1S66L

Crystal structure of heme domain of direct oxygen sensor from e. coli
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
NAADGIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yddU
publication title Insights into signal transduction involving PAS domain oxygen-sensing heme proteins from the X-ray crystal structure of Escherichia coli Dos heme domain (Ec DosH)
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxygen storage/transport
total genus 24
structure length 119
sequence length 119
chains with identical sequence U
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1s66L00
2J80A 1OTAA 3F1OB 3OLOA 1WA9A 2PR5A 3E4QA 2OWHA 3MQOA 4XT2B 1LSWA 5F5YA 2I9VA 3UB9A 4EERA 2A24B 1OTIA 2ZBBA 4JGQA 4EW7A 3FC7A 4JGOA 3PYPA 4MN5A 2WKPA 3F1PA 5J4EA 5HZHA 2PD8A 3EWKA 4H6JB 5F69A 3MJQA 2Z6CA 2K7SA 3P7NA 4EEUA 1S66L 2INWA 3LIAA 3E4OA 3K3DA 4E04A 2JN7A 3H7WA 4HY8A 3LUQA 1OTDA 2W0NA 1UWNX 5HWWA 4KUOA 5HDSA 4K08A 4LRXC 2YKHA 4HP9A 1EW0A 1S4RA 4B9OA 1T19A 1UWPX 2VLGA 2V0UA 4EETB 1GSXA 2H28A 1TS0A 4XT2A 4I3AA 3LIBA 4KUKA 2A24A 1D06A 3H7WB 4I3JA 2M1CA 1T1AA 3H9WA 3EEHA 2V1BA 1KOUA 4WL9A 1TS7A 1OTBA 2OOLA 1S4SA 5KIZA 1VB6A 2KDKA 4HH3A 2VV7A 4BBUA 1N9LA 2HV1A 5F6AA 3A0SA 1F98A 2PYRA 3G6OA 4BBVA 1S67L 1XJ3A 5DKLA 3K3CA 4HNBA 4HH2A 3VE3A 3RH8B 5HSQA 2QWSA 2JHEA 4R3AA 1P97A 1XJ2A 3RTYA 4MN6A 4PKYA 3BWLA 3MQQA 1T1BA 5J7EA 2PR6A 4I3IA 1OJ5A 2QHKA 1T1CA 3ZQ5A 4M4XA 1DP8A 1D7EA 4WUJA 4GS9B 1XFQA 2D01A 2WKRA 2L4RA 4EEPA 1OTEA 3B33A 2QKPA 4LLOB 2VV6A 4NXEA 3E4PA 5HWTA 4DJ2A 3IS2B 3LIDA 4GCZA 1LT0A 3A0RA 3MR0A 4HJ3A 5G4YA 3NJAA 4HI4A 5EFWA 5IU1A 3VOLA 3LI9A 4HP4A 5IS1A 3UMDA 4YWZA 4L9GA 1OT6A 5TBMA 1V9YA 3CLOA 4HJ4A 1OT9A 4L9EA 2VEAA 3H82B 3NOPC 4I39A 2L1MA 4I5SA 2KX6A 4HIAA 2QJ7A 1NWZA 1TS6A 3ICYA 3C8CA 2W27A 3C2WA 4KQDA 3LYXA 4HJ6A 2GJ3A 3NOTC 4DJ3A 5TBMB 3UB7A 5DKKA 1T18A 4GS9A 2R78A 1Y28A 3CAXA 4NXFA 4F3LA 1DP9A 4EESA 2L0WA 2D02A 2V1AA 1GSVA 4BBTA 1JNUA 3IS2A 2YKFA 3UE6A 3NHQA 4GHIA 5DJTA 3VE4A 1F9IA 5G4ZA 3UMEA 1S1YA 4WF0A 2CMNA 1DP6A 4LPZA 3LI8A 4LRYC 4HHDA 1XJ4A 5HDDA 3SW1A 4L9FA 3LIEA 1OJGA 3GECA 2PHYA 3CWFA 2B02A 3NOUC 4HOIA 4F3LB 2WKQA 1XFNA 5I5LA 1P0ZA 2V9AA 3H82A 4R6LA 3T50A 2QJ5A 1N9OA 3A0VA 4GHIB 1MZUA 2PD7A 3FG8A 4EQ1A 5HD3A 3BY8A 1N9NA 5F68A 1UGUA 3HJIA 5J3WA 4RQ9A 4NXGA 3D72A 1XJ6A 5HD5A 2P7JA 3LIFA 2ZOHA 2BASA 1TS8A 1X0OA 3GDIA 3BY9A 1LSVA 2OWJA 4LRZE 5HWVA 3F1PB 3UB8A 4R38A 2PDRA 3KX0X 3ULFA 3IBRA 4I38A 2V0WA 1BYWA 5AVEA 3F1NA 1ODVA 5HDCA 4NXBA 3F1OA 2ZOIA 3PHYA 4PKYG 4JGRA 1LL8A 2EA9A 1GSWA 3UB6A 2VV8A 5A8BA 1S1ZA 4EXOA 4HQAA 1V9ZA 4GW9A 2PYPA 1DRMA 3HJKA 5AVFA 5DJUA 3MXQA 3LICA 1LSXA 1G28A 4WLAA 4R70A 4JGPA 2Z6DA 4H6JA 3MFXA 3F1NB 4WN5A
chains in the Genus database with same CATH superfamily
4D60A 1K38A 3OLOA 5CGWA 1PZPA 3C7UA 5M19A 4IVKA 1K54A 4NEED 5A91A 4GLQA 3MQOA 1I2SA 1FSYA 2QMIA 2I9VA 3UB9A 2A24B 5FQQA 5HX9A 2V2FF 2XF3A 2V20A 2ZBBA 1BLCA 3A3IA 3FPVA 3UPOA 3Q81A 4EW7A 3HLEA 5DFXA 1K6RA 4JGOA 5CEDA 4PMAA 2Y2NA 3LR3A 4DXBA 2PD8A 4H6JB 2ZQAA 4WZ5A 3MJQA 2Z6CA 4PHTA 1S66L 4JXWA 4RVAA 2VJWA 3LIAA 1W7FA 3N6IA 4LV3A 2EXBA 1STZA 3ZGAB 3A3EA 3K3DA 1MWRA 1XP4A 4KENB 1K55A 5CGSA 3MKFA 2W0NA 3SH9A 3T4QA 5HWWA 4Z9QA 3AGDA 4QWOA 1GHMA 5HDSA 4R3JA 1G68A 4K08A 2BTFP 4KG2A 5E43A 3VP0A 3SH7A 3IHBA 1YPRA 1S4RA 4ID4A 1OPXA 1UWPX 1E3UD 4GDNA 5EPHA 1IFQA 3DTKA 1GSXA 1FOFA 4I3AA 4WZ5C 2W3GA 3KYEA 3LIBA 2Z2MB 1PIOA 4DE0A 1H8YA 2A24A 2R9WA 3ZNYA 1FR1A 3TJZC 5FI7A 4KZ9A 4OLDA 3HLWA 4BWIA 4OOMA 3ZDJA 3ZCZA 2VK3A 3EGDC 1HZOA 5KMWA 4IEDA 1OTBA 4WYYA 5KSHA 1S4SA 1E3UA 5EM0A 3Q82A 4EQIA 3GMWA 4HH3A 3T4SA 3NCKA 4WMCA 2HP9A 1M6KA 4O8GA 4UHUA 2E8JA 4FOFA 2HV1A 2W3EA 3A0SA 4CPKA 1EI5A 3NDEA 3KYZA 3QP1A 3W4QA 5F1GA 4HNBA 4R23A 2DMWA 1L2SA 3VE3A 3RH8B 5EV0A 1E25A 2A49A 2Y2HA 4OKPA 2QWSA 2JHEA 5FEGA 3C38A 4Y0TA 3T1XA 1LI0A 3MXSA 3LY3A 1XJ2A 4MN6A 5AJGA 3IWQA 3DWZA 2E8IA 1T1BA 5EUAA 4DN0A 5J7EA 3LEZA 4I3IA 3CJMA 3VSLA 4YFMA 1DP8A 4WUJA 4X68A 1OTEA 1L0DA 4Q8IA 2VV6A 4NXEA 3E4PA 3OCNA 5DF7A 1J3WA 5HWTA 1KE3A 4RX3A 4GCZA 1LT0A 3A0RA 1CJFA 5DVAA 3MR0A 5G4YA 3BYDA 3ITBA 4HI4A 2OLUA 5EFWA 4OPYA 5HAQA 4U0XA 4BMWA 1ES3A 3WRZA 1TDLA 4L9GA 4GKUA 5TBMA 2ZL1A 4EBPA 2ZC4B 3CHWP 2G2WA 2XD5A 1YAXA 3CLOA 4ETZA 1IYPA 1SDEA 2PU4A 4LFUA 4I39A 3V3SA 2P74A 4KZBA 4UA9A 4B4ZA 4E6XA 5CXWA 4CLCB 2EFXA 1JWPA 1G6AA 1ES5A 4OVDA 1RGYA 3C2WA 3N4IA 4JXVA 2V1ZA 4BQMA 2ZC6B 4HJ6A 2GJ3A 5IT5A 4Y2FA 2DNSA 3D3OA 1ACFA 5DTKA 3SH8A 4ZTKA 3DTIA 3EOIA 2VA0A 4HBUA 1NLYA 4OQ0A 4EESA 4FH2A 2V1AA 1PYYA 4QB8A 5DJTA 3IH8A 2V8CA 1CK3A 3R7WB 4LPZA 3O3VA 4KZ8A 1H0MA 2WUQA 2W3DA 5EOOA 3FPWA 2O9BA 2ZJ9A 3W2ZA 4LV2A 1OJGA 4KQRA 3GECA 1FILA 3ITAA 3NOUC 4OH0A 5I5LA 2A3UA 3S22A 3BFFA 3TE8A 4LV0A 3T50A 4X69A 2WAEA 4UAAA 1N9OA 2J8YA 1K6SA 2GDNA 4K0WA 3BM6A 4CLCA 3V50A 1PRQA 3TRCA 1SDNA 2Y2LA 3BY8A 1VEUB 3IH9A 5AQ7A 4JXGA 3ZG0A 4X55A 2RCXA 2WGIA 1KE0A 3JYIA 3OPLA 2JKRI 3LIFA 2BASA 1X0OA 2G7UA 4Q0JA 1CEGA 4LRZE 5M18A 3IF5A 3N8SA 1ERQA 4WBGA 3IBJA 3EQUA 1PFLA 2WAFA 3ULFA 2EFUA 3F1NA 1ODVA 2X02A 4AFIA 4X53A 1GSWA 5TJJA 2X01A 2CC1A 5A8BA 1MBLA 3MFDA 3HREA 3GVBA 3LEQA 4QJGA 4GW9A 1N9BA 2XLNA 3OPHA 2HDSA 2WZZA 1DRMA 3HJKA 4MN7A 5F82A 3QP8A 2WGVA 4KZAA 4C75A 1RGZA 4GN2A 3SS5A 2EX6A 4NK3A 1LI9A 4ETXA 2XH9A 2AVXA 1OTAA 3F1OB 2GZAA 1FSWA 1IKIA 3W8KA 1WA9A 2XRNA 2OWHA 3WS4A 4EERA 2Y4AA 4B93A 1ZKJA 3AGEA 2Y2PA 4JLFA 4K0XA 4P85A 5A90A 1NLZA 2WKPA 3WS2A 3N8RA 5EVID 3BEBA 5HZHA 2WGWB 2QPNA 4ZBEA 4MBHA 1BLPA 5E2GA 4EUVA 2LB9A 4DF6A 3LR5A 2W1RA 4DE2A 1YLZA 3E4OA 3PBRA 3WS5A 1L0GA 4PM6A 3UDFA 4E04A 4OLGA 3ZVWA 4EBLA 1KDWA 1Q2PA 1DY6A 3BW6A 4FD8A 5EVIA 4G3VA 1YKDA 3HUOA 2Y2OA 3IF6A 1SKFA 2B95A 4LRXC 3HCYA 1XGIA 2J9PA 1EW0A 3E2KA 3O88A 4B9OA 5E2EA 3ZG9B 3E0YA 2W3HA 5HW3A 2ZC7A 2XDMA 2VLGA 2PT7A 2V0UA 3BJNA 4EETB 3CITA 3ZG7B 4WZ4A 1IELA 3G31A 2OSUA 4N1XA 2H28A 3T1QB 2ZD8A 2RL3A 3GV9A 3KSHA 4RX2A 4KUKA 3RJUA 1YT4A 4I3JA 3DW0A 4N1HA 1PNEA 2EXAA 1FIKA 3B47A 3H9WA 1BT5A 3EEHA 5HAPA 2JKTM 1Q2QA 3E98A 4WL9A 2Q9NA 2C5WB 5GHXA 4OP8A 5E2FA 2EWWA 3G2YA 1L3LA 3CPTA 3HBRA 2WGWA 3C7VA 4Y0OA 3C4PA 5EVIC 3IF6C 5LBRA 4BD1A 5GHZA 2PYRA 4BBVA 1S67L 3K3CA 1LL5A 4Y15A 3G2ZA 1DJBA 2OAP1 1Y54A 5HSQA 3BFEA 4O0PA 1JTDA 1P97A 1EWZA 5FAPA 1EROA 3IX3A 2IWBA 5D3OA 3U2AA 3B3XA 4PKYA 5CRFA 2O99A 4X25A 3BWLA 4HBTA 3MQQA 5EM1A 4KZ6A 1OJ5A 5FAQA 3S1YA 1T1CA 4M4XA 3RFBA 1SKOA 4UA7A 1VHMA 2WK0A 2WKRA 4KG5A 4PM7A 4E3JA 4GD6A 5F1FA 2Y55A 4N9KA 4P6BA 4S2IA 4MDZA 5FAOA 5EE8A 3GRJA 1VETA 5FDHA 5GLCA 3LI9A 4OONA 3C4OA 1JWVA 1NY0A 4HP4A 5IS1A 3VP2A 2A2LA 3UMDA 2ZQCA 3LFVA 3UB5P 1W8YA 5GLBA 3LR0A 3PAEA 2ZMVA 2VEAA 3S7OA 2ZM8A 4JPMA 5CGXA 3O87A 4ZAMA 2DCFA 3V3RA 2KX6A 2HDUA 2J3WA 4WM9A 3CI6A 3ICYA 2H0TA 3HLGA 5GL9A 3LYXA 4BENA 3PBQA 1NRFA 1MWTA 1KVLA 5TBMB 2XROA 2P9VB 2ZL1B 2Q9MA 4X6TA 3MS6A 1PWDA 3PXPA 4F3LA 3DTEA 3IXDA 5U47A 2JCHA 4BBTA 2XD1A 4GNUA 1F9IA 5G4ZA 3UMEA 1S1YA 4WF0A 2CMNA 1BULA 1DP6A 3DWKA 2VGJA 4OQHA 3S4XA 1W63Q 4CJNA 4MCWA 1MXOA 1W5DA 3VOYA 2Y91A 4IHQA 3ZG5A 2H5SA 4R1GA 1CEFA 1XFNA 4H8RA 3LR4A 4UA6A 3E2LA 1O7EA 2QJ5A 4LCLA 4A5RA 2VGKA 3TW8A 3JVUA 4GB7A 1G5UA 4LV1A 3LO7A 4PM8A 4MLLA 5I94A 3B42A 2W1TB 3HJIA 1XKZA 3D72A 2P9VA 1GCEA 2XA7M 2OLVA 2ZOHA 2ZMAA 3GDIA 2O9CA 1LSVA 1SHVA 3G32A 2FFFB 3F1PB 4R38A 3IBRA 4I38A 2V0WA 4N9LA 1BYWA 4KZ7A 4ZRRA 4P6ZM 5HDCA 5HARA 2ZOIA 2BLSA 3IWIA 1F5MA 1TD5A 2Y2IA 4G3WA 4DE3A 2VKSA 1J9MA 3IX4A 1YLPA 3VV4A 1E4DA 1BTLA 3DAVA 3BQAA 1ESUA 1IOUA 1PW8A 1HLUP 4Y0UA 3MXQA 3BFCA 1K4EA 3OZHA 1G28A 1ALQA 1MKIA 5CX7A 2WKEA 1YSPA 4O7DA 3F1NB 2Y2GA 3TOIA 4WN5A 4IUKA 2J80A 4JKTA 4WEJA 4EV4A 5CHJA 4QPRA 3E4QA 3ISGA 3T4OA 3WWXA 4DKIA 3V39A 4XT2B 3VSKA 1LSWA 1Z09A 5F5YA 4EWFA 4YOFA 1K25A 2M7VA 3UDIA 2W1TA 5DFYA 4P0MA 4JGQA 3PR6A 3FC7A 3M6HA 3LCEA 3WS0A 4ME4A 4DE1A 1MWUA 1IYQA 4MN5A 3F1PA 5J4EA 3IXBA 4HEFA 5KSCA 3Q1FA 4GOGA 4EEUA 3P7NA 1FQGA 1ZTUA 1Z6FA 3T1SA 3VOZA 2XA7S 4ZJ1A 1NYMA 1DJAA 1PI5A 5HL1A 3MZFA 3HLBA 3H7WA 4HY8A 1H8MA 5TGFA 3LUQA 3HLCA 3DTMA 3OCLA 1UWNX 2DRWA 4MMNA 2WKHA 4MBFA 4U0TA 4X1MA 1ONHA 4BJPA 3LY4A 4HP9A 3T4TA 1K4FA 1KE4A 3N7WA 5AQ9A 4YINA 3V5MA 3BFGA 5HPFA 1TVFA 2GNXA 1H3QA 3IX8A 4RYEA 2O9AA 4XT2A 3M6BA 3ZVTA 4QY5A 4RA7A 3WRTA 2FH5A 3FKVA 1O07A 2V1BA 4X56A 5EVIB 1KOUA 3IF6B 3D9YA 5FASA 4JF4A 3Q7VA 3HUNA 2OOLA 4OPZA 5F83A 2PBDP 5KIZA 5EECA 1VB6A 2KDKA 4PPRA 4DMZA 4OPQA 1K56D 5L8MA 4S2LA 1L0FA 5CERA 3EQVA 2B5RA 5F6AA 1F98A 2XK1A 3G6OA 3KSIA 2W3FA 1XJ3A 2K2NA 3UPPA 2K31A 3FZCA 2J9OA 4JXSA 5HAIA 1JTGA 4XXRA 1QMEA 2ACGA 4Y5FA 3T4KA 3DBAA 2HDQA 3ZNTA 3VMAA 1LHYA 1MWSA 2I72A 3CPTB 3NY4A 5FQJA 3CUEC 2PR6A 4DRTA 2QHKA 2UV0E 3UO9A 3IWOA 1D7EA 1XXMA 1IYOA 4GS9B 4Z1WA 3T1RA 1XFQA 2V8FA 2D01A 2Y59A 3B33A 2QKPA 1JVJA 4LLOB 2HP6A 1I2WA 4KQQA 1H8ZA 1QMFA 4GZBA 3IS2B 4GD8A 4L0LA 4HJ3A 4Q0IA 3V67A 3P98A 4KQOA 3MZEA 5K5BA 3NJAA 1VQQA 5IU1A 3VOLA 3SS4A 3AGFA 3IT9A 3A3FA 3NIAA 4YWZA 1I5QA 4IJGA 3S7PA 3GR2A 1SKOB 2XFTA 1A0KA 3CZDA 4QY6A 3KSFA 1IKGA 3H82B 2ZC3B 2Y8HA 4QU3A 3IXGA 5DTTA 2HJEA 5GHYA 3G35A 2L1MA 3OPPA 1NYYA 3MF0A 4HIAA 2XQZA 4E3NA 5FA7A 1D1JA 1NWZA 1KVMA 1VETB 2C6WB 3C8CA 3EEAA 1BLSA 1MPLA 1JWZA 4PM9A 1BZAA 4UQIM 5TR7A 4PM5A 4DJ3A 4FH4A 3BECA 3UB7A 3IXHA 4MEZA 4GS9A 2R78A 4R4RA 2HP5A 3CAXA 4NXFA 1DP9A 2KLIA 4OP5A 3PAGA 3TSGA 4K91A 3QNCA 1WYBA 3IS2A 5C5KA 2YKFA 3UE6A 4LGWA 4GHIA 4IUHA 3NI9A 3NC8A 1N4OA 2JKRM 4FUWA 3FYZA 4HHDA 2VGLM 1XJ4A 3L9KA 5M1AA 2Q0OA 3SS3A 1DJCA 5HDDA 5TFQA 1YLTA 1FCMA 2Z2LB 4L9FA 3C5AA 4E3IA 4MNRA 4FCFA 1FR6A 4HESA 1ZG4A 2HDRA 4IVIA 4F3LB 4HOIA 5JYOA 5HL6A 2V9AA 3H82A 4Y3IA 4CLCE 1SCWA 3IQAA 1L0EA 3IHAA 4R3BA 1GHIA 4WEKA 4WELA 5DF9A 2PAVP 3R4KA 3W4PA 2PD7A 4ZJ3A 3FG8A 1CI9A 1H5XA 1N9NA 2QYBA 3OC2A 4XUXA 5GLAA 5F68A 1PWCA 1UGUA 5J3WA 4OPRA 4RQ9A 4ARZA 5CHUA 1K54C 4NXGA 5HD5A 1PI4A 2XR0A 1XGJA 4Y17A 3L7HA 1KGFA 1TS8A 2Y2QA 2X71A 2OWJA 3BLMA 1CF0A 5IHVA 3KX0X 1YMXA 3ZG8B 2HGVA 4UQIS 1CQAA 1G6OA 1RCJA 2B18A 5CTMA 4NXBA 2WYXA 5BOHA 3PHYA 3A3JA 3TG9A 4WMCD 4G3KA 2BG1A 1LL8A 4EUZA 5KZHA 3OOVA 1WYCA 4BL3A 4ESPA 1S1ZA 4NKPA 4O01A 4EXOA 2MJ6A 2ZC5B 4HQAA 2PYPA 5A93A 4MBKA 4E3MA 5FI6A 3BRMA 1FCOA 3MMHA 5EVEA 5DJUA 2Y2KA 3MBZA 1KGGA 3LICA 1LSXA 4WLAA 1K55C 4R70A 5FSRA 5L07A 1CI8A 2IWCA 2VGLS 2PRFA 4H6JA 3I7JA 1ZG6A 2ZQ7A 2JC7A 2XSSA 3VP4A 3PBOA 4ZJ2A 2M7UA 1HTZA 3GSGA 2ZQ9A 2PR5A 3S7QA 3N8LA 3GQZA 2Y79A 4II7A 2VX8A 3T12B 1OTIA 3NBLA 4GDBA 3D4FA 2HF6A 1HVBA 3UY6A 3C30A 3PYPA 3QP5A 3Q7ZA 3W4OA 1TEMA 1GA0A 1K57A 3T4JA 3KO6A 3EWKA 5F69A 2K7SA 2INWA 5AQBA 1AXBA 5CHMA 5HFOA 4FTXA 4Q0HA 1NXYA 1ES2A 2JN7A 2EX8A 2Y2JA 1OTDA 2JBFA 4KUOA 2NUPC 2EX2A 1NRJA 5FQIA 5DF8A 3HL9A 3FV7A 4S2KA 2YKHA 5FEFA 2JE5A 1T19A 4OQGA 3G30A 3PBSA 4KG6A 1K57C 4D2OA 1TS0A 5FDSA 1ESIA 3G4PA 1D06A 2VZWA 3H7WB 2HJ9C 2M1CA 2R9XA 3VP1A 1T1AA 5AQAA 5FATA 2ZM2A 2H10A 3S7NA 4ZDXA 4S2JA 1ZHHB 5FQ9A 1YSQA 4KZ4A 1BLHA 1TS7A 2JKFA 4N92A 1IYSA 3M2JA 5EOEA 3QHYA 4M3KA 2IA2A 2VV7A 4BBUA 2FZ0A 4S2NA 4X1LA 2XGNA 4EBNA 4E3LA 1NZOA 1N9LA 1GA9A 3MZDA 4OOYA 3VFFA 4LENA 4DXCA 5DKLA 4Y13A 4HH2A 4C6YA 3ZHHA 4QHCA 1YM1A 4R3AA 1LLBA 2G2UA 1U60A 5G18A 3Q7VB 4OOLA 3UN7A 4S2PA 5E2HA 1KDSA 3RTYA 4BL2A 1PWGA 1C3BA 3EGXC 4CLCD 4R0QA 2JKTI 3CG5A 1Y4OA 1P9RA 3WS1A 3ZQ5A 1W79A 1MC0A 3P09A 5A92A 1P9WA 3U4LP 2L4RA 4EEPA 1ONGA 1S6RA 4S2NC 2ZQDA 2J3TD 4P6ZS 4DJ2A 3UNWA 3VFHA 3LIDA 3QNBA 4JBFA 4IBXA 3A3DA 3Q07A 1S0WA 4IBRA 2ZMFA 1GHPA 1HD8A 2ZLYA 2KOIA 5FI2A 4UEYA 1YLWA 1XX2A 3MQ0A 2LB5A 1OT6A 1M40A 2XFSA 3OPRA 1YLYA 1V9YA 3QP6A 1BSGA 4NG2A 4HJ4A 4P87A 3UE1A 1OT9A 4L9EA 2EX9A 2J7VA 4NETA 2Y2MA 3NOPC 4S2MA 1YLJA 3SOIA 2OV5A 2ZQ8A 1PW1A 3CUEA 4I5SA 1PZOA 3PBNA 4GJ4A 4F94A 1SZVA 3R7WA 2QJ7A 3KYQA 2HZ5A 1TS6A 3FKWA 3HLDA 5CECA 5L2FA 2W27A 4KQDA 1NJ4A 3NOTC 4CLCC 5DKKA 1T18A 5FL3A 3QP4A 1YMSA 1Y28A 2XEPA 1F2KA 1W8QA 2JKGA 1ERMA 2L0WA 2D02A 1GSVA 1JNUA 4KZ5A 2P08A 3PBTA 2J3TC 3NHQA 2QZ6A 2WADA 3VE4A 2EWVA 4E3KA 3BFDA 4BLMA 4EU0A 1K56A 3LI8A 4LRYC 3KSGA 1VEUA 5J8XA 1VM1A 4S2OA 1TDGA 3M2KA 5FQKA 2H0YA 3SW1A 4XUZA 2O0YA 3UE3A 3MSHA 2WKIA 3MKEA 5DTSA 1FCNA 3LIEA 4JF5A 5L10A 4YNRA 1YQSA 3RXWA 4E3OA 2PHYA 2IWDA 3CWFA 2B02A 5FQMA 1IEMA 3RXXA 2WKQA 5EVLA 1P0ZA 3QP2A 4R6LA 3LGOA 4JF6A 1ZC2A 3A0VA 4GHIB 3NDGA 4PAUA 2UWXA 3NECA 4QD4A 3CMZA 3O86A 1MZUA 1NZUA 1LL9A 4EQ1A 5HD3A 3NULA 1RP5A 4CQHA 5HPIA 4B88A 4BD0A 2GX5A 2ZM0A 1XA1A 3VP3A 1XPBA 2NUTC 1W63M 1XJ6A 5GLDA 4U3TA 2P7JA 4DDSA 3UDXA 3MXRA 1ES4A 3HUMA 3ZYTA 3BY9A 1TF1A 1KGEA 3BLSA 5HWVA 1BUEA 1XA7A 4FSFA 3UB8A 2PDRA 4E6WA 5JYPA 3PTEA 3SZTA 4OQIA 3G34A 1MY8A 2PBYA 3JPUA 3FWLA 2P04A 4KZ3A 5AVEA 4B4XA 5MC7A 4R4SA 3F1OA 3BQ8A 2WZXA 4PKYG 4JGRA 2EA9A 3UB6A 2VV8A 2PU2A 1OMEA 1K0KA 4LCMA 2OAQ1 3P01A 5CTNA 3UE0A 3UPNA 3ZFZA 3T4LA 1AWIA 2FFYA 1WE4A 2HPBA 1V9ZA 4ARZB 3HLFA 4DDYA 5CEBA 3K2NA 3O5YA 3JVVA 5AVFA 3GTCA 1MKMA 3OBFA 3HVFA 5L09A 4JGPA 4C3QA 2Z6DA 3MFXA 4Y7PA
chains in the Genus database with same CATH topology
4IUKA 2XSSA 2J80A 1OTAA 3F1OB 2GZAA 3OLOA 3PBOA 1WA9A 4WEJA 2M7UA 2XRNA 2PR5A 4NEED 4QPRA 3E4QA 3S7QA 3T4OA 2Y79A 4GLQA 2OWHA 4II7A 3MQOA 2VX8A 4XT2B 1LSWA 5F5YA 2I9VA 3UB9A 4YOFA 4EERA 2A24B 1OTIA 2M7VA 2W1TA 5DFYA 4B93A 2ZBBA 3FPVA 4JGQA 4EW7A 3PR6A 3FC7A 2HF6A 5DFXA 3C30A 4JGOA 3PYPA 4ME4A 1NLZA 4MN5A 2WKPA 3F1PA 5J4EA 5HZHA 3T4JA 3LR3A 3KO6A 2PD8A 3EWKA 4H6JB 5F69A 4EUVA 3MJQA 2LB9A 2K7SA 2Z6CA 3P7NA 4PHTA 4EEUA 1S66L 1ZTUA 2INWA 3LR5A 2W1RA 2VJWA 2XA7S 3LIAA 3E4OA 3PBRA 1STZA 4Q0HA 3K3DA 4E04A 2JN7A 3H7WA 4HY8A 1H8MA 3LUQA 1OTDA 2W0NA 3OCLA 1UWNX 3T4QA 5HWWA 4KUOA 3BW6A 4MMNA 2NUPC 5HDSA 4G3VA 1YKDA 4K08A 1NRJA 4LRXC 3HCYA 2YKHA 4BJPA 4HP9A 3T4TA 1EW0A 1S4RA 4B9OA 3E0YA 2W3HA 1OPXA 1T19A 1UWPX 2VLGA 2PT7A 2V0UA 3BJNA 4EETB 3CITA 3PBSA 1IFQA 5HPFA 2GNXA 1GSXA 1H3QA 2H28A 1TS0A 2O9AA 4XT2A 4I3AA 2W3GA 3LIBA 3KSHA 4KUKA 2A24A 1D06A 2VZWA 3H7WB 2HJ9C 2M1CA 4I3JA 3TJZC 1T1AA 2FH5A 3B47A 3H9WA 3EEHA 4BWIA 4OOMA 3S7NA 2V1BA 3EGDC 2JKTM 1KOUA 3E98A 4WL9A 1ZHHB 1YSQA 1TS7A 1OTBA 2OOLA 5KSHA 1S4SA 5KIZA 2EWWA 1VB6A 2KDKA 4HH3A 4DMZA 3T4SA 2IA2A 5L8MA 4O8GA 2VV7A 4BBUA 2FZ0A 5LBRA 3EQVA 4FOFA 1N9LA 2HV1A 5F6AA 2W3EA 3A0SA 1F98A 2PYRA 3G6OA 3KSIA 3KYZA 4BBVA 2W3FA 1S67L 1XJ3A 2K2NA 2K31A 3K3CA 4HNBA 5DKLA 4HH2A 2DMWA 3VE3A 3RH8B 4Y5FA 2OAP1 3T4KA 5HSQA 2QWSA 2JHEA 4O0PA 4R3AA 3C38A 3DBAA 1P97A 4OOLA 1XJ2A 3U2AA 3RTYA 4MN6A 4PKYA 2O99A 3BWLA 5AJGA 3EGXC 3MQQA 4CLCD 1T1BA 4DN0A 5J7EA 3CUEC 2PR6A 2JKTI 4I3IA 1OJ5A 2QHKA 1P9RA 1T1CA 3ZQ5A 4M4XA 1DP8A 1MC0A 1D7EA 4WUJA 3RFBA 4GS9B 4Z1WA 1VHMA 1XFQA 1P9WA 2D01A 2WKRA 2L4RA 4EEPA 1OTEA 3B33A 2QKPA 4LLOB 2VV6A 4NXEA 2J3TD 3E4PA 3OCNA 5HWTA 4P6ZS 4DJ2A 3IS2B 3LIDA 4GCZA 1LT0A 3A0RA 4L0LA 3MR0A 4HJ3A 4MDZA 4Q0IA 3V67A 4KQOA 2ZMFA 5G4YA 5K5BA 3NJAA 4HI4A 2KOIA 5EFWA 5IU1A 3VOLA 3LI9A 4BMWA 4UEYA 3MQ0A 4HP4A 5IS1A 2A2LA 2LB5A 3UMDA 4YWZA 4IJGA 4L9GA 1OT6A 5TBMA 3S7PA 3LFVA 1V9YA 1YAXA 3LR0A 3CLOA 4HJ4A 4ETZA 1OT9A 4L9EA 2ZMVA 2VEAA 3KSFA 3H82B 3S7OA 2Y8HA 3NOPC 4I39A 2HJEA 2L1MA 4I5SA 3CUEA 2KX6A 3PBNA 4GJ4A 3MF0A 4HIAA 2J3WA 4CLCB 3R7WA 2QJ7A 3KYQA 1NWZA 3CI6A 1TS6A 3ICYA 3C8CA 3EEAA 2W27A 3C2WA 4KQDA 3LYXA 4UQIM 3PBQA 4HJ6A 2GJ3A 3NOTC 4DJ3A 5IT5A 4Y2FA 4CLCC 5TBMB 3D3OA 3UB7A 2XROA 5DKKA 1T18A 5FL3A 4GS9A 2R78A 1Y28A 3PXPA 3EOIA 3CAXA 2VA0A 4NXFA 4F3LA 1NLYA 1DP9A 2KLIA 4EESA 2L0WA 2D02A 2V1AA 1GSVA 4BBTA 1JNUA 3IS2A 5C5KA 2YKFA 3UE6A 2P08A 3PBTA 2J3TC 3NHQA 4GHIA 5DJTA 4IUHA 3VE4A 1F9IA 5G4ZA 3UMEA 1S1YA 3R7WB 4WF0A 2EWVA 2CMNA 1DP6A 4LPZA 4EU0A 2JKRM 3LI8A 3KSGA 4LRYC 4HHDA 2VGLM 1XJ4A 2W3DA 5HDDA 1W63Q 3SW1A 3FPWA 4MCWA 2O0YA 3UE3A 2O9BA 4L9FA 3W2ZA 3LIEA 1OJGA 4YNRA 3GECA 4IHQA 2PHYA 3CWFA 2B02A 3NOUC 4HOIA 4F3LB 2WKQA 1XFNA 3LR4A 5HL6A 5I5LA 1P0ZA 2V9AA 3H82A 4Y3IA 3TE8A 4CLCE 4R6LA 3T50A 2QJ5A 1N9OA 3A0VA 4GHIB 4PAUA 4WEKA 4WELA 5DF9A 4CLCA 3R4KA 3TW8A 1MZUA 3JVUA 2PD7A 3FG8A 3TRCA 4EQ1A 5HD3A 3BY8A 1N9NA 4CQHA 2QYBA 3OC2A 5HPIA 5F68A 3B42A 2GX5A 2W1TB 1UGUA 3HJIA 5J3WA 4RQ9A 4ARZA 2NUTC 4NXGA 1W63M 3D72A 1XJ6A 2JKRI 5HD5A 2P7JA 2XA7M 3LIFA 2ZOHA 2BASA 1TS8A 1X0OA 2G7UA 2O9CA 3BY9A 1LSVA 3GDIA 2OWJA 4LRZE 1TF1A 4Q0JA 3ZYTA 5HWVA 3F1PB 4FSFA 3UB8A 4R38A 2PDRA 3IBJA 3EQUA 3KX0X 3ULFA 3IBRA 4I38A 2V0WA 2P04A 1BYWA 2HGVA 4UQIS 5AVEA 4ZRRA 4P6ZM 3F1NA 1G6OA 1ODVA 5HDCA 2B18A 4NXBA 5MC7A 3F1OA 2ZOIA 3PHYA 4AFIA 3BQ8A 4PKYG 4G3KA 4JGRA 1LL8A 1GSWA 2EA9A 3UB6A 5TJJA 1F5MA 2VV8A 1TD5A 3OOVA 4G3WA 5A8BA 1S1ZA 2OAQ1 3P01A 2VKSA 4NKPA 4O01A 4EXOA 2MJ6A 3T4LA 4HQAA 1V9ZA 4ARZB 3VV4A 4GW9A 2PYPA 3K2NA 3O5YA 1DRMA 3HJKA 4MN7A 3JVVA 5AVFA 1MKMA 3BQAA 3MMHA 1IOUA 5DJUA 3OBFA 3MXQA 3LICA 1G28A 1LSXA 4WLAA 4R70A 4JGPA 5CX7A 2VGLS 1YSPA 2Z6DA 4H6JA 3MFXA 4ETXA 3F1NB 4WN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J80 A;  1OTA A;  3F1O B;  3OLO A;  1WA9 A;  2PR5 A;  3E4Q A;  2OWH A;  3MQO A;  4XT2 B;  1LSW A;  5F5Y A;  2I9V A;  3UB9 A;  4EER A;  2A24 B;  1OTI A;  2ZBB A;  4JGQ A;  4EW7 A;  3FC7 A;  4JGO A;  3PYP A;  4MN5 A;  2WKP A;  3F1P A;  5J4E A;  5HZH A;  2PD8 A;  3EWK A;  4H6J B;  5F69 A;  3MJQ A;  2Z6C A;  2K7S A;  3P7N A;  4EEU A;  1S66 L;  2INW A;  3LIA A;  3E4O A;  3K3D A;  4E04 A;  2JN7 A;  3H7W A;  4HY8 A;  3LUQ A;  1OTD A;  2W0N A;  1UWN X;  5HWW A;  4KUO A;  5HDS A;  4K08 A;  4LRX C;  2YKH A;  4HP9 A;  1EW0 A;  1S4R A;  4B9O A;  1T19 A;  1UWP X;  2VLG A;  2V0U A;  4EET B;  1GSX A;  2H28 A;  1TS0 A;  4XT2 A;  4I3A A;  3LIB A;  4KUK A;  2A24 A;  1D06 A;  3H7W B;  4I3J A;  2M1C A;  1T1A A;  3H9W A;  3EEH A;  2V1B A;  1KOU A;  4WL9 A;  1TS7 A;  1OTB A;  2OOL A;  1S4S A;  5KIZ A;  1VB6 A;  2KDK A;  4HH3 A;  2VV7 A;  4BBU A;  1N9L A;  2HV1 A;  5F6A A;  3A0S A;  1F98 A;  2PYR A;  3G6O A;  4BBV A;  1S67 L;  1XJ3 A;  5DKL A;  3K3C A;  4HNB A;  4HH2 A;  3VE3 A;  3RH8 B;  5HSQ A;  2QWS A;  2JHE A;  4R3A A;  1P97 A;  1XJ2 A;  3RTY A;  4MN6 A;  4PKY A;  3BWL A;  3MQQ A;  1T1B A;  5J7E A;  2PR6 A;  4I3I A;  1OJ5 A;  2QHK A;  1T1C A;  3ZQ5 A;  4M4X A;  1DP8 A;  1D7E A;  4WUJ A;  4GS9 B;  1XFQ A;  2D01 A;  2WKR A;  2L4R A;  4EEP A;  1OTE A;  3B33 A;  2QKP A;  4LLO B;  2VV6 A;  4NXE A;  3E4P A;  5HWT A;  4DJ2 A;  3IS2 B;  3LID A;  4GCZ A;  1LT0 A;  3A0R A;  3MR0 A;  4HJ3 A;  5G4Y A;  3NJA A;  4HI4 A;  5EFW A;  5IU1 A;  3VOL A;  3LI9 A;  4HP4 A;  5IS1 A;  3UMD A;  4YWZ A;  4L9G A;  1OT6 A;  5TBM A;  1V9Y A;  3CLO A;  4HJ4 A;  1OT9 A;  4L9E A;  2VEA A;  3H82 B;  3NOP C;  4I39 A;  2L1M A;  4I5S A;  2KX6 A;  4HIA A;  2QJ7 A;  1NWZ A;  1TS6 A;  3ICY A;  3C8C A;  2W27 A;  3C2W A;  4KQD A;  3LYX A;  4HJ6 A;  2GJ3 A;  3NOT C;  4DJ3 A;  5TBM B;  3UB7 A;  5DKK A;  1T18 A;  4GS9 A;  2R78 A;  1Y28 A;  3CAX A;  4NXF A;  4F3L A;  1DP9 A;  4EES A;  2L0W A;  2D02 A;  2V1A A;  1GSV A;  4BBT A;  1JNU A;  3IS2 A;  2YKF A;  3UE6 A;  3NHQ A;  4GHI A;  5DJT A;  3VE4 A;  1F9I A;  5G4Z A;  3UME A;  1S1Y A;  4WF0 A;  2CMN A;  1DP6 A;  4LPZ A;  3LI8 A;  4LRY C;  4HHD A;  1XJ4 A;  5HDD A;  3SW1 A;  4L9F A;  3LIE A;  1OJG A;  3GEC A;  2PHY A;  3CWF A;  2B02 A;  3NOU C;  4HOI A;  4F3L B;  2WKQ A;  1XFN A;  5I5L A;  1P0Z A;  2V9A A;  3H82 A;  4R6L A;  3T50 A;  2QJ5 A;  1N9O A;  3A0V A;  4GHI B;  1MZU A;  2PD7 A;  3FG8 A;  4EQ1 A;  5HD3 A;  3BY8 A;  1N9N A;  5F68 A;  1UGU A;  3HJI A;  5J3W A;  4RQ9 A;  4NXG A;  3D72 A;  1XJ6 A;  5HD5 A;  2P7J A;  3LIF A;  2ZOH A;  2BAS A;  1TS8 A;  1X0O A;  3GDI A;  3BY9 A;  1LSV A;  2OWJ A;  4LRZ E;  5HWV A;  3F1P B;  3UB8 A;  4R38 A;  2PDR A;  3KX0 X;  3ULF A;  3IBR A;  4I38 A;  2V0W A;  1BYW A;  5AVE A;  3F1N A;  1ODV A;  5HDC A;  4NXB A;  3F1O A;  2ZOI A;  3PHY A;  4PKY G;  4JGR A;  1LL8 A;  2EA9 A;  1GSW A;  3UB6 A;  2VV8 A;  5A8B A;  1S1Z A;  4EXO A;  4HQA A;  1V9Z A;  4GW9 A;  2PYP A;  1DRM A;  3HJK A;  5AVF A;  5DJU A;  3MXQ A;  3LIC A;  1LSX A;  1G28 A;  4WLA A;  4R70 A;  4JGP A;  2Z6D A;  4H6J A;  3MFX A;  3F1N B;  4WN5 A; 
#chains in the Genus database with same CATH topology
 4D60 A;  1K38 A;  3OLO A;  5CGW A;  1PZP A;  3C7U A;  5M19 A;  4IVK A;  1K54 A;  4NEE D;  5A91 A;  4GLQ A;  3MQO A;  1I2S A;  1FSY A;  2QMI A;  2I9V A;  3UB9 A;  2A24 B;  5FQQ A;  5HX9 A;  2V2F F;  2XF3 A;  2V20 A;  2ZBB A;  1BLC A;  3A3I A;  3FPV A;  3UPO A;  3Q81 A;  4EW7 A;  3HLE A;  5DFX A;  1K6R A;  4JGO A;  5CED A;  4PMA A;  2Y2N A;  3LR3 A;  4DXB A;  2PD8 A;  4H6J B;  2ZQA A;  4WZ5 A;  3MJQ A;  2Z6C A;  4PHT A;  1S66 L;  4JXW A;  4RVA A;  2VJW A;  3LIA A;  1W7F A;  3N6I A;  4LV3 A;  2EXB A;  1STZ A;  3ZGA B;  3A3E A;  3K3D A;  1MWR A;  1XP4 A;  4KEN B;  1K55 A;  5CGS A;  3MKF A;  2W0N A;  3SH9 A;  3T4Q A;  5HWW A;  4Z9Q A;  3AGD A;  4QWO A;  1GHM A;  5HDS A;  4R3J A;  1G68 A;  4K08 A;  2BTF P;  4KG2 A;  5E43 A;  3VP0 A;  3SH7 A;  3IHB A;  1YPR A;  1S4R A;  4ID4 A;  1OPX A;  1UWP X;  1E3U D;  4GDN A;  5EPH A;  1IFQ A;  3DTK A;  1GSX A;  1FOF A;  4I3A A;  4WZ5 C;  2W3G A;  3KYE A;  3LIB A;  2Z2M B;  1PIO A;  4DE0 A;  1H8Y A;  2A24 A;  2R9W A;  3ZNY A;  1FR1 A;  3TJZ C;  5FI7 A;  4KZ9 A;  4OLD A;  3HLW A;  4BWI A;  4OOM A;  3ZDJ A;  3ZCZ A;  2VK3 A;  3EGD C;  1HZO A;  5KMW A;  4IED A;  1OTB A;  4WYY A;  5KSH A;  1S4S A;  1E3U A;  5EM0 A;  3Q82 A;  4EQI A;  3GMW A;  4HH3 A;  3T4S A;  3NCK A;  4WMC A;  2HP9 A;  1M6K A;  4O8G A;  4UHU A;  2E8J A;  4FOF A;  2HV1 A;  2W3E A;  3A0S A;  4CPK A;  1EI5 A;  3NDE A;  3KYZ A;  3QP1 A;  3W4Q A;  5F1G A;  4HNB A;  4R23 A;  2DMW A;  1L2S A;  3VE3 A;  3RH8 B;  5EV0 A;  1E25 A;  2A49 A;  2Y2H A;  4OKP A;  2QWS A;  2JHE A;  5FEG A;  3C38 A;  4Y0T A;  3T1X A;  1LI0 A;  3MXS A;  3LY3 A;  1XJ2 A;  4MN6 A;  5AJG A;  3IWQ A;  3DWZ A;  2E8I A;  1T1B A;  5EUA A;  4DN0 A;  5J7E A;  3LEZ A;  4I3I A;  3CJM A;  3VSL A;  4YFM A;  1DP8 A;  4WUJ A;  4X68 A;  1OTE A;  1L0D A;  4Q8I A;  2VV6 A;  4NXE A;  3E4P A;  3OCN A;  5DF7 A;  1J3W A;  5HWT A;  1KE3 A;  4RX3 A;  4GCZ A;  1LT0 A;  3A0R A;  1CJF A;  5DVA A;  3MR0 A;  5G4Y A;  3BYD A;  3ITB A;  4HI4 A;  2OLU A;  5EFW A;  4OPY A;  5HAQ A;  4U0X A;  4BMW A;  1ES3 A;  3WRZ A;  1TDL A;  4L9G A;  4GKU A;  5TBM A;  2ZL1 A;  4EBP A;  2ZC4 B;  3CHW P;  2G2W A;  2XD5 A;  1YAX A;  3CLO A;  4ETZ A;  1IYP A;  1SDE A;  2PU4 A;  4LFU A;  4I39 A;  3V3S A;  2P74 A;  4KZB A;  4UA9 A;  4B4Z A;  4E6X A;  5CXW A;  4CLC B;  2EFX A;  1JWP A;  1G6A A;  1ES5 A;  4OVD A;  1RGY A;  3C2W A;  3N4I A;  4JXV A;  2V1Z A;  4BQM A;  2ZC6 B;  4HJ6 A;  2GJ3 A;  5IT5 A;  4Y2F A;  2DNS A;  3D3O A;  1ACF A;  5DTK A;  3SH8 A;  4ZTK A;  3DTI A;  3EOI A;  2VA0 A;  4HBU A;  1NLY A;  4OQ0 A;  4EES A;  4FH2 A;  2V1A A;  1PYY A;  4QB8 A;  5DJT A;  3IH8 A;  2V8C A;  1CK3 A;  3R7W B;  4LPZ A;  3O3V A;  4KZ8 A;  1H0M A;  2WUQ A;  2W3D A;  5EOO A;  3FPW A;  2O9B A;  2ZJ9 A;  3W2Z A;  4LV2 A;  1OJG A;  4KQR A;  3GEC A;  1FIL A;  3ITA A;  3NOU C;  4OH0 A;  5I5L A;  2A3U A;  3S22 A;  3BFF A;  3TE8 A;  4LV0 A;  3T50 A;  4X69 A;  2WAE A;  4UAA A;  1N9O A;  2J8Y A;  1K6S A;  2GDN A;  4K0W A;  3BM6 A;  4CLC A;  3V50 A;  1PRQ A;  3TRC A;  1SDN A;  2Y2L A;  3BY8 A;  1VEU B;  3IH9 A;  5AQ7 A;  4JXG A;  3ZG0 A;  4X55 A;  2RCX A;  2WGI A;  1KE0 A;  3JYI A;  3OPL A;  2JKR I;  3LIF A;  2BAS A;  1X0O A;  2G7U A;  4Q0J A;  1CEG A;  4LRZ E;  5M18 A;  3IF5 A;  3N8S A;  1ERQ A;  4WBG A;  3IBJ A;  3EQU A;  1PFL A;  2WAF A;  3ULF A;  2EFU A;  3F1N A;  1ODV A;  2X02 A;  4AFI A;  4X53 A;  1GSW A;  5TJJ A;  2X01 A;  2CC1 A;  5A8B A;  1MBL A;  3MFD A;  3HRE A;  3GVB A;  3LEQ A;  4QJG A;  4GW9 A;  1N9B A;  2XLN A;  3OPH A;  2HDS A;  2WZZ A;  1DRM A;  3HJK A;  4MN7 A;  5F82 A;  3QP8 A;  2WGV A;  4KZA A;  4C75 A;  1RGZ A;  4GN2 A;  3SS5 A;  2EX6 A;  4NK3 A;  1LI9 A;  4ETX A;  2XH9 A;  2AVX A;  1OTA A;  3F1O B;  2GZA A;  1FSW A;  1IKI A;  3W8K A;  1WA9 A;  2XRN A;  2OWH A;  3WS4 A;  4EER A;  2Y4A A;  4B93 A;  1ZKJ A;  3AGE A;  2Y2P A;  4JLF A;  4K0X A;  4P85 A;  5A90 A;  1NLZ A;  2WKP A;  3WS2 A;  3N8R A;  5EVI D;  3BEB A;  5HZH A;  2WGW B;  2QPN A;  4ZBE A;  4MBH A;  1BLP A;  5E2G A;  4EUV A;  2LB9 A;  4DF6 A;  3LR5 A;  2W1R A;  4DE2 A;  1YLZ A;  3E4O A;  3PBR A;  3WS5 A;  1L0G A;  4PM6 A;  3UDF A;  4E04 A;  4OLG A;  3ZVW A;  4EBL A;  1KDW A;  1Q2P A;  1DY6 A;  3BW6 A;  4FD8 A;  5EVI A;  4G3V A;  1YKD A;  3HUO A;  2Y2O A;  3IF6 A;  1SKF A;  2B95 A;  4LRX C;  3HCY A;  1XGI A;  2J9P A;  1EW0 A;  3E2K A;  3O88 A;  4B9O A;  5E2E A;  3ZG9 B;  3E0Y A;  2W3H A;  5HW3 A;  2ZC7 A;  2XDM A;  2VLG A;  2PT7 A;  2V0U A;  3BJN A;  4EET B;  3CIT A;  3ZG7 B;  4WZ4 A;  1IEL A;  3G31 A;  2OSU A;  4N1X A;  2H28 A;  3T1Q B;  2ZD8 A;  2RL3 A;  3GV9 A;  3KSH A;  4RX2 A;  4KUK A;  3RJU A;  1YT4 A;  4I3J A;  3DW0 A;  4N1H A;  1PNE A;  2EXA A;  1FIK A;  3B47 A;  3H9W A;  1BT5 A;  3EEH A;  5HAP A;  2JKT M;  1Q2Q A;  3E98 A;  4WL9 A;  2Q9N A;  2C5W B;  5GHX A;  4OP8 A;  5E2F A;  2EWW A;  3G2Y A;  1L3L A;  3CPT A;  3HBR A;  2WGW A;  3C7V A;  4Y0O A;  3C4P A;  5EVI C;  3IF6 C;  5LBR A;  4BD1 A;  5GHZ A;  2PYR A;  4BBV A;  1S67 L;  3K3C A;  1LL5 A;  4Y15 A;  3G2Z A;  1DJB A;  2OAP 1;  1Y54 A;  5HSQ A;  3BFE A;  4O0P A;  1JTD A;  1P97 A;  1EWZ A;  5FAP A;  1ERO A;  3IX3 A;  2IWB A;  5D3O A;  3U2A A;  3B3X A;  4PKY A;  5CRF A;  2O99 A;  4X25 A;  3BWL A;  4HBT A;  3MQQ A;  5EM1 A;  4KZ6 A;  1OJ5 A;  5FAQ A;  3S1Y A;  1T1C A;  4M4X A;  3RFB A;  1SKO A;  4UA7 A;  1VHM A;  2WK0 A;  2WKR A;  4KG5 A;  4PM7 A;  4E3J A;  4GD6 A;  5F1F A;  2Y55 A;  4N9K A;  4P6B A;  4S2I A;  4MDZ A;  5FAO A;  5EE8 A;  3GRJ A;  1VET A;  5FDH A;  5GLC A;  3LI9 A;  4OON A;  3C4O A;  1JWV A;  1NY0 A;  4HP4 A;  5IS1 A;  3VP2 A;  2A2L A;  3UMD A;  2ZQC A;  3LFV A;  3UB5 P;  1W8Y A;  5GLB A;  3LR0 A;  3PAE A;  2ZMV A;  2VEA A;  3S7O A;  2ZM8 A;  4JPM A;  5CGX A;  3O87 A;  4ZAM A;  2DCF A;  3V3R A;  2KX6 A;  2HDU A;  2J3W A;  4WM9 A;  3CI6 A;  3ICY A;  2H0T A;  3HLG A;  5GL9 A;  3LYX A;  4BEN A;  3PBQ A;  1NRF A;  1MWT A;  1KVL A;  5TBM B;  2XRO A;  2P9V B;  2ZL1 B;  2Q9M A;  4X6T A;  3MS6 A;  1PWD A;  3PXP A;  4F3L A;  3DTE A;  3IXD A;  5U47 A;  2JCH A;  4BBT A;  2XD1 A;  4GNU A;  1F9I A;  5G4Z A;  3UME A;  1S1Y A;  4WF0 A;  2CMN A;  1BUL A;  1DP6 A;  3DWK A;  2VGJ A;  4OQH A;  3S4X A;  1W63 Q;  4CJN A;  4MCW A;  1MXO A;  1W5D A;  3VOY A;  2Y91 A;  4IHQ A;  3ZG5 A;  2H5S A;  4R1G A;  1CEF A;  1XFN A;  4H8R A;  3LR4 A;  4UA6 A;  3E2L A;  1O7E A;  2QJ5 A;  4LCL A;  4A5R A;  2VGK A;  3TW8 A;  3JVU A;  4GB7 A;  1G5U A;  4LV1 A;  3LO7 A;  4PM8 A;  4MLL A;  5I94 A;  3B42 A;  2W1T B;  3HJI A;  1XKZ A;  3D72 A;  2P9V A;  1GCE A;  2XA7 M;  2OLV A;  2ZOH A;  2ZMA A;  3GDI A;  2O9C A;  1LSV A;  1SHV A;  3G32 A;  2FFF B;  3F1P B;  4R38 A;  3IBR A;  4I38 A;  2V0W A;  4N9L A;  1BYW A;  4KZ7 A;  4ZRR A;  4P6Z M;  5HDC A;  5HAR A;  2ZOI A;  2BLS A;  3IWI A;  1F5M A;  1TD5 A;  2Y2I A;  4G3W A;  4DE3 A;  2VKS A;  1J9M A;  3IX4 A;  1YLP A;  3VV4 A;  1E4D A;  1BTL A;  3DAV A;  3BQA A;  1ESU A;  1IOU A;  1PW8 A;  1HLU P;  4Y0U A;  3MXQ A;  3BFC A;  1K4E A;  3OZH A;  1G28 A;  1ALQ A;  1MKI A;  5CX7 A;  2WKE A;  1YSP A;  4O7D A;  3F1N B;  2Y2G A;  3TOI A;  4WN5 A;  4IUK A;  2J80 A;  4JKT A;  4WEJ A;  4EV4 A;  5CHJ A;  4QPR A;  3E4Q A;  3ISG A;  3T4O A;  3WWX A;  4DKI A;  3V39 A;  4XT2 B;  3VSK A;  1LSW A;  1Z09 A;  5F5Y A;  4EWF A;  4YOF A;  1K25 A;  2M7V A;  3UDI A;  2W1T A;  5DFY A;  4P0M A;  4JGQ A;  3PR6 A;  3FC7 A;  3M6H A;  3LCE A;  3WS0 A;  4ME4 A;  4DE1 A;  1MWU A;  1IYQ A;  4MN5 A;  3F1P A;  5J4E A;  3IXB A;  4HEF A;  5KSC A;  3Q1F A;  4GOG A;  4EEU A;  3P7N A;  1FQG A;  1ZTU A;  1Z6F A;  3T1S A;  3VOZ A;  2XA7 S;  4ZJ1 A;  1NYM A;  1DJA A;  1PI5 A;  5HL1 A;  3MZF A;  3HLB A;  3H7W A;  4HY8 A;  1H8M A;  5TGF A;  3LUQ A;  3HLC A;  3DTM A;  3OCL A;  1UWN X;  2DRW A;  4MMN A;  2WKH A;  4MBF A;  4U0T A;  4X1M A;  1ONH A;  4BJP A;  3LY4 A;  4HP9 A;  3T4T A;  1K4F A;  1KE4 A;  3N7W A;  5AQ9 A;  4YIN A;  3V5M A;  3BFG A;  5HPF A;  1TVF A;  2GNX A;  1H3Q A;  3IX8 A;  4RYE A;  2O9A A;  4XT2 A;  3M6B A;  3ZVT A;  4QY5 A;  4RA7 A;  3WRT A;  2FH5 A;  3FKV A;  1O07 A;  2V1B A;  4X56 A;  5EVI B;  1KOU A;  3IF6 B;  3D9Y A;  5FAS A;  4JF4 A;  3Q7V A;  3HUN A;  2OOL A;  4OPZ A;  5F83 A;  2PBD P;  5KIZ A;  5EEC A;  1VB6 A;  2KDK A;  4PPR A;  4DMZ A;  4OPQ A;  1K56 D;  5L8M A;  4S2L A;  1L0F A;  5CER A;  3EQV A;  2B5R A;  5F6A A;  1F98 A;  2XK1 A;  3G6O A;  3KSI A;  2W3F A;  1XJ3 A;  2K2N A;  3UPP A;  2K31 A;  3FZC A;  2J9O A;  4JXS A;  5HAI A;  1JTG A;  4XXR A;  1QME A;  2ACG A;  4Y5F A;  3T4K A;  3DBA A;  2HDQ A;  3ZNT A;  3VMA A;  1LHY A;  1MWS A;  2I72 A;  3CPT B;  3NY4 A;  5FQJ A;  3CUE C;  2PR6 A;  4DRT A;  2QHK A;  2UV0 E;  3UO9 A;  3IWO A;  1D7E A;  1XXM A;  1IYO A;  4GS9 B;  4Z1W A;  3T1R A;  1XFQ A;  2V8F A;  2D01 A;  2Y59 A;  3B33 A;  2QKP A;  1JVJ A;  4LLO B;  2HP6 A;  1I2W A;  4KQQ A;  1H8Z A;  1QMF A;  4GZB A;  3IS2 B;  4GD8 A;  4L0L A;  4HJ3 A;  4Q0I A;  3V67 A;  3P98 A;  4KQO A;  3MZE A;  5K5B A;  3NJA A;  1VQQ A;  5IU1 A;  3VOL A;  3SS4 A;  3AGF A;  3IT9 A;  3A3F A;  3NIA A;  4YWZ A;  1I5Q A;  4IJG A;  3S7P A;  3GR2 A;  1SKO B;  2XFT A;  1A0K A;  3CZD A;  4QY6 A;  3KSF A;  1IKG A;  3H82 B;  2ZC3 B;  2Y8H A;  4QU3 A;  3IXG A;  5DTT A;  2HJE A;  5GHY A;  3G35 A;  2L1M A;  3OPP A;  1NYY A;  3MF0 A;  4HIA A;  2XQZ A;  4E3N A;  5FA7 A;  1D1J A;  1NWZ A;  1KVM A;  1VET B;  2C6W B;  3C8C A;  3EEA A;  1BLS A;  1MPL A;  1JWZ A;  4PM9 A;  1BZA A;  4UQI M;  5TR7 A;  4PM5 A;  4DJ3 A;  4FH4 A;  3BEC A;  3UB7 A;  3IXH A;  4MEZ A;  4GS9 A;  2R78 A;  4R4R A;  2HP5 A;  3CAX A;  4NXF A;  1DP9 A;  2KLI A;  4OP5 A;  3PAG A;  3TSG A;  4K91 A;  3QNC A;  1WYB A;  3IS2 A;  5C5K A;  2YKF A;  3UE6 A;  4LGW A;  4GHI A;  4IUH A;  3NI9 A;  3NC8 A;  1N4O A;  2JKR M;  4FUW A;  3FYZ A;  4HHD A;  2VGL M;  1XJ4 A;  3L9K A;  5M1A A;  2Q0O A;  3SS3 A;  1DJC A;  5HDD A;  5TFQ A;  1YLT A;  1FCM A;  2Z2L B;  4L9F A;  3C5A A;  4E3I A;  4MNR A;  4FCF A;  1FR6 A;  4HES A;  1ZG4 A;  2HDR A;  4IVI A;  4F3L B;  4HOI A;  5JYO A;  5HL6 A;  2V9A A;  3H82 A;  4Y3I A;  4CLC E;  1SCW A;  3IQA A;  1L0E A;  3IHA A;  4R3B A;  1GHI A;  4WEK A;  4WEL A;  5DF9 A;  2PAV P;  3R4K A;  3W4P A;  2PD7 A;  4ZJ3 A;  3FG8 A;  1CI9 A;  1H5X A;  1N9N A;  2QYB A;  3OC2 A;  4XUX A;  5GLA A;  5F68 A;  1PWC A;  1UGU A;  5J3W A;  4OPR A;  4RQ9 A;  4ARZ A;  5CHU A;  1K54 C;  4NXG A;  5HD5 A;  1PI4 A;  2XR0 A;  1XGJ A;  4Y17 A;  3L7H A;  1KGF A;  1TS8 A;  2Y2Q A;  2X71 A;  2OWJ A;  3BLM A;  1CF0 A;  5IHV A;  3KX0 X;  1YMX A;  3ZG8 B;  2HGV A;  4UQI S;  1CQA A;  1G6O A;  1RCJ A;  2B18 A;  5CTM A;  4NXB A;  2WYX A;  5BOH A;  3PHY A;  3A3J A;  3TG9 A;  4WMC D;  4G3K A;  2BG1 A;  1LL8 A;  4EUZ A;  5KZH A;  3OOV A;  1WYC A;  4BL3 A;  4ESP A;  1S1Z A;  4NKP A;  4O01 A;  4EXO A;  2MJ6 A;  2ZC5 B;  4HQA A;  2PYP A;  5A93 A;  4MBK A;  4E3M A;  5FI6 A;  3BRM A;  1FCO A;  3MMH A;  5EVE A;  5DJU A;  2Y2K A;  3MBZ A;  1KGG A;  3LIC A;  1LSX A;  4WLA A;  1K55 C;  4R70 A;  5FSR A;  5L07 A;  1CI8 A;  2IWC A;  2VGL S;  2PRF A;  4H6J A;  3I7J A;  1ZG6 A;  2ZQ7 A;  2JC7 A;  2XSS A;  3VP4 A;  3PBO A;  4ZJ2 A;  2M7U A;  1HTZ A;  3GSG A;  2ZQ9 A;  2PR5 A;  3S7Q A;  3N8L A;  3GQZ A;  2Y79 A;  4II7 A;  2VX8 A;  3T12 B;  1OTI A;  3NBL A;  4GDB A;  3D4F A;  2HF6 A;  1HVB A;  3UY6 A;  3C30 A;  3PYP A;  3QP5 A;  3Q7Z A;  3W4O A;  1TEM A;  1GA0 A;  1K57 A;  3T4J A;  3KO6 A;  3EWK A;  5F69 A;  2K7S A;  2INW A;  5AQB A;  1AXB A;  5CHM A;  5HFO A;  4FTX A;  4Q0H A;  1NXY A;  1ES2 A;  2JN7 A;  2EX8 A;  2Y2J A;  1OTD A;  2JBF A;  4KUO A;  2NUP C;  2EX2 A;  1NRJ A;  5FQI A;  5DF8 A;  3HL9 A;  3FV7 A;  4S2K A;  2YKH A;  5FEF A;  2JE5 A;  1T19 A;  4OQG A;  3G30 A;  3PBS A;  4KG6 A;  1K57 C;  4D2O A;  1TS0 A;  5FDS A;  1ESI A;  3G4P A;  1D06 A;  2VZW A;  3H7W B;  2HJ9 C;  2M1C A;  2R9X A;  3VP1 A;  1T1A A;  5AQA A;  5FAT A;  2ZM2 A;  2H10 A;  3S7N A;  4ZDX A;  4S2J A;  1ZHH B;  5FQ9 A;  1YSQ A;  4KZ4 A;  1BLH A;  1TS7 A;  2JKF A;  4N92 A;  1IYS A;  3M2J A;  5EOE A;  3QHY A;  4M3K A;  2IA2 A;  2VV7 A;  4BBU A;  2FZ0 A;  4S2N A;  4X1L A;  2XGN A;  4EBN A;  4E3L A;  1NZO A;  1N9L A;  1GA9 A;  3MZD A;  4OOY A;  3VFF A;  4LEN A;  4DXC A;  5DKL A;  4Y13 A;  4HH2 A;  4C6Y A;  3ZHH A;  4QHC A;  1YM1 A;  4R3A A;  1LLB A;  2G2U A;  1U60 A;  5G18 A;  3Q7V B;  4OOL A;  3UN7 A;  4S2P A;  5E2H A;  1KDS A;  3RTY A;  4BL2 A;  1PWG A;  1C3B A;  3EGX C;  4CLC D;  4R0Q A;  2JKT I;  3CG5 A;  1Y4O A;  1P9R A;  3WS1 A;  3ZQ5 A;  1W79 A;  1MC0 A;  3P09 A;  5A92 A;  1P9W A;  3U4L P;  2L4R A;  4EEP A;  1ONG A;  1S6R A;  4S2N C;  2ZQD A;  2J3T D;  4P6Z S;  4DJ2 A;  3UNW A;  3VFH A;  3LID A;  3QNB A;  4JBF A;  4IBX A;  3A3D A;  3Q07 A;  1S0W A;  4IBR A;  2ZMF A;  1GHP A;  1HD8 A;  2ZLY A;  2KOI A;  5FI2 A;  4UEY A;  1YLW A;  1XX2 A;  3MQ0 A;  2LB5 A;  1OT6 A;  1M40 A;  2XFS A;  3OPR A;  1YLY A;  1V9Y A;  3QP6 A;  1BSG A;  4NG2 A;  4HJ4 A;  4P87 A;  3UE1 A;  1OT9 A;  4L9E A;  2EX9 A;  2J7V A;  4NET A;  2Y2M A;  3NOP C;  4S2M A;  1YLJ A;  3SOI A;  2OV5 A;  2ZQ8 A;  1PW1 A;  3CUE A;  4I5S A;  1PZO A;  3PBN A;  4GJ4 A;  4F94 A;  1SZV A;  3R7W A;  2QJ7 A;  3KYQ A;  2HZ5 A;  1TS6 A;  3FKW A;  3HLD A;  5CEC A;  5L2F A;  2W27 A;  4KQD A;  1NJ4 A;  3NOT C;  4CLC C;  5DKK A;  1T18 A;  5FL3 A;  3QP4 A;  1YMS A;  1Y28 A;  2XEP A;  1F2K A;  1W8Q A;  2JKG A;  1ERM A;  2L0W A;  2D02 A;  1GSV A;  1JNU A;  4KZ5 A;  2P08 A;  3PBT A;  2J3T C;  3NHQ A;  2QZ6 A;  2WAD A;  3VE4 A;  2EWV A;  4E3K A;  3BFD A;  4BLM A;  4EU0 A;  1K56 A;  3LI8 A;  4LRY C;  3KSG A;  1VEU A;  5J8X A;  1VM1 A;  4S2O A;  1TDG A;  3M2K A;  5FQK A;  2H0Y A;  3SW1 A;  4XUZ A;  2O0Y A;  3UE3 A;  3MSH A;  2WKI A;  3MKE A;  5DTS A;  1FCN A;  3LIE A;  4JF5 A;  5L10 A;  4YNR A;  1YQS A;  3RXW A;  4E3O A;  2PHY A;  2IWD A;  3CWF A;  2B02 A;  5FQM A;  1IEM A;  3RXX A;  2WKQ A;  5EVL A;  1P0Z A;  3QP2 A;  4R6L A;  3LGO A;  4JF6 A;  1ZC2 A;  3A0V A;  4GHI B;  3NDG A;  4PAU A;  2UWX A;  3NEC A;  4QD4 A;  3CMZ A;  3O86 A;  1MZU A;  1NZU A;  1LL9 A;  4EQ1 A;  5HD3 A;  3NUL A;  1RP5 A;  4CQH A;  5HPI A;  4B88 A;  4BD0 A;  2GX5 A;  2ZM0 A;  1XA1 A;  3VP3 A;  1XPB A;  2NUT C;  1W63 M;  1XJ6 A;  5GLD A;  4U3T A;  2P7J A;  4DDS A;  3UDX A;  3MXR A;  1ES4 A;  3HUM A;  3ZYT A;  3BY9 A;  1TF1 A;  1KGE A;  3BLS A;  5HWV A;  1BUE A;  1XA7 A;  4FSF A;  3UB8 A;  2PDR A;  4E6W A;  5JYP A;  3PTE A;  3SZT A;  4OQI A;  3G34 A;  1MY8 A;  2PBY A;  3JPU A;  3FWL A;  2P04 A;  4KZ3 A;  5AVE A;  4B4X A;  5MC7 A;  4R4S A;  3F1O A;  3BQ8 A;  2WZX A;  4PKY G;  4JGR A;  2EA9 A;  3UB6 A;  2VV8 A;  2PU2 A;  1OME A;  1K0K A;  4LCM A;  2OAQ 1;  3P01 A;  5CTN A;  3UE0 A;  3UPN A;  3ZFZ A;  3T4L A;  1AWI A;  2FFY A;  1WE4 A;  2HPB A;  1V9Z A;  4ARZ B;  3HLF A;  4DDY A;  5CEB A;  3K2N A;  3O5Y A;  3JVV A;  5AVF A;  3GTC A;  1MKM A;  3OBF A;  3HVF A;  5L09 A;  4JGP A;  4C3Q A;  2Z6D A;  3MFX A;  4Y7P A; 
#chains in the Genus database with same CATH homology
 4IUK A;  2XSS A;  2J80 A;  1OTA A;  3F1O B;  2GZA A;  3OLO A;  3PBO A;  1WA9 A;  4WEJ A;  2M7U A;  2XRN A;  2PR5 A;  4NEE D;  4QPR A;  3E4Q A;  3S7Q A;  3T4O A;  2Y79 A;  4GLQ A;  2OWH A;  4II7 A;  3MQO A;  2VX8 A;  4XT2 B;  1LSW A;  5F5Y A;  2I9V A;  3UB9 A;  4YOF A;  4EER A;  2A24 B;  1OTI A;  2M7V A;  2W1T A;  5DFY A;  4B93 A;  2ZBB A;  3FPV A;  4JGQ A;  4EW7 A;  3PR6 A;  3FC7 A;  2HF6 A;  5DFX A;  3C30 A;  4JGO A;  3PYP A;  4ME4 A;  1NLZ A;  4MN5 A;  2WKP A;  3F1P A;  5J4E A;  5HZH A;  3T4J A;  3LR3 A;  3KO6 A;  2PD8 A;  3EWK A;  4H6J B;  5F69 A;  4EUV A;  3MJQ A;  2LB9 A;  2K7S A;  2Z6C A;  3P7N A;  4PHT A;  4EEU A;  1S66 L;  1ZTU A;  2INW A;  3LR5 A;  2W1R A;  2VJW A;  2XA7 S;  3LIA A;  3E4O A;  3PBR A;  1STZ A;  4Q0H A;  3K3D A;  4E04 A;  2JN7 A;  3H7W A;  4HY8 A;  1H8M A;  3LUQ A;  1OTD A;  2W0N A;  3OCL A;  1UWN X;  3T4Q A;  5HWW A;  4KUO A;  3BW6 A;  4MMN A;  2NUP C;  5HDS A;  4G3V A;  1YKD A;  4K08 A;  1NRJ A;  4LRX C;  3HCY A;  2YKH A;  4BJP A;  4HP9 A;  3T4T A;  1EW0 A;  1S4R A;  4B9O A;  3E0Y A;  2W3H A;  1OPX A;  1T19 A;  1UWP X;  2VLG A;  2PT7 A;  2V0U A;  3BJN A;  4EET B;  3CIT A;  3PBS A;  1IFQ A;  5HPF A;  2GNX A;  1GSX A;  1H3Q A;  2H28 A;  1TS0 A;  2O9A A;  4XT2 A;  4I3A A;  2W3G A;  3LIB A;  3KSH A;  4KUK A;  2A24 A;  1D06 A;  2VZW A;  3H7W B;  2HJ9 C;  2M1C A;  4I3J A;  3TJZ C;  1T1A A;  2FH5 A;  3B47 A;  3H9W A;  3EEH A;  4BWI A;  4OOM A;  3S7N A;  2V1B A;  3EGD C;  2JKT M;  1KOU A;  3E98 A;  4WL9 A;  1ZHH B;  1YSQ A;  1TS7 A;  1OTB A;  2OOL A;  5KSH A;  1S4S A;  5KIZ A;  2EWW A;  1VB6 A;  2KDK A;  4HH3 A;  4DMZ A;  3T4S A;  2IA2 A;  5L8M A;  4O8G A;  2VV7 A;  4BBU A;  2FZ0 A;  5LBR A;  3EQV A;  4FOF A;  1N9L A;  2HV1 A;  5F6A A;  2W3E A;  3A0S A;  1F98 A;  2PYR A;  3G6O A;  3KSI A;  3KYZ A;  4BBV A;  2W3F A;  1S67 L;  1XJ3 A;  2K2N A;  2K31 A;  3K3C A;  4HNB A;  5DKL A;  4HH2 A;  2DMW A;  3VE3 A;  3RH8 B;  4Y5F A;  2OAP 1;  3T4K A;  5HSQ A;  2QWS A;  2JHE A;  4O0P A;  4R3A A;  3C38 A;  3DBA A;  1P97 A;  4OOL A;  1XJ2 A;  3U2A A;  3RTY A;  4MN6 A;  4PKY A;  2O99 A;  3BWL A;  5AJG A;  3EGX C;  3MQQ A;  4CLC D;  1T1B A;  4DN0 A;  5J7E A;  3CUE C;  2PR6 A;  2JKT I;  4I3I A;  1OJ5 A;  2QHK A;  1P9R A;  1T1C A;  3ZQ5 A;  4M4X A;  1DP8 A;  1MC0 A;  1D7E A;  4WUJ A;  3RFB A;  4GS9 B;  4Z1W A;  1VHM A;  1XFQ A;  1P9W A;  2D01 A;  2WKR A;  2L4R A;  4EEP A;  1OTE A;  3B33 A;  2QKP A;  4LLO B;  2VV6 A;  4NXE A;  2J3T D;  3E4P A;  3OCN A;  5HWT A;  4P6Z S;  4DJ2 A;  3IS2 B;  3LID A;  4GCZ A;  1LT0 A;  3A0R A;  4L0L A;  3MR0 A;  4HJ3 A;  4MDZ A;  4Q0I A;  3V67 A;  4KQO A;  2ZMF A;  5G4Y A;  5K5B A;  3NJA A;  4HI4 A;  2KOI A;  5EFW A;  5IU1 A;  3VOL A;  3LI9 A;  4BMW A;  4UEY A;  3MQ0 A;  4HP4 A;  5IS1 A;  2A2L A;  2LB5 A;  3UMD A;  4YWZ A;  4IJG A;  4L9G A;  1OT6 A;  5TBM A;  3S7P A;  3LFV A;  1V9Y A;  1YAX A;  3LR0 A;  3CLO A;  4HJ4 A;  4ETZ A;  1OT9 A;  4L9E A;  2ZMV A;  2VEA A;  3KSF A;  3H82 B;  3S7O A;  2Y8H A;  3NOP C;  4I39 A;  2HJE A;  2L1M A;  4I5S A;  3CUE A;  2KX6 A;  3PBN A;  4GJ4 A;  3MF0 A;  4HIA A;  2J3W A;  4CLC B;  3R7W A;  2QJ7 A;  3KYQ A;  1NWZ A;  3CI6 A;  1TS6 A;  3ICY A;  3C8C A;  3EEA A;  2W27 A;  3C2W A;  4KQD A;  3LYX A;  4UQI M;  3PBQ A;  4HJ6 A;  2GJ3 A;  3NOT C;  4DJ3 A;  5IT5 A;  4Y2F A;  4CLC C;  5TBM B;  3D3O A;  3UB7 A;  2XRO A;  5DKK A;  1T18 A;  5FL3 A;  4GS9 A;  2R78 A;  1Y28 A;  3PXP A;  3EOI A;  3CAX A;  2VA0 A;  4NXF A;  4F3L A;  1NLY A;  1DP9 A;  2KLI A;  4EES A;  2L0W A;  2D02 A;  2V1A A;  1GSV A;  4BBT A;  1JNU A;  3IS2 A;  5C5K A;  2YKF A;  3UE6 A;  2P08 A;  3PBT A;  2J3T C;  3NHQ A;  4GHI A;  5DJT A;  4IUH A;  3VE4 A;  1F9I A;  5G4Z A;  3UME A;  1S1Y A;  3R7W B;  4WF0 A;  2EWV A;  2CMN A;  1DP6 A;  4LPZ A;  4EU0 A;  2JKR M;  3LI8 A;  3KSG A;  4LRY C;  4HHD A;  2VGL M;  1XJ4 A;  2W3D A;  5HDD A;  1W63 Q;  3SW1 A;  3FPW A;  4MCW A;  2O0Y A;  3UE3 A;  2O9B A;  4L9F A;  3W2Z A;  3LIE A;  1OJG A;  4YNR A;  3GEC A;  4IHQ A;  2PHY A;  3CWF A;  2B02 A;  3NOU C;  4HOI A;  4F3L B;  2WKQ A;  1XFN A;  3LR4 A;  5HL6 A;  5I5L A;  1P0Z A;  2V9A A;  3H82 A;  4Y3I A;  3TE8 A;  4CLC E;  4R6L A;  3T50 A;  2QJ5 A;  1N9O A;  3A0V A;  4GHI B;  4PAU A;  4WEK A;  4WEL A;  5DF9 A;  4CLC A;  3R4K A;  3TW8 A;  1MZU A;  3JVU A;  2PD7 A;  3FG8 A;  3TRC A;  4EQ1 A;  5HD3 A;  3BY8 A;  1N9N A;  4CQH A;  2QYB A;  3OC2 A;  5HPI A;  5F68 A;  3B42 A;  2GX5 A;  2W1T B;  1UGU A;  3HJI A;  5J3W A;  4RQ9 A;  4ARZ A;  2NUT C;  4NXG A;  1W63 M;  3D72 A;  1XJ6 A;  2JKR I;  5HD5 A;  2P7J A;  2XA7 M;  3LIF A;  2ZOH A;  2BAS A;  1TS8 A;  1X0O A;  2G7U A;  2O9C A;  3BY9 A;  1LSV A;  3GDI A;  2OWJ A;  4LRZ E;  1TF1 A;  4Q0J A;  3ZYT A;  5HWV A;  3F1P B;  4FSF A;  3UB8 A;  4R38 A;  2PDR A;  3IBJ A;  3EQU A;  3KX0 X;  3ULF A;  3IBR A;  4I38 A;  2V0W A;  2P04 A;  1BYW A;  2HGV A;  4UQI S;  5AVE A;  4ZRR A;  4P6Z M;  3F1N A;  1G6O A;  1ODV A;  5HDC A;  2B18 A;  4NXB A;  5MC7 A;  3F1O A;  2ZOI A;  3PHY A;  4AFI A;  3BQ8 A;  4PKY G;  4G3K A;  4JGR A;  1LL8 A;  1GSW A;  2EA9 A;  3UB6 A;  5TJJ A;  1F5M A;  2VV8 A;  1TD5 A;  3OOV A;  4G3W A;  5A8B A;  1S1Z A;  2OAQ 1;  3P01 A;  2VKS A;  4NKP A;  4O01 A;  4EXO A;  2MJ6 A;  3T4L A;  4HQA A;  1V9Z A;  4ARZ B;  3VV4 A;  4GW9 A;  2PYP A;  3K2N A;  3O5Y A;  1DRM A;  3HJK A;  4MN7 A;  3JVV A;  5AVF A;  1MKM A;  3BQA A;  3MMH A;  1IOU A;  5DJU A;  3OBF A;  3MXQ A;  3LIC A;  1G28 A;  1LSX A;  4WLA A;  4R70 A;  4JGP A;  5CX7 A;  2VGL S;  1YSP A;  2Z6D A;  4H6J A;  3MFX A;  4ETX A;  3F1N B;  4WN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...