3TRCA

Structure of the gaf domain from a phosphoenolpyruvate-protein phosphotransferase (ptsp) from coxiella burnetii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
168
structure length
168
Chain Sequence
SNAMNMLKILRQITQEVNAAPNLEQALKLVVVRLCEALPADACSLFICDDVHGEYVLMATQGLNSKQVGKLRLKFGEGLIGLVGEREEPINLADAPLHPAYKHRPELGEEDYHGFLGIPIIEQGELLGILVIQQLESHHFAEEEEAFCVTLAIHLAAEIAHARAKGAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase
total genus 47
structure length 168
sequence length 168
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3trcA00
2Y8HA 4R6LA 3ZQ5A 4IUKA 5AJGA 2G7UA 4MCWA 4G3KA 5DFXA 2M7VA 4LRYC 5HL6A 4Y3IA 3RFBA 4IUHA 5DFYA 4DN0A 4EUVA 2XSSA 3W2ZA 4MMNA 3S7QA 3LFVA 4GLQA 5TJJA 3S7OA 2M7UA 3NOPC 3HCYA 4LRZE 4GW9A 2Y79A 4O01A 4ETZA 3D3OA 4BWIA 2B18A 3OBFA 3E98A 4PAUA 1STZA 5K5BA 4YNRA 3MQ0A 4ZRRA 4G3VA 3E0YA 3S7NA 2O9CA 2VEAA 5HSQA 2XRNA 4Q0JA 5LBRA 2W3FA 3K2NA 1TD5A 4E04A 1VHMA 2W1TB 2W3DA 4RQ9A 3VV4A 3KSIA 3CI6A 2W1TA 3KSFA 3NOUC 4ETXA 4LRXC 5HPIA 4MN7A 2W3GA 4YOFA 2IA2A 2O9BA 3OOVA 2W1RA 4EU0A 4DMZA 4O0PA 4O8GA 4G3WA 1YSQA 3TRCA 2VJWA 4MDZA 3C2WA 4Q0HA 2HGVA 1F5MA 3EEAA 3NOTC 3O5YA 3MF0A 3MMHA 2QYBA 4R70A 3CITA 3G6OA 5I5LA 2O9AA 4FOFA 1TF1A 4Y5FA 3IBRA 2K2NA 2LB5A 4Y2FA 4ME4A 3NHQA 2XROA 2W3EA 1YKDA 2GX5A 2O99A 4Z1WA 5L8MA 3DBAA 2ZMFA 2W3HA 1MKMA 2K31A 2KLIA 3KO6A 3IBJA 3KSGA 5HPFA 3R4KA 2O0YA 3S7PA 4QPRA 2VZWA 2VKSA 2LB9A 3KSHA 2OOLA 1YSPA 4Q0IA 5C5KA 4CQHA 1MC0A 1ZTUA 4IJGA 2KOIA 3BJNA
chains in the Genus database with same CATH superfamily
1K38A 3IHAA 3UN7A 2ZM2A 4GJ4A 1TS0A 3M2KA 3VP3A 2ZC4B 4B88A 3E4PA 3FZCA 4GLQA 5J8XA 3ZGAB 4GN2A 5A8BA 3C5AA 4OOYA 4Y17A 5EVIA 4EERA 1SKOA 3VP0A 2Y2GA 3ZFZA 3D3OA 2HDQA 3G31A 5M18A 2J8YA 3ZDJA 3T1SA 2OAQ1 5HSQA 4Q0JA 4QY5A 3VOZA 1MY8A 4NKPA 4E04A 1VETA 4MN5A 2WK0A 1ACFA 4XT2B 3D4FA 1L2SA 3IWOA 3AGFA 3P98A 5HWTA 3GV9A 3C2WA 4DE3A 3NDEA 3NJAA 5F5YA 3V39A 2OLVA 4Q8IA 5CXWA 3HLEA 1JTGA 4WMCD 1ERQA 4WZ4A 2V1ZA 3E4QA 4HBUA 5EOOA 4M4XA 4JLFA 1CI9A 4X55A 2WADA 5TR7A 2P9VB 2ZL1A 1BLPA 1SZVA 2ZM0A 5F1GA 1PZOA 3UB7A 3KX0X 2ZBBA 4A5RA 3BW6A 1TVFA 1PWCA 4IJGA 4BJPA 1NZOA 1UWNX 4DRTA 1SDEA 3A0SA 3NCKA 5GLCA 3FV7A 4LRYC 5DKKA 1EWZA 4IUHA 4RX2A 4KG5A 4KZ8A 1K56A 2EFUA 4GD8A 3NOPC 1CQAA 1S66L 4HJ4A 3UE1A 5IHVA 3CLOA 1EI5A 2JHEA 4EESA 2J9PA 4UQIM 3R7WA 3PR6A 2GJ3A 4IVIA 4GDBA 3BWLA 2GZAA 3NDGA 1F9IA 1TD5A 5I94A 1IELA 1DP6A 1NJ4A 4JGOA 4Y13A 3ZVWA 5CGWA 4ETXA 5HPIA 3W8KA 1I2WA 1PW8A 4I5SA 3OOVA 5EVLA 1LSXA 3B3XA 3ICYA 2WKRA 3EGDC 1IFQA 1XKZA 4KZ4A 2D02A 2JKTM 3CITA 3VFHA 1DRMA 4U0XA 4OLDA 1OT9A 4EUZA 3BFEA 3PAGA 3PXPA 4P6BA 1OTEA 2W3EA 1NLZA 3DBAA 1M6KA 1MKMA 4EQ1A 1H3QA 2PYRA 3U4LP 3KSGA 2Z6DA 5AQ7A 3S7PA 5JYOA 1IEMA 3MFDA 3FWLA 3N7WA 4KZ7A 2HZ5A 4JXGA 1H8MA 3S1YA 3SH7A 1YPRA 3Q1FA 3RH8B 4F3LA 3M6BA 4N9LA 1MWTA 3UB9A 1HVBA 5EVID 3P01A 1ESIA 4AFIA 3BFDA 4NXBA 1XPBA 4KZ6A 2B02A 2HP5A 4PM7A 3MJQA 2JKFA 3HCYA 1YLJA 4E6XA 5FATA 3AGDA 3C4OA 2OAP1 1XA7A 3BY9A 2XDMA 3SS3A 4QU3A 1AXBA 4Y0TA 5E2HA 3E2LA 3LR3A 4GHIB 1DJBA 3OLOA 5CTMA 3Q81A 1OTBA 1PIOA 1PZPA 3LR0A 1P97A 1DP9A 2FFYA 1NRFA 2XA7S 1PNEA 3DTIA 4WLAA 3BY8A 2JBFA 5U47A 1KDWA 4ZJ2A 3A3FA 5AQBA 1F2KA 3UMDA 4JXVA 4Q0HA 4WZ5A 4IBXA 3QP6A 1VQQA 4KUKA 3MS6A 3G6OA 4KZBA 2VGLS 2YKHA 4PKYA 4FOFA 3IF6B 2I9VA 2UV0E 5HWWA 4Y2FA 1JVJA 2ZLYA 1YKDA 1NWZA 4CPKA 5GLDA 2L1MA 3GMWA 1XJ3A 3F1PB 1KVLA 3T1RA 3LY3A 2VKSA 4DXBA 1BULA 2JKRI 4E3LA 3ZNTA 4R0QA 4K0WA 2EX6A 4BBTA 4M3KA 4KQDA 2R78A 5CX7A 4LV0A 3OZHA 4KZ9A 4U3TA 2XQZA 2FH5A 3VOLA 2XSSA 4H8RA 3TOIA 4JF5A 2PHYA 4ZTKA 1LI9A 4BBUA 3UB8A 2PBYA 4S2LA 4BWIA 5KZHA 5HD5A 1YM1A 2GNXA 2XLNA 1JWPA 2WGWA 4CLCB 2ZQAA 5AQ9A 2JC7A 1GSVA 2ZQDA 3GVBA 3H82B 1VHMA 2IWCA 1T1AA 1FCNA 4GD6A 3EQVA 5FAQA 5HDSA 1YLWA 3LUQA 3M2JA 2PAVP 4YOFA 1G68A 3S4XA 3IF5A 1OT6A 5E2EA 2QZ6A 2HGVA 3NULA 5FDHA 4X25A 1H5XA 1W8YA 2EX2A 2ZMVA 3HUNA 1C3BA 2XROA 1G28A 1Z6FA 4I3AA 4DE2A 2RCXA 2H0YA 4PM9A 3IBJA 1HLUP 1GCEA 5KIZA 1TEMA 5F1FA 3LEZA 3UE6A 5M19A 4OQIA 1L3LA 4MBHA 2ZC7A 3DW0A 2Y2IA 2KOIA 3LIBA 4D60A 3QP1A 2Y55A 2WAFA 5CHJA 1LT0A 3Q07A 3G2YA 1IKGA 5HX9A 2R9WA 2Z2LB 4OP5A 4WMCA 4DN0A 4P87A 3W2ZA 2WYXA 4DDYA 3S7OA 3G30A 1BLCA 3C8CA 4ID4A 4ZDXA 4LRZE 1J3WA 2BASA 3K3DA 3BFGA 2B18A 3UB6A 3E98A 4L9FA 5GLBA 4ZJ1A 1KE3A 2L4RA 5EV0A 4JF4A 5FDSA 2NUTC 3LI8A 3MQQA 3UO9A 2V1AA 2HDSA 4EBNA 2W1TB 1KOUA 5EFWA 5FI2A 3CI6A 4LENA 4IHQA 3CZDA 1D1JA 5F82A 1VB6A 5CEDA 2VJWA 2WZXA 2WKQA 3EEAA 4NK3A 1W79A 2HP6A 3UB5P 2XFTA 5G4ZA 4GS9A 3VOYA 3FKVA 4K08A 1BSGA 5F6AA 1OPXA 4OPQA 5FAOA 1RP5A 3B42A 4S2PA 5GHZA 4HH3A 2PR5A 1HD8A 2X71A 3SS5A 4BD0A 3IX8A 4DDSA 1E4DA 1GHIA 1ESUA 2PD7A 4RVAA 1TDGA 5CRFA 3VE3A 3IX3A 3T12B 4UA7A 2HJ9C 2QJ7A 1LHYA 5DTTA 4WF0A 4QJGA 1KGGA 3KSHA 4WN5A 1SCWA 4CJNA 2WGIA 4E3KA 2V2FF 2J3TD 3HLGA 4HP9A 3P09A 3LFVA 5TJJA 4EETB 1F98A 2M7UA 3HLBA 4FTXA 3JVUA 2V0UA 1ONGA 4GW9A 3NECA 3A3DA 3AGEA 3QP2A 5EVIC 5G4YA 4LFUA 3EWKA 1MWUA 4HEFA 4I38A 4FH2A 1XX2A 3NI9A 3RJUA 3LGOA 2XF3A 2VV6A 3GR2A 2HPBA 2XRNA 4HIAA 4S2MA 3EOIA 1N9OA 3LO7A 3MR0A 4R23A 4DXCA 3KSIA 5FEGA 3BLSA 4Z9QA 1MWSA 5HAIA 4KQQA 3KYQA 4O7DA 1T1BA 1K55C 3CMZA 5KSCA 3C7VA 3OCNA 1W5DA 3G2ZA 5DTSA 5G18A 2XA7M 2K2NA 5EVEA 4ME4A 3GQZA 1H8YA 2JE5A 4R1GA 2P04A 2O99A 1BUEA 5EUAA 2XR0A 1K55A 3Q7VA 2W0NA 1CEGA 2K31A 1K54C 4II7A 4KZ3A 2ZD8A 3ITAA 3PBQA 1KGEA 3O86A 5CECA 3D9YA 1T1CA 5EE8A 1IYOA 1OTDA 1ZG6A 2KDKA 3ZG9B 3D72A 5GHXA 4BLMA 2VV8A 1K54A 1XA1A 4PM8A 4IUKA 5AJGA 3WRTA 4OOLA 3CPTA 1WYCA 3IX4A 3IXBA 3H7WB 3S7QA 2PU2A 2Y2OA 3GDIA 3NBLA 1ES3A 1I2SA 3VMAA 3UY6A 1ES5A 4ETZA 3UDXA 4PMAA 2VA0A 4ZRRA 5DF7A 1FSYA 4OVDA 4C6YA 5DF8A 3BRMA 2OLUA 3K2NA 3C38A 5A92A 4E3NA 3C7UA 4N92A 2XD5A 4JBFA 4WUJA 5E2GA 5KMWA 4U0TA 5FA7A 5CTNA 3LR5A 4EU0A 4O8GA 5M1AA 1Z09A 3KYZA 4OKPA 2XEPA 4KZAA 2Y2LA 3VP1A 2BLSA 4UA9A 2Q9MA 2EXAA 3QNCA 1NZUA 2PT7A 2ZOIA 1GSWA 1PWGA 1UGUA 5TBMA 3ZYTA 4N1HA 5CERA 2JCHA 3SW1A 1MWRA 3HJIA 2Y2KA 3TJZC 1HTZA 1FIKA 3ZQ5A 2M1CA 3LCEA 1W7FA 4H6JA 3FKWA 3HL9A 4EUVA 5EECA 4JXSA 1L0GA 3PAEA 1IYPA 1WA9A 3HLCA 3F1OA 1PFLA 3KYEA 3WS0A 2I72A 3L7HA 4ARZB 4PAUA 1STZA 2A49A 2CMNA 4L9GA 3WWXA 3QP4A 2VEAA 4B9OA 2XD1A 2W3FA 1ES2A 4OQGA 4BL2A 4IVKA 1MBLA 5J3WA 3ZCZA 5DTKA 4MN7A 3BM6A 1T19A 2WAEA 1WE4A 3BEBA 4GKUA 1FCMA 1UWPX 4E3JA 1OJGA 1V9ZA 1NXYA 1U60A 3SOIA 4FH4A 1SHVA 3O5YA 1BTLA 3DTMA 4GB7A 1P9RA 1S4SA 1XFQA 1VEUA 4DE1A 1DP8A 2ZQ8A 4WZ5C 3V3SA 3F1NB 2A24A 4R3JA 5L8MA 3W4QA 5DJTA 3QP8A 1D7EA 3SS4A 3KO6A 3IXHA 1IOUA 2JKGA 4GDNA 2JN7A 2YKFA 4KQRA 2IWBA 3N6IA 5TGFA 1K57C 3ZVTA 4R6LA 4CLCD 3MXSA 1YLPA 1FR1A 3TW8A 1NY0A 1IYSA 1OTAA 4WEKA 4NXGA 3DWZA 5AVEA 5FQMA 4BD1A 2PU4A 5EVIB 4PHTA 3WS5A 1K57A 1SKOB 3BFFA 5JYPA 4S2NC 1AWIA 1LI0A 3PBSA 1O07A 2Y79A 3DAVA 5A90A 2J3TC 3P7NA 4X1MA 1VETB 4S2NA 5LBRA 1ZKJA 4S2JA 4BQMA 4DJ3A 1JWZA 3VFFA 5HD3A 2D01A 5DF9A 4WYYA 1S4RA 2HF6A 2W3GA 3Q82A 5FSRA 3IT9A 1ES4A 5EPHA 3FPVA 3A0VA 2XH9A 4QWOA 3UNWA 4XT2A 1YSQA 1YMXA 2CC1A 3NOTC 3MF0A 3OPHA 4XUZA 3LICA 3G4PA 1XGJA 1YQSA 3C30A 1S1ZA 3UPPA 1MXOA 2W3HA 3JVVA 1SDNA 4N9KA 4UQIS 3MXRA 4UAAA 2ZL1B 1K4EA 4B4ZA 5GL9A 5MC7A 4X1LA 1LSVA 3E2KA 1YLTA 2VZWA 4LGWA 2JKRM 4ESPA 4I3JA 3G32A 1PYYA 2P9VA 2WUQA 2OOLA 3WS2A 3I7JA 2M7VA 1I5QA 2MJ6A 1L0DA 4L9EA 3FPWA 3R7WB 3NC8A 3B47A 3ZHHA 1LLBA 2ACGA 3OBFA 5HL1A 5EM1A 1SKFA 3HBRA 1YLZA 1Q2PA 2OSUA 4EBPA 3T4OA 1GHPA 5DVAA 4P85A 3LR4A 4FUWA 1GHMA 2W3DA 4EEUA 2EX8A 1LSWA 4HESA 1JWVA 2H10A 1FCOA 3TE8A 1N9LA 5F68A 5J7EA 3BFCA 3SH8A 1XGIA 1YT4A 3HLFA 5HFOA 3DWKA 2HDRA 4UEYA 3N4IA 5I5LA 4ZJ3A 5FQQA 2LB5A 3MKEA 4JKTA 2GX5A 2V1BA 4Z1WA 5IS1A 1A0KA 4R3BA 2ZC6B 2X01A 4PM6A 3O87A 4R4RA 5HPFA 5HZHA 5J4EA 4MNRA 1CI8A 1P9WA 3OPRA 4QPRA 1DJCA 4B93A 2LB9A 4X56A 2PR6A 5L07A 4E6WA 1CF0A 4F3LB 5FASA 4DE0A 1H0MA 1XFNA 4MCWA 5HARA 3A0RA 5L09A 3VSKA 3ZG8B 5FEFA 3MQOA 2P7JA 3LEQA 5CHMA 1S1YA 3BLMA 3N8LA 3LY4A 3VP2A 1FR6A 5GHYA 2J80A 2UWXA 4LV2A 3LIDA 2ZQCA 3HLWA 2E8JA 2E8IA 2G2WA 3IQAA 4FD8A 3MQ0A 3W4PA 1IKIA 2B95A 4HJ3A 2QWSA 3HVFA 4N1XA 3ZG5A 4S2IA 1GSXA 2H28A 1G5UA 2Z6CA 4RQ9A 4Y15A 3QHYA 4HI4A 1BZAA 4GHIA 3NOUC 1V9YA 1XJ6A 4LRXC 2OWJA 4RYEA 3CWFA 2V0WA 2W1RA 4QY6A 3IF6C 3PHYA 4P6ZS 4X6TA 4OQ0A 3FC7A 4MDZA 1F5MA 1RGZA 2EA9A 3MMHA 2QYBA 5DJUA 1IYQA 5HW3A 4WL9A 5FL3A 1VM1A 3IBRA 2A2LA 4I3IA 2XFSA 5F69A 2EWWA 2L0WA 3IF6A 2HP9A 3T1XA 1XXMA 1N9BA 4KG6A 5FQJA 4S2OA 4NETA 5KSHA 1KVMA 2A3UA 2BG1A 4HHDA 4GZBA 2ZQ7A 3F1PA 5FQKA 5HDCA 1DJAA 1ZTUA 1E25A 3CHWP 4G3KA 4MN6A 5IU1A 3S22A 1FSWA 5L10A 4EBLA 2VGLM 2X02A 1G6AA 3MZEA 1HZOA 3PBNA 1FILA 3ZNYA 1GA9A 3MZFA 4CLCC 3MKFA 4O01A 3ZG7B 2WGWB 4UA6A 1ALQA 2EX9A 2O9CA 4OONA 1LL8A 3OC2A 5CGSA 4BBVA 4CLCA 2BTFP 5HAPA 3QNBA 4GCZA 3UPOA 5L2FA 1Y54A 3H82A 3MBZA 3G34A 3A3EA 4LV3A 4WEJA 5HDDA 3W4OA 4O0PA 4LPZA 3T50A 3IS2A 3G35A 4NEED 2ZQ9A 4P0MA 4XXRA 2DNSA 2V20A 3WS4A 5EOEA 3UDIA 4DKIA 3RXWA 3U2AA 3HUMA 2JKTI 3DTKA 3E4OA 4QB8A 3JYIA 1CEFA 3LYXA 4JXWA 4C3QA 1NLYA 5BOHA 3MFXA 2XK1A 1LL9A 5E2FA 2RL3A 4X53A 2ZM8A 3EQUA 3LIFA 2O0YA 1EW0A 2XGNA 1D06A 3UPNA 1RGYA 3A3JA 3IXDA 2DMWA 3GRJA 1N9NA 1MC0A 3EGXC 3BJNA 2Q0OA 4WM9A 1TS6A 2PRFA 4NG2A 2WGVA 2Y2PA 4HOIA 4UHUA 5GLAA 5HL6A 1ONHA 4QHCA 2C6WB 4GOGA 4Y0UA 3FG8A 1H8ZA 3K3CA 4EV4A 3IH9A 5AVFA 2Y2HA 4JF6A 1CK3A 1KGFA 1YLYA 1ODVA 4OPZA 4PKYG 1T18A 1LL5A 2VX8A 2QPNA 4IBRA 4R4SA 3B33A 3IWIA 3TSGA 3L9KA 3EEHA 3S7NA 4EWFA 1K25A 2IWDA 3UE0A 3LIAA 5CHUA 3CUEC 1QMFA 3VV4A 1E3UD 5F83A 2W1TA 3KSFA 2J9OA 4K91A 4PM5A 1XJ2A 1TS8A 3ISGA 3PBOA 3UDFA 4DMZA 4HH2A 4L0LA 4BMWA 4LCMA 3CUEA 4XUXA 4GS9B 1DY6A 3T4SA 3T4LA 5DKLA 2PDRA 4EW7A 3WS1A 3A3IA 2QHKA 1S67L 1TDLA 2HDUA 2PYPA 2O9AA 1JTDA 3GTCA 2HV1A 5FQ9A 1P0ZA 3NHQA 5EM0A 2OV5A 5FAPA 1WYBA 2KLIA 4RX3A 4C75A 2C5WB 1W63M 4JGRA 2INWA 1BLHA 1PI4A 4WBGA 3PBTA 1KDSA 3HREA 4KENB 4X68A 4HP4A 2WKEA 1ERMA 2AVXA 1YSPA 4CQHA 4D2OA 3ULFA 3GECA 2ZJ9A 4HBTA 5DFXA 4HQAA 3BQ8A 2PD8A 4Y3IA 1ZHHB 4HNBA 3N8SA 5DFYA 2Y2MA 2EWVA 4MMNA 1TS7A 3HLDA 4LV1A 1ZG4A 4NXEA 2Q9NA 1W63Q 2DRWA 5E43A 4RA7A 2Y4AA 1CJFA 1Q2QA 1M40A 4DJ2A 1MZUA 4YNRA 2Y2NA 4OQHA 1G6OA 2WKIA 3V67A 4KUOA 2EXBA 3E0YA 1K6RA 4Y0OA 3JPUA 1PW1A 5IT5A 4E3MA 3T4KA 4R38A 1YMSA 3NY4A 1J9MA 2IA2A 1X0OA 4KZ5A 3H9WA 3LIEA 2V8FA 1KE0A 3TRCA 4BL3A 5TFQA 1O7EA 2ZC5B 3UMEA 1NRJA 4QD4A 3OPPA 1PWDA 1YAXA 3Q7VB 2QMIA 5HAQA 1K56D 2Z2MB 1Y4OA 3OPLA 1L0EA 3VP4A 5A93A 4P6ZM 4CLCE 5FQIA 4EEPA 3V3RA 2OWHA 2ZOHA 2EFXA 4OOMA 3DTEA 3MZDA 4Q0IA 2NUPC 3CPTB 3O88A 2Y8HA 3CAXA 4LCLA 2G7UA 5AQAA 1BLSA 1S6RA 2QJ5A 2KX6A 4HY8A 3IWQA 2Y59A 2V9AA 1NYYA 3TG9A 2H5SA 1OMEA 3CG5A 4PPRA 3H7WA 4FSFA 2B5RA 2FFFB 2PBDP 2Y2QA 3OCLA 3IS2B 5K5BA 1K0KA 2DCFA 4G3VA 2GDNA 4I39A 4DF6A 4YFMA 4OP8A 1K6SA 4E3OA 1ZC2A 4MBFA 2P74A 2VV7A 3ITBA 4F94A 3MXQA 3PBRA 4JPMA 3SH9A 5D3OA 1W8QA 2W27A 1OJ5A 4OH0A 4NXFA 2WKHA 4G3WA 1EROA 5CEBA 2R9XA 3FYZA 4B4XA 2J7VA 4R70A 3BQAA 2Y91A 4HJ6A 1TF1A 4Y5FA 3HJKA 1BT5A 3Q7ZA 2WZZA 1RCJA 5FI7A 1QMEA 5TBMB 1K4FA 3T4QA 3HUOA 1KE4A 4MEZA 2FZ0A 4ZBEA 2VLGA 2ZMAA 3R4KA 5CGXA 1FQGA 3IH8A 4JGQA 4BENA 5FI6A 4EXOA 2Y2JA 3T1QB 3QP5A 3NIAA 3IXGA 5C5KA 3PTEA 4OPRA 2V8CA 4H6JB 1XP4A 3M6HA 2HJEA 4OLGA 3CJMA 3RFBA 2VGKA 3N8RA 3VE4A 1GA0A 1XJ4A 3F1OB 4YINA 3RTYA 3SZTA 3ZG0A 4X69A 3O3VA 3RXXA 1PI5A 2G2UA 4GNUA 4ARZA 5A91A 4MLLA 2H0TA 3T4JA 1NYMA 3MSHA 4MBKA 3IHBA 1OTIA 2K7SA 4IEDA 2WKPA 1S0WA 2O9BA 4S2KA 4KQOA 5HWVA 1MKIA 2ZC3B 4JGPA 1BYWA 1VEUB 1L0FA 4R3AA 4ZAMA 1PRQA 3PYPA 2A24B 3LI9A 4K0XA 2VK3A 3VSLA 3UE3A 3WRZA 1MPLA 3F1NA 4OPYA 4FCFA 1FOFA 2ZMFA 3T4TA 4LLOB 4WELA 4YWZA 3V50A 3GSGA 2P08A 3BECA 3BYDA 4KG2A 2J3WA 1Y28A 1N4OA 2VGJA 1E3UA 4Y7PA 4EQIA 3V5MA 1JNUA 4E3IA 3C4PA 2QKPA
chains in the Genus database with same CATH topology
4R6LA 4CLCD 1TS6A 3TW8A 1LT0A 1OTAA 4HOIA 5HL6A 4WEKA 4GJ4A 1TS0A 4NXGA 4DN0A 5AVEA 3W2ZA 3E4PA 4GLQA 3FG8A 3K3CA 3S7OA 5A8BA 4PHTA 5AVFA 3C8CA 4EERA 3PBSA 4LRZE 2Y79A 2BASA 3K3DA 3D3OA 2B18A 3UB6A 3E98A 1ODVA 4PKYG 4L9FA 1T18A 2VX8A 2J3TC 3B33A 3P7NA 2L4RA 3EEHA 3S7NA 2OAQ1 2NUTC 3LI8A 5HSQA 5LBRA 3MQQA 4Q0JA 3LIAA 3CUEC 2V1AA 4NKPA 4E04A 4DJ3A 2W1TB 1KOUA 3VV4A 5HD3A 4MN5A 5EFWA 3CI6A 2W1TA 2D01A 3KSFA 5DF9A 1S4RA 2HF6A 2W3GA 4IHQA 1XJ2A 1TS8A 3PBOA 4XT2B 3FPVA 4DMZA 3A0VA 4HH2A 4L0LA 4BMWA 1VB6A 5HWTA 4XT2A 1YSQA 3CUEA 2VJWA 4GS9B 3C2WA 3T4SA 3T4LA 2WKQA 3EEAA 5DKLA 3NOTC 3MF0A 5G4ZA 3NJAA 2PDRA 4EW7A 4GS9A 5F5YA 3LICA 2QHKA 1S67L 4K08A 5F6AA 1OPXA 2PYPA 2O9AA 2HV1A 1P0ZA 3B42A 3E4QA 3NHQA 4HH3A 2PR5A 3C30A 1S1ZA 4M4XA 2W3HA 3JVVA 4UQIS 2KLIA 2PD7A 1W63M 4JGRA 2INWA 3VE3A 5MC7A 3PBTA 2HJ9C 4HP4A 1LSVA 2QJ7A 2VZWA 2JKRM 3UB7A 4I3JA 3KX0X 2ZBBA 4WF0A 3BW6A 3KSHA 2OOLA 4WN5A 1YSPA 4CQHA 4IJGA 4BJPA 3ULFA 1UWNX 3A0SA 3GECA 5DFXA 2M7VA 4HQAA 3BQ8A 4LRYC 2PD8A 4Y3IA 1ZHHB 5DKKA 4HNBA 4IUHA 2J3TD 5DFYA 4HP9A 2MJ6A 2EWVA 4MMNA 1TS7A 3LFVA 5TJJA 4EETB 1F98A 2M7UA 3NOPC 1S66L 4HJ4A 4L9EA 4NXEA 3JVUA 3FPWA 2V0UA 1W63Q 3CLOA 3R7WB 2JHEA 4GW9A 3B47A 4EESA 3OBFA 4UQIM 3R7WA 4DJ2A 1MZUA 3PR6A 4YNRA 2GJ3A 5G4YA 1G6OA 3EWKA 3V67A 4KUOA 4I38A 3E0YA 3BWLA 2GZAA 2VV6A 3T4OA 1F9IA 2XRNA 4HIAA 1TD5A 3LR4A 5IT5A 2W3DA 4EEUA 3EOIA 1N9OA 1DP6A 3MR0A 3T4KA 4JGOA 4R38A 3KSIA 1LSWA 4ETXA 5HPIA 2IA2A 1X0OA 4I5SA 3TE8A 3OOVA 3H9WA 1N9LA 1LSXA 3KYQA 3LIEA 3ICYA 1T1BA 5F68A 2WKRA 3TRCA 3EGDC 1IFQA 5J7EA 2D02A 2JKTM 3UMEA 3CITA 1NRJA 3OCNA 1DRMA 4UEYA 1OT9A 5I5LA 2XA7M 2K2NA 2LB5A 3PXPA 4ME4A 1OTEA 1YAXA 2W3EA 2P04A 1NLZA 2GX5A 2O99A 2V1BA 4Z1WA 3DBAA 5IS1A 4P6ZM 2W0NA 1MKMA 4EQ1A 2K31A 1H3QA 4CLCE 2PYRA 4II7A 3KSGA 5HPFA 5HZHA 5J4EA 2Z6DA 3PBQA 1P9WA 4EEPA 3S7PA 2OWHA 4QPRA 2ZOHA 1T1CA 1OTDA 4B93A 2LB9A 4OOMA 2KDKA 2PR6A 4F3LB 4Q0IA 3D72A 2NUPC 1H8MA 1XFNA 2VV8A 2Y8HA 3CAXA 4IUKA 5AJGA 3RH8B 4OOLA 4F3LA 2G7UA 4MCWA 3UB9A 3A0RA 2QJ5A 3P01A 3MQOA 2P7JA 4AFIA 2KX6A 4HY8A 1S1YA 3H7WB 2V9AA 3S7QA 3GDIA 4NXBA 2B02A 3H7WA 2J80A 3MJQA 3HCYA 3LIDA 4FSFA 4ETZA 3OCLA 2VA0A 3IS2B 5K5BA 2OAP1 3MQ0A 4ZRRA 4G3VA 3BY9A 4HJ3A 4I39A 2QWSA 1GSXA 3LR3A 2VV7A 3K2NA 4GHIB 2H28A 3C38A 2Z6CA 3OLOA 4RQ9A 3MXQA 1OTBA 4HI4A 4GHIA 3LR0A 4WUJA 1P97A 3PBRA 1DP9A 3NOUC 1V9YA 1XJ6A 4LRXC 2OWJA 2XA7S 3CWFA 4WLAA 3BY8A 2W27A 2V0WA 2W1RA 3LR5A 4EU0A 1OJ5A 4NXFA 4O8GA 3PHYA 4G3WA 4P6ZS 3UMDA 3FC7A 4MDZA 4Q0HA 3KYZA 1F5MA 2EA9A 3MMHA 2QYBA 4R70A 3BQAA 4KUKA 4HJ6A 3G6OA 5DJUA 2VGLS 4WL9A 2YKHA 5FL3A 4PKYA 4FOFA 1TF1A 4Y5FA 3IBRA 3HJKA 2A2LA 2I9VA 4I3IA 5HWWA 4Y2FA 5F69A 1YKDA 2EWWA 2L0WA 1NWZA 5TBMB 2PT7A 3T4QA 2L1MA 2ZOIA 1GSWA 2FZ0A 1UGUA 5KSHA 5TBMA 2VLGA 3R4KA 1XJ3A 3F1PB 3ZYTA 3BJNA 4HHDA 3SW1A 3HJIA 4JGQA 3F1PA 2VKSA 5HDCA 4EXOA 3TJZC 2JKRI 5C5KA 1ZTUA 3ZQ5A 2M1CA 4H6JB 4BBTA 4G3KA 2HJEA 4KQDA 2R78A 5CX7A 4MN6A 3RFBA 4H6JA 5IU1A 2FH5A 4EUVA 3VOLA 2XSSA 2PHYA 3VE4A 2VGLM 1WA9A 1XJ4A 3F1OB 3PBNA 3RTYA 4BBUA 3F1OA 4CLCC 3UB8A 4O01A 4ARZB 4BWIA 4PAUA 1STZA 5HD5A 2CMNA 4ARZA 2GNXA 4L9GA 4CLCB 2O9CA 1LL8A 3OC2A 2VEAA 4B9OA 1GSVA 3T4JA 4BBVA 2W3FA 4CLCA 3H82B 1VHMA 4GCZA 1T1AA 3H82A 3EQVA 5HDSA 5J3WA 1OTIA 2K7SA 3LUQA 4MN7A 2WKPA 4WEJA 4YOFA 5HDDA 2O9BA 4KQOA 5HWVA 4O0PA 1T19A 4LPZA 3T50A 2KOIA 1UWPX 3IS2A 4NEED 1OJGA 1OT6A 1V9ZA 4JGPA 1BYWA 2HGVA 4R3AA 3O5YA 1P9RA 1S4SA 3PYPA 1XFQA 2A24B 1DP8A 3LI9A 3U2AA 2JKTI 2ZMVA 3E4OA 3F1NB 3UE3A 2A24A 3LYXA 2XROA 1G28A 3F1NA 5L8MA 4I3AA 1NLYA 3MFXA 2ZMFA 3T4TA 4LLOB 4WELA 5DJTA 4YWZA 2P08A 1D7EA 1Y28A 2J3WA 3KO6A 3IBJA 5KIZA 3EQUA 3LIFA 2O0YA 1JNUA 1EW0A 3UE6A 1IOUA 1D06A 2JN7A 2YKFA 2DMWA 1N9NA 1MC0A 3EGXC 3LIBA 2QKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8H A;  4R6L A;  3ZQ5 A;  4IUK A;  5AJG A;  2G7U A;  4MCW A;  4G3K A;  5DFX A;  2M7V A;  4LRY C;  5HL6 A;  4Y3I A;  3RFB A;  4IUH A;  5DFY A;  4DN0 A;  4EUV A;  2XSS A;  3W2Z A;  4MMN A;  3S7Q A;  3LFV A;  4GLQ A;  5TJJ A;  3S7O A;  2M7U A;  3NOP C;  3HCY A;  4LRZ E;  4GW9 A;  2Y79 A;  4O01 A;  4ETZ A;  3D3O A;  4BWI A;  2B18 A;  3OBF A;  3E98 A;  4PAU A;  1STZ A;  5K5B A;  4YNR A;  3MQ0 A;  4ZRR A;  4G3V A;  3E0Y A;  3S7N A;  2O9C A;  2VEA A;  5HSQ A;  2XRN A;  4Q0J A;  5LBR A;  2W3F A;  3K2N A;  1TD5 A;  4E04 A;  1VHM A;  2W1T B;  2W3D A;  4RQ9 A;  3VV4 A;  3KSI A;  3CI6 A;  2W1T A;  3KSF A;  3NOU C;  4ETX A;  4LRX C;  5HPI A;  4MN7 A;  2W3G A;  4YOF A;  2IA2 A;  2O9B A;  3OOV A;  2W1R A;  4EU0 A;  4DMZ A;  4O0P A;  4O8G A;  4G3W A;  1YSQ A;  3TRC A;  2VJW A;  4MDZ A;  3C2W A;  4Q0H A;  2HGV A;  1F5M A;  3EEA A;  3NOT C;  3O5Y A;  3MF0 A;  3MMH A;  2QYB A;  4R70 A;  3CIT A;  3G6O A;  5I5L A;  2O9A A;  4FOF A;  1TF1 A;  4Y5F A;  3IBR A;  2K2N A;  2LB5 A;  4Y2F A;  4ME4 A;  3NHQ A;  2XRO A;  2W3E A;  1YKD A;  2GX5 A;  2O99 A;  4Z1W A;  5L8M A;  3DBA A;  2ZMF A;  2W3H A;  1MKM A;  2K31 A;  2KLI A;  3KO6 A;  3IBJ A;  3KSG A;  5HPF A;  3R4K A;  2O0Y A;  3S7P A;  4QPR A;  2VZW A;  2VKS A;  2LB9 A;  3KSH A;  2OOL A;  1YSP A;  4Q0I A;  5C5K A;  4CQH A;  1MC0 A;  1ZTU A;  4IJG A;  2KOI A;  3BJN A; 
#chains in the Genus database with same CATH topology
 1K38 A;  3IHA A;  3UN7 A;  2ZM2 A;  4GJ4 A;  1TS0 A;  3M2K A;  3VP3 A;  2ZC4 B;  4B88 A;  3E4P A;  3FZC A;  4GLQ A;  5J8X A;  3ZGA B;  4GN2 A;  5A8B A;  3C5A A;  4OOY A;  4Y17 A;  5EVI A;  4EER A;  1SKO A;  3VP0 A;  2Y2G A;  3ZFZ A;  3D3O A;  2HDQ A;  3G31 A;  5M18 A;  2J8Y A;  3ZDJ A;  3T1S A;  2OAQ 1;  5HSQ A;  4Q0J A;  4QY5 A;  3VOZ A;  1MY8 A;  4NKP A;  4E04 A;  1VET A;  4MN5 A;  2WK0 A;  1ACF A;  4XT2 B;  3D4F A;  1L2S A;  3IWO A;  3AGF A;  3P98 A;  5HWT A;  3GV9 A;  3C2W A;  4DE3 A;  3NDE A;  3NJA A;  5F5Y A;  3V39 A;  2OLV A;  4Q8I A;  5CXW A;  3HLE A;  1JTG A;  4WMC D;  1ERQ A;  4WZ4 A;  2V1Z A;  3E4Q A;  4HBU A;  5EOO A;  4M4X A;  4JLF A;  1CI9 A;  4X55 A;  2WAD A;  5TR7 A;  2P9V B;  2ZL1 A;  1BLP A;  1SZV A;  2ZM0 A;  5F1G A;  1PZO A;  3UB7 A;  3KX0 X;  2ZBB A;  4A5R A;  3BW6 A;  1TVF A;  1PWC A;  4IJG A;  4BJP A;  1NZO A;  1UWN X;  4DRT A;  1SDE A;  3A0S A;  3NCK A;  5GLC A;  3FV7 A;  4LRY C;  5DKK A;  1EWZ A;  4IUH A;  4RX2 A;  4KG5 A;  4KZ8 A;  1K56 A;  2EFU A;  4GD8 A;  3NOP C;  1CQA A;  1S66 L;  4HJ4 A;  3UE1 A;  5IHV A;  3CLO A;  1EI5 A;  2JHE A;  4EES A;  2J9P A;  4UQI M;  3R7W A;  3PR6 A;  2GJ3 A;  4IVI A;  4GDB A;  3BWL A;  2GZA A;  3NDG A;  1F9I A;  1TD5 A;  5I94 A;  1IEL A;  1DP6 A;  1NJ4 A;  4JGO A;  4Y13 A;  3ZVW A;  5CGW A;  4ETX A;  5HPI A;  3W8K A;  1I2W A;  1PW8 A;  4I5S A;  3OOV A;  5EVL A;  1LSX A;  3B3X A;  3ICY A;  2WKR A;  3EGD C;  1IFQ A;  1XKZ A;  4KZ4 A;  2D02 A;  2JKT M;  3CIT A;  3VFH A;  1DRM A;  4U0X A;  4OLD A;  1OT9 A;  4EUZ A;  3BFE A;  3PAG A;  3PXP A;  4P6B A;  1OTE A;  2W3E A;  1NLZ A;  3DBA A;  1M6K A;  1MKM A;  4EQ1 A;  1H3Q A;  2PYR A;  3U4L P;  3KSG A;  2Z6D A;  5AQ7 A;  3S7P A;  5JYO A;  1IEM A;  3MFD A;  3FWL A;  3N7W A;  4KZ7 A;  2HZ5 A;  4JXG A;  1H8M A;  3S1Y A;  3SH7 A;  1YPR A;  3Q1F A;  3RH8 B;  4F3L A;  3M6B A;  4N9L A;  1MWT A;  3UB9 A;  1HVB A;  5EVI D;  3P01 A;  1ESI A;  4AFI A;  3BFD A;  4NXB A;  1XPB A;  4KZ6 A;  2B02 A;  2HP5 A;  4PM7 A;  3MJQ A;  2JKF A;  3HCY A;  1YLJ A;  4E6X A;  5FAT A;  3AGD A;  3C4O A;  2OAP 1;  1XA7 A;  3BY9 A;  2XDM A;  3SS3 A;  4QU3 A;  1AXB A;  4Y0T A;  5E2H A;  3E2L A;  3LR3 A;  4GHI B;  1DJB A;  3OLO A;  5CTM A;  3Q81 A;  1OTB A;  1PIO A;  1PZP A;  3LR0 A;  1P97 A;  1DP9 A;  2FFY A;  1NRF A;  2XA7 S;  1PNE A;  3DTI A;  4WLA A;  3BY8 A;  2JBF A;  5U47 A;  1KDW A;  4ZJ2 A;  3A3F A;  5AQB A;  1F2K A;  3UMD A;  4JXV A;  4Q0H A;  4WZ5 A;  4IBX A;  3QP6 A;  1VQQ A;  4KUK A;  3MS6 A;  3G6O A;  4KZB A;  2VGL S;  2YKH A;  4PKY A;  4FOF A;  3IF6 B;  2I9V A;  2UV0 E;  5HWW A;  4Y2F A;  1JVJ A;  2ZLY A;  1YKD A;  1NWZ A;  4CPK A;  5GLD A;  2L1M A;  3GMW A;  1XJ3 A;  3F1P B;  1KVL A;  3T1R A;  3LY3 A;  2VKS A;  4DXB A;  1BUL A;  2JKR I;  4E3L A;  3ZNT A;  4R0Q A;  4K0W A;  2EX6 A;  4BBT A;  4M3K A;  4KQD A;  2R78 A;  5CX7 A;  4LV0 A;  3OZH A;  4KZ9 A;  4U3T A;  2XQZ A;  2FH5 A;  3VOL A;  2XSS A;  4H8R A;  3TOI A;  4JF5 A;  2PHY A;  4ZTK A;  1LI9 A;  4BBU A;  3UB8 A;  2PBY A;  4S2L A;  4BWI A;  5KZH A;  5HD5 A;  1YM1 A;  2GNX A;  2XLN A;  1JWP A;  2WGW A;  4CLC B;  2ZQA A;  5AQ9 A;  2JC7 A;  1GSV A;  2ZQD A;  3GVB A;  3H82 B;  1VHM A;  2IWC A;  1T1A A;  1FCN A;  4GD6 A;  3EQV A;  5FAQ A;  5HDS A;  1YLW A;  3LUQ A;  3M2J A;  2PAV P;  4YOF A;  1G68 A;  3S4X A;  3IF5 A;  1OT6 A;  5E2E A;  2QZ6 A;  2HGV A;  3NUL A;  5FDH A;  4X25 A;  1H5X A;  1W8Y A;  2EX2 A;  2ZMV A;  3HUN A;  1C3B A;  2XRO A;  1G28 A;  1Z6F A;  4I3A A;  4DE2 A;  2RCX A;  2H0Y A;  4PM9 A;  3IBJ A;  1HLU P;  1GCE A;  5KIZ A;  1TEM A;  5F1F A;  3LEZ A;  3UE6 A;  5M19 A;  4OQI A;  1L3L A;  4MBH A;  2ZC7 A;  3DW0 A;  2Y2I A;  2KOI A;  3LIB A;  4D60 A;  3QP1 A;  2Y55 A;  2WAF A;  5CHJ A;  1LT0 A;  3Q07 A;  3G2Y A;  1IKG A;  5HX9 A;  2R9W A;  2Z2L B;  4OP5 A;  4WMC A;  4DN0 A;  4P87 A;  3W2Z A;  2WYX A;  4DDY A;  3S7O A;  3G30 A;  1BLC A;  3C8C A;  4ID4 A;  4ZDX A;  4LRZ E;  1J3W A;  2BAS A;  3K3D A;  3BFG A;  2B18 A;  3UB6 A;  3E98 A;  4L9F A;  5GLB A;  4ZJ1 A;  1KE3 A;  2L4R A;  5EV0 A;  4JF4 A;  5FDS A;  2NUT C;  3LI8 A;  3MQQ A;  3UO9 A;  2V1A A;  2HDS A;  4EBN A;  2W1T B;  1KOU A;  5EFW A;  5FI2 A;  3CI6 A;  4LEN A;  4IHQ A;  3CZD A;  1D1J A;  5F82 A;  1VB6 A;  5CED A;  2VJW A;  2WZX A;  2WKQ A;  3EEA A;  4NK3 A;  1W79 A;  2HP6 A;  3UB5 P;  2XFT A;  5G4Z A;  4GS9 A;  3VOY A;  3FKV A;  4K08 A;  1BSG A;  5F6A A;  1OPX A;  4OPQ A;  5FAO A;  1RP5 A;  3B42 A;  4S2P A;  5GHZ A;  4HH3 A;  2PR5 A;  1HD8 A;  2X71 A;  3SS5 A;  4BD0 A;  3IX8 A;  4DDS A;  1E4D A;  1GHI A;  1ESU A;  2PD7 A;  4RVA A;  1TDG A;  5CRF A;  3VE3 A;  3IX3 A;  3T12 B;  4UA7 A;  2HJ9 C;  2QJ7 A;  1LHY A;  5DTT A;  4WF0 A;  4QJG A;  1KGG A;  3KSH A;  4WN5 A;  1SCW A;  4CJN A;  2WGI A;  4E3K A;  2V2F F;  2J3T D;  3HLG A;  4HP9 A;  3P09 A;  3LFV A;  5TJJ A;  4EET B;  1F98 A;  2M7U A;  3HLB A;  4FTX A;  3JVU A;  2V0U A;  1ONG A;  4GW9 A;  3NEC A;  3A3D A;  3AGE A;  3QP2 A;  5EVI C;  5G4Y A;  4LFU A;  3EWK A;  1MWU A;  4HEF A;  4I38 A;  4FH2 A;  1XX2 A;  3NI9 A;  3RJU A;  3LGO A;  2XF3 A;  2VV6 A;  3GR2 A;  2HPB A;  2XRN A;  4HIA A;  4S2M A;  3EOI A;  1N9O A;  3LO7 A;  3MR0 A;  4R23 A;  4DXC A;  3KSI A;  5FEG A;  3BLS A;  4Z9Q A;  1MWS A;  5HAI A;  4KQQ A;  3KYQ A;  4O7D A;  1T1B A;  1K55 C;  3CMZ A;  5KSC A;  3C7V A;  3OCN A;  1W5D A;  3G2Z A;  5DTS A;  5G18 A;  2XA7 M;  2K2N A;  5EVE A;  4ME4 A;  3GQZ A;  1H8Y A;  2JE5 A;  4R1G A;  2P04 A;  2O99 A;  1BUE A;  5EUA A;  2XR0 A;  1K55 A;  3Q7V A;  2W0N A;  1CEG A;  2K31 A;  1K54 C;  4II7 A;  4KZ3 A;  2ZD8 A;  3ITA A;  3PBQ A;  1KGE A;  3O86 A;  5CEC A;  3D9Y A;  1T1C A;  5EE8 A;  1IYO A;  1OTD A;  1ZG6 A;  2KDK A;  3ZG9 B;  3D72 A;  5GHX A;  4BLM A;  2VV8 A;  1K54 A;  1XA1 A;  4PM8 A;  4IUK A;  5AJG A;  3WRT A;  4OOL A;  3CPT A;  1WYC A;  3IX4 A;  3IXB A;  3H7W B;  3S7Q A;  2PU2 A;  2Y2O A;  3GDI A;  3NBL A;  1ES3 A;  1I2S A;  3VMA A;  3UY6 A;  1ES5 A;  4ETZ A;  3UDX A;  4PMA A;  2VA0 A;  4ZRR A;  5DF7 A;  1FSY A;  4OVD A;  4C6Y A;  5DF8 A;  3BRM A;  2OLU A;  3K2N A;  3C38 A;  5A92 A;  4E3N A;  3C7U A;  4N92 A;  2XD5 A;  4JBF A;  4WUJ A;  5E2G A;  5KMW A;  4U0T A;  5FA7 A;  5CTN A;  3LR5 A;  4EU0 A;  4O8G A;  5M1A A;  1Z09 A;  3KYZ A;  4OKP A;  2XEP A;  4KZA A;  2Y2L A;  3VP1 A;  2BLS A;  4UA9 A;  2Q9M A;  2EXA A;  3QNC A;  1NZU A;  2PT7 A;  2ZOI A;  1GSW A;  1PWG A;  1UGU A;  5TBM A;  3ZYT A;  4N1H A;  5CER A;  2JCH A;  3SW1 A;  1MWR A;  3HJI A;  2Y2K A;  3TJZ C;  1HTZ A;  1FIK A;  3ZQ5 A;  2M1C A;  3LCE A;  1W7F A;  4H6J A;  3FKW A;  3HL9 A;  4EUV A;  5EEC A;  4JXS A;  1L0G A;  3PAE A;  1IYP A;  1WA9 A;  3HLC A;  3F1O A;  1PFL A;  3KYE A;  3WS0 A;  2I72 A;  3L7H A;  4ARZ B;  4PAU A;  1STZ A;  2A49 A;  2CMN A;  4L9G A;  3WWX A;  3QP4 A;  2VEA A;  4B9O A;  2XD1 A;  2W3F A;  1ES2 A;  4OQG A;  4BL2 A;  4IVK A;  1MBL A;  5J3W A;  3ZCZ A;  5DTK A;  4MN7 A;  3BM6 A;  1T19 A;  2WAE A;  1WE4 A;  3BEB A;  4GKU A;  1FCM A;  1UWP X;  4E3J A;  1OJG A;  1V9Z A;  1NXY A;  1U60 A;  3SOI A;  4FH4 A;  1SHV A;  3O5Y A;  1BTL A;  3DTM A;  4GB7 A;  1P9R A;  1S4S A;  1XFQ A;  1VEU A;  4DE1 A;  1DP8 A;  2ZQ8 A;  4WZ5 C;  3V3S A;  3F1N B;  2A24 A;  4R3J A;  5L8M A;  3W4Q A;  5DJT A;  3QP8 A;  1D7E A;  3SS4 A;  3KO6 A;  3IXH A;  1IOU A;  2JKG A;  4GDN A;  2JN7 A;  2YKF A;  4KQR A;  2IWB A;  3N6I A;  5TGF A;  1K57 C;  3ZVT A;  4R6L A;  4CLC D;  3MXS A;  1YLP A;  1FR1 A;  3TW8 A;  1NY0 A;  1IYS A;  1OTA A;  4WEK A;  4NXG A;  3DWZ A;  5AVE A;  5FQM A;  4BD1 A;  2PU4 A;  5EVI B;  4PHT A;  3WS5 A;  1K57 A;  1SKO B;  3BFF A;  5JYP A;  4S2N C;  1AWI A;  1LI0 A;  3PBS A;  1O07 A;  2Y79 A;  3DAV A;  5A90 A;  2J3T C;  3P7N A;  4X1M A;  1VET B;  4S2N A;  5LBR A;  1ZKJ A;  4S2J A;  4BQM A;  4DJ3 A;  1JWZ A;  3VFF A;  5HD3 A;  2D01 A;  5DF9 A;  4WYY A;  1S4R A;  2HF6 A;  2W3G A;  3Q82 A;  5FSR A;  3IT9 A;  1ES4 A;  5EPH A;  3FPV A;  3A0V A;  2XH9 A;  4QWO A;  3UNW A;  4XT2 A;  1YSQ A;  1YMX A;  2CC1 A;  3NOT C;  3MF0 A;  3OPH A;  4XUZ A;  3LIC A;  3G4P A;  1XGJ A;  1YQS A;  3C30 A;  1S1Z A;  3UPP A;  1MXO A;  2W3H A;  3JVV A;  1SDN A;  4N9K A;  4UQI S;  3MXR A;  4UAA A;  2ZL1 B;  1K4E A;  4B4Z A;  5GL9 A;  5MC7 A;  4X1L A;  1LSV A;  3E2K A;  1YLT A;  2VZW A;  4LGW A;  2JKR M;  4ESP A;  4I3J A;  3G32 A;  1PYY A;  2P9V A;  2WUQ A;  2OOL A;  3WS2 A;  3I7J A;  2M7V A;  1I5Q A;  2MJ6 A;  1L0D A;  4L9E A;  3FPW A;  3R7W B;  3NC8 A;  3B47 A;  3ZHH A;  1LLB A;  2ACG A;  3OBF A;  5HL1 A;  5EM1 A;  1SKF A;  3HBR A;  1YLZ A;  1Q2P A;  2OSU A;  4EBP A;  3T4O A;  1GHP A;  5DVA A;  4P85 A;  3LR4 A;  4FUW A;  1GHM A;  2W3D A;  4EEU A;  2EX8 A;  1LSW A;  4HES A;  1JWV A;  2H10 A;  1FCO A;  3TE8 A;  1N9L A;  5F68 A;  5J7E A;  3BFC A;  3SH8 A;  1XGI A;  1YT4 A;  3HLF A;  5HFO A;  3DWK A;  2HDR A;  4UEY A;  3N4I A;  5I5L A;  4ZJ3 A;  5FQQ A;  2LB5 A;  3MKE A;  4JKT A;  2GX5 A;  2V1B A;  4Z1W A;  5IS1 A;  1A0K A;  4R3B A;  2ZC6 B;  2X01 A;  4PM6 A;  3O87 A;  4R4R A;  5HPF A;  5HZH A;  5J4E A;  4MNR A;  1CI8 A;  1P9W A;  3OPR A;  4QPR A;  1DJC A;  4B93 A;  2LB9 A;  4X56 A;  2PR6 A;  5L07 A;  4E6W A;  1CF0 A;  4F3L B;  5FAS A;  4DE0 A;  1H0M A;  1XFN A;  4MCW A;  5HAR A;  3A0R A;  5L09 A;  3VSK A;  3ZG8 B;  5FEF A;  3MQO A;  2P7J A;  3LEQ A;  5CHM A;  1S1Y A;  3BLM A;  3N8L A;  3LY4 A;  3VP2 A;  1FR6 A;  5GHY A;  2J80 A;  2UWX A;  4LV2 A;  3LID A;  2ZQC A;  3HLW A;  2E8J A;  2E8I A;  2G2W A;  3IQA A;  4FD8 A;  3MQ0 A;  3W4P A;  1IKI A;  2B95 A;  4HJ3 A;  2QWS A;  3HVF A;  4N1X A;  3ZG5 A;  4S2I A;  1GSX A;  2H28 A;  1G5U A;  2Z6C A;  4RQ9 A;  4Y15 A;  3QHY A;  4HI4 A;  1BZA A;  4GHI A;  3NOU C;  1V9Y A;  1XJ6 A;  4LRX C;  2OWJ A;  4RYE A;  3CWF A;  2V0W A;  2W1R A;  4QY6 A;  3IF6 C;  3PHY A;  4P6Z S;  4X6T A;  4OQ0 A;  3FC7 A;  4MDZ A;  1F5M A;  1RGZ A;  2EA9 A;  3MMH A;  2QYB A;  5DJU A;  1IYQ A;  5HW3 A;  4WL9 A;  5FL3 A;  1VM1 A;  3IBR A;  2A2L A;  4I3I A;  2XFS A;  5F69 A;  2EWW A;  2L0W A;  3IF6 A;  2HP9 A;  3T1X A;  1XXM A;  1N9B A;  4KG6 A;  5FQJ A;  4S2O A;  4NET A;  5KSH A;  1KVM A;  2A3U A;  2BG1 A;  4HHD A;  4GZB A;  2ZQ7 A;  3F1P A;  5FQK A;  5HDC A;  1DJA A;  1ZTU A;  1E25 A;  3CHW P;  4G3K A;  4MN6 A;  5IU1 A;  3S22 A;  1FSW A;  5L10 A;  4EBL A;  2VGL M;  2X02 A;  1G6A A;  3MZE A;  1HZO A;  3PBN A;  1FIL A;  3ZNY A;  1GA9 A;  3MZF A;  4CLC C;  3MKF A;  4O01 A;  3ZG7 B;  2WGW B;  4UA6 A;  1ALQ A;  2EX9 A;  2O9C A;  4OON A;  1LL8 A;  3OC2 A;  5CGS A;  4BBV A;  4CLC A;  2BTF P;  5HAP A;  3QNB A;  4GCZ A;  3UPO A;  5L2F A;  1Y54 A;  3H82 A;  3MBZ A;  3G34 A;  3A3E A;  4LV3 A;  4WEJ A;  5HDD A;  3W4O A;  4O0P A;  4LPZ A;  3T50 A;  3IS2 A;  3G35 A;  4NEE D;  2ZQ9 A;  4P0M A;  4XXR A;  2DNS A;  2V20 A;  3WS4 A;  5EOE A;  3UDI A;  4DKI A;  3RXW A;  3U2A A;  3HUM A;  2JKT I;  3DTK A;  3E4O A;  4QB8 A;  3JYI A;  1CEF A;  3LYX A;  4JXW A;  4C3Q A;  1NLY A;  5BOH A;  3MFX A;  2XK1 A;  1LL9 A;  5E2F A;  2RL3 A;  4X53 A;  2ZM8 A;  3EQU A;  3LIF A;  2O0Y A;  1EW0 A;  2XGN A;  1D06 A;  3UPN A;  1RGY A;  3A3J A;  3IXD A;  2DMW A;  3GRJ A;  1N9N A;  1MC0 A;  3EGX C;  3BJN A;  2Q0O A;  4WM9 A;  1TS6 A;  2PRF A;  4NG2 A;  2WGV A;  2Y2P A;  4HOI A;  4UHU A;  5GLA A;  5HL6 A;  1ONH A;  4QHC A;  2C6W B;  4GOG A;  4Y0U A;  3FG8 A;  1H8Z A;  3K3C A;  4EV4 A;  3IH9 A;  5AVF A;  2Y2H A;  4JF6 A;  1CK3 A;  1KGF A;  1YLY A;  1ODV A;  4OPZ A;  4PKY G;  1T18 A;  1LL5 A;  2VX8 A;  2QPN A;  4IBR A;  4R4S A;  3B33 A;  3IWI A;  3TSG A;  3L9K A;  3EEH A;  3S7N A;  4EWF A;  1K25 A;  2IWD A;  3UE0 A;  3LIA A;  5CHU A;  3CUE C;  1QMF A;  3VV4 A;  1E3U D;  5F83 A;  2W1T A;  3KSF A;  2J9O A;  4K91 A;  4PM5 A;  1XJ2 A;  1TS8 A;  3ISG A;  3PBO A;  3UDF A;  4DMZ A;  4HH2 A;  4L0L A;  4BMW A;  4LCM A;  3CUE A;  4XUX A;  4GS9 B;  1DY6 A;  3T4S A;  3T4L A;  5DKL A;  2PDR A;  4EW7 A;  3WS1 A;  3A3I A;  2QHK A;  1S67 L;  1TDL A;  2HDU A;  2PYP A;  2O9A A;  1JTD A;  3GTC A;  2HV1 A;  5FQ9 A;  1P0Z A;  3NHQ A;  5EM0 A;  2OV5 A;  5FAP A;  1WYB A;  2KLI A;  4RX3 A;  4C75 A;  2C5W B;  1W63 M;  4JGR A;  2INW A;  1BLH A;  1PI4 A;  4WBG A;  3PBT A;  1KDS A;  3HRE A;  4KEN B;  4X68 A;  4HP4 A;  2WKE A;  1ERM A;  2AVX A;  1YSP A;  4CQH A;  4D2O A;  3ULF A;  3GEC A;  2ZJ9 A;  4HBT A;  5DFX A;  4HQA A;  3BQ8 A;  2PD8 A;  4Y3I A;  1ZHH B;  4HNB A;  3N8S A;  5DFY A;  2Y2M A;  2EWV A;  4MMN A;  1TS7 A;  3HLD A;  4LV1 A;  1ZG4 A;  4NXE A;  2Q9N A;  1W63 Q;  2DRW A;  5E43 A;  4RA7 A;  2Y4A A;  1CJF A;  1Q2Q A;  1M40 A;  4DJ2 A;  1MZU A;  4YNR A;  2Y2N A;  4OQH A;  1G6O A;  2WKI A;  3V67 A;  4KUO A;  2EXB A;  3E0Y A;  1K6R A;  4Y0O A;  3JPU A;  1PW1 A;  5IT5 A;  4E3M A;  3T4K A;  4R38 A;  1YMS A;  3NY4 A;  1J9M A;  2IA2 A;  1X0O A;  4KZ5 A;  3H9W A;  3LIE A;  2V8F A;  1KE0 A;  3TRC A;  4BL3 A;  5TFQ A;  1O7E A;  2ZC5 B;  3UME A;  1NRJ A;  4QD4 A;  3OPP A;  1PWD A;  1YAX A;  3Q7V B;  2QMI A;  5HAQ A;  1K56 D;  2Z2M B;  1Y4O A;  3OPL A;  1L0E A;  3VP4 A;  5A93 A;  4P6Z M;  4CLC E;  5FQI A;  4EEP A;  3V3R A;  2OWH A;  2ZOH A;  2EFX A;  4OOM A;  3DTE A;  3MZD A;  4Q0I A;  2NUP C;  3CPT B;  3O88 A;  2Y8H A;  3CAX A;  4LCL A;  2G7U A;  5AQA A;  1BLS A;  1S6R A;  2QJ5 A;  2KX6 A;  4HY8 A;  3IWQ A;  2Y59 A;  2V9A A;  1NYY A;  3TG9 A;  2H5S A;  1OME A;  3CG5 A;  4PPR A;  3H7W A;  4FSF A;  2B5R A;  2FFF B;  2PBD P;  2Y2Q A;  3OCL A;  3IS2 B;  5K5B A;  1K0K A;  2DCF A;  4G3V A;  2GDN A;  4I39 A;  4DF6 A;  4YFM A;  4OP8 A;  1K6S A;  4E3O A;  1ZC2 A;  4MBF A;  2P74 A;  2VV7 A;  3ITB A;  4F94 A;  3MXQ A;  3PBR A;  4JPM A;  3SH9 A;  5D3O A;  1W8Q A;  2W27 A;  1OJ5 A;  4OH0 A;  4NXF A;  2WKH A;  4G3W A;  1ERO A;  5CEB A;  2R9X A;  3FYZ A;  4B4X A;  2J7V A;  4R70 A;  3BQA A;  2Y91 A;  4HJ6 A;  1TF1 A;  4Y5F A;  3HJK A;  1BT5 A;  3Q7Z A;  2WZZ A;  1RCJ A;  5FI7 A;  1QME A;  5TBM B;  1K4F A;  3T4Q A;  3HUO A;  1KE4 A;  4MEZ A;  2FZ0 A;  4ZBE A;  2VLG A;  2ZMA A;  3R4K A;  5CGX A;  1FQG A;  3IH8 A;  4JGQ A;  4BEN A;  5FI6 A;  4EXO A;  2Y2J A;  3T1Q B;  3QP5 A;  3NIA A;  3IXG A;  5C5K A;  3PTE A;  4OPR A;  2V8C A;  4H6J B;  1XP4 A;  3M6H A;  2HJE A;  4OLG A;  3CJM A;  3RFB A;  2VGK A;  3N8R A;  3VE4 A;  1GA0 A;  1XJ4 A;  3F1O B;  4YIN A;  3RTY A;  3SZT A;  3ZG0 A;  4X69 A;  3O3V A;  3RXX A;  1PI5 A;  2G2U A;  4GNU A;  4ARZ A;  5A91 A;  4MLL A;  2H0T A;  3T4J A;  1NYM A;  3MSH A;  4MBK A;  3IHB A;  1OTI A;  2K7S A;  4IED A;  2WKP A;  1S0W A;  2O9B A;  4S2K A;  4KQO A;  5HWV A;  1MKI A;  2ZC3 B;  4JGP A;  1BYW A;  1VEU B;  1L0F A;  4R3A A;  4ZAM A;  1PRQ A;  3PYP A;  2A24 B;  3LI9 A;  4K0X A;  2VK3 A;  3VSL A;  3UE3 A;  3WRZ A;  1MPL A;  3F1N A;  4OPY A;  4FCF A;  1FOF A;  2ZMF A;  3T4T A;  4LLO B;  4WEL A;  4YWZ A;  3V50 A;  3GSG A;  2P08 A;  3BEC A;  3BYD A;  4KG2 A;  2J3W A;  1Y28 A;  1N4O A;  2VGJ A;  1E3U A;  4Y7P A;  4EQI A;  3V5M A;  1JNU A;  4E3I A;  3C4P A;  2QKP A; 
#chains in the Genus database with same CATH homology
 4R6L A;  4CLC D;  1TS6 A;  3TW8 A;  1LT0 A;  1OTA A;  4HOI A;  5HL6 A;  4WEK A;  4GJ4 A;  1TS0 A;  4NXG A;  4DN0 A;  5AVE A;  3W2Z A;  3E4P A;  4GLQ A;  3FG8 A;  3K3C A;  3S7O A;  5A8B A;  4PHT A;  5AVF A;  3C8C A;  4EER A;  3PBS A;  4LRZ E;  2Y79 A;  2BAS A;  3K3D A;  3D3O A;  2B18 A;  3UB6 A;  3E98 A;  1ODV A;  4PKY G;  4L9F A;  1T18 A;  2VX8 A;  2J3T C;  3B33 A;  3P7N A;  2L4R A;  3EEH A;  3S7N A;  2OAQ 1;  2NUT C;  3LI8 A;  5HSQ A;  5LBR A;  3MQQ A;  4Q0J A;  3LIA A;  3CUE C;  2V1A A;  4NKP A;  4E04 A;  4DJ3 A;  2W1T B;  1KOU A;  3VV4 A;  5HD3 A;  4MN5 A;  5EFW A;  3CI6 A;  2W1T A;  2D01 A;  3KSF A;  5DF9 A;  1S4R A;  2HF6 A;  2W3G A;  4IHQ A;  1XJ2 A;  1TS8 A;  3PBO A;  4XT2 B;  3FPV A;  4DMZ A;  3A0V A;  4HH2 A;  4L0L A;  4BMW A;  1VB6 A;  5HWT A;  4XT2 A;  1YSQ A;  3CUE A;  2VJW A;  4GS9 B;  3C2W A;  3T4S A;  3T4L A;  2WKQ A;  3EEA A;  5DKL A;  3NOT C;  3MF0 A;  5G4Z A;  3NJA A;  2PDR A;  4EW7 A;  4GS9 A;  5F5Y A;  3LIC A;  2QHK A;  1S67 L;  4K08 A;  5F6A A;  1OPX A;  2PYP A;  2O9A A;  2HV1 A;  1P0Z A;  3B42 A;  3E4Q A;  3NHQ A;  4HH3 A;  2PR5 A;  3C30 A;  1S1Z A;  4M4X A;  2W3H A;  3JVV A;  4UQI S;  2KLI A;  2PD7 A;  1W63 M;  4JGR A;  2INW A;  3VE3 A;  5MC7 A;  3PBT A;  2HJ9 C;  4HP4 A;  1LSV A;  2QJ7 A;  2VZW A;  2JKR M;  3UB7 A;  4I3J A;  3KX0 X;  2ZBB A;  4WF0 A;  3BW6 A;  3KSH A;  2OOL A;  4WN5 A;  1YSP A;  4CQH A;  4IJG A;  4BJP A;  3ULF A;  1UWN X;  3A0S A;  3GEC A;  5DFX A;  2M7V A;  4HQA A;  3BQ8 A;  4LRY C;  2PD8 A;  4Y3I A;  1ZHH B;  5DKK A;  4HNB A;  4IUH A;  2J3T D;  5DFY A;  4HP9 A;  2MJ6 A;  2EWV A;  4MMN A;  1TS7 A;  3LFV A;  5TJJ A;  4EET B;  1F98 A;  2M7U A;  3NOP C;  1S66 L;  4HJ4 A;  4L9E A;  4NXE A;  3JVU A;  3FPW A;  2V0U A;  1W63 Q;  3CLO A;  3R7W B;  2JHE A;  4GW9 A;  3B47 A;  4EES A;  3OBF A;  4UQI M;  3R7W A;  4DJ2 A;  1MZU A;  3PR6 A;  4YNR A;  2GJ3 A;  5G4Y A;  1G6O A;  3EWK A;  3V67 A;  4KUO A;  4I38 A;  3E0Y A;  3BWL A;  2GZA A;  2VV6 A;  3T4O A;  1F9I A;  2XRN A;  4HIA A;  1TD5 A;  3LR4 A;  5IT5 A;  2W3D A;  4EEU A;  3EOI A;  1N9O A;  1DP6 A;  3MR0 A;  3T4K A;  4JGO A;  4R38 A;  3KSI A;  1LSW A;  4ETX A;  5HPI A;  2IA2 A;  1X0O A;  4I5S A;  3TE8 A;  3OOV A;  3H9W A;  1N9L A;  1LSX A;  3KYQ A;  3LIE A;  3ICY A;  1T1B A;  5F68 A;  2WKR A;  3TRC A;  3EGD C;  1IFQ A;  5J7E A;  2D02 A;  2JKT M;  3UME A;  3CIT A;  1NRJ A;  3OCN A;  1DRM A;  4UEY A;  1OT9 A;  5I5L A;  2XA7 M;  2K2N A;  2LB5 A;  3PXP A;  4ME4 A;  1OTE A;  1YAX A;  2W3E A;  2P04 A;  1NLZ A;  2GX5 A;  2O99 A;  2V1B A;  4Z1W A;  3DBA A;  5IS1 A;  4P6Z M;  2W0N A;  1MKM A;  4EQ1 A;  2K31 A;  1H3Q A;  4CLC E;  2PYR A;  4II7 A;  3KSG A;  5HPF A;  5HZH A;  5J4E A;  2Z6D A;  3PBQ A;  1P9W A;  4EEP A;  3S7P A;  2OWH A;  4QPR A;  2ZOH A;  1T1C A;  1OTD A;  4B93 A;  2LB9 A;  4OOM A;  2KDK A;  2PR6 A;  4F3L B;  4Q0I A;  3D72 A;  2NUP C;  1H8M A;  1XFN A;  2VV8 A;  2Y8H A;  3CAX A;  4IUK A;  5AJG A;  3RH8 B;  4OOL A;  4F3L A;  2G7U A;  4MCW A;  3UB9 A;  3A0R A;  2QJ5 A;  3P01 A;  3MQO A;  2P7J A;  4AFI A;  2KX6 A;  4HY8 A;  1S1Y A;  3H7W B;  2V9A A;  3S7Q A;  3GDI A;  4NXB A;  2B02 A;  3H7W A;  2J80 A;  3MJQ A;  3HCY A;  3LID A;  4FSF A;  4ETZ A;  3OCL A;  2VA0 A;  3IS2 B;  5K5B A;  2OAP 1;  3MQ0 A;  4ZRR A;  4G3V A;  3BY9 A;  4HJ3 A;  4I39 A;  2QWS A;  1GSX A;  3LR3 A;  2VV7 A;  3K2N A;  4GHI B;  2H28 A;  3C38 A;  2Z6C A;  3OLO A;  4RQ9 A;  3MXQ A;  1OTB A;  4HI4 A;  4GHI A;  3LR0 A;  4WUJ A;  1P97 A;  3PBR A;  1DP9 A;  3NOU C;  1V9Y A;  1XJ6 A;  4LRX C;  2OWJ A;  2XA7 S;  3CWF A;  4WLA A;  3BY8 A;  2W27 A;  2V0W A;  2W1R A;  3LR5 A;  4EU0 A;  1OJ5 A;  4NXF A;  4O8G A;  3PHY A;  4G3W A;  4P6Z S;  3UMD A;  3FC7 A;  4MDZ A;  4Q0H A;  3KYZ A;  1F5M A;  2EA9 A;  3MMH A;  2QYB A;  4R70 A;  3BQA A;  4KUK A;  4HJ6 A;  3G6O A;  5DJU A;  2VGL S;  4WL9 A;  2YKH A;  5FL3 A;  4PKY A;  4FOF A;  1TF1 A;  4Y5F A;  3IBR A;  3HJK A;  2A2L A;  2I9V A;  4I3I A;  5HWW A;  4Y2F A;  5F69 A;  1YKD A;  2EWW A;  2L0W A;  1NWZ A;  5TBM B;  2PT7 A;  3T4Q A;  2L1M A;  2ZOI A;  1GSW A;  2FZ0 A;  1UGU A;  5KSH A;  5TBM A;  2VLG A;  3R4K A;  1XJ3 A;  3F1P B;  3ZYT A;  3BJN A;  4HHD A;  3SW1 A;  3HJI A;  4JGQ A;  3F1P A;  2VKS A;  5HDC A;  4EXO A;  3TJZ C;  2JKR I;  5C5K A;  1ZTU A;  3ZQ5 A;  2M1C A;  4H6J B;  4BBT A;  4G3K A;  2HJE A;  4KQD A;  2R78 A;  5CX7 A;  4MN6 A;  3RFB A;  4H6J A;  5IU1 A;  2FH5 A;  4EUV A;  3VOL A;  2XSS A;  2PHY A;  3VE4 A;  2VGL M;  1WA9 A;  1XJ4 A;  3F1O B;  3PBN A;  3RTY A;  4BBU A;  3F1O A;  4CLC C;  3UB8 A;  4O01 A;  4ARZ B;  4BWI A;  4PAU A;  1STZ A;  5HD5 A;  2CMN A;  4ARZ A;  2GNX A;  4L9G A;  4CLC B;  2O9C A;  1LL8 A;  3OC2 A;  2VEA A;  4B9O A;  1GSV A;  3T4J A;  4BBV A;  2W3F A;  4CLC A;  3H82 B;  1VHM A;  4GCZ A;  1T1A A;  3H82 A;  3EQV A;  5HDS A;  5J3W A;  1OTI A;  2K7S A;  3LUQ A;  4MN7 A;  2WKP A;  4WEJ A;  4YOF A;  5HDD A;  2O9B A;  4KQO A;  5HWV A;  4O0P A;  1T19 A;  4LPZ A;  3T50 A;  2KOI A;  1UWP X;  3IS2 A;  4NEE D;  1OJG A;  1OT6 A;  1V9Z A;  4JGP A;  1BYW A;  2HGV A;  4R3A A;  3O5Y A;  1P9R A;  1S4S A;  3PYP A;  1XFQ A;  2A24 B;  1DP8 A;  3LI9 A;  3U2A A;  2JKT I;  2ZMV A;  3E4O A;  3F1N B;  3UE3 A;  2A24 A;  3LYX A;  2XRO A;  1G28 A;  3F1N A;  5L8M A;  4I3A A;  1NLY A;  3MFX A;  2ZMF A;  3T4T A;  4LLO B;  4WEL A;  5DJT A;  4YWZ A;  2P08 A;  1D7E A;  1Y28 A;  2J3W A;  3KO6 A;  3IBJ A;  5KIZ A;  3EQU A;  3LIF A;  2O0Y A;  1JNU A;  1EW0 A;  3UE6 A;  1IOU A;  1D06 A;  2JN7 A;  2YKF A;  2DMW A;  1N9N A;  1MC0 A;  3EGX C;  3LIB A;  2QKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...