4EXOA

Revised, rerefined crystal structure of pdb entry 2qhk, methyl accepting chemotaxis protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
AELVRDRQELIDARKKELKAYMMMGVTAIKPLYDSDVNGSNKQAAKEILKAMRFESDGYFFAYDSQGINTLHAIKPSLEGKNLYDLKDENGVAVIAGLIDASQKGDGFLYFSWHKPTINAQAPKLGYAEYLQKWDWVLGTGIYIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title Structure and Proposed Mechanism for the pH-Sensing Helicobacter pylori Chemoreceptor TlpB.
pubmed doi rcsb
source organism Vibrio parahaemolyticus
total genus 49
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2012-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4exoA00
4NXFA 2W0NA 3BY8A 1GSVA 2P7JA 2J80A 3C8CA 4EEUA 2VV6A 2EA9A 1F98A 1N9NA 1VB6A 1T1AA 4DJ2A 2QJ5A 2QJ7A 1JNUA 3H7WA 4F3LB 2PDRA 4EETB 2QKPA 1V9ZA 5DJTA 1LSVA 1LSWA 3H7WB 2R78A 4MN6A 4BBTA 3D72A 4NXEA 1N9LA 2L0WA 4EXOA 1UWPX 2CMNA 1OJGA 4BBUA 5KIZA 2Z6CA 5HDCA 1MZUA 4LRYC 2B02A 1GSWA 4HJ3A 2W27A 2HV1A 3F1NA 2OWHA 4WUJA 5HD3A 3LIBA 3BWLA 2VLGA 1XJ2A 3ULFA 5HWTA 3F1NB 4YWZA 2VV8A 4EESA 2ZBBA 5G4YA 2PYRA 3MQQA 4EQ1A 3C2WA 3LIAA 3UB7A 5HSQA 1DP9A 5AVFA 5IS1A 2QHKA 3RH8B 4XT2B 5HDSA 4HJ6A 1XJ4A 1T18A 3EEHA 1DP8A 1D06A 5AVEA 4DJ3A 3VOLA 3F1PB 3NJAA 1OTEA 1TS6A 1X0OA 2V0UA 3E4PA 5DKLA 3OLOA 2GJ3A 2V1AA 2JHEA 1WA9A 1D7EA 3IBRA 3E4QA 4PKYG 3ICYA 4I3AA 5F69A 2D02A 1TS8A 5J4EA 2ZOHA 3GDIA 1OTAA 1OTDA 1S4SA 3LICA 2M1CA 2WKRA 5F6AA 1V9YA 4F3LA 3LIEA 1XJ3A 2D01A 4NXBA 3KX0X 1S67L 1OTBA 1EW0A 3F1OA 2PR6A 1UGUA 3LIFA 3G6OA 2PD8A 3F1OB 3NHQA 4I38A 4WL9A 4R70A 5F5YA 3H82A 3UMDA 5HZHA 4GS9B 4EEPA 1N9OA 3VE3A 1LSXA 2OWJA 3RTYA 4L9FA 3H82B 3NOPC 2PR5A 1LL8A 1P0ZA 3LI9A 5F68A 1S1YA 2YKFA 1F9IA 5I5LA 3BY9A 3MJQA 4M4XA 3GECA 4HP9A 1TS7A 5J7EA 4JGOA 2VV7A 1ODVA 3FG8A 3LUQA 4KUKA 1BYWA 4I39A 2L1MA 4GW9A 3EWKA 4XT2A 1G28A 4HY8A 3HJIA 2WKPA 4BBVA 3F1PA 2JN7A 4JGRA 4LRZE 2YKHA 4L9GA 2PD7A 4HH3A 2KX6A 3E4OA 4WLAA 1DRMA 1S66L 4R3AA 1UWNX 4I5SA 1DP6A 3CLOA 5G4ZA 5J3WA 3UE6A 4B9OA 2ZOIA 3K3CA 1OTIA 2K7SA 3UB9A 5IU1A 2V1BA 4L9EA 4HOIA 5A8BA 4NXGA 1S1ZA 1TS0A 3A0RA 1OT9A 3NOTC 4GCZA 4LPZA 4EW7A 2OOLA 1OJ5A 3MR0A 4HHDA 4HQAA 4GS9A 3PYPA 3VE4A 3IS2A 5HWVA 3A0VA 2I9VA 4HIAA 4JGPA 3IS2B 1XJ6A 4JGQA 2WKQA 4WF0A 4KQDA 2PYPA 4MN5A 3UMEA 3HJKA 2QWSA 3ZQ5A 4KUOA 2BASA 3FC7A 4E04A 3MXQA 4WN5A 1KOUA 3LYXA 4HNBA 2V9AA 5DJUA 1OT6A 4PKYA 5HDDA 3MFXA 1S4RA 4I3IA 2VEAA 4R6LA 3A0SA 3H9WA 1XFQA 3MQOA 5EFWA 4EERA 3LI8A 2KDKA 1GSXA 4LRXC 1NWZA 5HD5A 3LIDA 5TBMA 2H28A 3CWFA 4H6JA 1Y28A 2A24A 3UB8A 3K3DA 1P97A 5TBMB 3SW1A 4H6JB 2L4RA 3B33A 1T1CA 2A24B 4HH2A 4GHIA 3CAXA 2PHYA 3NOUC 3UB6A 2V0WA 4HJ4A 4LLOB 3P7NA 4GHIB 5DKKA 4I3JA 3PHYA 4RQ9A 4HI4A 4R38A 1T19A 2Z6DA 1XFNA 4K08A 1T1BA 5HWWA 1LT0A 4HP4A 2INWA 3T50A
chains in the Genus database with same CATH superfamily
1ZKJA 1FCNA 2ZMFA 1G6OA 1NJ4A 1LI9A 1FR6A 3BY8A 1VETA 2E8IA 1K56A 3GVBA 4FTXA 4OLGA 2P7JA 3LEQA 2QZ6A 1Q2PA 2J80A 5F83A 2V1ZA 1K4EA 1RCJA 4EBNA 2EA9A 1TDLA 3BFDA 3UN7A 3IX4A 3WWXA 3IHAA 2HZ5A 4GD6A 1YSPA 3ITBA 3WS1A 4S2NC 2WZZA 3IXHA 1LSVA 2Y2MA 1LSWA 3TOIA 3KYZA 1MWSA 1ESUA 4X1LA 1AXBA 2VGKA 3R4KA 4WEKA 4BBTA 3PBSA 5E2HA 4E3MA 3HLEA 1PFLA 4Y3IA 3VOZA 4HEFA 3KSGA 5FASA 1KE4A 1OJGA 2B5RA 2IWCA 2XDMA 2Z6CA 5G18A 4KZ8A 2DRWA 3WRZA 2ZM0A 4HJ3A 2XSSA 1ERQA 4WUJA 5FEFA 1KGFA 1XJ2A 2H5SA 1QMEA 4C3QA 1MKMA 3GMWA 2VV8A 4EESA 1I2SA 4Q0JA 4ZRRA 1BZAA 4Q8IA 3BFEA 4KG5A 1NZOA 3S7QA 4LCMA 1K38A 1EROA 4Y13A 2H0TA 2DMWA 3LFVA 3C30A 4CQHA 5M18A 3E98A 4BD0A 3DW0A 1H5XA 2O9BA 4XUXA 1PW1A 4S2IA 5CGWA 5AVEA 5HAQA 2R9WA 3VOLA 5FSRA 3OZHA 3PTEA 1OTEA 1TS6A 1X0OA 4Y17A 5L07A 4B93A 2JHEA 4JKTA 3HLDA 3P98A 1ZC2A 3DTKA 5EOEA 1EI5A 3IBRA 4I3AA 3ZG7B 2X01A 1H0MA 1OTDA 3G35A 3LICA 5DTKA 3UB5P 4X69A 1V9YA 3E0YA 3P01A 3TE8A 4B88A 2HDUA 1I5QA 1PNEA 4PM6A 2Q0OA 4WZ4A 4DXCA 3NULA 1EW0A 4DMZA 3Q1FA 1UGUA 3G6OA 2PD8A 1PI5A 4IUKA 4I38A 2H0YA 5FATA 5DTSA 1SKOB 1GCEA 2ZL1B 1KGEA 3UMDA 5HZHA 2PU2A 4EEPA 3VE3A 4ZAMA 1LSXA 1YLJA 5AJGA 5HFOA 3GQZA 5EPHA 2EFUA 3K2NA 3VSLA 4BMWA 1KDSA 2HP6A 3PBRA 2ZM2A 1HD8A 3BY9A 5L2FA 1KVLA 3IX3A 5EV0A 5FQJA 2O9CA 2Q9NA 2ACGA 3FG8A 1XKZA 2ZQ8A 4KUKA 1BYWA 4I39A 5FQKA 3S7NA 4GW9A 4ZJ1A 4JLFA 3TJZC 3VP4A 1IOUA 4IVKA 3T4SA 3ZG0A 5E2EA 1L0DA 3S4XA 3I7JA 3F1PA 3HUOA 1L0EA 4IJGA 2WAFA 3PR6A 4R0QA 2YKHA 3ZYTA 1LL5A 2PD7A 3MQ0A 4L9GA 5CHUA 4E3LA 3E4OA 1U60A 5HL6A 4BWIA 1ES5A 2P9VB 3NECA 1S66L 2W3EA 2XF3A 1UWNX 2VA0A 5HAIA 3S7OA 3ZG8B 1SDEA 1XPBA 2XD1A 2Y2HA 2PU4A 2M7VA 4DE2A 2ZQCA 3O88A 3OBFA 3DTEA 5HW3A 4IUHA 3D4FA 5KSHA 2Y2KA 2H10A 2K7SA 1W8YA 3UB9A 3OPLA 4L0LA 2Q9MA 4KZBA 4HOIA 2Y4AA 1PYYA 3QP1A 2VK3A 3NOTC 4QY5A 4R3JA 2OOLA 3ZHHA 2RCXA 1VM1A 4HHDA 4BQMA 3PYPA 4P0MA 4OVDA 4OLDA 5CX7A 4UAAA 3HLFA 3UO9A 4ETZA 3EQVA 3ITAA 4JGPA 3VFHA 4Y0UA 3HBRA 1ZHHB 1XJ6A 4JGQA 2WKQA 3CPTA 2FFYA 2JKTM 3T1QB 2OLUA 5DVAA 3HJKA 2QWSA 3BQ8A 2ZC4B 3FC7A 3W4QA 4E04A 2Y79A 3A3IA 2ZC5B 4WN5A 4S2MA 2V9AA 1PWGA 3KSIA 2VJWA 3GSGA 1JWVA 4MBHA 4I3IA 1YPRA 3N4IA 3A0SA 1JWZA 1XFQA 4YNRA 2G2UA 1XGIA 4EERA 5C5KA 1ZG6A 3PBOA 1L2SA 1ALQA 1GSXA 4LRXC 1F5MA 2Y2GA 4JXWA 2H28A 3G2YA 5KZHA 1KGGA 1Y28A 3MKEA 3PBNA 4MBFA 1HVBA 1FQGA 5TBMB 1LL9A 3IH8A 4WZ5A 2BTFP 2ZMVA 5CHJA 3V67A 2L4RA 4KZ3A 5D3OA 1T1CA 2XQZA 2NUPC 3CAXA 5FQ9A 3P7NA 2XROA 4I3JA 4RA7A 4IBXA 3PHYA 4GN2A 1T19A 4QY6A 3IXGA 4HESA 4N9LA 2W3GA 3C5AA 4Q0HA 1LT0A 4LGWA 2XGNA 3OPHA 1ES2A 2EWVA 5L10A 4GNUA 5EVIA 3B3XA 1LI0A 4KQQA 4NXFA 2W0NA 4DF6A 1GSVA 4O01A 4KZ9A 5EVID 2HF6A 2GDNA 3C8CA 4EEUA 2WGVA 1SCWA 1JVJA 4IVIA 2RL3A 4PMAA 2VV6A 3G34A 1F98A 3UDIA 1VB6A 4DDSA 1ES3A 4IHQA 3AGEA 3E2LA 2PDRA 3R7WA 4EETB 4PPRA 4X68A 4X1MA 3H7WB 4NEED 4MN6A 2FZ0A 3SS4A 1VEUB 3D72A 4NXEA 3ZG5A 4FSFA 2L0WA 4EXOA 4UQIM 2XRNA 2HGVA 4QB8A 4BBUA 5KIZA 5CECA 4LRYC 2B02A 3LY3A 2W27A 3EEAA 3BWLA 3ULFA 3V3RA 1LLBA 3F1NB 4YOFA 4KZAA 1YKDA 5A91A 1Q2QA 2ZBBA 2PBDP 1OPXA 1H3QA 1TF1A 3SOIA 3LIAA 4B4XA 2JBFA 4Y7PA 2EX9A 4KQRA 1DP9A 5IS1A 4N1XA 3KYEA 3CI6A 4K0XA 4Z9QA 1KVMA 1P9RA 2OAP1 4QWOA 3FKVA 4FOFA 1IYSA 4HJ6A 4N1HA 1XJ4A 2V8CA 3OPPA 4IEDA 3G32A 2W1RA 1FIKA 4DJ3A 3F1PB 2A49A 3OLOA 2V1AA 2W3HA 4XUZA 5F1FA 3G31A 3PAEA 1YLPA 1YMSA 1EWZA 4EUZA 4G3KA 3IF6A 3CG5A 5J4EA 4MMNA 3OCLA 1YMXA 5DF8A 1S4SA 1ESIA 4EU0A 2M1CA 1XXMA 1XX2A 4OPRA 1MPLA 3BECA 4UA7A 4F3LA 3LIEA 4MEZA 3MXSA 4KZ7A 1DY6A 4OPZA 3NC8A 1S67L 4RX3A 1J9MA 3HLBA 3ZG9B 4S2OA 3O5YA 2J3TD 5M19A 2C5WB 2VGLM 3F1OB 1YM1A 5L09A 4UQIS 5F5YA 5FI7A 1BULA 3SS3A 1PIOA 1W8QA 4DN0A 1O07A 1NY0A 1N9OA 2X71A 4JXGA 4D2OA 2OWJA 3S22A 4L9FA 3FV7A 3H82B 2ZQDA 3Q81A 2JKFA 3UPPA 3N8RA 2WKEA 5CEBA 2PR5A 1LL8A 3CPTB 4MN7A 2Y55A 3L9KA 1F9IA 2LB5A 3NDGA 1IYQA 3FKWA 2HPBA 2HJEA 2O0YA 1FILA 2EXAA 3DWKA 2QPNA 4LFUA 2WK0A 4X56A 3PBTA 1CI8A 2W3DA 4BENA 3LR5A 2WGWA 3EWKA 3W2ZA 1W7FA 1KE3A 3AGFA 4R1GA 4OQGA 4R4RA 1MXOA 2J3WA 5I94A 3NIAA 2KX6A 4CLCD 1BSGA 3T1XA 5GL9A 4R3AA 2DCFA 5EOOA 3JPUA 3CLOA 2WAEA 1XA1A 5FDSA 5G4ZA 3LR3A 2J8YA 3ZCZA 1E4DA 2JKTI 4KG6A 3Q7VB 1STZA 3UE3A 3SZTA 3ZFZA 4OQHA 4KZ5A 4Y0TA 1M40A 4B9OA 4OOMA 4QPRA 4P85A 4GDNA 2JCHA 4CLCE 2V1BA 3IF5A 1Y4OA 4NXGA 1K57C 1S1ZA 2X02A 4DDYA 3SH9A 3W4OA 1MWUA 3W8KA 4GCZA 2W1TA 4EW7A 4H8RA 4UHUA 4WZ5C 3T4OA 3MR0A 2VGLS 2ZMAA 4GS9A 4FD8A 4PM8A 3VE4A 3IS2A 3OC2A 4HIAA 4R4SA 5FEGA 1SDNA 4E6WA 4WMCA 4ARZB 3UNWA 1BLSA 4KQDA 3N7WA 4MN5A 2OV5A 2V2FF 5HAPA 3ZQ5A 4KUOA 2BASA 4ZBEA 4WMCD 1CK3A 2Y8HA 4UA9A 1S4RA 2VEAA 4R6LA 3IHBA 4MDZA 3RJUA 1Z09A 3IXDA 3JYIA 1ERMA 4OPQA 5EVIC 1IEMA 1GHPA 3BFFA 1NXYA 5TFQA 5HD5A 4OQIA 3BW6A 3CWFA 3HLGA 1JTGA 3HUMA 2A24A 1CI9A 4H6JB 4JBFA 4K0WA 1K0KA 1XP4A 5GHYA 3NBLA 4HH2A 2J9OA 4K91A 5AQBA 1YT4A 3B42A 3NOUC 3UB6A 3VSKA 4HJ4A 1NLYA 2Z2LB 1BLHA 4GHIB 4Y2FA 5BOHA 4HI4A 3JVUA 4R38A 3MZFA 4U0XA 2Y2JA 1GA9A 4K08A 5TR7A 4OKPA 4E3OA 3QP4A 3TG9A 2ZQ7A 1PW8A 4JXSA 4KZ6A 4CJNA 4RX2A 1NZUA 3B47A 4EWFA 3WRTA 2Y2NA 4GZBA 1HTZA 4JPMA 3IX8A 3VP2A 2FFFB 5FQQA 3VFFA 2K2NA 5HPFA 1VETB 2IWBA 4D60A 3CJMA 1T1AA 2QJ5A 1H8MA 3AGDA 4EUVA 2EXBA 4RYEA 4F3LB 1E25A 5EVLA 1LHYA 4U0TA 2R78A 5HL1A 3TSGA 3QP2A 4QHCA 3VOYA 1UWPX 2ZC7A 2CMNA 3O87A 4O8GA 2QYBA 5DF7A 1VHMA 1WYCA 2HP5A 3M6BA 5HDCA 2PAVP 1F2KA 5EUAA 1GSWA 1W79A 3IF6C 4LV3A 5CGSA 2HV1A 1K57A 4UEYA 5HD3A 2VLGA 1D1JA 3C38A 3BFGA 3HUNA 3VP0A 3WS4A 3LGOA 4YWZA 2P04A 1IFQA 4FUWA 3CMZA 2PYRA 4EQ1A 2J3TC 4OONA 4LV2A 5HSQA 4OP5A 3EGXC 5FQMA 5AVFA 5A92A 3VMAA 1Y54A 1A0KA 1CF0A 5E2FA 3LY4A 3CITA 3PBQA 1D06A 1J3WA 1IYOA 3NJAA 3MZDA 2V0UA 3FPWA 5DKLA 4PM5A 1G6AA 1FOFA 4ZTKA 1D7EA 3OOVA 3ZNTA 4PKYG 4Y15A 4P6ZS 3NI9A 1TS8A 1OMEA 2Y91A 4EBPA 2ZOHA 3MKFA 3HVFA 5A93A 1CQAA 3CUEA 3MMHA 2ZM8A 2WKRA 3DAVA 3LEZA 5FI6A 1XJ3A 3HLCA 2D01A 4NXBA 3HREA 4WM9A 4P6BA 1OTBA 3G2ZA 4CLCC 2O99A 4X25A 3T4QA 2WZXA 2PR6A 4S2LA 2ZL1A 3GR2A 1YLYA 1NYYA 3E2KA 3LIFA 1PZOA 1L3LA 1QMFA 1WYBA 5L8MA 3MF0A 3NHQA 5AQ9A 3V39A 3KYQA 4R70A 4WYYA 4GS9B 2DNSA 3IXBA 3RTYA 4YINA 2VZWA 4R3BA 5GHXA 1MKIA 1ZG4A 5F68A 1ZTUA 3KO6A 5I5LA 1W63M 5GLBA 3MJQA 4M4XA 4HP9A 1TS7A 3QP5A 2HP9A 3MXRA 2VV7A 2OAQ1 3LUQA 2XK1A 3HL9A 2L1MA 3V3SA 3KSHA 3HCYA 3O86A 2UV0E 4XT2A 1Z6FA 2WKPA 4BBVA 2QMIA 1P9WA 2JN7A 3EOIA 5EECA 3T12B 4PM9A 4GOGA 4ID4A 1S0WA 3P09A 1CJFA 2P9VA 4JGRA 5IT5A 4LRZE 1DRMA 5TGFA 1GHMA 3DTMA 1DP6A 3SS5A 5J3WA 4S2JA 3QNBA 3ZNYA 2ZLYA 3UE6A 2PRFA 2GX5A 4NKPA 5F82A 2ZOIA 5EM0A 4G3WA 5DFXA 4ZDXA 1MBLA 3BEBA 3C7VA 2EX2A 1YLWA 4L9EA 1SKFA 3LCEA 4M3KA 3WS5A 2UWXA 1K25A 1TS0A 2XEPA 1OT9A 4LPZA 4E6XA 4R23A 4ZJ2A 3IH9A 1OJ5A 1YLTA 1VQQA 5MC7A 2EX8A 3A0VA 1K56D 2I9VA 5JYOA 2ZD8A 3MS6A 1K54A 1DJBA 2NUTC 3NY4A 5GHZA 5IHVA 3N8SA 5FI2A 3TW8A 2PYPA 2FH5A 5GLDA 1XA7A 4LENA 2Y2OA 3UMEA 5E43A 2J9PA 3C7UA 4GB7A 3MXQA 1KOUA 3LYXA 4HNBA 2XH9A 3MFXA 2E8JA 1W63Q 3ZVWA 4RVAA 1BT5A 5EFWA 3LI8A 1K55A 4BL2A 4N9KA 4E3JA 2HDRA 3LIDA 5TBMA 1K6SA 3UDXA 3T1SA 3UB8A 1WE4A 4CLCA 1ES4A 4DE1A 1P97A 4GDBA 2JKRM 3FYZA 3SW1A 3FWLA 3B33A 3JVVA 1MWTA 2PT7A 2CC1A 2PHYA 1TVFA 4ME4A 4X53A 2V0WA 4DXBA 2OLVA 3Q07A 5DKKA 4OP8A 3DBAA 1YAXA 1SZVA 1BTLA 2ZQ9A 4BLMA 2Z6DA 4Q0IA 1PWCA 4UA6A 3N8LA 1T1BA 3NDEA 1O7EA 4WELA 2INWA 3T50A 3UY6A 4QU3A 2Y2IA 3WS2A 1S6RA 2M7UA 5EVIB 1IKGA 2A3UA 5CTMA 1SHVA 4OOYA 2WKHA 3BYDA 4ETXA 3BM6A 4OOLA 2Z2MB 2PBYA 3UPOA 3SH8A 1NYMA 4Y0OA 3GTCA 2C6WB 1KE0A 2G7UA 1N9NA 4MBKA 4DJ2A 4DKIA 2QJ7A 1JNUA 3H7WA 1MC0A 4E3NA 4FCFA 2WKIA 4QD4A 2QKPA 1VEUA 1V9ZA 5DJTA 3UE1A 1BUEA 1MWRA 5CXWA 3R7WB 1H8YA 3G4PA 2G2WA 4OH0A 2ZC3B 5CRFA 2VGJA 2BLSA 1N9LA 1FCMA 1AWIA 2B18A 2XA7M 2EWWA 3EQUA 4GKUA 4GLQA 3IWQA 3S7PA 5HPIA 1MZUA 2W3FA 2WYXA 4EBLA 3T4LA 3O3VA 2XFTA 3QHYA 3F1NA 3NCKA 4JF4A 2OWHA 5FAOA 3LIBA 2Y59A 2IWDA 1PZPA 2HJ9C 3CUEC 1L0FA 3T4KA 3D3OA 5HWTA 3IBJA 2VKSA 2V20A 4YFMA 2XLNA 5G4YA 4PAUA 3MQQA 5GLAA 3VP1A 4LCLA 3C2WA 2LB9A 4DRTA 1MY8A 4DE3A 3UB7A 3FPVA 3C4OA 1FCOA 4XXRA 3ZDJA 2QHKA 5KSCA 4S2NA 3BRMA 3RH8B 3DTIA 1BLCA 5GLCA 4XT2B 5HDSA 2K31A 1T18A 3EEHA 3D9YA 3SH7A 1DP8A 1BLPA 1IYPA 4G3VA 5FQIA 3E4PA 3QP8A 2GJ3A 1PI4A 3PAGA 1WA9A 1M6KA 4II7A 5HARA 3E4QA 5J8XA 3ICYA 5F69A 3Q7ZA 2D02A 4FH4A 3EGDC 3M6HA 1YSQA 4P6ZM 3GDIA 1CEFA 3CHWP 1OTAA 1RGZA 2EFXA 4KQOA 1DJCA 3QP6A 3IF6B 2JC7A 2MJ6A 4C6YA 1L0GA 2OSUA 5JYPA 3A3EA 5F6AA 1YLZA 2JKGA 5AQ7A 3ISGA 5KMWA 4PHTA 2XFSA 2HDSA 5DTTA 5CHMA 5TJJA 3UDFA 2ZC6B 3KX0X 3F1OA 4KG2A 5M1AA 3U2AA 5U47A 2JE5A 3ZVTA 5CEDA 4NK3A 2V8FA 5DFYA 3M2KA 1TD5A 1HZOA 4WL9A 5CTNA 2ZJ9A 3H82A 3MSHA 1XGJA 2XA7S 1G68A 3GRJA 1CEGA 3OPRA 3L7HA 4E3KA 1DJAA 3RXWA 3LR4A 5FAQA 1C3BA 3NOPC 1FR1A 1YQSA 1P0ZA 5DF9A 3LI9A 4EV4A 3RFBA 1S1YA 2YKFA 3MZEA 2Y2LA 3GECA 5J7EA 2WADA 4JGOA 5EVEA 2GZAA 4E3IA 4X6TA 1ODVA 1IELA 3M2JA 2KOIA 3IWOA 1FSYA 1GA0A 3BFCA 1NLZA 1RP5A 3T1RA 4B4ZA 1G28A 1I2WA 3PXPA 4Z1WA 2HDQA 2P08A 3DWZA 1PRQA 4HY8A 3HJIA 4IBRA 1K4FA 4BD1A 4EQIA 2WGWB 4BJPA 4CLCB 1NRJA 3G30A 1PWDA 4HH3A 1K54C 5FL3A 4WLAA 3UPNA 4KZ4A 3V5MA 1ONHA 3U4LP 3QNCA 4O0PA 3IT9A 3MBZA 4MNRA 4P87A 5E2GA 2Y2PA 3Q7VA 3VP3A 4I5SA 4MCWA 4A5RA 1ONGA 4JF5A 2WGIA 5LBRA 4HBTA 1W5DA 4LV1A 3WS0A 1KDWA 3BLSA 1ACFA 3A3FA 2O9AA 3K3CA 4LV0A 4OPYA 3C4PA 1K55C 1FSWA 1N4OA 3IQAA 1OTIA 3VV4A 1NRFA 5IU1A 5HX9A 4O7DA 4OQ0A 4AFIA 5EM1A 5A8BA 3A3JA 4C75A 3A0RA 4FH2A 3V50A 4BL3A 5EE8A 1TEMA 2I72A 3FZCA 4N92A 1JWPA 3BJNA 4U3TA 1HLUP 5AQAA 1SKOA 1IKIA 1RGYA 4Y5FA 4HQAA 3OCNA 5HWVA 2W1TB 2P74A 3N6IA 4ARZA 2JKRI 3RXXA 3W4PA 2J7VA 3IS2B 2WUQA 2AVXA 4KENB 4JXVA 4ZJ3A 4WF0A 1TDGA 5A90A 1N9BA 5CERA 3HLWA 3BQAA 5FAPA 3Q82A 4S2KA 1H8ZA 2XD5A 5DJUA 1OT6A 4PKYA 4X55A 1JTDA 5HDDA 4QJGA 1K6RA 2EX6A 4NG2A 3H9WA 5FDHA 3T4JA 3MQOA 3IWIA 4GD8A 5CGXA 4S2PA 2A2LA 4WEJA 3LR0A 4DE0A 1G5UA 2IA2A 4F94A 2KDKA 4NETA 3MFDA 1NWZA 4H6JA 3UE0A 2BG1A 3K3DA 5K5BA 1GHIA 2KLIA 4JF6A 5FA7A 2R9XA 4MLLA 3S1YA 3TRCA 3BLMA 2A24B 4GHIA 3A3DA 3ZGAB 4LLOB 3T4TA 2B95A 4GJ4A 3KSFA 3LO7A 2Y2QA 4RQ9A 3GV9A 2ZQAA 4ESPA 1E3UA 2VX8A 1XFNA 3CZDA 5HWWA 4HP4A 5F1GA 2GNXA 1E3UD 4WBGA 4HBUA 4PM7A 2XR0A 4CPKA
chains in the Genus database with same CATH topology
4NXFA 2ZMFA 2M7UA 2W0NA 1G6OA 3BY8A 1GSVA 4O01A 4ETXA 2HF6A 2P7JA 2K2NA 4OOLA 2J80A 3C8CA 5HPFA 4EEUA 2VV6A 2EA9A 1F98A 2G7UA 1N9NA 1VB6A 1T1AA 4DJ2A 4IHQA 2QJ5A 2QJ7A 1JNUA 3H7WA 1H8MA 4EUVA 1MC0A 4F3LB 1YSPA 2PDRA 3R7WA 4EETB 2QKPA 1V9ZA 5DJTA 1LSVA 1LSWA 3KYZA 3H7WB 4NEED 3R7WB 3R4KA 2R78A 4MN6A 4WEKA 2FZ0A 4BBTA 3PBSA 3D72A 4NXEA 1N9LA 4Y3IA 4FSFA 2L0WA 4EXOA 3KSGA 2B18A 1UWPX 4UQIM 2CMNA 1OJGA 2HGVA 2QYBA 2EWWA 2XA7M 2XRNA 1VHMA 3EQUA 4O8GA 4BBUA 4GLQA 5KIZA 2Z6CA 5HDCA 3S7PA 5HPIA 1MZUA 2W3FA 4LRYC 2B02A 1GSWA 3T4LA 4HJ3A 2XSSA 2W27A 2HV1A 3EEAA 3F1NA 2OWHA 4WUJA 4UEYA 5HD3A 3LIBA 3BWLA 2VLGA 1XJ2A 3ULFA 3C38A 2HJ9C 3CUEC 3T4KA 3D3OA 1MKMA 5HWTA 3F1NB 4YOFA 3IBJA 4YWZA 1YKDA 2P04A 1IFQA 2VKSA 2VV8A 4EESA 2ZBBA 4Q0JA 5G4YA 4ZRRA 4PAUA 2PYRA 1OPXA 3MQQA 4EQ1A 2J3TC 1H3QA 1TF1A 3C2WA 3LIAA 2LB9A 3UB7A 5HSQA 3S7QA 3FPVA 3EGXC 1DP9A 5AVFA 5IS1A 2DMWA 2QHKA 3LFVA 3C30A 3CI6A 3RH8B 1P9RA 2OAP1 4FOFA 4CQHA 4XT2B 5HDSA 3CITA 2K31A 3PBQA 4HJ6A 1XJ4A 1T18A 3E98A 3EEHA 2O9BA 1DP8A 2W1RA 1D06A 5AVEA 4DJ3A 3VOLA 3F1PB 3NJAA 4G3VA 1OTEA 1TS6A 1X0OA 2V0UA 3E4PA 3FPWA 5DKLA 3OLOA 2GJ3A 4B93A 2V1AA 2JHEA 2W3HA 1WA9A 1D7EA 3OOVA 4II7A 3IBRA 3E4QA 4PKYG 4P6ZS 3ICYA 4I3AA 5F69A 2D02A 4G3KA 1TS8A 3EGDC 5J4EA 4MMNA 2ZOHA 1YSQA 4P6ZM 3GDIA 3OCLA 1OTAA 1OTDA 1S4SA 3LICA 3CUEA 4KQOA 4EU0A 2M1CA 3MMHA 2MJ6A 2WKRA 5F6AA 1V9YA 3E0YA 3P01A 4F3LA 3LIEA 4PHTA 3TE8A 1XJ3A 5TJJA 2D01A 4NXBA 3KX0X 1S67L 1OTBA 1EW0A 4CLCC 2O99A 3F1OA 3T4QA 4DMZA 2PR6A 1UGUA 3O5YA 2J3TD 3U2AA 3LIFA 3G6OA 5L8MA 5DFYA 2PD8A 2VGLM 1TD5A 3F1OB 3MF0A 4IUKA 3NHQA 4I38A 4WL9A 3KYQA 4R70A 4UQIS 5F5YA 3H82A 3UMDA 5HZHA 2XA7S 4GS9B 4EEPA 4DN0A 1N9OA 3VE3A 1LSXA 2OWJA 5AJGA 3RTYA 4L9FA 3H82B 2VZWA 3LR4A 3NOPC 3K2NA 2PR5A 1LL8A 1P0ZA 4BMWA 5DF9A 3LI9A 3RFBA 3PBRA 5F68A 4MN7A 1ZTUA 1S1YA 2YKFA 3KO6A 1F9IA 2LB5A 5I5LA 1W63M 3BY9A 3MJQA 4M4XA 3GECA 4HP9A 1TS7A 5J7EA 2HJEA 4JGOA 2O0YA 2GZAA 2O9CA 2VV7A 1ODVA 3FG8A 2OAQ1 3LUQA 4KUKA 1BYWA 4I39A 3PBTA 2L1MA 4GW9A 3S7NA 2W3DA 2KOIA 3KSHA 3HCYA 3LR5A 1NLZA 3TJZC 3EWKA 4XT2A 1G28A 1IOUA 3PXPA 4Z1WA 3W2ZA 2P08A 4HY8A 3T4SA 3HJIA 2WKPA 4BBVA 3F1PA 1P9WA 2JN7A 3EOIA 2J3WA 4IJGA 4BJPA 3PR6A 4CLCB 1NRJA 4JGRA 5IT5A 4LRZE 2YKHA 3ZYTA 4L9GA 2PD7A 3MQ0A 4HH3A 2KX6A 4CLCD 3E4OA 5FL3A 4WLAA 5HL6A 4BWIA 4O0PA 1DRMA 1S66L 2W3EA 4R3AA 1UWNX 2VA0A 4I5SA 4MCWA 3S7OA 1DP6A 3CLOA 5G4ZA 5J3WA 3LR3A 5LBRA 2JKTI 1STZA 2M7VA 3UE3A 3UE6A 2GX5A 4NKPA 3OBFA 4B9OA 2ZOIA 2O9AA 3K3CA 4IUHA 4OOMA 5KSHA 4G3WA 5DFXA 4QPRA 1OTIA 2K7SA 3VV4A 3UB9A 4CLCE 4L0LA 5IU1A 4AFIA 2V1BA 4L9EA 4HOIA 5A8BA 4NXGA 1S1ZA 1TS0A 3A0RA 1OT9A 3NOTC 4GCZA 4LPZA 2W1TA 4EW7A 3BJNA 2OOLA 1OJ5A 3T4OA 3MR0A 2VGLS 4HHDA 4Y5FA 4HQAA 4GS9A 3OCNA 5MC7A 3PYPA 3VE4A 3IS2A 5HWVA 2W1TB 3A0VA 4ARZA 2I9VA 3OC2A 4HIAA 5CX7A 4ETZA 2JKRI 3EQVA 4JGPA 2NUTC 3IS2B 1ZHHB 4ARZB 1XJ6A 4JGQA 2WKQA 4WF0A 3TW8A 4KQDA 2PYPA 2JKTM 2FH5A 4MN5A 3UMEA 3HJKA 2QWSA 3ZQ5A 4KUOA 3BQ8A 3BQAA 2BASA 3FC7A 4E04A 2Y79A 3MXQA 4WN5A 1KOUA 3LYXA 4HNBA 2V9AA 5DJUA 1OT6A 3KSIA 2VJWA 2Y8HA 4PKYA 5HDDA 3MFXA 1S4RA 4I3IA 2VEAA 4R6LA 3A0SA 1W63Q 3H9WA 4MDZA 3T4JA 1XFQA 3MQOA 4YNRA 5EFWA 4EERA 5C5KA 3PBOA 3LI8A 2A2LA 4WEJA 3LR0A 2IA2A 2KDKA 1GSXA 4LRXC 1F5MA 1NWZA 5HD5A 3LIDA 5TBMA 3BW6A 2H28A 3CWFA 4H6JA 1Y28A 3PBNA 2A24A 3UB8A 4CLCA 3K3DA 5K5BA 1P97A 5TBMB 2KLIA 2JKRM 3SW1A 4H6JB 2ZMVA 3V67A 2L4RA 3TRCA 3B33A 3JVVA 1T1CA 2PT7A 2A24B 4HH2A 4GHIA 2NUPC 3CAXA 2PHYA 4ME4A 3B42A 3NOUC 3UB6A 2V0WA 4HJ4A 1NLYA 4LLOB 3P7NA 3T4TA 2XROA 4GHIB 5DKKA 4GJ4A 4I3JA 3KSFA 3PHYA 4RQ9A 3DBAA 1YAXA 4Y2FA 4HI4A 3JVUA 4R38A 1T19A 2Z6DA 2VX8A 1XFNA 4Q0IA 4K08A 1T1BA 5HWWA 2W3GA 4Q0HA 1LT0A 4HP4A 2GNXA 4WELA 2INWA 3T50A 2EWVA 3B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXF A;  2W0N A;  3BY8 A;  1GSV A;  2P7J A;  2J80 A;  3C8C A;  4EEU A;  2VV6 A;  2EA9 A;  1F98 A;  1N9N A;  1VB6 A;  1T1A A;  4DJ2 A;  2QJ5 A;  2QJ7 A;  1JNU A;  3H7W A;  4F3L B;  2PDR A;  4EET B;  2QKP A;  1V9Z A;  5DJT A;  1LSV A;  1LSW A;  3H7W B;  2R78 A;  4MN6 A;  4BBT A;  3D72 A;  4NXE A;  1N9L A;  2L0W A;  4EXO A;  1UWP X;  2CMN A;  1OJG A;  4BBU A;  5KIZ A;  2Z6C A;  5HDC A;  1MZU A;  4LRY C;  2B02 A;  1GSW A;  4HJ3 A;  2W27 A;  2HV1 A;  3F1N A;  2OWH A;  4WUJ A;  5HD3 A;  3LIB A;  3BWL A;  2VLG A;  1XJ2 A;  3ULF A;  5HWT A;  3F1N B;  4YWZ A;  2VV8 A;  4EES A;  2ZBB A;  5G4Y A;  2PYR A;  3MQQ A;  4EQ1 A;  3C2W A;  3LIA A;  3UB7 A;  5HSQ A;  1DP9 A;  5AVF A;  5IS1 A;  2QHK A;  3RH8 B;  4XT2 B;  5HDS A;  4HJ6 A;  1XJ4 A;  1T18 A;  3EEH A;  1DP8 A;  1D06 A;  5AVE A;  4DJ3 A;  3VOL A;  3F1P B;  3NJA A;  1OTE A;  1TS6 A;  1X0O A;  2V0U A;  3E4P A;  5DKL A;  3OLO A;  2GJ3 A;  2V1A A;  2JHE A;  1WA9 A;  1D7E A;  3IBR A;  3E4Q A;  4PKY G;  3ICY A;  4I3A A;  5F69 A;  2D02 A;  1TS8 A;  5J4E A;  2ZOH A;  3GDI A;  1OTA A;  1OTD A;  1S4S A;  3LIC A;  2M1C A;  2WKR A;  5F6A A;  1V9Y A;  4F3L A;  3LIE A;  1XJ3 A;  2D01 A;  4NXB A;  3KX0 X;  1S67 L;  1OTB A;  1EW0 A;  3F1O A;  2PR6 A;  1UGU A;  3LIF A;  3G6O A;  2PD8 A;  3F1O B;  3NHQ A;  4I38 A;  4WL9 A;  4R70 A;  5F5Y A;  3H82 A;  3UMD A;  5HZH A;  4GS9 B;  4EEP A;  1N9O A;  3VE3 A;  1LSX A;  2OWJ A;  3RTY A;  4L9F A;  3H82 B;  3NOP C;  2PR5 A;  1LL8 A;  1P0Z A;  3LI9 A;  5F68 A;  1S1Y A;  2YKF A;  1F9I A;  5I5L A;  3BY9 A;  3MJQ A;  4M4X A;  3GEC A;  4HP9 A;  1TS7 A;  5J7E A;  4JGO A;  2VV7 A;  1ODV A;  3FG8 A;  3LUQ A;  4KUK A;  1BYW A;  4I39 A;  2L1M A;  4GW9 A;  3EWK A;  4XT2 A;  1G28 A;  4HY8 A;  3HJI A;  2WKP A;  4BBV A;  3F1P A;  2JN7 A;  4JGR A;  4LRZ E;  2YKH A;  4L9G A;  2PD7 A;  4HH3 A;  2KX6 A;  3E4O A;  4WLA A;  1DRM A;  1S66 L;  4R3A A;  1UWN X;  4I5S A;  1DP6 A;  3CLO A;  5G4Z A;  5J3W A;  3UE6 A;  4B9O A;  2ZOI A;  3K3C A;  1OTI A;  2K7S A;  3UB9 A;  5IU1 A;  2V1B A;  4L9E A;  4HOI A;  5A8B A;  4NXG A;  1S1Z A;  1TS0 A;  3A0R A;  1OT9 A;  3NOT C;  4GCZ A;  4LPZ A;  4EW7 A;  2OOL A;  1OJ5 A;  3MR0 A;  4HHD A;  4HQA A;  4GS9 A;  3PYP A;  3VE4 A;  3IS2 A;  5HWV A;  3A0V A;  2I9V A;  4HIA A;  4JGP A;  3IS2 B;  1XJ6 A;  4JGQ A;  2WKQ A;  4WF0 A;  4KQD A;  2PYP A;  4MN5 A;  3UME A;  3HJK A;  2QWS A;  3ZQ5 A;  4KUO A;  2BAS A;  3FC7 A;  4E04 A;  3MXQ A;  4WN5 A;  1KOU A;  3LYX A;  4HNB A;  2V9A A;  5DJU A;  1OT6 A;  4PKY A;  5HDD A;  3MFX A;  1S4R A;  4I3I A;  2VEA A;  4R6L A;  3A0S A;  3H9W A;  1XFQ A;  3MQO A;  5EFW A;  4EER A;  3LI8 A;  2KDK A;  1GSX A;  4LRX C;  1NWZ A;  5HD5 A;  3LID A;  5TBM A;  2H28 A;  3CWF A;  4H6J A;  1Y28 A;  2A24 A;  3UB8 A;  3K3D A;  1P97 A;  5TBM B;  3SW1 A;  4H6J B;  2L4R A;  3B33 A;  1T1C A;  2A24 B;  4HH2 A;  4GHI A;  3CAX A;  2PHY A;  3NOU C;  3UB6 A;  2V0W A;  4HJ4 A;  4LLO B;  3P7N A;  4GHI B;  5DKK A;  4I3J A;  3PHY A;  4RQ9 A;  4HI4 A;  4R38 A;  1T19 A;  2Z6D A;  1XFN A;  4K08 A;  1T1B A;  5HWW A;  1LT0 A;  4HP4 A;  2INW A;  3T50 A; 
#chains in the Genus database with same CATH topology
 1ZKJ A;  1FCN A;  2ZMF A;  1G6O A;  1NJ4 A;  1LI9 A;  1FR6 A;  3BY8 A;  1VET A;  2E8I A;  1K56 A;  3GVB A;  4FTX A;  4OLG A;  2P7J A;  3LEQ A;  2QZ6 A;  1Q2P A;  2J80 A;  5F83 A;  2V1Z A;  1K4E A;  1RCJ A;  4EBN A;  2EA9 A;  1TDL A;  3BFD A;  3UN7 A;  3IX4 A;  3WWX A;  3IHA A;  2HZ5 A;  4GD6 A;  1YSP A;  3ITB A;  3WS1 A;  4S2N C;  2WZZ A;  3IXH A;  1LSV A;  2Y2M A;  1LSW A;  3TOI A;  3KYZ A;  1MWS A;  1ESU A;  4X1L A;  1AXB A;  2VGK A;  3R4K A;  4WEK A;  4BBT A;  3PBS A;  5E2H A;  4E3M A;  3HLE A;  1PFL A;  4Y3I A;  3VOZ A;  4HEF A;  3KSG A;  5FAS A;  1KE4 A;  1OJG A;  2B5R A;  2IWC A;  2XDM A;  2Z6C A;  5G18 A;  4KZ8 A;  2DRW A;  3WRZ A;  2ZM0 A;  4HJ3 A;  2XSS A;  1ERQ A;  4WUJ A;  5FEF A;  1KGF A;  1XJ2 A;  2H5S A;  1QME A;  4C3Q A;  1MKM A;  3GMW A;  2VV8 A;  4EES A;  1I2S A;  4Q0J A;  4ZRR A;  1BZA A;  4Q8I A;  3BFE A;  4KG5 A;  1NZO A;  3S7Q A;  4LCM A;  1K38 A;  1ERO A;  4Y13 A;  2H0T A;  2DMW A;  3LFV A;  3C30 A;  4CQH A;  5M18 A;  3E98 A;  4BD0 A;  3DW0 A;  1H5X A;  2O9B A;  4XUX A;  1PW1 A;  4S2I A;  5CGW A;  5AVE A;  5HAQ A;  2R9W A;  3VOL A;  5FSR A;  3OZH A;  3PTE A;  1OTE A;  1TS6 A;  1X0O A;  4Y17 A;  5L07 A;  4B93 A;  2JHE A;  4JKT A;  3HLD A;  3P98 A;  1ZC2 A;  3DTK A;  5EOE A;  1EI5 A;  3IBR A;  4I3A A;  3ZG7 B;  2X01 A;  1H0M A;  1OTD A;  3G35 A;  3LIC A;  5DTK A;  3UB5 P;  4X69 A;  1V9Y A;  3E0Y A;  3P01 A;  3TE8 A;  4B88 A;  2HDU A;  1I5Q A;  1PNE A;  4PM6 A;  2Q0O A;  4WZ4 A;  4DXC A;  3NUL A;  1EW0 A;  4DMZ A;  3Q1F A;  1UGU A;  3G6O A;  2PD8 A;  1PI5 A;  4IUK A;  4I38 A;  2H0Y A;  5FAT A;  5DTS A;  1SKO B;  1GCE A;  2ZL1 B;  1KGE A;  3UMD A;  5HZH A;  2PU2 A;  4EEP A;  3VE3 A;  4ZAM A;  1LSX A;  1YLJ A;  5AJG A;  5HFO A;  3GQZ A;  5EPH A;  2EFU A;  3K2N A;  3VSL A;  4BMW A;  1KDS A;  2HP6 A;  3PBR A;  2ZM2 A;  1HD8 A;  3BY9 A;  5L2F A;  1KVL A;  3IX3 A;  5EV0 A;  5FQJ A;  2O9C A;  2Q9N A;  2ACG A;  3FG8 A;  1XKZ A;  2ZQ8 A;  4KUK A;  1BYW A;  4I39 A;  5FQK A;  3S7N A;  4GW9 A;  4ZJ1 A;  4JLF A;  3TJZ C;  3VP4 A;  1IOU A;  4IVK A;  3T4S A;  3ZG0 A;  5E2E A;  1L0D A;  3S4X A;  3I7J A;  3F1P A;  3HUO A;  1L0E A;  4IJG A;  2WAF A;  3PR6 A;  4R0Q A;  2YKH A;  3ZYT A;  1LL5 A;  2PD7 A;  3MQ0 A;  4L9G A;  5CHU A;  4E3L A;  3E4O A;  1U60 A;  5HL6 A;  4BWI A;  1ES5 A;  2P9V B;  3NEC A;  1S66 L;  2W3E A;  2XF3 A;  1UWN X;  2VA0 A;  5HAI A;  3S7O A;  3ZG8 B;  1SDE A;  1XPB A;  2XD1 A;  2Y2H A;  2PU4 A;  2M7V A;  4DE2 A;  2ZQC A;  3O88 A;  3OBF A;  3DTE A;  5HW3 A;  4IUH A;  3D4F A;  5KSH A;  2Y2K A;  2H10 A;  2K7S A;  1W8Y A;  3UB9 A;  3OPL A;  4L0L A;  2Q9M A;  4KZB A;  4HOI A;  2Y4A A;  1PYY A;  3QP1 A;  2VK3 A;  3NOT C;  4QY5 A;  4R3J A;  2OOL A;  3ZHH A;  2RCX A;  1VM1 A;  4HHD A;  4BQM A;  3PYP A;  4P0M A;  4OVD A;  4OLD A;  5CX7 A;  4UAA A;  3HLF A;  3UO9 A;  4ETZ A;  3EQV A;  3ITA A;  4JGP A;  3VFH A;  4Y0U A;  3HBR A;  1ZHH B;  1XJ6 A;  4JGQ A;  2WKQ A;  3CPT A;  2FFY A;  2JKT M;  3T1Q B;  2OLU A;  5DVA A;  3HJK A;  2QWS A;  3BQ8 A;  2ZC4 B;  3FC7 A;  3W4Q A;  4E04 A;  2Y79 A;  3A3I A;  2ZC5 B;  4WN5 A;  4S2M A;  2V9A A;  1PWG A;  3KSI A;  2VJW A;  3GSG A;  1JWV A;  4MBH A;  4I3I A;  1YPR A;  3N4I A;  3A0S A;  1JWZ A;  1XFQ A;  4YNR A;  2G2U A;  1XGI A;  4EER A;  5C5K A;  1ZG6 A;  3PBO A;  1L2S A;  1ALQ A;  1GSX A;  4LRX C;  1F5M A;  2Y2G A;  4JXW A;  2H28 A;  3G2Y A;  5KZH A;  1KGG A;  1Y28 A;  3MKE A;  3PBN A;  4MBF A;  1HVB A;  1FQG A;  5TBM B;  1LL9 A;  3IH8 A;  4WZ5 A;  2BTF P;  2ZMV A;  5CHJ A;  3V67 A;  2L4R A;  4KZ3 A;  5D3O A;  1T1C A;  2XQZ A;  2NUP C;  3CAX A;  5FQ9 A;  3P7N A;  2XRO A;  4I3J A;  4RA7 A;  4IBX A;  3PHY A;  4GN2 A;  1T19 A;  4QY6 A;  3IXG A;  4HES A;  4N9L A;  2W3G A;  3C5A A;  4Q0H A;  1LT0 A;  4LGW A;  2XGN A;  3OPH A;  1ES2 A;  2EWV A;  5L10 A;  4GNU A;  5EVI A;  3B3X A;  1LI0 A;  4KQQ A;  4NXF A;  2W0N A;  4DF6 A;  1GSV A;  4O01 A;  4KZ9 A;  5EVI D;  2HF6 A;  2GDN A;  3C8C A;  4EEU A;  2WGV A;  1SCW A;  1JVJ A;  4IVI A;  2RL3 A;  4PMA A;  2VV6 A;  3G34 A;  1F98 A;  3UDI A;  1VB6 A;  4DDS A;  1ES3 A;  4IHQ A;  3AGE A;  3E2L A;  2PDR A;  3R7W A;  4EET B;  4PPR A;  4X68 A;  4X1M A;  3H7W B;  4NEE D;  4MN6 A;  2FZ0 A;  3SS4 A;  1VEU B;  3D72 A;  4NXE A;  3ZG5 A;  4FSF A;  2L0W A;  4EXO A;  4UQI M;  2XRN A;  2HGV A;  4QB8 A;  4BBU A;  5KIZ A;  5CEC A;  4LRY C;  2B02 A;  3LY3 A;  2W27 A;  3EEA A;  3BWL A;  3ULF A;  3V3R A;  1LLB A;  3F1N B;  4YOF A;  4KZA A;  1YKD A;  5A91 A;  1Q2Q A;  2ZBB A;  2PBD P;  1OPX A;  1H3Q A;  1TF1 A;  3SOI A;  3LIA A;  4B4X A;  2JBF A;  4Y7P A;  2EX9 A;  4KQR A;  1DP9 A;  5IS1 A;  4N1X A;  3KYE A;  3CI6 A;  4K0X A;  4Z9Q A;  1KVM A;  1P9R A;  2OAP 1;  4QWO A;  3FKV A;  4FOF A;  1IYS A;  4HJ6 A;  4N1H A;  1XJ4 A;  2V8C A;  3OPP A;  4IED A;  3G32 A;  2W1R A;  1FIK A;  4DJ3 A;  3F1P B;  2A49 A;  3OLO A;  2V1A A;  2W3H A;  4XUZ A;  5F1F A;  3G31 A;  3PAE A;  1YLP A;  1YMS A;  1EWZ A;  4EUZ A;  4G3K A;  3IF6 A;  3CG5 A;  5J4E A;  4MMN A;  3OCL A;  1YMX A;  5DF8 A;  1S4S A;  1ESI A;  4EU0 A;  2M1C A;  1XXM A;  1XX2 A;  4OPR A;  1MPL A;  3BEC A;  4UA7 A;  4F3L A;  3LIE A;  4MEZ A;  3MXS A;  4KZ7 A;  1DY6 A;  4OPZ A;  3NC8 A;  1S67 L;  4RX3 A;  1J9M A;  3HLB A;  3ZG9 B;  4S2O A;  3O5Y A;  2J3T D;  5M19 A;  2C5W B;  2VGL M;  3F1O B;  1YM1 A;  5L09 A;  4UQI S;  5F5Y A;  5FI7 A;  1BUL A;  3SS3 A;  1PIO A;  1W8Q A;  4DN0 A;  1O07 A;  1NY0 A;  1N9O A;  2X71 A;  4JXG A;  4D2O A;  2OWJ A;  3S22 A;  4L9F A;  3FV7 A;  3H82 B;  2ZQD A;  3Q81 A;  2JKF A;  3UPP A;  3N8R A;  2WKE A;  5CEB A;  2PR5 A;  1LL8 A;  3CPT B;  4MN7 A;  2Y55 A;  3L9K A;  1F9I A;  2LB5 A;  3NDG A;  1IYQ A;  3FKW A;  2HPB A;  2HJE A;  2O0Y A;  1FIL A;  2EXA A;  3DWK A;  2QPN A;  4LFU A;  2WK0 A;  4X56 A;  3PBT A;  1CI8 A;  2W3D A;  4BEN A;  3LR5 A;  2WGW A;  3EWK A;  3W2Z A;  1W7F A;  1KE3 A;  3AGF A;  4R1G A;  4OQG A;  4R4R A;  1MXO A;  2J3W A;  5I94 A;  3NIA A;  2KX6 A;  4CLC D;  1BSG A;  3T1X A;  5GL9 A;  4R3A A;  2DCF A;  5EOO A;  3JPU A;  3CLO A;  2WAE A;  1XA1 A;  5FDS A;  5G4Z A;  3LR3 A;  2J8Y A;  3ZCZ A;  1E4D A;  2JKT I;  4KG6 A;  3Q7V B;  1STZ A;  3UE3 A;  3SZT A;  3ZFZ A;  4OQH A;  4KZ5 A;  4Y0T A;  1M40 A;  4B9O A;  4OOM A;  4QPR A;  4P85 A;  4GDN A;  2JCH A;  4CLC E;  2V1B A;  3IF5 A;  1Y4O A;  4NXG A;  1K57 C;  1S1Z A;  2X02 A;  4DDY A;  3SH9 A;  3W4O A;  1MWU A;  3W8K A;  4GCZ A;  2W1T A;  4EW7 A;  4H8R A;  4UHU A;  4WZ5 C;  3T4O A;  3MR0 A;  2VGL S;  2ZMA A;  4GS9 A;  4FD8 A;  4PM8 A;  3VE4 A;  3IS2 A;  3OC2 A;  4HIA A;  4R4S A;  5FEG A;  1SDN A;  4E6W A;  4WMC A;  4ARZ B;  3UNW A;  1BLS A;  4KQD A;  3N7W A;  4MN5 A;  2OV5 A;  2V2F F;  5HAP A;  3ZQ5 A;  4KUO A;  2BAS A;  4ZBE A;  4WMC D;  1CK3 A;  2Y8H A;  4UA9 A;  1S4R A;  2VEA A;  4R6L A;  3IHB A;  4MDZ A;  3RJU A;  1Z09 A;  3IXD A;  3JYI A;  1ERM A;  4OPQ A;  5EVI C;  1IEM A;  1GHP A;  3BFF A;  1NXY A;  5TFQ A;  5HD5 A;  4OQI A;  3BW6 A;  3CWF A;  3HLG A;  1JTG A;  3HUM A;  2A24 A;  1CI9 A;  4H6J B;  4JBF A;  4K0W A;  1K0K A;  1XP4 A;  5GHY A;  3NBL A;  4HH2 A;  2J9O A;  4K91 A;  5AQB A;  1YT4 A;  3B42 A;  3NOU C;  3UB6 A;  3VSK A;  4HJ4 A;  1NLY A;  2Z2L B;  1BLH A;  4GHI B;  4Y2F A;  5BOH A;  4HI4 A;  3JVU A;  4R38 A;  3MZF A;  4U0X A;  2Y2J A;  1GA9 A;  4K08 A;  5TR7 A;  4OKP A;  4E3O A;  3QP4 A;  3TG9 A;  2ZQ7 A;  1PW8 A;  4JXS A;  4KZ6 A;  4CJN A;  4RX2 A;  1NZU A;  3B47 A;  4EWF A;  3WRT A;  2Y2N A;  4GZB A;  1HTZ A;  4JPM A;  3IX8 A;  3VP2 A;  2FFF B;  5FQQ A;  3VFF A;  2K2N A;  5HPF A;  1VET B;  2IWB A;  4D60 A;  3CJM A;  1T1A A;  2QJ5 A;  1H8M A;  3AGD A;  4EUV A;  2EXB A;  4RYE A;  4F3L B;  1E25 A;  5EVL A;  1LHY A;  4U0T A;  2R78 A;  5HL1 A;  3TSG A;  3QP2 A;  4QHC A;  3VOY A;  1UWP X;  2ZC7 A;  2CMN A;  3O87 A;  4O8G A;  2QYB A;  5DF7 A;  1VHM A;  1WYC A;  2HP5 A;  3M6B A;  5HDC A;  2PAV P;  1F2K A;  5EUA A;  1GSW A;  1W79 A;  3IF6 C;  4LV3 A;  5CGS A;  2HV1 A;  1K57 A;  4UEY A;  5HD3 A;  2VLG A;  1D1J A;  3C38 A;  3BFG A;  3HUN A;  3VP0 A;  3WS4 A;  3LGO A;  4YWZ A;  2P04 A;  1IFQ A;  4FUW A;  3CMZ A;  2PYR A;  4EQ1 A;  2J3T C;  4OON A;  4LV2 A;  5HSQ A;  4OP5 A;  3EGX C;  5FQM A;  5AVF A;  5A92 A;  3VMA A;  1Y54 A;  1A0K A;  1CF0 A;  5E2F A;  3LY4 A;  3CIT A;  3PBQ A;  1D06 A;  1J3W A;  1IYO A;  3NJA A;  3MZD A;  2V0U A;  3FPW A;  5DKL A;  4PM5 A;  1G6A A;  1FOF A;  4ZTK A;  1D7E A;  3OOV A;  3ZNT A;  4PKY G;  4Y15 A;  4P6Z S;  3NI9 A;  1TS8 A;  1OME A;  2Y91 A;  4EBP A;  2ZOH A;  3MKF A;  3HVF A;  5A93 A;  1CQA A;  3CUE A;  3MMH A;  2ZM8 A;  2WKR A;  3DAV A;  3LEZ A;  5FI6 A;  1XJ3 A;  3HLC A;  2D01 A;  4NXB A;  3HRE A;  4WM9 A;  4P6B A;  1OTB A;  3G2Z A;  4CLC C;  2O99 A;  4X25 A;  3T4Q A;  2WZX A;  2PR6 A;  4S2L A;  2ZL1 A;  3GR2 A;  1YLY A;  1NYY A;  3E2K A;  3LIF A;  1PZO A;  1L3L A;  1QMF A;  1WYB A;  5L8M A;  3MF0 A;  3NHQ A;  5AQ9 A;  3V39 A;  3KYQ A;  4R70 A;  4WYY A;  4GS9 B;  2DNS A;  3IXB A;  3RTY A;  4YIN A;  2VZW A;  4R3B A;  5GHX A;  1MKI A;  1ZG4 A;  5F68 A;  1ZTU A;  3KO6 A;  5I5L A;  1W63 M;  5GLB A;  3MJQ A;  4M4X A;  4HP9 A;  1TS7 A;  3QP5 A;  2HP9 A;  3MXR A;  2VV7 A;  2OAQ 1;  3LUQ A;  2XK1 A;  3HL9 A;  2L1M A;  3V3S A;  3KSH A;  3HCY A;  3O86 A;  2UV0 E;  4XT2 A;  1Z6F A;  2WKP A;  4BBV A;  2QMI A;  1P9W A;  2JN7 A;  3EOI A;  5EEC A;  3T12 B;  4PM9 A;  4GOG A;  4ID4 A;  1S0W A;  3P09 A;  1CJF A;  2P9V A;  4JGR A;  5IT5 A;  4LRZ E;  1DRM A;  5TGF A;  1GHM A;  3DTM A;  1DP6 A;  3SS5 A;  5J3W A;  4S2J A;  3QNB A;  3ZNY A;  2ZLY A;  3UE6 A;  2PRF A;  2GX5 A;  4NKP A;  5F82 A;  2ZOI A;  5EM0 A;  4G3W A;  5DFX A;  4ZDX A;  1MBL A;  3BEB A;  3C7V A;  2EX2 A;  1YLW A;  4L9E A;  1SKF A;  3LCE A;  4M3K A;  3WS5 A;  2UWX A;  1K25 A;  1TS0 A;  2XEP A;  1OT9 A;  4LPZ A;  4E6X A;  4R23 A;  4ZJ2 A;  3IH9 A;  1OJ5 A;  1YLT A;  1VQQ A;  5MC7 A;  2EX8 A;  3A0V A;  1K56 D;  2I9V A;  5JYO A;  2ZD8 A;  3MS6 A;  1K54 A;  1DJB A;  2NUT C;  3NY4 A;  5GHZ A;  5IHV A;  3N8S A;  5FI2 A;  3TW8 A;  2PYP A;  2FH5 A;  5GLD A;  1XA7 A;  4LEN A;  2Y2O A;  3UME A;  5E43 A;  2J9P A;  3C7U A;  4GB7 A;  3MXQ A;  1KOU A;  3LYX A;  4HNB A;  2XH9 A;  3MFX A;  2E8J A;  1W63 Q;  3ZVW A;  4RVA A;  1BT5 A;  5EFW A;  3LI8 A;  1K55 A;  4BL2 A;  4N9K A;  4E3J A;  2HDR A;  3LID A;  5TBM A;  1K6S A;  3UDX A;  3T1S A;  3UB8 A;  1WE4 A;  4CLC A;  1ES4 A;  4DE1 A;  1P97 A;  4GDB A;  2JKR M;  3FYZ A;  3SW1 A;  3FWL A;  3B33 A;  3JVV A;  1MWT A;  2PT7 A;  2CC1 A;  2PHY A;  1TVF A;  4ME4 A;  4X53 A;  2V0W A;  4DXB A;  2OLV A;  3Q07 A;  5DKK A;  4OP8 A;  3DBA A;  1YAX A;  1SZV A;  1BTL A;  2ZQ9 A;  4BLM A;  2Z6D A;  4Q0I A;  1PWC A;  4UA6 A;  3N8L A;  1T1B A;  3NDE A;  1O7E A;  4WEL A;  2INW A;  3T50 A;  3UY6 A;  4QU3 A;  2Y2I A;  3WS2 A;  1S6R A;  2M7U A;  5EVI B;  1IKG A;  2A3U A;  5CTM A;  1SHV A;  4OOY A;  2WKH A;  3BYD A;  4ETX A;  3BM6 A;  4OOL A;  2Z2M B;  2PBY A;  3UPO A;  3SH8 A;  1NYM A;  4Y0O A;  3GTC A;  2C6W B;  1KE0 A;  2G7U A;  1N9N A;  4MBK A;  4DJ2 A;  4DKI A;  2QJ7 A;  1JNU A;  3H7W A;  1MC0 A;  4E3N A;  4FCF A;  2WKI A;  4QD4 A;  2QKP A;  1VEU A;  1V9Z A;  5DJT A;  3UE1 A;  1BUE A;  1MWR A;  5CXW A;  3R7W B;  1H8Y A;  3G4P A;  2G2W A;  4OH0 A;  2ZC3 B;  5CRF A;  2VGJ A;  2BLS A;  1N9L A;  1FCM A;  1AWI A;  2B18 A;  2XA7 M;  2EWW A;  3EQU A;  4GKU A;  4GLQ A;  3IWQ A;  3S7P A;  5HPI A;  1MZU A;  2W3F A;  2WYX A;  4EBL A;  3T4L A;  3O3V A;  2XFT A;  3QHY A;  3F1N A;  3NCK A;  4JF4 A;  2OWH A;  5FAO A;  3LIB A;  2Y59 A;  2IWD A;  1PZP A;  2HJ9 C;  3CUE C;  1L0F A;  3T4K A;  3D3O A;  5HWT A;  3IBJ A;  2VKS A;  2V20 A;  4YFM A;  2XLN A;  5G4Y A;  4PAU A;  3MQQ A;  5GLA A;  3VP1 A;  4LCL A;  3C2W A;  2LB9 A;  4DRT A;  1MY8 A;  4DE3 A;  3UB7 A;  3FPV A;  3C4O A;  1FCO A;  4XXR A;  3ZDJ A;  2QHK A;  5KSC A;  4S2N A;  3BRM A;  3RH8 B;  3DTI A;  1BLC A;  5GLC A;  4XT2 B;  5HDS A;  2K31 A;  1T18 A;  3EEH A;  3D9Y A;  3SH7 A;  1DP8 A;  1BLP A;  1IYP A;  4G3V A;  5FQI A;  3E4P A;  3QP8 A;  2GJ3 A;  1PI4 A;  3PAG A;  1WA9 A;  1M6K A;  4II7 A;  5HAR A;  3E4Q A;  5J8X A;  3ICY A;  5F69 A;  3Q7Z A;  2D02 A;  4FH4 A;  3EGD C;  3M6H A;  1YSQ A;  4P6Z M;  3GDI A;  1CEF A;  3CHW P;  1OTA A;  1RGZ A;  2EFX A;  4KQO A;  1DJC A;  3QP6 A;  3IF6 B;  2JC7 A;  2MJ6 A;  4C6Y A;  1L0G A;  2OSU A;  5JYP A;  3A3E A;  5F6A A;  1YLZ A;  2JKG A;  5AQ7 A;  3ISG A;  5KMW A;  4PHT A;  2XFS A;  2HDS A;  5DTT A;  5CHM A;  5TJJ A;  3UDF A;  2ZC6 B;  3KX0 X;  3F1O A;  4KG2 A;  5M1A A;  3U2A A;  5U47 A;  2JE5 A;  3ZVT A;  5CED A;  4NK3 A;  2V8F A;  5DFY A;  3M2K A;  1TD5 A;  1HZO A;  4WL9 A;  5CTN A;  2ZJ9 A;  3H82 A;  3MSH A;  1XGJ A;  2XA7 S;  1G68 A;  3GRJ A;  1CEG A;  3OPR A;  3L7H A;  4E3K A;  1DJA A;  3RXW A;  3LR4 A;  5FAQ A;  1C3B A;  3NOP C;  1FR1 A;  1YQS A;  1P0Z A;  5DF9 A;  3LI9 A;  4EV4 A;  3RFB A;  1S1Y A;  2YKF A;  3MZE A;  2Y2L A;  3GEC A;  5J7E A;  2WAD A;  4JGO A;  5EVE A;  2GZA A;  4E3I A;  4X6T A;  1ODV A;  1IEL A;  3M2J A;  2KOI A;  3IWO A;  1FSY A;  1GA0 A;  3BFC A;  1NLZ A;  1RP5 A;  3T1R A;  4B4Z A;  1G28 A;  1I2W A;  3PXP A;  4Z1W A;  2HDQ A;  2P08 A;  3DWZ A;  1PRQ A;  4HY8 A;  3HJI A;  4IBR A;  1K4F A;  4BD1 A;  4EQI A;  2WGW B;  4BJP A;  4CLC B;  1NRJ A;  3G30 A;  1PWD A;  4HH3 A;  1K54 C;  5FL3 A;  4WLA A;  3UPN A;  4KZ4 A;  3V5M A;  1ONH A;  3U4L P;  3QNC A;  4O0P A;  3IT9 A;  3MBZ A;  4MNR A;  4P87 A;  5E2G A;  2Y2P A;  3Q7V A;  3VP3 A;  4I5S A;  4MCW A;  4A5R A;  1ONG A;  4JF5 A;  2WGI A;  5LBR A;  4HBT A;  1W5D A;  4LV1 A;  3WS0 A;  1KDW A;  3BLS A;  1ACF A;  3A3F A;  2O9A A;  3K3C A;  4LV0 A;  4OPY A;  3C4P A;  1K55 C;  1FSW A;  1N4O A;  3IQA A;  1OTI A;  3VV4 A;  1NRF A;  5IU1 A;  5HX9 A;  4O7D A;  4OQ0 A;  4AFI A;  5EM1 A;  5A8B A;  3A3J A;  4C75 A;  3A0R A;  4FH2 A;  3V50 A;  4BL3 A;  5EE8 A;  1TEM A;  2I72 A;  3FZC A;  4N92 A;  1JWP A;  3BJN A;  4U3T A;  1HLU P;  5AQA A;  1SKO A;  1IKI A;  1RGY A;  4Y5F A;  4HQA A;  3OCN A;  5HWV A;  2W1T B;  2P74 A;  3N6I A;  4ARZ A;  2JKR I;  3RXX A;  3W4P A;  2J7V A;  3IS2 B;  2WUQ A;  2AVX A;  4KEN B;  4JXV A;  4ZJ3 A;  4WF0 A;  1TDG A;  5A90 A;  1N9B A;  5CER A;  3HLW A;  3BQA A;  5FAP A;  3Q82 A;  4S2K A;  1H8Z A;  2XD5 A;  5DJU A;  1OT6 A;  4PKY A;  4X55 A;  1JTD A;  5HDD A;  4QJG A;  1K6R A;  2EX6 A;  4NG2 A;  3H9W A;  5FDH A;  3T4J A;  3MQO A;  3IWI A;  4GD8 A;  5CGX A;  4S2P A;  2A2L A;  4WEJ A;  3LR0 A;  4DE0 A;  1G5U A;  2IA2 A;  4F94 A;  2KDK A;  4NET A;  3MFD A;  1NWZ A;  4H6J A;  3UE0 A;  2BG1 A;  3K3D A;  5K5B A;  1GHI A;  2KLI A;  4JF6 A;  5FA7 A;  2R9X A;  4MLL A;  3S1Y A;  3TRC A;  3BLM A;  2A24 B;  4GHI A;  3A3D A;  3ZGA B;  4LLO B;  3T4T A;  2B95 A;  4GJ4 A;  3KSF A;  3LO7 A;  2Y2Q A;  4RQ9 A;  3GV9 A;  2ZQA A;  4ESP A;  1E3U A;  2VX8 A;  1XFN A;  3CZD A;  5HWW A;  4HP4 A;  5F1G A;  2GNX A;  1E3U D;  4WBG A;  4HBU A;  4PM7 A;  2XR0 A;  4CPK A; 
#chains in the Genus database with same CATH homology
 4NXF A;  2ZMF A;  2M7U A;  2W0N A;  1G6O A;  3BY8 A;  1GSV A;  4O01 A;  4ETX A;  2HF6 A;  2P7J A;  2K2N A;  4OOL A;  2J80 A;  3C8C A;  5HPF A;  4EEU A;  2VV6 A;  2EA9 A;  1F98 A;  2G7U A;  1N9N A;  1VB6 A;  1T1A A;  4DJ2 A;  4IHQ A;  2QJ5 A;  2QJ7 A;  1JNU A;  3H7W A;  1H8M A;  4EUV A;  1MC0 A;  4F3L B;  1YSP A;  2PDR A;  3R7W A;  4EET B;  2QKP A;  1V9Z A;  5DJT A;  1LSV A;  1LSW A;  3KYZ A;  3H7W B;  4NEE D;  3R7W B;  3R4K A;  2R78 A;  4MN6 A;  4WEK A;  2FZ0 A;  4BBT A;  3PBS A;  3D72 A;  4NXE A;  1N9L A;  4Y3I A;  4FSF A;  2L0W A;  4EXO A;  3KSG A;  2B18 A;  1UWP X;  4UQI M;  2CMN A;  1OJG A;  2HGV A;  2QYB A;  2EWW A;  2XA7 M;  2XRN A;  1VHM A;  3EQU A;  4O8G A;  4BBU A;  4GLQ A;  5KIZ A;  2Z6C A;  5HDC A;  3S7P A;  5HPI A;  1MZU A;  2W3F A;  4LRY C;  2B02 A;  1GSW A;  3T4L A;  4HJ3 A;  2XSS A;  2W27 A;  2HV1 A;  3EEA A;  3F1N A;  2OWH A;  4WUJ A;  4UEY A;  5HD3 A;  3LIB A;  3BWL A;  2VLG A;  1XJ2 A;  3ULF A;  3C38 A;  2HJ9 C;  3CUE C;  3T4K A;  3D3O A;  1MKM A;  5HWT A;  3F1N B;  4YOF A;  3IBJ A;  4YWZ A;  1YKD A;  2P04 A;  1IFQ A;  2VKS A;  2VV8 A;  4EES A;  2ZBB A;  4Q0J A;  5G4Y A;  4ZRR A;  4PAU A;  2PYR A;  1OPX A;  3MQQ A;  4EQ1 A;  2J3T C;  1H3Q A;  1TF1 A;  3C2W A;  3LIA A;  2LB9 A;  3UB7 A;  5HSQ A;  3S7Q A;  3FPV A;  3EGX C;  1DP9 A;  5AVF A;  5IS1 A;  2DMW A;  2QHK A;  3LFV A;  3C30 A;  3CI6 A;  3RH8 B;  1P9R A;  2OAP 1;  4FOF A;  4CQH A;  4XT2 B;  5HDS A;  3CIT A;  2K31 A;  3PBQ A;  4HJ6 A;  1XJ4 A;  1T18 A;  3E98 A;  3EEH A;  2O9B A;  1DP8 A;  2W1R A;  1D06 A;  5AVE A;  4DJ3 A;  3VOL A;  3F1P B;  3NJA A;  4G3V A;  1OTE A;  1TS6 A;  1X0O A;  2V0U A;  3E4P A;  3FPW A;  5DKL A;  3OLO A;  2GJ3 A;  4B93 A;  2V1A A;  2JHE A;  2W3H A;  1WA9 A;  1D7E A;  3OOV A;  4II7 A;  3IBR A;  3E4Q A;  4PKY G;  4P6Z S;  3ICY A;  4I3A A;  5F69 A;  2D02 A;  4G3K A;  1TS8 A;  3EGD C;  5J4E A;  4MMN A;  2ZOH A;  1YSQ A;  4P6Z M;  3GDI A;  3OCL A;  1OTA A;  1OTD A;  1S4S A;  3LIC A;  3CUE A;  4KQO A;  4EU0 A;  2M1C A;  3MMH A;  2MJ6 A;  2WKR A;  5F6A A;  1V9Y A;  3E0Y A;  3P01 A;  4F3L A;  3LIE A;  4PHT A;  3TE8 A;  1XJ3 A;  5TJJ A;  2D01 A;  4NXB A;  3KX0 X;  1S67 L;  1OTB A;  1EW0 A;  4CLC C;  2O99 A;  3F1O A;  3T4Q A;  4DMZ A;  2PR6 A;  1UGU A;  3O5Y A;  2J3T D;  3U2A A;  3LIF A;  3G6O A;  5L8M A;  5DFY A;  2PD8 A;  2VGL M;  1TD5 A;  3F1O B;  3MF0 A;  4IUK A;  3NHQ A;  4I38 A;  4WL9 A;  3KYQ A;  4R70 A;  4UQI S;  5F5Y A;  3H82 A;  3UMD A;  5HZH A;  2XA7 S;  4GS9 B;  4EEP A;  4DN0 A;  1N9O A;  3VE3 A;  1LSX A;  2OWJ A;  5AJG A;  3RTY A;  4L9F A;  3H82 B;  2VZW A;  3LR4 A;  3NOP C;  3K2N A;  2PR5 A;  1LL8 A;  1P0Z A;  4BMW A;  5DF9 A;  3LI9 A;  3RFB A;  3PBR A;  5F68 A;  4MN7 A;  1ZTU A;  1S1Y A;  2YKF A;  3KO6 A;  1F9I A;  2LB5 A;  5I5L A;  1W63 M;  3BY9 A;  3MJQ A;  4M4X A;  3GEC A;  4HP9 A;  1TS7 A;  5J7E A;  2HJE A;  4JGO A;  2O0Y A;  2GZA A;  2O9C A;  2VV7 A;  1ODV A;  3FG8 A;  2OAQ 1;  3LUQ A;  4KUK A;  1BYW A;  4I39 A;  3PBT A;  2L1M A;  4GW9 A;  3S7N A;  2W3D A;  2KOI A;  3KSH A;  3HCY A;  3LR5 A;  1NLZ A;  3TJZ C;  3EWK A;  4XT2 A;  1G28 A;  1IOU A;  3PXP A;  4Z1W A;  3W2Z A;  2P08 A;  4HY8 A;  3T4S A;  3HJI A;  2WKP A;  4BBV A;  3F1P A;  1P9W A;  2JN7 A;  3EOI A;  2J3W A;  4IJG A;  4BJP A;  3PR6 A;  4CLC B;  1NRJ A;  4JGR A;  5IT5 A;  4LRZ E;  2YKH A;  3ZYT A;  4L9G A;  2PD7 A;  3MQ0 A;  4HH3 A;  2KX6 A;  4CLC D;  3E4O A;  5FL3 A;  4WLA A;  5HL6 A;  4BWI A;  4O0P A;  1DRM A;  1S66 L;  2W3E A;  4R3A A;  1UWN X;  2VA0 A;  4I5S A;  4MCW A;  3S7O A;  1DP6 A;  3CLO A;  5G4Z A;  5J3W A;  3LR3 A;  5LBR A;  2JKT I;  1STZ A;  2M7V A;  3UE3 A;  3UE6 A;  2GX5 A;  4NKP A;  3OBF A;  4B9O A;  2ZOI A;  2O9A A;  3K3C A;  4IUH A;  4OOM A;  5KSH A;  4G3W A;  5DFX A;  4QPR A;  1OTI A;  2K7S A;  3VV4 A;  3UB9 A;  4CLC E;  4L0L A;  5IU1 A;  4AFI A;  2V1B A;  4L9E A;  4HOI A;  5A8B A;  4NXG A;  1S1Z A;  1TS0 A;  3A0R A;  1OT9 A;  3NOT C;  4GCZ A;  4LPZ A;  2W1T A;  4EW7 A;  3BJN A;  2OOL A;  1OJ5 A;  3T4O A;  3MR0 A;  2VGL S;  4HHD A;  4Y5F A;  4HQA A;  4GS9 A;  3OCN A;  5MC7 A;  3PYP A;  3VE4 A;  3IS2 A;  5HWV A;  2W1T B;  3A0V A;  4ARZ A;  2I9V A;  3OC2 A;  4HIA A;  5CX7 A;  4ETZ A;  2JKR I;  3EQV A;  4JGP A;  2NUT C;  3IS2 B;  1ZHH B;  4ARZ B;  1XJ6 A;  4JGQ A;  2WKQ A;  4WF0 A;  3TW8 A;  4KQD A;  2PYP A;  2JKT M;  2FH5 A;  4MN5 A;  3UME A;  3HJK A;  2QWS A;  3ZQ5 A;  4KUO A;  3BQ8 A;  3BQA A;  2BAS A;  3FC7 A;  4E04 A;  2Y79 A;  3MXQ A;  4WN5 A;  1KOU A;  3LYX A;  4HNB A;  2V9A A;  5DJU A;  1OT6 A;  3KSI A;  2VJW A;  2Y8H A;  4PKY A;  5HDD A;  3MFX A;  1S4R A;  4I3I A;  2VEA A;  4R6L A;  3A0S A;  1W63 Q;  3H9W A;  4MDZ A;  3T4J A;  1XFQ A;  3MQO A;  4YNR A;  5EFW A;  4EER A;  5C5K A;  3PBO A;  3LI8 A;  2A2L A;  4WEJ A;  3LR0 A;  2IA2 A;  2KDK A;  1GSX A;  4LRX C;  1F5M A;  1NWZ A;  5HD5 A;  3LID A;  5TBM A;  3BW6 A;  2H28 A;  3CWF A;  4H6J A;  1Y28 A;  3PBN A;  2A24 A;  3UB8 A;  4CLC A;  3K3D A;  5K5B A;  1P97 A;  5TBM B;  2KLI A;  2JKR M;  3SW1 A;  4H6J B;  2ZMV A;  3V67 A;  2L4R A;  3TRC A;  3B33 A;  3JVV A;  1T1C A;  2PT7 A;  2A24 B;  4HH2 A;  4GHI A;  2NUP C;  3CAX A;  2PHY A;  4ME4 A;  3B42 A;  3NOU C;  3UB6 A;  2V0W A;  4HJ4 A;  1NLY A;  4LLO B;  3P7N A;  3T4T A;  2XRO A;  4GHI B;  5DKK A;  4GJ4 A;  4I3J A;  3KSF A;  3PHY A;  4RQ9 A;  3DBA A;  1YAX A;  4Y2F A;  4HI4 A;  3JVU A;  4R38 A;  1T19 A;  2Z6D A;  2VX8 A;  1XFN A;  4Q0I A;  4K08 A;  1T1B A;  5HWW A;  2W3G A;  4Q0H A;  1LT0 A;  4HP4 A;  2GNX A;  4WEL A;  2INW A;  3T50 A;  2EWV A;  3B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...