH7A 4KQRA 1KE0A 3ZVTA 4ID4A 4OQHA 5EVIC 2XGNA 4N92A 4PM6A 3MKEA 5DTKA 3DWZA 5CGWA 3O86A 1BLPA 3UE3A 1BSGA 5EVIA 4DDSA 4QY6A 2WKHA 4WZ5C 5E43A 2EX8A 3FKWA 4UHUA 1MWUA 1ERMA 1M6KA 4WZ5A 4HESA 1LI9A 4D2OA 3MZEA 4JXSA 4BJPA 4EBNA 1FSYA 1JWVA 2Y4AA 2WGVA 3Q7ZA 4WEKA 2IWBA 4N9KA 3O87A 2WADA 3LO7A 1NY0A 2Y2KA 2ZQCA 3I7JA 1NYMA 1GHIA 3IWIA 5FI6A 3HLDA 5CEDA 3Q1FA 5M19A 2XD5A 3W8KA 1FQGA 4EBLA 4HBUA 1PIOA 4L0LA 4RVAA 3ZFZA 5BOHA 3V5MA 2DCFA 3VP3A 4R4SA 4JF5A 4DXCA 2Y2PA 1E3UA 5M18A 4PM8A 1KDWA 1HD8A 2WGWA 3C7VA 4B4XA 2R9XA 1PZOA 5EVLA 5HX9A 3SH8A 2QPNA 4OPZA 3OCNA 4HEFA 1IYOA 1XGIA 1NZUA 1S6RA 1BT5A 2JCHA 2Y2GA 1K55C 1YLWA 3BFDA 4E3IA 3IF6B 5FASA 3MXSA 1K56D 3IXGA 1K55A 4DDYA 4LCMA 2P74A 2V2FF 4ZJ3A 3Q81A 3ITAA 3FYZA 4IBRA 4E6XA 5FQMA 4WEJA 1IELA 3WRZA 1C3BA 5FQQA 1JTGA 1MKIA 2WUQA 3HLFA 1FCOA 1WYCA 2Y55A 4K91A 4FH2A 4MNRA 3GMWA 5TFQA 1ES2A 4DXBA 4BD0A 2HP5A 1CEFA 4JBFA 2C5WB 2XEPA 4IVIA 3ZCZA 4Y0TA 4OP5A 4XXRA 4DE3A 3M6HA 4R23A 2HP6A 4DF6A 4B4ZA 2XLNA 2Z2LB 4GDNA 4QHCA 4IEDA 4MBHA 4WMCD 4C6YA 1PWGA 3AGDA 4X68A 2ZLYA 2EX6A 2EXAA 3M2KA 2ZQ9A 3VFFA 3ZG7B 4DE2A 4OQIA 2ZM0A 4P6BA 1PWCA 1SDEA 2ZC7A 3BYDA 4Y0UA 5CTNA 1K57C 4QU3A 4KZ4A 2XQZA 4KZ8A 4OH0A 1PWDA 1KE3A 4HBTA 1K57A 4KZBA 5GLCA 2Y2IA 1K25A 2Y2LA 4JLFA 3VP0A 2X02A 4RX3A 1LLBA 1S0WA 4QD4A 1PZPA 4CPKA 1H5XA 1NYYA 5CHUA 4Y0OA 1SCWA 1YMXA 4P87A 3RJUA 3NDGA 3CG5A 3IWOA 4WZ4A 5E2HA 3N8SA 4GB7A 2QMIA 3SS3A 3UPPA 1KGEA 4BLMA 1CI8A 1H8YA 4X56A 5L2FA 2WZZA 3ZVWA 4QB8A 4UAAA 4EQIA 2WAEA 2Y2QA 4PM9A 3MXRA 1CI9A 3IXDA 1YLTA 4PMAA 5HFOA 1FR1A 3LY3A 5F1GA 3ZGAB 2I72A 3W4QA 5CHJA 3MBZA 1OMEA 2UWXA 2XD1A 2Y2JA 4OONA 3G2YA 5HARA 2ZJ9A 3ZG0A 2IWCA 4OQGA 4EV4A 4OP8A 4GD6A 3PBNA 4IVKA 4OQ0A 2OLUA 4MBKA 1FOFA 4S2NC 1FCNA 3N4IA 4WM9A 3TSGA 3UO9A 1JWPA 2Y59A 2J8YA 5GHYA 1MWSA 3HVFA 4S2NA 3WWXA 1G6AA 2PBYA 3EQVA 4GNUA 1DJCA 2ZC4B 3HLGA 5TR7A 4FSFA 3HLCA 5E2GA 4YFMA 4UA9A 3G31A 3OCLA 3DTMA 3LEZA 3ITBA 4DE0A 5I94A 1ONGA 5JYPA 1DJAA 1HVBA 5TGFA 1NRFA 3S1YA 1YLZA 1QMEA 3DWKA 1TVFA 2H0TA 2OV5A 3MKFA 3A3JA 3SOIA 3ZG8B 4JPMA 1ES5A 1MWRA 1YM1A 3HBRA 3NBLA 4UA7A 5HAPA 3MZDA 1LI0A 5HAIA 1XA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1X A;  3EQU A;  3ZHH A;  1BUL A;  3N8R A;  1CK3 A;  1L2S A;  3A3I A;  5FAO A;  3SS4 A;  3V39 A;  1K38 A;  4X69 A;  1RGZ A;  5F82 A;  3VSL A;  3UE0 A;  3W4P A;  1PW8 A;  4KZ6 A;  5G18 A;  5J8X A;  4R1G A;  2XH9 A;  1ALQ A;  1W5D A;  3N6I A;  4KZ7 A;  5EOO A;  3LCE A;  5A93 A;  3PAG A;  1O07 A;  5GHZ A;  4RX2 A;  5FDH A;  1Y54 A;  4N1H A;  3BFE A;  3QNC A;  4LV0 A;  1K54 C;  2PU4 A;  3G30 A;  3RXW A;  3N7W A;  1GA9 A;  3NCK A;  3PAE A;  1K54 A;  2RL3 A;  3IF6 C;  3IH8 A;  4KG2 A;  4OPQ A;  1ZG4 A;  5FQ9 A;  1GHP A;  1XA1 A;  3VP2 A;  4CJN A;  3GVB A;  2DRW A;  1EWZ A;  3NC8 A;  3PBS A;  4QY5 A;  3IF6 A;  4NET A;  5KZH A;  1RGY A;  3HRE A;  4EWF A;  2Q9M A;  1XP4 A;  1ES4 A;  4XUX A;  4OLG A;  2WKE A;  4R3J A;  4H8R A;  3RXX A;  3QNB A;  1PI5 A;  1K6S A;  1MXO A;  1IKI A;  1YQS A;  5CGS A;  5F83 A;  5JYO A;  1IYP A;  1ERQ A;  1Q2Q A;  1VQQ A;  3AGF A;  1W8Y A;  3UDF A;  2G2U A;  5DF7 A;  2Z2M B;  4GKU A;  2HDQ A;  3UY6 A;  1N9B A;  4LCL A;  4LV1 A;  3PBQ A;  2X71 A;  4LV3 A;  1LL5 A;  1ESU A;  1KGF A;  3HL9 A;  4YIN A;  4KZ5 A;  5U47 A;  3WS5 A;  4R4R A;  4U3T A;  2ZQ7 A;  1ZG6 A;  2GDN A;  3S22 A;  1Q2P A;  4OOL A;  4FD8 A;  4S2P A;  5D3O A;  5CEB A;  3BEB A;  2XFS A;  3G4P A;  3N8L A;  4X55 A;  4NK3 A;  1G68 A;  2Y91 A;  4S2L A;  4S2O A;  1W79 A;  3PTE A;  5FAQ A;  5EVI D;  5GLA A;  3NDE A;  1GA0 A;  3A3F A;  2VGK A;  3DW0 A;  4R0Q A;  3C4O A;  2XDM A;  3GTC A;  3FWL A;  1L0F A;  4A5R A;  4E3L A;  4P85 A;  3Q7V B;  5A90 A;  5EPH A;  4E3K A;  2DNS A;  2HDR A;  2PU2 A;  3WS2 A;  4LV2 A;  4OKP A;  2Y2O A;  3IHA A;  3C5A A;  4KG5 A;  5KMW A;  3GRJ A;  2ZM8 A;  1J9M A;  4E3M A;  3IQA A;  2EFU A;  1NZO A;  2EX9 A;  5KSH A;  3V3R A;  5DVA A;  1KVM A;  1YT4 A;  1MBL A;  1JTD A;  3G32 A;  5HL1 A;  2H5S A;  1IKG A;  2IWD A;  3ZNY A;  3CZD A;  3G35 A;  4FH4 A;  1FCM A;  2JE5 A;  3E2K A;  4K0X A;  4RYE A;  5E2E A;  2WAF A;  1E3U D;  3VP4 A;  3WS4 A;  4E6W A;  1XXM A;  5A92 A;  1K4F A;  4OPR A;  1CEG A;  1LL9 A;  1YLP A;  1PYY A;  4LEN A;  4S2M A;  1E25 A;  5HAQ A;  1BLC A;  1EI5 A;  3ZG5 A;  2V1Z A;  3S4X A;  3GV9 A;  1KDS A;  1O7E A;  4C75 A;  4PM5 A;  2ZC6 B;  1BLS A;  1WYB A;  5EOE A;  2X01 A;  1SDN A;  2Y2N A;  1IYS A;  4OOM A;  5FQI A;  3OPH A;  3TG9 A;  2VGJ A;  3B3X A;  2XR0 A;  5EE8 A;  3GQZ A;  4JXV A;  3G34 A;  3IXB A;  3P98 A;  5FSR A;  2EXB A;  2P9V B;  3BEC A;  4K0W A;  1XX2 A;  1MPL A;  4KG6 A;  4JF6 A;  5AQB A;  4X6T A;  4JXW A;  1M40 A;  1MY8 A;  5AQ9 A;  5EUA A;  3UPN A;  4U0X A;  5EVI B;  1YMS A;  4KZA A;  4JKT A;  1BZA A;  4JXG A;  4KQQ A;  2ZD8 A;  3E2L A;  2ZMA A;  2ZM2 A;  3C4P A;  2QZ6 A;  1JVJ A;  2J9O A;  1ZKJ A;  4ZJ2 A;  1ESI A;  4R3B A;  4X53 A;  5FI2 A;  4BQM A;  4KQO A;  3OC2 A;  4S2K A;  1FSW A;  2A3U A;  2WKI A;  4JF4 A;  4KEN B;  5CTM A;  5E2F A;  3VOY A;  5DTS A;  5CRF A;  1MWT A;  3FZC A;  4GN2 A;  3Q82 A;  5FAT A;  1RP5 A;  4KZ9 A;  3VFH A;  3MFD A;  3OPP A;  3BRM A;  2A49 A;  2ZC3 B;  3VOZ A;  5FQK A;  1BLH A;  2HDS A;  3HLB A;  4Z9Q A;  1SKF A;  2JC7 A;  4GOG A;  3W4O A;  2G2W A;  3OPL A;  1AXB A;  3CJM A;  4ZJ1 A;  4MEZ A;  4BEN A;  5DF8 A;  2HDU A;  2HP9 A;  4ZDX A;  1NXY A;  1ERO A;  5DTT A;  3WRT A;  2WGW B;  5CHM A;  4E3O A;  3SH9 A;  3VP1 A;  5GLB A;  4BL2 A;  3D4F A;  4UA6 A;  1I2W A;  1BUE A;  3O3V A;  5CER A;  4DKI A;  4PPR A;  1JWZ A;  4RA7 A;  1L0G A;  3GSG A;  3MZF A;  2OLV A;  1ONH A;  3BLM A;  4EUZ A;  1BTL A;  1PW1 A;  2BLS A;  3CMZ A;  3IHB A;  2ZC5 B;  4ZBE A;  3BFF A;  2XFT A;  2EX2 A;  3ZNT A;  1H8Z A;  4DRT A;  4EBP A;  3HUO A;  3VMA A;  3LY4 A;  2FFY A;  5AQ7 A;  2BG1 A;  1DY6 A;  5HW3 A;  1HTZ A;  2H0Y A;  2XK1 A;  1DJB A;  1GCE A;  3V50 A;  3WS0 A;  4OVD A;  3A3D A;  3SS5 A;  1RCJ A;  1PI4 A;  3O88 A;  4GZB A;  2ZQA A;  3BFG A;  2ZQD A;  4MBF A;  1Z6F A;  3Q07 A;  1FR6 A;  3WS1 A;  4E3J A;  1LHY A;  4OOY A;  3HLW A;  4F94 A;  1KE4 A;  1N4O A;  3FKV A;  3OPR A;  3C7U A;  3FV7 A;  4S2I A;  5EEC A;  3UDI A;  4B88 A;  4BL3 A;  3OZH A;  1W8Q A;  5F1F A;  2XF3 A;  5FAP A;  4O7D A;  4BD1 A;  2FFF B;  5IHV A;  3HUN A;  2HPB A;  4FCF A;  4WEL A;  4ZTK A;  1SHV A;  2R9W A;  3JYI A;  3M2J A;  3UDX A;  1ES3 A;  4N9L A;  3A3E A;  4KZ3 A;  1YLY A;  3NIA A;  1KGG A;  1IEM A;  1L0D A;  3VSK A;  1E4D A;  5FQJ A;  1YLJ A;  2JBF A;  4IBX A;  4S2J A;  5CGX A;  1I5Q A;  3G2Z A;  3PBR A;  4OLD A;  3PBT A;  2OSU A;  4PM7 A;  3Q7V A;  3P09 A;  5DF9 A;  2WGI A;  3GR2 A;  3NY4 A;  1QMF A;  2V20 A;  2WYX A;  4WBG A;  3UE1 A;  5M1A A;  5GLD A;  1IYQ A;  3UNW A;  3ZDJ A;  1TEM A;  3BM6 A;  5GL9 A;  2Y2H A;  1K6R A;  5GHX A;  1GHM A;  2J7V A;  4Q8I A;  3ZG9 B;  4C3Q A;  3IXH A;  5A91 A;  3UN7 A;  1K56 A;  2H10 A;  3AGE A;  2J9P A;  4M3K A;  5AQA A;  5FI7 A;  3ISG A;  4GD8 A;  1XPB A;  4XUZ A;  1KVL A;  2B5R A;  5CXW A;  1XKZ A;  4OPY A;  1U60 A;  1NJ4 A;  1WE4 A;  2Q9N A;  2Y2M A;  4QJG A;  1VM1 A;  2E8I A;  3HUM A;  3IWQ A;  3IT9 A;  3V3S A;  3BLS A;  4E3N A;  2WZX A;  1K4E A;  4P0M A;  3HLE A;  1TDL A;  3UPO A;  4WYY A;  2RCX A;  3PBO A;  2C6W B;  2ZQ8 A;  4U0T A;  5CEC A;  2CC1 A;  4WMC A;  5FA7 A;  1TDG A;  3TOI A;  3NI9 A;  4ZAM A;  4DE1 A;  2EFX A;  1I2S A;  1W7F A;  1XGJ A;  1HZO A;  3M6B A;  5KSC A;  1ZC2 A;  3IH9 A;  3IF5 A;  4GDB A;  3QHY A;  4MLL A;  2WK0 A;  3BFC A;  1L0E A;  4Y7P A;  2P9V A;  3SH7 A;  4KQR A;  1KE0 A;  3ZVT A;  4ID4 A;  4OQH A;  5EVI C;  2XGN A;  4N92 A;  4PM6 A;  3MKE A;  5DTK A;  3DWZ A;  5CGW A;  3O86 A;  1BLP A;  3UE3 A;  1BSG A;  5EVI A;  4DDS A;  4QY6 A;  2WKH A;  4WZ5 C;  5E43 A;  2EX8 A;  3FKW A;  4UHU A;  1MWU A;  1ERM A;  1M6K A;  4WZ5 A;  4HES A;  1LI9 A;  4D2O A;  3MZE A;  4JXS A;  4BJP A;  4EBN A;  1FSY A;  1JWV A;  2Y4A A;  2WGV A;  3Q7Z A;  4WEK A;  2IWB A;  4N9K A;  3O87 A;  2WAD A;  3LO7 A;  1NY0 A;  2Y2K A;  2ZQC A;  3I7J A;  1NYM A;  1GHI A;  3IWI A;  5FI6 A;  3HLD A;  5CED A;  3Q1F A;  5M19 A;  2XD5 A;  3W8K A;  1FQG A;  4EBL A;  4HBU A;  1PIO A;  4L0L A;  4RVA A;  3ZFZ A;  5BOH A;  3V5M A;  2DCF A;  3VP3 A;  4R4S A;  4JF5 A;  4DXC A;  2Y2P A;  1E3U A;  5M18 A;  4PM8 A;  1KDW A;  1HD8 A;  2WGW A;  3C7V A;  4B4X A;  2R9X A;  1PZO A;  5EVL A;  5HX9 A;  3SH8 A;  2QPN A;  4OPZ A;  3OCN A;  4HEF A;  1IYO A;  1XGI A;  1NZU A;  1S6R A;  1BT5 A;  2JCH A;  2Y2G A;  1K55 C;  1YLW A;  3BFD A;  4E3I A;  3IF6 B;  5FAS A;  3MXS A;  1K56 D;  3IXG A;  1K55 A;  4DDY A;  4LCM A;  2P74 A;  2V2F F;  4ZJ3 A;  3Q81 A;  3ITA A;  3FYZ A;  4IBR A;  4E6X A;  5FQM A;  4WEJ A;  1IEL A;  3WRZ A;  1C3B A;  5FQQ A;  1JTG A;  1MKI A;  2WUQ A;  3HLF A;  1FCO A;  1WYC A;  2Y55 A;  4K91 A;  4FH2 A;  4MNR A;  3GMW A;  5TFQ A;  1ES2 A;  4DXB A;  4BD0 A;  2HP5 A;  1CEF A;  4JBF A;  2C5W B;  2XEP A;  4IVI A;  3ZCZ A;  4Y0T A;  4OP5 A;  4XXR A;  4DE3 A;  3M6H A;  4R23 A;  2HP6 A;  4DF6 A;  4B4Z A;  2XLN A;  2Z2L B;  4GDN A;  4QHC A;  4IED A;  4MBH A;  4WMC D;  4C6Y A;  1PWG A;  3AGD A;  4X68 A;  2ZLY A;  2EX6 A;  2EXA A;  3M2K A;  2ZQ9 A;  3VFF A;  3ZG7 B;  4DE2 A;  4OQI A;  2ZM0 A;  4P6B A;  1PWC A;  1SDE A;  2ZC7 A;  3BYD A;  4Y0U A;  5CTN A;  1K57 C;  4QU3 A;  4KZ4 A;  2XQZ A;  4KZ8 A;  4OH0 A;  1PWD A;  1KE3 A;  4HBT A;  1K57 A;  4KZB A;  5GLC A;  2Y2I A;  1K25 A;  2Y2L A;  4JLF A;  3VP0 A;  2X02 A;  4RX3 A;  1LLB A;  1S0W A;  4QD4 A;  1PZP A;  4CPK A;  1H5X A;  1NYY A;  5CHU A;  4Y0O A;  1SCW A;  1YMX A;  4P87 A;  3RJU A;  3NDG A;  3CG5 A;  3IWO A;  4WZ4 A;  5E2H A;  3N8S A;  4GB7 A;  2QMI A;  3SS3 A;  3UPP A;  1KGE A;  4BLM A;  1CI8 A;  1H8Y A;  4X56 A;  5L2F A;  2WZZ A;  3ZVW A;  4QB8 A;  4UAA A;  4EQI A;  2WAE A;  2Y2Q A;  4PM9 A;  3MXR A;  1CI9 A;  3IXD A;  1YLT A;  4PMA A;  5HFO A;  1FR1 A;  3LY3 A;  5F1G A;  3ZGA B;  2I72 A;  3W4Q A;  5CHJ A;  3MBZ A;  1OME A;  2UWX A;  2XD1 A;  2Y2J A;  4OON A;  3G2Y A;  5HAR A;  2ZJ9 A;  3ZG0 A;  2IWC A;  4OQG A;  4EV4 A;  4OP8 A;  4GD6 A;  3PBN A;  4IVK A;  4OQ0 A;  2OLU A;  4MBK A;  1FOF A;  4S2N C;  1FCN A;  3N4I A;  4WM9 A;  3TSG A;  3UO9 A;  1JWP A;  2Y59 A;  2J8Y A;  5GHY A;  1MWS A;  3HVF A;  4S2N A;  3WWX A;  1G6A A;  2PBY A;  3EQV A;  4GNU A;  1DJC A;  2ZC4 B;  3HLG A;  5TR7 A;  4FSF A;  3HLC A;  5E2G A;  4YFM A;  4UA9 A;  3G31 A;  3OCL A;  3DTM A;  3LEZ A;  3ITB A;  4DE0 A;  5I94 A;  1ONG A;  5JYP A;  1DJA A;  1HVB A;  5TGF A;  1NRF A;  3S1Y A;  1YLZ A;  1QME A;  3DWK A;  1TVF A;  2H0T A;  2OV5 A;  3MKF A;  3A3J A;  3SOI A;  3ZG8 B;  4JPM A;  1ES5 A;  1MWR A;  1YM1 A;  3HBR A;  3NBL A;  4UA7 A;  5HAP A;  3MZD A;  1LI0 A;  5HAI A;  1XA7 A; 
#chains in the Genus database with same CATH topology
 3T1X A;  1BUL A;  1ZHH B;  3IBR A;  1K38 A;  4X69 A;  3W4P A;  3UE0 A;  1ACF A;  2XH9 A;  4N1H A;  3BFE A;  3QNC A;  4LV0 A;  4Q0H A;  2P7J A;  2PU4 A;  3G30 A;  1PNE A;  4OPQ A;  3VP2 A;  4HI4 A;  1GHP A;  1EWZ A;  4EWF A;  1D7E A;  3QNB A;  1PI5 A;  1IKI A;  5CGS A;  5JYO A;  5HSQ A;  1ERQ A;  3UDF A;  2Z2M B;  1F5M A;  2HDQ A;  3L7H A;  5HDS A;  4LV3 A;  3UB5 P;  4IJG A;  1ESU A;  1KGF A;  1UGU A;  2ZMF A;  4Z1W A;  2ZQ7 A;  2MJ6 A;  4FD8 A;  4S2P A;  2XFS A;  4S2L A;  3U4L P;  4R0Q A;  3C4O A;  3LIA A;  3FWL A;  3IHA A;  2Y8H A;  3C5A A;  4KG5 A;  3T4L A;  3GRJ A;  5F68 A;  4R6L A;  4NKP A;  2EX9 A;  2OWJ A;  4HJ6 A;  1V9Y A;  3V3R A;  1IKG A;  4R3A A;  4R70 A;  3WS4 A;  1VHM A;  5A92 A;  5EM1 A;  5HAQ A;  2Y79 A;  3FPW A;  4IUH A;  4X1L A;  3LI9 A;  3QP4 A;  1T19 A;  5HL6 A;  2X01 A;  3OPH A;  2XR0 A;  3IX3 A;  3R7W B;  1MPL A;  4JXW A;  4U0X A;  1YMS A;  1BZA A;  3E2L A;  3C4P A;  1JVJ A;  1STZ A;  3OC2 A;  5I5L A;  4S2K A;  3VOY A;  5DTS A;  3FZC A;  3Q82 A;  3MF0 A;  4KZ9 A;  3MFD A;  3OPP A;  3BRM A;  3CPT B;  1BLH A;  4WLA A;  3HLB A;  5A8B A;  2JC7 A;  3W4O A;  3A0V A;  2HV1 A;  1AWI A;  3BW6 A;  3WRT A;  3LR3 A;  4E3O A;  3NOT C;  5HD5 A;  1L0G A;  3GSG A;  3MZF A;  1ONH A;  4EUZ A;  1BTL A;  2ZC5 B;  4ZBE A;  3KX0 X;  1DP9 A;  4YWZ A;  1TD5 A;  4LPZ A;  2WKR A;  3WS0 A;  1YPR A;  4H6J A;  4GZB A;  4E3J A;  3BFG A;  2ZQD A;  3WS1 A;  1FR6 A;  4OOY A;  4GW9 A;  1KE4 A;  3PXP A;  3OPR A;  3C7U A;  4B88 A;  2XF3 A;  2NUT C;  4WEL A;  4ZTK A;  3FPV A;  3JYI A;  2R9W A;  3M2J A;  5DFX A;  1ES3 A;  3A3E A;  1KGG A;  1L0D A;  3EGX C;  4IBX A;  3CUE A;  3SW1 A;  4M4X A;  2JHE A;  3P09 A;  2KDK A;  3GR2 A;  4WBG A;  5M1A A;  2PBD P;  3UNW A;  3MQO A;  4O0P A;  3G6O A;  2ZMV A;  4C3Q A;  3CI6 A;  2H10 A;  3B47 A;  2K7S A;  2B5R A;  5CXW A;  4D60 A;  4NXE A;  3DTE A;  4QJG A;  2E8I A;  3IWQ A;  1NWZ A;  4EEP A;  1TDL A;  2VJW A;  1GSW A;  5CEC A;  3JPU A;  5DJT A;  3TOI A;  3NI9 A;  4DE1 A;  2EFX A;  1W7F A;  1XGJ A;  1HZO A;  4MLL A;  3ZQ5 A;  2WK0 A;  1L0E A;  2P9V A;  1P0Z A;  4OQH A;  4UQI M;  1YSQ A;  3MKE A;  1BLP A;  1S67 L;  4QY6 A;  1XFN A;  4UHU A;  1MWU A;  4D2O A;  5J4E A;  1FSY A;  1JWV A;  2Y4A A;  3Q7Z A;  5CED A;  1GHI A;  5FEF A;  4FOF A;  4RVA A;  3V5M A;  2DCF A;  4DXC A;  1KDW A;  3C7V A;  3FG8 A;  4OPZ A;  3OCN A;  4HEF A;  2Z6D A;  2Y2G A;  1OPX A;  2W1T A;  4E3I A;  2V8F A;  5FAS A;  1K56 D;  1P97 A;  3ITA A;  3E4O A;  1H0M A;  2XA7 S;  3S7Q A;  3WRZ A;  4MNR A;  3MQ0 A;  4FH2 A;  1F98 A;  3GMW A;  4DXB A;  3ZCZ A;  2GNX A;  4OP5 A;  4XXR A;  4DE3 A;  3OLO A;  2HP6 A;  4B4Z A;  2XLN A;  2WKQ A;  4X68 A;  2ZLY A;  2EXA A;  1N9O A;  4X1M A;  4OQI A;  2ZM0 A;  3T1Q B;  5K5B A;  2QHK A;  1OTB A;  2Y2L A;  4PHT A;  5F69 A;  1SCW A;  3RJU A;  2W1R A;  1TS0 A;  2QMI A;  2P08 A;  5G4Y A;  4BLM A;  1H8Y A;  4X56 A;  1XJ2 A;  2WZZ A;  3ZVW A;  1CI9 A;  1YLT A;  3E4P A;  3ZGA B;  1A0K A;  5HAR A;  5HPI A;  4OQG A;  4EV4 A;  3TRC A;  3PYP A;  4IVK A;  3UO9 A;  3TSG A;  1JWP A;  2Y59 A;  2J8Y A;  3HVF A;  4S2N A;  4JGP A;  3F1P A;  1LSW A;  3LYX A;  3MR0 A;  3IS2 A;  1JNU A;  2NUP C;  4LLO B;  3ITB A;  4DE0 A;  1HVB A;  1QME A;  4Q0J A;  2JKR M;  4Y5F A;  4JPM A;  1ES5 A;  4UA7 A;  1HLU P;  2QYB A;  2L1M A;  1LI0 A;  5HAI A;  3GTC A;  5AQA A;  4N1X A;  3EQU A;  3UE6 A;  3ZHH A;  1L2S A;  5FAO A;  2ZOI A;  3V39 A;  4EEU A;  5HWW A;  2W3H A;  2B02 A;  5G18 A;  5J8X A;  1ALQ A;  4KZ7 A;  5EOO A;  1O07 A;  5GHZ A;  4PKY A;  4LGW A;  1GSV A;  3K3D A;  1GA9 A;  3NCK A;  2RL3 A;  3IH8 A;  1TS7 A;  4KG2 A;  5FQ9 A;  1ZG4 A;  4CJN A;  4QY5 A;  4KUK A;  4NET A;  4Y17 A;  4OLG A;  4R3J A;  1XJ6 A;  4H8R A;  1K6S A;  3OBF A;  1Z09 A;  4H6J B;  4GLQ A;  4LCL A;  4LV1 A;  3V67 A;  1LL5 A;  1UWN X;  2VA0 A;  4KZ5 A;  1D1J A;  4U3T A;  1ZG6 A;  2GDN A;  5D3O A;  4IUK A;  3N8L A;  4X55 A;  4NK3 A;  2Y91 A;  1W79 A;  5EVI D;  3KSI A;  3T4J A;  4EU0 A;  3DW0 A;  4A5R A;  2ZOH A;  5EPH A;  5A90 A;  1D06 A;  4JGQ A;  3WS2 A;  5KMW A;  3IQA A;  5KSH A;  5DVA A;  3T50 A;  4KUO A;  5HL1 A;  3E2K A;  4E6W A;  1XXM A;  4OPR A;  1LL9 A;  1E25 A;  3ZG5 A;  3S4X A;  1KDS A;  1O7E A;  3H7W A;  1WYB A;  5EOE A;  2Y2N A;  1IYS A;  4OOM A;  3TG9 A;  2J3T D;  3LGO A;  1XJ4 A;  3G34 A;  3T4K A;  2P9V B;  3BEC A;  4K0W A;  2XRO A;  4KG6 A;  5AQB A;  5EUA A;  1M40 A;  3BJN A;  2W3G A;  4JXG A;  2M7U A;  1TS8 A;  4KQQ A;  4WL9 A;  2ZD8 A;  1T18 A;  2QZ6 A;  4X53 A;  2A3U A;  4I3I A;  4JF4 A;  5E2F A;  1MWT A;  1OTI A;  2AVX A;  1S4S A;  3F1N A;  3VFH A;  5FEG A;  2A49 A;  2ZC3 B;  2D02 A;  4NXG A;  4GOG A;  5TJJ A;  3HJI A;  1AXB A;  4BEN A;  5CX7 A;  4I3A A;  3VP1 A;  4BL2 A;  4UA6 A;  1I2W A;  1T1B A;  1JWZ A;  3MJQ A;  2PD7 A;  1VEU A;  2OLV A;  3RH8 B;  2W1T B;  2A24 A;  3IHB A;  3BFF A;  1MKM A;  2EX2 A;  2JKG A;  1LL8 A;  4EBP A;  1G5U A;  3CAX A;  5AQ7 A;  5HW3 A;  4MCW A;  2XK1 A;  1DJB A;  3SS5 A;  2IA2 A;  1RCJ A;  1CF0 A;  5HD3 A;  3P7N A;  3F1O A;  3O88 A;  1LHY A;  3HLW A;  4O01 A;  4F94 A;  4FTX A;  2JKT I;  3FKV A;  2J80 A;  1XFQ A;  3EWK A;  3FV7 A;  4S2I A;  5EEC A;  3UDI A;  5L07 A;  3OZH A;  2QWS A;  5FAP A;  4ETX A;  2FFF B;  3HUN A;  4DJ2 A;  2KLI A;  3LUQ A;  2V1B A;  1MC0 A;  1UWP X;  4KZ3 A;  4LRX C;  1YLY A;  2XA7 M;  3NIA A;  3VSK A;  3CUE C;  2O9A A;  2JBF A;  4S2J A;  5CGX A;  1I5Q A;  1K0K A;  3G2Z A;  3HJK A;  5EM0 A;  2OSU A;  3Q7V A;  3KSG A;  2WGI A;  2W0N A;  3UE1 A;  2V20 A;  2Z6C A;  1TEM A;  1H8M A;  1K6R A;  2P04 A;  2J7V A;  2M7V A;  3IXH A;  5L10 A;  3DTK A;  2VGL S;  3AGE A;  4B9O A;  5FI7 A;  3LIC A;  4GD8 A;  5G4Z A;  2HJE A;  4BWI A;  2PD8 A;  1U60 A;  3QP6 A;  2Y2M A;  1VM1 A;  3UB6 A;  3A0R A;  3BLS A;  4E3N A;  2WZX A;  4XT2 B;  3HLE A;  3UPO A;  4CQH A;  3A0S A;  2RCX A;  3PBO A;  2CC1 A;  4WMC A;  5FA7 A;  1XJ3 A;  1I2S A;  1J3W A;  5KSC A;  4GDB A;  1OTD A;  4MN7 A;  3RTY A;  3F1P B;  3BFC A;  3IS2 B;  1KE0 A;  3ZVT A;  4ID4 A;  3EEH A;  2K2N A;  2XGN A;  4N92 A;  4PM6 A;  5DTK A;  1BSG A;  5EVI A;  4DDS A;  3LEQ A;  5E43 A;  5IS1 A;  5AVE A;  1ERM A;  4WZ5 A;  2HF6 A;  3MZE A;  4G3V A;  4BJP A;  4GJ4 A;  2WGV A;  2IWB A;  3O5Y A;  2WAD A;  2EWV A;  3IWI A;  1NYM A;  1X0O A;  3Q1F A;  1WA9 A;  4NXF A;  4HBU A;  4L0L A;  3ZFZ A;  4R4S A;  2O9B A;  2Y2P A;  2WGW A;  3VE4 A;  4B4X A;  2R9X A;  5EVL A;  5HX9 A;  2QPN A;  1XGI A;  4I38 A;  1NZU A;  1S6R A;  3UB7 A;  5L09 A;  1FIK A;  3MSH A;  3TW8 A;  3RFB A;  4GHI A;  2V2F F;  4IBR A;  2H28 A;  2V1A A;  3R4K A;  5MC7 A;  3HLF A;  1IFQ A;  3VV4 A;  1CEF A;  2XEP A;  2D01 A;  3M6H A;  3D9Y A;  1PWG A;  3E0Y A;  4HH3 A;  2ZQ9 A;  1BYW A;  1VET A;  1N9L A;  2O99 A;  3KYQ A;  4P6B A;  1PWC A;  5HWV A;  5CTN A;  4CLC D;  4YNR A;  4OH0 A;  4KZB A;  4HBT A;  1K57 A;  2Y2I A;  3C30 A;  2OOL A;  4RX3 A;  1S1Z A;  4P6Z S;  2OAP 1;  1PZP A;  3GDI A;  5HPF A;  1NYY A;  5CHU A;  4Y0O A;  5AVF A;  4P87 A;  3NEC A;  3CG5 A;  3UME A;  3SS3 A;  4HIA A;  1KGE A;  3LI8 A;  3MXR A;  5HFO A;  5F1G A;  2I72 A;  5CHJ A;  2YKH A;  1OT6 A;  4OON A;  3H7W B;  1IOU A;  2IWC A;  5HZH A;  4OQ0 A;  4GD6 A;  4S2N C;  4WM9 A;  3N4I A;  3PHY A;  3NOU C;  3VOL A;  4HJ4 A;  3VE3 A;  2PBY A;  3EQV A;  4ZRR A;  4GNU A;  2GX5 A;  2ZC4 B;  4BBV A;  1V9Z A;  4FSF A;  5E2G A;  3G31 A;  5I94 A;  5JYP A;  5HWT A;  5L8M A;  3DWK A;  4G3K A;  4JGO A;  4LRY C;  2OV5 A;  3T4S A;  2VZW A;  3F1N B;  1MWR A;  3MZD A;  3N8R A;  3A3I A;  1RGZ A;  3VSL A;  3KSH A;  1PW8 A;  4EUV A;  3N6I A;  5A93 A;  2ZBB A;  3PAG A;  4L9F A;  1VEU B;  3T12 B;  3QP1 A;  2A24 B;  3RXW A;  3PAE A;  1K54 A;  2KOI A;  1EW0 A;  5IT5 A;  1XA1 A;  3D72 A;  3GVB A;  3NC8 A;  3IF6 A;  1RGY A;  3HRE A;  1XP4 A;  3RXX A;  1MXO A;  1YQS A;  5F83 A;  3F1O B;  1Q2Q A;  2QJ7 A;  3AGF A;  2G2U A;  3S7O A;  3UY6 A;  2X71 A;  3HL9 A;  4YIN A;  4Y15 A;  3S7N A;  3WS5 A;  4R4R A;  1Q2P A;  3BEB A;  3G4P A;  5FAQ A;  3NDE A;  1GA0 A;  2VGK A;  2XDM A;  3QP5 A;  4P85 A;  3Q7V B;  3JVU A;  4E3K A;  2DNS A;  1T1A A;  5DFY A;  2K31 A;  2W3F A;  2L4R A;  2Y2O A;  2ZM8 A;  4HP9 A;  3UMD A;  2EFU A;  3U2A A;  3HCY A;  2W3E A;  3G32 A;  1JTD A;  2H5S A;  3G35 A;  3UB8 A;  3CLO A;  4K0X A;  1K4F A;  1CEG A;  1PYY A;  4DN0 A;  4S2M A;  4BMW A;  4XT2 A;  2V1Z A;  3GV9 A;  4HNB A;  5EE8 A;  4JXV A;  5AJG A;  3LR5 A;  2JN7 A;  3UPN A;  1DP8 A;  1MY8 A;  5EVI B;  4KZA A;  1P9W A;  3H82 A;  2ZM2 A;  1ZKJ A;  1ESI A;  4R3B A;  2WKI A;  4KEN B;  4ARZ A;  3DAV A;  2UV0 E;  4GN2 A;  3D3O A;  1RP5 A;  4DJ3 A;  3VOZ A;  4Z9Q A;  3OPL A;  3CJM A;  3T4O A;  5DF8 A;  2HDU A;  2HP9 A;  1ERO A;  5DTT A;  2WGW B;  3SH9 A;  5GLB A;  1DRM A;  3O3V A;  4PPR A;  4R38 A;  3BLM A;  1PW1 A;  3H9W A;  2FH5 A;  2BLS A;  3CMZ A;  1YAX A;  1G6O A;  2EA9 A;  5F5Y A;  4GHI B;  2XFT A;  1H8Z A;  4DRT A;  3HUO A;  3LY4 A;  2FFY A;  1DY6 A;  4MMN A;  1HTZ A;  2H0Y A;  4WUJ A;  4ESP A;  4Y2F A;  3V50 A;  4OVD A;  3A3D A;  3UB9 A;  3L9K A;  1PI4 A;  5FDS A;  4MBF A;  4Y13 A;  1SZV A;  2BAS A;  2PT7 A;  1N4O A;  3C8C A;  3CHW P;  2ZL1 A;  2YKF A;  5EFW A;  4BL3 A;  1W8Q A;  5F1F A;  1L3L A;  4O7D A;  4BD1 A;  5IHV A;  4EQ1 A;  1CQA A;  1VET B;  1SHV A;  1YLJ A;  1OT9 A;  3PBR A;  3PBT A;  4PM7 A;  3NY4 A;  1QMF A;  2WYX A;  1IYQ A;  2Y2H A;  1GHM A;  4BBU A;  2Q0O A;  5A91 A;  3UN7 A;  1K56 A;  3EOI A;  4HY8 A;  4M3K A;  3BY9 A;  3ISG A;  1XPB A;  4XUZ A;  1XKZ A;  4G3W A;  4BBT A;  2L0W A;  4DMZ A;  4OPY A;  1NJ4 A;  3HUM A;  3IBJ A;  4P0M A;  1OJG A;  4UQI S;  1ODV A;  3NUL A;  1TDG A;  2PR5 A;  5TBM A;  3IF5 A;  1TF1 A;  4Y7P A;  4QWO A;  4KQR A;  5EVI C;  5CGW A;  3O86 A;  4IHQ A;  4WZ5 C;  2EX8 A;  2QJ5 A;  3FKW A;  1M6K A;  4HES A;  1LI9 A;  1KOU A;  3TE8 A;  4JXS A;  3IX8 A;  4EBN A;  4N9K A;  3LO7 A;  3ZYT A;  2B18 A;  1NY0 A;  4NXB A;  2JKT M;  4ETZ A;  2XD5 A;  1FQG A;  2VKS A;  1PIO A;  2VX8 A;  3LR0 A;  5BOH A;  4JF5 A;  3KYE A;  3MXQ A;  3SH8 A;  4WN5 A;  3LR4 A;  2JCH A;  3IF6 B;  2GZA A;  2INW A;  3MXS A;  3IXG A;  1K55 A;  2J3T C;  3Q81 A;  4E6X A;  2M1C A;  5FQQ A;  1JTG A;  1FCO A;  1WYC A;  1ES2 A;  1PFL A;  2HP5 A;  4IVI A;  4Y0T A;  4DF6 A;  4GDN A;  2Z2L B;  4C6Y A;  4IED A;  4MBH A;  3QP2 A;  3ULF A;  3M2K A;  3VFF A;  3T1R A;  4HHD A;  1SDE A;  2ZC7 A;  4Y0U A;  1K57 C;  1YSP A;  5DKK A;  1PWD A;  1KE3 A;  4JLF A;  2X02 A;  1LLB A;  1S0W A;  1H5X A;  1YMX A;  3NDG A;  5FL3 A;  3IWO A;  4WZ4 A;  5E2H A;  4NG2 A;  4GB7 A;  1OJ5 A;  2E8J A;  1CI8 A;  2PDR A;  4QB8 A;  4UAA A;  2J3W A;  3IXD A;  3LY3 A;  3W4Q A;  4EER A;  3BQ8 A;  3MBZ A;  4X25 A;  5J3W A;  3ZG0 A;  1OTA A;  4OP8 A;  2OLU A;  4GS9 A;  1FOF A;  1FCN A;  1OTE A;  3E98 A;  1MWS A;  5J7E A;  4QPR A;  1G6A A;  3IX4 A;  1LT0 A;  4F3L A;  5IU1 A;  3S7P A;  1PRQ A;  3C2W A;  5TR7 A;  3CIT A;  3HLC A;  4UA9 A;  3BWL A;  3OCL A;  3DTM A;  3LEZ A;  4CLC B;  3H82 B;  1DJA A;  4EW7 A;  5TGF A;  1NRF A;  3S1Y A;  1YLZ A;  2PYR A;  5DKL A;  4ARZ B;  1TVF A;  3MKF A;  4L9E A;  1GSX A;  3CWF A;  4AFI A;  1F9I A;  4CPK A;  4MN6 A;  3SS4 A;  1CK3 A;  2V8C A;  5F82 A;  4KZ6 A;  2O0Y A;  4R1G A;  3NJA A;  1W5D A;  3LCE A;  4RX2 A;  5FDH A;  1Y54 A;  4NEE D;  1K54 C;  3KYZ A;  3N7W A;  3IF6 C;  2DMW A;  2VEA A;  2DRW A;  3PBS A;  5KZH A;  1N9N A;  2Q9M A;  1ES4 A;  4XUX A;  2WKE A;  5DJU A;  3LIB A;  4MN5 A;  1IYP A;  1VQQ A;  2CMN A;  1W8Y A;  5LBR A;  5DF7 A;  2V9A A;  2ZL1 B;  4GKU A;  1N9B A;  3T4T A;  3PBQ A;  2B95 A;  1W63 Q;  5U47 A;  3C38 A;  4I3J A;  3S22 A;  2PRF A;  4OOL A;  5CEB A;  1G68 A;  4S2O A;  3PTE A;  5GLA A;  3A3F A;  3GEC A;  4MDZ A;  4ME4 A;  1L0F A;  4E3L A;  5EVE A;  4JGR A;  2HDR A;  2PU2 A;  4LV2 A;  4OKP A;  3EGD C;  4PAU A;  2OWH A;  3SZT A;  4WF0 A;  1J9M A;  4E3M A;  2V0W A;  1NZO A;  2BTF P;  1KVM A;  1YT4 A;  2XSS A;  1MBL A;  2IWD A;  3ZNY A;  3CZD A;  4FH4 A;  1FCM A;  2JE5 A;  5E2E A;  4II7 A;  4RYE A;  3VP4 A;  2WAF A;  1E3U D;  1YLP A;  2VV6 A;  5KIZ A;  4LEN A;  3MMH A;  1BLC A;  1EI5 A;  4C75 A;  4HJ3 A;  4PM5 A;  2ZC6 B;  2VK3 A;  1BLS A;  1SDN A;  1Y28 A;  3BQA A;  5FQI A;  2VGJ A;  4B93 A;  3B3X A;  3ICY A;  5TBM B;  3GQZ A;  3IXB A;  3P98 A;  5FSR A;  2EXB A;  1XX2 A;  4JF6 A;  4X6T A;  5AQ9 A;  3W2Z A;  4JKT A;  3DBA A;  4CLC C;  3NOP C;  4K08 A;  2ZMA A;  4PKY G;  2J9O A;  1DP6 A;  3LFV A;  5FI2 A;  4ZJ2 A;  4BQM A;  1NLY A;  2VV7 A;  4KQO A;  1FSW A;  5CTM A;  4E04 A;  5CRF A;  2G7U A;  5FAT A;  2FZ0 A;  1SKO A;  2PAV P;  5FQK A;  2HDS A;  3DTI A;  4KQD A;  1SKF A;  4HP4 A;  2G2W A;  4ZJ1 A;  4HOI A;  4MEZ A;  2W27 A;  3LIE A;  4ZDX A;  1NXY A;  5CHM A;  3D4F A;  1BUE A;  2A2L A;  5CER A;  3KO6 A;  4DKI A;  1VB6 A;  4RA7 A;  1S1Y A;  3LIF A;  5C5K A;  2R78 A;  4YOF A;  2HJ9 C;  3TJZ C;  3K2N A;  4I5S A;  4L9G A;  2PR6 A;  4LRZ E;  3ZNT A;  3MFX A;  3VMA A;  5HDD A;  2BG1 A;  1GCE A;  1ZTU A;  4EET B;  2ZQA A;  3E4Q A;  1Z6F A;  3Q07 A;  2QKP A;  2HPB A;  2LB5 A;  4I39 A;  4FCF A;  3UDX A;  4N9L A;  1IEM A;  3LID A;  1E4D A;  5FQJ A;  4HH2 A;  4OLD A;  5DF9 A;  5GLD A;  3ZDJ A;  3BM6 A;  5GL9 A;  5EV0 A;  5GHX A;  4Q8I A;  3ZG9 B;  4CLC E;  2J9P A;  1F2K A;  1KVL A;  2WKP A;  4Y3I A;  2I9V A;  3QP8 A;  1WE4 A;  2Q9N A;  1H3Q A;  3IT9 A;  3V3S A;  2VV8 A;  4Q0I A;  1K4E A;  2VGL M;  1G28 A;  1CJF A;  2O9C A;  4WYY A;  3P01 A;  2LB9 A;  4GS9 B;  2C6W B;  2ZQ8 A;  4U0T A;  2KX6 A;  4ZAM A;  3MQQ A;  3M6B A;  1FIL A;  4F3L B;  1ZC2 A;  3IH9 A;  3QHY A;  3R7W A;  3SH7 A;  4CLC A;  3DWZ A;  3UE3 A;  2EWW A;  3OOV A;  2W3D A;  2WKH A;  2ACG A;  1NLZ A;  4WEK A;  2HGV A;  3O87 A;  2Y2K A;  2ZQC A;  3I7J A;  5FI6 A;  3HLD A;  3CPT A;  5M19 A;  3W8K A;  4EBL A;  1S66 L;  3EEA A;  3VP3 A;  1E3U A;  5M18 A;  4PM8 A;  1HD8 A;  1PZO A;  3B33 A;  3K3C A;  3NHQ A;  1IYO A;  3T4Q A;  5F6A A;  1BT5 A;  4HQA A;  1K55 C;  1YLW A;  3BFD A;  4DDY A;  4LCM A;  2P74 A;  4ZJ3 A;  3FYZ A;  1T1C A;  5FQM A;  4WEJ A;  1IEL A;  2JKR I;  1C3B A;  1TS6 A;  4FUW A;  1MKI A;  2WUQ A;  4O8G A;  4K91 A;  2Y55 A;  5HDC A;  5TFQ A;  4BD0 A;  4JBF A;  1MZU A;  2C5W B;  3MS6 A;  4R23 A;  1NRJ A;  4EXO A;  3JVV A;  4QHC A;  4WMC D;  3AGD A;  2EX6 A;  1LSX A;  3ZG7 B;  4DE2 A;  1YKD A;  3BYD A;  2XRN A;  4QU3 A;  4KZ4 A;  2XQZ A;  2OAQ 1;  4KZ8 A;  5GLC A;  3VP0 A;  1K25 A;  4QD4 A;  1P9R A;  4EES A;  3T1S A;  2PHY A;  3PR6 A;  2VLG A;  3N8S A;  3FC7 A;  3UPP A;  5L2F A;  1Y4O A;  4EQI A;  2WAE A;  2Y2Q A;  4PM9 A;  4P6Z M;  4PMA A;  1FR1 A;  2JKF A;  4GCZ A;  1OME A;  2UWX A;  2XD1 A;  2Y2J A;  3G2Y A;  2HZ5 A;  1LSV A;  2ZJ9 A;  3BY8 A;  3PBN A;  4MBK A;  5GHY A;  3WWX A;  1DJC A;  3HLG A;  4LFU A;  3B42 A;  4YFM A;  1ONG A;  4UEY A;  4RQ9 A;  1W63 M;  2V0U A;  2GJ3 A;  2H0T A;  3A3J A;  3SOI A;  3ZG8 B;  1YM1 A;  3NBL A;  3HBR A;  1S4R A;  1SKO B;  5HAP A;  3KSF A;  2PYP A;  1XA7 A; 
#chains in the Genus database with same CATH homology
 4N1X A;  3EQU A;  3ZHH A;  1BUL A;  3N8R A;  1CK3 A;  1L2S A;  3A3I A;  5FAO A;  3SS4 A;  3V39 A;  1K38 A;  4X69 A;  1RGZ A;  5F82 A;  3VSL A;  3UE0 A;  3W4P A;  1PW8 A;  4KZ6 A;  5G18 A;  5J8X A;  4R1G A;  2XH9 A;  1ALQ A;  1W5D A;  3N6I A;  4KZ7 A;  5EOO A;  3LCE A;  5A93 A;  3PAG A;  1O07 A;  5GHZ A;  4RX2 A;  5FDH A;  1Y54 A;  4N1H A;  3BFE A;  3QNC A;  4LV0 A;  1K54 C;  2PU4 A;  3G30 A;  3RXW A;  3N7W A;  1GA9 A;  3NCK A;  3PAE A;  1K54 A;  2RL3 A;  3IF6 C;  3IH8 A;  4KG2 A;  4OPQ A;  1ZG4 A;  5FQ9 A;  1GHP A;  1XA1 A;  3VP2 A;  4CJN A;  3GVB A;  2DRW A;  1EWZ A;  3NC8 A;  3PBS A;  4QY5 A;  3IF6 A;  4NET A;  5KZH A;  1RGY A;  3HRE A;  4EWF A;  2Q9M A;  1XP4 A;  1ES4 A;  4XUX A;  4OLG A;  2WKE A;  4R3J A;  4H8R A;  3RXX A;  3QNB A;  1PI5 A;  1K6S A;  1MXO A;  1IKI A;  1YQS A;  5CGS A;  5F83 A;  5JYO A;  1IYP A;  1ERQ A;  1Q2Q A;  1VQQ A;  3AGF A;  1W8Y A;  3UDF A;  2G2U A;  5DF7 A;  2Z2M B;  4GKU A;  2HDQ A;  3UY6 A;  1N9B A;  4LCL A;  4LV1 A;  3PBQ A;  2X71 A;  4LV3 A;  1LL5 A;  1ESU A;  1KGF A;  3HL9 A;  4YIN A;  4KZ5 A;  5U47 A;  3WS5 A;  4R4R A;  4U3T A;  2ZQ7 A;  1ZG6 A;  2GDN A;  3S22 A;  1Q2P A;  4OOL A;  4FD8 A;  4S2P A;  5D3O A;  5CEB A;  3BEB A;  2XFS A;  3G4P A;  3N8L A;  4X55 A;  4NK3 A;  1G68 A;  2Y91 A;  4S2L A;  4S2O A;  1W79 A;  3PTE A;  5FAQ A;  5EVI D;  5GLA A;  3NDE A;  1GA0 A;  3A3F A;  2VGK A;  3DW0 A;  4R0Q A;  3C4O A;  2XDM A;  3GTC A;  3FWL A;  1L0F A;  4A5R A;  4E3L A;  4P85 A;  3Q7V B;  5A90 A;  5EPH A;  4E3K A;  2DNS A;  2HDR A;  2PU2 A;  3WS2 A;  4LV2 A;  4OKP A;  2Y2O A;  3IHA A;  3C5A A;  4KG5 A;  5KMW A;  3GRJ A;  2ZM8 A;  1J9M A;  4E3M A;  3IQA A;  2EFU A;  1NZO A;  2EX9 A;  5KSH A;  3V3R A;  5DVA A;  1KVM A;  1YT4 A;  1MBL A;  1JTD A;  3G32 A;  5HL1 A;  2H5S A;  1IKG A;  2IWD A;  3ZNY A;  3CZD A;  3G35 A;  4FH4 A;  1FCM A;  2JE5 A;  3E2K A;  4K0X A;  4RYE A;  5E2E A;  2WAF A;  1E3U D;  3VP4 A;  3WS4 A;  4E6W A;  1XXM A;  5A92 A;  1K4F A;  4OPR A;  1CEG A;  1LL9 A;  1YLP A;  1PYY A;  4LEN A;  4S2M A;  1E25 A;  5HAQ A;  1BLC A;  1EI5 A;  3ZG5 A;  2V1Z A;  3S4X A;  3GV9 A;  1KDS A;  1O7E A;  4C75 A;  4PM5 A;  2ZC6 B;  1BLS A;  1WYB A;  5EOE A;  2X01 A;  1SDN A;  2Y2N A;  1IYS A;  4OOM A;  5FQI A;  3OPH A;  3TG9 A;  2VGJ A;  3B3X A;  2XR0 A;  5EE8 A;  3GQZ A;  4JXV A;  3G34 A;  3IXB A;  3P98 A;  5FSR A;  2EXB A;  2P9V B;  3BEC A;  4K0W A;  1XX2 A;  1MPL A;  4KG6 A;  4JF6 A;  5AQB A;  4X6T A;  4JXW A;  1M40 A;  1MY8 A;  5AQ9 A;  5EUA A;  3UPN A;  4U0X A;  5EVI B;  1YMS A;  4KZA A;  4JKT A;  1BZA A;  4JXG A;  4KQQ A;  2ZD8 A;  3E2L A;  2ZMA A;  2ZM2 A;  3C4P A;  2QZ6 A;  1JVJ A;  2J9O A;  1ZKJ A;  4ZJ2 A;  1ESI A;  4R3B A;  4X53 A;  5FI2 A;  4BQM A;  4KQO A;  3OC2 A;  4S2K A;  1FSW A;  2A3U A;  2WKI A;  4JF4 A;  4KEN B;  5CTM A;  5E2F A;  3VOY A;  5DTS A;  5CRF A;  1MWT A;  3FZC A;  4GN2 A;  3Q82 A;  5FAT A;  1RP5 A;  4KZ9 A;  3VFH A;  3MFD A;  3OPP A;  3BRM A;  2A49 A;  2ZC3 B;  3VOZ A;  5FQK A;  1BLH A;  2HDS A;  3HLB A;  4Z9Q A;  1SKF A;  2JC7 A;  4GOG A;  3W4O A;  2G2W A;  3OPL A;  1AXB A;  3CJM A;  4ZJ1 A;  4MEZ A;  4BEN A;  5DF8 A;  2HDU A;  2HP9 A;  4ZDX A;  1NXY A;  1ERO A;  5DTT A;  3WRT A;  2WGW B;  5CHM A;  4E3O A;  3SH9 A;  3VP1 A;  5GLB A;  4BL2 A;  3D4F A;  4UA6 A;  1I2W A;  1BUE A;  3O3V A;  5CER A;  4DKI A;  4PPR A;  1JWZ A;  4RA7 A;  1L0G A;  3GSG A;  3MZF A;  2OLV A;  1ONH A;  3BLM A;  4EUZ A;  1BTL A;  1PW1 A;  2BLS A;  3CMZ A;  3IHB A;  2ZC5 B;  4ZBE A;  3BFF A;  2XFT A;  2EX2 A;  3ZNT A;  1H8Z A;  4DRT A;  4EBP A;  3HUO A;  3VMA A;  3LY4 A;  2FFY A;  5AQ7 A;  2BG1 A;  1DY6 A;  5HW3 A;  1HTZ A;  2H0Y A;  2XK1 A;  1DJB A;  1GCE A;  3V50 A;  3WS0 A;  4OVD A;  3A3D A;  3SS5 A;  1RCJ A;  1PI4 A;  3O88 A;  4GZB A;  2ZQA A;  3BFG A;  2ZQD A;  4MBF A;  1Z6F A;  3Q07 A;  1FR6 A;  3WS1 A;  4E3J A;  1LHY A;  4OOY A;  3HLW A;  4F94 A;  1KE4 A;  1N4O A;  3FKV A;  3OPR A;  3C7U A;  3FV7 A;  4S2I A;  5EEC A;  3UDI A;  4B88 A;  4BL3 A;  3OZH A;  1W8Q A;  5F1F A;  2XF3 A;  5FAP A;  4O7D A;  4BD1 A;  2FFF B;  5IHV A;  3HUN A;  2HPB A;  4FCF A;  4WEL A;  4ZTK A;  1SHV A;  2R9W A;  3JYI A;  3M2J A;  3UDX A;  1ES3 A;  4N9L A;  3A3E A;  4KZ3 A;  1YLY A;  3NIA A;  1KGG A;  1IEM A;  1L0D A;  3VSK A;  1E4D A;  5FQJ A;  1YLJ A;  2JBF A;  4IBX A;  4S2J A;  5CGX A;  1I5Q A;  3G2Z A;  3PBR A;  4OLD A;  3PBT A;  2OSU A;  4PM7 A;  3Q7V A;  3P09 A;  5DF9 A;  2WGI A;  3GR2 A;  3NY4 A;  1QMF A;  2V20 A;  2WYX A;  4WBG A;  3UE1 A;  5M1A A;  5GLD A;  1IYQ A;  3UNW A;  3ZDJ A;  1TEM A;  3BM6 A;  5GL9 A;  2Y2H A;  1K6R A;  5GHX A;  1GHM A;  2J7V A;  4Q8I A;  3ZG9 B;  4C3Q A;  3IXH A;  5A91 A;  3UN7 A;  1K56 A;  2H10 A;  3AGE A;  2J9P A;  4M3K A;  5AQA A;  5FI7 A;  3ISG A;  4GD8 A;  1XPB A;  4XUZ A;  1KVL A;  2B5R A;  5CXW A;  1XKZ A;  4OPY A;  1U60 A;  1NJ4 A;  1WE4 A;  2Q9N A;  2Y2M A;  4QJG A;  1VM1 A;  2E8I A;  3HUM A;  3IWQ A;  3IT9 A;  3V3S A;  3BLS A;  4E3N A;  2WZX A;  1K4E A;  4P0M A;  3HLE A;  1TDL A;  3UPO A;  4WYY A;  2RCX A;  3PBO A;  2C6W B;  2ZQ8 A;  4U0T A;  5CEC A;  2CC1 A;  4WMC A;  5FA7 A;  1TDG A;  3TOI A;  3NI9 A;  4ZAM A;  4DE1 A;  2EFX A;  1I2S A;  1W7F A;  1XGJ A;  1HZO A;  3M6B A;  5KSC A;  1ZC2 A;  3IH9 A;  3IF5 A;  4GDB A;  3QHY A;  4MLL A;  2WK0 A;  3BFC A;  1L0E A;  4Y7P A;  2P9V A;  3SH7 A;  4KQR A;  1KE0 A;  3ZVT A;  4ID4 A;  4OQH A;  5EVI C;  2XGN A;  4N92 A;  4PM6 A;  3MKE A;  5DTK A;  3DWZ A;  5CGW A;  3O86 A;  1BLP A;  3UE3 A;  1BSG A;  5EVI A;  4DDS A;  4QY6 A;  2WKH A;  4WZ5 C;  5E43 A;  2EX8 A;  3FKW A;  4UHU A;  1MWU A;  1ERM A;  1M6K A;  4WZ5 A;  4HES A;  1LI9 A;  4D2O A;  3MZE A;  4JXS A;  4BJP A;  4EBN A;  1FSY A;  1JWV A;  2Y4A A;  2WGV A;  3Q7Z A;  4WEK A;  2IWB A;  4N9K A;  3O87 A;  2WAD A;  3LO7 A;  1NY0 A;  2Y2K A;  2ZQC A;  3I7J A;  1NYM A;  1GHI A;  3IWI A;  5FI6 A;  3HLD A;  5CED A;  3Q1F A;  5M19 A;  2XD5 A;  3W8K A;  1FQG A;  4EBL A;  4HBU A;  1PIO A;  4L0L A;  4RVA A;  3ZFZ A;  5BOH A;  3V5M A;  2DCF A;  3VP3 A;  4R4S A;  4JF5 A;  4DXC A;  2Y2P A;  1E3U A;  5M18 A;  4PM8 A;  1KDW A;  1HD8 A;  2WGW A;  3C7V A;  4B4X A;  2R9X A;  1PZO A;  5EVL A;  5HX9 A;  3SH8 A;  2QPN A;  4OPZ A;  3OCN A;  4HEF A;  1IYO A;  1XGI A;  1NZU A;  1S6R A;  1BT5 A;  2JCH A;  2Y2G A;  1K55 C;  1YLW A;  3BFD A;  4E3I A;  3IF6 B;  5FAS A;  3MXS A;  1K56 D;  3IXG A;  1K55 A;  4DDY A;  4LCM A;  2P74 A;  2V2F F;  4ZJ3 A;  3Q81 A;  3ITA A;  3FYZ A;  4IBR A;  4E6X A;  5FQM A;  4WEJ A;  1IEL A;  3WRZ A;  1C3B A;  5FQQ A;  1JTG A;  1MKI A;  2WUQ A;  3HLF A;  1FCO A;  1WYC A;  2Y55 A;  4K91 A;  4FH2 A;  4MNR A;  3GMW A;  5TFQ A;  1ES2 A;  4DXB A;  4BD0 A;  2HP5 A;  1CEF A;  4JBF A;  2C5W B;  2XEP A;  4IVI A;  3ZCZ A;  4Y0T A;  4OP5 A;  4XXR A;  4DE3 A;  3M6H A;  4R23 A;  2HP6 A;  4DF6 A;  4B4Z A;  2XLN A;  2Z2L B;  4GDN A;  4QHC A;  4IED A;  4MBH A;  4WMC D;  4C6Y A;  1PWG A;  3AGD A;  4X68 A;  2ZLY A;  2EX6 A;  2EXA A;  3M2K A;  2ZQ9 A;  3VFF A;  3ZG7 B;  4DE2 A;  4OQI A;  2ZM0 A;  4P6B A;  1PWC A;  1SDE A;  2ZC7 A;  3BYD A;  4Y0U A;  5CTN A;  1K57 C;  4QU3 A;  4KZ4 A;  2XQZ A;  4KZ8 A;  4OH0 A;  1PWD A;  1KE3 A;  4HBT A;  1K57 A;  4KZB A;  5GLC A;  2Y2I A;  1K25 A;  2Y2L A;  4JLF A;  3VP0 A;  2X02 A;  4RX3 A;  1LLB A;  1S0W A;  4QD4 A;  1PZP A;  4CPK A;  1H5X A;  1NYY A;  5CHU A;  4Y0O A;  1SCW A;  1YMX A;  4P87 A;  3RJU A;  3NDG A;  3CG5 A;  3IWO A;  4WZ4 A;  5E2H A;  3N8S A;  4GB7 A;  2QMI A;  3SS3 A;  3UPP A;  1KGE A;  4BLM A;  1CI8 A;  1H8Y A;  4X56 A;  5L2F A;  2WZZ A;  3ZVW A;  4QB8 A;  4UAA A;  4EQI A;  2WAE A;  2Y2Q A;  4PM9 A;  3MXR A;  1CI9 A;  3IXD A;  1YLT A;  4PMA A;  5HFO A;  1FR1 A;  3LY3 A;  5F1G A;  3ZGA B;  2I72 A;  3W4Q A;  5CHJ A;  3MBZ A;  1OME A;  2UWX A;  2XD1 A;  2Y2J A;  4OON A;  3G2Y A;  5HAR A;  2ZJ9 A;  3ZG0 A;  2IWC A;  4OQG A;  4EV4 A;  4OP8 A;  4GD6 A;  3PBN A;  4IVK A;  4OQ0 A;  2OLU A;  4MBK A;  1FOF A;  4S2N C;  1FCN A;  3N4I A;  4WM9 A;  3TSG A;  3UO9 A;  1JWP A;  2Y59 A;  2J8Y A;  5GHY A;  1MWS A;  3HVF A;  4S2N A;  3WWX A;  1G6A A;  2PBY A;  3EQV A;  4GNU A;  1DJC A;  2ZC4 B;  3HLG A;  5TR7 A;  4FSF A;  3HLC A;  5E2G A;  4YFM A;  4UA9 A;  3G31 A;  3OCL A;  3DTM A;  3LEZ A;  3ITB A;  4DE0 A;  5I94 A;  1ONG A;  5JYP A;  1DJA A;  1HVB A;  5TGF A;  1NRF A;  3S1Y A;  1YLZ A;  1QME A;  3DWK A;  1TVF A;  2H0T A;  2OV5 A;  3MKF A;  3A3J A;  3SOI A;  3ZG8 B;  4JPM A;  1ES5 A;  1MWR A;  1YM1 A;  3HBR A;  3NBL A;  4UA7 A;  5HAP A;  3MZD A;  1LI0 A;  5HAI A;  1XA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...