1S66L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
b'NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yddU
molecule tags Oxygen storage/transport
source organism Escherichia coli
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
total genus 24
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s66L00
2QJ5A 3UB7A 1T18A 3ICYA 4GHIA 4GHIB 1S4RA 4NXBA 4F3LB 1TS0A 1XJ2A 1S66L 5F5YA 1MZUA 5F6AA 4EEUA 3CLOA 4GCZA 4XT2A 4HI4A 1V9ZA 4GS9A 5DKLA 3UMDA 3LI8A 1ODVA 3KX0X 2WKPA 3A0SA 1OT6A 3UB9A 1T1AA 4KQDA 2JN7A 1LSXA 2PR6A 3F1NA 3GECA 1GSVA 5AVFA 1OT9A 2CMNA 2QJ7A 2PR5A 3CWFA 3F1NB 2WKQA 3LICA 1BYWA 2HV1A 2M1CA 3PYPA 2L4RA 4H6JA 4H6JB 4LLOB 2PD7A 2ZOHA 3RTYA 2B02A 5I5LA 2H28A 3PHYA 5AVEA 1EW0A 1S1YA 5J4EA 2KDKA 4LPZA 3D72A 1OJ5A 4I3JA 4HY8A 3F1PB 5HDSA 3F1OB 3C2WA 1VB6A 4EXOA 1X0OA 3LIDA 4XT2B 5A8BA 1N9LA 4HNBA 2W0NA 4KUOA 4L9EA 2JHEA 2QWSA 4L9GA 2OWHA 1T19A 2YKFA 5J7EA 1TS8A 2VV8A 3MJQA 4YWZA 4E04A 1N9OA 1UWNX 3EWKA 2D02A 2PHYA 2L1MA 2V1AA 2V1BA 3IBRA 4NXFA 4WL9A 3E4PA 1LSWA 2V0WA 4HJ3A 1T1BA 3H7WA 5DJUA 1F98A 2PYPA 1OJGA 4HHDA 1TS7A 1XFQA 3LIAA 4HH2A 4WF0A 5HDDA 4L9FA 2L0WA 4JGOA 3ULFA 1D7EA 2GJ3A 2PYRA 3HJIA 5HD3A 1F9IA 5TBMA 3LIBA 2D01A 5TBMB 3VE3A 3MQOA 3VOLA 2W27A 4M4XA 3MQQA 1OTDA 3LUQA 1OTAA 4WN5A 2KX6A 4K08A 3BWLA 5J3WA 4B9OA 4BBUA 4WLAA 4I3IA 3B33A 3MXQA 4R3AA 5F69A 3K3CA 3P7NA 5HWTA 1S67L 4MN5A 3A0VA 3K3DA 4I3AA 1NWZA 3UB6A 1XJ6A 4NXEA 4R70A 4EERA 4I38A 3NOTC 3E4QA 1LL8A 2K7SA 1JNUA 1T1CA 1Y28A 2A24B 2VV6A 2R78A 3GDIA 2A24A 5G4ZA 3G6OA 3VE4A 2Z6CA 4KUKA 4JGRA 3ZQ5A 4R38A 5DKKA 1P97A 4LRYC 1XJ4A 4GW9A 4HP9A 3F1OA 4I39A 2VV7A 5EFWA 3IS2A 1XFNA 1KOUA 3H82B 3SW1A 1DP6A 3C8CA 3RH8B 2Z6DA 3EEHA 4R6LA 5HD5A 4HIAA 3FG8A 2V0UA 5HWVA 1DRMA 4EQ1A 3BY9A 3E4OA 4JGQA 4HP4A 3H9WA 5F68A 2OWJA 5G4YA 2EA9A 3LYXA 4MN6A 3MFXA 1D06A 4DJ2A 1WA9A 5IS1A 3FC7A 3LIEA 4HJ4A 2I9VA 2VLGA 4RQ9A 1S1ZA 3NOPC 4F3LA 2ZBBA 1LT0A 2OOLA 4NXGA 3OLOA 1TS6A 5DJTA 5HSQA 4JGPA 1LSVA 1P0ZA 3NOUC 4HQAA 5HZHA 1DP9A 4LRXC 4EW7A 1OTBA 4HJ6A 2YKHA 3A0RA 3MR0A 2J80A 2V9AA 4EESA 2PD8A 4I5SA 1XJ3A 4HOIA 3F1PA 5HDCA 3UB8A 3HJKA 3LIFA 1DP8A 1GSXA 4PKYA 4BBVA 4BBTA 2QHKA 1GSWA 4WUJA 2INWA 2P7JA 4DJ3A 1OTEA 1UWPX 3H82A 1G28A 2ZOIA 3LI9A 3NJAA 4LRZE 3CAXA 5IU1A 3T50A 4PKYG 4EETB 2PDRA 2QKPA 1N9NA 2VEAA 2WKRA 1S4SA 3BY8A 3NHQA 1OTIA 4GS9B 4HH3A 4EEPA 3H7WB 3IS2B 1V9YA 3UE6A 3UMEA 5HWWA 2BASA 5KIZA 1UGUA
chains in the Genus database with same CATH superfamily
2QJ5A 3GMWA 4RX3A 2Y2GA 1EWZA 4NXBA 3VMAA 5EV0A 4XUXA 1TDGA 3VSLA 3CLOA 2VGLS 3SH9A 4EUVA 3V50A 5E2GA 1J9MA 1KVMA 4H6JA 3VSKA 2PD7A 1PI4A 5AVEA 2XD5A 3G30A 4KZ9A 2J3WA 2JBFA 4HNBA 1K55C 1T19A 2W1TA 4LV1A 4JLFA 1I2WA 3DW0A 1P9RA 3FWLA 3PAEA 1NYMA 3LEQA 1XFQA 5IHVA 3BLMA 5DTKA 3B42A 3M2JA 4PAUA 4E3NA 4P85A 4R3AA 5E43A 1CI9A 3KYEA 4MN5A 2HDRA 4Y5FA 4MN7A 4S2MA 4LV3A 3NOTC 1CK3A 4IVKA 2A24B 2HP5A 3FV7A 2WGWB 3KSHA 4ZJ1A 2H5SA 2ZC5B 4GD8A 5FQ9A 3VP1A 4JGQA 2J9OA 4MBFA 1BLPA 5G4YA 2B95A 4CLCD 5FASA 4DXCA 4EBPA 4NXGA 5HL1A 1K4FA 3QNBA 2WZZA 4N1HA 3JVUA 1KE3A 3MR0A 2J80A 4HOIA 1DP8A 1XKZA 2W3DA 3P01A 1GA0A 2P7JA 1ES3A 1SKFA 2AVXA 2O9AA 1GCEA 4LCLA 5FATA 1V9YA 3ICYA 4OLGA 1ZG4A 1PZOA 1NXYA 2VX8A 3IBJA 3DTEA 3NULA 2Y2IA 1E25A 4N9LA 3A3DA 1NJ4A 3GTCA 5AVFA 1PRQA 2WKQA 4P6ZM 1ZC2A 3ZFZA 1EW0A 2KDKA 4OH0A 1IYOA 2FZ0A 5CXWA 1IYPA 1JTDA 1NRJA 2C6WB 2XF3A 1I2SA 3MXRA 2V1BA 3T4KA 4ETZA 3L7HA 4HJ3A 1T1BA 1TDLA 4GOGA 1K57A 3LIAA 1FQGA 2PYRA 4BD1A 1FCMA 2W3FA 4EBNA 3BWLA 4Q8IA 4RX2A 2QYBA 4FCFA 3P7NA 1XA1A 2Y2JA 3EEAA 3A3JA 5E2HA 3SOIA 4N9KA 3E4QA 5HPIA 3OPLA 3T1QB 4S2JA 3DWZA 1ZKJA 3BM6A 1K6RA 5FQKA 1P9WA 2XEPA 3V67A 5I94A 2OAQ1 3D4FA 5EECA 2ZLYA 3M6HA 1SZVA 2ZBBA 1MKIA 1LSVA 1EI5A 3VP0A 3E98A 5HAQA 3V39A 5A93A 1QMEA 3HLFA 3H82A 1MWTA 1Q2PA 3Q7VB 4PKYG 4P6BA 2QKPA 1W79A 4L0LA 1YLTA 3IS2B 4CLCC 3N6IA 1YLYA 2EWVA 1FCNA 4F3LB 4KZAA 3VP2A 3IF6C 1V9ZA 1TF1A 4GS9A 2WKIA 4IEDA 2K31A 4CPKA 1JWPA 4YINA 3MMHA 1DJAA 5FQIA 5J4EA 5MC7A 4G3KA 3DTKA 4E3LA 5KMWA 3S22A 5FSRA 3UPOA 5M1AA 2P9VA 3EQUA 5AQAA 3P98A 2V1AA 5AQBA 2XRNA 3KYZA 4WL9A 5HDDA 4L9FA 1AXBA 2DRWA 4JF4A 3W2ZA 1M6KA 5HPFA 5AQ9A 2XA7S 3WRZA 3IH8A 3MF0A 1LL8A 1CQAA 2R78A 2A24A 3IXHA 1L2SA 5FI2A 3CG5A 1BTLA 1K38A 4DDYA 2OV5A 1YLJA 2R9WA 5HW3A 2GDNA 1WA9A 3DTMA 3S7OA 4S2IA 3NCKA 4JXWA 4KENB 4GKUA 1KGFA 1BLHA 4LRXC 1OTBA 4EETB 4BQMA 3LIFA 2VGLM 1H8MA 4PM6A 2O9BA 1OTEA 2ZQAA 3EOIA 4LRZE 3CAXA 1S4SA 1CJFA 5DF9A 5A92A 4EWFA 2EX9A 2Q9MA 4GHIB 4DKIA 3Q1FA 2Y8HA 1MZUA 3ITBA 3UMDA 1XGJA 2X71A 5DKLA 2Y2MA 3ZNYA 3T1XA 4M3KA 3QNCA 4N92A 1YSPA 3OLOA 3F1NB 3WS1A 1BYWA 3QHYA 2Y2PA 1LI0A 3JYIA 2XH9A 3BFGA 2HF6A 4S2OA 1BLCA 3G4PA 4ME4A 3OZHA 4OPQA 3GV9A 5JYPA 3QP8A 1LHYA 1OTDA 4LCMA 3K3CA 4PM5A 3Q7ZA 1NWZA 4R70A 1GHMA 4X55A 3NDEA 1PI5A 4WEJA 2LB9A 4HP9A 2DNSA 2NUTC 2J3TD 5DF8A 3BFCA 3CJMA 2V1ZA 4FTXA 3DTIA 4R4RA 3EEHA 1DRMA 5CEDA 3HUNA 4E6WA 2ZC4B 5LBRA 1IYSA 3HLBA 4EBLA 3CITA 4DJ2A 5F1FA 5IT5A 1RCJA 3UPPA 3PR6A 4MLLA 3V3RA 1PIOA 1H8YA 2J8YA 4JGPA 4EW7A 2VGJA 5M19A 3IXDA 5HX9A 3HBRA 5IU1A 2VEAA 5E2FA 2IWCA 1XA7A 3H7WB 4KZBA 3PBQA 3TRCA 3UB7A 1QMFA 2PT7A 4FUWA 5FI6A 2XROA 4DE1A 1CI8A 1BSGA 1YAXA 4S2NC 4EEUA 1KVLA 5EOOA 3PTEA 3KX0X 4DN0A 3UB9A 4WZ5C 3HLWA 1GSVA 2Q9NA 1OT9A 2QJ7A 1HZOA 2M1CA 1YQSA 4GLQA 4MBHA 2ZL1B 4NKPA 4GN2A 4NETA 1LL5A 1VHMA 4L9EA 1Y4OA 1OMEA 2EXBA 5HARA 5FAPA 4IBXA 2GJ3A 1K4EA 1F9IA 1MXOA 3BECA 3U4LP 1KE0A 3VOLA 2W27A 4PM7A 4XUZA 3LUQA 4ID4A 4BENA 3B33A 3NY4A 4BJPA 2HJEA 3LR3A 4ZJ3A 2WAFA 4I3AA 3T1SA 4NXEA 4K0XA 2XSSA 2Z6CA 3VFFA 1O7EA 1P97A 4WMCA 4MDZA 2ZQ8A 3FPVA 3NBLA 3SW1A 2GX5A 3T4TA 1XXMA 1N9BA 2H0YA 4MBKA 2QPNA 3ZG8B 2HDSA 3N8LA 1DJCA 2WUQA 2XK1A 1D06A 2DMWA 3OPHA 1ERQA 4RQ9A 3HLCA 4R1GA 3N7WA 3BRMA 2A2LA 4OOLA 5HSQA 3NOUC 3UNWA 2EFXA 2V9AA 1XJ3A 1LL9A 5FQJA 3NJAA 4PM8A 2WKEA 1E3UD 3N8SA 2FFYA 2FH5A 5FA7A 3HREA 1UGUA 2JKGA 4O01A 2QMIA 4GD6A 5HL6A 3NC8A 4OPYA 1WE4A 4GCZA 4HI4A 2G2UA 4Q0JA 4WBGA 3S7QA 3DWKA 5E2EA 1G68A 3KSGA 2CMNA 3EQVA 2L4RA 3WS5A 2ZOHA 3G34A 4LV2A 3FKWA 1Z6FA 3JPUA 2WGWA 5TFQA 4E3IA 2Y2QA 3QP1A 3CMZA 4Y7PA 5EVLA 3PBOA 2JKFA 5GHXA 1ONGA 1W63Q 3E2KA 3HLDA 3T4QA 4OLDA 2PYPA 2Y4AA 4ZBEA 4KZ5A 3HJIA 4X1MA 5GLAA 1N4OA 3SH8A 5FAOA 5M18A 4OONA 1K54A 3LY3A 4DDSA 3GSGA 2XLNA 5EOEA 4X25A 5DF7A 4KUKA 4ESPA 1H8ZA 4UA7A 1XFNA 3H82B 3PAGA 3C8CA 3A3FA 5HD5A 3ZDJA 4WZ5A 3BQAA 5F68A 4Z9QA 1CEFA 1C3BA 3UPNA 1LI9A 1YLPA 1MC0A 2ZM8A 4Y17A 5HAIA 1S1ZA 3MSHA 3C4PA 4F3LA 5CEBA 1TD5A 2CC1A 4D2OA 1P0ZA 2YKHA 4EV4A 1L0EA 4JF5A 3UB8A 4MMNA 4X56A 3T50A 1PYYA 2ZQ7A 4EEPA 4C6YA 3LY4A 2JE5A 1CEGA 1VM1A 3UN7A 3VP4A 2UWXA 4XXRA 1IOUA 3OC2A 3WS4A 2G2WA 1OT6A 4R4SA 2JN7A 3MS6A 5CGXA 1H5XA 1FOFA 3CWFA 2PU4A 4LLOB 4H6JB 4JBFA 2P04A 4HY8A 4IVIA 1IKGA 2I72A 4B4XA 4E3MA 5J7EA 1ZHHB 4ARZA 4WEKA 4NXFA 5FDSA 1ZG6A 4RYEA 3UB5P 1I5QA 4NK3A 2RL3A 4WLAA 3BQ8A 1IELA 2HP9A 3UB6A 3PBTA 1NY0A 3TW8A 1M40A 3VOZA 4X68A 3RH8B 1XP4A 3NIAA 3E4OA 1SHVA 3LYXA 3NOPC 1E4DA 1PZPA 3OCNA 3SZTA 1Q2QA 2GZAA 3HL9A 4OP5A 3AGEA 4RVAA 4GZBA 3UE6A 2Y79A 3P09A 5GLDA 1GA9A 3ZVTA 5F82A 1K56A 3B3XA 3B47A 3DAVA 1NLYA 3IX8A 1W5DA 4EU0A 5CECA 3IF6B 1Z09A 4BLMA 1PFLA 4WYYA 5HDSA 4EXOA 1X0OA 2C5WB 1PW1A 4JF6A 3CPTB 1FSWA 2QWSA 3JVVA 4K91A 1JWZA 1YM1A 1ZTUA 3G2ZA 2KLIA 1O07A 4PHTA 5TBMA 5FQMA 4E3JA 3MQOA 1DY6A 5FEFA 4RA7A 2PU2A 3DBAA 1KE4A 1HD8A 3QP6A 3A0VA 3SS4A 3IXBA 4P0MA 1MWRA 4N1XA 2WGIA 2ZMVA 3CPTA 4LFUA 2M7VA 3ZG9B 5A91A 2VV6A 1T1CA 4BWIA 3QP2A 3HCYA 4LV0A 5EVIB 4Y15A 4O8GA 2XFSA 1Y54A 5EM0A 3PXPA 3U2AA 1FSYA 4EQ1A 4QWOA 1MWUA 3OPPA 3FC7A 3LIEA 2Y2NA 2I9VA 1TEMA 4P6ZS 4FSFA 4HQAA 4KZ7A 3A0RA 2WADA 1ES4A 3QP4A 1K55A 2ZOIA 3IT9A 1N9NA 1PWCA 2V8CA 2K2NA 1KGGA 5F1GA 1SDEA 5L09A 1S4RA 3Q07A 1GHIA 3WRTA 1MY8A 4KZ3A 3MKEA 3LICA 2IWBA 4OQGA 4EQIA 3E0YA 3VP3A 1K57C 4LPZA 2BTFP 1OJ5A 3C2WA 3IXGA 4E04A 3UE1A 2L1MA 3WWXA 4KQOA 3IBRA 5CGSA 4S2KA 1F98A 3FYZA 1JTGA 1XX2A 1ES2A 2J3TC 3LR0A 3RFBA 4M4XA 3IH9A 1FCOA 3D3OA 3W8KA 3IHBA 4OQHA 4ARZB 3T1RA 2B5RA 4Y0UA 1W8YA 3HUMA 2K7SA 1JNUA 4X1LA 2HPBA 4ETXA 5GLBA 1XJ4A 4GW9A 4I39A 3AGFA 3MZEA 3KYQA 2Z2LB 3N4IA 4R6LA 5HAPA 3FG8A 5KSCA 5HWVA 2ZQ9A 3H9WA 4KG2A 4O0PA 4Q0HA 2WYXA 4F94A 4JPMA 5BOHA 5K5BA 1MPLA 2LB5A 4WMCD 3TG9A 2HDUA 2DCFA 1MWSA 4KQRA 1MKMA 2PD8A 1BULA 5HDCA 4NEED 4PKYA 4NG2A 5EUAA 1GSWA 4DJ3A 1FILA 4DF6A 1D1JA 3FKVA 1RGZA 2PDRA 4HH3A 5DFYA 5CGWA 1ACFA 1ONHA 3CUEC 4G3WA 1S66L 3AGDA 4YNRA 3IWOA 1T1AA 1XGIA 4QB8A 1S0WA 3OOVA 3CHWP 5FI7A 2BLSA 4CLCB 3SH7A 5GHZA 4K0WA 4C75A 3O88A 1PW8A 3F1OB 3W4QA 4MNRA 3UE0A 4UQIS 2H0TA 3MJQA 4YWZA 4BMWA 1IKIA 1BLSA 1K25A 1LSWA 2ZL1A 4IUKA 2OLVA 1K0KA 4OKPA 1D7EA 5A90A 3ZYTA 5TBMB 2D01A 1H0MA 4WN5A 3G35A 5HWTA 3IWIA 1L0DA 3IQAA 2X02A 1Y28A 3RJUA 2EWWA 4KZ6A 1W63M 3TJZC 3IX4A 4BL2A 4UA9A 4UAAA 2O0YA 3T4JA 1H3QA 4JXGA 4DRTA 3TSGA 4E3KA 2HDQA 4MN6A 3W4OA 1HLUP 2Y2KA 3UY6A 2OOLA 3EGXC 1L0FA 1SKOB 1KDWA 5FQQA 5KSHA 1OPXA 4LENA 1GSXA 4FH4A 4WUJA 1NZOA 4E3OA 2Y91A 3UMEA 1KDSA 2V2FF 3TOIA 3O5YA 3MZFA 3MZDA 1XJ2A 2R9XA 5F6AA 5TR7A 1ESUA 4FH2A 3LI8A 3RXWA 2HJ9C 1L3LA 4KQDA 4QHCA 2ACGA 1LSXA 2H10A 2P08A 1G6OA 3GRJA 3PYPA 1NZUA 1YSQA 5L10A 1BT5A 2P74A 2IWDA 3C30A 2X01A 4GNUA 2XGNA 5AJGA 2V8FA 4CLCE 3E4PA 3H7WA 4QPRA 1OJGA 3NDGA 1SCWA 3M2KA 4DE0A 2L0WA 3A3IA 2MJ6A 5J3WA 2EXAA 1YLZA 2RCXA 3K2NA 3LGOA 4WM9A 5CTNA 1J3WA 3WS0A 2O9CA 3Q81A 2VV7A 3IS2A 2PBYA 4DE3A 4YFMA 1PNEA 5EVIA 4B88A 2WGVA 2VZWA 3A3EA 4P87A 3RXXA 1K6SA 1LLBA 5D3OA 1S6RA 5DJTA 1DP9A 5GLCA 4OP8A 1EROA 4H8RA 3BLSA 1HTZA 4EESA 3HJKA 3BJNA 5CHUA 2EX8A 4BBVA 3M6BA 4ZAMA 4HESA 1JWVA 5HWWA 1TS6A 3ZCZA 2XR0A 3ZG5A 4Y0OA 4QU3A 3W4PA 4UQIM 4GDNA 5J8XA 2PR6A 2PR5A 2HV1A 3RTYA 2KOIA 3R7WB 2B02A 1PWGA 2ZQDA 1S1YA 3D72A 5CHJA 3F1PB 3UDIA 4QJGA 1VB6A 3LIDA 4GJ4A 2JHEA 2JKTM 2PAVP 4KZ4A 2YKFA 2VV8A 3FZCA 1BUEA 3VV4A 5CHMA 3KO6A 2HGVA 2PRFA 2IA2A 4ZTKA 3MQQA 4BBUA 3MXQA 3SS5A 4MCWA 5EVEA 1S67L 2UV0E 3T12B 5CRFA 2M7UA 4A5RA 3UO9A 5C5KA 1XJ6A 4EERA 4FOFA 3G6OA 3OCLA 4PM9A 3ZQ5A 4KG6A 4DXBA 3MFDA 3EGDC 5GL9A 4JXSA 2XDMA 3ZG7B 2GNXA 2XQZA 4Z1WA 2ZD8A 1RP5A 5L07A 2W1RA 2W3EA 2ZC3B 2A49A 1YLWA 2O99A 3ITAA 1NYYA 4HBTA 4IHQA 3IF5A 2JKRM 3T4SA 1K56D 4AFIA 4MEZA 1UWPX 3VFHA 5FDHA 2G7UA 3GQZA 2OLUA 2ZM2A 4QY6A 3ZHHA 4DE2A 1CF0A 3BFFA 1G6AA 2Y2LA 3ZNTA 3GVBA 2J7VA 3A0SA 3FPWA 4II7A 1YMSA 2Y2OA 3IHAA 4JKTA 4KUOA 5AQ7A 2OWHA 1BZAA 3E2LA 1UWNX 2ZC7A 1GHPA 4G3VA 3CZDA 3HLEA 2JKTI 4B9OA 4KQQA 4I38A 4Q0IA 1VQQA 3O87A 3PBNA 4UA6A 1HVBA 2FFFB 1KGEA 4LRYC 3F1OA 5EFWA 1WYCA 1KOUA 3R7WA 2VKSA 5FAQA 5L8MA 1K54C 3BY9A 4FD8A 1YPRA 1G5UA 3LO7A 4HJ4A 1YKDA 2XFTA 3C5AA 2QZ6A 3V3SA 2WKHA 2QHKA 2INWA 5CERA 1G28A 3T4LA 1PWDA 1SKOA 4PMAA 3PBSA 4ZJ2A 2JCHA 2Y59A 2J9PA 5KZHA 5EVID 1TS0A 4IBRA 3S7PA 4ZRRA 4XT2A 3IF6A 3G31A 4OPRA 5DTSA 4UEYA 4O7DA 3VOYA 4JXVA 2WAEA 3LEZA 2A3UA 4KG5A 3T4OA 4ZDXA 4U0TA 4BD0A 1NLZA 2D02A 3QP5A 2V0WA 1W8QA 2VK3A 5DJUA 3OPRA 3ULFA 2ZM0A 4IJGA 3UDFA 3C7VA 5HD3A 4D60A 1OTAA 2KX6A 2Z2MB 2OAP1 3K3DA 3S4XA 2WK0A 3C4OA 4UHUA 3VE4A 1YT4A 1SDNA 5G4ZA 1WYBA 4JGRA 4R38A 5DKKA 3UDXA 4CLCA 5HFOA 3O86A 1NRFA 5EPHA 2Y2HA 2HP6A 2EX2A 4BL3A 3BW6A 5DTTA 1IEMA 3UE3A 2JKRI 4HP4A 3MKFA 2OWJA 4C3QA 5FL3A 1IFQA 4S2NA 3BFDA 3Q82A 2VLGA 3G32A 3GR2A 5CX7A 5HZHA 4CQHA 3R4KA 3HLGA 3HVFA 5CTMA 4I5SA 5IS1A 4KZ8A 3Q7VA 1YMXA 4E6XA 5I5LA 3BY8A 4OQIA 2BASA 4Y3IA 3CI6A 1T18A 2WZXA 4GHIA 4YOFA 5F83A 3MBZA 2W3GA 3O3VA 1ODVA 3C38A 2B18A 2XA7M 2ZMAA 2ZQCA 4R3JA 4Y2FA 2Q0OA 4WZ4A 4DMZA 4L9GA 1TS8A 2JC7A 1N9OA 3EWKA 1E3UA 2PHYA 5EM1A 1TVFA 2XD1A 4HBUA 4HH2A 4OOMA 1TS7A 4WF0A 4JGOA 3L9KA 3WS2A 4HEFA 3LIBA 3PBRA 3VE3A 4PPRA 3LR5A 2EFUA 1JVJA 4X53A 1IYQA 4K08A 2ZJ9A 5F69A 3TE8A 3ISGA 1VETB 4LGWA 3KSFA 3ZG0A 4R3BA 4X6TA 2VA0A 4OOYA 3S1YA 3NI9A 1DP6A 4X69A 2Z6DA 2W3HA 4HIAA 2V0UA 1U60A 2EX6A 1VEUB 2EA9A 5U47A 3LFVA 5JYOA 5EE8A 5DVAA 5L2FA 3N8RA 3I7JA 3CUEA 3S7NA 1XPBA 4GB7A 3LR4A 3G2YA 4EUZA 4U0XA 5GHYA 4WELA 3SS3A 4OQ0A 3LI9A 3BEBA 4OVDA 1ES5A 2WKRA 4GS9B 1OTIA 1FR1A 4QD4A 5KIZA 4IUHA 2NUPC 5F5YA 3V5MA 3C7UA 3ZVWA 1ESIA 1ALQA 2VJWA 2WKPA 3LCEA 4Y13A 2VGKA 1FR6A 1MBLA 3F1NA 3GECA 3KSIA 4GDBA 5G18A 2H28A 3PHYA 4OPZA 4I3JA 4XT2B 1N9LA 2W0NA 1W7FA 2BG1A 1F5MA 1STZA 1RGYA 4QY5A 2OSUA 1DJBA 4HHDA 5A8BA 3MQ0A 5DFXA 3HUOA 2HZ5A 2ZMFA 3BYDA 2Y55A 4I3IA 1F2KA 4S2LA 4CJNA 2PBDP 4S2PA 5EVIC 1L0GA 2ZC6B 3GDIA 2W1TB 4Y0TA 1VEUA 2V20A 3IX3A 4R23A 5TJJA 3IWQA 3NECA 3BFEA 4R0QA 1AWIA 3MFXA 3ZGAB 1ERMA 4B93A 5FEGA 1LT0A 1FIKA 3OBFA 4HJ6A 4U3TA 1VETA 3F1PA 4BBTA 3MXSA 5TGFA 4B4ZA 2E8IA 1A0KA 3D9YA 3NHQA 2E8JA 2P9VB
chains in the Genus database with same CATH topology
3TRCA 2QJ5A 3UB7A 2PT7A 1S4RA 4NXBA 2XROA 1YAXA 4EEUA 3CLOA 2VGLS 3KX0X 3A0SA 3FPWA 3UB9A 4DN0A 4EUVA 1GSVA 1OT9A 2QJ7A 4II7A 3LICA 4H6JA 2M1CA 4GLQA 2PD7A 5AVEA 3E0YA 4NKPA 4LPZA 1OJ5A 2J3WA 3C2WA 1VHMA 4HNBA 4KUOA 4L9EA 2OWHA 1T19A 2W1TA 4E04A 1UWNX 2L1MA 1P9RA 4KQOA 3IBRA 1F98A 1XFQA 4G3VA 2GJ3A 1F9IA 2J3TC 3LR0A 3B42A 3RFBA 3VOLA 2W27A 4M4XA 4PAUA 3D3OA 3LUQA 2JKTI 4B9OA 3B33A 4R3AA 4BJPA 2HJEA 4ARZB 4MN5A 3LR3A 4I3AA 4Y5FA 4NXEA 4MN7A 4I38A 4Q0IA 3NOTC 3PBNA 2K7SA 1JNUA 2A24B 2XSSA 2Z6CA 4ETXA 1P97A 4LRYC 1XJ4A 4GW9A 3F1OA 4I39A 5EFWA 3KSHA 3KYQA 4MDZA 1KOUA 3R7WA 3FPVA 2VKSA 3SW1A 2GX5A 3T4TA 4R6LA 5L8MA 3FG8A 5HWVA 3BY9A 4JGQA 3H9WA 5G4YA 4O0PA 4Q0HA 1D06A 2DMWA 4HJ4A 5K5BA 4RQ9A 4CLCD 2LB5A 4NXGA 1YKDA 2A2LA 4OOLA 5HSQA 3NOUC 3JVUA 3MR0A 2J80A 1MKMA 2V9AA 2PD8A 1XJ3A 4HOIA 5HDCA 1DP8A 4NEED 4PKYA 2W3DA 2QHKA 3P01A 1GSWA 2INWA 2P7JA 4DJ3A 1G28A 3NJAA 3T4LA 2O9AA 2PDRA 4HH3A 5DFYA 2FH5A 3PBSA 1V9YA 1UGUA 4O01A 3CUEC 3ICYA 4G3WA 5HL6A 3IBJA 2VX8A 1TS0A 1S66L 3S7PA 4ZRRA 4GCZA 4XT2A 4HI4A 4YNRA 4Q0JA 1T1AA 3S7QA 5AVFA 3KSGA 2CMNA 3OOVA 2WKQA 3EQVA 2L4RA 2ZOHA 4P6ZM 4CLCB 1EW0A 4UEYA 2KDKA 3F1OB 2FZ0A 3T4OA 1NRJA 4UQIS 3MJQA 4YWZA 4BMWA 3PBOA 1NLZA 2D02A 2V1BA 3T4KA 4ETZA 1LSWA 1W63Q 2V0WA 4HJ3A 1T1BA 5DJUA 3T4QA 2PYPA 4IUKA 3LIAA 3ULFA 4IJGA 1D7EA 3HJIA 2PYRA 5HD3A 3ZYTA 5TBMB 2D01A 2W3FA 4WN5A 1OTAA 2KX6A 3BWLA 5HWTA 2QYBA 3P7NA 2OAP1 3K3DA 3EEAA 3E4QA 1Y28A 3VE4A 5HPIA 5G4ZA 2EWWA 4KUKA 4JGRA 4R38A 5DKKA 4CLCA 1W63M 3TJZC 1XFNA 3H82B 2O0YA 3T4JA 1H3QA 3C8CA 5HD5A 3BW6A 3UE3A 1P9WA 2JKRI 4HP4A 3BQAA 5F68A 2OWJA 2K2NA 5FL3A 3V67A 4MN6A 1IFQA 2OAQ1 1MC0A 2VLGA 1S1ZA 4F3LA 2ZBBA 1TD5A 2OOLA 3EGXC 5CX7A 1LSVA 1P0ZA 5HZHA 4CQHA 3R4KA 2YKHA 3E98A 5KSHA 4I5SA 5IS1A 1OPXA 3UB8A 1GSXA 4WUJA 4MMNA 3H82A 3T50A 4PKYG 2QKPA 3BY8A 5I5LA 4EEPA 4L0LA 3IS2B 3UMEA 4CLCC 2BASA 4Y3IA 3CI6A 1T18A 4GHIA 2EWVA 4YOFA 3O5YA 2W3GA 4F3LB 1XJ2A 1IOUA 5F6AA 3OC2A 1V9ZA 1TF1A 4GS9A 3LI8A 1ODVA 2HJ9C 1OT6A 3C38A 4KQDA 2JN7A 1LSXA 2B18A 2XA7M 2P08A 2K31A 1G6OA 3CWFA 3PYPA 4LLOB 4H6JB 4Y2FA 1YSQA 3MMHA 2P04A 5J4EA 5MC7A 4G3KA 4HY8A 3C30A 4DMZA 4L9GA 5J7EA 1TS8A 3EQUA 1N9OA 1ZHHB 3EWKA 5AJGA 4ARZA 2PHYA 2V1AA 4CLCE 4WEKA 2XRNA 3KYZA 4NXFA 4WL9A 3E4PA 3H7WA 4QPRA 4HH2A 1OJGA 4OOMA 1TS7A 4WF0A 5HDDA 4L9FA 2L0WA 4JGOA 3LIBA 3PBRA 3VE3A 2MJ6A 3LR5A 3W2ZA 4K08A 5J3WA 4WLAA 5F69A 3BQ8A 3K2NA 3TE8A 5HPFA 3UB6A 2XA7S 3KSFA 3MF0A 2O9CA 1LL8A 3PBTA 2VA0A 2R78A 2A24A 2VV7A 3TW8A 3IS2A 1DP6A 3RH8B 2Z6DA 2W3HA 4HIAA 2V0UA 3E4OA 2VZWA 2EA9A 3LYXA 3LFVA 1WA9A 3S7OA 3NOPC 3CUEA 3S7NA 5DJTA 1DP9A 3LR4A 4LRXC 1OTBA 4EESA 3OCNA 4EETB 3HJKA 3LIFA 4WELA 2VGLM 1H8MA 3BJNA 2O9BA 1OTEA 3EOIA 3LI9A 4BBVA 4LRZE 3CAXA 2GZAA 2WKRA 1S4SA 4GS9B 1OTIA 5HWWA 3UE6A 5KIZA 2Y79A 5DF9A 4IUHA 1TS6A 2NUPC 4GHIB 2Y8HA 5F5YA 1MZUA 3UMDA 2VJWA 5DKLA 4UQIM 2WKPA 3B47A 2PR6A 3F1NA 1NLYA 3GECA 1YSPA 3KSIA 3F1NB 3OLOA 2PR5A 1BYWA 2HV1A 3RTYA 2KOIA 3R7WB 2B02A 4EU0A 2H28A 3PHYA 1S1YA 3D72A 4I3JA 3F1PB 5HDSA 1VB6A 4EXOA 1X0OA 3LIDA 4GJ4A 4XT2B 1N9LA 2W0NA 2JHEA 2JKTM 2QWSA 3JVVA 2YKFA 2VV8A 1F5MA 1STZA 3VV4A 1ZTUA 2HF6A 3KO6A 2KLIA 4HHDA 4ME4A 5A8BA 4PHTA 3MQ0A 2HGVA 5DFXA 2IA2A 5TBMA 3MQOA 2ZMFA 3MQQA 1OTDA 4BBUA 4I3IA 3MXQA 3K3CA 3DBAA 4MCWA 1S67L 3A0VA 2M7UA 1NWZA 5C5KA 1XJ6A 2ZMVA 4R70A 4EERA 2M7VA 2VV6A 1T1CA 3GDIA 4FOFA 2W1TB 3HCYA 4BWIA 3G6OA 3OCLA 3ZQ5A 4WEJA 2LB9A 4HP9A 2NUTC 2J3TD 4O8GA 3EGDC 3PXPA 2GNXA 5TJJA 3EEHA 3U2AA 4Z1WA 1DRMA 4EQ1A 2W1RA 5LBRA 2W3EA 3MFXA 3CITA 4DJ2A 5IT5A 3FC7A 3LIEA 2I9VA 3PR6A 4B93A 1LT0A 2O99A 4JGPA 4P6ZS 4FSFA 4HQAA 4EW7A 3OBFA 4HJ6A 4IHQA 3A0RA 3F1PA 2JKRM 4BBTA 3T4SA 4AFIA 1UWPX 5IU1A 2ZOIA 2VEAA 1N9NA 3NHQA 3H7WB 2G7UA 3PBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ5 A;  3UB7 A;  1T18 A;  3ICY A;  4GHI A;  4GHI B;  1S4R A;  4NXB A;  4F3L B;  1TS0 A;  1XJ2 A;  1S66 L;  5F5Y A;  1MZU A;  5F6A A;  4EEU A;  3CLO A;  4GCZ A;  4XT2 A;  4HI4 A;  1V9Z A;  4GS9 A;  5DKL A;  3UMD A;  3LI8 A;  1ODV A;  3KX0 X;  2WKP A;  3A0S A;  1OT6 A;  3UB9 A;  1T1A A;  4KQD A;  2JN7 A;  1LSX A;  2PR6 A;  3F1N A;  3GEC A;  1GSV A;  5AVF A;  1OT9 A;  2CMN A;  2QJ7 A;  2PR5 A;  3CWF A;  3F1N B;  2WKQ A;  3LIC A;  1BYW A;  2HV1 A;  2M1C A;  3PYP A;  2L4R A;  4H6J A;  4H6J B;  4LLO B;  2PD7 A;  2ZOH A;  3RTY A;  2B02 A;  5I5L A;  2H28 A;  3PHY A;  5AVE A;  1EW0 A;  1S1Y A;  5J4E A;  2KDK A;  4LPZ A;  3D72 A;  1OJ5 A;  4I3J A;  4HY8 A;  3F1P B;  5HDS A;  3F1O B;  3C2W A;  1VB6 A;  4EXO A;  1X0O A;  3LID A;  4XT2 B;  5A8B A;  1N9L A;  4HNB A;  2W0N A;  4KUO A;  4L9E A;  2JHE A;  2QWS A;  4L9G A;  2OWH A;  1T19 A;  2YKF A;  5J7E A;  1TS8 A;  2VV8 A;  3MJQ A;  4YWZ A;  4E04 A;  1N9O A;  1UWN X;  3EWK A;  2D02 A;  2PHY A;  2L1M A;  2V1A A;  2V1B A;  3IBR A;  4NXF A;  4WL9 A;  3E4P A;  1LSW A;  2V0W A;  4HJ3 A;  1T1B A;  3H7W A;  5DJU A;  1F98 A;  2PYP A;  1OJG A;  4HHD A;  1TS7 A;  1XFQ A;  3LIA A;  4HH2 A;  4WF0 A;  5HDD A;  4L9F A;  2L0W A;  4JGO A;  3ULF A;  1D7E A;  2GJ3 A;  2PYR A;  3HJI A;  5HD3 A;  1F9I A;  5TBM A;  3LIB A;  2D01 A;  5TBM B;  3VE3 A;  3MQO A;  3VOL A;  2W27 A;  4M4X A;  3MQQ A;  1OTD A;  3LUQ A;  1OTA A;  4WN5 A;  2KX6 A;  4K08 A;  3BWL A;  5J3W A;  4B9O A;  4BBU A;  4WLA A;  4I3I A;  3B33 A;  3MXQ A;  4R3A A;  5F69 A;  3K3C A;  3P7N A;  5HWT A;  1S67 L;  4MN5 A;  3A0V A;  3K3D A;  4I3A A;  1NWZ A;  3UB6 A;  1XJ6 A;  4NXE A;  4R70 A;  4EER A;  4I38 A;  3NOT C;  3E4Q A;  1LL8 A;  2K7S A;  1JNU A;  1T1C A;  1Y28 A;  2A24 B;  2VV6 A;  2R78 A;  3GDI A;  2A24 A;  5G4Z A;  3G6O A;  3VE4 A;  2Z6C A;  4KUK A;  4JGR A;  3ZQ5 A;  4R38 A;  5DKK A;  1P97 A;  4LRY C;  1XJ4 A;  4GW9 A;  4HP9 A;  3F1O A;  4I39 A;  2VV7 A;  5EFW A;  3IS2 A;  1XFN A;  1KOU A;  3H82 B;  3SW1 A;  1DP6 A;  3C8C A;  3RH8 B;  2Z6D A;  3EEH A;  4R6L A;  5HD5 A;  4HIA A;  3FG8 A;  2V0U A;  5HWV A;  1DRM A;  4EQ1 A;  3BY9 A;  3E4O A;  4JGQ A;  4HP4 A;  3H9W A;  5F68 A;  2OWJ A;  5G4Y A;  2EA9 A;  3LYX A;  4MN6 A;  3MFX A;  1D06 A;  4DJ2 A;  1WA9 A;  5IS1 A;  3FC7 A;  3LIE A;  4HJ4 A;  2I9V A;  2VLG A;  4RQ9 A;  1S1Z A;  3NOP C;  4F3L A;  2ZBB A;  1LT0 A;  2OOL A;  4NXG A;  3OLO A;  1TS6 A;  5DJT A;  5HSQ A;  4JGP A;  1LSV A;  1P0Z A;  3NOU C;  4HQA A;  5HZH A;  1DP9 A;  4LRX C;  4EW7 A;  1OTB A;  4HJ6 A;  2YKH A;  3A0R A;  3MR0 A;  2J80 A;  2V9A A;  4EES A;  2PD8 A;  4I5S A;  1XJ3 A;  4HOI A;  3F1P A;  5HDC A;  3UB8 A;  3HJK A;  3LIF A;  1DP8 A;  1GSX A;  4PKY A;  4BBV A;  4BBT A;  2QHK A;  1GSW A;  4WUJ A;  2INW A;  2P7J A;  4DJ3 A;  1OTE A;  1UWP X;  3H82 A;  1G28 A;  2ZOI A;  3LI9 A;  3NJA A;  4LRZ E;  3CAX A;  5IU1 A;  3T50 A;  4PKY G;  4EET B;  2PDR A;  2QKP A;  1N9N A;  2VEA A;  2WKR A;  1S4S A;  3BY8 A;  3NHQ A;  1OTI A;  4GS9 B;  4HH3 A;  4EEP A;  3H7W B;  3IS2 B;  1V9Y A;  3UE6 A;  3UME A;  5HWW A;  2BAS A;  5KIZ A;  1UGU A; 
#chains in the Genus database with same CATH topology
 2QJ5 A;  3GMW A;  4RX3 A;  2Y2G A;  1EWZ A;  4NXB A;  3VMA A;  5EV0 A;  4XUX A;  1TDG A;  3VSL A;  3CLO A;  2VGL S;  3SH9 A;  4EUV A;  3V50 A;  5E2G A;  1J9M A;  1KVM A;  4H6J A;  3VSK A;  2PD7 A;  1PI4 A;  5AVE A;  2XD5 A;  3G30 A;  4KZ9 A;  2J3W A;  2JBF A;  4HNB A;  1K55 C;  1T19 A;  2W1T A;  4LV1 A;  4JLF A;  1I2W A;  3DW0 A;  1P9R A;  3FWL A;  3PAE A;  1NYM A;  3LEQ A;  1XFQ A;  5IHV A;  3BLM A;  5DTK A;  3B42 A;  3M2J A;  4PAU A;  4E3N A;  4P85 A;  4R3A A;  5E43 A;  1CI9 A;  3KYE A;  4MN5 A;  2HDR A;  4Y5F A;  4MN7 A;  4S2M A;  4LV3 A;  3NOT C;  1CK3 A;  4IVK A;  2A24 B;  2HP5 A;  3FV7 A;  2WGW B;  3KSH A;  4ZJ1 A;  2H5S A;  2ZC5 B;  4GD8 A;  5FQ9 A;  3VP1 A;  4JGQ A;  2J9O A;  4MBF A;  1BLP A;  5G4Y A;  2B95 A;  4CLC D;  5FAS A;  4DXC A;  4EBP A;  4NXG A;  5HL1 A;  1K4F A;  3QNB A;  2WZZ A;  4N1H A;  3JVU A;  1KE3 A;  3MR0 A;  2J80 A;  4HOI A;  1DP8 A;  1XKZ A;  2W3D A;  3P01 A;  1GA0 A;  2P7J A;  1ES3 A;  1SKF A;  2AVX A;  2O9A A;  1GCE A;  4LCL A;  5FAT A;  1V9Y A;  3ICY A;  4OLG A;  1ZG4 A;  1PZO A;  1NXY A;  2VX8 A;  3IBJ A;  3DTE A;  3NUL A;  2Y2I A;  1E25 A;  4N9L A;  3A3D A;  1NJ4 A;  3GTC A;  5AVF A;  1PRQ A;  2WKQ A;  4P6Z M;  1ZC2 A;  3ZFZ A;  1EW0 A;  2KDK A;  4OH0 A;  1IYO A;  2FZ0 A;  5CXW A;  1IYP A;  1JTD A;  1NRJ A;  2C6W B;  2XF3 A;  1I2S A;  3MXR A;  2V1B A;  3T4K A;  4ETZ A;  3L7H A;  4HJ3 A;  1T1B A;  1TDL A;  4GOG A;  1K57 A;  3LIA A;  1FQG A;  2PYR A;  4BD1 A;  1FCM A;  2W3F A;  4EBN A;  3BWL A;  4Q8I A;  4RX2 A;  2QYB A;  4FCF A;  3P7N A;  1XA1 A;  2Y2J A;  3EEA A;  3A3J A;  5E2H A;  3SOI A;  4N9K A;  3E4Q A;  5HPI A;  3OPL A;  3T1Q B;  4S2J A;  3DWZ A;  1ZKJ A;  3BM6 A;  1K6R A;  5FQK A;  1P9W A;  2XEP A;  3V67 A;  5I94 A;  2OAQ 1;  3D4F A;  5EEC A;  2ZLY A;  3M6H A;  1SZV A;  2ZBB A;  1MKI A;  1LSV A;  1EI5 A;  3VP0 A;  3E98 A;  5HAQ A;  3V39 A;  5A93 A;  1QME A;  3HLF A;  3H82 A;  1MWT A;  1Q2P A;  3Q7V B;  4PKY G;  4P6B A;  2QKP A;  1W79 A;  4L0L A;  1YLT A;  3IS2 B;  4CLC C;  3N6I A;  1YLY A;  2EWV A;  1FCN A;  4F3L B;  4KZA A;  3VP2 A;  3IF6 C;  1V9Z A;  1TF1 A;  4GS9 A;  2WKI A;  4IED A;  2K31 A;  4CPK A;  1JWP A;  4YIN A;  3MMH A;  1DJA A;  5FQI A;  5J4E A;  5MC7 A;  4G3K A;  3DTK A;  4E3L A;  5KMW A;  3S22 A;  5FSR A;  3UPO A;  5M1A A;  2P9V A;  3EQU A;  5AQA A;  3P98 A;  2V1A A;  5AQB A;  2XRN A;  3KYZ A;  4WL9 A;  5HDD A;  4L9F A;  1AXB A;  2DRW A;  4JF4 A;  3W2Z A;  1M6K A;  5HPF A;  5AQ9 A;  2XA7 S;  3WRZ A;  3IH8 A;  3MF0 A;  1LL8 A;  1CQA A;  2R78 A;  2A24 A;  3IXH A;  1L2S A;  5FI2 A;  3CG5 A;  1BTL A;  1K38 A;  4DDY A;  2OV5 A;  1YLJ A;  2R9W A;  5HW3 A;  2GDN A;  1WA9 A;  3DTM A;  3S7O A;  4S2I A;  3NCK A;  4JXW A;  4KEN B;  4GKU A;  1KGF A;  1BLH A;  4LRX C;  1OTB A;  4EET B;  4BQM A;  3LIF A;  2VGL M;  1H8M A;  4PM6 A;  2O9B A;  1OTE A;  2ZQA A;  3EOI A;  4LRZ E;  3CAX A;  1S4S A;  1CJF A;  5DF9 A;  5A92 A;  4EWF A;  2EX9 A;  2Q9M A;  4GHI B;  4DKI A;  3Q1F A;  2Y8H A;  1MZU A;  3ITB A;  3UMD A;  1XGJ A;  2X71 A;  5DKL A;  2Y2M A;  3ZNY A;  3T1X A;  4M3K A;  3QNC A;  4N92 A;  1YSP A;  3OLO A;  3F1N B;  3WS1 A;  1BYW A;  3QHY A;  2Y2P A;  1LI0 A;  3JYI A;  2XH9 A;  3BFG A;  2HF6 A;  4S2O A;  1BLC A;  3G4P A;  4ME4 A;  3OZH A;  4OPQ A;  3GV9 A;  5JYP A;  3QP8 A;  1LHY A;  1OTD A;  4LCM A;  3K3C A;  4PM5 A;  3Q7Z A;  1NWZ A;  4R70 A;  1GHM A;  4X55 A;  3NDE A;  1PI5 A;  4WEJ A;  2LB9 A;  4HP9 A;  2DNS A;  2NUT C;  2J3T D;  5DF8 A;  3BFC A;  3CJM A;  2V1Z A;  4FTX A;  3DTI A;  4R4R A;  3EEH A;  1DRM A;  5CED A;  3HUN A;  4E6W A;  2ZC4 B;  5LBR A;  1IYS A;  3HLB A;  4EBL A;  3CIT A;  4DJ2 A;  5F1F A;  5IT5 A;  1RCJ A;  3UPP A;  3PR6 A;  4MLL A;  3V3R A;  1PIO A;  1H8Y A;  2J8Y A;  4JGP A;  4EW7 A;  2VGJ A;  5M19 A;  3IXD A;  5HX9 A;  3HBR A;  5IU1 A;  2VEA A;  5E2F A;  2IWC A;  1XA7 A;  3H7W B;  4KZB A;  3PBQ A;  3TRC A;  3UB7 A;  1QMF A;  2PT7 A;  4FUW A;  5FI6 A;  2XRO A;  4DE1 A;  1CI8 A;  1BSG A;  1YAX A;  4S2N C;  4EEU A;  1KVL A;  5EOO A;  3PTE A;  3KX0 X;  4DN0 A;  3UB9 A;  4WZ5 C;  3HLW A;  1GSV A;  2Q9N A;  1OT9 A;  2QJ7 A;  1HZO A;  2M1C A;  1YQS A;  4GLQ A;  4MBH A;  2ZL1 B;  4NKP A;  4GN2 A;  4NET A;  1LL5 A;  1VHM A;  4L9E A;  1Y4O A;  1OME A;  2EXB A;  5HAR A;  5FAP A;  4IBX A;  2GJ3 A;  1K4E A;  1F9I A;  1MXO A;  3BEC A;  3U4L P;  1KE0 A;  3VOL A;  2W27 A;  4PM7 A;  4XUZ A;  3LUQ A;  4ID4 A;  4BEN A;  3B33 A;  3NY4 A;  4BJP A;  2HJE A;  3LR3 A;  4ZJ3 A;  2WAF A;  4I3A A;  3T1S A;  4NXE A;  4K0X A;  2XSS A;  2Z6C A;  3VFF A;  1O7E A;  1P97 A;  4WMC A;  4MDZ A;  2ZQ8 A;  3FPV A;  3NBL A;  3SW1 A;  2GX5 A;  3T4T A;  1XXM A;  1N9B A;  2H0Y A;  4MBK A;  2QPN A;  3ZG8 B;  2HDS A;  3N8L A;  1DJC A;  2WUQ A;  2XK1 A;  1D06 A;  2DMW A;  3OPH A;  1ERQ A;  4RQ9 A;  3HLC A;  4R1G A;  3N7W A;  3BRM A;  2A2L A;  4OOL A;  5HSQ A;  3NOU C;  3UNW A;  2EFX A;  2V9A A;  1XJ3 A;  1LL9 A;  5FQJ A;  3NJA A;  4PM8 A;  2WKE A;  1E3U D;  3N8S A;  2FFY A;  2FH5 A;  5FA7 A;  3HRE A;  1UGU A;  2JKG A;  4O01 A;  2QMI A;  4GD6 A;  5HL6 A;  3NC8 A;  4OPY A;  1WE4 A;  4GCZ A;  4HI4 A;  2G2U A;  4Q0J A;  4WBG A;  3S7Q A;  3DWK A;  5E2E A;  1G68 A;  3KSG A;  2CMN A;  3EQV A;  2L4R A;  3WS5 A;  2ZOH A;  3G34 A;  4LV2 A;  3FKW A;  1Z6F A;  3JPU A;  2WGW A;  5TFQ A;  4E3I A;  2Y2Q A;  3QP1 A;  3CMZ A;  4Y7P A;  5EVL A;  3PBO A;  2JKF A;  5GHX A;  1ONG A;  1W63 Q;  3E2K A;  3HLD A;  3T4Q A;  4OLD A;  2PYP A;  2Y4A A;  4ZBE A;  4KZ5 A;  3HJI A;  4X1M A;  5GLA A;  1N4O A;  3SH8 A;  5FAO A;  5M18 A;  4OON A;  1K54 A;  3LY3 A;  4DDS A;  3GSG A;  2XLN A;  5EOE A;  4X25 A;  5DF7 A;  4KUK A;  4ESP A;  1H8Z A;  4UA7 A;  1XFN A;  3H82 B;  3PAG A;  3C8C A;  3A3F A;  5HD5 A;  3ZDJ A;  4WZ5 A;  3BQA A;  5F68 A;  4Z9Q A;  1CEF A;  1C3B A;  3UPN A;  1LI9 A;  1YLP A;  1MC0 A;  2ZM8 A;  4Y17 A;  5HAI A;  1S1Z A;  3MSH A;  3C4P A;  4F3L A;  5CEB A;  1TD5 A;  2CC1 A;  4D2O A;  1P0Z A;  2YKH A;  4EV4 A;  1L0E A;  4JF5 A;  3UB8 A;  4MMN A;  4X56 A;  3T50 A;  1PYY A;  2ZQ7 A;  4EEP A;  4C6Y A;  3LY4 A;  2JE5 A;  1CEG A;  1VM1 A;  3UN7 A;  3VP4 A;  2UWX A;  4XXR A;  1IOU A;  3OC2 A;  3WS4 A;  2G2W A;  1OT6 A;  4R4S A;  2JN7 A;  3MS6 A;  5CGX A;  1H5X A;  1FOF A;  3CWF A;  2PU4 A;  4LLO B;  4H6J B;  4JBF A;  2P04 A;  4HY8 A;  4IVI A;  1IKG A;  2I72 A;  4B4X A;  4E3M A;  5J7E A;  1ZHH B;  4ARZ A;  4WEK A;  4NXF A;  5FDS A;  1ZG6 A;  4RYE A;  3UB5 P;  1I5Q A;  4NK3 A;  2RL3 A;  4WLA A;  3BQ8 A;  1IEL A;  2HP9 A;  3UB6 A;  3PBT A;  1NY0 A;  3TW8 A;  1M40 A;  3VOZ A;  4X68 A;  3RH8 B;  1XP4 A;  3NIA A;  3E4O A;  1SHV A;  3LYX A;  3NOP C;  1E4D A;  1PZP A;  3OCN A;  3SZT A;  1Q2Q A;  2GZA A;  3HL9 A;  4OP5 A;  3AGE A;  4RVA A;  4GZB A;  3UE6 A;  2Y79 A;  3P09 A;  5GLD A;  1GA9 A;  3ZVT A;  5F82 A;  1K56 A;  3B3X A;  3B47 A;  3DAV A;  1NLY A;  3IX8 A;  1W5D A;  4EU0 A;  5CEC A;  3IF6 B;  1Z09 A;  4BLM A;  1PFL A;  4WYY A;  5HDS A;  4EXO A;  1X0O A;  2C5W B;  1PW1 A;  4JF6 A;  3CPT B;  1FSW A;  2QWS A;  3JVV A;  4K91 A;  1JWZ A;  1YM1 A;  1ZTU A;  3G2Z A;  2KLI A;  1O07 A;  4PHT A;  5TBM A;  5FQM A;  4E3J A;  3MQO A;  1DY6 A;  5FEF A;  4RA7 A;  2PU2 A;  3DBA A;  1KE4 A;  1HD8 A;  3QP6 A;  3A0V A;  3SS4 A;  3IXB A;  4P0M A;  1MWR A;  4N1X A;  2WGI A;  2ZMV A;  3CPT A;  4LFU A;  2M7V A;  3ZG9 B;  5A91 A;  2VV6 A;  1T1C A;  4BWI A;  3QP2 A;  3HCY A;  4LV0 A;  5EVI B;  4Y15 A;  4O8G A;  2XFS A;  1Y54 A;  5EM0 A;  3PXP A;  3U2A A;  1FSY A;  4EQ1 A;  4QWO A;  1MWU A;  3OPP A;  3FC7 A;  3LIE A;  2Y2N A;  2I9V A;  1TEM A;  4P6Z S;  4FSF A;  4HQA A;  4KZ7 A;  3A0R A;  2WAD A;  1ES4 A;  3QP4 A;  1K55 A;  2ZOI A;  3IT9 A;  1N9N A;  1PWC A;  2V8C A;  2K2N A;  1KGG A;  5F1G A;  1SDE A;  5L09 A;  1S4R A;  3Q07 A;  1GHI A;  3WRT A;  1MY8 A;  4KZ3 A;  3MKE A;  3LIC A;  2IWB A;  4OQG A;  4EQI A;  3E0Y A;  3VP3 A;  1K57 C;  4LPZ A;  2BTF P;  1OJ5 A;  3C2W A;  3IXG A;  4E04 A;  3UE1 A;  2L1M A;  3WWX A;  4KQO A;  3IBR A;  5CGS A;  4S2K A;  1F98 A;  3FYZ A;  1JTG A;  1XX2 A;  1ES2 A;  2J3T C;  3LR0 A;  3RFB A;  4M4X A;  3IH9 A;  1FCO A;  3D3O A;  3W8K A;  3IHB A;  4OQH A;  4ARZ B;  3T1R A;  2B5R A;  4Y0U A;  1W8Y A;  3HUM A;  2K7S A;  1JNU A;  4X1L A;  2HPB A;  4ETX A;  5GLB A;  1XJ4 A;  4GW9 A;  4I39 A;  3AGF A;  3MZE A;  3KYQ A;  2Z2L B;  3N4I A;  4R6L A;  5HAP A;  3FG8 A;  5KSC A;  5HWV A;  2ZQ9 A;  3H9W A;  4KG2 A;  4O0P A;  4Q0H A;  2WYX A;  4F94 A;  4JPM A;  5BOH A;  5K5B A;  1MPL A;  2LB5 A;  4WMC D;  3TG9 A;  2HDU A;  2DCF A;  1MWS A;  4KQR A;  1MKM A;  2PD8 A;  1BUL A;  5HDC A;  4NEE D;  4PKY A;  4NG2 A;  5EUA A;  1GSW A;  4DJ3 A;  1FIL A;  4DF6 A;  1D1J A;  3FKV A;  1RGZ A;  2PDR A;  4HH3 A;  5DFY A;  5CGW A;  1ACF A;  1ONH A;  3CUE C;  4G3W A;  1S66 L;  3AGD A;  4YNR A;  3IWO A;  1T1A A;  1XGI A;  4QB8 A;  1S0W A;  3OOV A;  3CHW P;  5FI7 A;  2BLS A;  4CLC B;  3SH7 A;  5GHZ A;  4K0W A;  4C75 A;  3O88 A;  1PW8 A;  3F1O B;  3W4Q A;  4MNR A;  3UE0 A;  4UQI S;  2H0T A;  3MJQ A;  4YWZ A;  4BMW A;  1IKI A;  1BLS A;  1K25 A;  1LSW A;  2ZL1 A;  4IUK A;  2OLV A;  1K0K A;  4OKP A;  1D7E A;  5A90 A;  3ZYT A;  5TBM B;  2D01 A;  1H0M A;  4WN5 A;  3G35 A;  5HWT A;  3IWI A;  1L0D A;  3IQA A;  2X02 A;  1Y28 A;  3RJU A;  2EWW A;  4KZ6 A;  1W63 M;  3TJZ C;  3IX4 A;  4BL2 A;  4UA9 A;  4UAA A;  2O0Y A;  3T4J A;  1H3Q A;  4JXG A;  4DRT A;  3TSG A;  4E3K A;  2HDQ A;  4MN6 A;  3W4O A;  1HLU P;  2Y2K A;  3UY6 A;  2OOL A;  3EGX C;  1L0F A;  1SKO B;  1KDW A;  5FQQ A;  5KSH A;  1OPX A;  4LEN A;  1GSX A;  4FH4 A;  4WUJ A;  1NZO A;  4E3O A;  2Y91 A;  3UME A;  1KDS A;  2V2F F;  3TOI A;  3O5Y A;  3MZF A;  3MZD A;  1XJ2 A;  2R9X A;  5F6A A;  5TR7 A;  1ESU A;  4FH2 A;  3LI8 A;  3RXW A;  2HJ9 C;  1L3L A;  4KQD A;  4QHC A;  2ACG A;  1LSX A;  2H10 A;  2P08 A;  1G6O A;  3GRJ A;  3PYP A;  1NZU A;  1YSQ A;  5L10 A;  1BT5 A;  2P74 A;  2IWD A;  3C30 A;  2X01 A;  4GNU A;  2XGN A;  5AJG A;  2V8F A;  4CLC E;  3E4P A;  3H7W A;  4QPR A;  1OJG A;  3NDG A;  1SCW A;  3M2K A;  4DE0 A;  2L0W A;  3A3I A;  2MJ6 A;  5J3W A;  2EXA A;  1YLZ A;  2RCX A;  3K2N A;  3LGO A;  4WM9 A;  5CTN A;  1J3W A;  3WS0 A;  2O9C A;  3Q81 A;  2VV7 A;  3IS2 A;  2PBY A;  4DE3 A;  4YFM A;  1PNE A;  5EVI A;  4B88 A;  2WGV A;  2VZW A;  3A3E A;  4P87 A;  3RXX A;  1K6S A;  1LLB A;  5D3O A;  1S6R A;  5DJT A;  1DP9 A;  5GLC A;  4OP8 A;  1ERO A;  4H8R A;  3BLS A;  1HTZ A;  4EES A;  3HJK A;  3BJN A;  5CHU A;  2EX8 A;  4BBV A;  3M6B A;  4ZAM A;  4HES A;  1JWV A;  5HWW A;  1TS6 A;  3ZCZ A;  2XR0 A;  3ZG5 A;  4Y0O A;  4QU3 A;  3W4P A;  4UQI M;  4GDN A;  5J8X A;  2PR6 A;  2PR5 A;  2HV1 A;  3RTY A;  2KOI A;  3R7W B;  2B02 A;  1PWG A;  2ZQD A;  1S1Y A;  3D72 A;  5CHJ A;  3F1P B;  3UDI A;  4QJG A;  1VB6 A;  3LID A;  4GJ4 A;  2JHE A;  2JKT M;  2PAV P;  4KZ4 A;  2YKF A;  2VV8 A;  3FZC A;  1BUE A;  3VV4 A;  5CHM A;  3KO6 A;  2HGV A;  2PRF A;  2IA2 A;  4ZTK A;  3MQQ A;  4BBU A;  3MXQ A;  3SS5 A;  4MCW A;  5EVE A;  1S67 L;  2UV0 E;  3T12 B;  5CRF A;  2M7U A;  4A5R A;  3UO9 A;  5C5K A;  1XJ6 A;  4EER A;  4FOF A;  3G6O A;  3OCL A;  4PM9 A;  3ZQ5 A;  4KG6 A;  4DXB A;  3MFD A;  3EGD C;  5GL9 A;  4JXS A;  2XDM A;  3ZG7 B;  2GNX A;  2XQZ A;  4Z1W A;  2ZD8 A;  1RP5 A;  5L07 A;  2W1R A;  2W3E A;  2ZC3 B;  2A49 A;  1YLW A;  2O99 A;  3ITA A;  1NYY A;  4HBT A;  4IHQ A;  3IF5 A;  2JKR M;  3T4S A;  1K56 D;  4AFI A;  4MEZ A;  1UWP X;  3VFH A;  5FDH A;  2G7U A;  3GQZ A;  2OLU A;  2ZM2 A;  4QY6 A;  3ZHH A;  4DE2 A;  1CF0 A;  3BFF A;  1G6A A;  2Y2L A;  3ZNT A;  3GVB A;  2J7V A;  3A0S A;  3FPW A;  4II7 A;  1YMS A;  2Y2O A;  3IHA A;  4JKT A;  4KUO A;  5AQ7 A;  2OWH A;  1BZA A;  3E2L A;  1UWN X;  2ZC7 A;  1GHP A;  4G3V A;  3CZD A;  3HLE A;  2JKT I;  4B9O A;  4KQQ A;  4I38 A;  4Q0I A;  1VQQ A;  3O87 A;  3PBN A;  4UA6 A;  1HVB A;  2FFF B;  1KGE A;  4LRY C;  3F1O A;  5EFW A;  1WYC A;  1KOU A;  3R7W A;  2VKS A;  5FAQ A;  5L8M A;  1K54 C;  3BY9 A;  4FD8 A;  1YPR A;  1G5U A;  3LO7 A;  4HJ4 A;  1YKD A;  2XFT A;  3C5A A;  2QZ6 A;  3V3S A;  2WKH A;  2QHK A;  2INW A;  5CER A;  1G28 A;  3T4L A;  1PWD A;  1SKO A;  4PMA A;  3PBS A;  4ZJ2 A;  2JCH A;  2Y59 A;  2J9P A;  5KZH A;  5EVI D;  1TS0 A;  4IBR A;  3S7P A;  4ZRR A;  4XT2 A;  3IF6 A;  3G31 A;  4OPR A;  5DTS A;  4UEY A;  4O7D A;  3VOY A;  4JXV A;  2WAE A;  3LEZ A;  2A3U A;  4KG5 A;  3T4O A;  4ZDX A;  4U0T A;  4BD0 A;  1NLZ A;  2D02 A;  3QP5 A;  2V0W A;  1W8Q A;  2VK3 A;  5DJU A;  3OPR A;  3ULF A;  2ZM0 A;  4IJG A;  3UDF A;  3C7V A;  5HD3 A;  4D60 A;  1OTA A;  2KX6 A;  2Z2M B;  2OAP 1;  3K3D A;  3S4X A;  2WK0 A;  3C4O A;  4UHU A;  3VE4 A;  1YT4 A;  1SDN A;  5G4Z A;  1WYB A;  4JGR A;  4R38 A;  5DKK A;  3UDX A;  4CLC A;  5HFO A;  3O86 A;  1NRF A;  5EPH A;  2Y2H A;  2HP6 A;  2EX2 A;  4BL3 A;  3BW6 A;  5DTT A;  1IEM A;  3UE3 A;  2JKR I;  4HP4 A;  3MKF A;  2OWJ A;  4C3Q A;  5FL3 A;  1IFQ A;  4S2N A;  3BFD A;  3Q82 A;  2VLG A;  3G32 A;  3GR2 A;  5CX7 A;  5HZH A;  4CQH A;  3R4K A;  3HLG A;  3HVF A;  5CTM A;  4I5S A;  5IS1 A;  4KZ8 A;  3Q7V A;  1YMX A;  4E6X A;  5I5L A;  3BY8 A;  4OQI A;  2BAS A;  4Y3I A;  3CI6 A;  1T18 A;  2WZX A;  4GHI A;  4YOF A;  5F83 A;  3MBZ A;  2W3G A;  3O3V A;  1ODV A;  3C38 A;  2B18 A;  2XA7 M;  2ZMA A;  2ZQC A;  4R3J A;  4Y2F A;  2Q0O A;  4WZ4 A;  4DMZ A;  4L9G A;  1TS8 A;  2JC7 A;  1N9O A;  3EWK A;  1E3U A;  2PHY A;  5EM1 A;  1TVF A;  2XD1 A;  4HBU A;  4HH2 A;  4OOM A;  1TS7 A;  4WF0 A;  4JGO A;  3L9K A;  3WS2 A;  4HEF A;  3LIB A;  3PBR A;  3VE3 A;  4PPR A;  3LR5 A;  2EFU A;  1JVJ A;  4X53 A;  1IYQ A;  4K08 A;  2ZJ9 A;  5F69 A;  3TE8 A;  3ISG A;  1VET B;  4LGW A;  3KSF A;  3ZG0 A;  4R3B A;  4X6T A;  2VA0 A;  4OOY A;  3S1Y A;  3NI9 A;  1DP6 A;  4X69 A;  2Z6D A;  2W3H A;  4HIA A;  2V0U A;  1U60 A;  2EX6 A;  1VEU B;  2EA9 A;  5U47 A;  3LFV A;  5JYO A;  5EE8 A;  5DVA A;  5L2F A;  3N8R A;  3I7J A;  3CUE A;  3S7N A;  1XPB A;  4GB7 A;  3LR4 A;  3G2Y A;  4EUZ A;  4U0X A;  5GHY A;  4WEL A;  3SS3 A;  4OQ0 A;  3LI9 A;  3BEB A;  4OVD A;  1ES5 A;  2WKR A;  4GS9 B;  1OTI A;  1FR1 A;  4QD4 A;  5KIZ A;  4IUH A;  2NUP C;  5F5Y A;  3V5M A;  3C7U A;  3ZVW A;  1ESI A;  1ALQ A;  2VJW A;  2WKP A;  3LCE A;  4Y13 A;  2VGK A;  1FR6 A;  1MBL A;  3F1N A;  3GEC A;  3KSI A;  4GDB A;  5G18 A;  2H28 A;  3PHY A;  4OPZ A;  4I3J A;  4XT2 B;  1N9L A;  2W0N A;  1W7F A;  2BG1 A;  1F5M A;  1STZ A;  1RGY A;  4QY5 A;  2OSU A;  1DJB A;  4HHD A;  5A8B A;  3MQ0 A;  5DFX A;  3HUO A;  2HZ5 A;  2ZMF A;  3BYD A;  2Y55 A;  4I3I A;  1F2K A;  4S2L A;  4CJN A;  2PBD P;  4S2P A;  5EVI C;  1L0G A;  2ZC6 B;  3GDI A;  2W1T B;  4Y0T A;  1VEU A;  2V20 A;  3IX3 A;  4R23 A;  5TJJ A;  3IWQ A;  3NEC A;  3BFE A;  4R0Q A;  1AWI A;  3MFX A;  3ZGA B;  1ERM A;  4B93 A;  5FEG A;  1LT0 A;  1FIK A;  3OBF A;  4HJ6 A;  4U3T A;  1VET A;  3F1P A;  4BBT A;  3MXS A;  5TGF A;  4B4Z A;  2E8I A;  1A0K A;  3D9Y A;  3NHQ A;  2E8J A;  2P9V B; 
#chains in the Genus database with same CATH homology
 3TRC A;  2QJ5 A;  3UB7 A;  2PT7 A;  1S4R A;  4NXB A;  2XRO A;  1YAX A;  4EEU A;  3CLO A;  2VGL S;  3KX0 X;  3A0S A;  3FPW A;  3UB9 A;  4DN0 A;  4EUV A;  1GSV A;  1OT9 A;  2QJ7 A;  4II7 A;  3LIC A;  4H6J A;  2M1C A;  4GLQ A;  2PD7 A;  5AVE A;  3E0Y A;  4NKP A;  4LPZ A;  1OJ5 A;  2J3W A;  3C2W A;  1VHM A;  4HNB A;  4KUO A;  4L9E A;  2OWH A;  1T19 A;  2W1T A;  4E04 A;  1UWN X;  2L1M A;  1P9R A;  4KQO A;  3IBR A;  1F98 A;  1XFQ A;  4G3V A;  2GJ3 A;  1F9I A;  2J3T C;  3LR0 A;  3B42 A;  3RFB A;  3VOL A;  2W27 A;  4M4X A;  4PAU A;  3D3O A;  3LUQ A;  2JKT I;  4B9O A;  3B33 A;  4R3A A;  4BJP A;  2HJE A;  4ARZ B;  4MN5 A;  3LR3 A;  4I3A A;  4Y5F A;  4NXE A;  4MN7 A;  4I38 A;  4Q0I A;  3NOT C;  3PBN A;  2K7S A;  1JNU A;  2A24 B;  2XSS A;  2Z6C A;  4ETX A;  1P97 A;  4LRY C;  1XJ4 A;  4GW9 A;  3F1O A;  4I39 A;  5EFW A;  3KSH A;  3KYQ A;  4MDZ A;  1KOU A;  3R7W A;  3FPV A;  2VKS A;  3SW1 A;  2GX5 A;  3T4T A;  4R6L A;  5L8M A;  3FG8 A;  5HWV A;  3BY9 A;  4JGQ A;  3H9W A;  5G4Y A;  4O0P A;  4Q0H A;  1D06 A;  2DMW A;  4HJ4 A;  5K5B A;  4RQ9 A;  4CLC D;  2LB5 A;  4NXG A;  1YKD A;  2A2L A;  4OOL A;  5HSQ A;  3NOU C;  3JVU A;  3MR0 A;  2J80 A;  1MKM A;  2V9A A;  2PD8 A;  1XJ3 A;  4HOI A;  5HDC A;  1DP8 A;  4NEE D;  4PKY A;  2W3D A;  2QHK A;  3P01 A;  1GSW A;  2INW A;  2P7J A;  4DJ3 A;  1G28 A;  3NJA A;  3T4L A;  2O9A A;  2PDR A;  4HH3 A;  5DFY A;  2FH5 A;  3PBS A;  1V9Y A;  1UGU A;  4O01 A;  3CUE C;  3ICY A;  4G3W A;  5HL6 A;  3IBJ A;  2VX8 A;  1TS0 A;  1S66 L;  3S7P A;  4ZRR A;  4GCZ A;  4XT2 A;  4HI4 A;  4YNR A;  4Q0J A;  1T1A A;  3S7Q A;  5AVF A;  3KSG A;  2CMN A;  3OOV A;  2WKQ A;  3EQV A;  2L4R A;  2ZOH A;  4P6Z M;  4CLC B;  1EW0 A;  4UEY A;  2KDK A;  3F1O B;  2FZ0 A;  3T4O A;  1NRJ A;  4UQI S;  3MJQ A;  4YWZ A;  4BMW A;  3PBO A;  1NLZ A;  2D02 A;  2V1B A;  3T4K A;  4ETZ A;  1LSW A;  1W63 Q;  2V0W A;  4HJ3 A;  1T1B A;  5DJU A;  3T4Q A;  2PYP A;  4IUK A;  3LIA A;  3ULF A;  4IJG A;  1D7E A;  3HJI A;  2PYR A;  5HD3 A;  3ZYT A;  5TBM B;  2D01 A;  2W3F A;  4WN5 A;  1OTA A;  2KX6 A;  3BWL A;  5HWT A;  2QYB A;  3P7N A;  2OAP 1;  3K3D A;  3EEA A;  3E4Q A;  1Y28 A;  3VE4 A;  5HPI A;  5G4Z A;  2EWW A;  4KUK A;  4JGR A;  4R38 A;  5DKK A;  4CLC A;  1W63 M;  3TJZ C;  1XFN A;  3H82 B;  2O0Y A;  3T4J A;  1H3Q A;  3C8C A;  5HD5 A;  3BW6 A;  3UE3 A;  1P9W A;  2JKR I;  4HP4 A;  3BQA A;  5F68 A;  2OWJ A;  2K2N A;  5FL3 A;  3V67 A;  4MN6 A;  1IFQ A;  2OAQ 1;  1MC0 A;  2VLG A;  1S1Z A;  4F3L A;  2ZBB A;  1TD5 A;  2OOL A;  3EGX C;  5CX7 A;  1LSV A;  1P0Z A;  5HZH A;  4CQH A;  3R4K A;  2YKH A;  3E98 A;  5KSH A;  4I5S A;  5IS1 A;  1OPX A;  3UB8 A;  1GSX A;  4WUJ A;  4MMN A;  3H82 A;  3T50 A;  4PKY G;  2QKP A;  3BY8 A;  5I5L A;  4EEP A;  4L0L A;  3IS2 B;  3UME A;  4CLC C;  2BAS A;  4Y3I A;  3CI6 A;  1T18 A;  4GHI A;  2EWV A;  4YOF A;  3O5Y A;  2W3G A;  4F3L B;  1XJ2 A;  1IOU A;  5F6A A;  3OC2 A;  1V9Z A;  1TF1 A;  4GS9 A;  3LI8 A;  1ODV A;  2HJ9 C;  1OT6 A;  3C38 A;  4KQD A;  2JN7 A;  1LSX A;  2B18 A;  2XA7 M;  2P08 A;  2K31 A;  1G6O A;  3CWF A;  3PYP A;  4LLO B;  4H6J B;  4Y2F A;  1YSQ A;  3MMH A;  2P04 A;  5J4E A;  5MC7 A;  4G3K A;  4HY8 A;  3C30 A;  4DMZ A;  4L9G A;  5J7E A;  1TS8 A;  3EQU A;  1N9O A;  1ZHH B;  3EWK A;  5AJG A;  4ARZ A;  2PHY A;  2V1A A;  4CLC E;  4WEK A;  2XRN A;  3KYZ A;  4NXF A;  4WL9 A;  3E4P A;  3H7W A;  4QPR A;  4HH2 A;  1OJG A;  4OOM A;  1TS7 A;  4WF0 A;  5HDD A;  4L9F A;  2L0W A;  4JGO A;  3LIB A;  3PBR A;  3VE3 A;  2MJ6 A;  3LR5 A;  3W2Z A;  4K08 A;  5J3W A;  4WLA A;  5F69 A;  3BQ8 A;  3K2N A;  3TE8 A;  5HPF A;  3UB6 A;  2XA7 S;  3KSF A;  3MF0 A;  2O9C A;  1LL8 A;  3PBT A;  2VA0 A;  2R78 A;  2A24 A;  2VV7 A;  3TW8 A;  3IS2 A;  1DP6 A;  3RH8 B;  2Z6D A;  2W3H A;  4HIA A;  2V0U A;  3E4O A;  2VZW A;  2EA9 A;  3LYX A;  3LFV A;  1WA9 A;  3S7O A;  3NOP C;  3CUE A;  3S7N A;  5DJT A;  1DP9 A;  3LR4 A;  4LRX C;  1OTB A;  4EES A;  3OCN A;  4EET B;  3HJK A;  3LIF A;  4WEL A;  2VGL M;  1H8M A;  3BJN A;  2O9B A;  1OTE A;  3EOI A;  3LI9 A;  4BBV A;  4LRZ E;  3CAX A;  2GZA A;  2WKR A;  1S4S A;  4GS9 B;  1OTI A;  5HWW A;  3UE6 A;  5KIZ A;  2Y79 A;  5DF9 A;  4IUH A;  1TS6 A;  2NUP C;  4GHI B;  2Y8H A;  5F5Y A;  1MZU A;  3UMD A;  2VJW A;  5DKL A;  4UQI M;  2WKP A;  3B47 A;  2PR6 A;  3F1N A;  1NLY A;  3GEC A;  1YSP A;  3KSI A;  3F1N B;  3OLO A;  2PR5 A;  1BYW A;  2HV1 A;  3RTY A;  2KOI A;  3R7W B;  2B02 A;  4EU0 A;  2H28 A;  3PHY A;  1S1Y A;  3D72 A;  4I3J A;  3F1P B;  5HDS A;  1VB6 A;  4EXO A;  1X0O A;  3LID A;  4GJ4 A;  4XT2 B;  1N9L A;  2W0N A;  2JHE A;  2JKT M;  2QWS A;  3JVV A;  2YKF A;  2VV8 A;  1F5M A;  1STZ A;  3VV4 A;  1ZTU A;  2HF6 A;  3KO6 A;  2KLI A;  4HHD A;  4ME4 A;  5A8B A;  4PHT A;  3MQ0 A;  2HGV A;  5DFX A;  2IA2 A;  5TBM A;  3MQO A;  2ZMF A;  3MQQ A;  1OTD A;  4BBU A;  4I3I A;  3MXQ A;  3K3C A;  3DBA A;  4MCW A;  1S67 L;  3A0V A;  2M7U A;  1NWZ A;  5C5K A;  1XJ6 A;  2ZMV A;  4R70 A;  4EER A;  2M7V A;  2VV6 A;  1T1C A;  3GDI A;  4FOF A;  2W1T B;  3HCY A;  4BWI A;  3G6O A;  3OCL A;  3ZQ5 A;  4WEJ A;  2LB9 A;  4HP9 A;  2NUT C;  2J3T D;  4O8G A;  3EGD C;  3PXP A;  2GNX A;  5TJJ A;  3EEH A;  3U2A A;  4Z1W A;  1DRM A;  4EQ1 A;  2W1R A;  5LBR A;  2W3E A;  3MFX A;  3CIT A;  4DJ2 A;  5IT5 A;  3FC7 A;  3LIE A;  2I9V A;  3PR6 A;  4B93 A;  1LT0 A;  2O99 A;  4JGP A;  4P6Z S;  4FSF A;  4HQA A;  4EW7 A;  3OBF A;  4HJ6 A;  4IHQ A;  3A0R A;  3F1P A;  2JKR M;  4BBT A;  3T4S A;  4AFI A;  1UWP X;  5IU1 A;  2ZOI A;  2VEA A;  1N9N A;  3NHQ A;  3H7W B;  2G7U A;  3PBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...