3TRCA

Structure of the gaf domain from a phosphoenolpyruvate-protein phosphotransferase (ptsp) from coxiella burnetii
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
168
structure length
168
Chain Sequence
SNAMNMLKILRQITQEVNAAPNLEQALKLVVVRLCEALPADACSLFICDDVHGEYVLMATQGLNSKQVGKLRLKFGEGLIGLVGEREEPINLADAPLHPAYKHRPELGEEDYHGFLGIPIIEQGELLGILVIQQLESHHFAEEEEAFCVTLAIHLAAEIAHARAKGAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoenolpyruvate-protein phosphotransferase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 47
structure length 168
sequence length 168
ec nomenclature ec 2.7.3.9: Phosphoenolpyruvate--protein phosphotransferase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3trcA00
2G7UA 2KOIA 5HPIA 4R6LA 4ETXA 4MN7A 3ZQ5A 2VKSA 5LBRA 3NOUC 4E04A 4ME4A 2W3EA 2IA2A 4R70A 3KSIA 4G3VA 5C5KA 4G3WA 2B18A 2VZWA 2VJWA 3G6OA 3MF0A 4GLQA 2W1RA 3S7QA 3IBRA 1TD5A 3DBAA 4Y5FA 2M7UA 2OOLA 2W3GA 4MCWA 4ETZA 2ZMFA 4Z1WA 1STZA 3MMHA 3O5YA 2Y79A 4G3KA 3NOPC 3K2NA 3MQ0A 3E0YA 3S7OA 4MMNA 3RFBA 3S7NA 5DFYA 1YSQA 2LB5A 3IBJA 2HGVA 1MKMA 2W3HA 4CQHA 4DN0A 4QPRA 3KSHA 4IUKA 3C2WA 3EEAA 4BWIA 4PAUA 2O0YA 3BJNA 4FOFA 1TF1A 2O9CA 2XSSA 3D3OA 2K2NA 4LRYC 2W3DA 4YNRA 1VHMA 1F5MA 4ZRRA 3KSGA 5HPFA 4EU0A 1YKDA 3KO6A 2GX5A 2O9AA 3VV4A 3W2ZA 3HCYA 4O01A 4YOFA 5AJGA 4IJGA 2XROA 3CI6A 4Q0IA 2W3FA 3NHQA 2M7VA 4Y3IA 3S7PA 3OBFA 2VEAA 4O0PA 4MDZA 5TJJA 2O99A 2K31A 3CITA 3NOTC 1YSPA 1ZTUA 2Y8HA 2LB9A 2XRNA 4GW9A 4Y2FA 5K5BA 4Q0HA 3R4KA 5I5LA 4EUVA 5DFXA 4O8GA 5HSQA 2KLIA 2QYBA 4DMZA 2W1TA 5HL6A 3OOVA 3TRCA 2O9BA 4LRXC 5L8MA 4Q0JA 3KSFA 3E98A 2W1TB 4RQ9A 4IUHA 3LFVA 4LRZE 1MC0A
chains in the Genus database with same CATH superfamily
4PHTA 2FFYA 2BTFP 4IBXA 4R6LA 4F3LA 4OOMA 3MBZA 3ZQ5A 4ZAMA 1Q2PA 3LICA 4S2OA 1ALQA 3VSKA 5FQ9A 1IYQA 3HLGA 4NKPA 4KG2A 1TVFA 1T1CA 3ZG8B 4BBTA 2JC7A 2IWDA 4JF4A 3ZNYA 4E3OA 2XF3A 3B42A 5F5YA 2ZMFA 3KYEA 2W27A 1CQAA 1OMEA 5HDSA 4HNBA 2ZOHA 3RFBA 3LI9A 1VQQA 4F3LB 1XP4A 5G4YA 5CHJA 1TS6A 2Q9NA 3QP6A 2H10A 1AXBA 4U0TA 3D4FA 4PAUA 4Y0UA 3IS2A 1BLPA 1GHPA 5EECA 5HDCA 5G18A 3IX8A 4ZJ2A 1IOUA 3UDIA 4FH2A 1PWDA 1FR1A 3PYPA 5F83A 2Y2OA 4K08A 1K56A 4OONA 5DF9A 4EEPA 2M1CA 2EFUA 2X71A 1LL5A 5GLAA 1ZG6A 4Y2FA 3E2KA 5U47A 3C4OA 2X02A 5CXWA 1H3QA 2XLNA 3PXPA 1I5QA 1LI0A 1HLUP 5FQJA 4RQ9A 1YQSA 3DTKA 1PFLA 4JGOA 1XJ4A 2G7UA 3OPLA 5HPIA 3NBLA 3NOUC 2HZ5A 3GV9A 3KSIA 2EXAA 2ZMVA 3LIAA 5AQAA 1DP9A 4HJ6A 4LCLA 1JWPA 3ULFA 3HBRA 1TDLA 3PBQA 2HDSA 4HP9A 4OPZA 1ES5A 1AWIA 3OZHA 3QP1A 3G4PA 4CLCC 4LV2A 1ODVA 3UB8A 1YMXA 2WK0A 3DTEA 1FSWA 1MKMA 4KQDA 3KYZA 3OPRA 5DJTA 2ZC5B 1N9BA 4E3KA 2ZOIA 3MXSA 4OOLA 3QP2A 2NUPC 3RXXA 4E3LA 5DF8A 1KE0A 1GA9A 4GKUA 2L1MA 3ZGAB 4JF5A 3PBTA 2VX8A 4WL9A 1PW8A 4P6BA 2IWBA 1Q2QA 3V50A 1FSYA 5GL9A 1QMFA 3BYDA 5F69A 4OLDA 1OT9A 1T1AA 2PDRA 1H0MA 3V5MA 2ZQAA 3BFGA 4PM6A 4PM9A 5DFXA 1PZPA 4LENA 3G30A 3UMEA 1EROA 4DF6A 3MZDA 1JWZA 4I3IA 4L0LA 3LFVA 2V0WA 3B33A 1OTBA 3CJMA 1BLCA 4ETXA 2VKSA 3IXGA 4E04A 2VV6A 4M3KA 5CEDA 4G3WA 1XJ3A 2ACGA 2E8JA 2HP9A 1KE4A 2Y4AA 2XQZA 5M1AA 4S2IA 3V67A 1GHMA 3ZNTA 4UHUA 3S7QA 3TOIA 3OCLA 2PBYA 1STZA 4I39A 2Y2NA 5HWTA 1OTEA 1L0EA 1NLYA 1RCJA 3PBSA 2VGJA 4OQGA 2JKTM 3BRMA 4WM9A 5HAQA 1TDGA 3P09A 1IKGA 1RP5A 2A2LA 3LYXA 4IUKA 4QJGA 4BENA 1LL9A 2Y2MA 1K54A 1S4RA 1OJGA 1V9YA 3NDGA 3KSGA 1HD8A 3H82A 4EBNA 1YM1A 1UWNX 2Y2LA 4JKTA 4ZDXA 4DE0A 5KSCA 4NG2A 2JBFA 1YSPA 3LO7A 1BTLA 3DW0A 4UAAA 4N92A 3GDIA 3T4OA 2J8YA 4II7A 4KQOA 1JVJA 3M6BA 5I5LA 5HSQA 2KLIA 4LCMA 2W1TA 4E3NA 3H82B 4UA7A 4BLMA 2IWCA 5AQBA 4ZBEA 3IX3A 3ZYTA 3WS4A 1DJBA 3C5AA 4MBHA 3FKVA 2V8CA 4E3IA 5LBRA 1U60A 1UWPX 4DE3A 1BLSA 1LT0A 2HJ9C 2VJWA 3GSGA 4OP8A 4DJ3A 4N1XA 3EQVA 5CTNA 4BD0A 1K54C 2EFXA 3IQAA 4FCFA 2VK3A 2Y79A 2B02A 3N8SA 1DJAA 3UPNA 1W79A 4FUWA 3TG9A 4Y15A 5HW3A 3T4QA 1IFQA 5CEBA 3BY8A 4KZAA 4B88A 3C30A 4R3BA 3ZG5A 3VFHA 2ZQ7A 4NXBA 1Z6FA 2R78A 3BJNA 1W7FA 4JXVA 5IHVA 1CF0A 2WGWA 4LRYC 1NZOA 2GDNA 1OTAA 2GJ3A 2WKEA 5TFQA 1YKDA 2CC1A 2PR5A 2JHEA 3UPOA 2OV5A 3OCNA 4OPYA 5MC7A 1KGFA 3FPVA 1VEUA 4MDZA 5HD5A 3IH8A 1XPBA 2O99A 3ZG0A 2J9PA 4OKPA 4HP4A 3HLWA 3QP8A 3MR0A 4WLAA 1G28A 2DCFA 2C5WB 1K55A 5EE8A 1MXOA 2K7SA 4UQIS 2PR6A 3BY9A 4S2LA 4Y13A 3SS3A 3E98A 1X0OA 3CMZA 1Y4OA 1VEUB 1EW0A 2XD5A 5CGWA 1PZOA 5KMWA 4KUOA 2HP5A 3IHAA 4WZ5A 2PAVP 5C5KA 3H9WA 5L10A 3SW1A 2GNXA 3BQAA 4HQAA 1JTDA 4Y5FA 4R4SA 4EXOA 5F68A 4MCWA 1WYBA 1FCOA 3ICYA 3O87A 1K57A 3LR5A 4NETA 5J3WA 5KSHA 2ZM2A 3WS2A 4AFIA 3VP2A 1SKOA 2JKGA 3HVFA 5TGFA 3P7NA 3IXBA 2UWXA 2B5RA 1YLPA 1PWGA 3TSGA 4B4XA 3LGOA 5A92A 3HLCA 5E43A 1D1JA 1C3BA 3BLSA 2ZBBA 1OPXA 5FDSA 1MWSA 2W3DA 4YNRA 2ZC6B 3A0SA 5DF7A 5L2FA 1K55C 1TS8A 2P7JA 4O01A 1ZG4A 3Q07A 4ARZB 1ACFA 1NRJA 4LV0A 3CITA 4S2PA 4LLOB 4S2KA 4X1LA 1YLJA 3A3DA 4IHQA 4JBFA 4DDYA 3U4LP 3C8CA 2I9VA 5FI6A 1I2SA 2Y2JA 3E4OA 4KZ6A 1GCEA 3T1XA 3ITBA 1KGGA 1K57C 4DXBA 4OOYA 4X68A 4PM7A 4GN2A 3HUMA 1G6OA 5HDDA 2PD7A 5L09A 2VZWA 3UB5P 4HBUA 3OPHA 2W0NA 1HVBA 1M40A 4G3KA 1H5XA 3LIEA 4C6YA 4K0WA 2D01A 2VA0A 5KIZA 5AVEA 3WRZA 2GZAA 3QNCA 5DFYA 3G35A 2HGVA 1GSVA 4X56A 4R38A 4QB8A 3ZDJA 4OP5A 1SDNA 4CQHA 1D06A 4DDSA 3V39A 3E2LA 3O88A 2V1ZA 1WE4A 3AGEA 1ESIA 5A91A 2WUQA 4P87A 4BBUA 3T4LA 4MBKA 4HHDA 3FWLA 2HJEA 2BG1A 4LPZA 3NJAA 2OWHA 3LY4A 4Y3IA 1E3UA 3S7PA 5L07A 2YKFA 4H6JB 3T1RA 3HLDA 5GLDA 4ZTKA 1NRFA 1CK3A 1XX2A 2XRNA 4CLCA 1G5UA 1K0KA 5F6AA 1M6KA 4PKYA 5CGSA 4O8GA 3MKEA 2ZLYA 5DTKA 1IYSA 4CLCE 4D60A 5IT5A 2A3UA 3KSFA 3S22A 3GTCA 3NC8A 2EX6A 3MSHA 3SH7A 1P9WA 4U0XA 1DJCA 3M2KA 1P97A 1LL8A 1Y54A 3C4PA 3H7WA 5FSRA 2VV8A 4WBGA 2WZXA 1K6SA 4XUZA 4CLCB 5J4EA 5AVFA 3HL9A 2RCXA 3IHBA 4BJPA 3WRTA 2OOLA 1H8ZA 3O5YA 1IELA 4K91A 4IBRA 3NDEA 3M2JA 3T12B 3T1SA 3CG5A 4S2NC 1LHYA 4OQIA 4HEFA 3BECA 1TEMA 2DRWA 4E3MA 3H7WB 3CUEC 4LGWA 1SHVA 3FZCA 2HPBA 2BLSA 2R9XA 2OAP1 5CTMA 5DKKA 2DNSA 3FKWA 1XXMA 1DY6A 3ZVTA 3E4PA 3IWIA 2HDUA 3TJZC 3NECA 2QKPA 1KDWA 2XROA 5EPHA 4JF6A 3W8KA 5TJJA 4Y7PA 1ZTUA 4GDBA 3HUOA 1E25A 2V0UA 4BL3A 3RTYA 5F1FA 1PIOA 4KZBA 3P98A 3PTEA 2J9OA 4R4RA 3SH9A 3R4KA 2HDQA 3CLOA 2ZM0A 1P9RA 4Y0TA 5HL6A 3DWKA 3FG8A 4LRXC 5L8MA 4I3AA 1MY8A 4LRZE 5F1GA 4X55A 2ZQDA 3GVBA 4MN7A 5I94A 4I38A 3W4OA 5TR7A 5E2GA 4GB7A 5TBMA 1J9MA 4R23A 3HJIA 3IBRA 5EOOA 5HD3A 5HAIA 4KQQA 4WEJA 4XXRA 4N1HA 3PAEA 4UQIM 3T50A 5DTTA 1ES4A 4EQ1A 2LB5A 3IT9A 5CERA 1YT4A 2KX6A 3KSHA 5GLCA 5IU1A 4IVKA 5TBMB 1L0GA 1CJFA 2JKFA 4KUKA 3SZTA 4X6TA 5J7EA 4ZJ1A 3GRJA 2XSSA 4FSFA 1F2KA 3L9KA 2ZMAA 1DRMA 3IWQA 2V2FF 3VP0A 4ZRRA 4EUZA 2Z2MB 2GX5A 3V3SA 1YLWA 3UN7A 4EQIA 5HARA 4NXFA 2J7VA 3S1YA 3EOIA 3A3EA 4OQ0A 2I72A 4PPRA 3UE0A 4KZ8A 2Y55A 4QU3A 1N9LA 4GW9A 3ISGA 5CX7A 2HDRA 3VP4A 5K5BA 4QWOA 4Q0HA 3UDFA 1GHIA 4DRTA 4X25A 4HH2A 4HH3A 1K38A 3WS1A 3R7WB 5KZHA 4EESA 2PYRA 5A8BA 5EV0A 1J3WA 2CMNA 2KOIA 1BUEA 2ZC4B 3N7WA 5FI7A 2ZQ8A 4KZ3A 4R70A 3UY6A 4EERA 3UB7A 4BQMA 3KX0X 3V3RA 1E3UD 4S2MA 1L0FA 4ZJ3A 3A3FA 3MXRA 3G32A 3CPTB 2PU2A 5CECA 1F9IA 4GS9A 2ZQ9A 3MQ0A 4N9LA 1K4FA 4CLCD 5JYOA 3BQ8A 3IBJA 3LEZA 1ERMA 2Q0OA 5M18A 2HV1A 3A3IA 4K0XA 2W3HA 3MS6A 5DTSA 4BWIA 2L0WA 3IX4A 2O0YA 2YKHA 1W63Q 5JYPA 3M6HA 1BZAA 3OLOA 3ZG9B 4QY6A 4LFUA 4EU0A 1OT6A 4GS9B 3PR6A 1CEFA 3CI6A 1FR6A 1PI4A 1S67L 4I3JA 3O86A 1SCWA 4CJNA 3G2ZA 1H8YA 4Z9QA 2EWVA 2G2UA 3N8RA 1O7EA 3PBOA 1QMEA 2VLGA 4U3TA 5HAPA 2UV0E 2ZC7A 2G2WA 2INWA 4KENB 4NXEA 4EUVA 3VP1A 4PKYG 4DMZA 1LSXA 3HJKA 1T1BA 3UMDA 2WYXA 2FZ0A 2O9BA 1P0ZA 4BMWA 2EA9A 4KZ4A 3RJUA 2ZL1B 4HY8A 4QY5A 3BM6A 1MZUA 1ZC2A 3MFDA 3G31A 1CI9A 1T18A 3A0RA 4R1GA 4HI4A 3E4QA 5EUAA 3LY3A 4DJ2A 3RH8B 1SKFA 1BLHA 1TD5A 1FCMA 1SZVA 2JKRI 4S2JA 3MMHA 3MQQA 3NIAA 1PI5A 1KVLA 4RVAA 5FQKA 4CPKA 4LV3A 2Q9MA 3S7NA 2WAFA 2H5SA 1MKIA 3LI8A 4GHIB 3I7JA 2VGLS 3C2WA 1S66L 3HLEA 4NXGA 3RXWA 3LR4A 5FQIA 1S4SA 5AQ9A 3KO6A 2JN7A 4KG5A 3VV4A 3HCYA 4ARZA 2XEPA 4IJGA 3Q7ZA 4HBTA 2A24B 2ZQCA 4HJ3A 3UNWA 3IF6B 4JXWA 2OAQ1 4KG6A 1XA7A 2DMWA 3UB6A 2RL3A 1Y28A 2LB9A 5GHYA 1XGIA 2AVXA 3GECA 3UPPA 3DWZA 4JGPA 1MWTA 4WMCA 2H0TA 2OLVA 3IWOA 4WYYA 1ES3A 4KQRA 4IUHA 5FASA 3Q1FA 5E2FA 1T19A 3CHWP 4E6XA 3VOYA 2WAEA 2W3EA 2IA2A 1L3LA 4G3VA 2EXBA 5FI2A 4HESA 1D7EA 3IF6C 1IYPA 5EOEA 2WGVA 2XFTA 3MJQA 3MXQA 2OWJA 4MN6A 5DVAA 4HOIA 1IKIA 5A90A 1O07A 3BEBA 2NUTC 1BYWA 1G68A 3B3XA 1L2SA 2XR0A 2J3TC 3S7OA 4MLLA 4MMNA 3A0VA 1ZHHB 1PNEA 3DAVA 5EVIB 2V8FA 3UB9A 4DN0A 2FH5A 1TS7A 2WGIA 4RX2A 3EEAA 3B47A 1W63M 3QHYA 5F82A 2EWWA 5CGXA 4DKIA 3FC7A 3ZVWA 1VHMA 3Q82A 3LCEA 3EWKA 4YWZA 1KE3A 2V20A 3D9YA 5HPFA 1RGYA 2WKQA 4EBPA 4UA9A 1CI8A 4H6JA 2W3FA 3MZEA 4GCZA 1TS0A 1YLYA 4PM8A 2K31A 3CWFA 1A0KA 3G2YA 3JYIA 5HFOA 1EI5A 5EVIC 4EV4A 3ZHHA 4BL2A 3A3JA 2PBDP 3N6IA 3BFFA 4L9EA 4OPRA 2Z2LB 4S2NA 3EQUA 4IEDA 4X53A 2JCHA 3TW8A 3CUEA 1ERQA 1PYYA 2H28A 4P6ZS 3C38A 4X69A 2Y2GA 3T4TA 4KZ9A 2EX9A 3BWLA 3EGXC 4FTXA 4ME4A 2B18A 5FEGA 4JXGA 3G6OA 3LR0A 1F98A 2XA7S 4M4XA 2M7UA 2W3GA 4EWFA 1IYOA 3BFCA 3W4PA 4JPMA 1NY0A 1FILA 2V9AA 1YMSA 1KOUA 3JVUA 5GHXA 3VOLA 3UE6A 4QHCA 2PRFA 1NJ4A 1JNUA 2ZC3B 5FDHA 4QPRA 1W8QA 4OQHA 5FA7A 4FOFA 1TF1A 3IF5A 1MWUA 3IXHA 3GMWA 3EEHA 3IS2B 1F5MA 3MKFA 3VSLA 2P04A 2R9WA 3C7VA 5HZHA 2D02A 4NEED 5AJGA 1FIKA 4XUXA 3Q81A 4EBLA 2HF6A 2Y2QA 3NOTC 4EETB 4RX3A 4MNRA 1N9OA 2MJ6A 2PHYA 4Y17A 2XFSA 4GD6A 4GD8A 3PBNA 4EEUA 3SH8A 2J80A 1Z09A 5FQMA 4HJ4A 1E4DA 4N9KA 4WUJA 3IH9A 3DTMA 4Q0JA 4EW7A 3ZCZA 1ES2A 3PAGA 3UE1A 1G6AA 1YPRA 2V1AA 4ESPA 1ZKJA 3VE4A 4P85A 3K3DA 2J3TD 2X01A 3T4SA 3JVVA 3QNBA 1GSXA 4E3JA 2ZD8A 1CEGA 1W8YA 2V1BA 2Y2KA 2Y91A 2Z6CA 2XDMA 1NYMA 3HLFA 2WKIA 5EM0A 5GHZA 4JGRA 3CZDA 4ETZA 2WZZA 1YLTA 3GR2A 3LEQA 4RA7A 3NOPC 4NK3A 4YFMA 3E0YA 2WADA 2PT7A 2QMIA 4IVIA 4WMCD 4BD1A 5HL1A 3UO9A 3BLMA 1V9ZA 3NCKA 4OH0A 2XK1A 1OTIA 3G34A 3CAXA 2PD8A 5A93A 2E8IA 2H0YA 4WZ4A 3D3OA 2JKRM 5EVID 3BFEA 1OJ5A 5EVEA 4KZ5A 1PW1A 3W2ZA 4H8RA 5HWVA 1YAXA 3MQOA 2QJ5A 1KVMA 2VEAA 4O0PA 4RYEA 5D3OA 5E2EA 3OPPA 4O7DA 4GDNA 1LI9A 3BW6A 2QJ7A 2Y8HA 4PMAA 4Q8IA 2VGLM 2KDKA 3VOZA 3R7WA 2EX2A 3OOVA 1VETA 3AGDA 4B4ZA 5M19A 1MC0A 1W5DA 1S1YA 4WF0A 1N4OA 3T4KA 5HX9A 1H8MA 4C3QA 2FFFB 3CPTA 4A5RA 3UE3A 4B9OA 1ESUA 4R0QA 4F94A 2XGNA 3F1PA 1VETB 2L4RA 4OVDA 1XFQA 4FH4A 1NLZA 3WS5A 1VB6A 1OTDA 3LIFA 3LUQA 2WKRA 1EWZA 4MBFA 5EFWA 4E6WA 1YLZA 2ZJ9A 3S4XA 3N4IA 1RGZA 1LLBA 3T1QB 2Y59A 3W4QA 4DE1A 3F1PB 4R3AA 3OC2A 2O9AA 4YOFA 1LSVA 3HREA 4XT2A 4KZ7A 4Q0IA 1BULA 5CHMA 3NHQA 1XJ6A 3D72A 1HZOA 2JE5A 2XH9A 5FEFA 2HP6A 3MZFA 3QP4A 3LR3A 3BFDA 4WELA 2ZL1A 3ITAA 1K56D 4OPQA 2EX8A 1BSGA 4XT2B 2W1TB 4JGQA 4MN5A 1XFNA 5HWWA 4BBVA 1K25A 1XKZA 1BT5A 5BOHA 1L0DA 5FL3A 1GA0A 2WKHA 4C75A 5G4ZA 2P08A 1SDEA 3DBAA 4JLFA 1PWCA 5AQ7A 2BASA 3F1NA 5CRFA 3F1OA 3O3VA 2ZM8A 4GNUA 5E2HA 3SS4A 1XJ2A 2VV7A 3K2NA 2P9VA 2C6WB 1YSQA 1DP6A 4GHIA 4LV1A 1GSWA 5FAOA 4P6ZM 3WS0A 5EVLA 5J8XA 4D2OA 3IXDA 2O9CA 5CHUA 3F1NB 5GLBA 4DE2A 2XA7M 3F1OB 1WA9A 2A24A 2WGWB 3FV7A 1KGEA 1MWRA 3FYZA 2QWSA 4YINA 2P9VB 3SS5A 3IF6A 2M7VA 3OBFA 1UGUA 4WEKA 4L9GA 2Y2IA 4P0MA 4B93A 4JXSA 2XD1A 3SOIA 3U2AA 2Y2HA 2B95A 3HUNA 3VP3A 3K3CA 5FAPA 3L7HA 1ONGA 1S1ZA 2A49A 2WKPA 2QZ6A 1VM1A 4MEZA 5FQQA 3VFFA 1HTZA 5DKLA 3VMAA 2P74A 3KYQA 3AGFA 1K4EA 1MBLA 1MPLA 2QPNA 4UEYA 2Y2PA 3TE8A 1S6RA 3LIBA 3ZG7B 4WN5A 3DTIA 1ONHA 2JKTI 1KDSA 4GZBA 3QP5A 3NI9A 2OSUA 1N9NA 4UA6A 2VGKA 3MF0A 4PM5A 3PHYA 4GLQA 2W1RA 1NXYA 1FQGA 5EM1A 4Z1WA 4QD4A 1I2WA 3C7UA 3N8LA 2PYPA 4FD8A 1S0WA 4GOGA 5EVIA 1PRQA 2QHKA 3MFXA 3Q7VA 3GQZA 5FATA 1FCNA 2J3WA 3NY4A 1SKOB 1DP8A 4HIAA 3VE3A 3UDXA 2OLUA 1IEMA 2Z6DA 3ZFZA 4OLGA 2K2NA 5IS1A 3P01A 4WZ5C 4DXCA 1LSWA 4GJ4A 4ID4A 4Y0OA 1NZUA 3JPUA 1K6RA 3EGDC 3PBRA 3Q7VB 1FOFA 4R3JA 1JTGA 4I5SA 5DJUA 4L9FA 1XGJA 1JWVA 3WWXA 3T4JA 1NYYA 1NWZA 2QYBA 3HLBA 1WYCA 5FAQA 3TRCA 3NULA 2PU4A 3FPWA 3LIDA 4X1MA 1XA1A
chains in the Genus database with same CATH topology
2CMNA 1EW0A 4PHTA 2V1AA 2KOIA 4KUOA 4R6LA 3VE4A 4F3LA 3K3DA 2J3TD 4OOMA 3ZQ5A 3T4SA 3JVVA 4R70A 3LICA 1GSXA 4EERA 5C5KA 3UB7A 3H9WA 2Z6CA 2V1BA 3KX0X 4NKPA 3SW1A 2GNXA 1T1CA 4BBTA 3BQAA 4HQAA 4Y5FA 4EXOA 5F68A 4JGRA 4MCWA 3B42A 5F5YA 4ETZA 2ZMFA 3ICYA 2W27A 3LR5A 5J3WA 1F9IA 3NOPC 4GS9A 3MQ0A 5KSHA 4AFIA 5HDSA 4CLCD 4HNBA 3E0YA 2ZOHA 3RFBA 2PT7A 3BQ8A 3IBJA 3LI9A 4F3LB 2HV1A 5G4YA 2W3HA 3P7NA 1TS6A 1V9ZA 4BWIA 1OTIA 2L0WA 3CAXA 2PD8A 4PAUA 2O0YA 3IS2A 2YKHA 2ZBBA 1W63Q 1OPXA 3D3OA 2JKRM 2W3DA 4YNRA 5HDCA 1OJ5A 3OLOA 1IOUA 3A0SA 4EU0A 1OT6A 4GS9B 1TS8A 2P7JA 3W2ZA 4O01A 3PR6A 3CI6A 3PYPA 1S67L 1YAXA 5HWVA 3MQOA 2QJ5A 2VEAA 4I3JA 4O0PA 4ARZB 4K08A 1NRJA 2EWVA 3CITA 5DF9A 3PBOA 4EEPA 2M1CA 2VLGA 4LLOB 3BW6A 2QJ7A 2Y8HA 2INWA 2VGLM 4Y2FA 4IHQA 2KDKA 1H3QA 4NXEA 4EUVA 3PXPA 3C8CA 4PKYG 3R7WA 2I9VA 4DMZA 1LSXA 3HJKA 1T1BA 3UMDA 3OOVA 2FZ0A 2O9BA 1P0ZA 3E4OA 4BMWA 4RQ9A 2EA9A 4HY8A 1MC0A 1MZUA 4JGOA 1XJ4A 2G7UA 5HPIA 1S1YA 4WF0A 3NOUC 3T4KA 1T18A 1G6OA 3A0RA 3KSIA 5HDDA 2ZMVA 2PD7A 4HI4A 1H8MA 3E4QA 3LIAA 2VZWA 1DP9A 4DJ2A 3RH8B 4HJ6A 3UE3A 1TD5A 4B9OA 3ULFA 2W0NA 2JKRI 3PBQA 4HP9A 3MMHA 3MQQA 4G3KA 3F1PA 3LIEA 5KIZA 2D01A 2L4RA 2VA0A 5AVEA 4CLCC 1XFQA 1ODVA 2GZAA 1NLZA 3S7NA 5DFYA 3UB8A 1VB6A 1OTDA 3LIFA 2HGVA 1GSVA 3LUQA 2WKRA 4R38A 1MKMA 3LI8A 4KQDA 5EFWA 4CQHA 3KYZA 1D06A 5DJTA 4GHIB 2VGLS 2ZOIA 3C2WA 1S66L 4OOLA 2NUPC 4BBUA 3T4LA 4NXGA 4HHDA 2L1MA 3LR4A 2HJEA 3PBTA 1S4SA 2VX8A 3F1PB 4LPZA 3KO6A 3OC2A 4R3AA 4WL9A 2O9AA 2JN7A 3VV4A 3NJAA 3HCYA 1LSVA 4YOFA 4ARZA 2OWHA 4IJGA 4XT2A 4Q0IA 2A24B 3NHQA 4Y3IA 1XJ6A 3S7PA 4HJ3A 3D72A 2YKFA 4H6JB 2OAQ1 5F69A 1OT9A 1T1AA 2PDRA 2DMWA 3UB6A 1Y28A 2LB9A 2XRNA 4CLCA 3LR3A 3GECA 5F6AA 4PKYA 4JGPA 5DFXA 4WELA 4O8GA 3UMEA 4CLCE 5IT5A 3KSFA 4XT2B 2W1TB 1P9WA 4JGQA 4I3IA 4IUHA 3LFVA 4L0LA 4MN5A 2V0WA 1XFNA 3B33A 1OTBA 5HWWA 1P97A 4ETXA 1LL8A 1T19A 4BBVA 2VKSA 3H7WA 4E04A 2W3EA 2IA2A 5FL3A 2VV6A 2VV8A 4G3VA 4G3WA 1XJ3A 1D7EA 5G4ZA 2P08A 3V67A 4CLCB 5J4EA 3MJQA 5AVFA 3MXQA 2OWJA 4MN6A 3S7QA 3DBAA 4HOIA 3OCLA 4BJPA 2OOLA 1STZA 2BASA 4I39A 3F1NA 2NUTC 3F1OA 3O5YA 1BYWA 5HWTA 1OTEA 1XJ2A 2VV7A 3K2NA 1NLYA 2J3TC 3S7OA 3PBSA 4MMNA 3A0VA 1YSQA 1ZHHB 1DP6A 4GHIA 1GSWA 2JKTM 3UB9A 3H7WB 3CUEC 4DN0A 4P6ZM 2A2LA 1TS7A 2FH5A 3LYXA 4IUKA 3EEAA 3B47A 2OAP1 1W63M 2EWWA 5DKKA 2O9CA 1S4RA 3FC7A 1OJGA 1VHMA 1V9YA 3EWKA 3F1NB 4YWZA 2XA7M 3F1OB 3E4PA 1WA9A 2A24A 3KSGA 5HPFA 3H82A 2WKQA 3TJZC 2QWSA 1UWNX 2QKPA 2XROA 4H6JA 2W3FA 2M7VA 4GCZA 3OBFA 1UGUA 4WEKA 1TS0A 4L9GA 5TJJA 4B93A 3U2AA 2K31A 3CWFA 1YSPA 1ZTUA 2V0UA 3K3CA 3RTYA 1S1ZA 3GDIA 2WKPA 3T4OA 4II7A 4L9EA 4KQOA 3R4KA 5I5LA 3CLOA 5DKLA 3EQUA 2KLIA 1P9RA 5HSQA 2W1TA 5HL6A 3TW8A 3KYQA 3H82B 3CUEA 3FG8A 4LRXC 5L8MA 4I3AA 4UEYA 4LRZE 3ZYTA 3TE8A 3LIBA 2H28A 4P6ZS 4MN7A 4WN5A 5LBRA 1UWPX 2JKTI 3C38A 4I38A 3T4TA 3BWLA 3EGXC 4ME4A 1LT0A 1N9NA 2B18A 2HJ9C 5TBMA 2VJWA 3G6OA 3LR0A 3MF0A 1F98A 3PHYA 4GLQA 2W1RA 4DJ3A 2XA7S 3HJIA 3IBRA 4M4XA 2M7UA 2W3GA 3EQVA 5HD3A 4Z1WA 4WEJA 2PYPA 2Y79A 2V9AA 2B02A 4UQIM 1KOUA 3T50A 3JVUA 3VOLA 3UE6A 2QHKA 4EQ1A 2LB5A 3T4QA 1IFQA 3MFXA 3BY8A 1JNUA 2J3WA 3C30A 1DP8A 4HIAA 4QPRA 2KX6A 3KSHA 5IU1A 3VE3A 4NXBA 5TBMB 2R78A 3BJNA 4FOFA 1TF1A 4KUKA 5J7EA 2Z6DA 2XSSA 4FSFA 2K2NA 4LRYC 5IS1A 3EEHA 3P01A 1OTAA 3IS2B 1F5MA 1DRMA 1LSWA 2GJ3A 4GJ4A 4ZRRA 2P04A 1YKDA 2GX5A 2PR5A 5HZHA 2JHEA 2D02A 4NEED 5AJGA 3OCNA 3EGDC 5MC7A 4NXFA 3PBRA 3FPVA 4MDZA 5HD5A 3EOIA 2HF6A 2O99A 3NOTC 4EETB 4I5SA 5DJUA 4HP4A 1N9OA 2MJ6A 3MR0A 1N9LA 2PHYA 4GW9A 4L9FA 4WLAA 1G28A 3PBNA 5CX7A 4EEUA 5K5BA 3T4JA 2J80A 4Q0HA 1NWZA 4HJ4A 2K7SA 2QYBA 4UQIS 2PR6A 3BY9A 3TRCA 4HH2A 4WUJA 3FPWA 4HH3A 4Q0JA 4EW7A 3R7WB 3E98A 1X0OA 3LIDA 4EESA 2PYRA 5A8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7U A;  2KOI A;  5HPI A;  4R6L A;  4ETX A;  4MN7 A;  3ZQ5 A;  2VKS A;  5LBR A;  3NOU C;  4E04 A;  4ME4 A;  2W3E A;  2IA2 A;  4R70 A;  3KSI A;  4G3V A;  5C5K A;  4G3W A;  2B18 A;  2VZW A;  2VJW A;  3G6O A;  3MF0 A;  4GLQ A;  2W1R A;  3S7Q A;  3IBR A;  1TD5 A;  3DBA A;  4Y5F A;  2M7U A;  2OOL A;  2W3G A;  4MCW A;  4ETZ A;  2ZMF A;  4Z1W A;  1STZ A;  3MMH A;  3O5Y A;  2Y79 A;  4G3K A;  3NOP C;  3K2N A;  3MQ0 A;  3E0Y A;  3S7O A;  4MMN A;  3RFB A;  3S7N A;  5DFY A;  1YSQ A;  2LB5 A;  3IBJ A;  2HGV A;  1MKM A;  2W3H A;  4CQH A;  4DN0 A;  4QPR A;  3KSH A;  4IUK A;  3C2W A;  3EEA A;  4BWI A;  4PAU A;  2O0Y A;  3BJN A;  4FOF A;  1TF1 A;  2O9C A;  2XSS A;  3D3O A;  2K2N A;  4LRY C;  2W3D A;  4YNR A;  1VHM A;  1F5M A;  4ZRR A;  3KSG A;  5HPF A;  4EU0 A;  1YKD A;  3KO6 A;  2GX5 A;  2O9A A;  3VV4 A;  3W2Z A;  3HCY A;  4O01 A;  4YOF A;  5AJG A;  4IJG A;  2XRO A;  3CI6 A;  4Q0I A;  2W3F A;  3NHQ A;  2M7V A;  4Y3I A;  3S7P A;  3OBF A;  2VEA A;  4O0P A;  4MDZ A;  5TJJ A;  2O99 A;  2K31 A;  3CIT A;  3NOT C;  1YSP A;  1ZTU A;  2Y8H A;  2LB9 A;  2XRN A;  4GW9 A;  4Y2F A;  5K5B A;  4Q0H A;  3R4K A;  5I5L A;  4EUV A;  5DFX A;  4O8G A;  5HSQ A;  2KLI A;  2QYB A;  4DMZ A;  2W1T A;  5HL6 A;  3OOV A;  3TRC A;  2O9B A;  4LRX C;  5L8M A;  4Q0J A;  3KSF A;  3E98 A;  2W1T B;  4RQ9 A;  4IUH A;  3LFV A;  4LRZ E;  1MC0 A; 
#chains in the Genus database with same CATH topology
 4PHT A;  2FFY A;  2BTF P;  4IBX A;  4R6L A;  4F3L A;  4OOM A;  3MBZ A;  3ZQ5 A;  4ZAM A;  1Q2P A;  3LIC A;  4S2O A;  1ALQ A;  3VSK A;  5FQ9 A;  1IYQ A;  3HLG A;  4NKP A;  4KG2 A;  1TVF A;  1T1C A;  3ZG8 B;  4BBT A;  2JC7 A;  2IWD A;  4JF4 A;  3ZNY A;  4E3O A;  2XF3 A;  3B42 A;  5F5Y A;  2ZMF A;  3KYE A;  2W27 A;  1CQA A;  1OME A;  5HDS A;  4HNB A;  2ZOH A;  3RFB A;  3LI9 A;  1VQQ A;  4F3L B;  1XP4 A;  5G4Y A;  5CHJ A;  1TS6 A;  2Q9N A;  3QP6 A;  2H10 A;  1AXB A;  4U0T A;  3D4F A;  4PAU A;  4Y0U A;  3IS2 A;  1BLP A;  1GHP A;  5EEC A;  5HDC A;  5G18 A;  3IX8 A;  4ZJ2 A;  1IOU A;  3UDI A;  4FH2 A;  1PWD A;  1FR1 A;  3PYP A;  5F83 A;  2Y2O A;  4K08 A;  1K56 A;  4OON A;  5DF9 A;  4EEP A;  2M1C A;  2EFU A;  2X71 A;  1LL5 A;  5GLA A;  1ZG6 A;  4Y2F A;  3E2K A;  5U47 A;  3C4O A;  2X02 A;  5CXW A;  1H3Q A;  2XLN A;  3PXP A;  1I5Q A;  1LI0 A;  1HLU P;  5FQJ A;  4RQ9 A;  1YQS A;  3DTK A;  1PFL A;  4JGO A;  1XJ4 A;  2G7U A;  3OPL A;  5HPI A;  3NBL A;  3NOU C;  2HZ5 A;  3GV9 A;  3KSI A;  2EXA A;  2ZMV A;  3LIA A;  5AQA A;  1DP9 A;  4HJ6 A;  4LCL A;  1JWP A;  3ULF A;  3HBR A;  1TDL A;  3PBQ A;  2HDS A;  4HP9 A;  4OPZ A;  1ES5 A;  1AWI A;  3OZH A;  3QP1 A;  3G4P A;  4CLC C;  4LV2 A;  1ODV A;  3UB8 A;  1YMX A;  2WK0 A;  3DTE A;  1FSW A;  1MKM A;  4KQD A;  3KYZ A;  3OPR A;  5DJT A;  2ZC5 B;  1N9B A;  4E3K A;  2ZOI A;  3MXS A;  4OOL A;  3QP2 A;  2NUP C;  3RXX A;  4E3L A;  5DF8 A;  1KE0 A;  1GA9 A;  4GKU A;  2L1M A;  3ZGA B;  4JF5 A;  3PBT A;  2VX8 A;  4WL9 A;  1PW8 A;  4P6B A;  2IWB A;  1Q2Q A;  3V50 A;  1FSY A;  5GL9 A;  1QMF A;  3BYD A;  5F69 A;  4OLD A;  1OT9 A;  1T1A A;  2PDR A;  1H0M A;  3V5M A;  2ZQA A;  3BFG A;  4PM6 A;  4PM9 A;  5DFX A;  1PZP A;  4LEN A;  3G30 A;  3UME A;  1ERO A;  4DF6 A;  3MZD A;  1JWZ A;  4I3I A;  4L0L A;  3LFV A;  2V0W A;  3B33 A;  1OTB A;  3CJM A;  1BLC A;  4ETX A;  2VKS A;  3IXG A;  4E04 A;  2VV6 A;  4M3K A;  5CED A;  4G3W A;  1XJ3 A;  2ACG A;  2E8J A;  2HP9 A;  1KE4 A;  2Y4A A;  2XQZ A;  5M1A A;  4S2I A;  3V67 A;  1GHM A;  3ZNT A;  4UHU A;  3S7Q A;  3TOI A;  3OCL A;  2PBY A;  1STZ A;  4I39 A;  2Y2N A;  5HWT A;  1OTE A;  1L0E A;  1NLY A;  1RCJ A;  3PBS A;  2VGJ A;  4OQG A;  2JKT M;  3BRM A;  4WM9 A;  5HAQ A;  1TDG A;  3P09 A;  1IKG A;  1RP5 A;  2A2L A;  3LYX A;  4IUK A;  4QJG A;  4BEN A;  1LL9 A;  2Y2M A;  1K54 A;  1S4R A;  1OJG A;  1V9Y A;  3NDG A;  3KSG A;  1HD8 A;  3H82 A;  4EBN A;  1YM1 A;  1UWN X;  2Y2L A;  4JKT A;  4ZDX A;  4DE0 A;  5KSC A;  4NG2 A;  2JBF A;  1YSP A;  3LO7 A;  1BTL A;  3DW0 A;  4UAA A;  4N92 A;  3GDI A;  3T4O A;  2J8Y A;  4II7 A;  4KQO A;  1JVJ A;  3M6B A;  5I5L A;  5HSQ A;  2KLI A;  4LCM A;  2W1T A;  4E3N A;  3H82 B;  4UA7 A;  4BLM A;  2IWC A;  5AQB A;  4ZBE A;  3IX3 A;  3ZYT A;  3WS4 A;  1DJB A;  3C5A A;  4MBH A;  3FKV A;  2V8C A;  4E3I A;  5LBR A;  1U60 A;  1UWP X;  4DE3 A;  1BLS A;  1LT0 A;  2HJ9 C;  2VJW A;  3GSG A;  4OP8 A;  4DJ3 A;  4N1X A;  3EQV A;  5CTN A;  4BD0 A;  1K54 C;  2EFX A;  3IQA A;  4FCF A;  2VK3 A;  2Y79 A;  2B02 A;  3N8S A;  1DJA A;  3UPN A;  1W79 A;  4FUW A;  3TG9 A;  4Y15 A;  5HW3 A;  3T4Q A;  1IFQ A;  5CEB A;  3BY8 A;  4KZA A;  4B88 A;  3C30 A;  4R3B A;  3ZG5 A;  3VFH A;  2ZQ7 A;  4NXB A;  1Z6F A;  2R78 A;  3BJN A;  1W7F A;  4JXV A;  5IHV A;  1CF0 A;  2WGW A;  4LRY C;  1NZO A;  2GDN A;  1OTA A;  2GJ3 A;  2WKE A;  5TFQ A;  1YKD A;  2CC1 A;  2PR5 A;  2JHE A;  3UPO A;  2OV5 A;  3OCN A;  4OPY A;  5MC7 A;  1KGF A;  3FPV A;  1VEU A;  4MDZ A;  5HD5 A;  3IH8 A;  1XPB A;  2O99 A;  3ZG0 A;  2J9P A;  4OKP A;  4HP4 A;  3HLW A;  3QP8 A;  3MR0 A;  4WLA A;  1G28 A;  2DCF A;  2C5W B;  1K55 A;  5EE8 A;  1MXO A;  2K7S A;  4UQI S;  2PR6 A;  3BY9 A;  4S2L A;  4Y13 A;  3SS3 A;  3E98 A;  1X0O A;  3CMZ A;  1Y4O A;  1VEU B;  1EW0 A;  2XD5 A;  5CGW A;  1PZO A;  5KMW A;  4KUO A;  2HP5 A;  3IHA A;  4WZ5 A;  2PAV P;  5C5K A;  3H9W A;  5L10 A;  3SW1 A;  2GNX A;  3BQA A;  4HQA A;  1JTD A;  4Y5F A;  4R4S A;  4EXO A;  5F68 A;  4MCW A;  1WYB A;  1FCO A;  3ICY A;  3O87 A;  1K57 A;  3LR5 A;  4NET A;  5J3W A;  5KSH A;  2ZM2 A;  3WS2 A;  4AFI A;  3VP2 A;  1SKO A;  2JKG A;  3HVF A;  5TGF A;  3P7N A;  3IXB A;  2UWX A;  2B5R A;  1YLP A;  1PWG A;  3TSG A;  4B4X A;  3LGO A;  5A92 A;  3HLC A;  5E43 A;  1D1J A;  1C3B A;  3BLS A;  2ZBB A;  1OPX A;  5FDS A;  1MWS A;  2W3D A;  4YNR A;  2ZC6 B;  3A0S A;  5DF7 A;  5L2F A;  1K55 C;  1TS8 A;  2P7J A;  4O01 A;  1ZG4 A;  3Q07 A;  4ARZ B;  1ACF A;  1NRJ A;  4LV0 A;  3CIT A;  4S2P A;  4LLO B;  4S2K A;  4X1L A;  1YLJ A;  3A3D A;  4IHQ A;  4JBF A;  4DDY A;  3U4L P;  3C8C A;  2I9V A;  5FI6 A;  1I2S A;  2Y2J A;  3E4O A;  4KZ6 A;  1GCE A;  3T1X A;  3ITB A;  1KGG A;  1K57 C;  4DXB A;  4OOY A;  4X68 A;  4PM7 A;  4GN2 A;  3HUM A;  1G6O A;  5HDD A;  2PD7 A;  5L09 A;  2VZW A;  3UB5 P;  4HBU A;  3OPH A;  2W0N A;  1HVB A;  1M40 A;  4G3K A;  1H5X A;  3LIE A;  4C6Y A;  4K0W A;  2D01 A;  2VA0 A;  5KIZ A;  5AVE A;  3WRZ A;  2GZA A;  3QNC A;  5DFY A;  3G35 A;  2HGV A;  1GSV A;  4X56 A;  4R38 A;  4QB8 A;  3ZDJ A;  4OP5 A;  1SDN A;  4CQH A;  1D06 A;  4DDS A;  3V39 A;  3E2L A;  3O88 A;  2V1Z A;  1WE4 A;  3AGE A;  1ESI A;  5A91 A;  2WUQ A;  4P87 A;  4BBU A;  3T4L A;  4MBK A;  4HHD A;  3FWL A;  2HJE A;  2BG1 A;  4LPZ A;  3NJA A;  2OWH A;  3LY4 A;  4Y3I A;  1E3U A;  3S7P A;  5L07 A;  2YKF A;  4H6J B;  3T1R A;  3HLD A;  5GLD A;  4ZTK A;  1NRF A;  1CK3 A;  1XX2 A;  2XRN A;  4CLC A;  1G5U A;  1K0K A;  5F6A A;  1M6K A;  4PKY A;  5CGS A;  4O8G A;  3MKE A;  2ZLY A;  5DTK A;  1IYS A;  4CLC E;  4D60 A;  5IT5 A;  2A3U A;  3KSF A;  3S22 A;  3GTC A;  3NC8 A;  2EX6 A;  3MSH A;  3SH7 A;  1P9W A;  4U0X A;  1DJC A;  3M2K A;  1P97 A;  1LL8 A;  1Y54 A;  3C4P A;  3H7W A;  5FSR A;  2VV8 A;  4WBG A;  2WZX A;  1K6S A;  4XUZ A;  4CLC B;  5J4E A;  5AVF A;  3HL9 A;  2RCX A;  3IHB A;  4BJP A;  3WRT A;  2OOL A;  1H8Z A;  3O5Y A;  1IEL A;  4K91 A;  4IBR A;  3NDE A;  3M2J A;  3T12 B;  3T1S A;  3CG5 A;  4S2N C;  1LHY A;  4OQI A;  4HEF A;  3BEC A;  1TEM A;  2DRW A;  4E3M A;  3H7W B;  3CUE C;  4LGW A;  1SHV A;  3FZC A;  2HPB A;  2BLS A;  2R9X A;  2OAP 1;  5CTM A;  5DKK A;  2DNS A;  3FKW A;  1XXM A;  1DY6 A;  3ZVT A;  3E4P A;  3IWI A;  2HDU A;  3TJZ C;  3NEC A;  2QKP A;  1KDW A;  2XRO A;  5EPH A;  4JF6 A;  3W8K A;  5TJJ A;  4Y7P A;  1ZTU A;  4GDB A;  3HUO A;  1E25 A;  2V0U A;  4BL3 A;  3RTY A;  5F1F A;  1PIO A;  4KZB A;  3P98 A;  3PTE A;  2J9O A;  4R4R A;  3SH9 A;  3R4K A;  2HDQ A;  3CLO A;  2ZM0 A;  1P9R A;  4Y0T A;  5HL6 A;  3DWK A;  3FG8 A;  4LRX C;  5L8M A;  4I3A A;  1MY8 A;  4LRZ E;  5F1G A;  4X55 A;  2ZQD A;  3GVB A;  4MN7 A;  5I94 A;  4I38 A;  3W4O A;  5TR7 A;  5E2G A;  4GB7 A;  5TBM A;  1J9M A;  4R23 A;  3HJI A;  3IBR A;  5EOO A;  5HD3 A;  5HAI A;  4KQQ A;  4WEJ A;  4XXR A;  4N1H A;  3PAE A;  4UQI M;  3T50 A;  5DTT A;  1ES4 A;  4EQ1 A;  2LB5 A;  3IT9 A;  5CER A;  1YT4 A;  2KX6 A;  3KSH A;  5GLC A;  5IU1 A;  4IVK A;  5TBM B;  1L0G A;  1CJF A;  2JKF A;  4KUK A;  3SZT A;  4X6T A;  5J7E A;  4ZJ1 A;  3GRJ A;  2XSS A;  4FSF A;  1F2K A;  3L9K A;  2ZMA A;  1DRM A;  3IWQ A;  2V2F F;  3VP0 A;  4ZRR A;  4EUZ A;  2Z2M B;  2GX5 A;  3V3S A;  1YLW A;  3UN7 A;  4EQI A;  5HAR A;  4NXF A;  2J7V A;  3S1Y A;  3EOI A;  3A3E A;  4OQ0 A;  2I72 A;  4PPR A;  3UE0 A;  4KZ8 A;  2Y55 A;  4QU3 A;  1N9L A;  4GW9 A;  3ISG A;  5CX7 A;  2HDR A;  3VP4 A;  5K5B A;  4QWO A;  4Q0H A;  3UDF A;  1GHI A;  4DRT A;  4X25 A;  4HH2 A;  4HH3 A;  1K38 A;  3WS1 A;  3R7W B;  5KZH A;  4EES A;  2PYR A;  5A8B A;  5EV0 A;  1J3W A;  2CMN A;  2KOI A;  1BUE A;  2ZC4 B;  3N7W A;  5FI7 A;  2ZQ8 A;  4KZ3 A;  4R70 A;  3UY6 A;  4EER A;  3UB7 A;  4BQM A;  3KX0 X;  3V3R A;  1E3U D;  4S2M A;  1L0F A;  4ZJ3 A;  3A3F A;  3MXR A;  3G32 A;  3CPT B;  2PU2 A;  5CEC A;  1F9I A;  4GS9 A;  2ZQ9 A;  3MQ0 A;  4N9L A;  1K4F A;  4CLC D;  5JYO A;  3BQ8 A;  3IBJ A;  3LEZ A;  1ERM A;  2Q0O A;  5M18 A;  2HV1 A;  3A3I A;  4K0X A;  2W3H A;  3MS6 A;  5DTS A;  4BWI A;  2L0W A;  3IX4 A;  2O0Y A;  2YKH A;  1W63 Q;  5JYP A;  3M6H A;  1BZA A;  3OLO A;  3ZG9 B;  4QY6 A;  4LFU A;  4EU0 A;  1OT6 A;  4GS9 B;  3PR6 A;  1CEF A;  3CI6 A;  1FR6 A;  1PI4 A;  1S67 L;  4I3J A;  3O86 A;  1SCW A;  4CJN A;  3G2Z A;  1H8Y A;  4Z9Q A;  2EWV A;  2G2U A;  3N8R A;  1O7E A;  3PBO A;  1QME A;  2VLG A;  4U3T A;  5HAP A;  2UV0 E;  2ZC7 A;  2G2W A;  2INW A;  4KEN B;  4NXE A;  4EUV A;  3VP1 A;  4PKY G;  4DMZ A;  1LSX A;  3HJK A;  1T1B A;  3UMD A;  2WYX A;  2FZ0 A;  2O9B A;  1P0Z A;  4BMW A;  2EA9 A;  4KZ4 A;  3RJU A;  2ZL1 B;  4HY8 A;  4QY5 A;  3BM6 A;  1MZU A;  1ZC2 A;  3MFD A;  3G31 A;  1CI9 A;  1T18 A;  3A0R A;  4R1G A;  4HI4 A;  3E4Q A;  5EUA A;  3LY3 A;  4DJ2 A;  3RH8 B;  1SKF A;  1BLH A;  1TD5 A;  1FCM A;  1SZV A;  2JKR I;  4S2J A;  3MMH A;  3MQQ A;  3NIA A;  1PI5 A;  1KVL A;  4RVA A;  5FQK A;  4CPK A;  4LV3 A;  2Q9M A;  3S7N A;  2WAF A;  2H5S A;  1MKI A;  3LI8 A;  4GHI B;  3I7J A;  2VGL S;  3C2W A;  1S66 L;  3HLE A;  4NXG A;  3RXW A;  3LR4 A;  5FQI A;  1S4S A;  5AQ9 A;  3KO6 A;  2JN7 A;  4KG5 A;  3VV4 A;  3HCY A;  4ARZ A;  2XEP A;  4IJG A;  3Q7Z A;  4HBT A;  2A24 B;  2ZQC A;  4HJ3 A;  3UNW A;  3IF6 B;  4JXW A;  2OAQ 1;  4KG6 A;  1XA7 A;  2DMW A;  3UB6 A;  2RL3 A;  1Y28 A;  2LB9 A;  5GHY A;  1XGI A;  2AVX A;  3GEC A;  3UPP A;  3DWZ A;  4JGP A;  1MWT A;  4WMC A;  2H0T A;  2OLV A;  3IWO A;  4WYY A;  1ES3 A;  4KQR A;  4IUH A;  5FAS A;  3Q1F A;  5E2F A;  1T19 A;  3CHW P;  4E6X A;  3VOY A;  2WAE A;  2W3E A;  2IA2 A;  1L3L A;  4G3V A;  2EXB A;  5FI2 A;  4HES A;  1D7E A;  3IF6 C;  1IYP A;  5EOE A;  2WGV A;  2XFT A;  3MJQ A;  3MXQ A;  2OWJ A;  4MN6 A;  5DVA A;  4HOI A;  1IKI A;  5A90 A;  1O07 A;  3BEB A;  2NUT C;  1BYW A;  1G68 A;  3B3X A;  1L2S A;  2XR0 A;  2J3T C;  3S7O A;  4MLL A;  4MMN A;  3A0V A;  1ZHH B;  1PNE A;  3DAV A;  5EVI B;  2V8F A;  3UB9 A;  4DN0 A;  2FH5 A;  1TS7 A;  2WGI A;  4RX2 A;  3EEA A;  3B47 A;  1W63 M;  3QHY A;  5F82 A;  2EWW A;  5CGX A;  4DKI A;  3FC7 A;  3ZVW A;  1VHM A;  3Q82 A;  3LCE A;  3EWK A;  4YWZ A;  1KE3 A;  2V20 A;  3D9Y A;  5HPF A;  1RGY A;  2WKQ A;  4EBP A;  4UA9 A;  1CI8 A;  4H6J A;  2W3F A;  3MZE A;  4GCZ A;  1TS0 A;  1YLY A;  4PM8 A;  2K31 A;  3CWF A;  1A0K A;  3G2Y A;  3JYI A;  5HFO A;  1EI5 A;  5EVI C;  4EV4 A;  3ZHH A;  4BL2 A;  3A3J A;  2PBD P;  3N6I A;  3BFF A;  4L9E A;  4OPR A;  2Z2L B;  4S2N A;  3EQU A;  4IED A;  4X53 A;  2JCH A;  3TW8 A;  3CUE A;  1ERQ A;  1PYY A;  2H28 A;  4P6Z S;  3C38 A;  4X69 A;  2Y2G A;  3T4T A;  4KZ9 A;  2EX9 A;  3BWL A;  3EGX C;  4FTX A;  4ME4 A;  2B18 A;  5FEG A;  4JXG A;  3G6O A;  3LR0 A;  1F98 A;  2XA7 S;  4M4X A;  2M7U A;  2W3G A;  4EWF A;  1IYO A;  3BFC A;  3W4P A;  4JPM A;  1NY0 A;  1FIL A;  2V9A A;  1YMS A;  1KOU A;  3JVU A;  5GHX A;  3VOL A;  3UE6 A;  4QHC A;  2PRF A;  1NJ4 A;  1JNU A;  2ZC3 B;  5FDH A;  4QPR A;  1W8Q A;  4OQH A;  5FA7 A;  4FOF A;  1TF1 A;  3IF5 A;  1MWU A;  3IXH A;  3GMW A;  3EEH A;  3IS2 B;  1F5M A;  3MKF A;  3VSL A;  2P04 A;  2R9W A;  3C7V A;  5HZH A;  2D02 A;  4NEE D;  5AJG A;  1FIK A;  4XUX A;  3Q81 A;  4EBL A;  2HF6 A;  2Y2Q A;  3NOT C;  4EET B;  4RX3 A;  4MNR A;  1N9O A;  2MJ6 A;  2PHY A;  4Y17 A;  2XFS A;  4GD6 A;  4GD8 A;  3PBN A;  4EEU A;  3SH8 A;  2J80 A;  1Z09 A;  5FQM A;  4HJ4 A;  1E4D A;  4N9K A;  4WUJ A;  3IH9 A;  3DTM A;  4Q0J A;  4EW7 A;  3ZCZ A;  1ES2 A;  3PAG A;  3UE1 A;  1G6A A;  1YPR A;  2V1A A;  4ESP A;  1ZKJ A;  3VE4 A;  4P85 A;  3K3D A;  2J3T D;  2X01 A;  3T4S A;  3JVV A;  3QNB A;  1GSX A;  4E3J A;  2ZD8 A;  1CEG A;  1W8Y A;  2V1B A;  2Y2K A;  2Y91 A;  2Z6C A;  2XDM A;  1NYM A;  3HLF A;  2WKI A;  5EM0 A;  5GHZ A;  4JGR A;  3CZD A;  4ETZ A;  2WZZ A;  1YLT A;  3GR2 A;  3LEQ A;  4RA7 A;  3NOP C;  4NK3 A;  4YFM A;  3E0Y A;  2WAD A;  2PT7 A;  2QMI A;  4IVI A;  4WMC D;  4BD1 A;  5HL1 A;  3UO9 A;  3BLM A;  1V9Z A;  3NCK A;  4OH0 A;  2XK1 A;  1OTI A;  3G34 A;  3CAX A;  2PD8 A;  5A93 A;  2E8I A;  2H0Y A;  4WZ4 A;  3D3O A;  2JKR M;  5EVI D;  3BFE A;  1OJ5 A;  5EVE A;  4KZ5 A;  1PW1 A;  3W2Z A;  4H8R A;  5HWV A;  1YAX A;  3MQO A;  2QJ5 A;  1KVM A;  2VEA A;  4O0P A;  4RYE A;  5D3O A;  5E2E A;  3OPP A;  4O7D A;  4GDN A;  1LI9 A;  3BW6 A;  2QJ7 A;  2Y8H A;  4PMA A;  4Q8I A;  2VGL M;  2KDK A;  3VOZ A;  3R7W A;  2EX2 A;  3OOV A;  1VET A;  3AGD A;  4B4Z A;  5M19 A;  1MC0 A;  1W5D A;  1S1Y A;  4WF0 A;  1N4O A;  3T4K A;  5HX9 A;  1H8M A;  4C3Q A;  2FFF B;  3CPT A;  4A5R A;  3UE3 A;  4B9O A;  1ESU A;  4R0Q A;  4F94 A;  2XGN A;  3F1P A;  1VET B;  2L4R A;  4OVD A;  1XFQ A;  4FH4 A;  1NLZ A;  3WS5 A;  1VB6 A;  1OTD A;  3LIF A;  3LUQ A;  2WKR A;  1EWZ A;  4MBF A;  5EFW A;  4E6W A;  1YLZ A;  2ZJ9 A;  3S4X A;  3N4I A;  1RGZ A;  1LLB A;  3T1Q B;  2Y59 A;  3W4Q A;  4DE1 A;  3F1P B;  4R3A A;  3OC2 A;  2O9A A;  4YOF A;  1LSV A;  3HRE A;  4XT2 A;  4KZ7 A;  4Q0I A;  1BUL A;  5CHM A;  3NHQ A;  1XJ6 A;  3D72 A;  1HZO A;  2JE5 A;  2XH9 A;  5FEF A;  2HP6 A;  3MZF A;  3QP4 A;  3LR3 A;  3BFD A;  4WEL A;  2ZL1 A;  3ITA A;  1K56 D;  4OPQ A;  2EX8 A;  1BSG A;  4XT2 B;  2W1T B;  4JGQ A;  4MN5 A;  1XFN A;  5HWW A;  4BBV A;  1K25 A;  1XKZ A;  1BT5 A;  5BOH A;  1L0D A;  5FL3 A;  1GA0 A;  2WKH A;  4C75 A;  5G4Z A;  2P08 A;  1SDE A;  3DBA A;  4JLF A;  1PWC A;  5AQ7 A;  2BAS A;  3F1N A;  5CRF A;  3F1O A;  3O3V A;  2ZM8 A;  4GNU A;  5E2H A;  3SS4 A;  1XJ2 A;  2VV7 A;  3K2N A;  2P9V A;  2C6W B;  1YSQ A;  1DP6 A;  4GHI A;  4LV1 A;  1GSW A;  5FAO A;  4P6Z M;  3WS0 A;  5EVL A;  5J8X A;  4D2O A;  3IXD A;  2O9C A;  5CHU A;  3F1N B;  5GLB A;  4DE2 A;  2XA7 M;  3F1O B;  1WA9 A;  2A24 A;  2WGW B;  3FV7 A;  1KGE A;  1MWR A;  3FYZ A;  2QWS A;  4YIN A;  2P9V B;  3SS5 A;  3IF6 A;  2M7V A;  3OBF A;  1UGU A;  4WEK A;  4L9G A;  2Y2I A;  4P0M A;  4B93 A;  4JXS A;  2XD1 A;  3SOI A;  3U2A A;  2Y2H A;  2B95 A;  3HUN A;  3VP3 A;  3K3C A;  5FAP A;  3L7H A;  1ONG A;  1S1Z A;  2A49 A;  2WKP A;  2QZ6 A;  1VM1 A;  4MEZ A;  5FQQ A;  3VFF A;  1HTZ A;  5DKL A;  3VMA A;  2P74 A;  3KYQ A;  3AGF A;  1K4E A;  1MBL A;  1MPL A;  2QPN A;  4UEY A;  2Y2P A;  3TE8 A;  1S6R A;  3LIB A;  3ZG7 B;  4WN5 A;  3DTI A;  1ONH A;  2JKT I;  1KDS A;  4GZB A;  3QP5 A;  3NI9 A;  2OSU A;  1N9N A;  4UA6 A;  2VGK A;  3MF0 A;  4PM5 A;  3PHY A;  4GLQ A;  2W1R A;  1NXY A;  1FQG A;  5EM1 A;  4Z1W A;  4QD4 A;  1I2W A;  3C7U A;  3N8L A;  2PYP A;  4FD8 A;  1S0W A;  4GOG A;  5EVI A;  1PRQ A;  2QHK A;  3MFX A;  3Q7V A;  3GQZ A;  5FAT A;  1FCN A;  2J3W A;  3NY4 A;  1SKO B;  1DP8 A;  4HIA A;  3VE3 A;  3UDX A;  2OLU A;  1IEM A;  2Z6D A;  3ZFZ A;  4OLG A;  2K2N A;  5IS1 A;  3P01 A;  4WZ5 C;  4DXC A;  1LSW A;  4GJ4 A;  4ID4 A;  4Y0O A;  1NZU A;  3JPU A;  1K6R A;  3EGD C;  3PBR A;  3Q7V B;  1FOF A;  4R3J A;  1JTG A;  4I5S A;  5DJU A;  4L9F A;  1XGJ A;  1JWV A;  3WWX A;  3T4J A;  1NYY A;  1NWZ A;  2QYB A;  3HLB A;  1WYC A;  5FAQ A;  3TRC A;  3NUL A;  2PU4 A;  3FPW A;  3LID A;  4X1M A;  1XA1 A; 
#chains in the Genus database with same CATH homology
 2CMN A;  1EW0 A;  4PHT A;  2V1A A;  2KOI A;  4KUO A;  4R6L A;  3VE4 A;  4F3L A;  3K3D A;  2J3T D;  4OOM A;  3ZQ5 A;  3T4S A;  3JVV A;  4R70 A;  3LIC A;  1GSX A;  4EER A;  5C5K A;  3UB7 A;  3H9W A;  2Z6C A;  2V1B A;  3KX0 X;  4NKP A;  3SW1 A;  2GNX A;  1T1C A;  4BBT A;  3BQA A;  4HQA A;  4Y5F A;  4EXO A;  5F68 A;  4JGR A;  4MCW A;  3B42 A;  5F5Y A;  4ETZ A;  2ZMF A;  3ICY A;  2W27 A;  3LR5 A;  5J3W A;  1F9I A;  3NOP C;  4GS9 A;  3MQ0 A;  5KSH A;  4AFI A;  5HDS A;  4CLC D;  4HNB A;  3E0Y A;  2ZOH A;  3RFB A;  2PT7 A;  3BQ8 A;  3IBJ A;  3LI9 A;  4F3L B;  2HV1 A;  5G4Y A;  2W3H A;  3P7N A;  1TS6 A;  1V9Z A;  4BWI A;  1OTI A;  2L0W A;  3CAX A;  2PD8 A;  4PAU A;  2O0Y A;  3IS2 A;  2YKH A;  2ZBB A;  1W63 Q;  1OPX A;  3D3O A;  2JKR M;  2W3D A;  4YNR A;  5HDC A;  1OJ5 A;  3OLO A;  1IOU A;  3A0S A;  4EU0 A;  1OT6 A;  4GS9 B;  1TS8 A;  2P7J A;  3W2Z A;  4O01 A;  3PR6 A;  3CI6 A;  3PYP A;  1S67 L;  1YAX A;  5HWV A;  3MQO A;  2QJ5 A;  2VEA A;  4I3J A;  4O0P A;  4ARZ B;  4K08 A;  1NRJ A;  2EWV A;  3CIT A;  5DF9 A;  3PBO A;  4EEP A;  2M1C A;  2VLG A;  4LLO B;  3BW6 A;  2QJ7 A;  2Y8H A;  2INW A;  2VGL M;  4Y2F A;  4IHQ A;  2KDK A;  1H3Q A;  4NXE A;  4EUV A;  3PXP A;  3C8C A;  4PKY G;  3R7W A;  2I9V A;  4DMZ A;  1LSX A;  3HJK A;  1T1B A;  3UMD A;  3OOV A;  2FZ0 A;  2O9B A;  1P0Z A;  3E4O A;  4BMW A;  4RQ9 A;  2EA9 A;  4HY8 A;  1MC0 A;  1MZU A;  4JGO A;  1XJ4 A;  2G7U A;  5HPI A;  1S1Y A;  4WF0 A;  3NOU C;  3T4K A;  1T18 A;  1G6O A;  3A0R A;  3KSI A;  5HDD A;  2ZMV A;  2PD7 A;  4HI4 A;  1H8M A;  3E4Q A;  3LIA A;  2VZW A;  1DP9 A;  4DJ2 A;  3RH8 B;  4HJ6 A;  3UE3 A;  1TD5 A;  4B9O A;  3ULF A;  2W0N A;  2JKR I;  3PBQ A;  4HP9 A;  3MMH A;  3MQQ A;  4G3K A;  3F1P A;  3LIE A;  5KIZ A;  2D01 A;  2L4R A;  2VA0 A;  5AVE A;  4CLC C;  1XFQ A;  1ODV A;  2GZA A;  1NLZ A;  3S7N A;  5DFY A;  3UB8 A;  1VB6 A;  1OTD A;  3LIF A;  2HGV A;  1GSV A;  3LUQ A;  2WKR A;  4R38 A;  1MKM A;  3LI8 A;  4KQD A;  5EFW A;  4CQH A;  3KYZ A;  1D06 A;  5DJT A;  4GHI B;  2VGL S;  2ZOI A;  3C2W A;  1S66 L;  4OOL A;  2NUP C;  4BBU A;  3T4L A;  4NXG A;  4HHD A;  2L1M A;  3LR4 A;  2HJE A;  3PBT A;  1S4S A;  2VX8 A;  3F1P B;  4LPZ A;  3KO6 A;  3OC2 A;  4R3A A;  4WL9 A;  2O9A A;  2JN7 A;  3VV4 A;  3NJA A;  3HCY A;  1LSV A;  4YOF A;  4ARZ A;  2OWH A;  4IJG A;  4XT2 A;  4Q0I A;  2A24 B;  3NHQ A;  4Y3I A;  1XJ6 A;  3S7P A;  4HJ3 A;  3D72 A;  2YKF A;  4H6J B;  2OAQ 1;  5F69 A;  1OT9 A;  1T1A A;  2PDR A;  2DMW A;  3UB6 A;  1Y28 A;  2LB9 A;  2XRN A;  4CLC A;  3LR3 A;  3GEC A;  5F6A A;  4PKY A;  4JGP A;  5DFX A;  4WEL A;  4O8G A;  3UME A;  4CLC E;  5IT5 A;  3KSF A;  4XT2 B;  2W1T B;  1P9W A;  4JGQ A;  4I3I A;  4IUH A;  3LFV A;  4L0L A;  4MN5 A;  2V0W A;  1XFN A;  3B33 A;  1OTB A;  5HWW A;  1P97 A;  4ETX A;  1LL8 A;  1T19 A;  4BBV A;  2VKS A;  3H7W A;  4E04 A;  2W3E A;  2IA2 A;  5FL3 A;  2VV6 A;  2VV8 A;  4G3V A;  4G3W A;  1XJ3 A;  1D7E A;  5G4Z A;  2P08 A;  3V67 A;  4CLC B;  5J4E A;  3MJQ A;  5AVF A;  3MXQ A;  2OWJ A;  4MN6 A;  3S7Q A;  3DBA A;  4HOI A;  3OCL A;  4BJP A;  2OOL A;  1STZ A;  2BAS A;  4I39 A;  3F1N A;  2NUT C;  3F1O A;  3O5Y A;  1BYW A;  5HWT A;  1OTE A;  1XJ2 A;  2VV7 A;  3K2N A;  1NLY A;  2J3T C;  3S7O A;  3PBS A;  4MMN A;  3A0V A;  1YSQ A;  1ZHH B;  1DP6 A;  4GHI A;  1GSW A;  2JKT M;  3UB9 A;  3H7W B;  3CUE C;  4DN0 A;  4P6Z M;  2A2L A;  1TS7 A;  2FH5 A;  3LYX A;  4IUK A;  3EEA A;  3B47 A;  2OAP 1;  1W63 M;  2EWW A;  5DKK A;  2O9C A;  1S4R A;  3FC7 A;  1OJG A;  1VHM A;  1V9Y A;  3EWK A;  3F1N B;  4YWZ A;  2XA7 M;  3F1O B;  3E4P A;  1WA9 A;  2A24 A;  3KSG A;  5HPF A;  3H82 A;  2WKQ A;  3TJZ C;  2QWS A;  1UWN X;  2QKP A;  2XRO A;  4H6J A;  2W3F A;  2M7V A;  4GCZ A;  3OBF A;  1UGU A;  4WEK A;  1TS0 A;  4L9G A;  5TJJ A;  4B93 A;  3U2A A;  2K31 A;  3CWF A;  1YSP A;  1ZTU A;  2V0U A;  3K3C A;  3RTY A;  1S1Z A;  3GDI A;  2WKP A;  3T4O A;  4II7 A;  4L9E A;  4KQO A;  3R4K A;  5I5L A;  3CLO A;  5DKL A;  3EQU A;  2KLI A;  1P9R A;  5HSQ A;  2W1T A;  5HL6 A;  3TW8 A;  3KYQ A;  3H82 B;  3CUE A;  3FG8 A;  4LRX C;  5L8M A;  4I3A A;  4UEY A;  4LRZ E;  3ZYT A;  3TE8 A;  3LIB A;  2H28 A;  4P6Z S;  4MN7 A;  4WN5 A;  5LBR A;  1UWP X;  2JKT I;  3C38 A;  4I38 A;  3T4T A;  3BWL A;  3EGX C;  4ME4 A;  1LT0 A;  1N9N A;  2B18 A;  2HJ9 C;  5TBM A;  2VJW A;  3G6O A;  3LR0 A;  3MF0 A;  1F98 A;  3PHY A;  4GLQ A;  2W1R A;  4DJ3 A;  2XA7 S;  3HJI A;  3IBR A;  4M4X A;  2M7U A;  2W3G A;  3EQV A;  5HD3 A;  4Z1W A;  4WEJ A;  2PYP A;  2Y79 A;  2V9A A;  2B02 A;  4UQI M;  1KOU A;  3T50 A;  3JVU A;  3VOL A;  3UE6 A;  2QHK A;  4EQ1 A;  2LB5 A;  3T4Q A;  1IFQ A;  3MFX A;  3BY8 A;  1JNU A;  2J3W A;  3C30 A;  1DP8 A;  4HIA A;  4QPR A;  2KX6 A;  3KSH A;  5IU1 A;  3VE3 A;  4NXB A;  5TBM B;  2R78 A;  3BJN A;  4FOF A;  1TF1 A;  4KUK A;  5J7E A;  2Z6D A;  2XSS A;  4FSF A;  2K2N A;  4LRY C;  5IS1 A;  3EEH A;  3P01 A;  1OTA A;  3IS2 B;  1F5M A;  1DRM A;  1LSW A;  2GJ3 A;  4GJ4 A;  4ZRR A;  2P04 A;  1YKD A;  2GX5 A;  2PR5 A;  5HZH A;  2JHE A;  2D02 A;  4NEE D;  5AJG A;  3OCN A;  3EGD C;  5MC7 A;  4NXF A;  3PBR A;  3FPV A;  4MDZ A;  5HD5 A;  3EOI A;  2HF6 A;  2O99 A;  3NOT C;  4EET B;  4I5S A;  5DJU A;  4HP4 A;  1N9O A;  2MJ6 A;  3MR0 A;  1N9L A;  2PHY A;  4GW9 A;  4L9F A;  4WLA A;  1G28 A;  3PBN A;  5CX7 A;  4EEU A;  5K5B A;  3T4J A;  2J80 A;  4Q0H A;  1NWZ A;  4HJ4 A;  2K7S A;  2QYB A;  4UQI S;  2PR6 A;  3BY9 A;  3TRC A;  4HH2 A;  4WUJ A;  3FPW A;  4HH3 A;  4Q0J A;  4EW7 A;  3R7W B;  3E98 A;  1X0O A;  3LID A;  4EES A;  2PYR A;  5A8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...