3B3XA

Crystal structure of class a beta-lactamase of bacillus licheniformis bs3 with aminocitrate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title 2-Aminopropane-1,2,3-tricarboxylic acid: Synthesis and co-crystallization with the class A beta-lactamase BS3 of Bacillus licheniformis
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 81
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3b3xA00
3IXHA 5DVAA 4DE3A 3M6BA 3JYIA 3V3RA 3LCEA 5DTKA 4KZ4A 1EROA 2XEPA 4N1HA 2UWXA 2V20A 2XR0A 3UPPA 3GVBA 2IWCA 1TEMA 4JXWA 2QMIA 2XF3A 3GV9A 1H5XA 2WGVA 4JXVA 4MLLA 1KDWA 5CERA 2HDSA 5GHXA 3A3IA 4F94A 5I94A 5HL1A 3VP2A 1NZOA 3A3DA 1YMSA 3NDGA 5AQAA 4JF6A 4D2OA 1FSWA 4LV1A 1LI0A 4MBKA 3ZNYA 4BD1A 2EXBA 4JF4A 2WAFA 2WGWA 1RP5A 1Y54A 3OPPA 1NYMA 2WGWB 3M6HA 4WEKA 2WK0A 3N7WA 1ES5A 3Q82A 5EUAA 1K6SA 4BJPA 1N9BA 1G68A 3BFCA 3OZHA 2ZM0A 3SS4A 2Q9MA 5FI6A 5E2GA 3HLCA 1PI4A 5CGSA 3V3SA 5CEBA 3FWLA 2Y2KA 3UDFA 4S2IA 2HDQA 2XGNA 2RL3A 3IHBA 1MBLA 2EX8A 3HVFA 5EOOA 4E3OA 4GB7A 1O7EA 1GHIA 3BLSA 2Y2JA 4ZTKA 3NY4A 2BLSA 1E3UD 5DTSA 3HLEA 1JTDA 3OCLA 5HAIA 2DNSA 4QY5A 1K54A 1HD8A 4S2JA 1IYQA 1L0GA 2EX9A 1E25A 2B5RA 5AQ9A 1YLWA 3AGDA 2GDNA 4B4XA 2Y2MA 3G34A 5GLCA 3ZG5A 1U60A 1E4DA 3W4PA 1BLSA 1MPLA 1YLJA 3EQVA 3N8SA 3AGEA 1NRFA 1FCOA 4R3JA 1DJAA 1HZOA 3FKVA 5DF9A 1K54C 3MBZA 5KZHA 3C4OA 3HREA 3IXBA 3UN7A 3VP3A 4BENA 2PBYA 4MNRA 4RA7A 3V50A 4WBGA 3ZVWA 4KG6A 1CI8A 4ZJ2A 1HTZA 4FD8A 3TOIA 2ZQ7A 5A92A 4HBTA 4OOMA 1VM1A 4HESA 4P6BA 3G35A 3GRJA 4GD8A 1E3UA 4OPQA 4PMAA 1BSGA 3A3JA 2X01A 2FFFB 2J9OA 3MZEA 1L0EA 4IEDA 4R4SA 3WS2A 2EFUA 3MXRA 4DF6A 5BOHA 2JE5A 5FDHA 1GHPA 1MWSA 3VOZA 4KZBA 4PPRA 5EVIB 4EUZA 1BZAA 3PBOA 4BL2A 3P09A 4X68A 3WS0A 3FYZA 2ZQCA 3FZCA 3WS1A 2I72A 4OLDA 4LV0A 5E2HA 4E3JA 3OPHA 3WS5A 1QMEA 3TG9A 4IVKA 1I2SA 5A90A 1WYCA 3IWIA 4R23A 3HUNA 1RCJA 4OQHA 3GTCA 5CHMA 2JC7A 1FCNA 3QNBA 2G2UA 4OPYA 4EQIA 5E43A 3A3FA 1LL5A 3O88A 1FQGA 1YQSA 4KQQA 1J9MA 2BG1A 3IF6A 4S2KA 4S2PA 1N4OA 4U3TA 3WRTA 1DY6A 3IF6B 3BFEA 1PW1A 4KZAA 3VP0A 3VMAA 4S2LA 4C75A 1ERQA 4WZ5A 4PM6A 4FCFA 4GN2A 2WKHA 3IF6C 3LY3A 3V39A 4LCMA 4EBLA 2P74A 1C3BA 1FR6A 3LEZA 5EVLA 4DDSA 3BFFA 4UAAA 5CRFA 4K0XA 4E3KA 3HLFA 5HX9A 3ZG0A 1MKIA 3SS5A 1KVLA 2RCXA 3SS3A 4JPMA 4X69A 1K38A 3HL9A 1GA0A 5HAQA 5DTTA 2Y2NA 1NJ4A 2ZD8A 3PBRA 4JXGA 4B4ZA 3PBTA 4A5RA 4E6WA 2WYXA 2ZQAA 4K91A 4MBFA 3MKEA 2VGJA 5FQQA 4UA9A 1MWRA 1WE4A 1KVMA 1PWGA 1XPBA 5KMWA 3RXWA 2HP5A 3Q1FA 4IBXA 1K25A 3DWZA 1ALQA 1DJCA 1IKIA 3HUMA 3NC8A 4X6TA 2XFTA 4MBHA 2Z2LB 3A3EA 3W4QA 5G18A 2Y55A 3VSKA 4P87A 4IVIA 3W4OA 2V1ZA 2EFXA 4QU3A 1YLYA 3ZG9B 3C7UA 5HARA 2G2WA 4OPZA 3QNCA 5TR7A 3M2JA 3ZGAB 1JTGA 2Y2OA 4OP5A 1KGFA 4GKUA 4OQGA 4LENA 1Q2PA 2DCFA 1IEMA 4XUXA 4PM9A 4GD6A 1YLPA 2Y2GA 4PM5A 5E2FA 3IF5A 3IH8A 3W8KA 4GDNA 4X55A 4ZDXA 3N8LA 2EX6A 5EOEA 1L0FA 3DWKA 2WZZA 3OPLA 4KZ9A 5AQBA 3CJMA 4ZJ1A 4ZJ3A 5JYOA 2H0TA 1IKGA 2ZQ8A 4C3QA 5FQKA 5L2FA 2XQZA 1WYBA 3TSGA 5FA7A 4NETA 3I7JA 5DF8A 2DRWA 3SOIA 1BT5A 1YT4A 5EVID 2V2FF 3IT9A 5CGXA 4KENB 4QHCA 1BLCA 1W8QA 3HLGA 2XD5A 5EPHA 3HBRA 4OPRA 2Y2HA 4U0XA 1ZG4A 4EWFA 4B88A 5A91A 3IXGA 5HW3A 4DE2A 1K55A 5F1FA 1W5DA 1VQQA 5EECA 2WZXA 1K4EA 1YMXA 1PIOA 2WAEA 1YLTA 2QZ6A 2ZQ9A 1ESUA 3RXXA 4DDYA 4Y0OA 5CHUA 4JLFA 3G32A 2OLVA 1KE0A 3O3VA 1ONHA 3WS4A 4OP8A 3MKFA 1DJBA 1K55C 3DW0A 4KQRA 4XXRA 1BULA 1GA9A 1TDGA 4R3BA 5EVIA 2ZC3B 2Y91A 5CXWA 4KG2A 4OLGA 2QPNA 2ZJ9A 5CTNA 3DTMA 1M6KA 2A49A 3MFDA 5CECA 1SDNA 3G4PA 3PAEA 5TFQA 5U47A 5EVIC 1BTLA 2ZC6B 4E3IA 3QHYA 4N92A 4S2NA 1CEGA 1JWZA 2Y2QA 3G2ZA 5FQMA 1ES3A 1I5QA 3VSLA 5FASA 5CGWA 4HBUA 1FSYA 1L2SA 3Q81A 4KZ6A 4LV3A 5DF7A 5GHYA 2ZC5B 3HUOA 4KG5A 2WADA 4QY6A 4QD4A 2PU2A 3PTEA 4UA6A 2R9WA 3N6IA 1SCWA 1CK3A 1SHVA 4RX2A 4WELA 2XD1A 3UPNA 4P0MA 4BLMA 1NY0A 1ZKJA 3GQZA 4BL3A 3NBLA 3CMZA 4WEJA 4NK3A 4IBRA 4WZ5C 3LO7A 4FSFA 4KZ5A 2WUQA 3SH7A 5FQIA 1XGIA 4P85A 2X71A 4OQIA 5GLAA 3IWOA 1G6AA 4BD0A 5M18A 5FATA 5FQJA 1PWCA 2XH9A 4ID4A 1M40A 3EQUA 3BRMA 2PU4A 3G2YA 4WMCD 1LI9A 1LLBA 2VGKA 2OLUA 2ZMAA 4QJGA 4OQ0A 1PW8A 1KE4A 3AGFA 3S22A 3GMWA 2ZLYA 1RGZA 2XK1A 5GL9A 2Y2LA 4Q8IA 1W8YA 3ZVTA 1BUEA 2C5WB 3ZHHA 3ZG8B 1I2WA 4WM9A 1LL9A 4JXSA 3NCKA 3BYDA 5D3OA 1CI9A 4R1GA 3SH8A 2Y4AA 2WGIA 2XLNA 3V5MA 5J8XA 1ONGA 1RGYA 1TDLA 4UA7A 3UE3A 4OOLA 3PAGA 3UO9A 5FQ9A 4DKIA 1MY8A 3BECA 4K0WA 1CEFA 2XDMA 1PZPA 3PBQA 1EWZA 3BEBA 1TVFA 2H0YA 5FI2A 3IH9A 4WMCA 4U0TA 1IYOA 1ES2A 1YM1A 4YINA 1YLZA 4E3NA 3FKWA 4GDBA 3E2LA 1AXBA 4JKTA 4KQOA 1KDSA 3G30A 5FAQA 4ZBEA 2HDUA 4DE0A 2WKIA 2Y2PA 4O7DA 5GHZA 3UE0A 1XXMA 5CTMA 5IHVA 2Y59A 3LY4A 3IHAA 2HDRA 3Q7ZA 2ZQDA 3ITBA 3UNWA 4R4RA 4EBPA 5HAPA 2ZM2A 2X02A 4N9KA 2J8YA 3SH9A 4EV4A 5F1GA 1JVJA 4X56A 5GLDA 1L0DA 5AQ7A 2Z2MB 1BLHA 3NI9A 3ZFZA 4ZAMA 4GOGA 2IWBA 4YFMA 5CHJA 5M1AA 1W7FA 1IELA 3MZFA 1Q2QA 1XP4A 4XUZA 3MXSA 4FH4A 1ZC2A 1EI5A 2HP6A 3BM6A 4WZ4A 4X53A 2OV5A 3Q7VA 4DXCA 2WKEA 2EXAA 3G31A 3Q7VB 4Z9QA 4GZBA 5CEDA 3ZNTA 4MEZA 5EE8A 1W79A 1XA1A 5HFOA 1ES4A 3D4FA 4DXBA 4DE1A 1XKZA 5TGFA 4L0LA 1XA7A 1KE3A 1GCEA 1S0WA 3VFFA 4QB8A 4E6XA 4RVAA 3CG5A 4Y7PA 3VP1A 3MZDA 1S6RA 5A93A 1FR1A 2IWDA 2OSUA 3BFDA 1XGJA 4GNUA 1IYSA 1MWTA 1FOFA 5KSCA 1K6RA 4BQMA 1K56D 1PWDA 1OMEA 3O86A 4DRTA 3UPOA 3ZDJA 4S2MA 3WWXA 2P9VA 2ZM8A 2E8IA 3NIAA 4LV2A 2P9VB 4N9LA 1HVBA 3N4IA 3HLDA 5GLBA 4OOYA 1KGGA 3C7VA 3NDEA 1KGEA 1FCMA 1H8ZA 4KZ7A 4E3LA 5JYPA 2C6WB 3PBSA 4OKPA 3OC2A 5KSHA 3OCNA 5F82A 2H5SA 1GHMA 3C4PA 3IWQA 3VOYA 3GSGA 3HLBA 4R0QA 4KZ3A 1K57A 4WYYA 2R9XA 4Y0UA 3UDXA 4EBNA 2Q9NA 4S2NC 1NZUA 1Z6FA 1XX2A 3IQAA 5F83A 5FAPA 3VFHA 5E2EA 1MWUA 1JWVA 1PZOA 1SKFA 3CZDA 3HLWA 2J9PA 3N8RA 1K56A 3ITAA 1K57C 5M19A 2H10A 3ISGA 2JCHA 4CPKA 1MXOA 3Q07A 2HPBA 2CC1A 4PM7A 4Y0TA 2FFYA 3OPRA 3RJUA 2J7VA 2EX2A 1O07A 5FI7A 3WRZA 4JF5A 3ZCZA 3S1YA 3GR2A 4OVDA 3UE1A 1QMFA 3UY6A 4RYEA 4N1XA 1K4FA 4OONA 4LCLA 4C6YA 1SDEA 1NYYA 2JBFA 3C5AA 3S4XA 4M3KA 2A3UA 5FSRA 1ERMA 1ESIA 2Y2IA 3ZG7B 4PM8A 3B3XA 4FH2A 4JBFA 4CJNA 1IYPA 3M2KA 1JWPA 2XFSA 3PBNA 4HEFA 3UDIA 1H8YA 2ZC4B 1ZG6A 1PI5A 1PYYA 3P98A 3O87A 4H8RA 2ZC7A 3FV7A 1LHYA 4UHUA 4E3MA 3VP4A 3IXDA 4KZ8A 3E2KA 1NXYA 4OH0A 4RX3A 5FAOA 3BFGA 3BLMA 2HP9A 4S2OA 1BLPA
chains in the Genus database with same CATH superfamily
3V3RA 3IS2A 2XR0A 3VV4A 2IWCA 4JXWA 2GX5A 2WGVA 5I94A 1KDWA 4F94A 3A3DA 3NDGA 1FSWA 1LI0A 2VV8A 2WGWA 2WK0A 2LB9A 3N7WA 3Q82A 3OZHA 4B9OA 3UMDA 4H6JB 5CGSA 3UDFA 2EX8A 2KOIA 5AJGA 3BLSA 1GHIA 2EWWA 2Y2JA 2GNXA 3HJKA 5DTSA 3HLEA 2DNSA 1W63Q 2PHYA 5AQ9A 2VZWA 1E4DA 3EQVA 3N8SA 2V8CA 3AGEA 1HZOA 5KZHA 3VP3A 4WBGA 4HIAA 1CI8A 2OOLA 4L9FA 3TOIA 5A92A 4HBTA 3G35A 1BSGA 1LL8A 3EOIA 2J9OA 4M4XA 5BOHA 2JE5A 1GHPA 3TW8A 2HZ5A 3WS0A 2I72A 5F69A 1T1CA 4RQ9A 1FCNA 3QNBA 3PXPA 1X0OA 1FQGA 4KQQA 3ZYTA 1TS8A 3C38A 4S2KA 4U3TA 1N4OA 4CQHA 2PD7A 1DY6A 3IF6B 2VA0A 1ERQA 3A0VA 4PM6A 4WZ5A 3MS6A 4GN2A 2WKHA 1LSVA 3IF6C 3LY3A 3V39A 2P74A 4DDSA 5CRFA 2EA9A 3D9YA 1MKIA 1PFLA 1KVLA 4EUVA 3K3CA 5DJUA 1XJ6A 4X69A 1GA0A 5DTTA 1NJ4A 4B4ZA 3NECA 2J3TD 2VGJA 1MWRA 5KMWA 1ALQA 2Y8HA 5FEFA 3NC8A 3LUQA 2XFTA 4ZRRA 4Y2FA 2FZ0A 5G18A 3VSKA 4IVIA 2PAVP 3W4OA 2V1ZA 1TS6A 5HARA 4OPZA 3QNCA 5F68A 1JTGA 2WKQA 4OP5A 2W0NA 5DKLA 2VK3A 4GD6A 5E2FA 3IF5A 4GDNA 1T19A 4ZDXA 2VX8A 3N8LA 5EOEA 4KZ9A 4ZJ3A 4GS9A 2W1TA 2H0TA 4NKPA 5FQKA 4EU0A 1P0ZA 1WYBA 4HJ6A 3D72A 1BT5A 5EVID 3IT9A 5EM1A 1W8QA 2XD5A 4U0XA 4B88A 4XT2A 1VQQA 5EECA 1K4EA 1YLTA 5HPFA 1NLZA 3OBFA 2QZ6A 4Q0JA 3P01A 4DDYA 3G32A 3L9KA 1DJBA 5L10A 4ME4A 4XXRA 2ZC3B 1CQAA 3O5YA 2Y91A 1HLUP 2QPNA 3LIBA 4OLGA 4R3AA 3JPUA 3ZQ5A 4UQIM 1ES3A 1I5QA 5FASA 5CGWA 4LV3A 2H28A 1W63M 4KG5A 2WADA 4QY6A 4UA6A 5LBRA 1SCWA 4WELA 3UPNA 4Y3IA 1NY0A 5EM0A 3GQZA 2PYRA 4NK3A 3SH7A 1D06A 3MFXA 2V8FA 3EQUA 3BRMA 2PU4A 2ZMAA 3FPWA 3GMWA 1RGZA 2XK1A 4L9GA 3ZVTA 2L0WA 2C5WB 4EERA 3PYPA 4LPZA 2B95A 1G5UA 3V5MA 1ONGA 1VHMA 2XDMA 4EQ1A 3LR0A 1IYOA 4E3NA 3IS2B 3E2LA 3KSIA 2ZBBA 4JKTA 5FAQA 4ZBEA 4DE0A 3KSHA 3UE0A 5AVEA 3T4OA 2Y59A 2HDRA 4NXFA 5G4ZA 3B33A 5HAPA 1OTIA 1JVJA 3KSGA 5GLDA 5AQ7A 4EW7A 3NI9A 3CLOA 4FUWA 1XJ2A 2JKRI 1XP4A 4XUZA 3MSHA 5HWTA 4Z9QA 2V0WA 3ZNTA 5EE8A 1W79A 1XA1A 2A24A 5HFOA 4IHQA 3T4LA 4L0LA 1XA7A 1OTDA 1YSQA 4Y7PA 3VP1A 4NXGA 4AFIA 1MWTA 2PR6A 1FOFA 3KYEA 4BQMA 1K56D 1PWDA 1OMEA 2K2NA 3WWXA 2WKPA 2P9VA 3F1OB 2E8IA 2J80A 3HJIA 4HHDA 1KGGA 3FPVA 1H8ZA 3MR0A 2C6WB 5KSHA 3GSGA 4R0QA 2PR5A 1T18A 4Y0UA 4IJGA 3T4SA 4MN5A 3ITAA 1AWIA 4CPKA 5EVEA 5A8BA 3BJNA 5FI7A 3ZCZA 3S1YA 3GR2A 4OVDA 3UY6A 2NUTC 1NYYA 3S4XA 5FSRA 3T1RA 1ERMA 4PM8A 3B3XA 4CJNA 3M2KA 3PBNA 2XFSA 1H8YA 3BY9A 2IA2A 4UHUA 3C8CA 4KZ8A 2QYBA 3C30A 5DVAA 4GLQA 3JYIA 5DTKA 4JGOA 2XEPA 3F1PA 2O9CA 3GDIA 4N1HA 1XFNA 1TEMA 3V67A 4CLCC 2XF3A 3GV9A 2W3EA 4FOFA 2W1RA 3A3IA 3VP2A 4D2OA 4JF6A 5TBMB 3ZNYA 3U2AA 1GSWA 1XFQA 1RP5A 3OPPA 1NYMA 3M6HA 5EUAA 1K6SA 1WA9A 1G68A 2Q9MA 1PI4A 3NOTC 1GSXA 2XGNA 5DKKA 5FDSA 3NY4A 2Z6CA 3G6OA 1LT0A 4GS9B 4ESPA 1JTDA 3OCLA 5HAIA 4O0PA 4S2JA 5FL3A 3T1XA 1L0GA 2EX9A 1E25A 2GDNA 4B4XA 3ZG5A 4F3LB 1U60A 3W4PA 1MPLA 1YLJA 1NRFA 1DJAA 5DF9A 1K54C 3MBZA 2GJ3A 3HREA 3QP5A 2PBYA 3K2NA 4MNRA 4XT2B 1YPRA 3V50A 5K5BA 4ZJ2A 4HESA 3GRJA 4OPQA 5L07A 4HP9A 4PKYA 3T12B 5FDHA 3JVUA 3VOZA 4EUZA 3LEQA 2E8JA 4BL2A 4Y15A 2ZQCA 3WS1A 4OLDA 2GZAA 3LFVA 1QMEA 3H7WB 2Y79A 4IVKA 5A90A 4LRZE 1WYCA 4R23A 3H9WA 1RCJA 4OQHA 2JC7A 5E43A 2BG1A 4S2PA 3VMAA 3VP0A 4WN5A 3A0SA 3EGXC 1C3BA 1FR6A 1YAXA 5EVLA 5CX7A 3HLFA 5HX9A 3ZG0A 1F98A 2ZD8A 4WL9A 2ZQAA 1GSVA 3E4PA 4PKYG 5FQQA 4UA9A 2VV7A 4DJ3A 1KVMA 1XPBA 3RXWA 3CPTA 2HP5A 4QWOA 3DWZA 5L8MA 4X6TA 2YKFA 2Z2LB 2QHKA 2EFXA 4QU3A 1YLYA 3C7UA 3M2JA 2Y2OA 3LR3A 4XUXA 1YLPA 1IFQA 4BBVA 3IH8A 4X55A 3ULFA 5HPIA 1S1YA 3CJMA 1P9WA 2XQZA 4II7A 5J4EA 5FA7A 2DRWA 2W3DA 3SOIA 2V2FF 4R6LA 4G3WA 3FG8A 3LI9A 3HLGA 5EPHA 4Y5FA 4OPRA 2Y2HA 1ZG4A 3IXGA 4MCWA 2XRNA 3BY8A 3RXXA 5CHUA 4JLFA 5F6AA 2D01A 2OLVA 4R38A 3MKFA 1K55C 4KQRA 4R70A 1BULA 1GA9A 5TJJA 5EVIA 4NEED 3DAVA 5C5KA 5CECA 2A49A 1TS7A 5U47A 2V1AA 1BTLA 4IUHA 3QHYA 3T1SA 3B47A 1S1ZA 3G2ZA 3T4QA 1L2SA 1VETB 3HUOA 5J7EA 2R9WA 1XJ4A 4RX2A 4JGQA 4BLMA 1ZKJA 4LFUA 1P97A 3NBLA 3CMZA 1D1JA 3E0YA 3LO7A 4FSFA 4X25A 1XGIA 4P85A 3DBAA 5GLAA 2W27A 3IWOA 5FATA 5FQJA 1PWCA 2XH9A 4ID4A 1M40A 2M7UA 1LI9A 1LLBA 4ARZB 2OLUA 4OQ0A 1K0KA 1PW8A 2M7VA 3S22A 2UV0E 3MQOA 5GL9A 2Y2LA 3F1NA 1EW0A 3MJQA 3QP2A 3IBJA 1LL9A 3BYDA 5D3OA 1F9IA 2XLNA 1TDLA 3UE3A 3PAGA 1MY8A 1CEFA 3BEBA 1TVFA 3IH9A 2PD8A 1ES2A 4YINA 1YLZA 4GDBA 3F1PB 2INWA 3LIAA 1AXBA 5HDDA 1KDSA 4GHIB 2Y2PA 5HDCA 1XXMA 5CTMA 5IHVA 3LY4A 4NG2A 2XA7M 2ZQDA 3ITBA 3GECA 2V0UA 3BQAA 4EV4A 5F1GA 4IUKA 1SKOB 4LGWA 3ZFZA 2IWBA 5CHJA 5M1AA 2P04A 1Q2QA 2O99A 3CUEA 3MXSA 1EI5A 4X53A 3LR5A 1UWPX 3CI6A 4WZ4A 3Q7VA 2WKEA 4G3KA 2EXAA 1DP9A 4GZBA 4P6ZM 3CHWP 2PT7A 3D4FA 4DE1A 3QP8A 3VFFA 4QB8A 1LSWA 4E6XA 3CG5A 3MZDA 1S6RA 4GNUA 1IYSA 3H82B 3RH8B 3ZDJA 5AVFA 2ZM8A 1A0KA 3N4IA 4LRXC 3C7VA 1FCMA 4OKPA 5F82A 3LIFA 3VOYA 1T1AA 1F2KA 3IX4A 2KDKA 3T1QB 3VFHA 4O8GA 1JWVA 2JKFA 1SKFA 3CZDA 3EWKA 1K56A 1K57C 5M19A 2H10A 3ISGA 2PYPA 2PRFA 1CJFA 4KUKA 4CLCD 4BMWA 4N1XA 4OONA 4LCLA 4C6YA 3C5AA 2JBFA 2Y2IA 3ZG7B 1IYPA 1JWPA 3UDIA 3MQQA 3P98A 3O87A 4H8RA 3FV7A 1LHYA 2HGVA 3D3OA 3VP4A 4E3MA 3E2KA 2HP9A 1S66L 4X1LA 4KZ4A 1EROA 4I38A 4MMNA 2VEAA 3UPPA 2QMIA 3NOPC 4YWZA 1H5XA 2HDSA 5HL1A 1NZOA 2JKTM 5AQAA 1BYWA 4LV1A 2O9BA 4MBKA 4BD1A 2EXBA 3E4QA 1Y54A 3EGDC 2WGWB 3NHQA 4BJPA 1N9BA 5DFXA 5HD5A 5FI6A 5E2GA 3HLCA 3V3SA 3FWLA 2RL3A 1MBLA 3DTIA 2VV6A 4E3OA 1O7EA 4ZTKA 2R78A 2BLSA 3UE6A 1ZTUA 1E3UD 2EWVA 1IOUA 2CMNA 2ZMFA 1IYQA 1SZVA 2B5RA 1YLWA 2Y2MA 5GLCA 2AVXA 1BLSA 3CWFA 4R3JA 3FKVA 4JGRA 4MN6A 3C4OA 4BENA 4KG6A 1HTZA 3A0RA 4FD8A 1DP6A 2O0YA 1LSXA 4P6BA 3MZEA 1L0EA 4R4SA 3WS2A 2EFUA 4DF6A 1FIKA 1MWSA 4I3IA 4PPRA 5EVIB 2KX6A 1BZAA 4X68A 3FYZA 3FZCA 4E3JA 4LV0A 3OPHA 1STZA 3WS5A 2VGLM 3HUNA 3GTCA 3C2WA 5CHMA 1N9OA 1PRQA 2G2UA 4EQIA 1LL5A 2M1CA 3O88A 1J3WA 2W3FA 4HH3A 1J9MA 3PR6A 3IF6A 4GW9A 3U4LP 4KZAA 5G4YA 1S4RA 4WF0A 2ZOHA 3NOUC 5IT5A 2J3WA 2P7JA 2RCXA 3SS3A 4EEPA 1K38A 3HL9A 2Y2NA 3PBRA 4JXGA 4A5RA 4E6WA 4K91A 1PWGA 1MZUA 2JKRM 3Q1FA 1DJCA 1IKIA 3HUMA 4E04A 3W4QA 4HI4A 2I9VA 2OWHA 2OWJA 3ZGAB 4GKUA 2NUPC 1IEMA 2B02A 4PM9A 1Y4OA 3T4TA 3DWKA 3QP6A 5JYOA 3LI8A 1DP8A 1VEUA 2W1TB 2ZQ8A 3FC7A 4HH2A 4GJ4A 3BWLA 5MC7A 3I7JA 5DF8A 1YT4A 4QHCA 1BLCA 3TE8A 3HBRA 3RTYA 4EWFA 5A91A 4DE2A 5F1FA 1YMXA 2VJWA 2ZQ9A 1ESUA 4Y0OA 2VLGA 3O3VA 2W3HA 4OP8A 3DW0A 4KG2A 2ZJ9A 5CTNA 2QJ5A 3MFDA 4NXEA 3PAEA 5TFQA 2BTFP 4WUJA 1JWZA 2Y2QA 4EETB 3VSLA 3SW1A 4ETZA 1FSYA 5DF7A 3L7HA 5GHYA 2L4RA 2ZC5B 2K7SA 2PU2A 3PTEA 3UB8A 2OAP1 3N6IA 1SHVA 2QWSA 2Q0OA 2WKRA 4FTXA 5EV0A 3CITA 4IBRA 4KZ5A 2WUQA 5FQIA 1JNUA 3S7OA 5M18A 2V1BA 1G6AA 4BD0A 5HSQA 2ZMVA 4WMCD 2VGKA 1V9YA 2DMWA 1ODVA 1BUEA 3ZHHA 4JXSA 2OAQ1 3NCKA 4EXOA 4G3VA 2Y4AA 5J8XA 1RGYA 4UA7A 4OOLA 3UO9A 5FQ9A 3BECA 4I3JA 4I39A 2H0YA 2VKSA 1YM1A 1XJ3A 4NXBA 2BASA 4KQOA 3G30A 2B18A 2WKIA 3OLOA 5GHZA 3SZTA 3T4KA 4EBPA 1TF1A 4N9KA 2J8YA 3SH9A 4CLCE 4X56A 2Z2MB 1BLHA 4GOGA 4Q0HA 2PBDP 4FH4A 1ZC2A 2HP6A 2OV5A 5F5YA 3VOLA 3G31A 1N9LA 4B93A 1UWNX 4HJ4A 1ES4A 1FILA 1XKZA 2A24B 5TGFA 1KE3A 3JVVA 1S0WA 3S7QA 5A93A 1FR1A 1OPXA 2OSUA 3BFDA 1XGJA 4EEUA 5KSCA 1D7EA 2ZL1A 3O86A 2HJEA 2L1MA 3F1OA 5HWWA 4LV2A 2P9VB 4N9LA 5GLBA 2QKPA 4E3LA 4KZ7A 3PBSA 4HOIA 3KSFA 1YSPA 4KZ3A 4WYYA 3UDXA 3R4KA 4EBNA 2Q9NA 4S2NC 5HZHA 1NZUA 1MKMA 1XX2A 3IQAA 5FAPA 4HQAA 1MWUA 1PZOA 3N8RA 2G7UA 4BWIA 2HPBA 2CC1A 2FFYA 3OPRA 3RJUA 3W2ZA 1O07A 3IX3A 3WRZA 1N9NA 4JF5A 3UE1A 1QMFA 4RYEA 1SDEA 2P08A 2KLIA 1G6OA 5KIZA 4JBFA 4FH2A 4HEFA 4HY8A 2ZC7A 5IS1A 1NXYA 4RX3A 3BLMA 2JKGA 4CLCA 3IXHA 4DE3A 3M6BA 3LCEA 2UWXA 2V20A 3GVBA 4JXVA 4MLLA 5CERA 5GHXA 3KYZA 3LICA 4HJ3A 5TBMA 1YMSA 3RFBA 4JF4A 5EFWA 2WAFA 4WEKA 5J3WA 4LLOB 1ES5A 3BFCA 2ZM0A 3SS4A 2HF6A 5CEBA 5DJTA 2Y2KA 2QJ7A 4S2IA 2HDQA 3IHBA 3MQ0A 3MXQA 3HVFA 3BW6A 5EOOA 4GB7A 3VE3A 2K31A 1F5MA 1VEUB 3IX8A 4QY5A 1K54A 1HD8A 4F3LA 4Q0IA 3AGDA 3G34A 2Z6DA 1FCOA 1ACFA 2JKTI 3UN7A 3IXBA 1VB6A 1OTAA 3ZVWA 4RA7A 2MJ6A 3QP1A 2ZQ7A 4OOMA 2XSSA 1VM1A 3KO6A 4GD8A 1E3UA 4PMAA 3A3JA 2X01A 2FFFB 4IEDA 1G28A 3MXRA 4Z1WA 3DTKA 4KZBA 4O01A 1UGUA 3PBOA 1H3QA 3P09A 5E2HA 2V9AA 3H7WA 3UB7A 3TG9A 1I2SA 3IWIA 1TS0A 1MC0A 4OPYA 3T4JA 3A3FA 1YQSA 2HV1A 3R7WA 3WRTA 3LIDA 3BFEA 1PW1A 3EEHA 3UB5P 4S2LA 4C75A 4BBTA 4FCFA 3MF0A 1YKDA 3TRCA 4LCMA 1PNEA 4EBLA 1TD5A 3LEZA 3BQ8A 3BFFA 4UAAA 4K0XA 4E3KA 1V9ZA 2XA7S 3SS5A 4JPMA 2JN7A 4MDZA 3UMEA 5HAQA 1T1BA 3PBTA 2WYXA 3TJZC 4MBFA 3MKEA 1WE4A 1NLYA 4IBXA 3CPTB 1K25A 4MN7A 3B42A 3KYQA 4D60A 4MBHA 3A3EA 4P6ZS 2Y55A 4P87A 3ZG9B 2G2WA 5TR7A 4H6JA 1KGFA 4OQGA 4LENA 1Q2PA 2DCFA 2Y2GA 4PM5A 3W8KA 3E4OA 2EX6A 1L0FA 2WZZA 3OPLA 4ZJ1A 4I3AA 5AQBA 4EESA 2A2LA 1IKGA 2J3TC 4PHTA 4C3QA 5L2FA 5HL6A 3KX0X 3TSGA 4NETA 4UQIS 1L3LA 5CGXA 4KENB 1Y28A 4YOFA 3T50A 3LGOA 5HW3A 1K55A 1W5DA 2WZXA 1PIOA 2WAEA 1DRMA 5IU1A 1OJGA 4ETXA 1KE0A 3OOVA 1ONHA 3WS4A 4KQDA 4L9EA 4KUOA 4R3BA 1TDGA 5CXWA 3E98A 3DTMA 1M6KA 1OT6A 1SDNA 2ZL1B 3G4PA 5L09A 5EVIC 2ACGA 4BBUA 2ZC6B 4E3IA 4N92A 4S2NA 1CEGA 1H8MA 1S4SA 5FQMA 4QPRA 4HBUA 1VETA 4KZ6A 3Q81A 3NJAA 4QD4A 1CK3A 3DTEA 2XD1A 1H0MA 4P0MA 4BL3A 4WEJA 1NWZA 4WZ5C 3PHYA 2X71A 4LRYC 4OQIA 3CAXA 1OTEA 2YKHA 4ARZA 3G2YA 4QJGA 1KE4A 1P9RA 3AGFA 2ZLYA 1NRJA 4Q8IA 2XROA 1W8YA 3F1NB 4PAUA 3ZG8B 5I5LA 1I2WA 3HCYA 4WM9A 4UEYA 2ZOIA 1CI9A 4R1GA 3SH8A 4JGPA 2WGIA 4DKIA 4K0WA 3PBQA 1PZPA 1EWZA 4CLCB 5FI2A 4WMCA 4U0TA 3FKWA 4K08A 2O9AA 4HNBA 4GHIA 5HWVA 2HDUA 4O7DA 3S7PA 1ZHHB 2D02A 3IHAA 3Q7ZA 3UNWA 4R4RA 2ZM2A 2X02A 2LB5A 1SKOA 1L0DA 4ZAMA 4DMZA 4YFMA 1W7FA 1IELA 3IBRA 3MZFA 2PDRA 1OT9A 3BM6A 4DXCA 3Q7VB 5CEDA 3LYXA 2VGLS 4MEZA 3CUEC 3NULA 4YNRA 4DXBA 3LIEA 1GCEA 3S7NA 4RVAA 1OJ5A 2FH5A 2IWDA 4GCZA 3H82A 1S67L 1K6RA 4DRTA 3UPOA 4S2MA 2HJ9C 3NIAA 2W3GA 1HVBA 3HLDA 4OOYA 1OTBA 3NDEA 1KGEA 5JYPA 1CF0A 3K3DA 4DJ2A 3OC2A 3OCNA 3QP4A 2H5SA 1GHMA 3C4PA 3IWQA 5DFYA 3HLBA 1K57A 2R9XA 1Z6FA 5F83A 5E2EA 3MMHA 4I5SA 3HLWA 5HDSA 2J9PA 4Y13A 2JCHA 2JHEA 1MXOA 3Q07A 4PM7A 4Y0TA 2J7VA 2EX2A 3ICYA 5FEGA 3VE4A 3R7WB 3UB6A 1K4FA 4Y17A 3P7NA 4M3KA 3UB9A 2A3UA 4HP4A 4DN0A 1ESIA 3EEAA 2ZC4B 1ZG6A 1PI5A 1PYYA 1Z09A 3LR4A 3IXDA 4OH0A 5FAOA 3BFGA 4WLAA 5HD3A 4S2OA 1BLPA 1KOUA 4X1MA
chains in the Genus database with same CATH topology
3IXHA 5DVAA 4DE3A 3M6BA 3JYIA 3V3RA 3LCEA 5DTKA 4KZ4A 1EROA 2XEPA 4N1HA 2UWXA 2V20A 2XR0A 3UPPA 3GVBA 2IWCA 1TEMA 4JXWA 2QMIA 2XF3A 3GV9A 1H5XA 2WGVA 4JXVA 4MLLA 1KDWA 5CERA 2HDSA 5GHXA 3A3IA 4F94A 5I94A 5HL1A 3VP2A 1NZOA 3A3DA 1YMSA 3NDGA 5AQAA 4JF6A 4D2OA 1FSWA 4LV1A 1LI0A 4MBKA 3ZNYA 4BD1A 2EXBA 4JF4A 2WAFA 2WGWA 1RP5A 1Y54A 3OPPA 1NYMA 2WGWB 3M6HA 4WEKA 2WK0A 3N7WA 1ES5A 3Q82A 5EUAA 1K6SA 4BJPA 1N9BA 1G68A 3BFCA 3OZHA 2ZM0A 3SS4A 2Q9MA 5FI6A 5E2GA 3HLCA 1PI4A 5CGSA 3V3SA 5CEBA 3FWLA 2Y2KA 3UDFA 4S2IA 2HDQA 2XGNA 2RL3A 3IHBA 1MBLA 2EX8A 3HVFA 5EOOA 4E3OA 4GB7A 1O7EA 1GHIA 3BLSA 2Y2JA 4ZTKA 3NY4A 2BLSA 1E3UD 5DTSA 3HLEA 1JTDA 3OCLA 5HAIA 2DNSA 4QY5A 1K54A 1HD8A 4S2JA 1IYQA 1L0GA 2EX9A 1E25A 2B5RA 5AQ9A 1YLWA 3AGDA 2GDNA 4B4XA 2Y2MA 3G34A 5GLCA 3ZG5A 1U60A 1E4DA 3W4PA 1BLSA 1MPLA 1YLJA 3EQVA 3N8SA 3AGEA 1NRFA 1FCOA 4R3JA 1DJAA 1HZOA 3FKVA 5DF9A 1K54C 3MBZA 5KZHA 3C4OA 3HREA 3IXBA 3UN7A 3VP3A 4BENA 2PBYA 4MNRA 4RA7A 3V50A 4WBGA 3ZVWA 4KG6A 1CI8A 4ZJ2A 1HTZA 4FD8A 3TOIA 2ZQ7A 5A92A 4HBTA 4OOMA 1VM1A 4HESA 4P6BA 3G35A 3GRJA 4GD8A 1E3UA 4OPQA 4PMAA 1BSGA 3A3JA 2X01A 2FFFB 2J9OA 3MZEA 1L0EA 4IEDA 4R4SA 3WS2A 2EFUA 3MXRA 4DF6A 5BOHA 2JE5A 5FDHA 1GHPA 1MWSA 3VOZA 4KZBA 4PPRA 5EVIB 4EUZA 1BZAA 3PBOA 4BL2A 3P09A 4X68A 3WS0A 3FYZA 2ZQCA 3FZCA 3WS1A 2I72A 4OLDA 4LV0A 5E2HA 4E3JA 3OPHA 3WS5A 1QMEA 3TG9A 4IVKA 1I2SA 5A90A 1WYCA 3IWIA 4R23A 3HUNA 1RCJA 4OQHA 3GTCA 5CHMA 2JC7A 1FCNA 3QNBA 2G2UA 4OPYA 4EQIA 5E43A 3A3FA 1LL5A 3O88A 1FQGA 1YQSA 4KQQA 1J9MA 2BG1A 3IF6A 4S2KA 4S2PA 1N4OA 4U3TA 3WRTA 1DY6A 3IF6B 3BFEA 1PW1A 4KZAA 3VP0A 3VMAA 4S2LA 4C75A 1ERQA 4WZ5A 4PM6A 4FCFA 4GN2A 2WKHA 3IF6C 3LY3A 3V39A 4LCMA 4EBLA 2P74A 1C3BA 1FR6A 3LEZA 5EVLA 4DDSA 3BFFA 4UAAA 5CRFA 4K0XA 4E3KA 3HLFA 5HX9A 3ZG0A 1MKIA 3SS5A 1KVLA 2RCXA 3SS3A 4JPMA 4X69A 1K38A 3HL9A 1GA0A 5HAQA 5DTTA 2Y2NA 1NJ4A 2ZD8A 3PBRA 4JXGA 4B4ZA 3PBTA 4A5RA 4E6WA 2WYXA 2ZQAA 4K91A 4MBFA 3MKEA 2VGJA 5FQQA 4UA9A 1MWRA 1WE4A 1KVMA 1PWGA 1XPBA 5KMWA 3RXWA 2HP5A 3Q1FA 4IBXA 1K25A 3DWZA 1ALQA 1DJCA 1IKIA 3HUMA 3NC8A 4X6TA 2XFTA 4MBHA 2Z2LB 3A3EA 3W4QA 5G18A 2Y55A 3VSKA 4P87A 4IVIA 3W4OA 2V1ZA 2EFXA 4QU3A 1YLYA 3ZG9B 3C7UA 5HARA 2G2WA 4OPZA 3QNCA 5TR7A 3M2JA 3ZGAB 1JTGA 2Y2OA 4OP5A 1KGFA 4GKUA 4OQGA 4LENA 1Q2PA 2DCFA 1IEMA 4XUXA 4PM9A 4GD6A 1YLPA 2Y2GA 4PM5A 5E2FA 3IF5A 3IH8A 3W8KA 4GDNA 4X55A 4ZDXA 3N8LA 2EX6A 5EOEA 1L0FA 3DWKA 2WZZA 3OPLA 4KZ9A 5AQBA 3CJMA 4ZJ1A 4ZJ3A 5JYOA 2H0TA 1IKGA 2ZQ8A 4C3QA 5FQKA 5L2FA 2XQZA 1WYBA 3TSGA 5FA7A 4NETA 3I7JA 5DF8A 2DRWA 3SOIA 1BT5A 1YT4A 5EVID 2V2FF 3IT9A 5CGXA 4KENB 4QHCA 1BLCA 1W8QA 3HLGA 2XD5A 5EPHA 3HBRA 4OPRA 2Y2HA 4U0XA 1ZG4A 4EWFA 4B88A 5A91A 3IXGA 5HW3A 4DE2A 1K55A 5F1FA 1W5DA 1VQQA 5EECA 2WZXA 1K4EA 1YMXA 1PIOA 2WAEA 1YLTA 2QZ6A 2ZQ9A 1ESUA 3RXXA 4DDYA 4Y0OA 5CHUA 4JLFA 3G32A 2OLVA 1KE0A 3O3VA 1ONHA 3WS4A 4OP8A 3MKFA 1DJBA 1K55C 3DW0A 4KQRA 4XXRA 1BULA 1GA9A 1TDGA 4R3BA 5EVIA 2ZC3B 2Y91A 5CXWA 4KG2A 4OLGA 2QPNA 2ZJ9A 5CTNA 3DTMA 1M6KA 2A49A 3MFDA 5CECA 1SDNA 3G4PA 3PAEA 5TFQA 5U47A 5EVIC 1BTLA 2ZC6B 4E3IA 3QHYA 4N92A 4S2NA 1CEGA 1JWZA 2Y2QA 3G2ZA 5FQMA 1ES3A 1I5QA 3VSLA 5FASA 5CGWA 4HBUA 1FSYA 1L2SA 3Q81A 4KZ6A 4LV3A 5DF7A 5GHYA 2ZC5B 3HUOA 4KG5A 2WADA 4QY6A 4QD4A 2PU2A 3PTEA 4UA6A 2R9WA 3N6IA 1SCWA 1CK3A 1SHVA 4RX2A 4WELA 2XD1A 3UPNA 4P0MA 4BLMA 1NY0A 1ZKJA 3GQZA 4BL3A 3NBLA 3CMZA 4WEJA 4NK3A 4IBRA 4WZ5C 3LO7A 4FSFA 4KZ5A 2WUQA 3SH7A 5FQIA 1XGIA 4P85A 2X71A 4OQIA 5GLAA 3IWOA 1G6AA 4BD0A 5M18A 5FATA 5FQJA 1PWCA 2XH9A 4ID4A 1M40A 3EQUA 3BRMA 2PU4A 3G2YA 4WMCD 1LI9A 1LLBA 2VGKA 2OLUA 2ZMAA 4QJGA 4OQ0A 1PW8A 1KE4A 3AGFA 3S22A 3GMWA 2ZLYA 1RGZA 2XK1A 5GL9A 2Y2LA 4Q8IA 1W8YA 3ZVTA 1BUEA 2C5WB 3ZHHA 3ZG8B 1I2WA 4WM9A 1LL9A 4JXSA 3NCKA 3BYDA 5D3OA 1CI9A 4R1GA 3SH8A 2Y4AA 2WGIA 2XLNA 3V5MA 5J8XA 1ONGA 1RGYA 1TDLA 4UA7A 3UE3A 4OOLA 3PAGA 3UO9A 5FQ9A 4DKIA 1MY8A 3BECA 4K0WA 1CEFA 2XDMA 1PZPA 3PBQA 1EWZA 3BEBA 1TVFA 2H0YA 5FI2A 3IH9A 4WMCA 4U0TA 1IYOA 1ES2A 1YM1A 4YINA 1YLZA 4E3NA 3FKWA 4GDBA 3E2LA 1AXBA 4JKTA 4KQOA 1KDSA 3G30A 5FAQA 4ZBEA 2HDUA 4DE0A 2WKIA 2Y2PA 4O7DA 5GHZA 3UE0A 1XXMA 5CTMA 5IHVA 2Y59A 3LY4A 3IHAA 2HDRA 3Q7ZA 2ZQDA 3ITBA 3UNWA 4R4RA 4EBPA 5HAPA 2ZM2A 2X02A 4N9KA 2J8YA 3SH9A 4EV4A 5F1GA 1JVJA 4X56A 5GLDA 1L0DA 5AQ7A 2Z2MB 1BLHA 3NI9A 3ZFZA 4ZAMA 4GOGA 2IWBA 4YFMA 5CHJA 5M1AA 1W7FA 1IELA 3MZFA 1Q2QA 1XP4A 4XUZA 3MXSA 4FH4A 1ZC2A 1EI5A 2HP6A 3BM6A 4WZ4A 4X53A 2OV5A 3Q7VA 4DXCA 2WKEA 2EXAA 3G31A 3Q7VB 4Z9QA 4GZBA 5CEDA 3ZNTA 4MEZA 5EE8A 1W79A 1XA1A 5HFOA 1ES4A 3D4FA 4DXBA 4DE1A 1XKZA 5TGFA 4L0LA 1XA7A 1KE3A 1GCEA 1S0WA 3VFFA 4QB8A 4E6XA 4RVAA 3CG5A 4Y7PA 3VP1A 3MZDA 1S6RA 5A93A 1FR1A 2IWDA 2OSUA 3BFDA 1XGJA 4GNUA 1IYSA 1MWTA 1FOFA 5KSCA 1K6RA 4BQMA 1K56D 1PWDA 1OMEA 3O86A 4DRTA 3UPOA 3ZDJA 4S2MA 3WWXA 2P9VA 2ZM8A 2E8IA 3NIAA 4LV2A 2P9VB 4N9LA 1HVBA 3N4IA 3HLDA 5GLBA 4OOYA 1KGGA 3C7VA 3NDEA 1KGEA 1FCMA 1H8ZA 4KZ7A 4E3LA 5JYPA 2C6WB 3PBSA 4OKPA 3OC2A 5KSHA 3OCNA 5F82A 2H5SA 1GHMA 3C4PA 3IWQA 3VOYA 3GSGA 3HLBA 4R0QA 4KZ3A 1K57A 4WYYA 2R9XA 4Y0UA 3UDXA 4EBNA 2Q9NA 4S2NC 1NZUA 1Z6FA 1XX2A 3IQAA 5F83A 5FAPA 3VFHA 5E2EA 1MWUA 1JWVA 1PZOA 1SKFA 3CZDA 3HLWA 2J9PA 3N8RA 1K56A 3ITAA 1K57C 5M19A 2H10A 3ISGA 2JCHA 4CPKA 1MXOA 3Q07A 2HPBA 2CC1A 4PM7A 4Y0TA 2FFYA 3OPRA 3RJUA 2J7VA 2EX2A 1O07A 5FI7A 3WRZA 4JF5A 3ZCZA 3S1YA 3GR2A 4OVDA 3UE1A 1QMFA 3UY6A 4RYEA 4N1XA 1K4FA 4OONA 4LCLA 4C6YA 1SDEA 1NYYA 2JBFA 3C5AA 3S4XA 4M3KA 2A3UA 5FSRA 1ERMA 1ESIA 2Y2IA 3ZG7B 4PM8A 3B3XA 4FH2A 4JBFA 4CJNA 1IYPA 3M2KA 1JWPA 2XFSA 3PBNA 4HEFA 3UDIA 1H8YA 2ZC4B 1ZG6A 1PI5A 1PYYA 3P98A 3O87A 4H8RA 2ZC7A 3FV7A 1LHYA 4UHUA 4E3MA 3VP4A 3IXDA 4KZ8A 3E2KA 1NXYA 4OH0A 4RX3A 5FAOA 3BFGA 3BLMA 2HP9A 4S2OA 1BLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXH A;  5DVA A;  4DE3 A;  3M6B A;  3JYI A;  3V3R A;  3LCE A;  5DTK A;  4KZ4 A;  1ERO A;  2XEP A;  4N1H A;  2UWX A;  2V20 A;  2XR0 A;  3UPP A;  3GVB A;  2IWC A;  1TEM A;  4JXW A;  2QMI A;  2XF3 A;  3GV9 A;  1H5X A;  2WGV A;  4JXV A;  4MLL A;  1KDW A;  5CER A;  2HDS A;  5GHX A;  3A3I A;  4F94 A;  5I94 A;  5HL1 A;  3VP2 A;  1NZO A;  3A3D A;  1YMS A;  3NDG A;  5AQA A;  4JF6 A;  4D2O A;  1FSW A;  4LV1 A;  1LI0 A;  4MBK A;  3ZNY A;  4BD1 A;  2EXB A;  4JF4 A;  2WAF A;  2WGW A;  1RP5 A;  1Y54 A;  3OPP A;  1NYM A;  2WGW B;  3M6H A;  4WEK A;  2WK0 A;  3N7W A;  1ES5 A;  3Q82 A;  5EUA A;  1K6S A;  4BJP A;  1N9B A;  1G68 A;  3BFC A;  3OZH A;  2ZM0 A;  3SS4 A;  2Q9M A;  5FI6 A;  5E2G A;  3HLC A;  1PI4 A;  5CGS A;  3V3S A;  5CEB A;  3FWL A;  2Y2K A;  3UDF A;  4S2I A;  2HDQ A;  2XGN A;  2RL3 A;  3IHB A;  1MBL A;  2EX8 A;  3HVF A;  5EOO A;  4E3O A;  4GB7 A;  1O7E A;  1GHI A;  3BLS A;  2Y2J A;  4ZTK A;  3NY4 A;  2BLS A;  1E3U D;  5DTS A;  3HLE A;  1JTD A;  3OCL A;  5HAI A;  2DNS A;  4QY5 A;  1K54 A;  1HD8 A;  4S2J A;  1IYQ A;  1L0G A;  2EX9 A;  1E25 A;  2B5R A;  5AQ9 A;  1YLW A;  3AGD A;  2GDN A;  4B4X A;  2Y2M A;  3G34 A;  5GLC A;  3ZG5 A;  1U60 A;  1E4D A;  3W4P A;  1BLS A;  1MPL A;  1YLJ A;  3EQV A;  3N8S A;  3AGE A;  1NRF A;  1FCO A;  4R3J A;  1DJA A;  1HZO A;  3FKV A;  5DF9 A;  1K54 C;  3MBZ A;  5KZH A;  3C4O A;  3HRE A;  3IXB A;  3UN7 A;  3VP3 A;  4BEN A;  2PBY A;  4MNR A;  4RA7 A;  3V50 A;  4WBG A;  3ZVW A;  4KG6 A;  1CI8 A;  4ZJ2 A;  1HTZ A;  4FD8 A;  3TOI A;  2ZQ7 A;  5A92 A;  4HBT A;  4OOM A;  1VM1 A;  4HES A;  4P6B A;  3G35 A;  3GRJ A;  4GD8 A;  1E3U A;  4OPQ A;  4PMA A;  1BSG A;  3A3J A;  2X01 A;  2FFF B;  2J9O A;  3MZE A;  1L0E A;  4IED A;  4R4S A;  3WS2 A;  2EFU A;  3MXR A;  4DF6 A;  5BOH A;  2JE5 A;  5FDH A;  1GHP A;  1MWS A;  3VOZ A;  4KZB A;  4PPR A;  5EVI B;  4EUZ A;  1BZA A;  3PBO A;  4BL2 A;  3P09 A;  4X68 A;  3WS0 A;  3FYZ A;  2ZQC A;  3FZC A;  3WS1 A;  2I72 A;  4OLD A;  4LV0 A;  5E2H A;  4E3J A;  3OPH A;  3WS5 A;  1QME A;  3TG9 A;  4IVK A;  1I2S A;  5A90 A;  1WYC A;  3IWI A;  4R23 A;  3HUN A;  1RCJ A;  4OQH A;  3GTC A;  5CHM A;  2JC7 A;  1FCN A;  3QNB A;  2G2U A;  4OPY A;  4EQI A;  5E43 A;  3A3F A;  1LL5 A;  3O88 A;  1FQG A;  1YQS A;  4KQQ A;  1J9M A;  2BG1 A;  3IF6 A;  4S2K A;  4S2P A;  1N4O A;  4U3T A;  3WRT A;  1DY6 A;  3IF6 B;  3BFE A;  1PW1 A;  4KZA A;  3VP0 A;  3VMA A;  4S2L A;  4C75 A;  1ERQ A;  4WZ5 A;  4PM6 A;  4FCF A;  4GN2 A;  2WKH A;  3IF6 C;  3LY3 A;  3V39 A;  4LCM A;  4EBL A;  2P74 A;  1C3B A;  1FR6 A;  3LEZ A;  5EVL A;  4DDS A;  3BFF A;  4UAA A;  5CRF A;  4K0X A;  4E3K A;  3HLF A;  5HX9 A;  3ZG0 A;  1MKI A;  3SS5 A;  1KVL A;  2RCX A;  3SS3 A;  4JPM A;  4X69 A;  1K38 A;  3HL9 A;  1GA0 A;  5HAQ A;  5DTT A;  2Y2N A;  1NJ4 A;  2ZD8 A;  3PBR A;  4JXG A;  4B4Z A;  3PBT A;  4A5R A;  4E6W A;  2WYX A;  2ZQA A;  4K91 A;  4MBF A;  3MKE A;  2VGJ A;  5FQQ A;  4UA9 A;  1MWR A;  1WE4 A;  1KVM A;  1PWG A;  1XPB A;  5KMW A;  3RXW A;  2HP5 A;  3Q1F A;  4IBX A;  1K25 A;  3DWZ A;  1ALQ A;  1DJC A;  1IKI A;  3HUM A;  3NC8 A;  4X6T A;  2XFT A;  4MBH A;  2Z2L B;  3A3E A;  3W4Q A;  5G18 A;  2Y55 A;  3VSK A;  4P87 A;  4IVI A;  3W4O A;  2V1Z A;  2EFX A;  4QU3 A;  1YLY A;  3ZG9 B;  3C7U A;  5HAR A;  2G2W A;  4OPZ A;  3QNC A;  5TR7 A;  3M2J A;  3ZGA B;  1JTG A;  2Y2O A;  4OP5 A;  1KGF A;  4GKU A;  4OQG A;  4LEN A;  1Q2P A;  2DCF A;  1IEM A;  4XUX A;  4PM9 A;  4GD6 A;  1YLP A;  2Y2G A;  4PM5 A;  5E2F A;  3IF5 A;  3IH8 A;  3W8K A;  4GDN A;  4X55 A;  4ZDX A;  3N8L A;  2EX6 A;  5EOE A;  1L0F A;  3DWK A;  2WZZ A;  3OPL A;  4KZ9 A;  5AQB A;  3CJM A;  4ZJ1 A;  4ZJ3 A;  5JYO A;  2H0T A;  1IKG A;  2ZQ8 A;  4C3Q A;  5FQK A;  5L2F A;  2XQZ A;  1WYB A;  3TSG A;  5FA7 A;  4NET A;  3I7J A;  5DF8 A;  2DRW A;  3SOI A;  1BT5 A;  1YT4 A;  5EVI D;  2V2F F;  3IT9 A;  5CGX A;  4KEN B;  4QHC A;  1BLC A;  1W8Q A;  3HLG A;  2XD5 A;  5EPH A;  3HBR A;  4OPR A;  2Y2H A;  4U0X A;  1ZG4 A;  4EWF A;  4B88 A;  5A91 A;  3IXG A;  5HW3 A;  4DE2 A;  1K55 A;  5F1F A;  1W5D A;  1VQQ A;  5EEC A;  2WZX A;  1K4E A;  1YMX A;  1PIO A;  2WAE A;  1YLT A;  2QZ6 A;  2ZQ9 A;  1ESU A;  3RXX A;  4DDY A;  4Y0O A;  5CHU A;  4JLF A;  3G32 A;  2OLV A;  1KE0 A;  3O3V A;  1ONH A;  3WS4 A;  4OP8 A;  3MKF A;  1DJB A;  1K55 C;  3DW0 A;  4KQR A;  4XXR A;  1BUL A;  1GA9 A;  1TDG A;  4R3B A;  5EVI A;  2ZC3 B;  2Y91 A;  5CXW A;  4KG2 A;  4OLG A;  2QPN A;  2ZJ9 A;  5CTN A;  3DTM A;  1M6K A;  2A49 A;  3MFD A;  5CEC A;  1SDN A;  3G4P A;  3PAE A;  5TFQ A;  5U47 A;  5EVI C;  1BTL A;  2ZC6 B;  4E3I A;  3QHY A;  4N92 A;  4S2N A;  1CEG A;  1JWZ A;  2Y2Q A;  3G2Z A;  5FQM A;  1ES3 A;  1I5Q A;  3VSL A;  5FAS A;  5CGW A;  4HBU A;  1FSY A;  1L2S A;  3Q81 A;  4KZ6 A;  4LV3 A;  5DF7 A;  5GHY A;  2ZC5 B;  3HUO A;  4KG5 A;  2WAD A;  4QY6 A;  4QD4 A;  2PU2 A;  3PTE A;  4UA6 A;  2R9W A;  3N6I A;  1SCW A;  1CK3 A;  1SHV A;  4RX2 A;  4WEL A;  2XD1 A;  3UPN A;  4P0M A;  4BLM A;  1NY0 A;  1ZKJ A;  3GQZ A;  4BL3 A;  3NBL A;  3CMZ A;  4WEJ A;  4NK3 A;  4IBR A;  4WZ5 C;  3LO7 A;  4FSF A;  4KZ5 A;  2WUQ A;  3SH7 A;  5FQI A;  1XGI A;  4P85 A;  2X71 A;  4OQI A;  5GLA A;  3IWO A;  1G6A A;  4BD0 A;  5M18 A;  5FAT A;  5FQJ A;  1PWC A;  2XH9 A;  4ID4 A;  1M40 A;  3EQU A;  3BRM A;  2PU4 A;  3G2Y A;  4WMC D;  1LI9 A;  1LLB A;  2VGK A;  2OLU A;  2ZMA A;  4QJG A;  4OQ0 A;  1PW8 A;  1KE4 A;  3AGF A;  3S22 A;  3GMW A;  2ZLY A;  1RGZ A;  2XK1 A;  5GL9 A;  2Y2L A;  4Q8I A;  1W8Y A;  3ZVT A;  1BUE A;  2C5W B;  3ZHH A;  3ZG8 B;  1I2W A;  4WM9 A;  1LL9 A;  4JXS A;  3NCK A;  3BYD A;  5D3O A;  1CI9 A;  4R1G A;  3SH8 A;  2Y4A A;  2WGI A;  2XLN A;  3V5M A;  5J8X A;  1ONG A;  1RGY A;  1TDL A;  4UA7 A;  3UE3 A;  4OOL A;  3PAG A;  3UO9 A;  5FQ9 A;  4DKI A;  1MY8 A;  3BEC A;  4K0W A;  1CEF A;  2XDM A;  1PZP A;  3PBQ A;  1EWZ A;  3BEB A;  1TVF A;  2H0Y A;  5FI2 A;  3IH9 A;  4WMC A;  4U0T A;  1IYO A;  1ES2 A;  1YM1 A;  4YIN A;  1YLZ A;  4E3N A;  3FKW A;  4GDB A;  3E2L A;  1AXB A;  4JKT A;  4KQO A;  1KDS A;  3G30 A;  5FAQ A;  4ZBE A;  2HDU A;  4DE0 A;  2WKI A;  2Y2P A;  4O7D A;  5GHZ A;  3UE0 A;  1XXM A;  5CTM A;  5IHV A;  2Y59 A;  3LY4 A;  3IHA A;  2HDR A;  3Q7Z A;  2ZQD A;  3ITB A;  3UNW A;  4R4R A;  4EBP A;  5HAP A;  2ZM2 A;  2X02 A;  4N9K A;  2J8Y A;  3SH9 A;  4EV4 A;  5F1G A;  1JVJ A;  4X56 A;  5GLD A;  1L0D A;  5AQ7 A;  2Z2M B;  1BLH A;  3NI9 A;  3ZFZ A;  4ZAM A;  4GOG A;  2IWB A;  4YFM A;  5CHJ A;  5M1A A;  1W7F A;  1IEL A;  3MZF A;  1Q2Q A;  1XP4 A;  4XUZ A;  3MXS A;  4FH4 A;  1ZC2 A;  1EI5 A;  2HP6 A;  3BM6 A;  4WZ4 A;  4X53 A;  2OV5 A;  3Q7V A;  4DXC A;  2WKE A;  2EXA A;  3G31 A;  3Q7V B;  4Z9Q A;  4GZB A;  5CED A;  3ZNT A;  4MEZ A;  5EE8 A;  1W79 A;  1XA1 A;  5HFO A;  1ES4 A;  3D4F A;  4DXB A;  4DE1 A;  1XKZ A;  5TGF A;  4L0L A;  1XA7 A;  1KE3 A;  1GCE A;  1S0W A;  3VFF A;  4QB8 A;  4E6X A;  4RVA A;  3CG5 A;  4Y7P A;  3VP1 A;  3MZD A;  1S6R A;  5A93 A;  1FR1 A;  2IWD A;  2OSU A;  3BFD A;  1XGJ A;  4GNU A;  1IYS A;  1MWT A;  1FOF A;  5KSC A;  1K6R A;  4BQM A;  1K56 D;  1PWD A;  1OME A;  3O86 A;  4DRT A;  3UPO A;  3ZDJ A;  4S2M A;  3WWX A;  2P9V A;  2ZM8 A;  2E8I A;  3NIA A;  4LV2 A;  2P9V B;  4N9L A;  1HVB A;  3N4I A;  3HLD A;  5GLB A;  4OOY A;  1KGG A;  3C7V A;  3NDE A;  1KGE A;  1FCM A;  1H8Z A;  4KZ7 A;  4E3L A;  5JYP A;  2C6W B;  3PBS A;  4OKP A;  3OC2 A;  5KSH A;  3OCN A;  5F82 A;  2H5S A;  1GHM A;  3C4P A;  3IWQ A;  3VOY A;  3GSG A;  3HLB A;  4R0Q A;  4KZ3 A;  1K57 A;  4WYY A;  2R9X A;  4Y0U A;  3UDX A;  4EBN A;  2Q9N A;  4S2N C;  1NZU A;  1Z6F A;  1XX2 A;  3IQA A;  5F83 A;  5FAP A;  3VFH A;  5E2E A;  1MWU A;  1JWV A;  1PZO A;  1SKF A;  3CZD A;  3HLW A;  2J9P A;  3N8R A;  1K56 A;  3ITA A;  1K57 C;  5M19 A;  2H10 A;  3ISG A;  2JCH A;  4CPK A;  1MXO A;  3Q07 A;  2HPB A;  2CC1 A;  4PM7 A;  4Y0T A;  2FFY A;  3OPR A;  3RJU A;  2J7V A;  2EX2 A;  1O07 A;  5FI7 A;  3WRZ A;  4JF5 A;  3ZCZ A;  3S1Y A;  3GR2 A;  4OVD A;  3UE1 A;  1QMF A;  3UY6 A;  4RYE A;  4N1X A;  1K4F A;  4OON A;  4LCL A;  4C6Y A;  1SDE A;  1NYY A;  2JBF A;  3C5A A;  3S4X A;  4M3K A;  2A3U A;  5FSR A;  1ERM A;  1ESI A;  2Y2I A;  3ZG7 B;  4PM8 A;  3B3X A;  4FH2 A;  4JBF A;  4CJN A;  1IYP A;  3M2K A;  1JWP A;  2XFS A;  3PBN A;  4HEF A;  3UDI A;  1H8Y A;  2ZC4 B;  1ZG6 A;  1PI5 A;  1PYY A;  3P98 A;  3O87 A;  4H8R A;  2ZC7 A;  3FV7 A;  1LHY A;  4UHU A;  4E3M A;  3VP4 A;  3IXD A;  4KZ8 A;  3E2K A;  1NXY A;  4OH0 A;  4RX3 A;  5FAO A;  3BFG A;  3BLM A;  2HP9 A;  4S2O A;  1BLP A; 
#chains in the Genus database with same CATH topology
 3V3R A;  3IS2 A;  2XR0 A;  3VV4 A;  2IWC A;  4JXW A;  2GX5 A;  2WGV A;  5I94 A;  1KDW A;  4F94 A;  3A3D A;  3NDG A;  1FSW A;  1LI0 A;  2VV8 A;  2WGW A;  2WK0 A;  2LB9 A;  3N7W A;  3Q82 A;  3OZH A;  4B9O A;  3UMD A;  4H6J B;  5CGS A;  3UDF A;  2EX8 A;  2KOI A;  5AJG A;  3BLS A;  1GHI A;  2EWW A;  2Y2J A;  2GNX A;  3HJK A;  5DTS A;  3HLE A;  2DNS A;  1W63 Q;  2PHY A;  5AQ9 A;  2VZW A;  1E4D A;  3EQV A;  3N8S A;  2V8C A;  3AGE A;  1HZO A;  5KZH A;  3VP3 A;  4WBG A;  4HIA A;  1CI8 A;  2OOL A;  4L9F A;  3TOI A;  5A92 A;  4HBT A;  3G35 A;  1BSG A;  1LL8 A;  3EOI A;  2J9O A;  4M4X A;  5BOH A;  2JE5 A;  1GHP A;  3TW8 A;  2HZ5 A;  3WS0 A;  2I72 A;  5F69 A;  1T1C A;  4RQ9 A;  1FCN A;  3QNB A;  3PXP A;  1X0O A;  1FQG A;  4KQQ A;  3ZYT A;  1TS8 A;  3C38 A;  4S2K A;  4U3T A;  1N4O A;  4CQH A;  2PD7 A;  1DY6 A;  3IF6 B;  2VA0 A;  1ERQ A;  3A0V A;  4PM6 A;  4WZ5 A;  3MS6 A;  4GN2 A;  2WKH A;  1LSV A;  3IF6 C;  3LY3 A;  3V39 A;  2P74 A;  4DDS A;  5CRF A;  2EA9 A;  3D9Y A;  1MKI A;  1PFL A;  1KVL A;  4EUV A;  3K3C A;  5DJU A;  1XJ6 A;  4X69 A;  1GA0 A;  5DTT A;  1NJ4 A;  4B4Z A;  3NEC A;  2J3T D;  2VGJ A;  1MWR A;  5KMW A;  1ALQ A;  2Y8H A;  5FEF A;  3NC8 A;  3LUQ A;  2XFT A;  4ZRR A;  4Y2F A;  2FZ0 A;  5G18 A;  3VSK A;  4IVI A;  2PAV P;  3W4O A;  2V1Z A;  1TS6 A;  5HAR A;  4OPZ A;  3QNC A;  5F68 A;  1JTG A;  2WKQ A;  4OP5 A;  2W0N A;  5DKL A;  2VK3 A;  4GD6 A;  5E2F A;  3IF5 A;  4GDN A;  1T19 A;  4ZDX A;  2VX8 A;  3N8L A;  5EOE A;  4KZ9 A;  4ZJ3 A;  4GS9 A;  2W1T A;  2H0T A;  4NKP A;  5FQK A;  4EU0 A;  1P0Z A;  1WYB A;  4HJ6 A;  3D72 A;  1BT5 A;  5EVI D;  3IT9 A;  5EM1 A;  1W8Q A;  2XD5 A;  4U0X A;  4B88 A;  4XT2 A;  1VQQ A;  5EEC A;  1K4E A;  1YLT A;  5HPF A;  1NLZ A;  3OBF A;  2QZ6 A;  4Q0J A;  3P01 A;  4DDY A;  3G32 A;  3L9K A;  1DJB A;  5L10 A;  4ME4 A;  4XXR A;  2ZC3 B;  1CQA A;  3O5Y A;  2Y91 A;  1HLU P;  2QPN A;  3LIB A;  4OLG A;  4R3A A;  3JPU A;  3ZQ5 A;  4UQI M;  1ES3 A;  1I5Q A;  5FAS A;  5CGW A;  4LV3 A;  2H28 A;  1W63 M;  4KG5 A;  2WAD A;  4QY6 A;  4UA6 A;  5LBR A;  1SCW A;  4WEL A;  3UPN A;  4Y3I A;  1NY0 A;  5EM0 A;  3GQZ A;  2PYR A;  4NK3 A;  3SH7 A;  1D06 A;  3MFX A;  2V8F A;  3EQU A;  3BRM A;  2PU4 A;  2ZMA A;  3FPW A;  3GMW A;  1RGZ A;  2XK1 A;  4L9G A;  3ZVT A;  2L0W A;  2C5W B;  4EER A;  3PYP A;  4LPZ A;  2B95 A;  1G5U A;  3V5M A;  1ONG A;  1VHM A;  2XDM A;  4EQ1 A;  3LR0 A;  1IYO A;  4E3N A;  3IS2 B;  3E2L A;  3KSI A;  2ZBB A;  4JKT A;  5FAQ A;  4ZBE A;  4DE0 A;  3KSH A;  3UE0 A;  5AVE A;  3T4O A;  2Y59 A;  2HDR A;  4NXF A;  5G4Z A;  3B33 A;  5HAP A;  1OTI A;  1JVJ A;  3KSG A;  5GLD A;  5AQ7 A;  4EW7 A;  3NI9 A;  3CLO A;  4FUW A;  1XJ2 A;  2JKR I;  1XP4 A;  4XUZ A;  3MSH A;  5HWT A;  4Z9Q A;  2V0W A;  3ZNT A;  5EE8 A;  1W79 A;  1XA1 A;  2A24 A;  5HFO A;  4IHQ A;  3T4L A;  4L0L A;  1XA7 A;  1OTD A;  1YSQ A;  4Y7P A;  3VP1 A;  4NXG A;  4AFI A;  1MWT A;  2PR6 A;  1FOF A;  3KYE A;  4BQM A;  1K56 D;  1PWD A;  1OME A;  2K2N A;  3WWX A;  2WKP A;  2P9V A;  3F1O B;  2E8I A;  2J80 A;  3HJI A;  4HHD A;  1KGG A;  3FPV A;  1H8Z A;  3MR0 A;  2C6W B;  5KSH A;  3GSG A;  4R0Q A;  2PR5 A;  1T18 A;  4Y0U A;  4IJG A;  3T4S A;  4MN5 A;  3ITA A;  1AWI A;  4CPK A;  5EVE A;  5A8B A;  3BJN A;  5FI7 A;  3ZCZ A;  3S1Y A;  3GR2 A;  4OVD A;  3UY6 A;  2NUT C;  1NYY A;  3S4X A;  5FSR A;  3T1R A;  1ERM A;  4PM8 A;  3B3X A;  4CJN A;  3M2K A;  3PBN A;  2XFS A;  1H8Y A;  3BY9 A;  2IA2 A;  4UHU A;  3C8C A;  4KZ8 A;  2QYB A;  3C30 A;  5DVA A;  4GLQ A;  3JYI A;  5DTK A;  4JGO A;  2XEP A;  3F1P A;  2O9C A;  3GDI A;  4N1H A;  1XFN A;  1TEM A;  3V67 A;  4CLC C;  2XF3 A;  3GV9 A;  2W3E A;  4FOF A;  2W1R A;  3A3I A;  3VP2 A;  4D2O A;  4JF6 A;  5TBM B;  3ZNY A;  3U2A A;  1GSW A;  1XFQ A;  1RP5 A;  3OPP A;  1NYM A;  3M6H A;  5EUA A;  1K6S A;  1WA9 A;  1G68 A;  2Q9M A;  1PI4 A;  3NOT C;  1GSX A;  2XGN A;  5DKK A;  5FDS A;  3NY4 A;  2Z6C A;  3G6O A;  1LT0 A;  4GS9 B;  4ESP A;  1JTD A;  3OCL A;  5HAI A;  4O0P A;  4S2J A;  5FL3 A;  3T1X A;  1L0G A;  2EX9 A;  1E25 A;  2GDN A;  4B4X A;  3ZG5 A;  4F3L B;  1U60 A;  3W4P A;  1MPL A;  1YLJ A;  1NRF A;  1DJA A;  5DF9 A;  1K54 C;  3MBZ A;  2GJ3 A;  3HRE A;  3QP5 A;  2PBY A;  3K2N A;  4MNR A;  4XT2 B;  1YPR A;  3V50 A;  5K5B A;  4ZJ2 A;  4HES A;  3GRJ A;  4OPQ A;  5L07 A;  4HP9 A;  4PKY A;  3T12 B;  5FDH A;  3JVU A;  3VOZ A;  4EUZ A;  3LEQ A;  2E8J A;  4BL2 A;  4Y15 A;  2ZQC A;  3WS1 A;  4OLD A;  2GZA A;  3LFV A;  1QME A;  3H7W B;  2Y79 A;  4IVK A;  5A90 A;  4LRZ E;  1WYC A;  4R23 A;  3H9W A;  1RCJ A;  4OQH A;  2JC7 A;  5E43 A;  2BG1 A;  4S2P A;  3VMA A;  3VP0 A;  4WN5 A;  3A0S A;  3EGX C;  1C3B A;  1FR6 A;  1YAX A;  5EVL A;  5CX7 A;  3HLF A;  5HX9 A;  3ZG0 A;  1F98 A;  2ZD8 A;  4WL9 A;  2ZQA A;  1GSV A;  3E4P A;  4PKY G;  5FQQ A;  4UA9 A;  2VV7 A;  4DJ3 A;  1KVM A;  1XPB A;  3RXW A;  3CPT A;  2HP5 A;  4QWO A;  3DWZ A;  5L8M A;  4X6T A;  2YKF A;  2Z2L B;  2QHK A;  2EFX A;  4QU3 A;  1YLY A;  3C7U A;  3M2J A;  2Y2O A;  3LR3 A;  4XUX A;  1YLP A;  1IFQ A;  4BBV A;  3IH8 A;  4X55 A;  3ULF A;  5HPI A;  1S1Y A;  3CJM A;  1P9W A;  2XQZ A;  4II7 A;  5J4E A;  5FA7 A;  2DRW A;  2W3D A;  3SOI A;  2V2F F;  4R6L A;  4G3W A;  3FG8 A;  3LI9 A;  3HLG A;  5EPH A;  4Y5F A;  4OPR A;  2Y2H A;  1ZG4 A;  3IXG A;  4MCW A;  2XRN A;  3BY8 A;  3RXX A;  5CHU A;  4JLF A;  5F6A A;  2D01 A;  2OLV A;  4R38 A;  3MKF A;  1K55 C;  4KQR A;  4R70 A;  1BUL A;  1GA9 A;  5TJJ A;  5EVI A;  4NEE D;  3DAV A;  5C5K A;  5CEC A;  2A49 A;  1TS7 A;  5U47 A;  2V1A A;  1BTL A;  4IUH A;  3QHY A;  3T1S A;  3B47 A;  1S1Z A;  3G2Z A;  3T4Q A;  1L2S A;  1VET B;  3HUO A;  5J7E A;  2R9W A;  1XJ4 A;  4RX2 A;  4JGQ A;  4BLM A;  1ZKJ A;  4LFU A;  1P97 A;  3NBL A;  3CMZ A;  1D1J A;  3E0Y A;  3LO7 A;  4FSF A;  4X25 A;  1XGI A;  4P85 A;  3DBA A;  5GLA A;  2W27 A;  3IWO A;  5FAT A;  5FQJ A;  1PWC A;  2XH9 A;  4ID4 A;  1M40 A;  2M7U A;  1LI9 A;  1LLB A;  4ARZ B;  2OLU A;  4OQ0 A;  1K0K A;  1PW8 A;  2M7V A;  3S22 A;  2UV0 E;  3MQO A;  5GL9 A;  2Y2L A;  3F1N A;  1EW0 A;  3MJQ A;  3QP2 A;  3IBJ A;  1LL9 A;  3BYD A;  5D3O A;  1F9I A;  2XLN A;  1TDL A;  3UE3 A;  3PAG A;  1MY8 A;  1CEF A;  3BEB A;  1TVF A;  3IH9 A;  2PD8 A;  1ES2 A;  4YIN A;  1YLZ A;  4GDB A;  3F1P B;  2INW A;  3LIA A;  1AXB A;  5HDD A;  1KDS A;  4GHI B;  2Y2P A;  5HDC A;  1XXM A;  5CTM A;  5IHV A;  3LY4 A;  4NG2 A;  2XA7 M;  2ZQD A;  3ITB A;  3GEC A;  2V0U A;  3BQA A;  4EV4 A;  5F1G A;  4IUK A;  1SKO B;  4LGW A;  3ZFZ A;  2IWB A;  5CHJ A;  5M1A A;  2P04 A;  1Q2Q A;  2O99 A;  3CUE A;  3MXS A;  1EI5 A;  4X53 A;  3LR5 A;  1UWP X;  3CI6 A;  4WZ4 A;  3Q7V A;  2WKE A;  4G3K A;  2EXA A;  1DP9 A;  4GZB A;  4P6Z M;  3CHW P;  2PT7 A;  3D4F A;  4DE1 A;  3QP8 A;  3VFF A;  4QB8 A;  1LSW A;  4E6X A;  3CG5 A;  3MZD A;  1S6R A;  4GNU A;  1IYS A;  3H82 B;  3RH8 B;  3ZDJ A;  5AVF A;  2ZM8 A;  1A0K A;  3N4I A;  4LRX C;  3C7V A;  1FCM A;  4OKP A;  5F82 A;  3LIF A;  3VOY A;  1T1A A;  1F2K A;  3IX4 A;  2KDK A;  3T1Q B;  3VFH A;  4O8G A;  1JWV A;  2JKF A;  1SKF A;  3CZD A;  3EWK A;  1K56 A;  1K57 C;  5M19 A;  2H10 A;  3ISG A;  2PYP A;  2PRF A;  1CJF A;  4KUK A;  4CLC D;  4BMW A;  4N1X A;  4OON A;  4LCL A;  4C6Y A;  3C5A A;  2JBF A;  2Y2I A;  3ZG7 B;  1IYP A;  1JWP A;  3UDI A;  3MQQ A;  3P98 A;  3O87 A;  4H8R A;  3FV7 A;  1LHY A;  2HGV A;  3D3O A;  3VP4 A;  4E3M A;  3E2K A;  2HP9 A;  1S66 L;  4X1L A;  4KZ4 A;  1ERO A;  4I38 A;  4MMN A;  2VEA A;  3UPP A;  2QMI A;  3NOP C;  4YWZ A;  1H5X A;  2HDS A;  5HL1 A;  1NZO A;  2JKT M;  5AQA A;  1BYW A;  4LV1 A;  2O9B A;  4MBK A;  4BD1 A;  2EXB A;  3E4Q A;  1Y54 A;  3EGD C;  2WGW B;  3NHQ A;  4BJP A;  1N9B A;  5DFX A;  5HD5 A;  5FI6 A;  5E2G A;  3HLC A;  3V3S A;  3FWL A;  2RL3 A;  1MBL A;  3DTI A;  2VV6 A;  4E3O A;  1O7E A;  4ZTK A;  2R78 A;  2BLS A;  3UE6 A;  1ZTU A;  1E3U D;  2EWV A;  1IOU A;  2CMN A;  2ZMF A;  1IYQ A;  1SZV A;  2B5R A;  1YLW A;  2Y2M A;  5GLC A;  2AVX A;  1BLS A;  3CWF A;  4R3J A;  3FKV A;  4JGR A;  4MN6 A;  3C4O A;  4BEN A;  4KG6 A;  1HTZ A;  3A0R A;  4FD8 A;  1DP6 A;  2O0Y A;  1LSX A;  4P6B A;  3MZE A;  1L0E A;  4R4S A;  3WS2 A;  2EFU A;  4DF6 A;  1FIK A;  1MWS A;  4I3I A;  4PPR A;  5EVI B;  2KX6 A;  1BZA A;  4X68 A;  3FYZ A;  3FZC A;  4E3J A;  4LV0 A;  3OPH A;  1STZ A;  3WS5 A;  2VGL M;  3HUN A;  3GTC A;  3C2W A;  5CHM A;  1N9O A;  1PRQ A;  2G2U A;  4EQI A;  1LL5 A;  2M1C A;  3O88 A;  1J3W A;  2W3F A;  4HH3 A;  1J9M A;  3PR6 A;  3IF6 A;  4GW9 A;  3U4L P;  4KZA A;  5G4Y A;  1S4R A;  4WF0 A;  2ZOH A;  3NOU C;  5IT5 A;  2J3W A;  2P7J A;  2RCX A;  3SS3 A;  4EEP A;  1K38 A;  3HL9 A;  2Y2N A;  3PBR A;  4JXG A;  4A5R A;  4E6W A;  4K91 A;  1PWG A;  1MZU A;  2JKR M;  3Q1F A;  1DJC A;  1IKI A;  3HUM A;  4E04 A;  3W4Q A;  4HI4 A;  2I9V A;  2OWH A;  2OWJ A;  3ZGA B;  4GKU A;  2NUP C;  1IEM A;  2B02 A;  4PM9 A;  1Y4O A;  3T4T A;  3DWK A;  3QP6 A;  5JYO A;  3LI8 A;  1DP8 A;  1VEU A;  2W1T B;  2ZQ8 A;  3FC7 A;  4HH2 A;  4GJ4 A;  3BWL A;  5MC7 A;  3I7J A;  5DF8 A;  1YT4 A;  4QHC A;  1BLC A;  3TE8 A;  3HBR A;  3RTY A;  4EWF A;  5A91 A;  4DE2 A;  5F1F A;  1YMX A;  2VJW A;  2ZQ9 A;  1ESU A;  4Y0O A;  2VLG A;  3O3V A;  2W3H A;  4OP8 A;  3DW0 A;  4KG2 A;  2ZJ9 A;  5CTN A;  2QJ5 A;  3MFD A;  4NXE A;  3PAE A;  5TFQ A;  2BTF P;  4WUJ A;  1JWZ A;  2Y2Q A;  4EET B;  3VSL A;  3SW1 A;  4ETZ A;  1FSY A;  5DF7 A;  3L7H A;  5GHY A;  2L4R A;  2ZC5 B;  2K7S A;  2PU2 A;  3PTE A;  3UB8 A;  2OAP 1;  3N6I A;  1SHV A;  2QWS A;  2Q0O A;  2WKR A;  4FTX A;  5EV0 A;  3CIT A;  4IBR A;  4KZ5 A;  2WUQ A;  5FQI A;  1JNU A;  3S7O A;  5M18 A;  2V1B A;  1G6A A;  4BD0 A;  5HSQ A;  2ZMV A;  4WMC D;  2VGK A;  1V9Y A;  2DMW A;  1ODV A;  1BUE A;  3ZHH A;  4JXS A;  2OAQ 1;  3NCK A;  4EXO A;  4G3V A;  2Y4A A;  5J8X A;  1RGY A;  4UA7 A;  4OOL A;  3UO9 A;  5FQ9 A;  3BEC A;  4I3J A;  4I39 A;  2H0Y A;  2VKS A;  1YM1 A;  1XJ3 A;  4NXB A;  2BAS A;  4KQO A;  3G30 A;  2B18 A;  2WKI A;  3OLO A;  5GHZ A;  3SZT A;  3T4K A;  4EBP A;  1TF1 A;  4N9K A;  2J8Y A;  3SH9 A;  4CLC E;  4X56 A;  2Z2M B;  1BLH A;  4GOG A;  4Q0H A;  2PBD P;  4FH4 A;  1ZC2 A;  2HP6 A;  2OV5 A;  5F5Y A;  3VOL A;  3G31 A;  1N9L A;  4B93 A;  1UWN X;  4HJ4 A;  1ES4 A;  1FIL A;  1XKZ A;  2A24 B;  5TGF A;  1KE3 A;  3JVV A;  1S0W A;  3S7Q A;  5A93 A;  1FR1 A;  1OPX A;  2OSU A;  3BFD A;  1XGJ A;  4EEU A;  5KSC A;  1D7E A;  2ZL1 A;  3O86 A;  2HJE A;  2L1M A;  3F1O A;  5HWW A;  4LV2 A;  2P9V B;  4N9L A;  5GLB A;  2QKP A;  4E3L A;  4KZ7 A;  3PBS A;  4HOI A;  3KSF A;  1YSP A;  4KZ3 A;  4WYY A;  3UDX A;  3R4K A;  4EBN A;  2Q9N A;  4S2N C;  5HZH A;  1NZU A;  1MKM A;  1XX2 A;  3IQA A;  5FAP A;  4HQA A;  1MWU A;  1PZO A;  3N8R A;  2G7U A;  4BWI A;  2HPB A;  2CC1 A;  2FFY A;  3OPR A;  3RJU A;  3W2Z A;  1O07 A;  3IX3 A;  3WRZ A;  1N9N A;  4JF5 A;  3UE1 A;  1QMF A;  4RYE A;  1SDE A;  2P08 A;  2KLI A;  1G6O A;  5KIZ A;  4JBF A;  4FH2 A;  4HEF A;  4HY8 A;  2ZC7 A;  5IS1 A;  1NXY A;  4RX3 A;  3BLM A;  2JKG A;  4CLC A;  3IXH A;  4DE3 A;  3M6B A;  3LCE A;  2UWX A;  2V20 A;  3GVB A;  4JXV A;  4MLL A;  5CER A;  5GHX A;  3KYZ A;  3LIC A;  4HJ3 A;  5TBM A;  1YMS A;  3RFB A;  4JF4 A;  5EFW A;  2WAF A;  4WEK A;  5J3W A;  4LLO B;  1ES5 A;  3BFC A;  2ZM0 A;  3SS4 A;  2HF6 A;  5CEB A;  5DJT A;  2Y2K A;  2QJ7 A;  4S2I A;  2HDQ A;  3IHB A;  3MQ0 A;  3MXQ A;  3HVF A;  3BW6 A;  5EOO A;  4GB7 A;  3VE3 A;  2K31 A;  1F5M A;  1VEU B;  3IX8 A;  4QY5 A;  1K54 A;  1HD8 A;  4F3L A;  4Q0I A;  3AGD A;  3G34 A;  2Z6D A;  1FCO A;  1ACF A;  2JKT I;  3UN7 A;  3IXB A;  1VB6 A;  1OTA A;  3ZVW A;  4RA7 A;  2MJ6 A;  3QP1 A;  2ZQ7 A;  4OOM A;  2XSS A;  1VM1 A;  3KO6 A;  4GD8 A;  1E3U A;  4PMA A;  3A3J A;  2X01 A;  2FFF B;  4IED A;  1G28 A;  3MXR A;  4Z1W A;  3DTK A;  4KZB A;  4O01 A;  1UGU A;  3PBO A;  1H3Q A;  3P09 A;  5E2H A;  2V9A A;  3H7W A;  3UB7 A;  3TG9 A;  1I2S A;  3IWI A;  1TS0 A;  1MC0 A;  4OPY A;  3T4J A;  3A3F A;  1YQS A;  2HV1 A;  3R7W A;  3WRT A;  3LID A;  3BFE A;  1PW1 A;  3EEH A;  3UB5 P;  4S2L A;  4C75 A;  4BBT A;  4FCF A;  3MF0 A;  1YKD A;  3TRC A;  4LCM A;  1PNE A;  4EBL A;  1TD5 A;  3LEZ A;  3BQ8 A;  3BFF A;  4UAA A;  4K0X A;  4E3K A;  1V9Z A;  2XA7 S;  3SS5 A;  4JPM A;  2JN7 A;  4MDZ A;  3UME A;  5HAQ A;  1T1B A;  3PBT A;  2WYX A;  3TJZ C;  4MBF A;  3MKE A;  1WE4 A;  1NLY A;  4IBX A;  3CPT B;  1K25 A;  4MN7 A;  3B42 A;  3KYQ A;  4D60 A;  4MBH A;  3A3E A;  4P6Z S;  2Y55 A;  4P87 A;  3ZG9 B;  2G2W A;  5TR7 A;  4H6J A;  1KGF A;  4OQG A;  4LEN A;  1Q2P A;  2DCF A;  2Y2G A;  4PM5 A;  3W8K A;  3E4O A;  2EX6 A;  1L0F A;  2WZZ A;  3OPL A;  4ZJ1 A;  4I3A A;  5AQB A;  4EES A;  2A2L A;  1IKG A;  2J3T C;  4PHT A;  4C3Q A;  5L2F A;  5HL6 A;  3KX0 X;  3TSG A;  4NET A;  4UQI S;  1L3L A;  5CGX A;  4KEN B;  1Y28 A;  4YOF A;  3T50 A;  3LGO A;  5HW3 A;  1K55 A;  1W5D A;  2WZX A;  1PIO A;  2WAE A;  1DRM A;  5IU1 A;  1OJG A;  4ETX A;  1KE0 A;  3OOV A;  1ONH A;  3WS4 A;  4KQD A;  4L9E A;  4KUO A;  4R3B A;  1TDG A;  5CXW A;  3E98 A;  3DTM A;  1M6K A;  1OT6 A;  1SDN A;  2ZL1 B;  3G4P A;  5L09 A;  5EVI C;  2ACG A;  4BBU A;  2ZC6 B;  4E3I A;  4N92 A;  4S2N A;  1CEG A;  1H8M A;  1S4S A;  5FQM A;  4QPR A;  4HBU A;  1VET A;  4KZ6 A;  3Q81 A;  3NJA A;  4QD4 A;  1CK3 A;  3DTE A;  2XD1 A;  1H0M A;  4P0M A;  4BL3 A;  4WEJ A;  1NWZ A;  4WZ5 C;  3PHY A;  2X71 A;  4LRY C;  4OQI A;  3CAX A;  1OTE A;  2YKH A;  4ARZ A;  3G2Y A;  4QJG A;  1KE4 A;  1P9R A;  3AGF A;  2ZLY A;  1NRJ A;  4Q8I A;  2XRO A;  1W8Y A;  3F1N B;  4PAU A;  3ZG8 B;  5I5L A;  1I2W A;  3HCY A;  4WM9 A;  4UEY A;  2ZOI A;  1CI9 A;  4R1G A;  3SH8 A;  4JGP A;  2WGI A;  4DKI A;  4K0W A;  3PBQ A;  1PZP A;  1EWZ A;  4CLC B;  5FI2 A;  4WMC A;  4U0T A;  3FKW A;  4K08 A;  2O9A A;  4HNB A;  4GHI A;  5HWV A;  2HDU A;  4O7D A;  3S7P A;  1ZHH B;  2D02 A;  3IHA A;  3Q7Z A;  3UNW A;  4R4R A;  2ZM2 A;  2X02 A;  2LB5 A;  1SKO A;  1L0D A;  4ZAM A;  4DMZ A;  4YFM A;  1W7F A;  1IEL A;  3IBR A;  3MZF A;  2PDR A;  1OT9 A;  3BM6 A;  4DXC A;  3Q7V B;  5CED A;  3LYX A;  2VGL S;  4MEZ A;  3CUE C;  3NUL A;  4YNR A;  4DXB A;  3LIE A;  1GCE A;  3S7N A;  4RVA A;  1OJ5 A;  2FH5 A;  2IWD A;  4GCZ A;  3H82 A;  1S67 L;  1K6R A;  4DRT A;  3UPO A;  4S2M A;  2HJ9 C;  3NIA A;  2W3G A;  1HVB A;  3HLD A;  4OOY A;  1OTB A;  3NDE A;  1KGE A;  5JYP A;  1CF0 A;  3K3D A;  4DJ2 A;  3OC2 A;  3OCN A;  3QP4 A;  2H5S A;  1GHM A;  3C4P A;  3IWQ A;  5DFY A;  3HLB A;  1K57 A;  2R9X A;  1Z6F A;  5F83 A;  5E2E A;  3MMH A;  4I5S A;  3HLW A;  5HDS A;  2J9P A;  4Y13 A;  2JCH A;  2JHE A;  1MXO A;  3Q07 A;  4PM7 A;  4Y0T A;  2J7V A;  2EX2 A;  3ICY A;  5FEG A;  3VE4 A;  3R7W B;  3UB6 A;  1K4F A;  4Y17 A;  3P7N A;  4M3K A;  3UB9 A;  2A3U A;  4HP4 A;  4DN0 A;  1ESI A;  3EEA A;  2ZC4 B;  1ZG6 A;  1PI5 A;  1PYY A;  1Z09 A;  3LR4 A;  3IXD A;  4OH0 A;  5FAO A;  3BFG A;  4WLA A;  5HD3 A;  4S2O A;  1BLP A;  1KOU A;  4X1M A; 
#chains in the Genus database with same CATH homology
 3IXH A;  5DVA A;  4DE3 A;  3M6B A;  3JYI A;  3V3R A;  3LCE A;  5DTK A;  4KZ4 A;  1ERO A;  2XEP A;  4N1H A;  2UWX A;  2V20 A;  2XR0 A;  3UPP A;  3GVB A;  2IWC A;  1TEM A;  4JXW A;  2QMI A;  2XF3 A;  3GV9 A;  1H5X A;  2WGV A;  4JXV A;  4MLL A;  1KDW A;  5CER A;  2HDS A;  5GHX A;  3A3I A;  4F94 A;  5I94 A;  5HL1 A;  3VP2 A;  1NZO A;  3A3D A;  1YMS A;  3NDG A;  5AQA A;  4JF6 A;  4D2O A;  1FSW A;  4LV1 A;  1LI0 A;  4MBK A;  3ZNY A;  4BD1 A;  2EXB A;  4JF4 A;  2WAF A;  2WGW A;  1RP5 A;  1Y54 A;  3OPP A;  1NYM A;  2WGW B;  3M6H A;  4WEK A;  2WK0 A;  3N7W A;  1ES5 A;  3Q82 A;  5EUA A;  1K6S A;  4BJP A;  1N9B A;  1G68 A;  3BFC A;  3OZH A;  2ZM0 A;  3SS4 A;  2Q9M A;  5FI6 A;  5E2G A;  3HLC A;  1PI4 A;  5CGS A;  3V3S A;  5CEB A;  3FWL A;  2Y2K A;  3UDF A;  4S2I A;  2HDQ A;  2XGN A;  2RL3 A;  3IHB A;  1MBL A;  2EX8 A;  3HVF A;  5EOO A;  4E3O A;  4GB7 A;  1O7E A;  1GHI A;  3BLS A;  2Y2J A;  4ZTK A;  3NY4 A;  2BLS A;  1E3U D;  5DTS A;  3HLE A;  1JTD A;  3OCL A;  5HAI A;  2DNS A;  4QY5 A;  1K54 A;  1HD8 A;  4S2J A;  1IYQ A;  1L0G A;  2EX9 A;  1E25 A;  2B5R A;  5AQ9 A;  1YLW A;  3AGD A;  2GDN A;  4B4X A;  2Y2M A;  3G34 A;  5GLC A;  3ZG5 A;  1U60 A;  1E4D A;  3W4P A;  1BLS A;  1MPL A;  1YLJ A;  3EQV A;  3N8S A;  3AGE A;  1NRF A;  1FCO A;  4R3J A;  1DJA A;  1HZO A;  3FKV A;  5DF9 A;  1K54 C;  3MBZ A;  5KZH A;  3C4O A;  3HRE A;  3IXB A;  3UN7 A;  3VP3 A;  4BEN A;  2PBY A;  4MNR A;  4RA7 A;  3V50 A;  4WBG A;  3ZVW A;  4KG6 A;  1CI8 A;  4ZJ2 A;  1HTZ A;  4FD8 A;  3TOI A;  2ZQ7 A;  5A92 A;  4HBT A;  4OOM A;  1VM1 A;  4HES A;  4P6B A;  3G35 A;  3GRJ A;  4GD8 A;  1E3U A;  4OPQ A;  4PMA A;  1BSG A;  3A3J A;  2X01 A;  2FFF B;  2J9O A;  3MZE A;  1L0E A;  4IED A;  4R4S A;  3WS2 A;  2EFU A;  3MXR A;  4DF6 A;  5BOH A;  2JE5 A;  5FDH A;  1GHP A;  1MWS A;  3VOZ A;  4KZB A;  4PPR A;  5EVI B;  4EUZ A;  1BZA A;  3PBO A;  4BL2 A;  3P09 A;  4X68 A;  3WS0 A;  3FYZ A;  2ZQC A;  3FZC A;  3WS1 A;  2I72 A;  4OLD A;  4LV0 A;  5E2H A;  4E3J A;  3OPH A;  3WS5 A;  1QME A;  3TG9 A;  4IVK A;  1I2S A;  5A90 A;  1WYC A;  3IWI A;  4R23 A;  3HUN A;  1RCJ A;  4OQH A;  3GTC A;  5CHM A;  2JC7 A;  1FCN A;  3QNB A;  2G2U A;  4OPY A;  4EQI A;  5E43 A;  3A3F A;  1LL5 A;  3O88 A;  1FQG A;  1YQS A;  4KQQ A;  1J9M A;  2BG1 A;  3IF6 A;  4S2K A;  4S2P A;  1N4O A;  4U3T A;  3WRT A;  1DY6 A;  3IF6 B;  3BFE A;  1PW1 A;  4KZA A;  3VP0 A;  3VMA A;  4S2L A;  4C75 A;  1ERQ A;  4WZ5 A;  4PM6 A;  4FCF A;  4GN2 A;  2WKH A;  3IF6 C;  3LY3 A;  3V39 A;  4LCM A;  4EBL A;  2P74 A;  1C3B A;  1FR6 A;  3LEZ A;  5EVL A;  4DDS A;  3BFF A;  4UAA A;  5CRF A;  4K0X A;  4E3K A;  3HLF A;  5HX9 A;  3ZG0 A;  1MKI A;  3SS5 A;  1KVL A;  2RCX A;  3SS3 A;  4JPM A;  4X69 A;  1K38 A;  3HL9 A;  1GA0 A;  5HAQ A;  5DTT A;  2Y2N A;  1NJ4 A;  2ZD8 A;  3PBR A;  4JXG A;  4B4Z A;  3PBT A;  4A5R A;  4E6W A;  2WYX A;  2ZQA A;  4K91 A;  4MBF A;  3MKE A;  2VGJ A;  5FQQ A;  4UA9 A;  1MWR A;  1WE4 A;  1KVM A;  1PWG A;  1XPB A;  5KMW A;  3RXW A;  2HP5 A;  3Q1F A;  4IBX A;  1K25 A;  3DWZ A;  1ALQ A;  1DJC A;  1IKI A;  3HUM A;  3NC8 A;  4X6T A;  2XFT A;  4MBH A;  2Z2L B;  3A3E A;  3W4Q A;  5G18 A;  2Y55 A;  3VSK A;  4P87 A;  4IVI A;  3W4O A;  2V1Z A;  2EFX A;  4QU3 A;  1YLY A;  3ZG9 B;  3C7U A;  5HAR A;  2G2W A;  4OPZ A;  3QNC A;  5TR7 A;  3M2J A;  3ZGA B;  1JTG A;  2Y2O A;  4OP5 A;  1KGF A;  4GKU A;  4OQG A;  4LEN A;  1Q2P A;  2DCF A;  1IEM A;  4XUX A;  4PM9 A;  4GD6 A;  1YLP A;  2Y2G A;  4PM5 A;  5E2F A;  3IF5 A;  3IH8 A;  3W8K A;  4GDN A;  4X55 A;  4ZDX A;  3N8L A;  2EX6 A;  5EOE A;  1L0F A;  3DWK A;  2WZZ A;  3OPL A;  4KZ9 A;  5AQB A;  3CJM A;  4ZJ1 A;  4ZJ3 A;  5JYO A;  2H0T A;  1IKG A;  2ZQ8 A;  4C3Q A;  5FQK A;  5L2F A;  2XQZ A;  1WYB A;  3TSG A;  5FA7 A;  4NET A;  3I7J A;  5DF8 A;  2DRW A;  3SOI A;  1BT5 A;  1YT4 A;  5EVI D;  2V2F F;  3IT9 A;  5CGX A;  4KEN B;  4QHC A;  1BLC A;  1W8Q A;  3HLG A;  2XD5 A;  5EPH A;  3HBR A;  4OPR A;  2Y2H A;  4U0X A;  1ZG4 A;  4EWF A;  4B88 A;  5A91 A;  3IXG A;  5HW3 A;  4DE2 A;  1K55 A;  5F1F A;  1W5D A;  1VQQ A;  5EEC A;  2WZX A;  1K4E A;  1YMX A;  1PIO A;  2WAE A;  1YLT A;  2QZ6 A;  2ZQ9 A;  1ESU A;  3RXX A;  4DDY A;  4Y0O A;  5CHU A;  4JLF A;  3G32 A;  2OLV A;  1KE0 A;  3O3V A;  1ONH A;  3WS4 A;  4OP8 A;  3MKF A;  1DJB A;  1K55 C;  3DW0 A;  4KQR A;  4XXR A;  1BUL A;  1GA9 A;  1TDG A;  4R3B A;  5EVI A;  2ZC3 B;  2Y91 A;  5CXW A;  4KG2 A;  4OLG A;  2QPN A;  2ZJ9 A;  5CTN A;  3DTM A;  1M6K A;  2A49 A;  3MFD A;  5CEC A;  1SDN A;  3G4P A;  3PAE A;  5TFQ A;  5U47 A;  5EVI C;  1BTL A;  2ZC6 B;  4E3I A;  3QHY A;  4N92 A;  4S2N A;  1CEG A;  1JWZ A;  2Y2Q A;  3G2Z A;  5FQM A;  1ES3 A;  1I5Q A;  3VSL A;  5FAS A;  5CGW A;  4HBU A;  1FSY A;  1L2S A;  3Q81 A;  4KZ6 A;  4LV3 A;  5DF7 A;  5GHY A;  2ZC5 B;  3HUO A;  4KG5 A;  2WAD A;  4QY6 A;  4QD4 A;  2PU2 A;  3PTE A;  4UA6 A;  2R9W A;  3N6I A;  1SCW A;  1CK3 A;  1SHV A;  4RX2 A;  4WEL A;  2XD1 A;  3UPN A;  4P0M A;  4BLM A;  1NY0 A;  1ZKJ A;  3GQZ A;  4BL3 A;  3NBL A;  3CMZ A;  4WEJ A;  4NK3 A;  4IBR A;  4WZ5 C;  3LO7 A;  4FSF A;  4KZ5 A;  2WUQ A;  3SH7 A;  5FQI A;  1XGI A;  4P85 A;  2X71 A;  4OQI A;  5GLA A;  3IWO A;  1G6A A;  4BD0 A;  5M18 A;  5FAT A;  5FQJ A;  1PWC A;  2XH9 A;  4ID4 A;  1M40 A;  3EQU A;  3BRM A;  2PU4 A;  3G2Y A;  4WMC D;  1LI9 A;  1LLB A;  2VGK A;  2OLU A;  2ZMA A;  4QJG A;  4OQ0 A;  1PW8 A;  1KE4 A;  3AGF A;  3S22 A;  3GMW A;  2ZLY A;  1RGZ A;  2XK1 A;  5GL9 A;  2Y2L A;  4Q8I A;  1W8Y A;  3ZVT A;  1BUE A;  2C5W B;  3ZHH A;  3ZG8 B;  1I2W A;  4WM9 A;  1LL9 A;  4JXS A;  3NCK A;  3BYD A;  5D3O A;  1CI9 A;  4R1G A;  3SH8 A;  2Y4A A;  2WGI A;  2XLN A;  3V5M A;  5J8X A;  1ONG A;  1RGY A;  1TDL A;  4UA7 A;  3UE3 A;  4OOL A;  3PAG A;  3UO9 A;  5FQ9 A;  4DKI A;  1MY8 A;  3BEC A;  4K0W A;  1CEF A;  2XDM A;  1PZP A;  3PBQ A;  1EWZ A;  3BEB A;  1TVF A;  2H0Y A;  5FI2 A;  3IH9 A;  4WMC A;  4U0T A;  1IYO A;  1ES2 A;  1YM1 A;  4YIN A;  1YLZ A;  4E3N A;  3FKW A;  4GDB A;  3E2L A;  1AXB A;  4JKT A;  4KQO A;  1KDS A;  3G30 A;  5FAQ A;  4ZBE A;  2HDU A;  4DE0 A;  2WKI A;  2Y2P A;  4O7D A;  5GHZ A;  3UE0 A;  1XXM A;  5CTM A;  5IHV A;  2Y59 A;  3LY4 A;  3IHA A;  2HDR A;  3Q7Z A;  2ZQD A;  3ITB A;  3UNW A;  4R4R A;  4EBP A;  5HAP A;  2ZM2 A;  2X02 A;  4N9K A;  2J8Y A;  3SH9 A;  4EV4 A;  5F1G A;  1JVJ A;  4X56 A;  5GLD A;  1L0D A;  5AQ7 A;  2Z2M B;  1BLH A;  3NI9 A;  3ZFZ A;  4ZAM A;  4GOG A;  2IWB A;  4YFM A;  5CHJ A;  5M1A A;  1W7F A;  1IEL A;  3MZF A;  1Q2Q A;  1XP4 A;  4XUZ A;  3MXS A;  4FH4 A;  1ZC2 A;  1EI5 A;  2HP6 A;  3BM6 A;  4WZ4 A;  4X53 A;  2OV5 A;  3Q7V A;  4DXC A;  2WKE A;  2EXA A;  3G31 A;  3Q7V B;  4Z9Q A;  4GZB A;  5CED A;  3ZNT A;  4MEZ A;  5EE8 A;  1W79 A;  1XA1 A;  5HFO A;  1ES4 A;  3D4F A;  4DXB A;  4DE1 A;  1XKZ A;  5TGF A;  4L0L A;  1XA7 A;  1KE3 A;  1GCE A;  1S0W A;  3VFF A;  4QB8 A;  4E6X A;  4RVA A;  3CG5 A;  4Y7P A;  3VP1 A;  3MZD A;  1S6R A;  5A93 A;  1FR1 A;  2IWD A;  2OSU A;  3BFD A;  1XGJ A;  4GNU A;  1IYS A;  1MWT A;  1FOF A;  5KSC A;  1K6R A;  4BQM A;  1K56 D;  1PWD A;  1OME A;  3O86 A;  4DRT A;  3UPO A;  3ZDJ A;  4S2M A;  3WWX A;  2P9V A;  2ZM8 A;  2E8I A;  3NIA A;  4LV2 A;  2P9V B;  4N9L A;  1HVB A;  3N4I A;  3HLD A;  5GLB A;  4OOY A;  1KGG A;  3C7V A;  3NDE A;  1KGE A;  1FCM A;  1H8Z A;  4KZ7 A;  4E3L A;  5JYP A;  2C6W B;  3PBS A;  4OKP A;  3OC2 A;  5KSH A;  3OCN A;  5F82 A;  2H5S A;  1GHM A;  3C4P A;  3IWQ A;  3VOY A;  3GSG A;  3HLB A;  4R0Q A;  4KZ3 A;  1K57 A;  4WYY A;  2R9X A;  4Y0U A;  3UDX A;  4EBN A;  2Q9N A;  4S2N C;  1NZU A;  1Z6F A;  1XX2 A;  3IQA A;  5F83 A;  5FAP A;  3VFH A;  5E2E A;  1MWU A;  1JWV A;  1PZO A;  1SKF A;  3CZD A;  3HLW A;  2J9P A;  3N8R A;  1K56 A;  3ITA A;  1K57 C;  5M19 A;  2H10 A;  3ISG A;  2JCH A;  4CPK A;  1MXO A;  3Q07 A;  2HPB A;  2CC1 A;  4PM7 A;  4Y0T A;  2FFY A;  3OPR A;  3RJU A;  2J7V A;  2EX2 A;  1O07 A;  5FI7 A;  3WRZ A;  4JF5 A;  3ZCZ A;  3S1Y A;  3GR2 A;  4OVD A;  3UE1 A;  1QMF A;  3UY6 A;  4RYE A;  4N1X A;  1K4F A;  4OON A;  4LCL A;  4C6Y A;  1SDE A;  1NYY A;  2JBF A;  3C5A A;  3S4X A;  4M3K A;  2A3U A;  5FSR A;  1ERM A;  1ESI A;  2Y2I A;  3ZG7 B;  4PM8 A;  3B3X A;  4FH2 A;  4JBF A;  4CJN A;  1IYP A;  3M2K A;  1JWP A;  2XFS A;  3PBN A;  4HEF A;  3UDI A;  1H8Y A;  2ZC4 B;  1ZG6 A;  1PI5 A;  1PYY A;  3P98 A;  3O87 A;  4H8R A;  2ZC7 A;  3FV7 A;  1LHY A;  4UHU A;  4E3M A;  3VP4 A;  3IXD A;  4KZ8 A;  3E2K A;  1NXY A;  4OH0 A;  4RX3 A;  5FAO A;  3BFG A;  3BLM A;  2HP9 A;  4S2O A;  1BLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...