1S66L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
b'NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yddU
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
total genus 24
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s66L00
4HJ3A 3IS2B 2VV8A 4NXEA 5IU1A 1XJ6A 5F68A 5HDCA 1UWPX 1G28A 4I3IA 1LSWA 4R70A 4JGOA 2BASA 4GW9A 3GDIA 1OTEA 2GJ3A 3C8CA 2VLGA 2ZOHA 3F1NA 3LIEA 5F6AA 4HJ4A 2KDKA 1LSVA 3K3CA 3LIAA 3NHQA 3GECA 1OTDA 4E04A 4WLAA 2QHKA 3FC7A 1N9OA 2PDRA 4EESA 1WA9A 2EA9A 4LRYC 5HZHA 1GSWA 3MQQA 5HD3A 1DP9A 2QJ5A 4JGRA 3F1PA 3OLOA 3KX0X 1EW0A 4L9GA 3LIBA 1KOUA 3CLOA 3CWFA 2B02A 2JN7A 5DKKA 5KIZA 3VOLA 4H6JB 5A8BA 3MQOA 4M4XA 4HH2A 5J7EA 4HNBA 3K3DA 2V0WA 2OWJA 4HHDA 3G6OA 4JGQA 1Y28A 4WL9A 2PHYA 5HWTA 4MN5A 4NXFA 3A0RA 1TS0A 4I38A 4WN5A 4GHIA 5G4ZA 1D06A 2A24A 4HY8A 4I39A 4BBUA 4HOIA 3LI9A 1P97A 4EETB 1MZUA 1S66L 1GSXA 5HDDA 3UE6A 2L1MA 2WKPA 3FG8A 5J3WA 3HJIA 4HIAA 2PD8A 4MN6A 4EEPA 4XT2A 4DJ2A 2D01A 5AVFA 5HWWA 4DJ3A 1LL8A 4K08A 4I3JA 1T1CA 3IBRA 2CMNA 3H7WA 3EEHA 3VE3A 2Z6CA 3EWKA 2D02A 3E4OA 5DJUA 1S1ZA 3B33A 2ZBBA 3F1OB 1DRMA 3PHYA 2P7JA 3E4PA 3BY9A 4HH3A 4R38A 3NOTC 3IS2A 2YKHA 1T19A 4L9EA 3E4QA 2R78A 3A0SA 4I3AA 1OJ5A 2QWSA 1XFNA 3C2WA 1XJ2A 4I5SA 1OT6A 2W27A 1OTBA 4LLOB 4HP9A 4YWZA 1BYWA 3ULFA 3A0VA 2H28A 1S1YA 4PKYA 3BY8A 2I9VA 2VEAA 3LI8A 2V9AA 4EQ1A 2PD7A 5HDSA 3UB6A 3T50A 4GHIB 3PYPA 4EERA 4EEUA 2A24B 4R6LA 4KQDA 1F98A 4LRXC 5TBMB 1JNUA 4BBTA 1S4RA 4F3LB 5J4EA 4GS9A 4RQ9A 4EXOA 1N9LA 1X0OA 1T1BA 3H82A 2QJ7A 4H6JA 2JHEA 4R3AA 3NOPC 1XJ3A 1XJ4A 3UMDA 3H7WB 3MJQA 1F9IA 3BWLA 5AVEA 5IS1A 3H9WA 2M1CA 3F1NB 4PKYG 3UB8A 4NXBA 1OT9A 5HWVA 2V1BA 2V0UA 1TS7A 1DP6A 3MXQA 2J80A 4EW7A 5G4YA 4WUJA 5F69A 2ZOIA 5HD5A 1TS8A 2PR6A 3RH8B 2WKRA 1V9YA 2L4RA 1TS6A 3D72A 1S4SA 3LICA 2OOLA 2QKPA 1P0ZA 4WF0A 5DKLA 3F1PB 3LYXA 1NWZA 4HQAA 3VE4A 3ICYA 1T1AA 4NXGA 2HV1A 4HP4A 2WKQA 3SW1A 1VB6A 5I5LA 2YKFA 3MR0A 1OTAA 5HSQA 3RTYA 2OWHA 3F1OA 4KUKA 3UMEA 5EFWA 1S67L 1GSVA 1T18A 1XFQA 4GS9B 5F5YA 1N9NA 2KX6A 2INWA 1LSXA 4BBVA 4L9FA 3H82B 4HJ6A 3CAXA 2VV7A 2L0WA 1UGUA 2V1AA 1OTIA 2PYRA 4KUOA 4XT2B 2K7SA 3P7NA 5DJTA 2PR5A 1OJGA 3UB9A 4GCZA 4JGPA 2W0NA 3LIFA 1DP8A 3HJKA 2PYPA 4B9OA 1V9ZA 3NOUC 3LUQA 3UB7A 3LIDA 3NJAA 5TBMA 4LPZA 1D7EA 2VV6A 4HI4A 4F3LA 3ZQ5A 2Z6DA 1ODVA 3MFXA 1UWNX 4LRZE 1LT0A
chains in the Genus database with same CATH superfamily
5EPHA 2VV8A 4NXEA 4MLLA 4OP5A 1KDSA 3E0YA 4KZ9A 1K55A 2NUPC 2G2WA 3QP1A 1ERQA 4R70A 1LHYA 1ZC2A 3QP5A 1YMSA 1RGZA 2QMIA 2ZM8A 4OPRA 3GDIA 1OTEA 2IWDA 3C8CA 5L2FA 2ZOHA 3VOZA 2EX8A 1LSVA 3ISGA 2XROA 3GECA 5A91A 2VK3A 2QYBA 4KQQA 4E04A 3CG5A 3O87A 1IYOA 3N6IA 1L0DA 2P9VB 1FCNA 3C7UA 3RXXA 1PRQA 4OPQA 2W3EA 1G5UA 4LRYC 1JWZA 1H8ZA 1HVBA 1K4EA 3M2JA 1DP9A 3VP2A 3BECA 3EEAA 2O9BA 4PPRA 4JGRA 4WMCD 3Q07A 3VP1A 4L9GA 4IBRA 3K2NA 2Y2LA 5A8BA 4M4XA 4HH2A 4HNBA 2K2NA 2V0WA 1CEGA 2OWJA 4KQOA 1ES2A 1YLWA 5BOHA 2Z2MB 4KQRA 2J3TD 1K54C 1FQGA 4MN5A 2V2FF 4S2NC 4GB7A 4DE2A 3S1YA 3VV4A 2XFSA 1EROA 2EFUA 1JWPA 3RFBA 3TE8A 5G4ZA 1LI9A 2A24A 3PBNA 2EX2A 4BBUA 2J7VA 2PAVP 4DDSA 3MSHA 1TDLA 3C4PA 3IF6C 5E2HA 3PAGA 3MBZA 2WKPA 2XFTA 2W3HA 3ZCZA 4CQHA 4GZBA 1KGEA 3V67A 1H0MA 3G34A 4HIAA 3SH9A 2PD8A 4M3KA 2V20A 4MN6A 4R4SA 4EEPA 3LCEA 2V8CA 5HWWA 1LL8A 4OPZA 1K6RA 1K0KA 2J9PA 4BWIA 4K08A 1KVLA 3Q82A 4OPYA 2B5RA 1KGFA 3LO7A 3DWZA 2XF3A 3L9KA 2ZL1A 2D02A 3E4OA 3FWLA 5DJUA 3UE0A 1H3QA 3HUOA 1JVJA 5IHVA 2P7JA 3FYZA 1MWUA 2XA7S 3HLCA 4E3LA 4OKPA 2ZQ9A 3IS2A 2YKHA 1W8QA 1W63Q 4QPRA 4N9LA 4LV3A 2HDUA 2QWSA 2Y59A 1XJ2A 4I5SA 1IELA 1OT6A 4ID4A 3NI9A 3ZDJA 5IT5A 5HAQA 1DJBA 2WGWA 1PFLA 3S22A 1G68A 3V5MA 4QY5A 3IF5A 1ES3A 3BY8A 5EM1A 1CF0A 2BG1A 3HLBA 3UPOA 1MBLA 2V9AA 1RGYA 4P6ZS 4E3KA 1YLJA 2QPNA 1PI5A 5F82A 2HDRA 2IA2A 4MNRA 4NKPA 4U0XA 4EUZA 2JKRI 3WWXA 2A24B 3DAVA 3KSHA 5HL1A 5A93A 2ZD8A 3AGDA 3KSGA 1F98A 5FQKA 4OOYA 1JNUA 1IYSA 5TJJA 4UEYA 4F3LB 3BFEA 4BD1A 4PM7A 1ONHA 4N1HA 2QJ7A 3IHAA 1W5DA 3MS6A 3O5YA 4MDZA 2JHEA 4JXWA 4F94A 5G18A 3S7PA 3NOPC 5FSRA 1XJ3A 3IX8A 3BFCA 3UMDA 3CITA 2HDSA 1OMEA 4KZAA 5AVEA 3TOIA 2ZL1B 3DBAA 4N1XA 2VJWA 3NIAA 4OQHA 2HGVA 3UE3A 2ZMAA 5HWVA 2V1BA 2ZC7A 4Y3IA 2WADA 3L7HA 2V0UA 4U0TA 1DJAA 4NEED 4S2JA 5G4YA 3TJZC 4IBXA 2Q9NA 3UDIA 2QZ6A 2ZOIA 4DE3A 1VM1A 1NLYA 2A2LA 1WYCA 4WBGA 4K0XA 4NK3A 1J9MA 1PNEA 4OQ0A 3T1SA 1NJ4A 4ETXA 4WEKA 1XP4A 5DKLA 3KYEA 5GLDA 4BENA 4HQAA 3ICYA 2Z2LB 1T1AA 4WMCA 2WKQA 3S4XA 3B42A 1VB6A 4II7A 1FCOA 4OLGA 4KZ6A 4UAAA 5I5LA 2YKFA 1YKDA 1RP5A 4IEDA 1KDWA 5KSCA 3FPVA 4LCLA 4S2KA 3F1OA 5JYOA 3UMEA 2Y2IA 5EFWA 1SDEA 3WRZA 5HPFA 3CI6A 1GSVA 5CGXA 4RVAA 1XFQA 4CPKA 5FASA 1BTLA 1FSWA 5F5YA 1N9NA 5FEFA 1YLYA 4U3TA 4Y7PA 2OAP1 4ZRRA 4BBVA 2GNXA 4L9FA 2WUQA 1UGUA 3OCNA 1VETA 3WS2A 4G3WA 3MXRA 5FA7A 1M6KA 1H8YA 4RYEA 3GQZA 3E2LA 4ZBEA 2ZQ8A 1Z6FA 2B18A 3P7NA 3KYQA 5DJTA 2PR5A 3MQ0A 1EI5A 4A5RA 4JGPA 1CQAA 3G4PA 3QNBA 1DP8A 1GA9A 3HL9A 3SS5A 3HJKA 4X1LA 1DY6A 3NOUC 3UB7A 5DF8A 4E6XA 3RXWA 2VGLS 4FSFA 5GHYA 2WKHA 4CLCD 2VV6A 2XK1A 4HI4A 4UA9A 3LR5A 1YLPA 4GD6A 1TDGA 3BRMA 1UWNX 1CK3A 2ZMVA 5J8XA 3N8LA 4S2IA 3GTCA 5FAQA 1MPLA 3D9YA 3ZHHA 3IH9A 4Y0UA 5F68A 3CUEC 4XUXA 1UWPX 1HD8A 4Y2FA 4UA6A 3A3IA 4MBHA 2BASA 4YINA 3VMAA 4X69A 3P01A 3JVVA 5JYPA 5CX7A 4JPMA 1XA1A 5CTNA 4C75A 2EX9A 4O8GA 4OQGA 5GHXA 2VLGA 3LIEA 5FI6A 1FR6A 3EQUA 2KDKA 1SKOB 3B3XA 3NHQA 3T1RA 5KSHA 3C38A 1OTDA 5E2GA 3Q81A 3A3EA 3D4FA 4S2LA 4IUHA 1BULA 2JCHA 2Y4AA 3MF0A 4BL3A 3NC8A 4UA7A 4EESA 2WAFA 4JBFA 3HLFA 3VFFA 4WM9A 5EVEA 4G3VA 3OLOA 3KX0X 1EW0A 4S2OA 4E3MA 2M7VA 5EVID 3MFDA 1GHIA 3CPTA 5HAIA 3T4JA 4OONA 3MZDA 3MMHA 4IHQA 3ZGAB 3GV9A 3K3DA 2ZLYA 2XLNA 3G6OA 4JGQA 4WL9A 4GLQA 4WZ5A 3SOIA 1YSQA 5DTTA 5CRFA 5AJGA 1TS0A 4I38A 3CMZA 4EV4A 3GR2A 4GHIA 2Y2OA 1XA7A 3Q7ZA 3AGEA 3HLGA 1D06A 1K4FA 4HOIA 4B4ZA 3LI9A 1P97A 3UE1A 2R9WA 4JF6A 1GSXA 5HDDA 3UE6A 2L1MA 4DN0A 4R0QA 5HARA 1VEUA 5J3WA 3PXPA 1ONGA 3LY4A 3HJIA 2A3UA 5FQMA 4HESA 5AVFA 1MKIA 1I2SA 4OOMA 4Z9QA 3DTIA 3SS4A 3ZVTA 1N4OA 4JF5A 3R7WA 4GDBA 3V39A 3IBRA 5KZHA 2H0YA 5EOOA 4Y0TA 4EUVA 2CMNA 3H7WA 3EEHA 3KYZA 5E2FA 3VE3A 2HJ9C 1I5QA 2Z6CA 3G32A 2PBDP 3EWKA 3GSGA 3PHYA 2H10A 4BJPA 1GHMA 3M6HA 3PBTA 2Y2NA 3O3VA 2VX8A 1LL5A 3SH8A 4KZ3A 4HBTA 2A49A 5FI7A 1T19A 3E4QA 1XX2A 4X56A 4JLFA 1AXBA 4I3AA 3KSFA 1WE4A 1K57A 3CJMA 1XFNA 3CPTB 3C2WA 5L8MA 2ZJ9A 4NETA 4O7DA 4LLOB 4JXSA 4E3OA 3MZFA 3PAEA 4RX2A 1PWDA 4PKYA 4X53A 1PZOA 1OPXA 4EWFA 1VQQA 4WELA 2O99A 3Q1FA 1ES4A 1N9BA 1CEFA 4X68A 1ZG6A 4P85A 3FKVA 2XA7M 5HDSA 3T50A 4FH2A 4KG2A 1NZUA 4DKIA 4GHIB 3LEQA 2WGVA 5HFOA 3IQAA 4UHUA 1S0WA 4OP8A 3T4TA 4B93A 3WS1A 5EECA 3TW8A 4R23A 4ESPA 3DTEA 5TBMB 1K54A 4GS9A 4EXOA 3IXBA 4KG5A 4N92A 4S2NA 1X0OA 3G30A 5CHUA 4CLCA 1T1BA 2HF6A 3N8RA 4H6JA 3W8KA 4HEFA 2Y2MA 4Y5FA 3DTKA 5FL3A 4P6ZM 4R3AA 2HZ5A 5DFXA 1XJ4A 5DF9A 3H7WB 3VFHA 3IXHA 5DTSA 2JKRM 4LENA 3VP4A 1XGJA 2M1CA 2V1ZA 3NDGA 4PKYG 1SCWA 3A3DA 4D60A 4NXBA 2WZZA 5CEBA 1J3WA 2J80A 3OPLA 3HVFA 5HD5A 3BJNA 2XGNA 2GDNA 3RH8B 2WKRA 3JYIA 3OPHA 1S4SA 1AWIA 4C6YA 1L3LA 2EXAA 3MKEA 3IH8A 1MWSA 3KO6A 4WF0A 3T4QA 1NWZA 3VE4A 4LV2A 1I2WA 1ZG4A 4GJ4A 3ZFZA 3PBRA 3D3OA 2UWXA 5EVIA 3MR0A 3UPPA 1ACFA 1OTAA 2OAQ1 4EBNA 4PHTA 3G31A 5CECA 3W4PA 3ITAA 3Q7VA 1XPBA 1MKMA 1PWCA 2OLUA 4P6BA 3FV7A 3QP2A 2I72A 4GS9B 2KX6A 2XH9A 3G2ZA 5M19A 4MBKA 3C30A 4CLCB 4MN7A 3CAXA 2L0WA 3GRJA 3VOYA 2HPBA 5I94A 2ZM2A 2PYRA 4UQIS 1L0GA 3NBLA 5EUAA 3TRCA 1OJGA 4ZTKA 3OZHA 1MWRA 1LLBA 5HL6A 5FEGA 5DF7A 2PYPA 4EU0A 2FFFB 5C5KA 2Y55A 3TSGA 1A0KA 3LIDA 2JBFA 3RJUA 1P9RA 1D7EA 2Y8HA 4DXCA 4FCFA 1Q2QA 2X02A 3ZQ5A 2Z6DA 1E25A 4DF6A 1CI8A 1LT0A 4HJ3A 3IS2B 3ZG5A 4JXVA 5TGFA 3IXGA 4QWOA 1XJ6A 4K91A 4KG6A 2P08A 5LBRA 2JKGA 4WZ4A 2W3FA 1MC0A 1KVMA 1G28A 4PMAA 1LSWA 4ZJ3A 2W1TA 2WGWB 2RL3A 4GW9A 2EWVA 3NDEA 5EVIB 3C7VA 2GJ3A 5KMWA 5EOEA 1H8MA 3F1NA 2VGLM 1IYPA 3LY3A 4HJ4A 2JKTM 3GVBA 3PBQA 1ZKJA 4RX3A 5TR7A 2Y2GA 3HCYA 4WLAA 2QHKA 3FC7A 4S2PA 5HW3A 4BMWA 4ARZA 4ZJ1A 2XDMA 4YNRA 2EA9A 2PU2A 4E3JA 5EVLA 5HZHA 4LGWA 5HD3A 2QJ5A 5CGSA 1FR1A 5U47A 3DW0A 3F1PA 2J3TC 2H0TA 3LIBA 3NCKA 2HP9A 1KOUA 5F1FA 3HBRA 3T12B 5DKKA 3G2YA 5KIZA 3WRTA 1IFQA 4PM9A 3VOLA 3MQOA 3BFGA 4N9KA 1FSYA 2P74A 4HHDA 4Y17A 5FQQA 2PHYA 2ZC5B 3M2KA 3FPWA 1HLUP 4NXFA 4PM6A 3OOVA 4Y0OA 1IEMA 2EXBA 3SS3A 5FQIA 2FH5A 3IHBA 1D1JA 3LR0A 4K0WA 4Q8IA 1M40A 4S2MA 3PR6A 4MBFA 3ITBA 2MJ6A 2ZQAA 3T4SA 2DMWA 5FAPA 5F83A 1O07A 4Y15A 1YPRA 1L2SA 3NULA 4B88A 2OV5A 2W1TB 4XT2A 4DJ3A 2KLIA 1L0EA 2C6WB 4I3JA 1T1CA 1BZAA 1K25A 3T4LA 3BLMA 1E4DA 1W79A 2G7UA 2OLVA 1SKFA 3V50A 4FD8A 2ZBBA 3NECA 3ZYTA 3F1OB 4DMZA 1DRMA 2UV0E 1YLTA 3BY9A 4XUZA 2LB5A 3O88A 4HH3A 5A90A 2ZQCA 5DVAA 3P09A 3R4KA 3N8SA 2R78A 3JPUA 3A0SA 2FZ0A 4AFIA 2W3DA 1BLCA 4OVDA 4PM8A 2XQZA 1JTDA 4X25A 1S6RA 1NZOA 3BQ8A 1OTBA 4HP9A 4BQMA 1VETB 3A0VA 2H28A 4FTXA 1YSPA 1STZA 4E3NA 3LI8A 5DTKA 4EQ1A 2J8YA 3SH7A 1PIOA 1EWZA 3IWOA 2PD7A 5FDHA 3UB6A 5E2EA 3PYPA 3SZTA 4RA7A 2DCFA 2EX6A 2HJEA 3E2KA 4LV0A 1ZTUA 2ZQDA 4WZ5C 4KZ5A 4R3BA 4GD8A 3BLSA 4NG2A 4KZ7A 4Z1WA 3PBSA 1W63M 1W7FA 5EV0A 1N9LA 4MMNA 1XKZA 3UNWA 3WS5A 3ZG7B 1NRFA 3WS4A 3N4IA 4E6WA 1KE3A 3BEBA 2O9AA 2E8IA 4QU3A 1Y4OA 1QMEA 4R3JA 2HP6A 5IS1A 4X6TA 3H9WA 3S7QA 3UB8A 1OT9A 2XD5A 3VSKA 1W8YA 3UDFA 1BUEA 1K55C 1DP6A 1BLPA 3W4OA 1YAXA 2WGIA 5EM0A 3S7NA 2Y2PA 2JKFA 5F69A 3LEZA 2PRFA 3T4KA 1V9YA 2L4RA 2OSUA 1TS6A 2XEPA 2ZM0A 3D72A 5CEDA 2JC7A 2QKPA 4E3IA 1PZPA 1P0ZA 1SDNA 5GLAA 5AQ7A 2H5SA 4JF4A 2DRWA 1LL9A 4JKTA 2PT7A 2HV1A 1NLZA 4HP4A 1K57C 1GA0A 4OH0A 3SW1A 3FKWA 1KE4A 2ZC4B 5HX9A 4FH4A 4CJNA 3AGFA 4Y13A 3IX3A 3LFVA 4PAUA 1NYMA 5FQ9A 3IWIA 5L09A 2ACGA 5FDSA 4IVKA 3RTYA 2OWHA 3TG9A 3U2AA 4KZ4A 1IYQA 1DJCA 2Q0OA 4Q0IA 4IJGA 1S67L 3VSLA 1G6OA 3CHWP 1LSXA 3QNCA 2WKEA 2VV7A 4QY6A 2IWCA 3V3SA 1TF1A 1VEUB 2PU4A 1OTIA 1Z09A 3BFDA 1YT4A 1CJFA 5FAOA 3IX4A 4GDNA 4CLCC 3DWKA 1SHVA 5FI2A 3R7WB 5CGWA 1PI4A 3KSIA 3ZG9B 3DTMA 3WS0A 2GX5A 3LUQA 4R4RA 3MXSA 3IF6A 4LPZA 4GN2A 2EWWA 4F3LA 2O9CA 3HREA 3QHYA 5M1AA 4MEZA 1YM1A 2VA0A 4LRZE 3W4QA 4UQIM 4FOFA 3C4OA 5D3OA 5IU1A 3UY6A 2W1RA 4BL2A 4OLDA 5HDCA 4I3IA 4DXBA 3P98A 1YQSA 4JGOA 4O01A 1F5MA 5GLBA 1NRJA 5HPIA 1E3UD 3PBOA 2K31A 2VGJA 5E43A 5F6AA 2Y2HA 1IKGA 3K3CA 1L0FA 3LIAA 5CHMA 4DE0A 2ZC6B 3LGOA 2HP5A 2NUTC 1BSGA 1N9OA 2PDRA 5EVIC 2M7UA 3BYDA 1WA9A 4JXGA 4HBUA 5GHZA 1GSWA 3MQQA 4EQIA 3ZNTA 4O0PA 3HLDA 4H8RA 4IVIA 1IKIA 4QD4A 1HZOA 1TVFA 2LB9A 3LR3A 3U4LP 1SZVA 1ALQA 3CLOA 3CWFA 2B02A 4ETZA 2JN7A 2R9XA 4H6JB 2KOIA 3C5AA 5M18A 2WZXA 5J7EA 2ZC3B 2V8FA 4QHCA 2Y79A 3MKFA 5FATA 1Y28A 5CHJA 3A3FA 5HWTA 4KZBA 3IF6B 3QP8A 3A0RA 4WN5A 1XXMA 1QMFA 4CLCE 3UDXA 4HY8A 3GMWA 1WYBA 4I39A 1ESIA 4EETB 1GCEA 1MZUA 3T4OA 3VP0A 1S66L 3O86A 1VHMA 2BLSA 4LV1A 4ZJ2A 4WYYA 1Q2PA 3FG8A 1K56D 1NYYA 3EGXC 1K38A 3BFFA 2VZWA 5GL9A 4DJ2A 2D01A 3IWQA 4BD0A 2Y2KA 2Y2JA 1U60A 4LFUA 4DDYA 1JWVA 3IBJA 1RCJA 1PWGA 4GNUA 4XXRA 1BLSA 2FFYA 1S1ZA 3B33A 5AQ9A 2E8JA 2WK0A 2J3WA 2VGKA 3E4PA 4L0LA 3Q7VB 1ES5A 4R38A 3NOTC 3BW6A 3B47A 3HLEA 3M6BA 4L9EA 3G35A 5K5BA 1OJ5A 1IOUA 1TEMA 1KE0A 1HTZA 2W27A 4P87A 4YWZA 1BYWA 3ULFA 1FOFA 4ZDXA 3PTEA 4R1GA 4DE1A 5L07A 1S1YA 3CZDA 2I9VA 2VEAA 2W3GA 1SKOA 3S7OA 2WYXA 1NY0A 4B4XA 4KENB 4G3KA 4BLMA 3IXDA 1XGIA 1FIKA 4KZ8A 3ZVWA 3OC2A 3IT9A 1ZHHB 3W2ZA 4EERA 4EEUA 3T1XA 3NY4A 1TD5A 4R6LA 4OQIA 5GLCA 2XD1A 3OPPA 4KQDA 3QP6A 4LRXC 1YMXA 4X1MA 4BBTA 1S4RA 5J4EA 3A3JA 4WEJA 4RQ9A 5MC7A 4P0MA 2ZQ7A 2XRNA 5CTMA 2HDQA 3H82A 5AQBA 5EE8A 1ESUA 2Q9MA 2VKSA 2ZMFA 1ERMA 2O0YA 2G2UA 2WAEA 1MXOA 3E98A 3OPRA 1CI9A 4LCMA 5CERA 1F2KA 1MWTA 3MJQA 2Y91A 3UB5P 1F9IA 3BWLA 4X55A 4EBPA 1BT5A 5AQAA 1C3BA 2X01A 2JKTI 1PYYA 3F1NB 4D2OA 1KGGA 4EBLA 4QJGA 2WKIA 1TS7A 1E3UA 4Q0JA 3MXQA 3HUMA 5A92A 5L10A 4EW7A 4FUWA 4WUJA 3I7JA 1TS8A 1MY8A 2PR6A 3CUEA 4ARZB 4OOLA 3OCLA 1YLZA 1P9WA 3ZG8B 4YOFA 3LICA 2OOLA 2IWBA 3F1PB 3LYXA 3EOIA 3V3RA 2X71A 4ME4A 3OBFA 4NXGA 3N7WA 2JE5A 2AVXA 2Y2QA 2EFXA 4PM5A 2B95A 2DNSA 5FQJA 4QB8A 5HSQA 4YFMA 4MCWA 3UPNA 2XSSA 4KUKA 4Q0HA 4GKUA 1JTGA 3T1QB 1Y54A 1T18A 3JVUA 2P9VA 4ZAMA 4DRTA 2INWA 1H5XA 5CXWA 3VP3A 3H82B 4HJ6A 1GHPA 1FILA 3EQVA 5TFQA 1K6SA 2V1AA 2XR0A 2C5WB 3EGDC 2BTFP 5HAPA 1PW1A 3MZEA 4KUOA 3ZNYA 4XT2B 2K7SA 3HLWA 2GZAA 2CC1A 4C3QA 1K56A 3UB9A 4GCZA 2W0NA 3LR4A 3ZG0A 3LIFA 4B9OA 1G6AA 2PBYA 5F1GA 1O7EA 3BM6A 1V9ZA 2P04A 3FZCA 1PW8A 1LI0A 3NJAA 5TBMA 3HUNA 5DFYA 4GOGA 2RCXA 1BLHA 3UO9A 1FCMA 4IUKA 3UN7A 1ODVA 2J9OA 3MFXA 3BQAA 3QP4A 1NXYA
chains in the Genus database with same CATH topology
4HJ3A 3IS2B 2VV8A 2ZMVA 4UQIM 4FOFA 4NXEA 5IU1A 1XJ6A 2W1RA 2P08A 5LBRA 3E0YA 5F68A 2NUPC 2W3FA 3CUEC 1MC0A 5HDCA 1UWPX 1G28A 4I3IA 1LSWA 4Y2FA 4R70A 4JGOA 4O01A 2BASA 3P01A 2W1TA 1F5MA 3JVVA 1NRJA 4GW9A 5CX7A 5HPIA 2EWVA 3GDIA 3PBOA 2K31A 1OTEA 4O8GA 2GJ3A 1H8MA 3C8CA 2VLGA 2ZOHA 3F1NA 2VGLM 3LIEA 5F6AA 3EQUA 4HJ4A 2KDKA 2JKTM 1LSVA 3PBQA 3K3CA 2XROA 3LIAA 3NHQA 3GECA 5KSHA 3C38A 1OTDA 2QYBA 4E04A 3HCYA 4WLAA 2QHKA 3FC7A 4IUHA 2NUTC 1N9OA 2PDRA 3MF0A 4BMWA 4ARZA 2M7UA 4EESA 2W3EA 1WA9A 4YNRA 2EA9A 4LRYC 5HZHA 1GSWA 3MQQA 5HD3A 1DP9A 2QJ5A 4O0PA 3EEAA 2O9BA 4JGRA 2LB9A 4G3VA 3F1PA 3LR3A 3OLOA 2J3TC 3KX0X 1EW0A 4L9GA 3LIBA 1KOUA 3CLOA 3CWFA 2M7VA 2B02A 4ETZA 3K2NA 2JN7A 5DKKA 5KIZA 1IFQA 3VOLA 4H6JB 2KOIA 5A8BA 3T4JA 3MQOA 4M4XA 4HH2A 5J7EA 3MMHA 4IHQA 4HNBA 3K3DA 2K2NA 2V0WA 2OWJA 4HHDA 4KQOA 2Y79A 3G6OA 4JGQA 1Y28A 2J3TD 4WL9A 2PHYA 5HWTA 4MN5A 4GLQA 3FPWA 1YSQA 4NXFA 5AJGA 3A0RA 3OOVA 1TS0A 3VV4A 4I38A 4WN5A 4CLCE 2FH5A 4GHIA 3RFBA 3TE8A 5G4ZA 3LR0A 1D06A 2A24A 4HY8A 3PBNA 3PR6A 4I39A 4BBUA 4HOIA 3LI9A 2MJ6A 1P97A 4EETB 3T4SA 2DMWA 1MZUA 3T4OA 1S66L 1GSXA 1VHMA 5HDDA 3UE6A 2L1MA 4DN0A 2WKPA 3FG8A 2W3HA 5J3WA 3PXPA 4CQHA 3V67A 3EGXC 3HJIA 2W1TB 4HIAA 2PD8A 2VZWA 4MN6A 4EEPA 4XT2A 4DJ2A 2D01A 5AVFA 5HWWA 4DJ3A 1LL8A 4OOMA 2KLIA 4BWIA 4K08A 4I3JA 3R7WA 1T1CA 3IBRA 3T4LA 4EUVA 2CMNA 3H7WA 3EEHA 3KYZA 3VE3A 3IBJA 2HJ9C 2Z6CA 2G7UA 3EWKA 2D02A 3E4OA 5DJUA 1S1ZA 3B33A 2ZBBA 3ZYTA 1H3QA 2J3WA 3F1OB 4DMZA 1DRMA 3PHYA 4BJPA 2P7JA 3E4PA 3BY9A 2LB5A 3PBTA 4HH3A 4L0LA 2XA7S 2VX8A 3R4KA 4R38A 3NOTC 3BW6A 3IS2A 2YKHA 1T19A 3B47A 3E4QA 4L9EA 2R78A 3A0SA 2FZ0A 1W63Q 4AFIA 4QPRA 2W3DA 5K5BA 4I3AA 1OJ5A 1IOUA 3KSFA 2QWSA 1XFNA 3C2WA 1XJ2A 4I5SA 5L8MA 1OT6A 2W27A 1OTBA 3BQ8A 4LLOB 5IT5A 4HP9A 4YWZA 1BYWA 3ULFA 3A0VA 2H28A 1S1YA 4PKYA 1YSPA 1OPXA 1STZA 3BY8A 4WELA 2I9VA 2O99A 2VEAA 3LI8A 2W3GA 3S7OA 2V9AA 4EQ1A 4P6ZS 4G3KA 2PD7A 2XA7M 5HDSA 3UB6A 2IA2A 3T50A 4GHIB 4NKPA 3OC2A 3PYPA 1ZHHB 3W2ZA 4EERA 2JKRI 3T4TA 4EEUA 2A24B 2HJEA 4B93A 1TD5A 3KSHA 4R6LA 3TW8A 1ZTUA 4KQDA 3KSGA 1F98A 4LRXC 5TBMB 1JNUA 5TJJA 4UEYA 1S4RA 4BBTA 4F3LB 4Z1WA 3PBSA 5J4EA 1W63M 4GS9A 4WEJA 4RQ9A 4EXOA 5MC7A 1N9LA 4MMNA 1X0OA 2XRNA 4CLCA 1T1BA 2HF6A 3H82A 2QJ7A 4H6JA 4Y5FA 3O5YA 4MDZA 2JHEA 5FL3A 4P6ZM 2VKSA 2ZMFA 3S7PA 2O0YA 4R3AA 3E98A 3NOPC 1XJ3A 2O9AA 5DFXA 1XJ4A 5DF9A 3UMDA 3CITA 3H7WB 3MJQA 1F9IA 3BWLA 5AVEA 2JKRM 3DBAA 5IS1A 2VJWA 2JKTI 3H9WA 2M1CA 3F1NB 2HGVA 4PKYG 3S7QA 3UB8A 3UE3A 4NXBA 1OT9A 5HWVA 2V1BA 4Y3IA 2V0UA 1TS7A 1DP6A 4Q0JA 3MXQA 4NEED 2J80A 1YAXA 3S7NA 4EW7A 5G4YA 3TJZC 4WUJA 5F69A 2ZOIA 5HD5A 3BJNA 1TS8A 4ARZB 2PR6A 3CUEA 1NLYA 2A2LA 4OOLA 3RH8B 3T4KA 3OCLA 2WKRA 1V9YA 2L4RA 1TS6A 3D72A 1P9WA 1S4SA 4YOFA 3LICA 2OOLA 2QKPA 4ETXA 4WEKA 3KO6A 1P0ZA 4WF0A 3T4QA 5DKLA 3F1PB 3LYXA 1NWZA 4HQAA 3VE4A 3ICYA 3EOIA 4ME4A 1T1AA 3OBFA 4NXGA 2PT7A 4GJ4A 2HV1A 1NLZA 4HP4A 2WKQA 3SW1A 3PBRA 3B42A 3D3OA 1VB6A 4II7A 5I5LA 2YKFA 1YKDA 3LFVA 3MR0A 4PAUA 1OTAA 5HSQA 4MCWA 3FPVA 3RTYA 3U2AA 2OWHA 2OAQ1 2XSSA 3F1OA 4KUKA 3UMEA 4Q0HA 5EFWA 4PHTA 1MKMA 5HPFA 4Q0IA 4IJGA 3CI6A 1S67L 1GSVA 1T18A 3JVUA 1XFQA 4GS9B 1G6OA 5F5YA 1N9NA 2KX6A 2INWA 1LSXA 4ZRRA 2OAP1 3C30A 4CLCB 4BBVA 2GNXA 4L9FA 3H82B 4HJ6A 4MN7A 3CAXA 2VV7A 2L0WA 3EQVA 1UGUA 3OCNA 2V1AA 1TF1A 4G3WA 1OTIA 3EGDC 2PYRA 2B18A 4UQIS 4KUOA 4XT2B 2K7SA 3P7NA 3KYQA 5DJTA 2GZAA 2PR5A 3MQ0A 3TRCA 1OJGA 4CLCC 3UB9A 4GCZA 4JGPA 2W0NA 3LR4A 3R7WB 3LIFA 5HL6A 1DP8A 3KSIA 3HJKA 2PYPA 4B9OA 4EU0A 5C5KA 1V9ZA 2GX5A 2P04A 3NOUC 3LUQA 3UB7A 3LIDA 2VGLS 1P9RA 3NJAA 4FSFA 5TBMA 4LPZA 1D7EA 2Y8HA 4CLCD 2VV6A 5DFYA 4HI4A 2EWWA 3LR5A 4F3LA 2O9CA 4IUKA 3ZQ5A 2Z6DA 1ODVA 3MFXA 3BQAA 1UWNX 2VA0A 4LRZE 1LT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ3 A;  3IS2 B;  2VV8 A;  4NXE A;  5IU1 A;  1XJ6 A;  5F68 A;  5HDC A;  1UWP X;  1G28 A;  4I3I A;  1LSW A;  4R70 A;  4JGO A;  2BAS A;  4GW9 A;  3GDI A;  1OTE A;  2GJ3 A;  3C8C A;  2VLG A;  2ZOH A;  3F1N A;  3LIE A;  5F6A A;  4HJ4 A;  2KDK A;  1LSV A;  3K3C A;  3LIA A;  3NHQ A;  3GEC A;  1OTD A;  4E04 A;  4WLA A;  2QHK A;  3FC7 A;  1N9O A;  2PDR A;  4EES A;  1WA9 A;  2EA9 A;  4LRY C;  5HZH A;  1GSW A;  3MQQ A;  5HD3 A;  1DP9 A;  2QJ5 A;  4JGR A;  3F1P A;  3OLO A;  3KX0 X;  1EW0 A;  4L9G A;  3LIB A;  1KOU A;  3CLO A;  3CWF A;  2B02 A;  2JN7 A;  5DKK A;  5KIZ A;  3VOL A;  4H6J B;  5A8B A;  3MQO A;  4M4X A;  4HH2 A;  5J7E A;  4HNB A;  3K3D A;  2V0W A;  2OWJ A;  4HHD A;  3G6O A;  4JGQ A;  1Y28 A;  4WL9 A;  2PHY A;  5HWT A;  4MN5 A;  4NXF A;  3A0R A;  1TS0 A;  4I38 A;  4WN5 A;  4GHI A;  5G4Z A;  1D06 A;  2A24 A;  4HY8 A;  4I39 A;  4BBU A;  4HOI A;  3LI9 A;  1P97 A;  4EET B;  1MZU A;  1S66 L;  1GSX A;  5HDD A;  3UE6 A;  2L1M A;  2WKP A;  3FG8 A;  5J3W A;  3HJI A;  4HIA A;  2PD8 A;  4MN6 A;  4EEP A;  4XT2 A;  4DJ2 A;  2D01 A;  5AVF A;  5HWW A;  4DJ3 A;  1LL8 A;  4K08 A;  4I3J A;  1T1C A;  3IBR A;  2CMN A;  3H7W A;  3EEH A;  3VE3 A;  2Z6C A;  3EWK A;  2D02 A;  3E4O A;  5DJU A;  1S1Z A;  3B33 A;  2ZBB A;  3F1O B;  1DRM A;  3PHY A;  2P7J A;  3E4P A;  3BY9 A;  4HH3 A;  4R38 A;  3NOT C;  3IS2 A;  2YKH A;  1T19 A;  4L9E A;  3E4Q A;  2R78 A;  3A0S A;  4I3A A;  1OJ5 A;  2QWS A;  1XFN A;  3C2W A;  1XJ2 A;  4I5S A;  1OT6 A;  2W27 A;  1OTB A;  4LLO B;  4HP9 A;  4YWZ A;  1BYW A;  3ULF A;  3A0V A;  2H28 A;  1S1Y A;  4PKY A;  3BY8 A;  2I9V A;  2VEA A;  3LI8 A;  2V9A A;  4EQ1 A;  2PD7 A;  5HDS A;  3UB6 A;  3T50 A;  4GHI B;  3PYP A;  4EER A;  4EEU A;  2A24 B;  4R6L A;  4KQD A;  1F98 A;  4LRX C;  5TBM B;  1JNU A;  4BBT A;  1S4R A;  4F3L B;  5J4E A;  4GS9 A;  4RQ9 A;  4EXO A;  1N9L A;  1X0O A;  1T1B A;  3H82 A;  2QJ7 A;  4H6J A;  2JHE A;  4R3A A;  3NOP C;  1XJ3 A;  1XJ4 A;  3UMD A;  3H7W B;  3MJQ A;  1F9I A;  3BWL A;  5AVE A;  5IS1 A;  3H9W A;  2M1C A;  3F1N B;  4PKY G;  3UB8 A;  4NXB A;  1OT9 A;  5HWV A;  2V1B A;  2V0U A;  1TS7 A;  1DP6 A;  3MXQ A;  2J80 A;  4EW7 A;  5G4Y A;  4WUJ A;  5F69 A;  2ZOI A;  5HD5 A;  1TS8 A;  2PR6 A;  3RH8 B;  2WKR A;  1V9Y A;  2L4R A;  1TS6 A;  3D72 A;  1S4S A;  3LIC A;  2OOL A;  2QKP A;  1P0Z A;  4WF0 A;  5DKL A;  3F1P B;  3LYX A;  1NWZ A;  4HQA A;  3VE4 A;  3ICY A;  1T1A A;  4NXG A;  2HV1 A;  4HP4 A;  2WKQ A;  3SW1 A;  1VB6 A;  5I5L A;  2YKF A;  3MR0 A;  1OTA A;  5HSQ A;  3RTY A;  2OWH A;  3F1O A;  4KUK A;  3UME A;  5EFW A;  1S67 L;  1GSV A;  1T18 A;  1XFQ A;  4GS9 B;  5F5Y A;  1N9N A;  2KX6 A;  2INW A;  1LSX A;  4BBV A;  4L9F A;  3H82 B;  4HJ6 A;  3CAX A;  2VV7 A;  2L0W A;  1UGU A;  2V1A A;  1OTI A;  2PYR A;  4KUO A;  4XT2 B;  2K7S A;  3P7N A;  5DJT A;  2PR5 A;  1OJG A;  3UB9 A;  4GCZ A;  4JGP A;  2W0N A;  3LIF A;  1DP8 A;  3HJK A;  2PYP A;  4B9O A;  1V9Z A;  3NOU C;  3LUQ A;  3UB7 A;  3LID A;  3NJA A;  5TBM A;  4LPZ A;  1D7E A;  2VV6 A;  4HI4 A;  4F3L A;  3ZQ5 A;  2Z6D A;  1ODV A;  3MFX A;  1UWN X;  4LRZ E;  1LT0 A; 
#chains in the Genus database with same CATH topology
 5EPH A;  2VV8 A;  4NXE A;  4MLL A;  4OP5 A;  1KDS A;  3E0Y A;  4KZ9 A;  1K55 A;  2NUP C;  2G2W A;  3QP1 A;  1ERQ A;  4R70 A;  1LHY A;  1ZC2 A;  3QP5 A;  1YMS A;  1RGZ A;  2QMI A;  2ZM8 A;  4OPR A;  3GDI A;  1OTE A;  2IWD A;  3C8C A;  5L2F A;  2ZOH A;  3VOZ A;  2EX8 A;  1LSV A;  3ISG A;  2XRO A;  3GEC A;  5A91 A;  2VK3 A;  2QYB A;  4KQQ A;  4E04 A;  3CG5 A;  3O87 A;  1IYO A;  3N6I A;  1L0D A;  2P9V B;  1FCN A;  3C7U A;  3RXX A;  1PRQ A;  4OPQ A;  2W3E A;  1G5U A;  4LRY C;  1JWZ A;  1H8Z A;  1HVB A;  1K4E A;  3M2J A;  1DP9 A;  3VP2 A;  3BEC A;  3EEA A;  2O9B A;  4PPR A;  4JGR A;  4WMC D;  3Q07 A;  3VP1 A;  4L9G A;  4IBR A;  3K2N A;  2Y2L A;  5A8B A;  4M4X A;  4HH2 A;  4HNB A;  2K2N A;  2V0W A;  1CEG A;  2OWJ A;  4KQO A;  1ES2 A;  1YLW A;  5BOH A;  2Z2M B;  4KQR A;  2J3T D;  1K54 C;  1FQG A;  4MN5 A;  2V2F F;  4S2N C;  4GB7 A;  4DE2 A;  3S1Y A;  3VV4 A;  2XFS A;  1ERO A;  2EFU A;  1JWP A;  3RFB A;  3TE8 A;  5G4Z A;  1LI9 A;  2A24 A;  3PBN A;  2EX2 A;  4BBU A;  2J7V A;  2PAV P;  4DDS A;  3MSH A;  1TDL A;  3C4P A;  3IF6 C;  5E2H A;  3PAG A;  3MBZ A;  2WKP A;  2XFT A;  2W3H A;  3ZCZ A;  4CQH A;  4GZB A;  1KGE A;  3V67 A;  1H0M A;  3G34 A;  4HIA A;  3SH9 A;  2PD8 A;  4M3K A;  2V20 A;  4MN6 A;  4R4S A;  4EEP A;  3LCE A;  2V8C A;  5HWW A;  1LL8 A;  4OPZ A;  1K6R A;  1K0K A;  2J9P A;  4BWI A;  4K08 A;  1KVL A;  3Q82 A;  4OPY A;  2B5R A;  1KGF A;  3LO7 A;  3DWZ A;  2XF3 A;  3L9K A;  2ZL1 A;  2D02 A;  3E4O A;  3FWL A;  5DJU A;  3UE0 A;  1H3Q A;  3HUO A;  1JVJ A;  5IHV A;  2P7J A;  3FYZ A;  1MWU A;  2XA7 S;  3HLC A;  4E3L A;  4OKP A;  2ZQ9 A;  3IS2 A;  2YKH A;  1W8Q A;  1W63 Q;  4QPR A;  4N9L A;  4LV3 A;  2HDU A;  2QWS A;  2Y59 A;  1XJ2 A;  4I5S A;  1IEL A;  1OT6 A;  4ID4 A;  3NI9 A;  3ZDJ A;  5IT5 A;  5HAQ A;  1DJB A;  2WGW A;  1PFL A;  3S22 A;  1G68 A;  3V5M A;  4QY5 A;  3IF5 A;  1ES3 A;  3BY8 A;  5EM1 A;  1CF0 A;  2BG1 A;  3HLB A;  3UPO A;  1MBL A;  2V9A A;  1RGY A;  4P6Z S;  4E3K A;  1YLJ A;  2QPN A;  1PI5 A;  5F82 A;  2HDR A;  2IA2 A;  4MNR A;  4NKP A;  4U0X A;  4EUZ A;  2JKR I;  3WWX A;  2A24 B;  3DAV A;  3KSH A;  5HL1 A;  5A93 A;  2ZD8 A;  3AGD A;  3KSG A;  1F98 A;  5FQK A;  4OOY A;  1JNU A;  1IYS A;  5TJJ A;  4UEY A;  4F3L B;  3BFE A;  4BD1 A;  4PM7 A;  1ONH A;  4N1H A;  2QJ7 A;  3IHA A;  1W5D A;  3MS6 A;  3O5Y A;  4MDZ A;  2JHE A;  4JXW A;  4F94 A;  5G18 A;  3S7P A;  3NOP C;  5FSR A;  1XJ3 A;  3IX8 A;  3BFC A;  3UMD A;  3CIT A;  2HDS A;  1OME A;  4KZA A;  5AVE A;  3TOI A;  2ZL1 B;  3DBA A;  4N1X A;  2VJW A;  3NIA A;  4OQH A;  2HGV A;  3UE3 A;  2ZMA A;  5HWV A;  2V1B A;  2ZC7 A;  4Y3I A;  2WAD A;  3L7H A;  2V0U A;  4U0T A;  1DJA A;  4NEE D;  4S2J A;  5G4Y A;  3TJZ C;  4IBX A;  2Q9N A;  3UDI A;  2QZ6 A;  2ZOI A;  4DE3 A;  1VM1 A;  1NLY A;  2A2L A;  1WYC A;  4WBG A;  4K0X A;  4NK3 A;  1J9M A;  1PNE A;  4OQ0 A;  3T1S A;  1NJ4 A;  4ETX A;  4WEK A;  1XP4 A;  5DKL A;  3KYE A;  5GLD A;  4BEN A;  4HQA A;  3ICY A;  2Z2L B;  1T1A A;  4WMC A;  2WKQ A;  3S4X A;  3B42 A;  1VB6 A;  4II7 A;  1FCO A;  4OLG A;  4KZ6 A;  4UAA A;  5I5L A;  2YKF A;  1YKD A;  1RP5 A;  4IED A;  1KDW A;  5KSC A;  3FPV A;  4LCL A;  4S2K A;  3F1O A;  5JYO A;  3UME A;  2Y2I A;  5EFW A;  1SDE A;  3WRZ A;  5HPF A;  3CI6 A;  1GSV A;  5CGX A;  4RVA A;  1XFQ A;  4CPK A;  5FAS A;  1BTL A;  1FSW A;  5F5Y A;  1N9N A;  5FEF A;  1YLY A;  4U3T A;  4Y7P A;  2OAP 1;  4ZRR A;  4BBV A;  2GNX A;  4L9F A;  2WUQ A;  1UGU A;  3OCN A;  1VET A;  3WS2 A;  4G3W A;  3MXR A;  5FA7 A;  1M6K A;  1H8Y A;  4RYE A;  3GQZ A;  3E2L A;  4ZBE A;  2ZQ8 A;  1Z6F A;  2B18 A;  3P7N A;  3KYQ A;  5DJT A;  2PR5 A;  3MQ0 A;  1EI5 A;  4A5R A;  4JGP A;  1CQA A;  3G4P A;  3QNB A;  1DP8 A;  1GA9 A;  3HL9 A;  3SS5 A;  3HJK A;  4X1L A;  1DY6 A;  3NOU C;  3UB7 A;  5DF8 A;  4E6X A;  3RXW A;  2VGL S;  4FSF A;  5GHY A;  2WKH A;  4CLC D;  2VV6 A;  2XK1 A;  4HI4 A;  4UA9 A;  3LR5 A;  1YLP A;  4GD6 A;  1TDG A;  3BRM A;  1UWN X;  1CK3 A;  2ZMV A;  5J8X A;  3N8L A;  4S2I A;  3GTC A;  5FAQ A;  1MPL A;  3D9Y A;  3ZHH A;  3IH9 A;  4Y0U A;  5F68 A;  3CUE C;  4XUX A;  1UWP X;  1HD8 A;  4Y2F A;  4UA6 A;  3A3I A;  4MBH A;  2BAS A;  4YIN A;  3VMA A;  4X69 A;  3P01 A;  3JVV A;  5JYP A;  5CX7 A;  4JPM A;  1XA1 A;  5CTN A;  4C75 A;  2EX9 A;  4O8G A;  4OQG A;  5GHX A;  2VLG A;  3LIE A;  5FI6 A;  1FR6 A;  3EQU A;  2KDK A;  1SKO B;  3B3X A;  3NHQ A;  3T1R A;  5KSH A;  3C38 A;  1OTD A;  5E2G A;  3Q81 A;  3A3E A;  3D4F A;  4S2L A;  4IUH A;  1BUL A;  2JCH A;  2Y4A A;  3MF0 A;  4BL3 A;  3NC8 A;  4UA7 A;  4EES A;  2WAF A;  4JBF A;  3HLF A;  3VFF A;  4WM9 A;  5EVE A;  4G3V A;  3OLO A;  3KX0 X;  1EW0 A;  4S2O A;  4E3M A;  2M7V A;  5EVI D;  3MFD A;  1GHI A;  3CPT A;  5HAI A;  3T4J A;  4OON A;  3MZD A;  3MMH A;  4IHQ A;  3ZGA B;  3GV9 A;  3K3D A;  2ZLY A;  2XLN A;  3G6O A;  4JGQ A;  4WL9 A;  4GLQ A;  4WZ5 A;  3SOI A;  1YSQ A;  5DTT A;  5CRF A;  5AJG A;  1TS0 A;  4I38 A;  3CMZ A;  4EV4 A;  3GR2 A;  4GHI A;  2Y2O A;  1XA7 A;  3Q7Z A;  3AGE A;  3HLG A;  1D06 A;  1K4F A;  4HOI A;  4B4Z A;  3LI9 A;  1P97 A;  3UE1 A;  2R9W A;  4JF6 A;  1GSX A;  5HDD A;  3UE6 A;  2L1M A;  4DN0 A;  4R0Q A;  5HAR A;  1VEU A;  5J3W A;  3PXP A;  1ONG A;  3LY4 A;  3HJI A;  2A3U A;  5FQM A;  4HES A;  5AVF A;  1MKI A;  1I2S A;  4OOM A;  4Z9Q A;  3DTI A;  3SS4 A;  3ZVT A;  1N4O A;  4JF5 A;  3R7W A;  4GDB A;  3V39 A;  3IBR A;  5KZH A;  2H0Y A;  5EOO A;  4Y0T A;  4EUV A;  2CMN A;  3H7W A;  3EEH A;  3KYZ A;  5E2F A;  3VE3 A;  2HJ9 C;  1I5Q A;  2Z6C A;  3G32 A;  2PBD P;  3EWK A;  3GSG A;  3PHY A;  2H10 A;  4BJP A;  1GHM A;  3M6H A;  3PBT A;  2Y2N A;  3O3V A;  2VX8 A;  1LL5 A;  3SH8 A;  4KZ3 A;  4HBT A;  2A49 A;  5FI7 A;  1T19 A;  3E4Q A;  1XX2 A;  4X56 A;  4JLF A;  1AXB A;  4I3A A;  3KSF A;  1WE4 A;  1K57 A;  3CJM A;  1XFN A;  3CPT B;  3C2W A;  5L8M A;  2ZJ9 A;  4NET A;  4O7D A;  4LLO B;  4JXS A;  4E3O A;  3MZF A;  3PAE A;  4RX2 A;  1PWD A;  4PKY A;  4X53 A;  1PZO A;  1OPX A;  4EWF A;  1VQQ A;  4WEL A;  2O99 A;  3Q1F A;  1ES4 A;  1N9B A;  1CEF A;  4X68 A;  1ZG6 A;  4P85 A;  3FKV A;  2XA7 M;  5HDS A;  3T50 A;  4FH2 A;  4KG2 A;  1NZU A;  4DKI A;  4GHI B;  3LEQ A;  2WGV A;  5HFO A;  3IQA A;  4UHU A;  1S0W A;  4OP8 A;  3T4T A;  4B93 A;  3WS1 A;  5EEC A;  3TW8 A;  4R23 A;  4ESP A;  3DTE A;  5TBM B;  1K54 A;  4GS9 A;  4EXO A;  3IXB A;  4KG5 A;  4N92 A;  4S2N A;  1X0O A;  3G30 A;  5CHU A;  4CLC A;  1T1B A;  2HF6 A;  3N8R A;  4H6J A;  3W8K A;  4HEF A;  2Y2M A;  4Y5F A;  3DTK A;  5FL3 A;  4P6Z M;  4R3A A;  2HZ5 A;  5DFX A;  1XJ4 A;  5DF9 A;  3H7W B;  3VFH A;  3IXH A;  5DTS A;  2JKR M;  4LEN A;  3VP4 A;  1XGJ A;  2M1C A;  2V1Z A;  3NDG A;  4PKY G;  1SCW A;  3A3D A;  4D60 A;  4NXB A;  2WZZ A;  5CEB A;  1J3W A;  2J80 A;  3OPL A;  3HVF A;  5HD5 A;  3BJN A;  2XGN A;  2GDN A;  3RH8 B;  2WKR A;  3JYI A;  3OPH A;  1S4S A;  1AWI A;  4C6Y A;  1L3L A;  2EXA A;  3MKE A;  3IH8 A;  1MWS A;  3KO6 A;  4WF0 A;  3T4Q A;  1NWZ A;  3VE4 A;  4LV2 A;  1I2W A;  1ZG4 A;  4GJ4 A;  3ZFZ A;  3PBR A;  3D3O A;  2UWX A;  5EVI A;  3MR0 A;  3UPP A;  1ACF A;  1OTA A;  2OAQ 1;  4EBN A;  4PHT A;  3G31 A;  5CEC A;  3W4P A;  3ITA A;  3Q7V A;  1XPB A;  1MKM A;  1PWC A;  2OLU A;  4P6B A;  3FV7 A;  3QP2 A;  2I72 A;  4GS9 B;  2KX6 A;  2XH9 A;  3G2Z A;  5M19 A;  4MBK A;  3C30 A;  4CLC B;  4MN7 A;  3CAX A;  2L0W A;  3GRJ A;  3VOY A;  2HPB A;  5I94 A;  2ZM2 A;  2PYR A;  4UQI S;  1L0G A;  3NBL A;  5EUA A;  3TRC A;  1OJG A;  4ZTK A;  3OZH A;  1MWR A;  1LLB A;  5HL6 A;  5FEG A;  5DF7 A;  2PYP A;  4EU0 A;  2FFF B;  5C5K A;  2Y55 A;  3TSG A;  1A0K A;  3LID A;  2JBF A;  3RJU A;  1P9R A;  1D7E A;  2Y8H A;  4DXC A;  4FCF A;  1Q2Q A;  2X02 A;  3ZQ5 A;  2Z6D A;  1E25 A;  4DF6 A;  1CI8 A;  1LT0 A;  4HJ3 A;  3IS2 B;  3ZG5 A;  4JXV A;  5TGF A;  3IXG A;  4QWO A;  1XJ6 A;  4K91 A;  4KG6 A;  2P08 A;  5LBR A;  2JKG A;  4WZ4 A;  2W3F A;  1MC0 A;  1KVM A;  1G28 A;  4PMA A;  1LSW A;  4ZJ3 A;  2W1T A;  2WGW B;  2RL3 A;  4GW9 A;  2EWV A;  3NDE A;  5EVI B;  3C7V A;  2GJ3 A;  5KMW A;  5EOE A;  1H8M A;  3F1N A;  2VGL M;  1IYP A;  3LY3 A;  4HJ4 A;  2JKT M;  3GVB A;  3PBQ A;  1ZKJ A;  4RX3 A;  5TR7 A;  2Y2G A;  3HCY A;  4WLA A;  2QHK A;  3FC7 A;  4S2P A;  5HW3 A;  4BMW A;  4ARZ A;  4ZJ1 A;  2XDM A;  4YNR A;  2EA9 A;  2PU2 A;  4E3J A;  5EVL A;  5HZH A;  4LGW A;  5HD3 A;  2QJ5 A;  5CGS A;  1FR1 A;  5U47 A;  3DW0 A;  3F1P A;  2J3T C;  2H0T A;  3LIB A;  3NCK A;  2HP9 A;  1KOU A;  5F1F A;  3HBR A;  3T12 B;  5DKK A;  3G2Y A;  5KIZ A;  3WRT A;  1IFQ A;  4PM9 A;  3VOL A;  3MQO A;  3BFG A;  4N9K A;  1FSY A;  2P74 A;  4HHD A;  4Y17 A;  5FQQ A;  2PHY A;  2ZC5 B;  3M2K A;  3FPW A;  1HLU P;  4NXF A;  4PM6 A;  3OOV A;  4Y0O A;  1IEM A;  2EXB A;  3SS3 A;  5FQI A;  2FH5 A;  3IHB A;  1D1J A;  3LR0 A;  4K0W A;  4Q8I A;  1M40 A;  4S2M A;  3PR6 A;  4MBF A;  3ITB A;  2MJ6 A;  2ZQA A;  3T4S A;  2DMW A;  5FAP A;  5F83 A;  1O07 A;  4Y15 A;  1YPR A;  1L2S A;  3NUL A;  4B88 A;  2OV5 A;  2W1T B;  4XT2 A;  4DJ3 A;  2KLI A;  1L0E A;  2C6W B;  4I3J A;  1T1C A;  1BZA A;  1K25 A;  3T4L A;  3BLM A;  1E4D A;  1W79 A;  2G7U A;  2OLV A;  1SKF A;  3V50 A;  4FD8 A;  2ZBB A;  3NEC A;  3ZYT A;  3F1O B;  4DMZ A;  1DRM A;  2UV0 E;  1YLT A;  3BY9 A;  4XUZ A;  2LB5 A;  3O88 A;  4HH3 A;  5A90 A;  2ZQC A;  5DVA A;  3P09 A;  3R4K A;  3N8S A;  2R78 A;  3JPU A;  3A0S A;  2FZ0 A;  4AFI A;  2W3D A;  1BLC A;  4OVD A;  4PM8 A;  2XQZ A;  1JTD A;  4X25 A;  1S6R A;  1NZO A;  3BQ8 A;  1OTB A;  4HP9 A;  4BQM A;  1VET B;  3A0V A;  2H28 A;  4FTX A;  1YSP A;  1STZ A;  4E3N A;  3LI8 A;  5DTK A;  4EQ1 A;  2J8Y A;  3SH7 A;  1PIO A;  1EWZ A;  3IWO A;  2PD7 A;  5FDH A;  3UB6 A;  5E2E A;  3PYP A;  3SZT A;  4RA7 A;  2DCF A;  2EX6 A;  2HJE A;  3E2K A;  4LV0 A;  1ZTU A;  2ZQD A;  4WZ5 C;  4KZ5 A;  4R3B A;  4GD8 A;  3BLS A;  4NG2 A;  4KZ7 A;  4Z1W A;  3PBS A;  1W63 M;  1W7F A;  5EV0 A;  1N9L A;  4MMN A;  1XKZ A;  3UNW A;  3WS5 A;  3ZG7 B;  1NRF A;  3WS4 A;  3N4I A;  4E6W A;  1KE3 A;  3BEB A;  2O9A A;  2E8I A;  4QU3 A;  1Y4O A;  1QME A;  4R3J A;  2HP6 A;  5IS1 A;  4X6T A;  3H9W A;  3S7Q A;  3UB8 A;  1OT9 A;  2XD5 A;  3VSK A;  1W8Y A;  3UDF A;  1BUE A;  1K55 C;  1DP6 A;  1BLP A;  3W4O A;  1YAX A;  2WGI A;  5EM0 A;  3S7N A;  2Y2P A;  2JKF A;  5F69 A;  3LEZ A;  2PRF A;  3T4K A;  1V9Y A;  2L4R A;  2OSU A;  1TS6 A;  2XEP A;  2ZM0 A;  3D72 A;  5CED A;  2JC7 A;  2QKP A;  4E3I A;  1PZP A;  1P0Z A;  1SDN A;  5GLA A;  5AQ7 A;  2H5S A;  4JF4 A;  2DRW A;  1LL9 A;  4JKT A;  2PT7 A;  2HV1 A;  1NLZ A;  4HP4 A;  1K57 C;  1GA0 A;  4OH0 A;  3SW1 A;  3FKW A;  1KE4 A;  2ZC4 B;  5HX9 A;  4FH4 A;  4CJN A;  3AGF A;  4Y13 A;  3IX3 A;  3LFV A;  4PAU A;  1NYM A;  5FQ9 A;  3IWI A;  5L09 A;  2ACG A;  5FDS A;  4IVK A;  3RTY A;  2OWH A;  3TG9 A;  3U2A A;  4KZ4 A;  1IYQ A;  1DJC A;  2Q0O A;  4Q0I A;  4IJG A;  1S67 L;  3VSL A;  1G6O A;  3CHW P;  1LSX A;  3QNC A;  2WKE A;  2VV7 A;  4QY6 A;  2IWC A;  3V3S A;  1TF1 A;  1VEU B;  2PU4 A;  1OTI A;  1Z09 A;  3BFD A;  1YT4 A;  1CJF A;  5FAO A;  3IX4 A;  4GDN A;  4CLC C;  3DWK A;  1SHV A;  5FI2 A;  3R7W B;  5CGW A;  1PI4 A;  3KSI A;  3ZG9 B;  3DTM A;  3WS0 A;  2GX5 A;  3LUQ A;  4R4R A;  3MXS A;  3IF6 A;  4LPZ A;  4GN2 A;  2EWW A;  4F3L A;  2O9C A;  3HRE A;  3QHY A;  5M1A A;  4MEZ A;  1YM1 A;  2VA0 A;  4LRZ E;  3W4Q A;  4UQI M;  4FOF A;  3C4O A;  5D3O A;  5IU1 A;  3UY6 A;  2W1R A;  4BL2 A;  4OLD A;  5HDC A;  4I3I A;  4DXB A;  3P98 A;  1YQS A;  4JGO A;  4O01 A;  1F5M A;  5GLB A;  1NRJ A;  5HPI A;  1E3U D;  3PBO A;  2K31 A;  2VGJ A;  5E43 A;  5F6A A;  2Y2H A;  1IKG A;  3K3C A;  1L0F A;  3LIA A;  5CHM A;  4DE0 A;  2ZC6 B;  3LGO A;  2HP5 A;  2NUT C;  1BSG A;  1N9O A;  2PDR A;  5EVI C;  2M7U A;  3BYD A;  1WA9 A;  4JXG A;  4HBU A;  5GHZ A;  1GSW A;  3MQQ A;  4EQI A;  3ZNT A;  4O0P A;  3HLD A;  4H8R A;  4IVI A;  1IKI A;  4QD4 A;  1HZO A;  1TVF A;  2LB9 A;  3LR3 A;  3U4L P;  1SZV A;  1ALQ A;  3CLO A;  3CWF A;  2B02 A;  4ETZ A;  2JN7 A;  2R9X A;  4H6J B;  2KOI A;  3C5A A;  5M18 A;  2WZX A;  5J7E A;  2ZC3 B;  2V8F A;  4QHC A;  2Y79 A;  3MKF A;  5FAT A;  1Y28 A;  5CHJ A;  3A3F A;  5HWT A;  4KZB A;  3IF6 B;  3QP8 A;  3A0R A;  4WN5 A;  1XXM A;  1QMF A;  4CLC E;  3UDX A;  4HY8 A;  3GMW A;  1WYB A;  4I39 A;  1ESI A;  4EET B;  1GCE A;  1MZU A;  3T4O A;  3VP0 A;  1S66 L;  3O86 A;  1VHM A;  2BLS A;  4LV1 A;  4ZJ2 A;  4WYY A;  1Q2P A;  3FG8 A;  1K56 D;  1NYY A;  3EGX C;  1K38 A;  3BFF A;  2VZW A;  5GL9 A;  4DJ2 A;  2D01 A;  3IWQ A;  4BD0 A;  2Y2K A;  2Y2J A;  1U60 A;  4LFU A;  4DDY A;  1JWV A;  3IBJ A;  1RCJ A;  1PWG A;  4GNU A;  4XXR A;  1BLS A;  2FFY A;  1S1Z A;  3B33 A;  5AQ9 A;  2E8J A;  2WK0 A;  2J3W A;  2VGK A;  3E4P A;  4L0L A;  3Q7V B;  1ES5 A;  4R38 A;  3NOT C;  3BW6 A;  3B47 A;  3HLE A;  3M6B A;  4L9E A;  3G35 A;  5K5B A;  1OJ5 A;  1IOU A;  1TEM A;  1KE0 A;  1HTZ A;  2W27 A;  4P87 A;  4YWZ A;  1BYW A;  3ULF A;  1FOF A;  4ZDX A;  3PTE A;  4R1G A;  4DE1 A;  5L07 A;  1S1Y A;  3CZD A;  2I9V A;  2VEA A;  2W3G A;  1SKO A;  3S7O A;  2WYX A;  1NY0 A;  4B4X A;  4KEN B;  4G3K A;  4BLM A;  3IXD A;  1XGI A;  1FIK A;  4KZ8 A;  3ZVW A;  3OC2 A;  3IT9 A;  1ZHH B;  3W2Z A;  4EER A;  4EEU A;  3T1X A;  3NY4 A;  1TD5 A;  4R6L A;  4OQI A;  5GLC A;  2XD1 A;  3OPP A;  4KQD A;  3QP6 A;  4LRX C;  1YMX A;  4X1M A;  4BBT A;  1S4R A;  5J4E A;  3A3J A;  4WEJ A;  4RQ9 A;  5MC7 A;  4P0M A;  2ZQ7 A;  2XRN A;  5CTM A;  2HDQ A;  3H82 A;  5AQB A;  5EE8 A;  1ESU A;  2Q9M A;  2VKS A;  2ZMF A;  1ERM A;  2O0Y A;  2G2U A;  2WAE A;  1MXO A;  3E98 A;  3OPR A;  1CI9 A;  4LCM A;  5CER A;  1F2K A;  1MWT A;  3MJQ A;  2Y91 A;  3UB5 P;  1F9I A;  3BWL A;  4X55 A;  4EBP A;  1BT5 A;  5AQA A;  1C3B A;  2X01 A;  2JKT I;  1PYY A;  3F1N B;  4D2O A;  1KGG A;  4EBL A;  4QJG A;  2WKI A;  1TS7 A;  1E3U A;  4Q0J A;  3MXQ A;  3HUM A;  5A92 A;  5L10 A;  4EW7 A;  4FUW A;  4WUJ A;  3I7J A;  1TS8 A;  1MY8 A;  2PR6 A;  3CUE A;  4ARZ B;  4OOL A;  3OCL A;  1YLZ A;  1P9W A;  3ZG8 B;  4YOF A;  3LIC A;  2OOL A;  2IWB A;  3F1P B;  3LYX A;  3EOI A;  3V3R A;  2X71 A;  4ME4 A;  3OBF A;  4NXG A;  3N7W A;  2JE5 A;  2AVX A;  2Y2Q A;  2EFX A;  4PM5 A;  2B95 A;  2DNS A;  5FQJ A;  4QB8 A;  5HSQ A;  4YFM A;  4MCW A;  3UPN A;  2XSS A;  4KUK A;  4Q0H A;  4GKU A;  1JTG A;  3T1Q B;  1Y54 A;  1T18 A;  3JVU A;  2P9V A;  4ZAM A;  4DRT A;  2INW A;  1H5X A;  5CXW A;  3VP3 A;  3H82 B;  4HJ6 A;  1GHP A;  1FIL A;  3EQV A;  5TFQ A;  1K6S A;  2V1A A;  2XR0 A;  2C5W B;  3EGD C;  2BTF P;  5HAP A;  1PW1 A;  3MZE A;  4KUO A;  3ZNY A;  4XT2 B;  2K7S A;  3HLW A;  2GZA A;  2CC1 A;  4C3Q A;  1K56 A;  3UB9 A;  4GCZ A;  2W0N A;  3LR4 A;  3ZG0 A;  3LIF A;  4B9O A;  1G6A A;  2PBY A;  5F1G A;  1O7E A;  3BM6 A;  1V9Z A;  2P04 A;  3FZC A;  1PW8 A;  1LI0 A;  3NJA A;  5TBM A;  3HUN A;  5DFY A;  4GOG A;  2RCX A;  1BLH A;  3UO9 A;  1FCM A;  4IUK A;  3UN7 A;  1ODV A;  2J9O A;  3MFX A;  3BQA A;  3QP4 A;  1NXY A; 
#chains in the Genus database with same CATH homology
 4HJ3 A;  3IS2 B;  2VV8 A;  2ZMV A;  4UQI M;  4FOF A;  4NXE A;  5IU1 A;  1XJ6 A;  2W1R A;  2P08 A;  5LBR A;  3E0Y A;  5F68 A;  2NUP C;  2W3F A;  3CUE C;  1MC0 A;  5HDC A;  1UWP X;  1G28 A;  4I3I A;  1LSW A;  4Y2F A;  4R70 A;  4JGO A;  4O01 A;  2BAS A;  3P01 A;  2W1T A;  1F5M A;  3JVV A;  1NRJ A;  4GW9 A;  5CX7 A;  5HPI A;  2EWV A;  3GDI A;  3PBO A;  2K31 A;  1OTE A;  4O8G A;  2GJ3 A;  1H8M A;  3C8C A;  2VLG A;  2ZOH A;  3F1N A;  2VGL M;  3LIE A;  5F6A A;  3EQU A;  4HJ4 A;  2KDK A;  2JKT M;  1LSV A;  3PBQ A;  3K3C A;  2XRO A;  3LIA A;  3NHQ A;  3GEC A;  5KSH A;  3C38 A;  1OTD A;  2QYB A;  4E04 A;  3HCY A;  4WLA A;  2QHK A;  3FC7 A;  4IUH A;  2NUT C;  1N9O A;  2PDR A;  3MF0 A;  4BMW A;  4ARZ A;  2M7U A;  4EES A;  2W3E A;  1WA9 A;  4YNR A;  2EA9 A;  4LRY C;  5HZH A;  1GSW A;  3MQQ A;  5HD3 A;  1DP9 A;  2QJ5 A;  4O0P A;  3EEA A;  2O9B A;  4JGR A;  2LB9 A;  4G3V A;  3F1P A;  3LR3 A;  3OLO A;  2J3T C;  3KX0 X;  1EW0 A;  4L9G A;  3LIB A;  1KOU A;  3CLO A;  3CWF A;  2M7V A;  2B02 A;  4ETZ A;  3K2N A;  2JN7 A;  5DKK A;  5KIZ A;  1IFQ A;  3VOL A;  4H6J B;  2KOI A;  5A8B A;  3T4J A;  3MQO A;  4M4X A;  4HH2 A;  5J7E A;  3MMH A;  4IHQ A;  4HNB A;  3K3D A;  2K2N A;  2V0W A;  2OWJ A;  4HHD A;  4KQO A;  2Y79 A;  3G6O A;  4JGQ A;  1Y28 A;  2J3T D;  4WL9 A;  2PHY A;  5HWT A;  4MN5 A;  4GLQ A;  3FPW A;  1YSQ A;  4NXF A;  5AJG A;  3A0R A;  3OOV A;  1TS0 A;  3VV4 A;  4I38 A;  4WN5 A;  4CLC E;  2FH5 A;  4GHI A;  3RFB A;  3TE8 A;  5G4Z A;  3LR0 A;  1D06 A;  2A24 A;  4HY8 A;  3PBN A;  3PR6 A;  4I39 A;  4BBU A;  4HOI A;  3LI9 A;  2MJ6 A;  1P97 A;  4EET B;  3T4S A;  2DMW A;  1MZU A;  3T4O A;  1S66 L;  1GSX A;  1VHM A;  5HDD A;  3UE6 A;  2L1M A;  4DN0 A;  2WKP A;  3FG8 A;  2W3H A;  5J3W A;  3PXP A;  4CQH A;  3V67 A;  3EGX C;  3HJI A;  2W1T B;  4HIA A;  2PD8 A;  2VZW A;  4MN6 A;  4EEP A;  4XT2 A;  4DJ2 A;  2D01 A;  5AVF A;  5HWW A;  4DJ3 A;  1LL8 A;  4OOM A;  2KLI A;  4BWI A;  4K08 A;  4I3J A;  3R7W A;  1T1C A;  3IBR A;  3T4L A;  4EUV A;  2CMN A;  3H7W A;  3EEH A;  3KYZ A;  3VE3 A;  3IBJ A;  2HJ9 C;  2Z6C A;  2G7U A;  3EWK A;  2D02 A;  3E4O A;  5DJU A;  1S1Z A;  3B33 A;  2ZBB A;  3ZYT A;  1H3Q A;  2J3W A;  3F1O B;  4DMZ A;  1DRM A;  3PHY A;  4BJP A;  2P7J A;  3E4P A;  3BY9 A;  2LB5 A;  3PBT A;  4HH3 A;  4L0L A;  2XA7 S;  2VX8 A;  3R4K A;  4R38 A;  3NOT C;  3BW6 A;  3IS2 A;  2YKH A;  1T19 A;  3B47 A;  3E4Q A;  4L9E A;  2R78 A;  3A0S A;  2FZ0 A;  1W63 Q;  4AFI A;  4QPR A;  2W3D A;  5K5B A;  4I3A A;  1OJ5 A;  1IOU A;  3KSF A;  2QWS A;  1XFN A;  3C2W A;  1XJ2 A;  4I5S A;  5L8M A;  1OT6 A;  2W27 A;  1OTB A;  3BQ8 A;  4LLO B;  5IT5 A;  4HP9 A;  4YWZ A;  1BYW A;  3ULF A;  3A0V A;  2H28 A;  1S1Y A;  4PKY A;  1YSP A;  1OPX A;  1STZ A;  3BY8 A;  4WEL A;  2I9V A;  2O99 A;  2VEA A;  3LI8 A;  2W3G A;  3S7O A;  2V9A A;  4EQ1 A;  4P6Z S;  4G3K A;  2PD7 A;  2XA7 M;  5HDS A;  3UB6 A;  2IA2 A;  3T50 A;  4GHI B;  4NKP A;  3OC2 A;  3PYP A;  1ZHH B;  3W2Z A;  4EER A;  2JKR I;  3T4T A;  4EEU A;  2A24 B;  2HJE A;  4B93 A;  1TD5 A;  3KSH A;  4R6L A;  3TW8 A;  1ZTU A;  4KQD A;  3KSG A;  1F98 A;  4LRX C;  5TBM B;  1JNU A;  5TJJ A;  4UEY A;  1S4R A;  4BBT A;  4F3L B;  4Z1W A;  3PBS A;  5J4E A;  1W63 M;  4GS9 A;  4WEJ A;  4RQ9 A;  4EXO A;  5MC7 A;  1N9L A;  4MMN A;  1X0O A;  2XRN A;  4CLC A;  1T1B A;  2HF6 A;  3H82 A;  2QJ7 A;  4H6J A;  4Y5F A;  3O5Y A;  4MDZ A;  2JHE A;  5FL3 A;  4P6Z M;  2VKS A;  2ZMF A;  3S7P A;  2O0Y A;  4R3A A;  3E98 A;  3NOP C;  1XJ3 A;  2O9A A;  5DFX A;  1XJ4 A;  5DF9 A;  3UMD A;  3CIT A;  3H7W B;  3MJQ A;  1F9I A;  3BWL A;  5AVE A;  2JKR M;  3DBA A;  5IS1 A;  2VJW A;  2JKT I;  3H9W A;  2M1C A;  3F1N B;  2HGV A;  4PKY G;  3S7Q A;  3UB8 A;  3UE3 A;  4NXB A;  1OT9 A;  5HWV A;  2V1B A;  4Y3I A;  2V0U A;  1TS7 A;  1DP6 A;  4Q0J A;  3MXQ A;  4NEE D;  2J80 A;  1YAX A;  3S7N A;  4EW7 A;  5G4Y A;  3TJZ C;  4WUJ A;  5F69 A;  2ZOI A;  5HD5 A;  3BJN A;  1TS8 A;  4ARZ B;  2PR6 A;  3CUE A;  1NLY A;  2A2L A;  4OOL A;  3RH8 B;  3T4K A;  3OCL A;  2WKR A;  1V9Y A;  2L4R A;  1TS6 A;  3D72 A;  1P9W A;  1S4S A;  4YOF A;  3LIC A;  2OOL A;  2QKP A;  4ETX A;  4WEK A;  3KO6 A;  1P0Z A;  4WF0 A;  3T4Q A;  5DKL A;  3F1P B;  3LYX A;  1NWZ A;  4HQA A;  3VE4 A;  3ICY A;  3EOI A;  4ME4 A;  1T1A A;  3OBF A;  4NXG A;  2PT7 A;  4GJ4 A;  2HV1 A;  1NLZ A;  4HP4 A;  2WKQ A;  3SW1 A;  3PBR A;  3B42 A;  3D3O A;  1VB6 A;  4II7 A;  5I5L A;  2YKF A;  1YKD A;  3LFV A;  3MR0 A;  4PAU A;  1OTA A;  5HSQ A;  4MCW A;  3FPV A;  3RTY A;  3U2A A;  2OWH A;  2OAQ 1;  2XSS A;  3F1O A;  4KUK A;  3UME A;  4Q0H A;  5EFW A;  4PHT A;  1MKM A;  5HPF A;  4Q0I A;  4IJG A;  3CI6 A;  1S67 L;  1GSV A;  1T18 A;  3JVU A;  1XFQ A;  4GS9 B;  1G6O A;  5F5Y A;  1N9N A;  2KX6 A;  2INW A;  1LSX A;  4ZRR A;  2OAP 1;  3C30 A;  4CLC B;  4BBV A;  2GNX A;  4L9F A;  3H82 B;  4HJ6 A;  4MN7 A;  3CAX A;  2VV7 A;  2L0W A;  3EQV A;  1UGU A;  3OCN A;  2V1A A;  1TF1 A;  4G3W A;  1OTI A;  3EGD C;  2PYR A;  2B18 A;  4UQI S;  4KUO A;  4XT2 B;  2K7S A;  3P7N A;  3KYQ A;  5DJT A;  2GZA A;  2PR5 A;  3MQ0 A;  3TRC A;  1OJG A;  4CLC C;  3UB9 A;  4GCZ A;  4JGP A;  2W0N A;  3LR4 A;  3R7W B;  3LIF A;  5HL6 A;  1DP8 A;  3KSI A;  3HJK A;  2PYP A;  4B9O A;  4EU0 A;  5C5K A;  1V9Z A;  2GX5 A;  2P04 A;  3NOU C;  3LUQ A;  3UB7 A;  3LID A;  2VGL S;  1P9R A;  3NJA A;  4FSF A;  5TBM A;  4LPZ A;  1D7E A;  2Y8H A;  4CLC D;  2VV6 A;  5DFY A;  4HI4 A;  2EWW A;  3LR5 A;  4F3L A;  2O9C A;  4IUK A;  3ZQ5 A;  2Z6D A;  1ODV A;  3MFX A;  3BQA A;  1UWN X;  2VA0 A;  4LRZ E;  1LT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...