1S66L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
molecule keywords Hypothetical protein yddU
total genus 24
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s66L00
5IS1A 1XFQA 2L1MA 4HJ4A 4H6JA 2YKHA 3IS2B 4JGOA 1ODVA 4MN5A 2OWJA 3LYXA 3MJQA 4MN6A 3ZQ5A 3CLOA 4NXEA 5HDSA 5DJTA 4GS9B 1S67L 4R6LA 1OTEA 4RQ9A 2PD7A 2D02A 2VV7A 1BYWA 2OOLA 4XT2B 3F1OB 2VV8A 3G6OA 1OJGA 3F1OA 3D72A 4LLOB 4PKYA 1KOUA 4HJ3A 4KUKA 3HJKA 4HQAA 1TS0A 2KX6A 4HI4A 4I38A 1D06A 4HNBA 1V9ZA 3E4QA 4NXFA 3VE4A 4R70A 2PD8A 4EQ1A 4F3LB 2PHYA 3MQQA 3RH8B 3VE3A 2L4RA 4EXOA 5J7EA 4HH2A 2V1BA 5HDCA 4DJ3A 1F9IA 2QJ7A 1S4RA 3K3DA 4L9EA 2VEAA 3HJIA 5HDDA 4XT2A 2VLGA 3BY9A 4HH3A 1F98A 5TBMA 4EEPA 3H7WA 4F3LA 3C8CA 3LI9A 5I5LA 3UB9A 3GECA 3H7WB 3IBRA 4KUOA 3LIEA 3UMDA 4EEUA 4GCZA 1LL8A 1X0OA 1T18A 1TS8A 4LRYC 5DKKA 2GJ3A 4GHIA 2PDRA 2D01A 1LSXA 4EW7A 4I3AA 1OJ5A 1TS7A 2Z6DA 3MR0A 1NWZA 2JN7A 2BASA 4HIAA 4DJ2A 4GS9A 4HHDA 3UB8A 3SW1A 3LUQA 2CMNA 3MFXA 2WKRA 2ZOIA 1TS6A 2KDKA 3F1NA 1N9OA 2EA9A 3A0VA 3F1NB 5F69A 3GDIA 3IS2A 4JGQA 5DJUA 5AVFA 3MXQA 2PYPA 3LIDA 2I9VA 4HP4A 4LRZE 4WL9A 5DKLA 3VOLA 2PR5A 1G28A 4GW9A 5IU1A 5AVEA 1OTBA 5A8BA 3F1PA 3F1PB 3KX0X 4I5SA 3EWKA 2WKQA 2R78A 4L9GA 3OLOA 4E04A 2INWA 2QHKA 1JNUA 2V0UA 4WUJA 4WN5A 5F5YA 5HD5A 4H6JB 3FG8A 3CAXA 2HV1A 1S4SA 3UB6A 1GSVA 5F6AA 5TBMB 2ZOHA 4L9FA 1LSVA 2L0WA 2VV6A 3K3CA 5HWTA 3P7NA 5F68A 4KQDA 1T19A 2ZBBA 5HWVA 3NOUC 1UGUA 1VB6A 5HWWA 2V1AA 3H82A 1OTDA 5J3WA 3RTYA 1OT6A 5HSQA 2W27A 4EERA 5G4ZA 5KIZA 4WLAA 3FC7A 1N9LA 4HJ6A 3LIFA 1S1ZA 1EW0A 2PR6A 4HY8A 3B33A 3LI8A 3LICA 5HD3A 4HOIA 2B02A 4HP9A 1P0ZA 3NOPC 1T1AA 1XJ6A 1T1BA 4I3IA 1DP9A 4LPZA 4B9OA 2QWSA 5HZHA 3UB7A 4WF0A 1UWNX 3PYPA 3EEHA 2W0NA 1XJ3A 3E4PA 3ICYA 3NJAA 4R38A 3UMEA 3E4OA 1V9YA 2YKFA 3C2WA 3H82B 4EETB 1N9NA 3BY8A 4JGPA 1DP8A 1LSWA 1XJ2A 2Z6CA 1OTIA 3UE6A 3ULFA 2H28A 2QJ5A 4I3JA 2JHEA 2PYRA 4EESA 1WA9A 4PKYG 1Y28A 1DP6A 1OTAA 1GSXA 2P7JA 1DRMA 3A0SA 4I39A 4YWZA 4BBUA 2A24A 2J80A 2OWHA 1T1CA 4BBVA 4BBTA 4NXGA 1P97A 1UWPX 4NXBA 2M1CA 1OT9A 3MQOA 5EFWA 2WKPA 1S66L 3H9WA 3CWFA 4JGRA 1XJ4A 2K7SA 4K08A 2A24B 1XFNA 2V9AA 3A0RA 3PHYA 2V0WA 1LT0A 4GHIB 3T50A 4LRXC 3LIAA 4R3AA 2QKPA 3BWLA 1D7EA 1MZUA 4M4XA 5G4YA 3LIBA 5J4EA 1S1YA 1GSWA 3NOTC 3NHQA
chains in the Genus database with same CATH superfamily
4EBNA 1XFQA 2KOIA 1WE4A 3UDFA 3ZQ5A 3RJUA 5DJTA 1MPLA 2P9VA 1FR6A 5EUAA 1VQQA 3SOIA 5FL3A 3HJKA 4I38A 4HI4A 2DRWA 2XROA 1L0EA 3RH8B 3BQ8A 4FH4A 1YMSA 1STZA 1PNEA 2VEAA 3UMDA 3V50A 4II7A 2EX2A 2J3TD 1YAXA 2D01A 4S2JA 1TS7A 3IF6C 1NWZA 1TF1A 2Q9MA 5CX7A 3Q82A 3WRZA 1PWCA 2P04A 4M3KA 5AQ9A 5HL6A 1G28A 1ALQA 1YLZA 2PAVP 5A8BA 1L3LA 1JNUA 5CHMA 1G6AA 4R4RA 5FAQA 3P7NA 1UGUA 5HWWA 2GDNA 2V1AA 2BG1A 1SKFA 4WEKA 2H5SA 3IHAA 1N9LA 3VP3A 1EW0A 4HY8A 4WBGA 4BLMA 4HOIA 1T1BA 1UWNX 3VOYA 3NJAA 3QP8A 4R38A 3CJMA 1W5DA 4OP5A 1H8ZA 4QPRA 4WYYA 5MC7A 1XX2A 4FSFA 2JKTM 4N1HA 4NXGA 3O88A 3OC2A 3JPUA 3CWFA 2A24B 3A0RA 3AGFA 3MXSA 2W3DA 3MZDA 2WUQA 5BOHA 2M7VA 2HJEA 1NRFA 1KGEA 3MZEA 2O9CA 4HBTA 1RGZA 4WZ5A 4DXBA 1YLJA 3BM6A 1J3WA 2OLVA 5D3OA 5FSRA 3D72A 4HJ3A 3HVFA 5TGFA 4HNBA 1V9ZA 4KQRA 4EXOA 2EX6A 5FEFA 3MXRA 1FIKA 2DCFA 3UDXA 5TBMA 3RXWA 4PAUA 1HZOA 2BTFP 3S22A 3G4PA 2VX8A 1EWZA 5EVEA 1NYMA 3G35A 3T12B 3SW1A 3JVUA 2KDKA 4S2KA 4A5RA 3CITA 4WL9A 5DKLA 4MDZA 4JKTA 5IU1A 1W7FA 3SS3A 3ZNTA 2W3FA 2Y2NA 4E6XA 4BL2A 3DTEA 1GHMA 3OLOA 3ZG5A 2FFYA 5F5YA 3KSHA 2L0WA 3AGEA 2XR0A 1ES5A 3KYZA 2ZM8A 1K55C 4MEZA 3LR3A 1OPXA 3MBZA 1CQAA 3IH8A 4PHTA 4CLCA 3WS5A 3S7PA 4B88A 1H8MA 1VM1A 3D4FA 1IYPA 3UMEA 1NJ4A 3W2ZA 5C5KA 5E2GA 2Z6CA 4LV3A 1YSQA 3VSLA 4EQ1A 1PZOA 1KVLA 2OWHA 5EOOA 5EVIB 1LL5A 2Y2KA 1XA7A 5TR7A 3MQOA 1NY0A 3HLWA 4CPKA 1FCOA 5FASA 1D7EA 4FD8A 3IHBA 2VGJA 2GZAA 1IKIA 4OOLA 1CK3A 3GQZA 2J3TC 2EFUA 4Y3IA 4X55A 3C38A 3CUEC 5GLBA 2JKRM 3G30A 4OQGA 5CGWA 2Y79A 3IXGA 5FATA 4ZJ3A 3E2KA 3C7VA 5IHVA 1K4EA 5DVAA 1NYYA 3BFCA 4UA9A 2J9PA 1T18A 4PM6A 4S2LA 1YLPA 1JWPA 3CI6A 3MR0A 2JN7A 4P0MA 3GR2A 2Y2IA 3G2ZA 1PIOA 3V39A 4YINA 1ERQA 1K56D 2OLUA 4PMAA 2JKRI 4JXWA 2MJ6A 5EVID 1O07A 4S2PA 4Q0HA 3N8LA 4LV0A 5HPFA 2VV6A 1T19A 2KLIA 1BLHA 3ZDJA 3VSKA 5AQBA 3T1RA 5CEBA 1HLUP 4G3KA 4PM8A 3WWXA 3VFFA 3SZTA 4D2OA 2FFFB 1K57A 4D60A 4YWZA 5M19A 2W3HA 1K6SA 4KZBA 5AJGA 3W4QA 3SS5A 3OPLA 3H9WA 3B42A 2O9BA 2P08A 1MWTA 1K6RA 3FPWA 1E25A 3O87A 1N4OA 3NY4A 2ZC6B 2ZMFA 2YKHA 3OPRA 1ODVA 4MN5A 3IX4A 3PBSA 3T1SA 1K56A 1QMEA 1S67L 3T4SA 3WS2A 1GHIA 2VV8A 4LLOB 1PW8A 2ZQCA 1ES3A 4F3LB 5F83A 4KZ3A 4MMNA 2L4RA 2V1BA 2Q9NA 2AVXA 4WMCD 4DJ3A 3K3DA 4KQOA 5CTMA 3IXDA 3NDEA 4LRYC 1L0DA 1LSXA 1U60A 2BASA 3Q07A 5U47A 1N9OA 3QHYA 1BZAA 2I9VA 1SDNA 2PR5A 1WYBA 5CECA 4G3VA 3T1QB 2HPBA 3EWKA 3FKVA 2V0UA 3NBLA 3IWIA 3M6BA 5F68A 4KZ6A 1YMXA 5KMWA 1TD5A 1RP5A 4E3LA 3A3EA 1IEMA 5HWVA 3NOPC 4JXGA 4LPZA 1MKMA 2WGWA 4LV2A 1FOFA 2JBFA 4IUHA 3Q7VA 5DFYA 4IHQA 1I2SA 2H0YA 1BULA 5FAOA 3SH8A 3A0SA 1DY6A 2A24A 5EVIA 2HDUA 2VGLM 2XD5A 1OT9A 3GSGA 5FQJA 4LRXC 5G4YA 4E3OA 3PTEA 5J4EA 5HL1A 5CHUA 5DTKA 1MC0A 2ZC4B 3NULA 3CLOA 1LLBA 1M40A 2ZJ9A 4HBUA 3F1OA 3U2AA 3E4QA 2PD8A 3VE3A 2VJWA 3CHWP 3VP2A 3NCKA 1GA0A 3M2JA 3H7WA 1MXOA 3HUMA 4HESA 5AQAA 4KQQA 2XQZA 2JKGA 1X0OA 3PAGA 3EGXC 3NDGA 5DF8A 1LL9A 4NKPA 1F2KA 4PPRA 1KE3A 3Q7VB 3QP5A 4DJ2A 1PW1A 1S4SA 3V3RA 5HWTA 1A0KA 3VP1A 2ZL1A 4L0LA 2VK3A 4R3JA 4KG6A 3NECA 5G4ZA 3BQAA 4H8RA 1VEUB 3A3JA 1PI4A 2E8JA 4B9OA 3ZYTA 3SS4A 1PWDA 2Y2PA 3JYIA 4JXVA 3BLSA 3G2YA 3H82B 1DP8A 3A3IA 3QNBA 4BMWA 2EXBA 2P7JA 5GHXA 5HARA 4BBUA 5FQIA 1P97A 3ZNYA 2EX8A 3UPOA 1S66L 1W79A 4B4ZA 3RFBA 2J8YA 3CG5A 2FH5A 4BD1A 4PM5A 2QKPA 3I7JA 1NZOA 3TRCA 1XA1A 4KZAA 2ZQ7A 1NZUA 4R6LA 3N8RA 2EFXA 3JVVA 4JPMA 3IQAA 3LEZA 3ZGAB 3G6OA 3K2NA 1D06A 1YM1A 3G34A 4NXFA 3UE0A 4WEJA 3IF6A 1F9IA 2QJ7A 4XT2A 2VLGA 4S2OA 1Z09A 4G3WA 3DAVA 2PDRA 2Y2LA 3R7WA 1JWZA 2WKRA 4OOMA 1K54A 4HP4A 1S0WA 1ESUA 2XA7S 3DWZA 4X6TA 5E2HA 2IWBA 3FPVA 3UPPA 3BJNA 5TFQA 3UB6A 3QP1A 4Z9QA 1GSVA 1TEMA 2XA7M 1KVMA 4YOFA 3T1XA 4JLFA 4ID4A 5J3WA 2R9WA 4FH2A 2OAP1 4ZRRA 2B02A 4HP9A 1XJ6A 5KSHA 5AQ7A 4ARZB 3WRTA 3CMZA 3BY8A 1LSWA 3UE6A 1I2WA 3V3SA 3LFVA 2J80A 1MWUA 3HLBA 5EM1A 2JKTI 3LR4A 2PU4A 3M2KA 5CERA 2K31A 3T4JA 1NXYA 4HJ4A 1HD8A 4PM7A 5K5BA 3NC8A 5HDSA 3S7QA 1VEUA 1OTEA 3N8SA 4RQ9A 2JCHA 2J9OA 2EX9A 3ZCZA 2VV7A 3OPHA 4C3QA 1PYYA 3EOIA 1DJCA 4MLLA 4S2NC 1AWIA 1HTZA 5HDDA 4OP8A 4Y7PA 3ITBA 4KZ5A 2PU2A 3UE3A 4ZDXA 1K54C 3IWOA 3TSGA 4Y2FA 4GS9A 3MFXA 5M18A 2EA9A 1H8YA 5TJJA 1FILA 3IBJA 3LIDA 2VGLS 5CGXA 5AVEA 2QYBA 4DXCA 3KX0X 4L9GA 4O01A 4WUJA 4QY5A 2Y2OA 3K3CA 2HZ5A 1S6RA 4MBHA 2A3UA 3RTYA 4MBKA 4P87A 3BRMA 4EERA 2OSUA 5HD3A 2P9VB 4ZBEA 1BTLA 1IKGA 3SH7A 3HBRA 1LI0A 3ICYA 5M1AA 1ESIA 4UA6A 5HW3A 2YKFA 3C2WA 2QJ5A 5A90A 3TE8A 2JHEA 3FWLA 1ZTUA 1VHMA 3EEAA 2W1RA 5EV0A 3QP2A 3R4KA 2VZWA 1XKZA 5L09A 4GD6A 4GKUA 4OVDA 5L07A 4OOYA 2HF6A 3D3OA 4K0WA 3G31A 3QP4A 1BLPA 1CF0A 4JF6A 2XLNA 4YFMA 1J9MA 4QY6A 1L0FA 4OQ0A 2ZL1B 4IVIA 4FOFA 2Y2JA 3C8CA 4UAAA 5DF9A 5I5LA 3W4OA 5FI7A 4P85A 4GHIA 1AXBA 3P01A 2Z6DA 2UV0E 1RGYA 1IYOA 3Q7ZA 5DJUA 3O86A 1L2SA 3T4OA 4LENA 2Y91A 3NIAA 2R78A 3A3DA 2X71A 5I94A 1MY8A 2HV1A 2WAFA 5F6AA 5TBMB 1BUEA 2GNXA 2W1TA 2XD1A 4N9KA 2XEPA 2X01A 2HP9A 4XUXA 2DMWA 2WZZA 1BT5A 2J3WA 3S1YA 4I3IA 2O9AA 3OPPA 3C4PA 3V5MA 4GJ4A 1V9YA 4KG5A 4EETB 1IYSA 4B4XA 1W8QA 2ZD8A 4I39A 3FZCA 3BLMA 3LR0A 4JF4A 3KYEA 4OQIA 3BFFA 3WS0A 2PBDP 4IBXA 4R3AA 3LIBA 1S1YA 1RCJA 3A3FA 2BLSA 4H6JA 2EWVA 3O5YA 3EQUA 4GDNA 4MN6A 2XDMA 4GS9B 1CI8A 2PD7A 4E3MA 2RL3A 4EUZA 2VKSA 1BYWA 5KSCA 1XXMA 3MKFA 1SDEA 2CC1A 2PHYA 1CEGA 4DE0A 4OQHA 1TDLA 3CZDA 1ZKJA 2M7UA 3HJIA 4F3LA 2EWWA 1ERMA 1Q2QA 5DKKA 4GN2A 2Z2MB 3GVBA 4HHDA 5A91A 3A0VA 4WZ5C 2ZQ8A 1GCEA 4BL3A 1G6OA 3VFHA 4RX2A 2Y2GA 4U0TA 4UEYA 5HD5A 4XXRA 1FR1A 1TDGA 3H82A 2WK0A 3ZG0A 4B93A 5CXWA 4CJNA 3DW0A 4EBPA 5L10A 2PR6A 5FDHA 2ZM2A 5CHJA 4WZ4A 2PT7A 4FTXA 5EECA 2V20A 3EEHA 3LY3A 3ISGA 4Y5FA 2Y2MA 1G68A 3IXHA 2WZXA 5KZHA 1YLYA 2PYRA 1KDSA 4FCFA 4X68A 1ZG6A 3MKEA 1SZVA 1H3QA 1FSYA 3C5AA 2HP5A 4AFIA 3MMHA 2W3EA 1XPBA 3BEBA 3DWKA 1GSWA 3PBQA 1VETB 4S2IA 3MSHA 1KDWA 2UWXA 3HLFA 5FA7A 5CRFA 1WYCA 3IH9A 2OOLA 4XT2B 3BFDA 1M6KA 3CPTA 3VE4A 1G5UA 4ZTKA 2H10A 1PWGA 2C6WB 3KO6A 1CEFA 2I72A 1SKOB 4X56A 3BY9A 5GLDA 4QWOA 2IWDA 3IBRA 3ZG8B 4EEUA 5JYPA 3FYZA 1OJ5A 3UB8A 2VGKA 3S4XA 3F1NA 1FQGA 3HL9A 4BQMA 5DTTA 1SCWA 5FAPA 3KSIA 3T4QA 4I5SA 2H0TA 2OV5A 1PI5A 4WN5A 2GX5A 3U4LP 2W1TB 1IELA 5G18A 1CI9A 3HLEA 4N1XA 2XF3A 4R4SA 4EV4A 5IT5A 1P0ZA 3PYPA 1P9WA 4DDSA 3Q81A 1XJ2A 1OTIA 2H28A 3GRJA 2ZQAA 3T4LA 4PM9A 1JWVA 1UWPX 4X1MA 4S2MA 2LB9A 2ZC5B 1NRJA 2Y8HA 4DRTA 3OCNA 2WGWB 3DTKA 2OWJA 3MJQA 1W8YA 2WKHA 2XFTA 1JTGA 1E3UD 2VA0A 3S7OA 2XK1A 5CEDA 4HQAA 3LGOA 4IVKA 2Z2LB 4CLCD 4JBFA 3N4IA 3HLGA 2Q0OA 2Y2HA 2XH9A 3H7WB 2G2WA 2GJ3A 2J7VA 4GNUA 4IUKA 4GB7A 4OONA 5AVFA 1IFQA 2ZMAA 4O8GA 2B18A 3Q1FA 4MCWA 5DF7A 3VOZA 3IXBA 2A2LA 2W3GA 2B5RA 1NLZA 4DE1A 3IT9A 3EGDC 4Q0IA 4QJGA 3CPTB 5HAPA 4IEDA 2XFSA 5KIZA 1K4FA 5HPIA 3B33A 4U0XA 4PKYG 4Y0TA 4EW7A 2W0NA 3E4PA 3E4OA 3B3XA 1N9NA 2IWCA 3ULFA 4EESA 5HAIA 4X69A 4RVAA 1DP6A 1GSXA 5EM0A 1KGGA 4NXBA 2M1CA 4GOGA 1L0GA 2V8FA 4JGRA 5LBRA 3L7HA 1XFNA 4NK3A 4UHUA 2HDRA 3LEQA 4M4XA 2FZ0A 4CQHA 5EPHA 4ZJ2A 4EU0A 1MWSA 4JGOA 2V2FF 3CUEA 3OOVA 5GHYA 1K0KA 1DJAA 4PKYA 2Y4AA 4RA7A 4KUKA 3FV7A 1Q2PA 1KE0A 3PBTA 2WYXA 1N9BA 3BW6A 5JYOA 1IOUA 4HH3A 3LI9A 4E3NA 4KUOA 3N6IA 4EBLA 5FEGA 1TS8A 4QU3A 4I3AA 4C6YA 5A93A 1YSPA 1ZHHB 4XUZA 4JGQA 3MXQA 2PYPA 4LRZE 4K0XA 5L2FA 3LO7A 2WKIA 2X02A 4GW9A 2ZLYA 5L8MA 2WKQA 5E43A 1IYQA 3FG8A 3CAXA 3UN7A 1BLCA 4GDBA 4O7DA 1JTDA 3ITAA 3O3VA 5HSQA 1ES2A 2HDSA 3UPNA 3W8KA 1K57C 3LICA 5HZHA 2PRFA 4N92A 3UB7A 3MF0A 4S2NA 2O99A 4DE3A 4R0QA 4QD4A 1T1CA 1PZPA 1ACFA 4LGWA 1LHYA 1I5QA 4Y15A 1LT0A 5EVLA 3UB5P 1EI5A 3MS6A 4OH0A 1Y4OA 1BLSA 2L1MA 2G2UA 4NETA 5F1GA 3D9YA 1TVFA 3LYXA 3TJZC 4NXEA 4KZ7A 2C5WB 3DBAA 2D02A 3HREA 1OJGA 3UY6A 3KSGA 4GD8A 1TS0A 4DKIA 3PBRA 5HAQA 4BD0A 3BFGA 1F98A 3HCYA 3S7NA 1D1JA 4ARZA 4EUVA 2HJ9C 1O7EA 3PBOA 4N9LA 3LUQA 2CMNA 1H0MA 3IWQA 5F69A 3VMAA 1YT4A 3ZVWA 2QZ6A 4ETXA 4P6ZM 3ZHHA 5E2EA 1JVJA 3F1PB 5DFXA 3W4PA 3PXPA 2EXAA 4OLGA 4WM9A 2ZBBA 1VB6A 1W63M 4BWIA 3OZHA 4WLAA 3WS1A 1Y54A 1S1ZA 1MWRA 4Q8IA 1T1AA 1DP9A 4LFUA 5FDSA 5FQKA 1CJFA 1XJ3A 5CTNA 4KZ4A 5F1FA 3N7WA 4CLCC 3IF6B 2WGIA 4GZBA 1ONHA 4OPYA 1ZC2A 3PAEA 3UDIA 1DRMA 4BBVA 4IJGA 1YLTA 1FCNA 2HP6A 2R9XA 3KYQA 4BJPA 5EFWA 3RXXA 3PHYA 1YPRA 3T4TA 4OPRA 4UQIS 1MZUA 3QNCA 4Z1WA 3EQVA 3NOTC 5IS1A 3MZFA 3IS2B 3DTMA 1FCMA 4RYEA 3HUNA 2V1ZA 4R1GA 4IBRA 1XGJA 3UNWA 4BENA 3LCEA 4R70A 3E0YA 1E4DA 2A49A 4HH2A 4X1LA 4EEPA 3UB9A 3LIEA 3VP0A 3L9KA 4NG2A 1LL8A 2JKFA 4Y0OA 2Y59A 4MN7A 3OCLA 2QMIA 4HIAA 4UQIM 5HX9A 5DTSA 5GLCA 3HLCA 2ZOIA 1TS6A 2ZQDA 4HEFA 4LV1A 4OLDA 3IF5A 5J8XA 5FQMA 1OTBA 4MNRA 5CGSA 2INWA 3UO9A 3AGDA 2RCXA 2ZOHA 2ZC7A 4UA7A 1OTDA 3NI9A 1OT6A 5E2FA 2W27A 4EWFA 3IX3A 4LCLA 2WKEA 3FC7A 3HLDA 3QP6A 1ES4A 3VP4A 1HVBA 4OPQA 2O0YA 4I3JA 4DF6A 1XGIA 3TG9A 1WA9A 3P98A 1OTAA 4Y17A 4BBTA 3GV9A 5GL9A 1YLWA 1YQSA 2WKPA 3DTIA 3ZG9B 4K08A 3BECA 2QPNA 2V0WA 4GHIB 3T50A 3MFDA 3IX8A 1Z6FA 4OKPA 5A92A 2PBYA 5FI2A 1GA9A 2ZC3B 3TOIA 3F1OB 4DDYA 4OPZA 2Y2QA 4FUWA 4YNRA 2KX6A 4Q0JA 4KZ8A 1ONGA 1PFLA 3E98A 4JF5A 4ZAMA 1S4RA 3GMWA 3B47A 5EVIC 4ESPA 5FI6A 2XRNA 4GCZA 5GHZA 2P74A 1ZG4A 3BFEA 3G32A 3BYDA 4E04A 4E6WA 1MBLA 3IS2A 1P9RA 3HUOA 3M6HA 3VOLA 4KG2A 1DJBA 2HDQA 3OBFA 4X53A 4KZ9A 3F1PA 5GLAA 1K55A 4CLCE 2QHKA 4Y0UA 3MQ0A 1LSVA 1XP4A 4JXSA 4KQDA 3NOUC 1NLYA 2V8CA 4E3KA 4DMZA 3V67A 2WGVA 4E3IA 2IA2A 3LIFA 3ZVTA 1MKIA 2QWSA 2JC7A 4RX3A 4WF0A 4WMCA 4ZJ1A 1OMEA 2OAQ1 4R23A 1YKDA 2LB5A 2ZMVA 3LR5A 2G7UA 2ACGA 4R3BA 3PR6A 4QHCA 2K7SA 3C30A 2DNSA 2V9AA 4U3TA 1F5MA 1SHVA 5EOEA 3BWLA 1EROA 3E2LA 2K2NA 4LCMA 3NHQA 4ETZA 3LY4A 1VETA 3P09A 4EQIA 1BSGA 1PRQA 5HFOA 2WAEA 4CLCB 4P6ZS 1KOUA 1FSWA 3VV4A 3ZFZA 4DE2A 3MQQA 3UE1A 3C4OA 4F94A 5J7EA 1KE4A 5HDCA 4L9EA 3KSFA 3GECA 4Y13A 1E3UA 4X25A 4GLQA 5FQQA 3R7WB 2B95A 4O0PA 2XGNA 4K91A 5F82A 1K38A 3GTCA 3F1NB 3GDIA 3SH9A 2NUPC 2E8IA 3ZG7B 1QMFA 4KENB 1C3BA 1GHPA 1KGFA 5EE8A 3TW8A 3PBNA 4P6BA 5FQ9A 4H6JB 1SKOA 4L9FA 4WELA 4DN0A 1H5XA 3FKWA 2NUTC 2JE5A 4NEED 2Y55A 4HJ6A 3C7UA 3LI8A 2ZM0A 2WADA 4JGPA 2HGVA 4E3JA 4ME4A 1K25A 3WS4A 1Y28A 1LI9A 4QB8A 1W63Q 1XJ4A 2ZQ9A 2XSSA 3LIAA 4C75A 3T4KA 4MBFA
chains in the Genus database with same CATH topology
1XFQA 2L1MA 2KOIA 4H6JA 1MC0A 2EWVA 3O5YA 3EQUA 3LYXA 3TJZC 4MN6A 3ZQ5A 3CLOA 4NXEA 5DJTA 4GS9B 2PD7A 3DBAA 2D02A 2VKSA 1BYWA 1OJGA 3F1OA 3KSGA 5FL3A 3HJKA 4I38A 1TS0A 4HI4A 3U2AA 3E4QA 2XROA 2PD8A 2PHYA 3RH8B 3VE3A 3BQ8A 2VJWA 3PBRA 1STZA 2M7UA 2VEAA 3HJIA 4F3LA 1F98A 2EWWA 3H7WA 3UMDA 4II7A 2J3TD 1X0OA 3HCYA 3S7NA 1YAXA 5DKKA 3EGXC 4ARZA 2D01A 4EUVA 2HJ9C 1TS7A 1NWZA 3PBOA 1TF1A 4HHDA 3LUQA 2CMNA 5CX7A 5F69A 4NKPA 2P04A 3A0VA 5HL6A 1G28A 4ETXA 4P6ZM 1G6OA 5A8BA 3F1PB 5DFXA 1JNUA 4DJ2A 3PXPA 4UEYA 5HD5A 1S4SA 5HWTA 3P7NA 2ZBBA 4L0LA 1UGUA 1VB6A 5HWWA 2V1AA 3H82A 4B93A 1W63M 4WEKA 4BWIA 5G4ZA 3BQAA 4WLAA 1N9LA 1S1ZA 1EW0A 2PR6A 4HY8A 4HOIA 2PT7A 4B9OA 1T1AA 1T1BA 1DP9A 3ZYTA 1UWNX 3EEHA 3NJAA 1XJ3A 4R38A 4Y5FA 3H82B 4CLCC 1DP8A 4QPRA 4BMWA 2PYRA 5MC7A 4FSFA 2P7JA 1DRMA 4BBUA 2JKTM 4BBVA 4NXGA 1P97A 4IJGA 1H3QA 3KYQA 4BJPA 3OC2A 5EFWA 1S66L 3CWFA 2A24B 3A0RA 3RFBA 4AFIA 3PHYA 2FH5A 3T4TA 2W3DA 3MMHA 2QKPA 2W3EA 4UQIS 1MZUA 4Z1WA 2M7VA 3EQVA 2HJEA 3TRCA 1GSWA 3NOTC 3PBQA 5IS1A 2O9CA 3IS2B 4R6LA 3JVVA 2OOLA 4XT2B 3G6OA 3K2NA 3D72A 4HJ3A 1D06A 4HNBA 1V9ZA 3VE4A 4NXFA 4R70A 3E0YA 4WEJA 4EXOA 4HH2A 3KO6A 1F9IA 2QJ7A 5TBMA 4XT2A 2VLGA 3BY9A 4PAUA 4EEPA 3UB9A 3IBRA 4EEUA 3LIEA 1LL8A 4MN7A 3OCLA 4G3WA 2PDRA 2VX8A 1OJ5A 4HIAA 4UQIM 3UB8A 3SW1A 3R7WA 3JVUA 2WKRA 2ZOIA 1TS6A 2KDKA 3F1NA 4OOMA 3CITA 4HP4A 2XA7S 4WL9A 5DKLA 4MDZA 5IU1A 1OTBA 2W3FA 3KSIA 3T4QA 4I5SA 3FPVA 3OLOA 2INWA 3BJNA 4WN5A 2GX5A 5F5YA 3UB6A 2W1TB 1GSVA 2ZOHA 3KSHA 2XA7M 2L0WA 4YOFA 3KYZA 1OTDA 5J3WA 1OT6A 2W27A 3LR3A 1OPXA 3FC7A 2OAP1 4ZRRA 4PHTA 4CLCA 2B02A 4HP9A 1P0ZA 5IT5A 1XJ6A 3S7PA 5KSHA 1H8MA 3PYPA 1P9WA 4ARZB 3UMEA 3W2ZA 3BY8A 5C5KA 1LSWA 1XJ2A 2Z6CA 1OTIA 2O0YA 3UE6A 2H28A 4I3JA 1YSQA 1WA9A 4EQ1A 1OTAA 3LFVA 2J80A 2OWHA 3T4LA 4BBTA 1UWPX 2JKTI 3MQOA 2LB9A 2WKPA 3LR4A 4K08A 3T50A 2V0WA 4GHIB 1NRJA 1D7EA 2K31A 3T4JA 2Y8HA 2GZAA 4HJ4A 3OCNA 5K5BA 4OOLA 2OWJA 3MJQA 5HDSA 3S7QA 2J3TC 1OTEA 4RQ9A 4Y3IA 3C38A 3CUEC 2VV7A 3F1OB 2JKRM 2VA0A 3S7OA 2Y79A 3EOIA 4YNRA 4HQAA 2KX6A 4Q0JA 4CLCD 3E98A 1S4RA 5HDDA 3B47A 3UE3A 3H7WB 2XRNA 4GCZA 1T18A 2GJ3A 4IUKA 3CI6A 4Y2FA 3MR0A 2JN7A 4GS9A 3MFXA 4E04A 2EA9A 5AVFA 3IS2A 5TJJA 1IFQA 1P9RA 3IBJA 3LIDA 3VOLA 2VGLS 4O8GA 3OBFA 2JKRI 2B18A 4MCWA 5AVEA 2QYBA 2MJ6A 3F1PA 3KX0X 4CLCE 4L9GA 2A2LA 4O01A 2QHKA 4Q0HA 4WUJA 2W3GA 3MQ0A 1NLZA 5HPFA 1LSVA 2VV6A 3EGDC 3K3CA 4Q0IA 4KQDA 1T19A 2KLIA 3NOUC 1NLYA 4DMZA 3RTYA 3V67A 4EERA 5KIZA 5HPIA 2IA2A 3LIFA 5HD3A 3B33A 4PKYG 4EW7A 4G3KA 2QWSA 4WF0A 2W0NA 3E4PA 3ICYA 3E4OA 2YKFA 3C2WA 1N9NA 2OAQ1 3ULFA 2QJ5A 4EESA 3TE8A 2JHEA 1YKDA 2LB5A 2ZMVA 1DP6A 3LR5A 1GSXA 4YWZA 2W3HA 1ZTUA 2G7UA 3PR6A 1VHMA 3EEAA 2M1CA 4NXBA 5AJGA 3H9WA 4JGRA 2W1RA 2K7SA 3C30A 5LBRA 3B42A 2O9BA 1XFNA 1F5MA 2P08A 2V9AA 3R4KA 3FPWA 3BWLA 4M4XA 2FZ0A 2K2NA 4CQHA 2VZWA 3NHQA 4ETZA 4EU0A 2ZMFA 2YKHA 4JGOA 3CUEA 1ODVA 4MN5A 3OOVA 2HF6A 3D3OA 3PBSA 4CLCB 4P6ZS 1S67L 3T4SA 2VV8A 4LLOB 4PKYA 1KOUA 3VV4A 4KUKA 4F3LB 3MQQA 4MMNA 2L4RA 3PBTA 5J7EA 2V1BA 4FOFA 5HDCA 4DJ3A 3BW6A 3K3DA 4L9EA 1IOUA 4HH3A 3C8CA 3LI9A 3KSFA 5DF9A 3GECA 4KUOA 5I5LA 4KQOA 4GLQA 1TS8A 4LRYC 4GHIA 1LSXA 4I3AA 3P01A 2Z6DA 2BASA 3R7WB 4O0PA 1YSPA 1ZHHB 1N9OA 3F1NB 3GDIA 5DJUA 4JGQA 3MXQA 2PYPA 2NUPC 3T4OA 2I9VA 4LRZE 2PR5A 4GW9A 4G3VA 3TW8A 5L8MA 3EWKA 2WKQA 3PBNA 2R78A 2V0UA 4H6JB 3FG8A 3CAXA 2HV1A 5F6AA 5TBMB 4L9FA 2GNXA 2W1TA 4WELA 4DN0A 5F68A 2NUTC 2DMWA 1TD5A 5HSQA 4NEED 4HJ6A 2J3WA 3LI8A 3LICA 5HWVA 3NOPC 4I3IA 4LPZA 1MKMA 5HZHA 2O9AA 3UB7A 4IUHA 5DFYA 4GJ4A 1V9YA 4EETB 3MF0A 4JGPA 2HGVA 2O99A 4IHQA 4ME4A 1Y28A 3A0SA 4I39A 2A24A 3LR0A 1T1CA 2VGLM 1OT9A 1W63Q 1XJ4A 1LT0A 4LRXC 2XSSA 3LIAA 4R3AA 5G4YA 3LIBA 3T4KA 5J4EA 1S1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IS1 A;  1XFQ A;  2L1M A;  4HJ4 A;  4H6J A;  2YKH A;  3IS2 B;  4JGO A;  1ODV A;  4MN5 A;  2OWJ A;  3LYX A;  3MJQ A;  4MN6 A;  3ZQ5 A;  3CLO A;  4NXE A;  5HDS A;  5DJT A;  4GS9 B;  1S67 L;  4R6L A;  1OTE A;  4RQ9 A;  2PD7 A;  2D02 A;  2VV7 A;  1BYW A;  2OOL A;  4XT2 B;  3F1O B;  2VV8 A;  3G6O A;  1OJG A;  3F1O A;  3D72 A;  4LLO B;  4PKY A;  1KOU A;  4HJ3 A;  4KUK A;  3HJK A;  4HQA A;  1TS0 A;  2KX6 A;  4HI4 A;  4I38 A;  1D06 A;  4HNB A;  1V9Z A;  3E4Q A;  4NXF A;  3VE4 A;  4R70 A;  2PD8 A;  4EQ1 A;  4F3L B;  2PHY A;  3MQQ A;  3RH8 B;  3VE3 A;  2L4R A;  4EXO A;  5J7E A;  4HH2 A;  2V1B A;  5HDC A;  4DJ3 A;  1F9I A;  2QJ7 A;  1S4R A;  3K3D A;  4L9E A;  2VEA A;  3HJI A;  5HDD A;  4XT2 A;  2VLG A;  3BY9 A;  4HH3 A;  1F98 A;  5TBM A;  4EEP A;  3H7W A;  4F3L A;  3C8C A;  3LI9 A;  5I5L A;  3UB9 A;  3GEC A;  3H7W B;  3IBR A;  4KUO A;  3LIE A;  3UMD A;  4EEU A;  4GCZ A;  1LL8 A;  1X0O A;  1T18 A;  1TS8 A;  4LRY C;  5DKK A;  2GJ3 A;  4GHI A;  2PDR A;  2D01 A;  1LSX A;  4EW7 A;  4I3A A;  1OJ5 A;  1TS7 A;  2Z6D A;  3MR0 A;  1NWZ A;  2JN7 A;  2BAS A;  4HIA A;  4DJ2 A;  4GS9 A;  4HHD A;  3UB8 A;  3SW1 A;  3LUQ A;  2CMN A;  3MFX A;  2WKR A;  2ZOI A;  1TS6 A;  2KDK A;  3F1N A;  1N9O A;  2EA9 A;  3A0V A;  3F1N B;  5F69 A;  3GDI A;  3IS2 A;  4JGQ A;  5DJU A;  5AVF A;  3MXQ A;  2PYP A;  3LID A;  2I9V A;  4HP4 A;  4LRZ E;  4WL9 A;  5DKL A;  3VOL A;  2PR5 A;  1G28 A;  4GW9 A;  5IU1 A;  5AVE A;  1OTB A;  5A8B A;  3F1P A;  3F1P B;  3KX0 X;  4I5S A;  3EWK A;  2WKQ A;  2R78 A;  4L9G A;  3OLO A;  4E04 A;  2INW A;  2QHK A;  1JNU A;  2V0U A;  4WUJ A;  4WN5 A;  5F5Y A;  5HD5 A;  4H6J B;  3FG8 A;  3CAX A;  2HV1 A;  1S4S A;  3UB6 A;  1GSV A;  5F6A A;  5TBM B;  2ZOH A;  4L9F A;  1LSV A;  2L0W A;  2VV6 A;  3K3C A;  5HWT A;  3P7N A;  5F68 A;  4KQD A;  1T19 A;  2ZBB A;  5HWV A;  3NOU C;  1UGU A;  1VB6 A;  5HWW A;  2V1A A;  3H82 A;  1OTD A;  5J3W A;  3RTY A;  1OT6 A;  5HSQ A;  2W27 A;  4EER A;  5G4Z A;  5KIZ A;  4WLA A;  3FC7 A;  1N9L A;  4HJ6 A;  3LIF A;  1S1Z A;  1EW0 A;  2PR6 A;  4HY8 A;  3B33 A;  3LI8 A;  3LIC A;  5HD3 A;  4HOI A;  2B02 A;  4HP9 A;  1P0Z A;  3NOP C;  1T1A A;  1XJ6 A;  1T1B A;  4I3I A;  1DP9 A;  4LPZ A;  4B9O A;  2QWS A;  5HZH A;  3UB7 A;  4WF0 A;  1UWN X;  3PYP A;  3EEH A;  2W0N A;  1XJ3 A;  3E4P A;  3ICY A;  3NJA A;  4R38 A;  3UME A;  3E4O A;  1V9Y A;  2YKF A;  3C2W A;  3H82 B;  4EET B;  1N9N A;  3BY8 A;  4JGP A;  1DP8 A;  1LSW A;  1XJ2 A;  2Z6C A;  1OTI A;  3UE6 A;  3ULF A;  2H28 A;  2QJ5 A;  4I3J A;  2JHE A;  2PYR A;  4EES A;  1WA9 A;  4PKY G;  1Y28 A;  1DP6 A;  1OTA A;  1GSX A;  2P7J A;  1DRM A;  3A0S A;  4I39 A;  4YWZ A;  4BBU A;  2A24 A;  2J80 A;  2OWH A;  1T1C A;  4BBV A;  4BBT A;  4NXG A;  1P97 A;  1UWP X;  4NXB A;  2M1C A;  1OT9 A;  3MQO A;  5EFW A;  2WKP A;  1S66 L;  3H9W A;  3CWF A;  4JGR A;  1XJ4 A;  2K7S A;  4K08 A;  2A24 B;  1XFN A;  2V9A A;  3A0R A;  3PHY A;  2V0W A;  1LT0 A;  4GHI B;  3T50 A;  4LRX C;  3LIA A;  4R3A A;  2QKP A;  3BWL A;  1D7E A;  1MZU A;  4M4X A;  5G4Y A;  3LIB A;  5J4E A;  1S1Y A;  1GSW A;  3NOT C;  3NHQ A; 
#chains in the Genus database with same CATH topology
 4EBN A;  1XFQ A;  2KOI A;  1WE4 A;  3UDF A;  3ZQ5 A;  3RJU A;  5DJT A;  1MPL A;  2P9V A;  1FR6 A;  5EUA A;  1VQQ A;  3SOI A;  5FL3 A;  3HJK A;  4I38 A;  4HI4 A;  2DRW A;  2XRO A;  1L0E A;  3RH8 B;  3BQ8 A;  4FH4 A;  1YMS A;  1STZ A;  1PNE A;  2VEA A;  3UMD A;  3V50 A;  4II7 A;  2EX2 A;  2J3T D;  1YAX A;  2D01 A;  4S2J A;  1TS7 A;  3IF6 C;  1NWZ A;  1TF1 A;  2Q9M A;  5CX7 A;  3Q82 A;  3WRZ A;  1PWC A;  2P04 A;  4M3K A;  5AQ9 A;  5HL6 A;  1G28 A;  1ALQ A;  1YLZ A;  2PAV P;  5A8B A;  1L3L A;  1JNU A;  5CHM A;  1G6A A;  4R4R A;  5FAQ A;  3P7N A;  1UGU A;  5HWW A;  2GDN A;  2V1A A;  2BG1 A;  1SKF A;  4WEK A;  2H5S A;  3IHA A;  1N9L A;  3VP3 A;  1EW0 A;  4HY8 A;  4WBG A;  4BLM A;  4HOI A;  1T1B A;  1UWN X;  3VOY A;  3NJA A;  3QP8 A;  4R38 A;  3CJM A;  1W5D A;  4OP5 A;  1H8Z A;  4QPR A;  4WYY A;  5MC7 A;  1XX2 A;  4FSF A;  2JKT M;  4N1H A;  4NXG A;  3O88 A;  3OC2 A;  3JPU A;  3CWF A;  2A24 B;  3A0R A;  3AGF A;  3MXS A;  2W3D A;  3MZD A;  2WUQ A;  5BOH A;  2M7V A;  2HJE A;  1NRF A;  1KGE A;  3MZE A;  2O9C A;  4HBT A;  1RGZ A;  4WZ5 A;  4DXB A;  1YLJ A;  3BM6 A;  1J3W A;  2OLV A;  5D3O A;  5FSR A;  3D72 A;  4HJ3 A;  3HVF A;  5TGF A;  4HNB A;  1V9Z A;  4KQR A;  4EXO A;  2EX6 A;  5FEF A;  3MXR A;  1FIK A;  2DCF A;  3UDX A;  5TBM A;  3RXW A;  4PAU A;  1HZO A;  2BTF P;  3S22 A;  3G4P A;  2VX8 A;  1EWZ A;  5EVE A;  1NYM A;  3G35 A;  3T12 B;  3SW1 A;  3JVU A;  2KDK A;  4S2K A;  4A5R A;  3CIT A;  4WL9 A;  5DKL A;  4MDZ A;  4JKT A;  5IU1 A;  1W7F A;  3SS3 A;  3ZNT A;  2W3F A;  2Y2N A;  4E6X A;  4BL2 A;  3DTE A;  1GHM A;  3OLO A;  3ZG5 A;  2FFY A;  5F5Y A;  3KSH A;  2L0W A;  3AGE A;  2XR0 A;  1ES5 A;  3KYZ A;  2ZM8 A;  1K55 C;  4MEZ A;  3LR3 A;  1OPX A;  3MBZ A;  1CQA A;  3IH8 A;  4PHT A;  4CLC A;  3WS5 A;  3S7P A;  4B88 A;  1H8M A;  1VM1 A;  3D4F A;  1IYP A;  3UME A;  1NJ4 A;  3W2Z A;  5C5K A;  5E2G A;  2Z6C A;  4LV3 A;  1YSQ A;  3VSL A;  4EQ1 A;  1PZO A;  1KVL A;  2OWH A;  5EOO A;  5EVI B;  1LL5 A;  2Y2K A;  1XA7 A;  5TR7 A;  3MQO A;  1NY0 A;  3HLW A;  4CPK A;  1FCO A;  5FAS A;  1D7E A;  4FD8 A;  3IHB A;  2VGJ A;  2GZA A;  1IKI A;  4OOL A;  1CK3 A;  3GQZ A;  2J3T C;  2EFU A;  4Y3I A;  4X55 A;  3C38 A;  3CUE C;  5GLB A;  2JKR M;  3G30 A;  4OQG A;  5CGW A;  2Y79 A;  3IXG A;  5FAT A;  4ZJ3 A;  3E2K A;  3C7V A;  5IHV A;  1K4E A;  5DVA A;  1NYY A;  3BFC A;  4UA9 A;  2J9P A;  1T18 A;  4PM6 A;  4S2L A;  1YLP A;  1JWP A;  3CI6 A;  3MR0 A;  2JN7 A;  4P0M A;  3GR2 A;  2Y2I A;  3G2Z A;  1PIO A;  3V39 A;  4YIN A;  1ERQ A;  1K56 D;  2OLU A;  4PMA A;  2JKR I;  4JXW A;  2MJ6 A;  5EVI D;  1O07 A;  4S2P A;  4Q0H A;  3N8L A;  4LV0 A;  5HPF A;  2VV6 A;  1T19 A;  2KLI A;  1BLH A;  3ZDJ A;  3VSK A;  5AQB A;  3T1R A;  5CEB A;  1HLU P;  4G3K A;  4PM8 A;  3WWX A;  3VFF A;  3SZT A;  4D2O A;  2FFF B;  1K57 A;  4D60 A;  4YWZ A;  5M19 A;  2W3H A;  1K6S A;  4KZB A;  5AJG A;  3W4Q A;  3SS5 A;  3OPL A;  3H9W A;  3B42 A;  2O9B A;  2P08 A;  1MWT A;  1K6R A;  3FPW A;  1E25 A;  3O87 A;  1N4O A;  3NY4 A;  2ZC6 B;  2ZMF A;  2YKH A;  3OPR A;  1ODV A;  4MN5 A;  3IX4 A;  3PBS A;  3T1S A;  1K56 A;  1QME A;  1S67 L;  3T4S A;  3WS2 A;  1GHI A;  2VV8 A;  4LLO B;  1PW8 A;  2ZQC A;  1ES3 A;  4F3L B;  5F83 A;  4KZ3 A;  4MMN A;  2L4R A;  2V1B A;  2Q9N A;  2AVX A;  4WMC D;  4DJ3 A;  3K3D A;  4KQO A;  5CTM A;  3IXD A;  3NDE A;  4LRY C;  1L0D A;  1LSX A;  1U60 A;  2BAS A;  3Q07 A;  5U47 A;  1N9O A;  3QHY A;  1BZA A;  2I9V A;  1SDN A;  2PR5 A;  1WYB A;  5CEC A;  4G3V A;  3T1Q B;  2HPB A;  3EWK A;  3FKV A;  2V0U A;  3NBL A;  3IWI A;  3M6B A;  5F68 A;  4KZ6 A;  1YMX A;  5KMW A;  1TD5 A;  1RP5 A;  4E3L A;  3A3E A;  1IEM A;  5HWV A;  3NOP C;  4JXG A;  4LPZ A;  1MKM A;  2WGW A;  4LV2 A;  1FOF A;  2JBF A;  4IUH A;  3Q7V A;  5DFY A;  4IHQ A;  1I2S A;  2H0Y A;  1BUL A;  5FAO A;  3SH8 A;  3A0S A;  1DY6 A;  2A24 A;  5EVI A;  2HDU A;  2VGL M;  2XD5 A;  1OT9 A;  3GSG A;  5FQJ A;  4LRX C;  5G4Y A;  4E3O A;  3PTE A;  5J4E A;  5HL1 A;  5CHU A;  5DTK A;  1MC0 A;  2ZC4 B;  3NUL A;  3CLO A;  1LLB A;  1M40 A;  2ZJ9 A;  4HBU A;  3F1O A;  3U2A A;  3E4Q A;  2PD8 A;  3VE3 A;  2VJW A;  3CHW P;  3VP2 A;  3NCK A;  1GA0 A;  3M2J A;  3H7W A;  1MXO A;  3HUM A;  4HES A;  5AQA A;  4KQQ A;  2XQZ A;  2JKG A;  1X0O A;  3PAG A;  3EGX C;  3NDG A;  5DF8 A;  1LL9 A;  4NKP A;  1F2K A;  4PPR A;  1KE3 A;  3Q7V B;  3QP5 A;  4DJ2 A;  1PW1 A;  1S4S A;  3V3R A;  5HWT A;  1A0K A;  3VP1 A;  2ZL1 A;  4L0L A;  2VK3 A;  4R3J A;  4KG6 A;  3NEC A;  5G4Z A;  3BQA A;  4H8R A;  1VEU B;  3A3J A;  1PI4 A;  2E8J A;  4B9O A;  3ZYT A;  3SS4 A;  1PWD A;  2Y2P A;  3JYI A;  4JXV A;  3BLS A;  3G2Y A;  3H82 B;  1DP8 A;  3A3I A;  3QNB A;  4BMW A;  2EXB A;  2P7J A;  5GHX A;  5HAR A;  4BBU A;  5FQI A;  1P97 A;  3ZNY A;  2EX8 A;  3UPO A;  1S66 L;  1W79 A;  4B4Z A;  3RFB A;  2J8Y A;  3CG5 A;  2FH5 A;  4BD1 A;  4PM5 A;  2QKP A;  3I7J A;  1NZO A;  3TRC A;  1XA1 A;  4KZA A;  2ZQ7 A;  1NZU A;  4R6L A;  3N8R A;  2EFX A;  3JVV A;  4JPM A;  3IQA A;  3LEZ A;  3ZGA B;  3G6O A;  3K2N A;  1D06 A;  1YM1 A;  3G34 A;  4NXF A;  3UE0 A;  4WEJ A;  3IF6 A;  1F9I A;  2QJ7 A;  4XT2 A;  2VLG A;  4S2O A;  1Z09 A;  4G3W A;  3DAV A;  2PDR A;  2Y2L A;  3R7W A;  1JWZ A;  2WKR A;  4OOM A;  1K54 A;  4HP4 A;  1S0W A;  1ESU A;  2XA7 S;  3DWZ A;  4X6T A;  5E2H A;  2IWB A;  3FPV A;  3UPP A;  3BJN A;  5TFQ A;  3UB6 A;  3QP1 A;  4Z9Q A;  1GSV A;  1TEM A;  2XA7 M;  1KVM A;  4YOF A;  3T1X A;  4JLF A;  4ID4 A;  5J3W A;  2R9W A;  4FH2 A;  2OAP 1;  4ZRR A;  2B02 A;  4HP9 A;  1XJ6 A;  5KSH A;  5AQ7 A;  4ARZ B;  3WRT A;  3CMZ A;  3BY8 A;  1LSW A;  3UE6 A;  1I2W A;  3V3S A;  3LFV A;  2J80 A;  1MWU A;  3HLB A;  5EM1 A;  2JKT I;  3LR4 A;  2PU4 A;  3M2K A;  5CER A;  2K31 A;  3T4J A;  1NXY A;  4HJ4 A;  1HD8 A;  4PM7 A;  5K5B A;  3NC8 A;  5HDS A;  3S7Q A;  1VEU A;  1OTE A;  3N8S A;  4RQ9 A;  2JCH A;  2J9O A;  2EX9 A;  3ZCZ A;  2VV7 A;  3OPH A;  4C3Q A;  1PYY A;  3EOI A;  1DJC A;  4MLL A;  4S2N C;  1AWI A;  1HTZ A;  5HDD A;  4OP8 A;  4Y7P A;  3ITB A;  4KZ5 A;  2PU2 A;  3UE3 A;  4ZDX A;  1K54 C;  3IWO A;  3TSG A;  4Y2F A;  4GS9 A;  3MFX A;  5M18 A;  2EA9 A;  1H8Y A;  5TJJ A;  1FIL A;  3IBJ A;  3LID A;  2VGL S;  5CGX A;  5AVE A;  2QYB A;  4DXC A;  3KX0 X;  4L9G A;  4O01 A;  4WUJ A;  4QY5 A;  2Y2O A;  3K3C A;  2HZ5 A;  1S6R A;  4MBH A;  2A3U A;  3RTY A;  4MBK A;  4P87 A;  3BRM A;  4EER A;  2OSU A;  5HD3 A;  2P9V B;  4ZBE A;  1BTL A;  1IKG A;  3SH7 A;  3HBR A;  1LI0 A;  3ICY A;  5M1A A;  1ESI A;  4UA6 A;  5HW3 A;  2YKF A;  3C2W A;  2QJ5 A;  5A90 A;  3TE8 A;  2JHE A;  3FWL A;  1ZTU A;  1VHM A;  3EEA A;  2W1R A;  5EV0 A;  3QP2 A;  3R4K A;  2VZW A;  1XKZ A;  5L09 A;  4GD6 A;  4GKU A;  4OVD A;  5L07 A;  4OOY A;  2HF6 A;  3D3O A;  4K0W A;  3G31 A;  3QP4 A;  1BLP A;  1CF0 A;  4JF6 A;  2XLN A;  4YFM A;  1J9M A;  4QY6 A;  1L0F A;  4OQ0 A;  2ZL1 B;  4IVI A;  4FOF A;  2Y2J A;  3C8C A;  4UAA A;  5DF9 A;  5I5L A;  3W4O A;  5FI7 A;  4P85 A;  4GHI A;  1AXB A;  3P01 A;  2Z6D A;  2UV0 E;  1RGY A;  1IYO A;  3Q7Z A;  5DJU A;  3O86 A;  1L2S A;  3T4O A;  4LEN A;  2Y91 A;  3NIA A;  2R78 A;  3A3D A;  2X71 A;  5I94 A;  1MY8 A;  2HV1 A;  2WAF A;  5F6A A;  5TBM B;  1BUE A;  2GNX A;  2W1T A;  2XD1 A;  4N9K A;  2XEP A;  2X01 A;  2HP9 A;  4XUX A;  2DMW A;  2WZZ A;  1BT5 A;  2J3W A;  3S1Y A;  4I3I A;  2O9A A;  3OPP A;  3C4P A;  3V5M A;  4GJ4 A;  1V9Y A;  4KG5 A;  4EET B;  1IYS A;  4B4X A;  1W8Q A;  2ZD8 A;  4I39 A;  3FZC A;  3BLM A;  3LR0 A;  4JF4 A;  3KYE A;  4OQI A;  3BFF A;  3WS0 A;  2PBD P;  4IBX A;  4R3A A;  3LIB A;  1S1Y A;  1RCJ A;  3A3F A;  2BLS A;  4H6J A;  2EWV A;  3O5Y A;  3EQU A;  4GDN A;  4MN6 A;  2XDM A;  4GS9 B;  1CI8 A;  2PD7 A;  4E3M A;  2RL3 A;  4EUZ A;  2VKS A;  1BYW A;  5KSC A;  1XXM A;  3MKF A;  1SDE A;  2CC1 A;  2PHY A;  1CEG A;  4DE0 A;  4OQH A;  1TDL A;  3CZD A;  1ZKJ A;  2M7U A;  3HJI A;  4F3L A;  2EWW A;  1ERM A;  1Q2Q A;  5DKK A;  4GN2 A;  2Z2M B;  3GVB A;  4HHD A;  5A91 A;  3A0V A;  4WZ5 C;  2ZQ8 A;  1GCE A;  4BL3 A;  1G6O A;  3VFH A;  4RX2 A;  2Y2G A;  4U0T A;  4UEY A;  5HD5 A;  4XXR A;  1FR1 A;  1TDG A;  3H82 A;  2WK0 A;  3ZG0 A;  4B93 A;  5CXW A;  4CJN A;  3DW0 A;  4EBP A;  5L10 A;  2PR6 A;  5FDH A;  2ZM2 A;  5CHJ A;  4WZ4 A;  2PT7 A;  4FTX A;  5EEC A;  2V20 A;  3EEH A;  3LY3 A;  3ISG A;  4Y5F A;  2Y2M A;  1G68 A;  3IXH A;  2WZX A;  5KZH A;  1YLY A;  2PYR A;  1KDS A;  4FCF A;  4X68 A;  1ZG6 A;  3MKE A;  1SZV A;  1H3Q A;  1FSY A;  3C5A A;  2HP5 A;  4AFI A;  3MMH A;  2W3E A;  1XPB A;  3BEB A;  3DWK A;  1GSW A;  3PBQ A;  1VET B;  4S2I A;  3MSH A;  1KDW A;  2UWX A;  3HLF A;  5FA7 A;  5CRF A;  1WYC A;  3IH9 A;  2OOL A;  4XT2 B;  3BFD A;  1M6K A;  3CPT A;  3VE4 A;  1G5U A;  4ZTK A;  2H10 A;  1PWG A;  2C6W B;  3KO6 A;  1CEF A;  2I72 A;  1SKO B;  4X56 A;  3BY9 A;  5GLD A;  4QWO A;  2IWD A;  3IBR A;  3ZG8 B;  4EEU A;  5JYP A;  3FYZ A;  1OJ5 A;  3UB8 A;  2VGK A;  3S4X A;  3F1N A;  1FQG A;  3HL9 A;  4BQM A;  5DTT A;  1SCW A;  5FAP A;  3KSI A;  3T4Q A;  4I5S A;  2H0T A;  2OV5 A;  1PI5 A;  4WN5 A;  2GX5 A;  3U4L P;  2W1T B;  1IEL A;  5G18 A;  1CI9 A;  3HLE A;  4N1X A;  2XF3 A;  4R4S A;  4EV4 A;  5IT5 A;  1P0Z A;  3PYP A;  1P9W A;  4DDS A;  3Q81 A;  1XJ2 A;  1OTI A;  2H28 A;  3GRJ A;  2ZQA A;  3T4L A;  4PM9 A;  1JWV A;  1UWP X;  4X1M A;  4S2M A;  2LB9 A;  2ZC5 B;  1NRJ A;  2Y8H A;  4DRT A;  3OCN A;  2WGW B;  3DTK A;  2OWJ A;  3MJQ A;  1W8Y A;  2WKH A;  2XFT A;  1JTG A;  1E3U D;  2VA0 A;  3S7O A;  2XK1 A;  5CED A;  4HQA A;  3LGO A;  4IVK A;  2Z2L B;  4CLC D;  4JBF A;  3N4I A;  3HLG A;  2Q0O A;  2Y2H A;  2XH9 A;  3H7W B;  2G2W A;  2GJ3 A;  2J7V A;  4GNU A;  4IUK A;  4GB7 A;  4OON A;  5AVF A;  1IFQ A;  2ZMA A;  4O8G A;  2B18 A;  3Q1F A;  4MCW A;  5DF7 A;  3VOZ A;  3IXB A;  2A2L A;  2W3G A;  2B5R A;  1NLZ A;  4DE1 A;  3IT9 A;  3EGD C;  4Q0I A;  4QJG A;  3CPT B;  5HAP A;  4IED A;  2XFS A;  5KIZ A;  1K4F A;  5HPI A;  3B33 A;  4U0X A;  4PKY G;  4Y0T A;  4EW7 A;  2W0N A;  3E4P A;  3E4O A;  3B3X A;  1N9N A;  2IWC A;  3ULF A;  4EES A;  5HAI A;  4X69 A;  4RVA A;  1DP6 A;  1GSX A;  5EM0 A;  1KGG A;  4NXB A;  2M1C A;  4GOG A;  1L0G A;  2V8F A;  4JGR A;  5LBR A;  3L7H A;  1XFN A;  4NK3 A;  4UHU A;  2HDR A;  3LEQ A;  4M4X A;  2FZ0 A;  4CQH A;  5EPH A;  4ZJ2 A;  4EU0 A;  1MWS A;  4JGO A;  2V2F F;  3CUE A;  3OOV A;  5GHY A;  1K0K A;  1DJA A;  4PKY A;  2Y4A A;  4RA7 A;  4KUK A;  3FV7 A;  1Q2P A;  1KE0 A;  3PBT A;  2WYX A;  1N9B A;  3BW6 A;  5JYO A;  1IOU A;  4HH3 A;  3LI9 A;  4E3N A;  4KUO A;  3N6I A;  4EBL A;  5FEG A;  1TS8 A;  4QU3 A;  4I3A A;  4C6Y A;  5A93 A;  1YSP A;  1ZHH B;  4XUZ A;  4JGQ A;  3MXQ A;  2PYP A;  4LRZ E;  4K0X A;  5L2F A;  3LO7 A;  2WKI A;  2X02 A;  4GW9 A;  2ZLY A;  5L8M A;  2WKQ A;  5E43 A;  1IYQ A;  3FG8 A;  3CAX A;  3UN7 A;  1BLC A;  4GDB A;  4O7D A;  1JTD A;  3ITA A;  3O3V A;  5HSQ A;  1ES2 A;  2HDS A;  3UPN A;  3W8K A;  1K57 C;  3LIC A;  5HZH A;  2PRF A;  4N92 A;  3UB7 A;  3MF0 A;  4S2N A;  2O99 A;  4DE3 A;  4R0Q A;  4QD4 A;  1T1C A;  1PZP A;  1ACF A;  4LGW A;  1LHY A;  1I5Q A;  4Y15 A;  1LT0 A;  5EVL A;  3UB5 P;  1EI5 A;  3MS6 A;  4OH0 A;  1Y4O A;  1BLS A;  2L1M A;  2G2U A;  4NET A;  5F1G A;  3D9Y A;  1TVF A;  3LYX A;  3TJZ C;  4NXE A;  4KZ7 A;  2C5W B;  3DBA A;  2D02 A;  3HRE A;  1OJG A;  3UY6 A;  3KSG A;  4GD8 A;  1TS0 A;  4DKI A;  3PBR A;  5HAQ A;  4BD0 A;  3BFG A;  1F98 A;  3HCY A;  3S7N A;  1D1J A;  4ARZ A;  4EUV A;  2HJ9 C;  1O7E A;  3PBO A;  4N9L A;  3LUQ A;  2CMN A;  1H0M A;  3IWQ A;  5F69 A;  3VMA A;  1YT4 A;  3ZVW A;  2QZ6 A;  4ETX A;  4P6Z M;  3ZHH A;  5E2E A;  1JVJ A;  3F1P B;  5DFX A;  3W4P A;  3PXP A;  2EXA A;  4OLG A;  4WM9 A;  2ZBB A;  1VB6 A;  1W63 M;  4BWI A;  3OZH A;  4WLA A;  3WS1 A;  1Y54 A;  1S1Z A;  1MWR A;  4Q8I A;  1T1A A;  1DP9 A;  4LFU A;  5FDS A;  5FQK A;  1CJF A;  1XJ3 A;  5CTN A;  4KZ4 A;  5F1F A;  3N7W A;  4CLC C;  3IF6 B;  2WGI A;  4GZB A;  1ONH A;  4OPY A;  1ZC2 A;  3PAE A;  3UDI A;  1DRM A;  4BBV A;  4IJG A;  1YLT A;  1FCN A;  2HP6 A;  2R9X A;  3KYQ A;  4BJP A;  5EFW A;  3RXX A;  3PHY A;  1YPR A;  3T4T A;  4OPR A;  4UQI S;  1MZU A;  3QNC A;  4Z1W A;  3EQV A;  3NOT C;  5IS1 A;  3MZF A;  3IS2 B;  3DTM A;  1FCM A;  4RYE A;  3HUN A;  2V1Z A;  4R1G A;  4IBR A;  1XGJ A;  3UNW A;  4BEN A;  3LCE A;  4R70 A;  3E0Y A;  1E4D A;  2A49 A;  4HH2 A;  4X1L A;  4EEP A;  3UB9 A;  3LIE A;  3VP0 A;  3L9K A;  4NG2 A;  1LL8 A;  2JKF A;  4Y0O A;  2Y59 A;  4MN7 A;  3OCL A;  2QMI A;  4HIA A;  4UQI M;  5HX9 A;  5DTS A;  5GLC A;  3HLC A;  2ZOI A;  1TS6 A;  2ZQD A;  4HEF A;  4LV1 A;  4OLD A;  3IF5 A;  5J8X A;  5FQM A;  1OTB A;  4MNR A;  5CGS A;  2INW A;  3UO9 A;  3AGD A;  2RCX A;  2ZOH A;  2ZC7 A;  4UA7 A;  1OTD A;  3NI9 A;  1OT6 A;  5E2F A;  2W27 A;  4EWF A;  3IX3 A;  4LCL A;  2WKE A;  3FC7 A;  3HLD A;  3QP6 A;  1ES4 A;  3VP4 A;  1HVB A;  4OPQ A;  2O0Y A;  4I3J A;  4DF6 A;  1XGI A;  3TG9 A;  1WA9 A;  3P98 A;  1OTA A;  4Y17 A;  4BBT A;  3GV9 A;  5GL9 A;  1YLW A;  1YQS A;  2WKP A;  3DTI A;  3ZG9 B;  4K08 A;  3BEC A;  2QPN A;  2V0W A;  4GHI B;  3T50 A;  3MFD A;  3IX8 A;  1Z6F A;  4OKP A;  5A92 A;  2PBY A;  5FI2 A;  1GA9 A;  2ZC3 B;  3TOI A;  3F1O B;  4DDY A;  4OPZ A;  2Y2Q A;  4FUW A;  4YNR A;  2KX6 A;  4Q0J A;  4KZ8 A;  1ONG A;  1PFL A;  3E98 A;  4JF5 A;  4ZAM A;  1S4R A;  3GMW A;  3B47 A;  5EVI C;  4ESP A;  5FI6 A;  2XRN A;  4GCZ A;  5GHZ A;  2P74 A;  1ZG4 A;  3BFE A;  3G32 A;  3BYD A;  4E04 A;  4E6W A;  1MBL A;  3IS2 A;  1P9R A;  3HUO A;  3M6H A;  3VOL A;  4KG2 A;  1DJB A;  2HDQ A;  3OBF A;  4X53 A;  4KZ9 A;  3F1P A;  5GLA A;  1K55 A;  4CLC E;  2QHK A;  4Y0U A;  3MQ0 A;  1LSV A;  1XP4 A;  4JXS A;  4KQD A;  3NOU C;  1NLY A;  2V8C A;  4E3K A;  4DMZ A;  3V67 A;  2WGV A;  4E3I A;  2IA2 A;  3LIF A;  3ZVT A;  1MKI A;  2QWS A;  2JC7 A;  4RX3 A;  4WF0 A;  4WMC A;  4ZJ1 A;  1OME A;  2OAQ 1;  4R23 A;  1YKD A;  2LB5 A;  2ZMV A;  3LR5 A;  2G7U A;  2ACG A;  4R3B A;  3PR6 A;  4QHC A;  2K7S A;  3C30 A;  2DNS A;  2V9A A;  4U3T A;  1F5M A;  1SHV A;  5EOE A;  3BWL A;  1ERO A;  3E2L A;  2K2N A;  4LCM A;  3NHQ A;  4ETZ A;  3LY4 A;  1VET A;  3P09 A;  4EQI A;  1BSG A;  1PRQ A;  5HFO A;  2WAE A;  4CLC B;  4P6Z S;  1KOU A;  1FSW A;  3VV4 A;  3ZFZ A;  4DE2 A;  3MQQ A;  3UE1 A;  3C4O A;  4F94 A;  5J7E A;  1KE4 A;  5HDC A;  4L9E A;  3KSF A;  3GEC A;  4Y13 A;  1E3U A;  4X25 A;  4GLQ A;  5FQQ A;  3R7W B;  2B95 A;  4O0P A;  2XGN A;  4K91 A;  5F82 A;  1K38 A;  3GTC A;  3F1N B;  3GDI A;  3SH9 A;  2NUP C;  2E8I A;  3ZG7 B;  1QMF A;  4KEN B;  1C3B A;  1GHP A;  1KGF A;  5EE8 A;  3TW8 A;  3PBN A;  4P6B A;  5FQ9 A;  4H6J B;  1SKO A;  4L9F A;  4WEL A;  4DN0 A;  1H5X A;  3FKW A;  2NUT C;  2JE5 A;  4NEE D;  2Y55 A;  4HJ6 A;  3C7U A;  3LI8 A;  2ZM0 A;  2WAD A;  4JGP A;  2HGV A;  4E3J A;  4ME4 A;  1K25 A;  3WS4 A;  1Y28 A;  1LI9 A;  4QB8 A;  1W63 Q;  1XJ4 A;  2ZQ9 A;  2XSS A;  3LIA A;  4C75 A;  3T4K A;  4MBF A; 
#chains in the Genus database with same CATH homology
 1XFQ A;  2L1M A;  2KOI A;  4H6J A;  1MC0 A;  2EWV A;  3O5Y A;  3EQU A;  3LYX A;  3TJZ C;  4MN6 A;  3ZQ5 A;  3CLO A;  4NXE A;  5DJT A;  4GS9 B;  2PD7 A;  3DBA A;  2D02 A;  2VKS A;  1BYW A;  1OJG A;  3F1O A;  3KSG A;  5FL3 A;  3HJK A;  4I38 A;  1TS0 A;  4HI4 A;  3U2A A;  3E4Q A;  2XRO A;  2PD8 A;  2PHY A;  3RH8 B;  3VE3 A;  3BQ8 A;  2VJW A;  3PBR A;  1STZ A;  2M7U A;  2VEA A;  3HJI A;  4F3L A;  1F98 A;  2EWW A;  3H7W A;  3UMD A;  4II7 A;  2J3T D;  1X0O A;  3HCY A;  3S7N A;  1YAX A;  5DKK A;  3EGX C;  4ARZ A;  2D01 A;  4EUV A;  2HJ9 C;  1TS7 A;  1NWZ A;  3PBO A;  1TF1 A;  4HHD A;  3LUQ A;  2CMN A;  5CX7 A;  5F69 A;  4NKP A;  2P04 A;  3A0V A;  5HL6 A;  1G28 A;  4ETX A;  4P6Z M;  1G6O A;  5A8B A;  3F1P B;  5DFX A;  1JNU A;  4DJ2 A;  3PXP A;  4UEY A;  5HD5 A;  1S4S A;  5HWT A;  3P7N A;  2ZBB A;  4L0L A;  1UGU A;  1VB6 A;  5HWW A;  2V1A A;  3H82 A;  4B93 A;  1W63 M;  4WEK A;  4BWI A;  5G4Z A;  3BQA A;  4WLA A;  1N9L A;  1S1Z A;  1EW0 A;  2PR6 A;  4HY8 A;  4HOI A;  2PT7 A;  4B9O A;  1T1A A;  1T1B A;  1DP9 A;  3ZYT A;  1UWN X;  3EEH A;  3NJA A;  1XJ3 A;  4R38 A;  4Y5F A;  3H82 B;  4CLC C;  1DP8 A;  4QPR A;  4BMW A;  2PYR A;  5MC7 A;  4FSF A;  2P7J A;  1DRM A;  4BBU A;  2JKT M;  4BBV A;  4NXG A;  1P97 A;  4IJG A;  1H3Q A;  3KYQ A;  4BJP A;  3OC2 A;  5EFW A;  1S66 L;  3CWF A;  2A24 B;  3A0R A;  3RFB A;  4AFI A;  3PHY A;  2FH5 A;  3T4T A;  2W3D A;  3MMH A;  2QKP A;  2W3E A;  4UQI S;  1MZU A;  4Z1W A;  2M7V A;  3EQV A;  2HJE A;  3TRC A;  1GSW A;  3NOT C;  3PBQ A;  5IS1 A;  2O9C A;  3IS2 B;  4R6L A;  3JVV A;  2OOL A;  4XT2 B;  3G6O A;  3K2N A;  3D72 A;  4HJ3 A;  1D06 A;  4HNB A;  1V9Z A;  3VE4 A;  4NXF A;  4R70 A;  3E0Y A;  4WEJ A;  4EXO A;  4HH2 A;  3KO6 A;  1F9I A;  2QJ7 A;  5TBM A;  4XT2 A;  2VLG A;  3BY9 A;  4PAU A;  4EEP A;  3UB9 A;  3IBR A;  4EEU A;  3LIE A;  1LL8 A;  4MN7 A;  3OCL A;  4G3W A;  2PDR A;  2VX8 A;  1OJ5 A;  4HIA A;  4UQI M;  3UB8 A;  3SW1 A;  3R7W A;  3JVU A;  2WKR A;  2ZOI A;  1TS6 A;  2KDK A;  3F1N A;  4OOM A;  3CIT A;  4HP4 A;  2XA7 S;  4WL9 A;  5DKL A;  4MDZ A;  5IU1 A;  1OTB A;  2W3F A;  3KSI A;  3T4Q A;  4I5S A;  3FPV A;  3OLO A;  2INW A;  3BJN A;  4WN5 A;  2GX5 A;  5F5Y A;  3UB6 A;  2W1T B;  1GSV A;  2ZOH A;  3KSH A;  2XA7 M;  2L0W A;  4YOF A;  3KYZ A;  1OTD A;  5J3W A;  1OT6 A;  2W27 A;  3LR3 A;  1OPX A;  3FC7 A;  2OAP 1;  4ZRR A;  4PHT A;  4CLC A;  2B02 A;  4HP9 A;  1P0Z A;  5IT5 A;  1XJ6 A;  3S7P A;  5KSH A;  1H8M A;  3PYP A;  1P9W A;  4ARZ B;  3UME A;  3W2Z A;  3BY8 A;  5C5K A;  1LSW A;  1XJ2 A;  2Z6C A;  1OTI A;  2O0Y A;  3UE6 A;  2H28 A;  4I3J A;  1YSQ A;  1WA9 A;  4EQ1 A;  1OTA A;  3LFV A;  2J80 A;  2OWH A;  3T4L A;  4BBT A;  1UWP X;  2JKT I;  3MQO A;  2LB9 A;  2WKP A;  3LR4 A;  4K08 A;  3T50 A;  2V0W A;  4GHI B;  1NRJ A;  1D7E A;  2K31 A;  3T4J A;  2Y8H A;  2GZA A;  4HJ4 A;  3OCN A;  5K5B A;  4OOL A;  2OWJ A;  3MJQ A;  5HDS A;  3S7Q A;  2J3T C;  1OTE A;  4RQ9 A;  4Y3I A;  3C38 A;  3CUE C;  2VV7 A;  3F1O B;  2JKR M;  2VA0 A;  3S7O A;  2Y79 A;  3EOI A;  4YNR A;  4HQA A;  2KX6 A;  4Q0J A;  4CLC D;  3E98 A;  1S4R A;  5HDD A;  3B47 A;  3UE3 A;  3H7W B;  2XRN A;  4GCZ A;  1T18 A;  2GJ3 A;  4IUK A;  3CI6 A;  4Y2F A;  3MR0 A;  2JN7 A;  4GS9 A;  3MFX A;  4E04 A;  2EA9 A;  5AVF A;  3IS2 A;  5TJJ A;  1IFQ A;  1P9R A;  3IBJ A;  3LID A;  3VOL A;  2VGL S;  4O8G A;  3OBF A;  2JKR I;  2B18 A;  4MCW A;  5AVE A;  2QYB A;  2MJ6 A;  3F1P A;  3KX0 X;  4CLC E;  4L9G A;  2A2L A;  4O01 A;  2QHK A;  4Q0H A;  4WUJ A;  2W3G A;  3MQ0 A;  1NLZ A;  5HPF A;  1LSV A;  2VV6 A;  3EGD C;  3K3C A;  4Q0I A;  4KQD A;  1T19 A;  2KLI A;  3NOU C;  1NLY A;  4DMZ A;  3RTY A;  3V67 A;  4EER A;  5KIZ A;  5HPI A;  2IA2 A;  3LIF A;  5HD3 A;  3B33 A;  4PKY G;  4EW7 A;  4G3K A;  2QWS A;  4WF0 A;  2W0N A;  3E4P A;  3ICY A;  3E4O A;  2YKF A;  3C2W A;  1N9N A;  2OAQ 1;  3ULF A;  2QJ5 A;  4EES A;  3TE8 A;  2JHE A;  1YKD A;  2LB5 A;  2ZMV A;  1DP6 A;  3LR5 A;  1GSX A;  4YWZ A;  2W3H A;  1ZTU A;  2G7U A;  3PR6 A;  1VHM A;  3EEA A;  2M1C A;  4NXB A;  5AJG A;  3H9W A;  4JGR A;  2W1R A;  2K7S A;  3C30 A;  5LBR A;  3B42 A;  2O9B A;  1XFN A;  1F5M A;  2P08 A;  2V9A A;  3R4K A;  3FPW A;  3BWL A;  4M4X A;  2FZ0 A;  2K2N A;  4CQH A;  2VZW A;  3NHQ A;  4ETZ A;  4EU0 A;  2ZMF A;  2YKH A;  4JGO A;  3CUE A;  1ODV A;  4MN5 A;  3OOV A;  2HF6 A;  3D3O A;  3PBS A;  4CLC B;  4P6Z S;  1S67 L;  3T4S A;  2VV8 A;  4LLO B;  4PKY A;  1KOU A;  3VV4 A;  4KUK A;  4F3L B;  3MQQ A;  4MMN A;  2L4R A;  3PBT A;  5J7E A;  2V1B A;  4FOF A;  5HDC A;  4DJ3 A;  3BW6 A;  3K3D A;  4L9E A;  1IOU A;  4HH3 A;  3C8C A;  3LI9 A;  3KSF A;  5DF9 A;  3GEC A;  4KUO A;  5I5L A;  4KQO A;  4GLQ A;  1TS8 A;  4LRY C;  4GHI A;  1LSX A;  4I3A A;  3P01 A;  2Z6D A;  2BAS A;  3R7W B;  4O0P A;  1YSP A;  1ZHH B;  1N9O A;  3F1N B;  3GDI A;  5DJU A;  4JGQ A;  3MXQ A;  2PYP A;  2NUP C;  3T4O A;  2I9V A;  4LRZ E;  2PR5 A;  4GW9 A;  4G3V A;  3TW8 A;  5L8M A;  3EWK A;  2WKQ A;  3PBN A;  2R78 A;  2V0U A;  4H6J B;  3FG8 A;  3CAX A;  2HV1 A;  5F6A A;  5TBM B;  4L9F A;  2GNX A;  2W1T A;  4WEL A;  4DN0 A;  5F68 A;  2NUT C;  2DMW A;  1TD5 A;  5HSQ A;  4NEE D;  4HJ6 A;  2J3W A;  3LI8 A;  3LIC A;  5HWV A;  3NOP C;  4I3I A;  4LPZ A;  1MKM A;  5HZH A;  2O9A A;  3UB7 A;  4IUH A;  5DFY A;  4GJ4 A;  1V9Y A;  4EET B;  3MF0 A;  4JGP A;  2HGV A;  2O99 A;  4IHQ A;  4ME4 A;  1Y28 A;  3A0S A;  4I39 A;  2A24 A;  3LR0 A;  1T1C A;  2VGL M;  1OT9 A;  1W63 Q;  1XJ4 A;  1LT0 A;  4LRX C;  2XSS A;  3LIA A;  4R3A A;  5G4Y A;  3LIB A;  3T4K A;  5J4E A;  1S1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...