1S66L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords Hypothetical protein yddU
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s66L00
1OJ5A 5TBMB 1XFNA 3CWFA 3IBRA 3D72A 2P7JA 3PYPA 4GCZA 3A0RA 4M4XA 3CLOA 4LRXC 2QWSA 1TS0A 1XJ3A 3E4QA 1XJ6A 3BY8A 1XJ4A 2QHKA 2QJ7A 3LICA 4F3LA 1BYWA 2QJ5A 3H7WA 5HWWA 5F68A 5F69A 2QKPA 4JGQA 3F1NB 1ODVA 3LIFA 1DP8A 5J7EA 3MQQA 1OTAA 3ULFA 2ZOIA 4DJ3A 3VOLA 4GHIB 4H6JB 4HP9A 4XT2B 4JGPA 1T1AA 2EA9A 3UB9A 2INWA 3ICYA 3NOTC 2D01A 4HP4A 3FG8A 4EEPA 1LSXA 4I3IA 4I3JA 3OLOA 1G28A 3E4OA 3F1OA 4BBTA 3IS2B 1GSWA 1S67L 2J80A 2GJ3A 4HJ4A 5HZHA 4JGRA 2Z6DA 4WLAA 5HDCA 2YKHA 3UB8A 4HJ6A 3NOPC 5HDSA 1P97A 5G4ZA 1LT0A 3MQOA 4HI4A 4HY8A 4HJ3A 2VEAA 5J3WA 3LI8A 2L0WA 1T1BA 3HJKA 5DKLA 5HWVA 5J4EA 3RTYA 4LPZA 5HD3A 4WN5A 2PR5A 4HHDA 4L9GA 2ZBBA 1KOUA 3NJAA 4GW9A 2PD8A 3T50A 3SW1A 2L1MA 4LRZE 5AVFA 2D02A 3F1PA 4KUOA 4R70A 2HV1A 2VV6A 2L4RA 3RH8B 1N9OA 2OOLA 3UE6A 3FC7A 4WL9A 1T18A 1OJGA 4YWZA 1DP6A 3KX0X 1UWNX 3LUQA 3F1NA 5KIZA 2WKPA 1F9IA 1JNUA 4NXEA 5HD5A 4B9OA 3K3CA 1NWZA 1DRMA 3MFXA 1UGUA 4HOIA 1MZUA 3GECA 4HQAA 2V1AA 4I38A 5DJTA 2V1BA 2VV8A 2PYRA 5HDDA 2OWJA 3C2WA 4LRYC 4F3LB 2JN7A 3CAXA 3H7WB 4L9EA 1S4SA 3H9WA 1LSVA 1OTDA 5AVEA 1N9NA 3K3DA 4MN5A 3GDIA 4K08A 1S1YA 4R3AA 5EFWA 1OTEA 2A24A 2W0NA 3H82B 4EESA 4PKYA 2W27A 3E4PA 4I3AA 2PHYA 3LIEA 4EERA 1F98A 1X0OA 1T1CA 3F1OB 3A0VA 3NHQA 5TBMA 4R6LA 4DJ2A 2PDRA 3C8CA 3B33A 5A8BA 5F6AA 1XFQA 1OTBA 2WKRA 3MXQA 3VE4A 4NXBA 1LSWA 4MN6A 4HH3A 3P7NA 3HJIA 1TS7A 5IU1A 2R78A 2V0UA 4NXGA 4GS9B 4EETB 3ZQ5A 2KX6A 4HH2A 4BBUA 4EEUA 5DKKA 4PKYG 3PHYA 1S66L 1GSXA 4KQDA 1N9LA 4WF0A 2PD7A 3UMEA 3F1PB 2OWHA 3VE3A 2WKQA 1D7EA 3LYXA 2JHEA 2KDKA 4JGOA 5F5YA 4GHIA 1OT9A 4H6JA 3LIBA 4XT2A 1P0ZA 3BWLA 3UMDA 4I39A 2VV7A 5IS1A 2K7SA 1D06A 1V9ZA 1Y28A 3A0SA 4HNBA 3MJQA 1OTIA 5HWTA 4R38A 4EW7A 1EW0A 2B02A 3IS2A 2PYPA 4E04A 1VB6A 3H82A 1UWPX 5HSQA 4NXFA 3LI9A 5I5LA 4KUKA 3LIDA 2Z6CA 2V0WA 4L9FA 1GSVA 2PR6A 1V9YA 4HIAA 2H28A 4BBVA 2VLGA 1DP9A 4I5SA 5G4YA 3UB6A 4EXOA 4EQ1A 1LL8A 3EEHA 2M1CA 2A24B 4RQ9A 1TS6A 5DJUA 3G6OA 3LIAA 1S1ZA 2BASA 3BY9A 1T19A 1OT6A 2CMNA 1WA9A 3EWKA 4GS9A 4LLOB 1TS8A 2YKFA 1S4RA 1XJ2A 3NOUC 2V9AA 3MR0A 2I9VA 3UB7A 2ZOHA 4WUJA
chains in the Genus database with same CATH superfamily
1IYQA 2W1TB 3BFFA 2VX8A 3LCEA 3R7WB 3D72A 5HFOA 1PWDA 4M4XA 2VZWA 3TSGA 5GHXA 3G4PA 1GHIA 2P74A 4DE2A 1IKGA 4QB8A 3E4QA 3G32A 3MBZA 2XROA 3OPRA 2QPNA 4ZRRA 3BY8A 1PZOA 2XFSA 1EI5A 3KSIA 4UHUA 3LICA 1BYWA 5AQ7A 5F68A 3NC8A 2ZMVA 1EROA 3D3OA 2X71A 1ODVA 2ZC4B 2WGWA 3EQUA 5JYOA 3NIAA 5F1FA 3MQQA 3S7OA 1VETA 3JPUA 4OLGA 2BTFP 1DJBA 4Z9QA 3HUOA 4EV4A 4H6JB 4JGPA 4NKPA 4OQGA 3A3IA 3ZVWA 2Y2JA 1TD5A 3IXHA 1KE4A 4YINA 2D01A 4S2OA 4EU0A 5F83A 1NYYA 4Y3IA 1LSXA 3LR0A 4G3VA 1WE4A 3BM6A 4KZBA 5E2FA 3F1OA 1ACFA 2J80A 1S67L 2GJ3A 1O07A 4F94A 5FAQA 5EVLA 5HZHA 4K91A 3PR6A 5HDCA 3NOPC 4P87A 2V1ZA 1L3LA 3OBFA 1LT0A 4JXSA 3IX8A 2XGNA 4DDYA 3BQ8A 3BFCA 5CXWA 4HJ3A 1NZUA 2VEAA 2L0WA 5E2EA 5FQKA 2HDRA 1LL9A 4C75A 2GZAA 5FI6A 2PR5A 1BULA 4PM5A 1N4OA 2LB9A 3NJAA 4GW9A 2XFTA 1JWPA 1IFQA 5AVFA 4R1GA 2HV1A 3ITBA 1YM1A 3LO7A 5FQQA 1MY8A 2FFFB 4RYEA 1N9OA 3SH9A 5CEBA 2EFXA 4NG2A 2XDMA 1T18A 1OJGA 3LR4A 1SCWA 1G6OA 1ERMA 3EQVA 1DP6A 4R0QA 3OPLA 3ZG9B 2A2LA 3VP4A 4K0WA 3PTEA 4RX2A 2EX8A 5HD5A 1HZOA 2WGIA 3K3CA 5CEDA 3FV7A 2WGVA 4OPQA 3CJMA 2Y79A 1JWVA 1DRMA 3MFXA 4X53A 4MBHA 1PZPA 3C38A 4GKUA 4DDSA 5DJTA 5DTSA 2V1BA 5HDDA 5HW3A 4F3LB 1CK3A 3NCKA 2B18A 4KQRA 3WS2A 4L9EA 1S4SA 2H0YA 3H9WA 2Y2HA 5CHJA 2Q0OA 4ETXA 5AVEA 1N9NA 2ZC3B 1FILA 4MN5A 1RCJA 5AJGA 3HLDA 4R3AA 5EFWA 1K54C 1OTEA 2X02A 2A24A 3V3RA 3ISGA 3KO6A 4JKTA 2W27A 2O99A 1H3QA 2EWWA 1BTLA 1I5QA 3T12B 3D9YA 5IHVA 5L09A 1SKOA 2Y2NA 4EERA 2PRFA 2DRWA 1MKMA 1G6AA 1YSQA 1O7EA 2W1TA 3NHQA 1KE3A 3E0YA 2BG1A 5A8BA 4BWIA 4IVKA 3B47A 2Y4AA 2WKRA 4P6ZM 4PPRA 3T1XA 3MXQA 2Y55A 4X6TA 4YNRA 4II7A 5J8XA 1F5MA 1GHPA 1MXOA 5IU1A 4UA6A 1AXBA 3SS5A 2XR0A 5CTMA 2JCHA 5HPFA 3ZHHA 4E3IA 4S2MA 1IELA 4IJGA 1VM1A 3PHYA 1S66L 1N9LA 3HLFA 3W4QA 1H8ZA 1FR1A 5KZHA 4KZ8A 3UMEA 1ZTUA 2ZM8A 3T1SA 1OPXA 2VGLM 3LYXA 2JE5A 4Y13A 1W63Q 2ZD8A 1PYYA 3P98A 5M1AA 1H0MA 4H6JA 3LIBA 3IH8A 4KG6A 5KSCA 5U47A 1CJFA 4I39A 2K7SA 2QMIA 1Y28A 2WZXA 1TF1A 4R4RA 1OTIA 3IX4A 2WZZA 4FH4A 4N92A 3UDFA 2B02A 3UDXA 2WGWB 1K25A 3TJZC 4EBNA 4EWFA 2ZQ8A 1JWZA 2XD1A 3FYZA 5HSQA 4NXFA 2Y59A 4E3JA 5A90A 4ETZA 2XD5A 2JKRI 1BT5A 2XQZA 3N8SA 3HREA 3T4SA 3MKEA 3ZG0A 4YOFA 4GD6A 4IBRA 1YLTA 1H5XA 4KZ5A 3SZTA 2J3TD 2KLIA 5EE8A 2H10A 5HL6A 2H28A 4BBVA 4ZJ1A 1DP9A 4I5SA 3O86A 3FPVA 3JVVA 4EQ1A 3OCLA 2M1CA 5DJUA 3N6IA 4Q8IA 2BASA 2VK3A 3MF0A 4ESPA 4MN7A 2CMNA 4HBUA 4GS9A 3OC2A 4GOGA 1NXYA 1TS8A 2YKFA 3IWIA 1KDSA 1S4RA 4OQ0A 3B3XA 4LV3A 2ZC7A 1OJ5A 1XFNA 4FOFA 5DF7A 1YLPA 3HBRA 5GLDA 3Q1FA 3U4LP 2IA2A 4QJGA 3VFFA 5CGWA 4WYYA 2RL3A 4JBFA 3PYPA 4GCZA 4RVAA 2VA0A 3LGOA 4GDNA 3CLOA 4Z1WA 4LRXC 2QWSA 1XJ3A 3IX3A 2OV5A 5EUAA 2J8YA 3HUMA 3Q7ZA 2QJ7A 4F3LA 3PXPA 2ACGA 5HWWA 3R4KA 2I72A 2Y8HA 2Y2OA 1K38A 1YMSA 2QKPA 1PIOA 3O87A 5FQ9A 3OZHA 3HLEA 5AQAA 4KG2A 3LIFA 1W5DA 3T1QB 3C4PA 3U2AA 1YLZA 2C5WB 2NUPC 1E3UD 3Q7VB 2ZOIA 1NLYA 5A92A 4DXBA 4PHTA 2HZ5A 4HP9A 4XT2B 2EA9A 3UB9A 1PFLA 3MSHA 3ICYA 3NOTC 5A93A 3A3FA 3IF5A 1MWUA 4IEDA 4EEPA 5EECA 2OAQ1 2OLUA 2WKEA 2O0YA 5HX9A 5D3OA 1Y54A 3OLOA 1FCMA 2OAP1 3IS2B 5FL3A 1GSWA 4EUZA 1JVJA 3A3EA 1K54A 2PU4A 4CQHA 2DMWA 4HJ4A 3BLMA 3TE8A 4WLAA 3LR5A 4C3QA 3G2ZA 2HJEA 1NLZA 3I7JA 4OOYA 4B93A 5G4ZA 4U0XA 4HI4A 1OMEA 4LGWA 5J3WA 5DKLA 5HWVA 1E3UA 4WN5A 4RA7A 2PBYA 4L9GA 3CITA 2ZMAA 3ZFZA 3VP3A 4R23A 5L2FA 1K4FA 3W4OA 2PD8A 1IKIA 3ZVTA 3PAGA 1YLYA 2L1MA 3OPHA 5L10A 4A5RA 5CGSA 2W1RA 2E8JA 4NETA 4UQIS 2PU2A 4ZAMA 3RH8B 4GLQA 4KENB 4HEFA 4WL9A 3QP8A 4P6BA 1BLSA 3V50A 2OLVA 1UWNX 3F1NA 2JKTI 3C4OA 1KVMA 1RGZA 4R3JA 1LI0A 3VSLA 3QP1A 1F9IA 3E2LA 5EPHA 4DRTA 4NXEA 4WZ5C 4O0PA 5I94A 1BLHA 5DF9A 5FEGA 5C5KA 3VFHA 2J9PA 1MZUA 2JC7A 1NYMA 2VV8A 2PYRA 4Y2FA 3Q82A 1RGYA 3LFVA 3VP2A 1ZHHB 4U3TA 2JKRM 3PBNA 3LR3A 3HLWA 2M7UA 5FDHA 4IHQA 3BFGA 5EM1A 2XRNA 4X69A 1PW8A 2HDSA 1KDWA 4S2NA 3MZFA 4YFMA 4ZDXA 2V8CA 2XA7S 4ZJ2A 1BLPA 1PW1A 3CHWP 3RXWA 5A91A 5FSRA 5KMWA 2W0NA 4EESA 1IYPA 4X68A 1KE0A 3BRMA 3ZYTA 4KZ4A 2XF3A 2Q9NA 3O3VA 3UB5P 5E2HA 2IWCA 4S2LA 2PHYA 3Q07A 1VQQA 3LY3A 2FH5A 3GV9A 3LIEA 2WKHA 4L0LA 4FUWA 3MZDA 4RX3A 1T1CA 4Y0UA 1BLCA 3A0VA 3N8RA 2PDRA 3EGXC 3B33A 5F6AA 4CLCE 1K57C 1XFQA 2HPBA 1KVLA 4JF5A 1BZAA 2QZ6A 3ITAA 5AQBA 4NXBA 1ES5A 3Q81A 2HP9A 3IHBA 3HJIA 1TS7A 4GS9B 2M7VA 4EETB 2P08A 2KX6A 3T4JA 1ZG6A 1LI9A 3HUNA 4MCWA 4O7DA 4EEUA 3QNBA 2XEPA 3VP0A 3MXRA 3BECA 4PKYG 5FEFA 4K0XA 3OCNA 5HAPA 1CI9A 2EX6A 3PBRA 4O8GA 1FOFA 2NUTC 2OWHA 3C5AA 3VE3A 1CI8A 2K2NA 3GMWA 4Y0OA 2EX2A 2WKQA 1D7EA 2Z2MB 3Q7VA 2KDKA 5CHUA 2XH9A 1FIKA 1FSYA 1HTZA 1OT9A 2Y2KA 4B88A 1GHMA 4XT2A 1P0ZA 5LBRA 3QP4A 4JXVA 1XKZA 3UMDA 2VV7A 3HLBA 5K5BA 3A0SA 3G34A 3N4IA 2Y2PA 4QPRA 5HWTA 1S0WA 1ZC2A 1Q2QA 5E43A 1YMXA 4EW7A 4N9KA 4BL2A 2G2WA 4GN2A 5GLAA 3IS2A 2PYPA 3G30A 2ZQ7A 1VB6A 2V20A 1MKIA 2HP6A 3DTEA 3H82A 1MC0A 3AGEA 1UWPX 2J7VA 2VJWA 5HL1A 4KQQA 5CGXA 4MLLA 3PAEA 2V0WA 5FASA 1MWRA 5FI7A 5MC7A 2WUQA 3IXBA 3W4PA 4IBXA 1XA7A 4PM6A 3S7QA 1YQSA 1QMFA 4QWOA 5G4YA 4LCLA 1ESIA 3IWOA 4RQ9A 2WKIA 2HGVA 3CUEC 1S1ZA 3M6BA 3CMZA 1XGIA 4ZTKA 3BY9A 3VSKA 4LLOB 3TRCA 3NOUC 2I9VA 1TDGA 3UB7A 3WWXA 2W3EA 4X55A 4CLCC 3T4TA 3SH7A 4OQHA 3ZNYA 3CWFA 3GTCA 5F1GA 3IBRA 5TGFA 3V39A 2EWVA 3NECA 2Y2IA 4OPYA 3PBQA 3EOIA 4GDBA 2JKTM 4E3LA 4DN0A 3FKWA 4MNRA 2P9VB 1ONGA 4MMNA 2B5RA 4OOLA 4DE1A 4PM8A 1TS0A 1YLWA 2PBDP 1XJ6A 3NY4A 4LV2A 1CEGA 1XJ4A 4KG5A 3MMHA 3V3SA 4DKIA 2FZ0A 4FH2A 3F1NB 4BJPA 1DP8A 4WZ5A 5EV0A 5FA7A 2ZM2A 3DAVA 4BLMA 3ULFA 2XSSA 1GA9A 4X25A 3VOLA 3SOIA 1AWIA 2OSUA 2H5SA 4UA9A 1W63M 3D4FA 3UO9A 1T1AA 3V67A 1PRQA 3AGFA 1VEUA 1XA1A 3FKVA 2INWA 2AVXA 3IF6C 1SDNA 2ZQ9A 1K0KA 4HP4A 1ZG4A 4P85A 3FG8A 1LL5A 1M40A 3UDIA 5EOOA 3M6HA 4DF6A 4OPRA 1MWSA 3KSGA 1G28A 5FQMA 4BBTA 2GNXA 1NZOA 1Z6FA 3WRZA 4DE0A 1L2SA 1L0GA 2ZLYA 3M2JA 3UB8A 1IOUA 5GHZA 2V8FA 5HDSA 2ZQDA 1P97A 3BLSA 1ES3A 4FTXA 4HY8A 1ESUA 4PM9A 3SS4A 1JTDA 1K6RA 3LI8A 1T1BA 4UEYA 4X56A 4E3KA 5HD3A 1G5UA 4P6ZS 1KGEA 1ES2A 4HHDA 3W8KA 2ZBBA 1KOUA 4WEKA 2O9AA 4WELA 4GNUA 3ZG8B 1K57A 4N1HA 3SW1A 5EVIC 5FAPA 3TW8A 4LRZE 4G3WA 2P04A 4KUOA 1K4EA 4QHCA 4R70A 3NI9A 2VV6A 2ZL1B 5EVEA 5M18A 2V2FF 4JXWA 3KYEA 3GSGA 4KZ6A 1NJ4A 3GRJA 1H8MA 4DE3A 2OOLA 3UE6A 3UPPA 3DTKA 4EUVA 2XLNA 3LUQA 5KIZA 3IXGA 2VGLS 2WYXA 2WKPA 3DWZA 4G3KA 5GL9A 3JYIA 2J9OA 4E3NA 4JLFA 4P0MA 3G2YA 4FCFA 1BUEA 3CZDA 5FATA 1UGUA 3GECA 4HQAA 2V1AA 1FCNA 1TVFA 5DTTA 1YPRA 2VKSA 1F2KA 2JN7A 3CAXA 3H7WB 4MBKA 5DVAA 4DMZA 1LSVA 5EM0A 3L7HA 3UNWA 4JF6A 3K3DA 3GDIA 2KOIA 3NDEA 4GJ4A 3UN7A 2E8IA 4CLCD 3H82B 3ZGAB 1YAXA 3FZCA 4PKYA 3O88A 4BENA 3E4PA 1H8YA 4S2PA 4I3AA 2WAEA 2ZC6B 4OQIA 4Y0TA 3UE1A 5CHMA 1F98A 3WS5A 1FCOA 3BYDA 4GB7A 4B4XA 3TOIA 4BD1A 4H8RA 1X0OA 4OPZA 2R9XA 3ZDJA 4DJ2A 3C8CA 5M19A 4JPMA 3IWQA 4XUZA 3VOYA 1YSPA 4LENA 3HVFA 4OP8A 3CUEA 3VE4A 2A49A 1M6KA 4OH0A 1LSWA 3BW6A 1SZVA 4MN6A 1P9WA 3T1RA 3P7NA 1KGGA 2VGKA 2P9VA 4NXGA 5IT5A 5FQJA 3S7PA 4MBFA 1K6SA 1PI5A 3L9KA 3M2KA 4CLCA 4LCMA 4BQMA 4PMAA 5DKKA 1CF0A 1CEFA 4M3KA 4KZ9A 1GSXA 2EFUA 2JKGA 4WF0A 3DTMA 4HBTA 3HLGA 1LLBA 3F1PB 1J3WA 4Y7PA 2JHEA 3WS1A 4FD8A 3KYQA 2PT7A 5F5YA 4QY5A 3DTIA 3RXXA 3KSHA 1K56D 5CRFA 2B95A 3PBOA 1D1JA 3NULA 4AFIA 3BWLA 1A0KA 1FSWA 4QU3A 5FQIA 4E3OA 1D06A 1V9ZA 3OOVA 2O9CA 3EGDC 4HNBA 3MJQA 4Y15A 3S22A 4EQIA 3ZNTA 3FWLA 3E98A 1EW0A 2K31A 5L8MA 2DNSA 2IWDA 2JBFA 4E04A 3BEBA 3DWKA 1NRJA 2G2UA 1HD8A 3LI9A 2A3UA 3WRTA 3LIDA 2Z6CA 2GX5A 1K55C 1VEUB 3OPPA 3IF6A 2WAFA 1TEMA 4L9FA 3C7UA 1GSVA 5EVID 3HL9A 4JF4A 4MEZA 3V5MA 1QMEA 1J9MA 3VV4A 1V9YA 1Z09A 2WK0A 4OVDA 3A3JA 1K56A 3UB6A 4UAAA 3MKFA 1LL8A 5HAQA 1HVBA 3EEHA 1FR6A 4Q0HA 2Y2MA 3LIAA 3JVUA 3TG9A 3BFDA 4ARZB 2W3FA 2DCFA 1OT6A 1WA9A 3KSFA 2ZL1A 4LV0A 3BQAA 3B42A 2V9AA 3MR0A 1W79A 2ZOHA 1YLJA 4WUJA 5TFQA 4ZBEA 5DFYA 1SDEA 5TBMB 5TR7A 1W7FA 3C7VA 1L0FA 2WADA 3P01A 2J3TC 2G7UA 2JKFA 3IQAA 2Y2GA 5EVIA 2P7JA 3HCYA 5GLBA 3N7WA 5CECA 3A0RA 4B4ZA 3IBJA 5DFXA 1MWTA 3ZG7B 3QHYA 5FDSA 2QHKA 1XGJA 2QJ5A 2W3DA 3H7WA 5F69A 4JGQA 1W8QA 3ZG5A 3LY4A 2UV0E 2ZC5B 4E6WA 4NK3A 2Y91A 1PNEA 3G31A 5J7EA 1OTAA 4LFUA 1YT4A 2CC1A 5HPIA 4DJ3A 2O9BA 3CI6A 2HP5A 4GHIB 4X1MA 4E6XA 4FSFA 1E4DA 2QYBA 2X01A 2EXAA 4JXGA 2LB5A 3CPTA 5KSHA 1PI4A 4I3IA 4I3JA 4XXRA 3E4OA 3UY6A 1N9BA 5L07A 4QD4A 1G68A 3AGDA 5DTKA 2EXBA 3GVBA 5E2GA 1PWGA 1IEMA 4JGRA 2Z6DA 4NEED 2YKHA 2IWBA 1NRFA 4HJ6A 1Y4OA 4BL3A 4KZ3A 4GZBA 3MQOA 3BFEA 3UPNA 3QP2A 4KZAA 4Y17A 1BSGA 1GCEA 3HLCA 1PWCA 3HJKA 1ALQA 5J4EA 3RTYA 4LPZA 3MS6A 2J3WA 5GHYA 3FPWA 4O01A 4IUKA 2XK1A 3UPOA 3R7WA 3T50A 1C3BA 3UE0A 5AQ9A 3K2NA 1IYSA 3WS0A 3E2KA 2D02A 4EBPA 3F1PA 4KQOA 4OP5A 3G35A 2HF6A 3NDGA 3MQ0A 3LEQA 4WM9A 1Q2PA 2L4RA 3SH8A 3QNCA 2GDNA 3FC7A 4YWZA 3CG5A 4Q0IA 4CLCB 2MJ6A 3PBTA 1W8YA 1MBLA 1KGFA 3KX0X 1XP4A 4CJNA 5HAIA 1DY6A 1EWZA 3LEZA 1JNUA 4B9OA 1XX2A 4BMWA 4MDZA 5HARA 1NWZA 3RJUA 3O5YA 4HOIA 3SS3A 4S2IA 4I38A 3EEAA 3DW0A 1HLUP 1LHYA 1GA0A 2HJ9C 3IH9A 1DJCA 2OWJA 3C2WA 3KYZA 4LRYC 3A3DA 4WZ4A 1WYCA 1YKDA 1OTDA 2Y2QA 4E3MA 1ZKJA 4S2NC 5CX7A 1S6RA 1WYBA 4K08A 3GR2A 4ZJ3A 1VETB 1S1YA 3NBLA 1E25A 4U0TA 1VHMA 1L0DA 1ES4A 1JTGA 4LV1A 1NY0A 4ARZA 1SHVA 1K55A 4ME4A 4XUXA 2ZMFA 3T4QA 3IF6B 4ID4A 4R4SA 2ZQCA 5F82A 1RP5A 2H0TA 3IT9A 3F1OB 4IUHA 5TBMA 4R6LA 4CPKA 3BJNA 1OTBA 2Y2LA 3WS4A 4D60A 1FQGA 1XXMA 3VMAA 4Y5FA 4WBGA 4HH3A 4DXCA 4N1XA 2R78A 2V0UA 1CQAA 2EX9A 4GD8A 3ZQ5A 2PAVP 4HH2A 4BBUA 3VP1A 4D2OA 1I2SA 2W3GA 3MFDA 4UQIM 1L0EA 4X1LA 2ZJ9A 2ZM0A 4OKPA 4OOMA 1U60A 4KQDA 1ONHA 2FFYA 5FAOA 5DF8A 3QP6A 2PD7A 5EVIB 2ZQAA 5G18A 5TJJA 4OLDA 1MPLA 4JGOA 4WEJA 1SKFA 4GHIA 3DBAA 1TDLA 4QY6A 3T4KA 3IXDA 5BOHA 2W3HA 4R3BA 4BD0A 3T4OA 3P09A 5IS1A 4S2KA 1I2WA 5GLCA 1DJAA 2HDQA 1P9RA 4R38A 3IHAA 4C6YA 1XPBA 1STZA 3PBSA 4WMCD 2RCXA 5I5LA 1IYOA 4Q0JA 3ZCZA 4KUKA 2XA7M 2Z2LB 3VOZA 4UA7A 3MZEA 4HESA 2C6WB 2PR6A 5EOEA 2HDUA 5JYPA 5CTNA 3S1YA 4EBLA 3T4LA 4HIAA 3CPTB 3MXSA 4IVIA 4PM7A 4N9LA 5FI2A 1ERQA 2VLGA 3S7NA 2Q9MA 3C30A 4EXOA 4S2JA 4OONA 2R9WA 2A24B 1TS6A 3GQZA 4PAUA 3N8LA 3G6OA 2UWXA 5CERA 3UE3A 3QP5A 2BLSA 3RFBA 3S4XA 1T19A 2VGJA 4KZ7A 3EWKA 1SKOB 3W2ZA 1XJ2A 4WMCA
chains in the Genus database with same CATH topology
2W3EA 5DFYA 4CLCC 2W1TB 1OJ5A 5TBMB 1XFNA 4FOFA 3T4TA 2VX8A 2IA2A 3CWFA 3P01A 2J3TC 2G7UA 3IBRA 2EWVA 3R7WB 3D72A 2P7JA 3HCYA 3PYPA 4GCZA 3PBQA 3EOIA 2VA0A 3A0RA 2JKTM 4M4XA 2VZWA 4DN0A 3CLOA 3IBJA 4MMNA 4Z1WA 5DFXA 4OOLA 4LRXC 2QWSA 1TS0A 1XJ3A 3E4QA 1XJ6A 2XROA 4ZRRA 3BY8A 3KSIA 1XJ4A 2QHKA 2QJ7A 3LICA 3PXPA 4F3LA 3MMHA 1BYWA 2QJ5A 2W3DA 3H7WA 5HWWA 3R4KA 5F68A 5F69A 2Y8HA 2ZMVA 2QKPA 4JGQA 2FZ0A 3F1NB 3D3OA 1ODVA 3LIFA 4BJPA 3U2AA 1DP8A 3EQUA 5J7EA 2NUPC 3MQQA 1OTAA 3ULFA 3S7OA 5HPIA 2ZOIA 2XSSA 4DJ3A 2O9BA 3CI6A 1NLYA 3VOLA 4GHIB 4PHTA 4FSFA 1W63M 4H6JB 4HP9A 4XT2B 4JGPA 1T1AA 3V67A 2EA9A 4NKPA 3UB9A 2INWA 1TD5A 3ICYA 2QYBA 3NOTC 2D01A 4HP4A 4EU0A 2LB5A 3FG8A 4Y3IA 4EEPA 5KSHA 2OAQ1 1LSXA 3LR0A 4G3VA 4I3IA 2O0YA 3KSGA 4I3JA 3OLOA 1G28A 3E4OA 3F1OA 4BBTA 2OAP1 2GNXA 3IS2B 5FL3A 1GSWA 1S67L 2J80A 2GJ3A 4CQHA 2DMWA 4HJ4A 5HZHA 3PR6A 4JGRA 2Z6DA 3TE8A 4WLAA 4NEED 3LR5A 2YKHA 5HDCA 3UB8A 1IOUA 4HJ6A 2HJEA 1NLZA 3NOPC 5HDSA 1P97A 3OBFA 4B93A 5G4ZA 1LT0A 3MQOA 4HI4A 3BQ8A 4HY8A 4HJ3A 2VEAA 5J3WA 3LI8A 2L0WA 1T1BA 3HJKA 4UEYA 5DKLA 5HWVA 5J4EA 3RTYA 4LPZA 5HD3A 4WN5A 2GZAA 4P6ZS 2PR5A 2J3WA 4HHDA 3FPWA 4L9GA 4O01A 2ZBBA 3CITA 1KOUA 4WEKA 2O9AA 2LB9A 4IUKA 3NJAA 4WELA 4GW9A 2PD8A 3R7WA 3T50A 3K2NA 3SW1A 2L1MA 3TW8A 1IFQA 4LRZE 4G3WA 2P04A 5AVFA 2D02A 2W1RA 3F1PA 4KUOA 4KQOA 4R70A 2HV1A 2VV6A 2HF6A 3MQ0A 4UQIS 2L4RA 1H8MA 3RH8B 4GLQA 1N9OA 2OOLA 3UE6A 3FC7A 4WL9A 1T18A 1OJGA 3LR4A 4Q0IA 4YWZA 1G6OA 3EQVA 1DP6A 4CLCB 2MJ6A 3PBTA 4EUVA 3KX0X 1UWNX 3LUQA 3F1NA 2A2LA 2JKTI 5KIZA 2VGLS 2WKPA 1F9IA 4G3KA 1JNUA 4NXEA 5HD5A 4B9OA 4O0PA 3K3CA 4BMWA 5DF9A 4MDZA 5C5KA 2Y79A 1NWZA 1DRMA 3MFXA 3O5YA 1UGUA 4HOIA 1MZUA 3GECA 4HQAA 3C38A 2V1AA 4I38A 3EEAA 5DJTA 2V1BA 2VKSA 2VV8A 2PYRA 5HDDA 4Y2FA 2HJ9C 2OWJA 3KYZA 3C2WA 3LFVA 4LRYC 4F3LB 2JN7A 3CAXA 2B18A 3H7WB 1ZHHB 2JKRM 3PBNA 3LR3A 1YKDA 4L9EA 1S4SA 3H9WA 2M7UA 4IHQA 4DMZA 1LSVA 1OTDA 2XRNA 4ETXA 5AVEA 5CX7A 1N9NA 3K3DA 4MN5A 5AJGA 3GDIA 4K08A 2KOIA 4GJ4A 2XA7S 1S1YA 4R3AA 5EFWA 1VHMA 1OTEA 2A24A 4CLCD 2W0NA 3H82B 4EESA 3KO6A 1YAXA 4ARZA 3ZYTA 4PKYA 2W27A 2O99A 1H3QA 2EWWA 3E4PA 4ME4A 4I3AA 2ZMFA 2PHYA 3T4QA 2FH5A 3LIEA 4EERA 1F98A 4L0LA 1MKMA 1X0OA 1YSQA 1T1CA 3F1OB 2W1TA 4IUHA 3A0VA 3NHQA 5TBMA 4R6LA 4DJ2A 2PDRA 3C8CA 3E0YA 3BJNA 3B33A 3EGXC 5A8BA 5F6AA 4BWIA 4CLCE 1XFQA 3B47A 1OTBA 2WKRA 1YSPA 4P6ZM 3CUEA 3MXQA 3VE4A 4NXBA 1LSWA 3BW6A 4YNRA 4II7A 4MN6A 1P9WA 4Y5FA 1F5MA 4HH3A 3P7NA 3HJIA 1TS7A 5IU1A 2R78A 2V0UA 4NXGA 4GS9B 2M7VA 5IT5A 4EETB 2P08A 3ZQ5A 2KX6A 3S7PA 3T4JA 5HPFA 4HH2A 4MCWA 4BBUA 4CLCA 2W3GA 4EEUA 4IJGA 4UQIM 5DKKA 4PKYG 3PHYA 3OCNA 1S66L 4OOMA 1GSXA 4KQDA 1N9LA 4WF0A 3PBRA 2PD7A 4O8GA 3UMEA 3F1PB 1ZTUA 2OWHA 2NUTC 3VE3A 2K2NA 5TJJA 1OPXA 1D7EA 2VGLM 2WKQA 3LYXA 2JHEA 2KDKA 1W63Q 4JGOA 3KYQA 2PT7A 4WEJA 5F5YA 3KSHA 4GHIA 1OT9A 3DBAA 4H6JA 3LIBA 4XT2A 3T4KA 3PBOA 1P0ZA 5LBRA 4AFIA 3BWLA 2W3HA 3UMDA 4I39A 2VV7A 3T4OA 5IS1A 2K7SA 1D06A 1V9ZA 5K5BA 1Y28A 3OOVA 2O9CA 3A0SA 3EGDC 4HNBA 1TF1A 3MJQA 1OTIA 4QPRA 5HWTA 1P9RA 4R38A 3E98A 4EW7A 1EW0A 2B02A 2K31A 5L8MA 3TJZC 1STZA 3IS2A 2PYPA 4E04A 1VB6A 3PBSA 3H82A 1MC0A 1NRJA 1UWPX 5HSQA 4NXFA 2VJWA 3LI9A 5I5LA 4ETZA 4Q0JA 2JKRI 4KUKA 3LIDA 2Z6CA 2XA7M 3T4SA 2GX5A 4YOFA 2V0WA 4L9FA 1GSVA 2PR6A 2J3TD 5MC7A 2KLIA 3T4LA 5HL6A 3VV4A 1V9YA 4HIAA 2H28A 3S7QA 4BBVA 2VLGA 1DP9A 4I5SA 5G4YA 3S7NA 3C30A 3FPVA 3UB6A 3JVVA 4EXOA 4EQ1A 1LL8A 3EEHA 3OCLA 2M1CA 2A24B 4RQ9A 4Q0HA 1TS6A 4PAUA 5DJUA 2HGVA 3G6OA 3LIAA 3JVUA 3UE3A 4ARZB 3CUEC 1S1ZA 2BASA 3RFBA 3MF0A 2W3FA 3BY9A 1T19A 4MN7A 1OT6A 2CMNA 1WA9A 3EWKA 3KSFA 4GS9A 3OC2A 3W2ZA 4LLOB 3TRCA 1TS8A 2YKFA 3BQAA 1S4RA 1XJ2A 3B42A 3NOUC 2V9AA 3MR0A 2I9VA 3UB7A 2ZOHA 4WUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ5 A;  5TBM B;  1XFN A;  3CWF A;  3IBR A;  3D72 A;  2P7J A;  3PYP A;  4GCZ A;  3A0R A;  4M4X A;  3CLO A;  4LRX C;  2QWS A;  1TS0 A;  1XJ3 A;  3E4Q A;  1XJ6 A;  3BY8 A;  1XJ4 A;  2QHK A;  2QJ7 A;  3LIC A;  4F3L A;  1BYW A;  2QJ5 A;  3H7W A;  5HWW A;  5F68 A;  5F69 A;  2QKP A;  4JGQ A;  3F1N B;  1ODV A;  3LIF A;  1DP8 A;  5J7E A;  3MQQ A;  1OTA A;  3ULF A;  2ZOI A;  4DJ3 A;  3VOL A;  4GHI B;  4H6J B;  4HP9 A;  4XT2 B;  4JGP A;  1T1A A;  2EA9 A;  3UB9 A;  2INW A;  3ICY A;  3NOT C;  2D01 A;  4HP4 A;  3FG8 A;  4EEP A;  1LSX A;  4I3I A;  4I3J A;  3OLO A;  1G28 A;  3E4O A;  3F1O A;  4BBT A;  3IS2 B;  1GSW A;  1S67 L;  2J80 A;  2GJ3 A;  4HJ4 A;  5HZH A;  4JGR A;  2Z6D A;  4WLA A;  5HDC A;  2YKH A;  3UB8 A;  4HJ6 A;  3NOP C;  5HDS A;  1P97 A;  5G4Z A;  1LT0 A;  3MQO A;  4HI4 A;  4HY8 A;  4HJ3 A;  2VEA A;  5J3W A;  3LI8 A;  2L0W A;  1T1B A;  3HJK A;  5DKL A;  5HWV A;  5J4E A;  3RTY A;  4LPZ A;  5HD3 A;  4WN5 A;  2PR5 A;  4HHD A;  4L9G A;  2ZBB A;  1KOU A;  3NJA A;  4GW9 A;  2PD8 A;  3T50 A;  3SW1 A;  2L1M A;  4LRZ E;  5AVF A;  2D02 A;  3F1P A;  4KUO A;  4R70 A;  2HV1 A;  2VV6 A;  2L4R A;  3RH8 B;  1N9O A;  2OOL A;  3UE6 A;  3FC7 A;  4WL9 A;  1T18 A;  1OJG A;  4YWZ A;  1DP6 A;  3KX0 X;  1UWN X;  3LUQ A;  3F1N A;  5KIZ A;  2WKP A;  1F9I A;  1JNU A;  4NXE A;  5HD5 A;  4B9O A;  3K3C A;  1NWZ A;  1DRM A;  3MFX A;  1UGU A;  4HOI A;  1MZU A;  3GEC A;  4HQA A;  2V1A A;  4I38 A;  5DJT A;  2V1B A;  2VV8 A;  2PYR A;  5HDD A;  2OWJ A;  3C2W A;  4LRY C;  4F3L B;  2JN7 A;  3CAX A;  3H7W B;  4L9E A;  1S4S A;  3H9W A;  1LSV A;  1OTD A;  5AVE A;  1N9N A;  3K3D A;  4MN5 A;  3GDI A;  4K08 A;  1S1Y A;  4R3A A;  5EFW A;  1OTE A;  2A24 A;  2W0N A;  3H82 B;  4EES A;  4PKY A;  2W27 A;  3E4P A;  4I3A A;  2PHY A;  3LIE A;  4EER A;  1F98 A;  1X0O A;  1T1C A;  3F1O B;  3A0V A;  3NHQ A;  5TBM A;  4R6L A;  4DJ2 A;  2PDR A;  3C8C A;  3B33 A;  5A8B A;  5F6A A;  1XFQ A;  1OTB A;  2WKR A;  3MXQ A;  3VE4 A;  4NXB A;  1LSW A;  4MN6 A;  4HH3 A;  3P7N A;  3HJI A;  1TS7 A;  5IU1 A;  2R78 A;  2V0U A;  4NXG A;  4GS9 B;  4EET B;  3ZQ5 A;  2KX6 A;  4HH2 A;  4BBU A;  4EEU A;  5DKK A;  4PKY G;  3PHY A;  1S66 L;  1GSX A;  4KQD A;  1N9L A;  4WF0 A;  2PD7 A;  3UME A;  3F1P B;  2OWH A;  3VE3 A;  2WKQ A;  1D7E A;  3LYX A;  2JHE A;  2KDK A;  4JGO A;  5F5Y A;  4GHI A;  1OT9 A;  4H6J A;  3LIB A;  4XT2 A;  1P0Z A;  3BWL A;  3UMD A;  4I39 A;  2VV7 A;  5IS1 A;  2K7S A;  1D06 A;  1V9Z A;  1Y28 A;  3A0S A;  4HNB A;  3MJQ A;  1OTI A;  5HWT A;  4R38 A;  4EW7 A;  1EW0 A;  2B02 A;  3IS2 A;  2PYP A;  4E04 A;  1VB6 A;  3H82 A;  1UWP X;  5HSQ A;  4NXF A;  3LI9 A;  5I5L A;  4KUK A;  3LID A;  2Z6C A;  2V0W A;  4L9F A;  1GSV A;  2PR6 A;  1V9Y A;  4HIA A;  2H28 A;  4BBV A;  2VLG A;  1DP9 A;  4I5S A;  5G4Y A;  3UB6 A;  4EXO A;  4EQ1 A;  1LL8 A;  3EEH A;  2M1C A;  2A24 B;  4RQ9 A;  1TS6 A;  5DJU A;  3G6O A;  3LIA A;  1S1Z A;  2BAS A;  3BY9 A;  1T19 A;  1OT6 A;  2CMN A;  1WA9 A;  3EWK A;  4GS9 A;  4LLO B;  1TS8 A;  2YKF A;  1S4R A;  1XJ2 A;  3NOU C;  2V9A A;  3MR0 A;  2I9V A;  3UB7 A;  2ZOH A;  4WUJ A; 
#chains in the Genus database with same CATH topology
 1IYQ A;  2W1T B;  3BFF A;  2VX8 A;  3LCE A;  3R7W B;  3D72 A;  5HFO A;  1PWD A;  4M4X A;  2VZW A;  3TSG A;  5GHX A;  3G4P A;  1GHI A;  2P74 A;  4DE2 A;  1IKG A;  4QB8 A;  3E4Q A;  3G32 A;  3MBZ A;  2XRO A;  3OPR A;  2QPN A;  4ZRR A;  3BY8 A;  1PZO A;  2XFS A;  1EI5 A;  3KSI A;  4UHU A;  3LIC A;  1BYW A;  5AQ7 A;  5F68 A;  3NC8 A;  2ZMV A;  1ERO A;  3D3O A;  2X71 A;  1ODV A;  2ZC4 B;  2WGW A;  3EQU A;  5JYO A;  3NIA A;  5F1F A;  3MQQ A;  3S7O A;  1VET A;  3JPU A;  4OLG A;  2BTF P;  1DJB A;  4Z9Q A;  3HUO A;  4EV4 A;  4H6J B;  4JGP A;  4NKP A;  4OQG A;  3A3I A;  3ZVW A;  2Y2J A;  1TD5 A;  3IXH A;  1KE4 A;  4YIN A;  2D01 A;  4S2O A;  4EU0 A;  5F83 A;  1NYY A;  4Y3I A;  1LSX A;  3LR0 A;  4G3V A;  1WE4 A;  3BM6 A;  4KZB A;  5E2F A;  3F1O A;  1ACF A;  2J80 A;  1S67 L;  2GJ3 A;  1O07 A;  4F94 A;  5FAQ A;  5EVL A;  5HZH A;  4K91 A;  3PR6 A;  5HDC A;  3NOP C;  4P87 A;  2V1Z A;  1L3L A;  3OBF A;  1LT0 A;  4JXS A;  3IX8 A;  2XGN A;  4DDY A;  3BQ8 A;  3BFC A;  5CXW A;  4HJ3 A;  1NZU A;  2VEA A;  2L0W A;  5E2E A;  5FQK A;  2HDR A;  1LL9 A;  4C75 A;  2GZA A;  5FI6 A;  2PR5 A;  1BUL A;  4PM5 A;  1N4O A;  2LB9 A;  3NJA A;  4GW9 A;  2XFT A;  1JWP A;  1IFQ A;  5AVF A;  4R1G A;  2HV1 A;  3ITB A;  1YM1 A;  3LO7 A;  5FQQ A;  1MY8 A;  2FFF B;  4RYE A;  1N9O A;  3SH9 A;  5CEB A;  2EFX A;  4NG2 A;  2XDM A;  1T18 A;  1OJG A;  3LR4 A;  1SCW A;  1G6O A;  1ERM A;  3EQV A;  1DP6 A;  4R0Q A;  3OPL A;  3ZG9 B;  2A2L A;  3VP4 A;  4K0W A;  3PTE A;  4RX2 A;  2EX8 A;  5HD5 A;  1HZO A;  2WGI A;  3K3C A;  5CED A;  3FV7 A;  2WGV A;  4OPQ A;  3CJM A;  2Y79 A;  1JWV A;  1DRM A;  3MFX A;  4X53 A;  4MBH A;  1PZP A;  3C38 A;  4GKU A;  4DDS A;  5DJT A;  5DTS A;  2V1B A;  5HDD A;  5HW3 A;  4F3L B;  1CK3 A;  3NCK A;  2B18 A;  4KQR A;  3WS2 A;  4L9E A;  1S4S A;  2H0Y A;  3H9W A;  2Y2H A;  5CHJ A;  2Q0O A;  4ETX A;  5AVE A;  1N9N A;  2ZC3 B;  1FIL A;  4MN5 A;  1RCJ A;  5AJG A;  3HLD A;  4R3A A;  5EFW A;  1K54 C;  1OTE A;  2X02 A;  2A24 A;  3V3R A;  3ISG A;  3KO6 A;  4JKT A;  2W27 A;  2O99 A;  1H3Q A;  2EWW A;  1BTL A;  1I5Q A;  3T12 B;  3D9Y A;  5IHV A;  5L09 A;  1SKO A;  2Y2N A;  4EER A;  2PRF A;  2DRW A;  1MKM A;  1G6A A;  1YSQ A;  1O7E A;  2W1T A;  3NHQ A;  1KE3 A;  3E0Y A;  2BG1 A;  5A8B A;  4BWI A;  4IVK A;  3B47 A;  2Y4A A;  2WKR A;  4P6Z M;  4PPR A;  3T1X A;  3MXQ A;  2Y55 A;  4X6T A;  4YNR A;  4II7 A;  5J8X A;  1F5M A;  1GHP A;  1MXO A;  5IU1 A;  4UA6 A;  1AXB A;  3SS5 A;  2XR0 A;  5CTM A;  2JCH A;  5HPF A;  3ZHH A;  4E3I A;  4S2M A;  1IEL A;  4IJG A;  1VM1 A;  3PHY A;  1S66 L;  1N9L A;  3HLF A;  3W4Q A;  1H8Z A;  1FR1 A;  5KZH A;  4KZ8 A;  3UME A;  1ZTU A;  2ZM8 A;  3T1S A;  1OPX A;  2VGL M;  3LYX A;  2JE5 A;  4Y13 A;  1W63 Q;  2ZD8 A;  1PYY A;  3P98 A;  5M1A A;  1H0M A;  4H6J A;  3LIB A;  3IH8 A;  4KG6 A;  5KSC A;  5U47 A;  1CJF A;  4I39 A;  2K7S A;  2QMI A;  1Y28 A;  2WZX A;  1TF1 A;  4R4R A;  1OTI A;  3IX4 A;  2WZZ A;  4FH4 A;  4N92 A;  3UDF A;  2B02 A;  3UDX A;  2WGW B;  1K25 A;  3TJZ C;  4EBN A;  4EWF A;  2ZQ8 A;  1JWZ A;  2XD1 A;  3FYZ A;  5HSQ A;  4NXF A;  2Y59 A;  4E3J A;  5A90 A;  4ETZ A;  2XD5 A;  2JKR I;  1BT5 A;  2XQZ A;  3N8S A;  3HRE A;  3T4S A;  3MKE A;  3ZG0 A;  4YOF A;  4GD6 A;  4IBR A;  1YLT A;  1H5X A;  4KZ5 A;  3SZT A;  2J3T D;  2KLI A;  5EE8 A;  2H10 A;  5HL6 A;  2H28 A;  4BBV A;  4ZJ1 A;  1DP9 A;  4I5S A;  3O86 A;  3FPV A;  3JVV A;  4EQ1 A;  3OCL A;  2M1C A;  5DJU A;  3N6I A;  4Q8I A;  2BAS A;  2VK3 A;  3MF0 A;  4ESP A;  4MN7 A;  2CMN A;  4HBU A;  4GS9 A;  3OC2 A;  4GOG A;  1NXY A;  1TS8 A;  2YKF A;  3IWI A;  1KDS A;  1S4R A;  4OQ0 A;  3B3X A;  4LV3 A;  2ZC7 A;  1OJ5 A;  1XFN A;  4FOF A;  5DF7 A;  1YLP A;  3HBR A;  5GLD A;  3Q1F A;  3U4L P;  2IA2 A;  4QJG A;  3VFF A;  5CGW A;  4WYY A;  2RL3 A;  4JBF A;  3PYP A;  4GCZ A;  4RVA A;  2VA0 A;  3LGO A;  4GDN A;  3CLO A;  4Z1W A;  4LRX C;  2QWS A;  1XJ3 A;  3IX3 A;  2OV5 A;  5EUA A;  2J8Y A;  3HUM A;  3Q7Z A;  2QJ7 A;  4F3L A;  3PXP A;  2ACG A;  5HWW A;  3R4K A;  2I72 A;  2Y8H A;  2Y2O A;  1K38 A;  1YMS A;  2QKP A;  1PIO A;  3O87 A;  5FQ9 A;  3OZH A;  3HLE A;  5AQA A;  4KG2 A;  3LIF A;  1W5D A;  3T1Q B;  3C4P A;  3U2A A;  1YLZ A;  2C5W B;  2NUP C;  1E3U D;  3Q7V B;  2ZOI A;  1NLY A;  5A92 A;  4DXB A;  4PHT A;  2HZ5 A;  4HP9 A;  4XT2 B;  2EA9 A;  3UB9 A;  1PFL A;  3MSH A;  3ICY A;  3NOT C;  5A93 A;  3A3F A;  3IF5 A;  1MWU A;  4IED A;  4EEP A;  5EEC A;  2OAQ 1;  2OLU A;  2WKE A;  2O0Y A;  5HX9 A;  5D3O A;  1Y54 A;  3OLO A;  1FCM A;  2OAP 1;  3IS2 B;  5FL3 A;  1GSW A;  4EUZ A;  1JVJ A;  3A3E A;  1K54 A;  2PU4 A;  4CQH A;  2DMW A;  4HJ4 A;  3BLM A;  3TE8 A;  4WLA A;  3LR5 A;  4C3Q A;  3G2Z A;  2HJE A;  1NLZ A;  3I7J A;  4OOY A;  4B93 A;  5G4Z A;  4U0X A;  4HI4 A;  1OME A;  4LGW A;  5J3W A;  5DKL A;  5HWV A;  1E3U A;  4WN5 A;  4RA7 A;  2PBY A;  4L9G A;  3CIT A;  2ZMA A;  3ZFZ A;  3VP3 A;  4R23 A;  5L2F A;  1K4F A;  3W4O A;  2PD8 A;  1IKI A;  3ZVT A;  3PAG A;  1YLY A;  2L1M A;  3OPH A;  5L10 A;  4A5R A;  5CGS A;  2W1R A;  2E8J A;  4NET A;  4UQI S;  2PU2 A;  4ZAM A;  3RH8 B;  4GLQ A;  4KEN B;  4HEF A;  4WL9 A;  3QP8 A;  4P6B A;  1BLS A;  3V50 A;  2OLV A;  1UWN X;  3F1N A;  2JKT I;  3C4O A;  1KVM A;  1RGZ A;  4R3J A;  1LI0 A;  3VSL A;  3QP1 A;  1F9I A;  3E2L A;  5EPH A;  4DRT A;  4NXE A;  4WZ5 C;  4O0P A;  5I94 A;  1BLH A;  5DF9 A;  5FEG A;  5C5K A;  3VFH A;  2J9P A;  1MZU A;  2JC7 A;  1NYM A;  2VV8 A;  2PYR A;  4Y2F A;  3Q82 A;  1RGY A;  3LFV A;  3VP2 A;  1ZHH B;  4U3T A;  2JKR M;  3PBN A;  3LR3 A;  3HLW A;  2M7U A;  5FDH A;  4IHQ A;  3BFG A;  5EM1 A;  2XRN A;  4X69 A;  1PW8 A;  2HDS A;  1KDW A;  4S2N A;  3MZF A;  4YFM A;  4ZDX A;  2V8C A;  2XA7 S;  4ZJ2 A;  1BLP A;  1PW1 A;  3CHW P;  3RXW A;  5A91 A;  5FSR A;  5KMW A;  2W0N A;  4EES A;  1IYP A;  4X68 A;  1KE0 A;  3BRM A;  3ZYT A;  4KZ4 A;  2XF3 A;  2Q9N A;  3O3V A;  3UB5 P;  5E2H A;  2IWC A;  4S2L A;  2PHY A;  3Q07 A;  1VQQ A;  3LY3 A;  2FH5 A;  3GV9 A;  3LIE A;  2WKH A;  4L0L A;  4FUW A;  3MZD A;  4RX3 A;  1T1C A;  4Y0U A;  1BLC A;  3A0V A;  3N8R A;  2PDR A;  3EGX C;  3B33 A;  5F6A A;  4CLC E;  1K57 C;  1XFQ A;  2HPB A;  1KVL A;  4JF5 A;  1BZA A;  2QZ6 A;  3ITA A;  5AQB A;  4NXB A;  1ES5 A;  3Q81 A;  2HP9 A;  3IHB A;  3HJI A;  1TS7 A;  4GS9 B;  2M7V A;  4EET B;  2P08 A;  2KX6 A;  3T4J A;  1ZG6 A;  1LI9 A;  3HUN A;  4MCW A;  4O7D A;  4EEU A;  3QNB A;  2XEP A;  3VP0 A;  3MXR A;  3BEC A;  4PKY G;  5FEF A;  4K0X A;  3OCN A;  5HAP A;  1CI9 A;  2EX6 A;  3PBR A;  4O8G A;  1FOF A;  2NUT C;  2OWH A;  3C5A A;  3VE3 A;  1CI8 A;  2K2N A;  3GMW A;  4Y0O A;  2EX2 A;  2WKQ A;  1D7E A;  2Z2M B;  3Q7V A;  2KDK A;  5CHU A;  2XH9 A;  1FIK A;  1FSY A;  1HTZ A;  1OT9 A;  2Y2K A;  4B88 A;  1GHM A;  4XT2 A;  1P0Z A;  5LBR A;  3QP4 A;  4JXV A;  1XKZ A;  3UMD A;  2VV7 A;  3HLB A;  5K5B A;  3A0S A;  3G34 A;  3N4I A;  2Y2P A;  4QPR A;  5HWT A;  1S0W A;  1ZC2 A;  1Q2Q A;  5E43 A;  1YMX A;  4EW7 A;  4N9K A;  4BL2 A;  2G2W A;  4GN2 A;  5GLA A;  3IS2 A;  2PYP A;  3G30 A;  2ZQ7 A;  1VB6 A;  2V20 A;  1MKI A;  2HP6 A;  3DTE A;  3H82 A;  1MC0 A;  3AGE A;  1UWP X;  2J7V A;  2VJW A;  5HL1 A;  4KQQ A;  5CGX A;  4MLL A;  3PAE A;  2V0W A;  5FAS A;  1MWR A;  5FI7 A;  5MC7 A;  2WUQ A;  3IXB A;  3W4P A;  4IBX A;  1XA7 A;  4PM6 A;  3S7Q A;  1YQS A;  1QMF A;  4QWO A;  5G4Y A;  4LCL A;  1ESI A;  3IWO A;  4RQ9 A;  2WKI A;  2HGV A;  3CUE C;  1S1Z A;  3M6B A;  3CMZ A;  1XGI A;  4ZTK A;  3BY9 A;  3VSK A;  4LLO B;  3TRC A;  3NOU C;  2I9V A;  1TDG A;  3UB7 A;  3WWX A;  2W3E A;  4X55 A;  4CLC C;  3T4T A;  3SH7 A;  4OQH A;  3ZNY A;  3CWF A;  3GTC A;  5F1G A;  3IBR A;  5TGF A;  3V39 A;  2EWV A;  3NEC A;  2Y2I A;  4OPY A;  3PBQ A;  3EOI A;  4GDB A;  2JKT M;  4E3L A;  4DN0 A;  3FKW A;  4MNR A;  2P9V B;  1ONG A;  4MMN A;  2B5R A;  4OOL A;  4DE1 A;  4PM8 A;  1TS0 A;  1YLW A;  2PBD P;  1XJ6 A;  3NY4 A;  4LV2 A;  1CEG A;  1XJ4 A;  4KG5 A;  3MMH A;  3V3S A;  4DKI A;  2FZ0 A;  4FH2 A;  3F1N B;  4BJP A;  1DP8 A;  4WZ5 A;  5EV0 A;  5FA7 A;  2ZM2 A;  3DAV A;  4BLM A;  3ULF A;  2XSS A;  1GA9 A;  4X25 A;  3VOL A;  3SOI A;  1AWI A;  2OSU A;  2H5S A;  4UA9 A;  1W63 M;  3D4F A;  3UO9 A;  1T1A A;  3V67 A;  1PRQ A;  3AGF A;  1VEU A;  1XA1 A;  3FKV A;  2INW A;  2AVX A;  3IF6 C;  1SDN A;  2ZQ9 A;  1K0K A;  4HP4 A;  1ZG4 A;  4P85 A;  3FG8 A;  1LL5 A;  1M40 A;  3UDI A;  5EOO A;  3M6H A;  4DF6 A;  4OPR A;  1MWS A;  3KSG A;  1G28 A;  5FQM A;  4BBT A;  2GNX A;  1NZO A;  1Z6F A;  3WRZ A;  4DE0 A;  1L2S A;  1L0G A;  2ZLY A;  3M2J A;  3UB8 A;  1IOU A;  5GHZ A;  2V8F A;  5HDS A;  2ZQD A;  1P97 A;  3BLS A;  1ES3 A;  4FTX A;  4HY8 A;  1ESU A;  4PM9 A;  3SS4 A;  1JTD A;  1K6R A;  3LI8 A;  1T1B A;  4UEY A;  4X56 A;  4E3K A;  5HD3 A;  1G5U A;  4P6Z S;  1KGE A;  1ES2 A;  4HHD A;  3W8K A;  2ZBB A;  1KOU A;  4WEK A;  2O9A A;  4WEL A;  4GNU A;  3ZG8 B;  1K57 A;  4N1H A;  3SW1 A;  5EVI C;  5FAP A;  3TW8 A;  4LRZ E;  4G3W A;  2P04 A;  4KUO A;  1K4E A;  4QHC A;  4R70 A;  3NI9 A;  2VV6 A;  2ZL1 B;  5EVE A;  5M18 A;  2V2F F;  4JXW A;  3KYE A;  3GSG A;  4KZ6 A;  1NJ4 A;  3GRJ A;  1H8M A;  4DE3 A;  2OOL A;  3UE6 A;  3UPP A;  3DTK A;  4EUV A;  2XLN A;  3LUQ A;  5KIZ A;  3IXG A;  2VGL S;  2WYX A;  2WKP A;  3DWZ A;  4G3K A;  5GL9 A;  3JYI A;  2J9O A;  4E3N A;  4JLF A;  4P0M A;  3G2Y A;  4FCF A;  1BUE A;  3CZD A;  5FAT A;  1UGU A;  3GEC A;  4HQA A;  2V1A A;  1FCN A;  1TVF A;  5DTT A;  1YPR A;  2VKS A;  1F2K A;  2JN7 A;  3CAX A;  3H7W B;  4MBK A;  5DVA A;  4DMZ A;  1LSV A;  5EM0 A;  3L7H A;  3UNW A;  4JF6 A;  3K3D A;  3GDI A;  2KOI A;  3NDE A;  4GJ4 A;  3UN7 A;  2E8I A;  4CLC D;  3H82 B;  3ZGA B;  1YAX A;  3FZC A;  4PKY A;  3O88 A;  4BEN A;  3E4P A;  1H8Y A;  4S2P A;  4I3A A;  2WAE A;  2ZC6 B;  4OQI A;  4Y0T A;  3UE1 A;  5CHM A;  1F98 A;  3WS5 A;  1FCO A;  3BYD A;  4GB7 A;  4B4X A;  3TOI A;  4BD1 A;  4H8R A;  1X0O A;  4OPZ A;  2R9X A;  3ZDJ A;  4DJ2 A;  3C8C A;  5M19 A;  4JPM A;  3IWQ A;  4XUZ A;  3VOY A;  1YSP A;  4LEN A;  3HVF A;  4OP8 A;  3CUE A;  3VE4 A;  2A49 A;  1M6K A;  4OH0 A;  1LSW A;  3BW6 A;  1SZV A;  4MN6 A;  1P9W A;  3T1R A;  3P7N A;  1KGG A;  2VGK A;  2P9V A;  4NXG A;  5IT5 A;  5FQJ A;  3S7P A;  4MBF A;  1K6S A;  1PI5 A;  3L9K A;  3M2K A;  4CLC A;  4LCM A;  4BQM A;  4PMA A;  5DKK A;  1CF0 A;  1CEF A;  4M3K A;  4KZ9 A;  1GSX A;  2EFU A;  2JKG A;  4WF0 A;  3DTM A;  4HBT A;  3HLG A;  1LLB A;  3F1P B;  1J3W A;  4Y7P A;  2JHE A;  3WS1 A;  4FD8 A;  3KYQ A;  2PT7 A;  5F5Y A;  4QY5 A;  3DTI A;  3RXX A;  3KSH A;  1K56 D;  5CRF A;  2B95 A;  3PBO A;  1D1J A;  3NUL A;  4AFI A;  3BWL A;  1A0K A;  1FSW A;  4QU3 A;  5FQI A;  4E3O A;  1D06 A;  1V9Z A;  3OOV A;  2O9C A;  3EGD C;  4HNB A;  3MJQ A;  4Y15 A;  3S22 A;  4EQI A;  3ZNT A;  3FWL A;  3E98 A;  1EW0 A;  2K31 A;  5L8M A;  2DNS A;  2IWD A;  2JBF A;  4E04 A;  3BEB A;  3DWK A;  1NRJ A;  2G2U A;  1HD8 A;  3LI9 A;  2A3U A;  3WRT A;  3LID A;  2Z6C A;  2GX5 A;  1K55 C;  1VEU B;  3OPP A;  3IF6 A;  2WAF A;  1TEM A;  4L9F A;  3C7U A;  1GSV A;  5EVI D;  3HL9 A;  4JF4 A;  4MEZ A;  3V5M A;  1QME A;  1J9M A;  3VV4 A;  1V9Y A;  1Z09 A;  2WK0 A;  4OVD A;  3A3J A;  1K56 A;  3UB6 A;  4UAA A;  3MKF A;  1LL8 A;  5HAQ A;  1HVB A;  3EEH A;  1FR6 A;  4Q0H A;  2Y2M A;  3LIA A;  3JVU A;  3TG9 A;  3BFD A;  4ARZ B;  2W3F A;  2DCF A;  1OT6 A;  1WA9 A;  3KSF A;  2ZL1 A;  4LV0 A;  3BQA A;  3B42 A;  2V9A A;  3MR0 A;  1W79 A;  2ZOH A;  1YLJ A;  4WUJ A;  5TFQ A;  4ZBE A;  5DFY A;  1SDE A;  5TBM B;  5TR7 A;  1W7F A;  3C7V A;  1L0F A;  2WAD A;  3P01 A;  2J3T C;  2G7U A;  2JKF A;  3IQA A;  2Y2G A;  5EVI A;  2P7J A;  3HCY A;  5GLB A;  3N7W A;  5CEC A;  3A0R A;  4B4Z A;  3IBJ A;  5DFX A;  1MWT A;  3ZG7 B;  3QHY A;  5FDS A;  2QHK A;  1XGJ A;  2QJ5 A;  2W3D A;  3H7W A;  5F69 A;  4JGQ A;  1W8Q A;  3ZG5 A;  3LY4 A;  2UV0 E;  2ZC5 B;  4E6W A;  4NK3 A;  2Y91 A;  1PNE A;  3G31 A;  5J7E A;  1OTA A;  4LFU A;  1YT4 A;  2CC1 A;  5HPI A;  4DJ3 A;  2O9B A;  3CI6 A;  2HP5 A;  4GHI B;  4X1M A;  4E6X A;  4FSF A;  1E4D A;  2QYB A;  2X01 A;  2EXA A;  4JXG A;  2LB5 A;  3CPT A;  5KSH A;  1PI4 A;  4I3I A;  4I3J A;  4XXR A;  3E4O A;  3UY6 A;  1N9B A;  5L07 A;  4QD4 A;  1G68 A;  3AGD A;  5DTK A;  2EXB A;  3GVB A;  5E2G A;  1PWG A;  1IEM A;  4JGR A;  2Z6D A;  4NEE D;  2YKH A;  2IWB A;  1NRF A;  4HJ6 A;  1Y4O A;  4BL3 A;  4KZ3 A;  4GZB A;  3MQO A;  3BFE A;  3UPN A;  3QP2 A;  4KZA A;  4Y17 A;  1BSG A;  1GCE A;  3HLC A;  1PWC A;  3HJK A;  1ALQ A;  5J4E A;  3RTY A;  4LPZ A;  3MS6 A;  2J3W A;  5GHY A;  3FPW A;  4O01 A;  4IUK A;  2XK1 A;  3UPO A;  3R7W A;  3T50 A;  1C3B A;  3UE0 A;  5AQ9 A;  3K2N A;  1IYS A;  3WS0 A;  3E2K A;  2D02 A;  4EBP A;  3F1P A;  4KQO A;  4OP5 A;  3G35 A;  2HF6 A;  3NDG A;  3MQ0 A;  3LEQ A;  4WM9 A;  1Q2P A;  2L4R A;  3SH8 A;  3QNC A;  2GDN A;  3FC7 A;  4YWZ A;  3CG5 A;  4Q0I A;  4CLC B;  2MJ6 A;  3PBT A;  1W8Y A;  1MBL A;  1KGF A;  3KX0 X;  1XP4 A;  4CJN A;  5HAI A;  1DY6 A;  1EWZ A;  3LEZ A;  1JNU A;  4B9O A;  1XX2 A;  4BMW A;  4MDZ A;  5HAR A;  1NWZ A;  3RJU A;  3O5Y A;  4HOI A;  3SS3 A;  4S2I A;  4I38 A;  3EEA A;  3DW0 A;  1HLU P;  1LHY A;  1GA0 A;  2HJ9 C;  3IH9 A;  1DJC A;  2OWJ A;  3C2W A;  3KYZ A;  4LRY C;  3A3D A;  4WZ4 A;  1WYC A;  1YKD A;  1OTD A;  2Y2Q A;  4E3M A;  1ZKJ A;  4S2N C;  5CX7 A;  1S6R A;  1WYB A;  4K08 A;  3GR2 A;  4ZJ3 A;  1VET B;  1S1Y A;  3NBL A;  1E25 A;  4U0T A;  1VHM A;  1L0D A;  1ES4 A;  1JTG A;  4LV1 A;  1NY0 A;  4ARZ A;  1SHV A;  1K55 A;  4ME4 A;  4XUX A;  2ZMF A;  3T4Q A;  3IF6 B;  4ID4 A;  4R4S A;  2ZQC A;  5F82 A;  1RP5 A;  2H0T A;  3IT9 A;  3F1O B;  4IUH A;  5TBM A;  4R6L A;  4CPK A;  3BJN A;  1OTB A;  2Y2L A;  3WS4 A;  4D60 A;  1FQG A;  1XXM A;  3VMA A;  4Y5F A;  4WBG A;  4HH3 A;  4DXC A;  4N1X A;  2R78 A;  2V0U A;  1CQA A;  2EX9 A;  4GD8 A;  3ZQ5 A;  2PAV P;  4HH2 A;  4BBU A;  3VP1 A;  4D2O A;  1I2S A;  2W3G A;  3MFD A;  4UQI M;  1L0E A;  4X1L A;  2ZJ9 A;  2ZM0 A;  4OKP A;  4OOM A;  1U60 A;  4KQD A;  1ONH A;  2FFY A;  5FAO A;  5DF8 A;  3QP6 A;  2PD7 A;  5EVI B;  2ZQA A;  5G18 A;  5TJJ A;  4OLD A;  1MPL A;  4JGO A;  4WEJ A;  1SKF A;  4GHI A;  3DBA A;  1TDL A;  4QY6 A;  3T4K A;  3IXD A;  5BOH A;  2W3H A;  4R3B A;  4BD0 A;  3T4O A;  3P09 A;  5IS1 A;  4S2K A;  1I2W A;  5GLC A;  1DJA A;  2HDQ A;  1P9R A;  4R38 A;  3IHA A;  4C6Y A;  1XPB A;  1STZ A;  3PBS A;  4WMC D;  2RCX A;  5I5L A;  1IYO A;  4Q0J A;  3ZCZ A;  4KUK A;  2XA7 M;  2Z2L B;  3VOZ A;  4UA7 A;  3MZE A;  4HES A;  2C6W B;  2PR6 A;  5EOE A;  2HDU A;  5JYP A;  5CTN A;  3S1Y A;  4EBL A;  3T4L A;  4HIA A;  3CPT B;  3MXS A;  4IVI A;  4PM7 A;  4N9L A;  5FI2 A;  1ERQ A;  2VLG A;  3S7N A;  2Q9M A;  3C30 A;  4EXO A;  4S2J A;  4OON A;  2R9W A;  2A24 B;  1TS6 A;  3GQZ A;  4PAU A;  3N8L A;  3G6O A;  2UWX A;  5CER A;  3UE3 A;  3QP5 A;  2BLS A;  3RFB A;  3S4X A;  1T19 A;  2VGJ A;  4KZ7 A;  3EWK A;  1SKO B;  3W2Z A;  1XJ2 A;  4WMC A; 
#chains in the Genus database with same CATH homology
 2W3E A;  5DFY A;  4CLC C;  2W1T B;  1OJ5 A;  5TBM B;  1XFN A;  4FOF A;  3T4T A;  2VX8 A;  2IA2 A;  3CWF A;  3P01 A;  2J3T C;  2G7U A;  3IBR A;  2EWV A;  3R7W B;  3D72 A;  2P7J A;  3HCY A;  3PYP A;  4GCZ A;  3PBQ A;  3EOI A;  2VA0 A;  3A0R A;  2JKT M;  4M4X A;  2VZW A;  4DN0 A;  3CLO A;  3IBJ A;  4MMN A;  4Z1W A;  5DFX A;  4OOL A;  4LRX C;  2QWS A;  1TS0 A;  1XJ3 A;  3E4Q A;  1XJ6 A;  2XRO A;  4ZRR A;  3BY8 A;  3KSI A;  1XJ4 A;  2QHK A;  2QJ7 A;  3LIC A;  3PXP A;  4F3L A;  3MMH A;  1BYW A;  2QJ5 A;  2W3D A;  3H7W A;  5HWW A;  3R4K A;  5F68 A;  5F69 A;  2Y8H A;  2ZMV A;  2QKP A;  4JGQ A;  2FZ0 A;  3F1N B;  3D3O A;  1ODV A;  3LIF A;  4BJP A;  3U2A A;  1DP8 A;  3EQU A;  5J7E A;  2NUP C;  3MQQ A;  1OTA A;  3ULF A;  3S7O A;  5HPI A;  2ZOI A;  2XSS A;  4DJ3 A;  2O9B A;  3CI6 A;  1NLY A;  3VOL A;  4GHI B;  4PHT A;  4FSF A;  1W63 M;  4H6J B;  4HP9 A;  4XT2 B;  4JGP A;  1T1A A;  3V67 A;  2EA9 A;  4NKP A;  3UB9 A;  2INW A;  1TD5 A;  3ICY A;  2QYB A;  3NOT C;  2D01 A;  4HP4 A;  4EU0 A;  2LB5 A;  3FG8 A;  4Y3I A;  4EEP A;  5KSH A;  2OAQ 1;  1LSX A;  3LR0 A;  4G3V A;  4I3I A;  2O0Y A;  3KSG A;  4I3J A;  3OLO A;  1G28 A;  3E4O A;  3F1O A;  4BBT A;  2OAP 1;  2GNX A;  3IS2 B;  5FL3 A;  1GSW A;  1S67 L;  2J80 A;  2GJ3 A;  4CQH A;  2DMW A;  4HJ4 A;  5HZH A;  3PR6 A;  4JGR A;  2Z6D A;  3TE8 A;  4WLA A;  4NEE D;  3LR5 A;  2YKH A;  5HDC A;  3UB8 A;  1IOU A;  4HJ6 A;  2HJE A;  1NLZ A;  3NOP C;  5HDS A;  1P97 A;  3OBF A;  4B93 A;  5G4Z A;  1LT0 A;  3MQO A;  4HI4 A;  3BQ8 A;  4HY8 A;  4HJ3 A;  2VEA A;  5J3W A;  3LI8 A;  2L0W A;  1T1B A;  3HJK A;  4UEY A;  5DKL A;  5HWV A;  5J4E A;  3RTY A;  4LPZ A;  5HD3 A;  4WN5 A;  2GZA A;  4P6Z S;  2PR5 A;  2J3W A;  4HHD A;  3FPW A;  4L9G A;  4O01 A;  2ZBB A;  3CIT A;  1KOU A;  4WEK A;  2O9A A;  2LB9 A;  4IUK A;  3NJA A;  4WEL A;  4GW9 A;  2PD8 A;  3R7W A;  3T50 A;  3K2N A;  3SW1 A;  2L1M A;  3TW8 A;  1IFQ A;  4LRZ E;  4G3W A;  2P04 A;  5AVF A;  2D02 A;  2W1R A;  3F1P A;  4KUO A;  4KQO A;  4R70 A;  2HV1 A;  2VV6 A;  2HF6 A;  3MQ0 A;  4UQI S;  2L4R A;  1H8M A;  3RH8 B;  4GLQ A;  1N9O A;  2OOL A;  3UE6 A;  3FC7 A;  4WL9 A;  1T18 A;  1OJG A;  3LR4 A;  4Q0I A;  4YWZ A;  1G6O A;  3EQV A;  1DP6 A;  4CLC B;  2MJ6 A;  3PBT A;  4EUV A;  3KX0 X;  1UWN X;  3LUQ A;  3F1N A;  2A2L A;  2JKT I;  5KIZ A;  2VGL S;  2WKP A;  1F9I A;  4G3K A;  1JNU A;  4NXE A;  5HD5 A;  4B9O A;  4O0P A;  3K3C A;  4BMW A;  5DF9 A;  4MDZ A;  5C5K A;  2Y79 A;  1NWZ A;  1DRM A;  3MFX A;  3O5Y A;  1UGU A;  4HOI A;  1MZU A;  3GEC A;  4HQA A;  3C38 A;  2V1A A;  4I38 A;  3EEA A;  5DJT A;  2V1B A;  2VKS A;  2VV8 A;  2PYR A;  5HDD A;  4Y2F A;  2HJ9 C;  2OWJ A;  3KYZ A;  3C2W A;  3LFV A;  4LRY C;  4F3L B;  2JN7 A;  3CAX A;  2B18 A;  3H7W B;  1ZHH B;  2JKR M;  3PBN A;  3LR3 A;  1YKD A;  4L9E A;  1S4S A;  3H9W A;  2M7U A;  4IHQ A;  4DMZ A;  1LSV A;  1OTD A;  2XRN A;  4ETX A;  5AVE A;  5CX7 A;  1N9N A;  3K3D A;  4MN5 A;  5AJG A;  3GDI A;  4K08 A;  2KOI A;  4GJ4 A;  2XA7 S;  1S1Y A;  4R3A A;  5EFW A;  1VHM A;  1OTE A;  2A24 A;  4CLC D;  2W0N A;  3H82 B;  4EES A;  3KO6 A;  1YAX A;  4ARZ A;  3ZYT A;  4PKY A;  2W27 A;  2O99 A;  1H3Q A;  2EWW A;  3E4P A;  4ME4 A;  4I3A A;  2ZMF A;  2PHY A;  3T4Q A;  2FH5 A;  3LIE A;  4EER A;  1F98 A;  4L0L A;  1MKM A;  1X0O A;  1YSQ A;  1T1C A;  3F1O B;  2W1T A;  4IUH A;  3A0V A;  3NHQ A;  5TBM A;  4R6L A;  4DJ2 A;  2PDR A;  3C8C A;  3E0Y A;  3BJN A;  3B33 A;  3EGX C;  5A8B A;  5F6A A;  4BWI A;  4CLC E;  1XFQ A;  3B47 A;  1OTB A;  2WKR A;  1YSP A;  4P6Z M;  3CUE A;  3MXQ A;  3VE4 A;  4NXB A;  1LSW A;  3BW6 A;  4YNR A;  4II7 A;  4MN6 A;  1P9W A;  4Y5F A;  1F5M A;  4HH3 A;  3P7N A;  3HJI A;  1TS7 A;  5IU1 A;  2R78 A;  2V0U A;  4NXG A;  4GS9 B;  2M7V A;  5IT5 A;  4EET B;  2P08 A;  3ZQ5 A;  2KX6 A;  3S7P A;  3T4J A;  5HPF A;  4HH2 A;  4MCW A;  4BBU A;  4CLC A;  2W3G A;  4EEU A;  4IJG A;  4UQI M;  5DKK A;  4PKY G;  3PHY A;  3OCN A;  1S66 L;  4OOM A;  1GSX A;  4KQD A;  1N9L A;  4WF0 A;  3PBR A;  2PD7 A;  4O8G A;  3UME A;  3F1P B;  1ZTU A;  2OWH A;  2NUT C;  3VE3 A;  2K2N A;  5TJJ A;  1OPX A;  1D7E A;  2VGL M;  2WKQ A;  3LYX A;  2JHE A;  2KDK A;  1W63 Q;  4JGO A;  3KYQ A;  2PT7 A;  4WEJ A;  5F5Y A;  3KSH A;  4GHI A;  1OT9 A;  3DBA A;  4H6J A;  3LIB A;  4XT2 A;  3T4K A;  3PBO A;  1P0Z A;  5LBR A;  4AFI A;  3BWL A;  2W3H A;  3UMD A;  4I39 A;  2VV7 A;  3T4O A;  5IS1 A;  2K7S A;  1D06 A;  1V9Z A;  5K5B A;  1Y28 A;  3OOV A;  2O9C A;  3A0S A;  3EGD C;  4HNB A;  1TF1 A;  3MJQ A;  1OTI A;  4QPR A;  5HWT A;  1P9R A;  4R38 A;  3E98 A;  4EW7 A;  1EW0 A;  2B02 A;  2K31 A;  5L8M A;  3TJZ C;  1STZ A;  3IS2 A;  2PYP A;  4E04 A;  1VB6 A;  3PBS A;  3H82 A;  1MC0 A;  1NRJ A;  1UWP X;  5HSQ A;  4NXF A;  2VJW A;  3LI9 A;  5I5L A;  4ETZ A;  4Q0J A;  2JKR I;  4KUK A;  3LID A;  2Z6C A;  2XA7 M;  3T4S A;  2GX5 A;  4YOF A;  2V0W A;  4L9F A;  1GSV A;  2PR6 A;  2J3T D;  5MC7 A;  2KLI A;  3T4L A;  5HL6 A;  3VV4 A;  1V9Y A;  4HIA A;  2H28 A;  3S7Q A;  4BBV A;  2VLG A;  1DP9 A;  4I5S A;  5G4Y A;  3S7N A;  3C30 A;  3FPV A;  3UB6 A;  3JVV A;  4EXO A;  4EQ1 A;  1LL8 A;  3EEH A;  3OCL A;  2M1C A;  2A24 B;  4RQ9 A;  4Q0H A;  1TS6 A;  4PAU A;  5DJU A;  2HGV A;  3G6O A;  3LIA A;  3JVU A;  3UE3 A;  4ARZ B;  3CUE C;  1S1Z A;  2BAS A;  3RFB A;  3MF0 A;  2W3F A;  3BY9 A;  1T19 A;  4MN7 A;  1OT6 A;  2CMN A;  1WA9 A;  3EWK A;  3KSF A;  4GS9 A;  3OC2 A;  3W2Z A;  4LLO B;  3TRC A;  1TS8 A;  2YKF A;  3BQA A;  1S4R A;  1XJ2 A;  3B42 A;  3NOU C;  2V9A A;  3MR0 A;  2I9V A;  3UB7 A;  2ZOH A;  4WUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...