1S66L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
molecule keywords Hypothetical protein yddU
total genus 24
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s66L00
1D06A 3OLOA 4I3AA 1D7EA 2PR6A 5HD5A 3H7WB 4HJ3A 2ZOIA 2D02A 4WL9A 4BBUA 4RQ9A 1P97A 4EW7A 3K3DA 5AVFA 4PKYG 2KX6A 3VOLA 3RH8B 1TS8A 4EXOA 4H6JA 3BWLA 4LRZE 1S4RA 1V9ZA 3CAXA 3LIEA 3UMDA 3LIBA 2PD7A 5F69A 5HWTA 1DRMA 1S4SA 2VV6A 3E4QA 1OTDA 3UB9A 3UB6A 1S1ZA 3E4PA 4HQAA 5EFWA 2WKPA 3IS2B 2JN7A 2QWSA 2Z6DA 4I39A 4LRXC 5DJUA 5HWWA 3UE6A 3LI9A 1XJ4A 4HY8A 2QJ7A 2J80A 4EQ1A 1Y28A 5J7EA 1UWPX 4PKYA 5HZHA 1S66L 2A24B 3B33A 3UB7A 4GS9A 4F3LB 1XJ2A 4F3LA 2ZBBA 5TBMB 2R78A 1BYWA 2EA9A 2QKPA 4HJ6A 3H82A 5F5YA 4EERA 4KUOA 3VE3A 2YKHA 4LLOB 4HH3A 1GSWA 2V9AA 2W0NA 5G4ZA 3VE4A 1T1AA 2KDKA 2QJ5A 4EEUA 4HJ4A 2OWJA 3MQQA 2OOLA 3PYPA 4GW9A 1TS6A 1XJ3A 5HWVA 3G6OA 1DP8A 3F1OB 1OT6A 2PDRA 4WUJA 3RTYA 3CWFA 3NOPC 2VV8A 3PHYA 4WLAA 1DP6A 1N9LA 3H9WA 3LIFA 4M4XA 2PD8A 3HJIA 4JGQA 2V1AA 2ZOHA 1KOUA 3ULFA 3H7WA 2V0UA 3F1NB 5I5LA 2I9VA 5TBMA 4LPZA 3EEHA 2B02A 3E4OA 2OWHA 3GECA 2WKQA 3IBRA 3NOUC 2A24A 5HDSA 1V9YA 4YWZA 4EESA 3LIAA 1N9NA 2V0WA 1OTBA 5DKLA 2P7JA 4I3JA 1G28A 1LSVA 3EWKA 3MR0A 1T1BA 2VEAA 3BY9A 3ZQ5A 3NOTC 4LRYC 2CMNA 4HP4A 4KUKA 4MN6A 3MQOA 1UWNX 2INWA 4HIAA 2JHEA 4KQDA 2VLGA 4B9OA 1TS7A 4XT2B 2VV7A 4GS9B 1OJGA 1P0ZA 1LSXA 2YKFA 3NJAA 1T18A 2HV1A 3KX0X 5IS1A 5HD3A 5IU1A 3T50A 1F9IA 1N9OA 1ODVA 5HDCA 4L9GA 1LT0A 3K3CA 5F6AA 3C2WA 5HDDA 3F1PA 4EETB 4GCZA 4JGPA 2D01A 4NXEA 5AVEA 4E04A 2PHYA 1DP9A 3A0RA 1XFNA 3MFXA 1LSWA 4GHIB 4K08A 4L9EA 4WF0A 5J3WA 1F98A 2Z6CA 5A8BA 1X0OA 2PYPA 4WN5A 4R3AA 2L1MA 2PR5A 1NWZA 3P7NA 3D72A 4DJ3A 1S67L 1OTAA 3BY8A 5DKKA 3ICYA 4EEPA 2BASA 3F1PB 3MXQA 1T1CA 2W27A 3GDIA 3F1OA 5DJTA 2QHKA 1OJ5A 3H82B 2L4RA 1OTIA 1S1YA 5G4YA 1GSVA 1UGUA 2V1BA 4JGRA 1T19A 5F68A 4H6JB 1VB6A 3UB8A 3NHQA 1LL8A 4HOIA 4I3IA 4R70A 4DJ2A 3CLOA 3SW1A 3LICA 3F1NA 4MN5A 1OT9A 3A0SA 5HSQA 2WKRA 3A0VA 5KIZA 3FG8A 4NXGA 4HI4A 1EW0A 4HHDA 2GJ3A 3C8CA 4HNBA 4XT2A 2L0WA 4I38A 1MZUA 4BBVA 3IS2A 2H28A 4HH2A 3UMEA 4NXBA 2PYRA 3LYXA 1XJ6A 4BBTA 3FC7A 4GHIA 4JGOA 5J4EA 3LUQA 1WA9A 1XFQA 4R38A 3HJKA 2M1CA 4NXFA 4R6LA 1GSXA 3LI8A 1JNUA 3LIDA 4HP9A 2K7SA 4I5SA 3MJQA 1TS0A 4L9FA 1OTEA
chains in the Genus database with same CATH superfamily
5L09A 3IX3A 4WEKA 3DTKA 4L0LA 3UMDA 2PD7A 2OLVA 1DRMA 1H8MA 3W4PA 4B4ZA 2JN7A 3MS6A 3SZTA 1DJAA 2XRNA 3UN7A 2J80A 1RGYA 1Y28A 2M7UA 1G5UA 3Q1FA 3HLBA 3M6HA 3HLCA 3NBLA 4MN7A 4UA6A 2OOLA 3EQVA 4GW9A 1MY8A 2PU4A 5KZHA 1BLSA 1K25A 3E4OA 3IBRA 5CGWA 3BLMA 5FDHA 1CEGA 4K0XA 1OTBA 4KZ8A 5L2FA 4XT2B 4MNRA 4CLCA 3R7WB 4C3QA 1TDGA 1XA1A 3D4FA 3PAEA 1BLHA 3Q7VA 1CQAA 4EQ1A 3UNWA 4EEPA 5DKKA 1YLPA 1IYSA 5DJTA 1OTIA 2NUTC 3V50A 3KSIA 4HESA 2IWBA 3MF0A 4BBVA 2L0WA 5EVLA 4HH2A 1XJ6A 3GQZA 4DXCA 4E3NA 4B93A 2W3DA 3OLOA 3NCKA 1A0KA 4I3AA 1BUEA 2EX9A 5FQKA 4KZ5A 1FSWA 4CLCE 3IF5A 1D1JA 5E2HA 4ZAMA 1CI8A 3P98A 2OAQ1 4OP5A 4I39A 4X25A 5J7EA 1TVFA 4Q0HA 5FAOA 1L0FA 4JLFA 4PM5A 1BYWA 1O07A 1SHVA 4LLOB 1JWVA 3OPLA 2PDRA 1BSGA 1H3QA 3Q7VB 4YWZA 1K0KA 3KYZA 3L7HA 1YAXA 3G4PA 3QP2A 1YSQA 4UHUA 4GDBA 2INWA 2WKHA 2XA7M 3WS0A 1OJGA 3DTEA 4MMNA 2PAVP 4UA7A 5HD3A 1YMXA 5GHZA 2ZQ8A 4WZ4A 1NLYA 1J3WA 1ONGA 2BG1A 3CJMA 1Z6FA 3K3CA 4EETB 4GCZA 5DTTA 4WF0A 5EOOA 5GLDA 3ISGA 1LSWA 1O7EA 2L1MA 1ALQA 2Y4AA 2BASA 3ZFZA 2JKTM 4KZBA 5AQ9A 1FR1A 4S2NC 4QJGA 1Y4OA 4FH4A 2Y55A 5TR7A 2V2FF 3NHQA 3LR4A 4R4SA 1G68A 1DJBA 2ZQDA 2VGKA 4OH0A 2PBDP 3TSGA 4FSFA 1XGJA 1YMSA 3PBRA 1WE4A 5CERA 1GSXA 4PM6A 5L8MA 4JXVA 1OTEA 4HIAA 4B9OA 1NZUA 1JWZA 4RQ9A 4IEDA 4G3WA 2G2UA 5EE8A 4H6JA 5F82A 4E3KA 4KQQA 3AGEA 1LI0A 2HJ9C 1OTDA 4X1MA 5DF8A 4PHTA 3D9YA 2XSSA 4OOLA 3LI9A 5DF9A 2XD1A 3S22A 4OVDA 4HJ6A 4D60A 3VE4A 3FWLA 4Q0IA 3V67A 3KYEA 1OT6A 4WLAA 1DP6A 3T1RA 3T1XA 4KENB 4UA9A 3BJNA 4EQIA 3LIAA 3UDFA 4ZJ1A 1G28A 1VETA 3DAVA 1FCMA 1RCJA 1HZOA 1XXMA 3A3DA 3C7VA 2WGIA 4E3JA 4QU3A 3N7WA 1SDNA 1ES2A 4JXSA 5FQMA 3PBQA 3WS2A 1ESUA 3KYQA 5EOEA 4BL3A 2Z6CA 4R3AA 3P7NA 3M6BA 2ZL1A 1W8YA 4X53A 4FCFA 3R4KA 3GDIA 3JPUA 5G4YA 2XR0A 4C75A 2HZ5A 3IHAA 2C6WB 3NDGA 1YLJA 4GDNA 5HSQA 2VGLS 1Z09A 4O8GA 2KLIA 4BJPA 2W1RA 2XF3A 4YOFA 4HEFA 2LB5A 4GD6A 3MXRA 4MBKA 2W1TA 2C5WB 4LV1A 1D7EA 3S7NA 3EGDC 4BBUA 4S2IA 4QPRA 4QB8A 1W7FA 2Y2LA 3QNCA 1VM1A 5FI2A 3O87A 1AWIA 4IUKA 3E4QA 4ARZB 4EU0A 3CPTA 3HUNA 1BULA 2KOIA 2NUPC 3QP6A 2HDRA 4PKYA 3G2YA 1TF1A 1NYYA 3W8KA 1E3UA 3B3XA 3WS4A 3BFDA 4DE0A 2G2WA 3N8SA 1F5MA 4LPZA 2VGLM 1V9YA 3LGOA 4MBHA 5DKLA 3K2NA 3RFBA 3NOTC 5FQJA 1DJCA 4MN6A 3MQOA 5HPFA 4R1GA 1IOUA 1PW8A 1FOFA 1GHMA 3QP8A 1ONHA 3Q07A 3OPHA 4PM9A 4QWOA 5DVAA 4E3LA 4XXRA 3CI6A 3S4XA 3LFVA 5HAQA 5AVEA 1N9BA 3BRMA 4L9EA 5A8BA 2PR5A 3BY8A 1OTAA 4JF4A 3PXPA 2Y2JA 5A90A 2DCFA 4EWFA 4KG2A 1FILA 1LL8A 3CLOA 1NXYA 3GVBA 2WKRA 3GMWA 1WYBA 1NLZA 4I38A 3T4JA 3B42A 1NRFA 2CC1A 1KE3A 2DNSA 2WAEA 5TJJA 4G3KA 3O88A 5CTMA 4HJ3A 2D02A 5KSCA 4UAAA 3UDIA 1YLTA 4RX3A 3LEZA 1L0EA 2W3GA 3L9KA 2JKRI 1ERQA 3FYZA 2WAFA 3D3OA 3C38A 2XLNA 2VV6A 2E8IA 4IVKA 3E4PA 4LV2A 4CJNA 2ZM2A 5GLBA 5M19A 3NDEA 2ZQ9A 5TGFA 4OOMA 1TEMA 3MSHA 3ZG7B 2EWVA 4II7A 5HAIA 3ZG5A 4GS9A 3GV9A 2W0NA 2Y2PA 2GZAA 1YT4A 4KZ7A 3E0YA 3CWFA 1K6SA 1GCEA 5I5LA 1W63Q 4EESA 3LO7A 1DY6A 1PWCA 1BLPA 2EFUA 1K4EA 3HUOA 5U47A 4FTXA 5BOHA 4LFUA 5EV0A 4D2OA 1YM1A 1P0ZA 2YKFA 1M6KA 5HL6A 4IBXA 2Y2KA 5C5KA 3V5MA 4ARZA 4L9GA 3LR3A 3BLSA 3UPOA 3BQAA 5TFQA 2X02A 3F1PB 1KGGA 4R4RA 3SS5A 1EW0A 4JXGA 2Z2MB 1H8ZA 1MZUA 5DTSA 3LYXA 2Y91A 3LI8A 2PR6A 3A3JA 3VOZA 4Y2FA 4N9LA 3IF6C 4DKIA 3HLGA 5HARA 1BT5A 3LIEA 3VP0A 5F1FA 5F69A 1SCWA 1VEUA 2IWDA 4IBRA 3OOVA 1GHPA 2GDNA 2PU2A 5AQAA 3ZGAB 1PWDA 3U4LP 1S66L 1K55A 4DRTA 5CECA 2RL3A 2W3FA 3CZDA 3FPVA 1ACFA 5FQ9A 1FSYA 2YKHA 4HH3A 1HTZA 2ZJ9A 2OWJA 3E98A 3MMHA 3HUMA 5HWVA 5HFOA 3MZEA 3NOPC 3PTEA 4GN2A 2Q0OA 3NI9A 3H9WA 3P01A 5CHJA 2OWHA 3NOUC 4X6TA 5HX9A 1PWGA 3OBFA 4ETZA 3MR0A 1T1BA 3EGXC 3BY9A 5F83A 2HDQA 3T4KA 2VLGA 3WS5A 5DFYA 1IKGA 2Y2IA 2ZD8A 3G2ZA 5IU1A 4Y5FA 2V1ZA 1K56A 4GHIB 5J3WA 3QNBA 1S67L 3ITAA 4GZBA 3HCYA 1OJ5A 3DTIA 3JVVA 5EM0A 5EVIB 1T19A 3MXSA 4EBPA 4DJ2A 2ZMVA 1YPRA 2EX6A 2VGJA 3IS2A 4C6YA 2K31A 2J9OA 4BBTA 1VHMA 4R38A 1CI9A 1GHIA 3S1YA 2BTFP 2ZQCA 3MZDA 4O01A 3BFCA 1TD5A 2R9WA 4FD8A 3VFHA 3ZG9B 4S2OA 5EFWA 2J8YA 3LY3A 4PPRA 4BD1A 3PR6A 2FFYA 3VMAA 3CG5A 4DE3A 4KUOA 2KDKA 4HJ4A 2VV8A 3IXHA 4U0XA 3T4LA 1PRQA 2V1AA 3AGFA 1MWRA 2I9VA 2ZC5B 4S2JA 4ZBEA 3ZNTA 2X71A 4QY5A 4B88A 5CGXA 2A2LA 3BM6A 3HLFA 4OQHA 2AVXA 2ZL1B 3V3SA 5FEFA 4KQDA 3BECA 1PI4A 1S6RA 3LY4A 4LV3A 3KO6A 5EVEA 5CHUA 5E2EA 5CHMA 4R3BA 1AXBA 1LT0A 3UE0A 3N6IA 4NG2A 2H0TA 3F1PA 4GJ4A 3KSFA 5TBMB 2OAP1 4MCWA 3IXBA 1NWZA 4DJ3A 3F1OA 4KZ9A 2P08A 1UGUA 3HREA 5D3OA 3LICA 5A91A 4H8RA 4JF5A 1N4OA 2GJ3A 2H28A 4EV4A 1ES3A 3FC7A 3FZCA 3LUQA 1K56D 3VP3A 1WYCA 5FI6A 5KMWA 1OPXA 3BYDA 1W5DA 4LENA 4P6ZM 1H0MA 3S7QA 4DE1A 2Y2MA 3Q81A 3VSKA 1MKMA 4JF6A 3K3DA 4KG6A 4X69A 3T4QA 2A49A 4N92A 4BQMA 3UE1A 3UB6A 3S7OA 4DMZA 2HF6A 1UWPX 3OPRA 2A24B 2EX8A 2ZC6B 3IQAA 1IYQA 3CPTB 4S2LA 3T4OA 5CRFA 3G6OA 3MQ0A 1DP8A 1L3LA 1RP5A 5DF7A 5EUAA 1NY0A 3MFDA 3BW6A 3TE8A 3EOIA 1H5XA 1SZVA 2XEPA 2P7JA 5EM1A 3WS1A 4LRYC 4KUKA 4GNUA 1PFLA 2Z2LB 3KX0X 3NECA 1N9OA 4R0QA 3C2WA 1KDSA 1ZG6A 3A0RA 5FL3A 3SOIA 3NC8A 3Q82A 3QP4A 4OPRA 4H6JB 2UWXA 2WKIA 5A92A 1K38A 3BFGA 2H5SA 2IWCA 1U60A 3G32A 5LBRA 4R6LA 3MZFA 3LIDA 3G30A 1NYMA 3HBRA 5E2FA 5GHXA 5HD5A 2O9AA 4E3IA 2KX6A 3CITA 2EX2A 2HGVA 3ZNYA 3LIBA 2ACGA 1S4SA 1MBLA 3IS2B 4E3MA 3U2AA 5HWWA 1FCNA 5A93A 2Y2HA 1NZOA 5KSHA 1XJ2A 4PMAA 2ZBBA 4F3LA 3LR5A 4QD4A 2PBYA 4OPQA 5HPIA 3TOIA 3Q7ZA 4LV0A 4S2NA 4IHQA 2XA7S 3M2KA 3E2LA 2ZOHA 2V0UA 3F1NB 3IHBA 3T4TA 2B02A 5G18A 3IWQA 3S7PA 2W1TB 1K54A 1N9NA 4E6WA 4B4XA 1PI5A 4R3JA 3OZHA 4ETXA 3HLWA 3NJAA 1T18A 3SS4A 5JYPA 4O0PA 2PRFA 3FV7A 1KE0A 5GL9A 5HDCA 1ZG4A 2P04A 1PYYA 4NXEA 4E04A 1DP9A 3MFXA 1LL5A 4JPMA 1CEFA 1YLWA 1GSVA 4JGRA 3QP5A 1VB6A 3KSGA 4WMCA 3G31A 3IT9A 4EBLA 2I72A 5CX7A 4HI4A 3MKFA 4NXBA 3O86A 1VETB 4DXBA 2XQZA 2P9VB 1K55C 4OONA 4DDYA 2HJEA 1IEMA 3CUEA 4MBFA 3UDXA 2K7SA 4WEJA 3MJQA 2W27A 3PBSA 4WM9A 1PNEA 3CUEC 2XDMA 1IKIA 1EROA 3CMZA 1MWSA 4X56A 4OPZA 5GLAA 1S4RA 1E25A 4Y0UA 3EQUA 5MC7A 2DRWA 4LCMA 3IWIA 4OLDA 4LRXC 5EVIC 1XJ4A 2QJ7A 2V8CA 2Y2GA 4OP8A 1HD8A 3OCLA 4F3LB 4N1XA 2R78A 3BEBA 1GSWA 2V9AA 2EXBA 4WELA 4EEUA 2WADA 2Y79A 3MQQA 2HP6A 1XJ3A 1P9WA 1VEUB 4WUJA 2IA2A 4NKPA 4OQIA 1K4FA 1OMEA 1ES5A 4WMCD 3H7WA 5HW3A 4P87A 3TW8A 5CGSA 1F2KA 3A3EA 1XP4A 3KSHA 3DWKA 4BLMA 2J3TD 3BQ8A 1SDEA 1BLCA 3ZVWA 5HAPA 5FASA 1JTGA 2EWWA 5DFXA 5HDDA 2H0YA 2HPBA 3RXXA 1K54C 3MBZA 4RA7A 2WZXA 3NIAA 2QMIA 3P09A 5F68A 5IHVA 4UQIS 2J3WA 1Q2QA 1HLUP 5KIZA 2H10A 5M1AA 3FG8A 4NXGA 4XT2A 1XPBA 3ZYTA 1W79A 4U0TA 2FH5A 4JGOA 3NULA 1BZAA 4NXFA 4YFMA 5CXWA 1GA9A 5GLCA 2JKGA 2ZOIA 4WL9A 4RYEA 4KZ6A 4U3TA 1P97A 3TJZC 2ZC7A 4EW7A 5L07A 1ZHHB 1C3BA 2Y59A 3M2JA 3CAXA 1IYPA 3G35A 1PW1A 3UB9A 4GOGA 3UE6A 2OLUA 3SH8A 3N8LA 3C7UA 3W4OA 2G7UA 3W2ZA 2XFTA 5AJGA 2QJ5A 4GB7A 4OQ0A 2XD5A 4N1HA 2Q9MA 2XROA 1N9LA 3LIFA 1ERMA 5AQBA 1KOUA 2PT7A 1CF0A 4YNRA 3GECA 2WKQA 2JKRM 2WGWB 2QYBA 2JCHA 4E6XA 1G6OA 2CMNA 2XFSA 1UWNX 3DWZA 1TS7A 4Z9QA 1E4DA 5E2GA 4WZ5A 2JKTI 4K0WA 1BTLA 4M3KA 3UY6A 4CPKA 4XUXA 2J7VA 5F6AA 3MXQA 3VP4A 2ZQAA 4LGWA 2LB9A 2W3HA 2O0YA 3N8RA 1XKZA 1Y54A 3T12B 2ZQ7A 3IH9A 4HHDA 4QHCA 3UMEA 1NJ4A 3ZG8B 4Y0OA 3SH7A 4L9FA 2FZ0A 2ZMAA 2ZC3B 5FDSA 2XGNA 3IX8A 4GLQA 1MWTA 1S1ZA 1VQQA 4HQAA 4KQOA 3IH8A 1PZPA 4PM8A 3PBOA 3QHYA 4BL2A 4S2KA 3LEQA 5FI7A 3W4QA 2QKPA 2EXAA 1RGZA 1ES4A 1KGFA 4Y7PA 4IUHA 2A24A 5CTNA 4R23A 1LLBA 1K57A 2VJWA 2VV7A 4KZ4A 1LSXA 1IFQA 5IS1A 2Y2OA 4OPYA 3OCNA 1K6RA 3DBAA 4NK3A 2R9XA 2EFXA 2X01A 1F98A 4WN5A 4EBNA 3HLDA 2W3EA 2WGVA 4N9KA 3E2KA 2ZM8A 3JYIA 5FQQA 3UB8A 4WZ5C 2GX5A 3GR2A 3A0SA 3WWXA 5J8XA 3C8CA 4E3OA 4IJGA 3B47A 1KVLA 5I94A 1GA0A 5AQ7A 3OC2A 4EUZA 3VOLA 3PBNA 3BWLA 2JC7A 1I5QA 4FOFA 3T1SA 2GNXA 2QWSA 3IXGA 4HY8A 4Q8IA 3AGDA 4S2PA 3WRZA 3G34A 3PYPA 3T1QB 1CJFA 1TS6A 1S0WA 3RTYA 4MLLA 4DN0A 4P6ZS 1EI5A 5GHYA 2B95A 2B5RA 2VA0A 3HL9A 2VK3A 2HDSA 1I2SA 1W8QA 5CEDA 4ZDXA 2MJ6A 3MKEA 5EPHA 2Y8HA 2V20A 3A3IA 4ZRRA 3IF6A 1KDWA 4G3VA 2WUQA 4GD8A 4MDZA 3UO9A 1IELA 3VP2A 2XK1A 2PHYA 4BD0A 2HDUA 2WK0A 1X0OA 2PYPA 1LI9A 3ICYA 5EVID 1YKDA 4WBGA 1SKOB 4X55A 4OOYA 5M18A 4ZJ3A 3C5AA 4HNBA 4F94A 3N4IA 2JBFA 4JBFA 1J9MA 1QMEA 4Q0JA 1FR6A 5J4EA 2WGWA 1KGEA 2OSUA 4I5SA 2Y2NA 4Y3IA 4ZJ2A 4PAUA 4GKUA 4RVAA 3JVUA 5AVFA 5F1GA 4FH2A 2ZLYA 5DTKA 2VKSA 3RH8B 1G6AA 2JE5A 4LRZE 1LHYA 2WKPA 3ZHHA 2Z6DA 1JVJA 5E43A 4WYYA 3UPNA 2O99A 3ZG0A 5F5YA 4BWIA 3C4OA 4QY6A 2QPNA 1ZC2A 5G4ZA 1FIKA 1T1AA 2VX8A 1MWUA 2P9VA 4CLCD 3ITBA 4M4XA 4Y0TA 4JGQA 3VSLA 1NRJA 2J9PA 3EEHA 4KG5A 3TRCA 1KVMA 2E8JA 2V0WA 3SS3A 1LSVA 1JTDA 4BMWA 1W63M 1ZKJA 3UB5P 5HL1A 2J3TC 2Q9NA 2K2NA 2HV1A 1SKOA 1MPLA 4KQRA 1ODVA 3VOYA 3SH9A 4OKPA 2P74A 4K08A 4X1LA 1XA7A 4P6BA 5EECA 1MKIA 3ZDJA 4S2MA 2DMWA 3SW1A 3DTMA 4HOIA 4YINA 4R70A 4MN5A 3A0VA 3NY4A 5FSRA 4NETA 1QMFA 1YQSA 1SKFA 1XFQA 1YLZA 2M1CA 4RX2A 4P85A 5EVIA 1JWPA 3O3VA 4FUWA 5JYOA 2XH9A 4UEYA 4HBTA 3UPPA 1TS8A 4EXOA 4Y17A 3RXWA 4ID4A 3FKVA 4CQHA 2HP9A 5HWTA 3GTCA 2A3UA 4EUVA 5DJUA 3V3RA 3VP1A 1M40A 2WYXA 3FKWA 3VFFA 1STZA 1HVBA 3RJUA 3TG9A 4EERA 2EA9A 2B18A 3VE3A 2QZ6A 1PZOA 3HVFA 4O7DA 5K5BA 3F1OB 4LCLA 3PHYA 2PD8A 3HJIA 4JXWA 5TBMA 5HDSA 3BFFA 2ZC4B 1FCOA 4I3JA 2Y2QA 2ZMFA 4HP4A 1XX2A 2JHEA 2VZWA 4A5RA 4ESPA 1I2WA 4AFIA 4XUZA 4KZ3A 3EEAA 1F9IA 2RCXA 3ZCZA 3V39A 4X68A 3PAGA 5FAQA 4NEED 3IX4A 5FA7A 3GRJA 1EWZA 2L4RA 1LL9A 2V8FA 5L10A 2JKFA 3IF6B 4Y15A 4P0MA 3F1NA 4ME4A 1H8YA 2PYRA 5FATA 3IWOA 3C30A 4MEZA 1PIOA 4HP9A 5IT5A 1E3UD 4Z1WA 1TS0A 1D06A 4DF6A 4BENA 3H7WB 1P9RA 4DDSA 4PKYG 4Y13A 3CHWP 4IVIA 1V9ZA 4ZTKA 3A3FA 3VV4A 4K91A 5FEGA 1L0DA 2FFFB 1L0GA 1K57C 3PBTA 5HZHA 3B33A 3UB7A 3QP1A 3LCEA 1FQGA 3H82A 4PM7A 1KE4A 3BFEA 2UV0E 3DW0A 1ZTUA 3T4SA 4HBUA 1MC0A 2BLSA 4CLCC 5FQIA 1L2SA 3ULFA 2M7VA 3LR0A 4UQIM 1XGIA 3EWKA 2VEAA 4OLGA 3O5YA 2WKEA 2ZM0A 2OV5A 1IYOA 4GS9B 2O9CA 5CEBA 4CLCB 3IXDA 3C4PA 3T50A 1Q2PA 4JGPA 3IBJA 2O9BA 2D01A 3ZQ5A 1XFNA 1YSPA 3D72A 1CK3A 1T1CA 2QHKA 3H82B 3OPPA 4KZAA 1S1YA 2HP5A 2V1BA 3I7JA 4I3IA 3WRTA 3GSGA 1MXOA 1OT9A 3ZVTA 4OQGA 3HLEA 1TDLA 4DE2A 1ESIA 1YLYA 3UE3A 3R7WA 2WZZA 4GHIA 5FAPA 1WA9A 4JKTA 3FPWA 3HJKA 1JNUA
chains in the Genus database with same CATH topology
5HD5A 4HJ3A 2O9AA 2D02A 4WEKA 2KX6A 3VOLA 3CITA 3PBNA 3BWLA 2W3GA 2HGVA 5TJJA 2JKRI 4L0LA 3D3OA 4FOFA 3UMDA 3LIBA 2PD7A 3C38A 1DRMA 1H8MA 1S4SA 2VV6A 3E4PA 3IS2B 2GNXA 2JN7A 2QWSA 3U2AA 5HWWA 4OOMA 2XRNA 4HY8A 2J80A 1Y28A 2M7UA 2EWVA 4II7A 5KSHA 4GS9A 1XJ2A 4F3LA 2ZBBA 3LR5A 2W0NA 4MN7A 5HPIA 2GZAA 2OOLA 3EQVA 3PYPA 4GW9A 1TS6A 4IHQA 2XA7S 3E0YA 3RTYA 3CWFA 4DN0A 4P6ZS 2ZOHA 2V0UA 3F1NB 5I5LA 1W63Q 3T4TA 2B02A 3E4OA 3S7PA 2VA0A 3IBRA 4EESA 2W1TB 1N9NA 1OTBA 2MJ6A 4ETXA 4XT2B 1P0ZA 2Y8HA 4ZRRA 2YKFA 3NJAA 1T18A 4CLCA 3R7WB 4O0PA 5HL6A 5C5KA 4G3VA 4ARZA 5HDCA 4L9GA 4MDZA 2P04A 3LR3A 4NXEA 4E04A 2PHYA 1DP9A 3MFXA 1X0OA 2PYPA 3BQAA 4EQ1A 4EEPA 5DKKA 3ICYA 3F1PB 5DJTA 1OTIA 1YKDA 1GSVA 2NUTC 4JGRA 1VB6A 3KSGA 3KSIA 5CX7A 4HI4A 1EW0A 3MF0A 4HNBA 4BBVA 2L0WA 1MZUA 4HH2A 4NXBA 3LYXA 1XJ6A 4Q0JA 5J4EA 2HJEA 3CUEA 4B93A 3LI8A 2W3DA 2K7SA 4I5SA 3MJQA 4WEJA 3OLOA 2W27A 4Y3IA 4I3AA 2PR6A 3PBSA 4PAUA 3CUEC 4Y2FA 3JVUA 5AVFA 4CLCE 2VKSA 3RH8B 4LRZE 1S4RA 3EQUA 3LIEA 5MC7A 5F69A 3OOVA 2OAQ1 2WKPA 2Z6DA 4LRXC 4I39A 1XJ4A 2QJ7A 5J7EA 1S66L 2O99A 4Q0HA 3OCLA 4F3LB 2W3FA 3FPVA 2R78A 1BYWA 5F5YA 4BWIA 2YKHA 4LLOB 4HH3A 1GSWA 2V9AA 5G4ZA 1T1AA 2VX8A 4WELA 4EEUA 2Y79A 2OWJA 3MQQA 3E98A 3MMHA 4CLCD 1XJ3A 5HWVA 1P9WA 2PDRA 4WUJA 2IA2A 4NKPA 3NOPC 3H9WA 1H3QA 3P01A 4M4XA 4JGQA 3H7WA 1NRJA 3EEHA 2OWHA 4YWZA 3NOUC 3KYZA 3TW8A 3TRCA 1YAXA 2V0WA 1YSQA 3KSHA 3OBFA 1LSVA 4BMWA 4ETZA 3MR0A 1T1BA 3EGXC 1W63M 3BY9A 2J3TD 3BQ8A 2INWA 3T4KA 2VLGA 2XA7M 2J3TC 5DFYA 1OJGA 4MMNA 2K2NA 2HV1A 5HD3A 5IU1A 1NLYA 1ODVA 2EWWA 4Y5FA 3K3CA 5DFXA 5HDDA 4EETB 4GCZA 4WF0A 1LSWA 4GHIB 4K08A 5J3WA 2L1MA 1S67L 2BASA 2JKTM 3HCYA 1OJ5A 3JVVA 5F68A 4UQIS 1T19A 2J3WA 2DMWA 3SW1A 3NHQA 4HOIA 3LR4A 4R70A 4DJ2A 4MN5A 3A0VA 5KIZA 2ZMVA 3FG8A 4NXGA 4XT2A 3ZYTA 3IS2A 2K31A 2FH5A 4BBTA 1VHMA 4FSFA 4JGOA 1XFQA 3PBRA 4R38A 2M1CA 4NXFA 1GSXA 5L8MA 1OTEA 4HIAA 4B9OA 2ZOIA 4WL9A 4RQ9A 1P97A 4G3WA 3TJZC 4EW7A 4UEYA 1ZHHB 4O01A 1TS8A 4EXOA 4H6JA 1TD5A 3CAXA 2HJ9C 4CQHA 5HWTA 1OTDA 3UB9A 4PHTA 5EFWA 4EUVA 5DJUA 2XSSA 4OOLA 3UE6A 3LI9A 3PR6A 5DF9A 1STZA 4EERA 2EA9A 4HJ6A 2B18A 4KUOA 3VE3A 2G7UA 3VE4A 3W2ZA 5AJGA 4Q0IA 2KDKA 2QJ5A 4HJ4A 3V67A 5K5BA 3F1OB 1OT6A 2XROA 2VV8A 3PHYA 4WLAA 1DP6A 1N9LA 3LIFA 2PD8A 3HJIA 3T4LA 2V1AA 1KOUA 2PT7A 2I9VA 4YNRA 5TBMA 3GECA 2WKQA 5HDSA 3BJNA 3LIAA 2JKRM 2QYBA 4I3JA 1G28A 2A2LA 1G6OA 2ZMFA 2CMNA 4HP4A 4KQDA 1UWNX 2JHEA 2VZWA 1TS7A 4AFIA 3EEAA 2JKTI 3KO6A 1F9IA 1LT0A 3PBQA 3F1PA 4GJ4A 3KSFA 3KYQA 4NEED 5TBMB 2Z6CA 2OAP1 4MCWA 4R3AA 3P7NA 1NWZA 4DJ3A 5F6AA 3MXQA 3R4KA 3GDIA 3F1OA 2P08A 2L4RA 5G4YA 1UGUA 2LB9A 2W3HA 2O0YA 3LICA 3F1NA 4ME4A 5HSQA 2VGLS 4O8GA 2KLIA 2GJ3A 4HHDA 2W1RA 4BJPA 4YOFA 2LB5A 2H28A 3UMEA 2PYRA 3C30A 3FC7A 3LUQA 2W1TA 4HP9A 5IT5A 1OPXA 4Z1WA 1TS0A 4L9FA 1D06A 1D7EA 3EGDC 4P6ZM 3S7NA 3H7WB 1P9RA 4QPRA 4BBUA 3S7QA 2FZ0A 1MKMA 3K3DA 4PKYG 3T4QA 4GLQA 1V9ZA 3VV4A 4IUKA 3UB6A 3E4QA 4ARZB 1S1ZA 3S7OA 4HQAA 4EU0A 4KQOA 2KOIA 2NUPC 3PBOA 4DMZA 2HF6A 3PBTA 1UWPX 4PKYA 5HZHA 2A24B 1TF1A 3B33A 3UB7A 2QKPA 3H82A 3T4OA 3MQ0A 3G6OA 1ZTUA 1DP8A 3T4SA 1MC0A 4CLCC 1F5MA 3ULFA 4IUHA 4LPZA 2VGLM 3BW6A 2A24A 2M7VA 1V9YA 3TE8A 3EOIA 3LR0A 4UQIM 5DKLA 2P7JA 3EWKA 3K2NA 2VEAA 3RFBA 3NOTC 4LRYC 3O5YA 4KUKA 4MN6A 3MQOA 2VJWA 2VV7A 4GS9B 5HPFA 1IOUA 2O9CA 1LSXA 1IFQA 4CLCB 5IS1A 3KX0X 3T50A 1N9OA 3OCNA 3DBAA 3C2WA 3CI6A 4JGPA 3IBJA 3LFVA 2O9BA 2D01A 5AVEA 3ZQ5A 3A0RA 1XFNA 1YSPA 4L9EA 5A8BA 5FL3A 1F98A 4WN5A 2PR5A 3D72A 3BY8A 1OTAA 2W3EA 3PXPA 1T1CA 2QHKA 3H82B 1S1YA 2V1BA 4H6JB 3UB8A 1LL8A 4I3IA 3CLOA 2GX5A 1OT9A 3A0SA 2WKRA 3C8CA 1NLZA 4I38A 3T4JA 3B42A 3R7WA 3UE3A 4IJGA 3B47A 4GHIA 1WA9A 3FPWA 5LBRA 3HJKA 4R6LA 1JNUA 3LIDA 3OC2A 4G3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D06 A;  3OLO A;  4I3A A;  1D7E A;  2PR6 A;  5HD5 A;  3H7W B;  4HJ3 A;  2ZOI A;  2D02 A;  4WL9 A;  4BBU A;  4RQ9 A;  1P97 A;  4EW7 A;  3K3D A;  5AVF A;  4PKY G;  2KX6 A;  3VOL A;  3RH8 B;  1TS8 A;  4EXO A;  4H6J A;  3BWL A;  4LRZ E;  1S4R A;  1V9Z A;  3CAX A;  3LIE A;  3UMD A;  3LIB A;  2PD7 A;  5F69 A;  5HWT A;  1DRM A;  1S4S A;  2VV6 A;  3E4Q A;  1OTD A;  3UB9 A;  3UB6 A;  1S1Z A;  3E4P A;  4HQA A;  5EFW A;  2WKP A;  3IS2 B;  2JN7 A;  2QWS A;  2Z6D A;  4I39 A;  4LRX C;  5DJU A;  5HWW A;  3UE6 A;  3LI9 A;  1XJ4 A;  4HY8 A;  2QJ7 A;  2J80 A;  4EQ1 A;  1Y28 A;  5J7E A;  1UWP X;  4PKY A;  5HZH A;  1S66 L;  2A24 B;  3B33 A;  3UB7 A;  4GS9 A;  4F3L B;  1XJ2 A;  4F3L A;  2ZBB A;  5TBM B;  2R78 A;  1BYW A;  2EA9 A;  2QKP A;  4HJ6 A;  3H82 A;  5F5Y A;  4EER A;  4KUO A;  3VE3 A;  2YKH A;  4LLO B;  4HH3 A;  1GSW A;  2V9A A;  2W0N A;  5G4Z A;  3VE4 A;  1T1A A;  2KDK A;  2QJ5 A;  4EEU A;  4HJ4 A;  2OWJ A;  3MQQ A;  2OOL A;  3PYP A;  4GW9 A;  1TS6 A;  1XJ3 A;  5HWV A;  3G6O A;  1DP8 A;  3F1O B;  1OT6 A;  2PDR A;  4WUJ A;  3RTY A;  3CWF A;  3NOP C;  2VV8 A;  3PHY A;  4WLA A;  1DP6 A;  1N9L A;  3H9W A;  3LIF A;  4M4X A;  2PD8 A;  3HJI A;  4JGQ A;  2V1A A;  2ZOH A;  1KOU A;  3ULF A;  3H7W A;  2V0U A;  3F1N B;  5I5L A;  2I9V A;  5TBM A;  4LPZ A;  3EEH A;  2B02 A;  3E4O A;  2OWH A;  3GEC A;  2WKQ A;  3IBR A;  3NOU C;  2A24 A;  5HDS A;  1V9Y A;  4YWZ A;  4EES A;  3LIA A;  1N9N A;  2V0W A;  1OTB A;  5DKL A;  2P7J A;  4I3J A;  1G28 A;  1LSV A;  3EWK A;  3MR0 A;  1T1B A;  2VEA A;  3BY9 A;  3ZQ5 A;  3NOT C;  4LRY C;  2CMN A;  4HP4 A;  4KUK A;  4MN6 A;  3MQO A;  1UWN X;  2INW A;  4HIA A;  2JHE A;  4KQD A;  2VLG A;  4B9O A;  1TS7 A;  4XT2 B;  2VV7 A;  4GS9 B;  1OJG A;  1P0Z A;  1LSX A;  2YKF A;  3NJA A;  1T18 A;  2HV1 A;  3KX0 X;  5IS1 A;  5HD3 A;  5IU1 A;  3T50 A;  1F9I A;  1N9O A;  1ODV A;  5HDC A;  4L9G A;  1LT0 A;  3K3C A;  5F6A A;  3C2W A;  5HDD A;  3F1P A;  4EET B;  4GCZ A;  4JGP A;  2D01 A;  4NXE A;  5AVE A;  4E04 A;  2PHY A;  1DP9 A;  3A0R A;  1XFN A;  3MFX A;  1LSW A;  4GHI B;  4K08 A;  4L9E A;  4WF0 A;  5J3W A;  1F98 A;  2Z6C A;  5A8B A;  1X0O A;  2PYP A;  4WN5 A;  4R3A A;  2L1M A;  2PR5 A;  1NWZ A;  3P7N A;  3D72 A;  4DJ3 A;  1S67 L;  1OTA A;  3BY8 A;  5DKK A;  3ICY A;  4EEP A;  2BAS A;  3F1P B;  3MXQ A;  1T1C A;  2W27 A;  3GDI A;  3F1O A;  5DJT A;  2QHK A;  1OJ5 A;  3H82 B;  2L4R A;  1OTI A;  1S1Y A;  5G4Y A;  1GSV A;  1UGU A;  2V1B A;  4JGR A;  1T19 A;  5F68 A;  4H6J B;  1VB6 A;  3UB8 A;  3NHQ A;  1LL8 A;  4HOI A;  4I3I A;  4R70 A;  4DJ2 A;  3CLO A;  3SW1 A;  3LIC A;  3F1N A;  4MN5 A;  1OT9 A;  3A0S A;  5HSQ A;  2WKR A;  3A0V A;  5KIZ A;  3FG8 A;  4NXG A;  4HI4 A;  1EW0 A;  4HHD A;  2GJ3 A;  3C8C A;  4HNB A;  4XT2 A;  2L0W A;  4I38 A;  1MZU A;  4BBV A;  3IS2 A;  2H28 A;  4HH2 A;  3UME A;  4NXB A;  2PYR A;  3LYX A;  1XJ6 A;  4BBT A;  3FC7 A;  4GHI A;  4JGO A;  5J4E A;  3LUQ A;  1WA9 A;  1XFQ A;  4R38 A;  3HJK A;  2M1C A;  4NXF A;  4R6L A;  1GSX A;  3LI8 A;  1JNU A;  3LID A;  4HP9 A;  2K7S A;  4I5S A;  3MJQ A;  1TS0 A;  4L9F A;  1OTE A; 
#chains in the Genus database with same CATH topology
 5L09 A;  3IX3 A;  4WEK A;  3DTK A;  4L0L A;  3UMD A;  2PD7 A;  2OLV A;  1DRM A;  1H8M A;  3W4P A;  4B4Z A;  2JN7 A;  3MS6 A;  3SZT A;  1DJA A;  2XRN A;  3UN7 A;  2J80 A;  1RGY A;  1Y28 A;  2M7U A;  1G5U A;  3Q1F A;  3HLB A;  3M6H A;  3HLC A;  3NBL A;  4MN7 A;  4UA6 A;  2OOL A;  3EQV A;  4GW9 A;  1MY8 A;  2PU4 A;  5KZH A;  1BLS A;  1K25 A;  3E4O A;  3IBR A;  5CGW A;  3BLM A;  5FDH A;  1CEG A;  4K0X A;  1OTB A;  4KZ8 A;  5L2F A;  4XT2 B;  4MNR A;  4CLC A;  3R7W B;  4C3Q A;  1TDG A;  1XA1 A;  3D4F A;  3PAE A;  1BLH A;  3Q7V A;  1CQA A;  4EQ1 A;  3UNW A;  4EEP A;  5DKK A;  1YLP A;  1IYS A;  5DJT A;  1OTI A;  2NUT C;  3V50 A;  3KSI A;  4HES A;  2IWB A;  3MF0 A;  4BBV A;  2L0W A;  5EVL A;  4HH2 A;  1XJ6 A;  3GQZ A;  4DXC A;  4E3N A;  4B93 A;  2W3D A;  3OLO A;  3NCK A;  1A0K A;  4I3A A;  1BUE A;  2EX9 A;  5FQK A;  4KZ5 A;  1FSW A;  4CLC E;  3IF5 A;  1D1J A;  5E2H A;  4ZAM A;  1CI8 A;  3P98 A;  2OAQ 1;  4OP5 A;  4I39 A;  4X25 A;  5J7E A;  1TVF A;  4Q0H A;  5FAO A;  1L0F A;  4JLF A;  4PM5 A;  1BYW A;  1O07 A;  1SHV A;  4LLO B;  1JWV A;  3OPL A;  2PDR A;  1BSG A;  1H3Q A;  3Q7V B;  4YWZ A;  1K0K A;  3KYZ A;  3L7H A;  1YAX A;  3G4P A;  3QP2 A;  1YSQ A;  4UHU A;  4GDB A;  2INW A;  2WKH A;  2XA7 M;  3WS0 A;  1OJG A;  3DTE A;  4MMN A;  2PAV P;  4UA7 A;  5HD3 A;  1YMX A;  5GHZ A;  2ZQ8 A;  4WZ4 A;  1NLY A;  1J3W A;  1ONG A;  2BG1 A;  3CJM A;  1Z6F A;  3K3C A;  4EET B;  4GCZ A;  5DTT A;  4WF0 A;  5EOO A;  5GLD A;  3ISG A;  1LSW A;  1O7E A;  2L1M A;  1ALQ A;  2Y4A A;  2BAS A;  3ZFZ A;  2JKT M;  4KZB A;  5AQ9 A;  1FR1 A;  4S2N C;  4QJG A;  1Y4O A;  4FH4 A;  2Y55 A;  5TR7 A;  2V2F F;  3NHQ A;  3LR4 A;  4R4S A;  1G68 A;  1DJB A;  2ZQD A;  2VGK A;  4OH0 A;  2PBD P;  3TSG A;  4FSF A;  1XGJ A;  1YMS A;  3PBR A;  1WE4 A;  5CER A;  1GSX A;  4PM6 A;  5L8M A;  4JXV A;  1OTE A;  4HIA A;  4B9O A;  1NZU A;  1JWZ A;  4RQ9 A;  4IED A;  4G3W A;  2G2U A;  5EE8 A;  4H6J A;  5F82 A;  4E3K A;  4KQQ A;  3AGE A;  1LI0 A;  2HJ9 C;  1OTD A;  4X1M A;  5DF8 A;  4PHT A;  3D9Y A;  2XSS A;  4OOL A;  3LI9 A;  5DF9 A;  2XD1 A;  3S22 A;  4OVD A;  4HJ6 A;  4D60 A;  3VE4 A;  3FWL A;  4Q0I A;  3V67 A;  3KYE A;  1OT6 A;  4WLA A;  1DP6 A;  3T1R A;  3T1X A;  4KEN B;  4UA9 A;  3BJN A;  4EQI A;  3LIA A;  3UDF A;  4ZJ1 A;  1G28 A;  1VET A;  3DAV A;  1FCM A;  1RCJ A;  1HZO A;  1XXM A;  3A3D A;  3C7V A;  2WGI A;  4E3J A;  4QU3 A;  3N7W A;  1SDN A;  1ES2 A;  4JXS A;  5FQM A;  3PBQ A;  3WS2 A;  1ESU A;  3KYQ A;  5EOE A;  4BL3 A;  2Z6C A;  4R3A A;  3P7N A;  3M6B A;  2ZL1 A;  1W8Y A;  4X53 A;  4FCF A;  3R4K A;  3GDI A;  3JPU A;  5G4Y A;  2XR0 A;  4C75 A;  2HZ5 A;  3IHA A;  2C6W B;  3NDG A;  1YLJ A;  4GDN A;  5HSQ A;  2VGL S;  1Z09 A;  4O8G A;  2KLI A;  4BJP A;  2W1R A;  2XF3 A;  4YOF A;  4HEF A;  2LB5 A;  4GD6 A;  3MXR A;  4MBK A;  2W1T A;  2C5W B;  4LV1 A;  1D7E A;  3S7N A;  3EGD C;  4BBU A;  4S2I A;  4QPR A;  4QB8 A;  1W7F A;  2Y2L A;  3QNC A;  1VM1 A;  5FI2 A;  3O87 A;  1AWI A;  4IUK A;  3E4Q A;  4ARZ B;  4EU0 A;  3CPT A;  3HUN A;  1BUL A;  2KOI A;  2NUP C;  3QP6 A;  2HDR A;  4PKY A;  3G2Y A;  1TF1 A;  1NYY A;  3W8K A;  1E3U A;  3B3X A;  3WS4 A;  3BFD A;  4DE0 A;  2G2W A;  3N8S A;  1F5M A;  4LPZ A;  2VGL M;  1V9Y A;  3LGO A;  4MBH A;  5DKL A;  3K2N A;  3RFB A;  3NOT C;  5FQJ A;  1DJC A;  4MN6 A;  3MQO A;  5HPF A;  4R1G A;  1IOU A;  1PW8 A;  1FOF A;  1GHM A;  3QP8 A;  1ONH A;  3Q07 A;  3OPH A;  4PM9 A;  4QWO A;  5DVA A;  4E3L A;  4XXR A;  3CI6 A;  3S4X A;  3LFV A;  5HAQ A;  5AVE A;  1N9B A;  3BRM A;  4L9E A;  5A8B A;  2PR5 A;  3BY8 A;  1OTA A;  4JF4 A;  3PXP A;  2Y2J A;  5A90 A;  2DCF A;  4EWF A;  4KG2 A;  1FIL A;  1LL8 A;  3CLO A;  1NXY A;  3GVB A;  2WKR A;  3GMW A;  1WYB A;  1NLZ A;  4I38 A;  3T4J A;  3B42 A;  1NRF A;  2CC1 A;  1KE3 A;  2DNS A;  2WAE A;  5TJJ A;  4G3K A;  3O88 A;  5CTM A;  4HJ3 A;  2D02 A;  5KSC A;  4UAA A;  3UDI A;  1YLT A;  4RX3 A;  3LEZ A;  1L0E A;  2W3G A;  3L9K A;  2JKR I;  1ERQ A;  3FYZ A;  2WAF A;  3D3O A;  3C38 A;  2XLN A;  2VV6 A;  2E8I A;  4IVK A;  3E4P A;  4LV2 A;  4CJN A;  2ZM2 A;  5GLB A;  5M19 A;  3NDE A;  2ZQ9 A;  5TGF A;  4OOM A;  1TEM A;  3MSH A;  3ZG7 B;  2EWV A;  4II7 A;  5HAI A;  3ZG5 A;  4GS9 A;  3GV9 A;  2W0N A;  2Y2P A;  2GZA A;  1YT4 A;  4KZ7 A;  3E0Y A;  3CWF A;  1K6S A;  1GCE A;  5I5L A;  1W63 Q;  4EES A;  3LO7 A;  1DY6 A;  1PWC A;  1BLP A;  2EFU A;  1K4E A;  3HUO A;  5U47 A;  4FTX A;  5BOH A;  4LFU A;  5EV0 A;  4D2O A;  1YM1 A;  1P0Z A;  2YKF A;  1M6K A;  5HL6 A;  4IBX A;  2Y2K A;  5C5K A;  3V5M A;  4ARZ A;  4L9G A;  3LR3 A;  3BLS A;  3UPO A;  3BQA A;  5TFQ A;  2X02 A;  3F1P B;  1KGG A;  4R4R A;  3SS5 A;  1EW0 A;  4JXG A;  2Z2M B;  1H8Z A;  1MZU A;  5DTS A;  3LYX A;  2Y91 A;  3LI8 A;  2PR6 A;  3A3J A;  3VOZ A;  4Y2F A;  4N9L A;  3IF6 C;  4DKI A;  3HLG A;  5HAR A;  1BT5 A;  3LIE A;  3VP0 A;  5F1F A;  5F69 A;  1SCW A;  1VEU A;  2IWD A;  4IBR A;  3OOV A;  1GHP A;  2GDN A;  2PU2 A;  5AQA A;  3ZGA B;  1PWD A;  3U4L P;  1S66 L;  1K55 A;  4DRT A;  5CEC A;  2RL3 A;  2W3F A;  3CZD A;  3FPV A;  1ACF A;  5FQ9 A;  1FSY A;  2YKH A;  4HH3 A;  1HTZ A;  2ZJ9 A;  2OWJ A;  3E98 A;  3MMH A;  3HUM A;  5HWV A;  5HFO A;  3MZE A;  3NOP C;  3PTE A;  4GN2 A;  2Q0O A;  3NI9 A;  3H9W A;  3P01 A;  5CHJ A;  2OWH A;  3NOU C;  4X6T A;  5HX9 A;  1PWG A;  3OBF A;  4ETZ A;  3MR0 A;  1T1B A;  3EGX C;  3BY9 A;  5F83 A;  2HDQ A;  3T4K A;  2VLG A;  3WS5 A;  5DFY A;  1IKG A;  2Y2I A;  2ZD8 A;  3G2Z A;  5IU1 A;  4Y5F A;  2V1Z A;  1K56 A;  4GHI B;  5J3W A;  3QNB A;  1S67 L;  3ITA A;  4GZB A;  3HCY A;  1OJ5 A;  3DTI A;  3JVV A;  5EM0 A;  5EVI B;  1T19 A;  3MXS A;  4EBP A;  4DJ2 A;  2ZMV A;  1YPR A;  2EX6 A;  2VGJ A;  3IS2 A;  4C6Y A;  2K31 A;  2J9O A;  4BBT A;  1VHM A;  4R38 A;  1CI9 A;  1GHI A;  3S1Y A;  2BTF P;  2ZQC A;  3MZD A;  4O01 A;  3BFC A;  1TD5 A;  2R9W A;  4FD8 A;  3VFH A;  3ZG9 B;  4S2O A;  5EFW A;  2J8Y A;  3LY3 A;  4PPR A;  4BD1 A;  3PR6 A;  2FFY A;  3VMA A;  3CG5 A;  4DE3 A;  4KUO A;  2KDK A;  4HJ4 A;  2VV8 A;  3IXH A;  4U0X A;  3T4L A;  1PRQ A;  2V1A A;  3AGF A;  1MWR A;  2I9V A;  2ZC5 B;  4S2J A;  4ZBE A;  3ZNT A;  2X71 A;  4QY5 A;  4B88 A;  5CGX A;  2A2L A;  3BM6 A;  3HLF A;  4OQH A;  2AVX A;  2ZL1 B;  3V3S A;  5FEF A;  4KQD A;  3BEC A;  1PI4 A;  1S6R A;  3LY4 A;  4LV3 A;  3KO6 A;  5EVE A;  5CHU A;  5E2E A;  5CHM A;  4R3B A;  1AXB A;  1LT0 A;  3UE0 A;  3N6I A;  4NG2 A;  2H0T A;  3F1P A;  4GJ4 A;  3KSF A;  5TBM B;  2OAP 1;  4MCW A;  3IXB A;  1NWZ A;  4DJ3 A;  3F1O A;  4KZ9 A;  2P08 A;  1UGU A;  3HRE A;  5D3O A;  3LIC A;  5A91 A;  4H8R A;  4JF5 A;  1N4O A;  2GJ3 A;  2H28 A;  4EV4 A;  1ES3 A;  3FC7 A;  3FZC A;  3LUQ A;  1K56 D;  3VP3 A;  1WYC A;  5FI6 A;  5KMW A;  1OPX A;  3BYD A;  1W5D A;  4LEN A;  4P6Z M;  1H0M A;  3S7Q A;  4DE1 A;  2Y2M A;  3Q81 A;  3VSK A;  1MKM A;  4JF6 A;  3K3D A;  4KG6 A;  4X69 A;  3T4Q A;  2A49 A;  4N92 A;  4BQM A;  3UE1 A;  3UB6 A;  3S7O A;  4DMZ A;  2HF6 A;  1UWP X;  3OPR A;  2A24 B;  2EX8 A;  2ZC6 B;  3IQA A;  1IYQ A;  3CPT B;  4S2L A;  3T4O A;  5CRF A;  3G6O A;  3MQ0 A;  1DP8 A;  1L3L A;  1RP5 A;  5DF7 A;  5EUA A;  1NY0 A;  3MFD A;  3BW6 A;  3TE8 A;  3EOI A;  1H5X A;  1SZV A;  2XEP A;  2P7J A;  5EM1 A;  3WS1 A;  4LRY C;  4KUK A;  4GNU A;  1PFL A;  2Z2L B;  3KX0 X;  3NEC A;  1N9O A;  4R0Q A;  3C2W A;  1KDS A;  1ZG6 A;  3A0R A;  5FL3 A;  3SOI A;  3NC8 A;  3Q82 A;  3QP4 A;  4OPR A;  4H6J B;  2UWX A;  2WKI A;  5A92 A;  1K38 A;  3BFG A;  2H5S A;  2IWC A;  1U60 A;  3G32 A;  5LBR A;  4R6L A;  3MZF A;  3LID A;  3G30 A;  1NYM A;  3HBR A;  5E2F A;  5GHX A;  5HD5 A;  2O9A A;  4E3I A;  2KX6 A;  3CIT A;  2EX2 A;  2HGV A;  3ZNY A;  3LIB A;  2ACG A;  1S4S A;  1MBL A;  3IS2 B;  4E3M A;  3U2A A;  5HWW A;  1FCN A;  5A93 A;  2Y2H A;  1NZO A;  5KSH A;  1XJ2 A;  4PMA A;  2ZBB A;  4F3L A;  3LR5 A;  4QD4 A;  2PBY A;  4OPQ A;  5HPI A;  3TOI A;  3Q7Z A;  4LV0 A;  4S2N A;  4IHQ A;  2XA7 S;  3M2K A;  3E2L A;  2ZOH A;  2V0U A;  3F1N B;  3IHB A;  3T4T A;  2B02 A;  5G18 A;  3IWQ A;  3S7P A;  2W1T B;  1K54 A;  1N9N A;  4E6W A;  4B4X A;  1PI5 A;  4R3J A;  3OZH A;  4ETX A;  3HLW A;  3NJA A;  1T18 A;  3SS4 A;  5JYP A;  4O0P A;  2PRF A;  3FV7 A;  1KE0 A;  5GL9 A;  5HDC A;  1ZG4 A;  2P04 A;  1PYY A;  4NXE A;  4E04 A;  1DP9 A;  3MFX A;  1LL5 A;  4JPM A;  1CEF A;  1YLW A;  1GSV A;  4JGR A;  3QP5 A;  1VB6 A;  3KSG A;  4WMC A;  3G31 A;  3IT9 A;  4EBL A;  2I72 A;  5CX7 A;  4HI4 A;  3MKF A;  4NXB A;  3O86 A;  1VET B;  4DXB A;  2XQZ A;  2P9V B;  1K55 C;  4OON A;  4DDY A;  2HJE A;  1IEM A;  3CUE A;  4MBF A;  3UDX A;  2K7S A;  4WEJ A;  3MJQ A;  2W27 A;  3PBS A;  4WM9 A;  1PNE A;  3CUE C;  2XDM A;  1IKI A;  1ERO A;  3CMZ A;  1MWS A;  4X56 A;  4OPZ A;  5GLA A;  1S4R A;  1E25 A;  4Y0U A;  3EQU A;  5MC7 A;  2DRW A;  4LCM A;  3IWI A;  4OLD A;  4LRX C;  5EVI C;  1XJ4 A;  2QJ7 A;  2V8C A;  2Y2G A;  4OP8 A;  1HD8 A;  3OCL A;  4F3L B;  4N1X A;  2R78 A;  3BEB A;  1GSW A;  2V9A A;  2EXB A;  4WEL A;  4EEU A;  2WAD A;  2Y79 A;  3MQQ A;  2HP6 A;  1XJ3 A;  1P9W A;  1VEU B;  4WUJ A;  2IA2 A;  4NKP A;  4OQI A;  1K4F A;  1OME A;  1ES5 A;  4WMC D;  3H7W A;  5HW3 A;  4P87 A;  3TW8 A;  5CGS A;  1F2K A;  3A3E A;  1XP4 A;  3KSH A;  3DWK A;  4BLM A;  2J3T D;  3BQ8 A;  1SDE A;  1BLC A;  3ZVW A;  5HAP A;  5FAS A;  1JTG A;  2EWW A;  5DFX A;  5HDD A;  2H0Y A;  2HPB A;  3RXX A;  1K54 C;  3MBZ A;  4RA7 A;  2WZX A;  3NIA A;  2QMI A;  3P09 A;  5F68 A;  5IHV A;  4UQI S;  2J3W A;  1Q2Q A;  1HLU P;  5KIZ A;  2H10 A;  5M1A A;  3FG8 A;  4NXG A;  4XT2 A;  1XPB A;  3ZYT A;  1W79 A;  4U0T A;  2FH5 A;  4JGO A;  3NUL A;  1BZA A;  4NXF A;  4YFM A;  5CXW A;  1GA9 A;  5GLC A;  2JKG A;  2ZOI A;  4WL9 A;  4RYE A;  4KZ6 A;  4U3T A;  1P97 A;  3TJZ C;  2ZC7 A;  4EW7 A;  5L07 A;  1ZHH B;  1C3B A;  2Y59 A;  3M2J A;  3CAX A;  1IYP A;  3G35 A;  1PW1 A;  3UB9 A;  4GOG A;  3UE6 A;  2OLU A;  3SH8 A;  3N8L A;  3C7U A;  3W4O A;  2G7U A;  3W2Z A;  2XFT A;  5AJG A;  2QJ5 A;  4GB7 A;  4OQ0 A;  2XD5 A;  4N1H A;  2Q9M A;  2XRO A;  1N9L A;  3LIF A;  1ERM A;  5AQB A;  1KOU A;  2PT7 A;  1CF0 A;  4YNR A;  3GEC A;  2WKQ A;  2JKR M;  2WGW B;  2QYB A;  2JCH A;  4E6X A;  1G6O A;  2CMN A;  2XFS A;  1UWN X;  3DWZ A;  1TS7 A;  4Z9Q A;  1E4D A;  5E2G A;  4WZ5 A;  2JKT I;  4K0W A;  1BTL A;  4M3K A;  3UY6 A;  4CPK A;  4XUX A;  2J7V A;  5F6A A;  3MXQ A;  3VP4 A;  2ZQA A;  4LGW A;  2LB9 A;  2W3H A;  2O0Y A;  3N8R A;  1XKZ A;  1Y54 A;  3T12 B;  2ZQ7 A;  3IH9 A;  4HHD A;  4QHC A;  3UME A;  1NJ4 A;  3ZG8 B;  4Y0O A;  3SH7 A;  4L9F A;  2FZ0 A;  2ZMA A;  2ZC3 B;  5FDS A;  2XGN A;  3IX8 A;  4GLQ A;  1MWT A;  1S1Z A;  1VQQ A;  4HQA A;  4KQO A;  3IH8 A;  1PZP A;  4PM8 A;  3PBO A;  3QHY A;  4BL2 A;  4S2K A;  3LEQ A;  5FI7 A;  3W4Q A;  2QKP A;  2EXA A;  1RGZ A;  1ES4 A;  1KGF A;  4Y7P A;  4IUH A;  2A24 A;  5CTN A;  4R23 A;  1LLB A;  1K57 A;  2VJW A;  2VV7 A;  4KZ4 A;  1LSX A;  1IFQ A;  5IS1 A;  2Y2O A;  4OPY A;  3OCN A;  1K6R A;  3DBA A;  4NK3 A;  2R9X A;  2EFX A;  2X01 A;  1F98 A;  4WN5 A;  4EBN A;  3HLD A;  2W3E A;  2WGV A;  4N9K A;  3E2K A;  2ZM8 A;  3JYI A;  5FQQ A;  3UB8 A;  4WZ5 C;  2GX5 A;  3GR2 A;  3A0S A;  3WWX A;  5J8X A;  3C8C A;  4E3O A;  4IJG A;  3B47 A;  1KVL A;  5I94 A;  1GA0 A;  5AQ7 A;  3OC2 A;  4EUZ A;  3VOL A;  3PBN A;  3BWL A;  2JC7 A;  1I5Q A;  4FOF A;  3T1S A;  2GNX A;  2QWS A;  3IXG A;  4HY8 A;  4Q8I A;  3AGD A;  4S2P A;  3WRZ A;  3G34 A;  3PYP A;  3T1Q B;  1CJF A;  1TS6 A;  1S0W A;  3RTY A;  4MLL A;  4DN0 A;  4P6Z S;  1EI5 A;  5GHY A;  2B95 A;  2B5R A;  2VA0 A;  3HL9 A;  2VK3 A;  2HDS A;  1I2S A;  1W8Q A;  5CED A;  4ZDX A;  2MJ6 A;  3MKE A;  5EPH A;  2Y8H A;  2V20 A;  3A3I A;  4ZRR A;  3IF6 A;  1KDW A;  4G3V A;  2WUQ A;  4GD8 A;  4MDZ A;  3UO9 A;  1IEL A;  3VP2 A;  2XK1 A;  2PHY A;  4BD0 A;  2HDU A;  2WK0 A;  1X0O A;  2PYP A;  1LI9 A;  3ICY A;  5EVI D;  1YKD A;  4WBG A;  1SKO B;  4X55 A;  4OOY A;  5M18 A;  4ZJ3 A;  3C5A A;  4HNB A;  4F94 A;  3N4I A;  2JBF A;  4JBF A;  1J9M A;  1QME A;  4Q0J A;  1FR6 A;  5J4E A;  2WGW A;  1KGE A;  2OSU A;  4I5S A;  2Y2N A;  4Y3I A;  4ZJ2 A;  4PAU A;  4GKU A;  4RVA A;  3JVU A;  5AVF A;  5F1G A;  4FH2 A;  2ZLY A;  5DTK A;  2VKS A;  3RH8 B;  1G6A A;  2JE5 A;  4LRZ E;  1LHY A;  2WKP A;  3ZHH A;  2Z6D A;  1JVJ A;  5E43 A;  4WYY A;  3UPN A;  2O99 A;  3ZG0 A;  5F5Y A;  4BWI A;  3C4O A;  4QY6 A;  2QPN A;  1ZC2 A;  5G4Z A;  1FIK A;  1T1A A;  2VX8 A;  1MWU A;  2P9V A;  4CLC D;  3ITB A;  4M4X A;  4Y0T A;  4JGQ A;  3VSL A;  1NRJ A;  2J9P A;  3EEH A;  4KG5 A;  3TRC A;  1KVM A;  2E8J A;  2V0W A;  3SS3 A;  1LSV A;  1JTD A;  4BMW A;  1W63 M;  1ZKJ A;  3UB5 P;  5HL1 A;  2J3T C;  2Q9N A;  2K2N A;  2HV1 A;  1SKO A;  1MPL A;  4KQR A;  1ODV A;  3VOY A;  3SH9 A;  4OKP A;  2P74 A;  4K08 A;  4X1L A;  1XA7 A;  4P6B A;  5EEC A;  1MKI A;  3ZDJ A;  4S2M A;  2DMW A;  3SW1 A;  3DTM A;  4HOI A;  4YIN A;  4R70 A;  4MN5 A;  3A0V A;  3NY4 A;  5FSR A;  4NET A;  1QMF A;  1YQS A;  1SKF A;  1XFQ A;  1YLZ A;  2M1C A;  4RX2 A;  4P85 A;  5EVI A;  1JWP A;  3O3V A;  4FUW A;  5JYO A;  2XH9 A;  4UEY A;  4HBT A;  3UPP A;  1TS8 A;  4EXO A;  4Y17 A;  3RXW A;  4ID4 A;  3FKV A;  4CQH A;  2HP9 A;  5HWT A;  3GTC A;  2A3U A;  4EUV A;  5DJU A;  3V3R A;  3VP1 A;  1M40 A;  2WYX A;  3FKW A;  3VFF A;  1STZ A;  1HVB A;  3RJU A;  3TG9 A;  4EER A;  2EA9 A;  2B18 A;  3VE3 A;  2QZ6 A;  1PZO A;  3HVF A;  4O7D A;  5K5B A;  3F1O B;  4LCL A;  3PHY A;  2PD8 A;  3HJI A;  4JXW A;  5TBM A;  5HDS A;  3BFF A;  2ZC4 B;  1FCO A;  4I3J A;  2Y2Q A;  2ZMF A;  4HP4 A;  1XX2 A;  2JHE A;  2VZW A;  4A5R A;  4ESP A;  1I2W A;  4AFI A;  4XUZ A;  4KZ3 A;  3EEA A;  1F9I A;  2RCX A;  3ZCZ A;  3V39 A;  4X68 A;  3PAG A;  5FAQ A;  4NEE D;  3IX4 A;  5FA7 A;  3GRJ A;  1EWZ A;  2L4R A;  1LL9 A;  2V8F A;  5L10 A;  2JKF A;  3IF6 B;  4Y15 A;  4P0M A;  3F1N A;  4ME4 A;  1H8Y A;  2PYR A;  5FAT A;  3IWO A;  3C30 A;  4MEZ A;  1PIO A;  4HP9 A;  5IT5 A;  1E3U D;  4Z1W A;  1TS0 A;  1D06 A;  4DF6 A;  4BEN A;  3H7W B;  1P9R A;  4DDS A;  4PKY G;  4Y13 A;  3CHW P;  4IVI A;  1V9Z A;  4ZTK A;  3A3F A;  3VV4 A;  4K91 A;  5FEG A;  1L0D A;  2FFF B;  1L0G A;  1K57 C;  3PBT A;  5HZH A;  3B33 A;  3UB7 A;  3QP1 A;  3LCE A;  1FQG A;  3H82 A;  4PM7 A;  1KE4 A;  3BFE A;  2UV0 E;  3DW0 A;  1ZTU A;  3T4S A;  4HBU A;  1MC0 A;  2BLS A;  4CLC C;  5FQI A;  1L2S A;  3ULF A;  2M7V A;  3LR0 A;  4UQI M;  1XGI A;  3EWK A;  2VEA A;  4OLG A;  3O5Y A;  2WKE A;  2ZM0 A;  2OV5 A;  1IYO A;  4GS9 B;  2O9C A;  5CEB A;  4CLC B;  3IXD A;  3C4P A;  3T50 A;  1Q2P A;  4JGP A;  3IBJ A;  2O9B A;  2D01 A;  3ZQ5 A;  1XFN A;  1YSP A;  3D72 A;  1CK3 A;  1T1C A;  2QHK A;  3H82 B;  3OPP A;  4KZA A;  1S1Y A;  2HP5 A;  2V1B A;  3I7J A;  4I3I A;  3WRT A;  3GSG A;  1MXO A;  1OT9 A;  3ZVT A;  4OQG A;  3HLE A;  1TDL A;  4DE2 A;  1ESI A;  1YLY A;  3UE3 A;  3R7W A;  2WZZ A;  4GHI A;  5FAP A;  1WA9 A;  4JKT A;  3FPW A;  3HJK A;  1JNU A; 
#chains in the Genus database with same CATH homology
 5HD5 A;  4HJ3 A;  2O9A A;  2D02 A;  4WEK A;  2KX6 A;  3VOL A;  3CIT A;  3PBN A;  3BWL A;  2W3G A;  2HGV A;  5TJJ A;  2JKR I;  4L0L A;  3D3O A;  4FOF A;  3UMD A;  3LIB A;  2PD7 A;  3C38 A;  1DRM A;  1H8M A;  1S4S A;  2VV6 A;  3E4P A;  3IS2 B;  2GNX A;  2JN7 A;  2QWS A;  3U2A A;  5HWW A;  4OOM A;  2XRN A;  4HY8 A;  2J80 A;  1Y28 A;  2M7U A;  2EWV A;  4II7 A;  5KSH A;  4GS9 A;  1XJ2 A;  4F3L A;  2ZBB A;  3LR5 A;  2W0N A;  4MN7 A;  5HPI A;  2GZA A;  2OOL A;  3EQV A;  3PYP A;  4GW9 A;  1TS6 A;  4IHQ A;  2XA7 S;  3E0Y A;  3RTY A;  3CWF A;  4DN0 A;  4P6Z S;  2ZOH A;  2V0U A;  3F1N B;  5I5L A;  1W63 Q;  3T4T A;  2B02 A;  3E4O A;  3S7P A;  2VA0 A;  3IBR A;  4EES A;  2W1T B;  1N9N A;  1OTB A;  2MJ6 A;  4ETX A;  4XT2 B;  1P0Z A;  2Y8H A;  4ZRR A;  2YKF A;  3NJA A;  1T18 A;  4CLC A;  3R7W B;  4O0P A;  5HL6 A;  5C5K A;  4G3V A;  4ARZ A;  5HDC A;  4L9G A;  4MDZ A;  2P04 A;  3LR3 A;  4NXE A;  4E04 A;  2PHY A;  1DP9 A;  3MFX A;  1X0O A;  2PYP A;  3BQA A;  4EQ1 A;  4EEP A;  5DKK A;  3ICY A;  3F1P B;  5DJT A;  1OTI A;  1YKD A;  1GSV A;  2NUT C;  4JGR A;  1VB6 A;  3KSG A;  3KSI A;  5CX7 A;  4HI4 A;  1EW0 A;  3MF0 A;  4HNB A;  4BBV A;  2L0W A;  1MZU A;  4HH2 A;  4NXB A;  3LYX A;  1XJ6 A;  4Q0J A;  5J4E A;  2HJE A;  3CUE A;  4B93 A;  3LI8 A;  2W3D A;  2K7S A;  4I5S A;  3MJQ A;  4WEJ A;  3OLO A;  2W27 A;  4Y3I A;  4I3A A;  2PR6 A;  3PBS A;  4PAU A;  3CUE C;  4Y2F A;  3JVU A;  5AVF A;  4CLC E;  2VKS A;  3RH8 B;  4LRZ E;  1S4R A;  3EQU A;  3LIE A;  5MC7 A;  5F69 A;  3OOV A;  2OAQ 1;  2WKP A;  2Z6D A;  4LRX C;  4I39 A;  1XJ4 A;  2QJ7 A;  5J7E A;  1S66 L;  2O99 A;  4Q0H A;  3OCL A;  4F3L B;  2W3F A;  3FPV A;  2R78 A;  1BYW A;  5F5Y A;  4BWI A;  2YKH A;  4LLO B;  4HH3 A;  1GSW A;  2V9A A;  5G4Z A;  1T1A A;  2VX8 A;  4WEL A;  4EEU A;  2Y79 A;  2OWJ A;  3MQQ A;  3E98 A;  3MMH A;  4CLC D;  1XJ3 A;  5HWV A;  1P9W A;  2PDR A;  4WUJ A;  2IA2 A;  4NKP A;  3NOP C;  3H9W A;  1H3Q A;  3P01 A;  4M4X A;  4JGQ A;  3H7W A;  1NRJ A;  3EEH A;  2OWH A;  4YWZ A;  3NOU C;  3KYZ A;  3TW8 A;  3TRC A;  1YAX A;  2V0W A;  1YSQ A;  3KSH A;  3OBF A;  1LSV A;  4BMW A;  4ETZ A;  3MR0 A;  1T1B A;  3EGX C;  1W63 M;  3BY9 A;  2J3T D;  3BQ8 A;  2INW A;  3T4K A;  2VLG A;  2XA7 M;  2J3T C;  5DFY A;  1OJG A;  4MMN A;  2K2N A;  2HV1 A;  5HD3 A;  5IU1 A;  1NLY A;  1ODV A;  2EWW A;  4Y5F A;  3K3C A;  5DFX A;  5HDD A;  4EET B;  4GCZ A;  4WF0 A;  1LSW A;  4GHI B;  4K08 A;  5J3W A;  2L1M A;  1S67 L;  2BAS A;  2JKT M;  3HCY A;  1OJ5 A;  3JVV A;  5F68 A;  4UQI S;  1T19 A;  2J3W A;  2DMW A;  3SW1 A;  3NHQ A;  4HOI A;  3LR4 A;  4R70 A;  4DJ2 A;  4MN5 A;  3A0V A;  5KIZ A;  2ZMV A;  3FG8 A;  4NXG A;  4XT2 A;  3ZYT A;  3IS2 A;  2K31 A;  2FH5 A;  4BBT A;  1VHM A;  4FSF A;  4JGO A;  1XFQ A;  3PBR A;  4R38 A;  2M1C A;  4NXF A;  1GSX A;  5L8M A;  1OTE A;  4HIA A;  4B9O A;  2ZOI A;  4WL9 A;  4RQ9 A;  1P97 A;  4G3W A;  3TJZ C;  4EW7 A;  4UEY A;  1ZHH B;  4O01 A;  1TS8 A;  4EXO A;  4H6J A;  1TD5 A;  3CAX A;  2HJ9 C;  4CQH A;  5HWT A;  1OTD A;  3UB9 A;  4PHT A;  5EFW A;  4EUV A;  5DJU A;  2XSS A;  4OOL A;  3UE6 A;  3LI9 A;  3PR6 A;  5DF9 A;  1STZ A;  4EER A;  2EA9 A;  4HJ6 A;  2B18 A;  4KUO A;  3VE3 A;  2G7U A;  3VE4 A;  3W2Z A;  5AJG A;  4Q0I A;  2KDK A;  2QJ5 A;  4HJ4 A;  3V67 A;  5K5B A;  3F1O B;  1OT6 A;  2XRO A;  2VV8 A;  3PHY A;  4WLA A;  1DP6 A;  1N9L A;  3LIF A;  2PD8 A;  3HJI A;  3T4L A;  2V1A A;  1KOU A;  2PT7 A;  2I9V A;  4YNR A;  5TBM A;  3GEC A;  2WKQ A;  5HDS A;  3BJN A;  3LIA A;  2JKR M;  2QYB A;  4I3J A;  1G28 A;  2A2L A;  1G6O A;  2ZMF A;  2CMN A;  4HP4 A;  4KQD A;  1UWN X;  2JHE A;  2VZW A;  1TS7 A;  4AFI A;  3EEA A;  2JKT I;  3KO6 A;  1F9I A;  1LT0 A;  3PBQ A;  3F1P A;  4GJ4 A;  3KSF A;  3KYQ A;  4NEE D;  5TBM B;  2Z6C A;  2OAP 1;  4MCW A;  4R3A A;  3P7N A;  1NWZ A;  4DJ3 A;  5F6A A;  3MXQ A;  3R4K A;  3GDI A;  3F1O A;  2P08 A;  2L4R A;  5G4Y A;  1UGU A;  2LB9 A;  2W3H A;  2O0Y A;  3LIC A;  3F1N A;  4ME4 A;  5HSQ A;  2VGL S;  4O8G A;  2KLI A;  2GJ3 A;  4HHD A;  2W1R A;  4BJP A;  4YOF A;  2LB5 A;  2H28 A;  3UME A;  2PYR A;  3C30 A;  3FC7 A;  3LUQ A;  2W1T A;  4HP9 A;  5IT5 A;  1OPX A;  4Z1W A;  1TS0 A;  4L9F A;  1D06 A;  1D7E A;  3EGD C;  4P6Z M;  3S7N A;  3H7W B;  1P9R A;  4QPR A;  4BBU A;  3S7Q A;  2FZ0 A;  1MKM A;  3K3D A;  4PKY G;  3T4Q A;  4GLQ A;  1V9Z A;  3VV4 A;  4IUK A;  3UB6 A;  3E4Q A;  4ARZ B;  1S1Z A;  3S7O A;  4HQA A;  4EU0 A;  4KQO A;  2KOI A;  2NUP C;  3PBO A;  4DMZ A;  2HF6 A;  3PBT A;  1UWP X;  4PKY A;  5HZH A;  2A24 B;  1TF1 A;  3B33 A;  3UB7 A;  2QKP A;  3H82 A;  3T4O A;  3MQ0 A;  3G6O A;  1ZTU A;  1DP8 A;  3T4S A;  1MC0 A;  4CLC C;  1F5M A;  3ULF A;  4IUH A;  4LPZ A;  2VGL M;  3BW6 A;  2A24 A;  2M7V A;  1V9Y A;  3TE8 A;  3EOI A;  3LR0 A;  4UQI M;  5DKL A;  2P7J A;  3EWK A;  3K2N A;  2VEA A;  3RFB A;  3NOT C;  4LRY C;  3O5Y A;  4KUK A;  4MN6 A;  3MQO A;  2VJW A;  2VV7 A;  4GS9 B;  5HPF A;  1IOU A;  2O9C A;  1LSX A;  1IFQ A;  4CLC B;  5IS1 A;  3KX0 X;  3T50 A;  1N9O A;  3OCN A;  3DBA A;  3C2W A;  3CI6 A;  4JGP A;  3IBJ A;  3LFV A;  2O9B A;  2D01 A;  5AVE A;  3ZQ5 A;  3A0R A;  1XFN A;  1YSP A;  4L9E A;  5A8B A;  5FL3 A;  1F98 A;  4WN5 A;  2PR5 A;  3D72 A;  3BY8 A;  1OTA A;  2W3E A;  3PXP A;  1T1C A;  2QHK A;  3H82 B;  1S1Y A;  2V1B A;  4H6J B;  3UB8 A;  1LL8 A;  4I3I A;  3CLO A;  2GX5 A;  1OT9 A;  3A0S A;  2WKR A;  3C8C A;  1NLZ A;  4I38 A;  3T4J A;  3B42 A;  3R7W A;  3UE3 A;  4IJG A;  3B47 A;  4GHI A;  1WA9 A;  3FPW A;  5LBR A;  3HJK A;  4R6L A;  1JNU A;  3LID A;  3OC2 A;  4G3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...