4GHIB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a benzoxadiazole antagonist
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Allosteric inhibition of hypoxia inducible factor-2 with small molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ghiB01
2PYPA 5J7EA 3LI8A 2A24A 3EWKA 3K3DA 4F3LB 4GCZA 2D01A 1LSVA 5HWTA 1OTAA 5J4EA 4L9FA 1N9LA 4KUKA 2QKPA 1P97A 3NJAA 4HJ6A 3LIFA 1UWNX 4L9EA 5G4ZA 3E4OA 2V0WA 4DJ3A 1OT9A 3BY8A 1F9IA 1BYWA 3F1OB 4HOIA 1D06A 2PD7A 3LIAA 4HJ4A 3UB8A 3GDIA 2QWSA 5AVEA 5DKLA 4R6LA 2Z6CA 3A0SA 3MQQA 1N9NA 3A0VA 2PYRA 4JGQA 4JGPA 4LRZE 1S67L 1TS6A 2WKPA 4I38A 3VOLA 2ZOIA 4JGRA 2JN7A 4GHIB 2QHKA 1OJ5A 2Z6DA 4HJ3A 4EQ1A 2V0UA 3FG8A 1GSXA 1VB6A 1EW0A 4WUJA 3MJQA 3C2WA 4I3JA 4LRYC 3BWLA 2INWA 4I3IA 1GSWA 3MFXA 2JHEA 1XFNA 1OT6A 3BY9A 2A24B 5TBMA 1OTEA 3PYPA 1N9OA 3F1PA 1TS8A 2PR6A 4HP9A 1LSWA 2VV6A 2HV1A 4HNBA 3E4QA 3LIDA 3UE6A 2OWHA 4LLOB 4HHDA 3HJKA 2L4RA 3MXQA 4PKYG 4EXOA 3SW1A 4LPZA 2H28A 3HJIA 3H7WA 2V1BA 4EEUA 1OTIA 4I5SA 3NOTC 3CLOA 3IBRA 4EW7A 1T1AA 1LT0A 1MZUA 2L0WA 4R70A 4I39A 3G6OA 3LUQA 1T1BA 3LIBA 2PDRA 4PKYA 2W0NA 2PD8A 3ULFA 3PHYA 5F5YA 1X0OA 3GECA 1T19A 5F6AA 4BBTA 3IS2B 1S4RA 2R78A 1GSVA 2OOLA 5EFWA 5F69A 4XT2B 4DJ2A 1S4SA 4WF0A 3LIEA 2VEAA 4MN6A 4HI4A 5TBMB 3F1PB 4EERA 3UMEA 1S1YA 4R3AA 5HDCA 4M4XA 4E04A 5IU1A 2I9VA 4K08A 4WN5A 4HQAA 4BBVA 4EETB 3ICYA 2GJ3A 2PR5A 1JNUA 1TS0A 1OJGA 4WLAA 3H7WB 3E4PA 1XJ4A 3FC7A 3UB9A 2PHYA 2WKRA 2P7JA 5HD5A 1ODVA 4KUOA 5G4YA 5HDSA 3EEHA 3H9WA 4EEPA 3ZQ5A 5F68A 4EESA 4HH2A 1WA9A 2ZBBA 4HIAA 3H82A 1T18A 1XJ6A 1UWPX 2BASA 4GS9A 4YWZA 5HDDA 3VE4A 1DRMA 2M1CA 2EA9A 1S66L 4RQ9A 2YKFA 2OWJA 1XJ3A 5I5LA 1OTDA 1DP9A 5J3WA 4HH3A 4H6JA 3LICA 3LYXA 1DP8A 4HP4A 5HD3A 3MR0A 4NXFA 1XFQA 2B02A 4BBUA 1NWZA 2VLGA 3B33A 3NHQA 4KQDA 4WL9A 3NOPC 4LRXC 1KOUA 4MN5A 3MQOA 2VV8A 3F1NA 4NXEA 1D7EA 1T1CA 4I3AA 3UMDA 2VV7A 3P7NA 3T50A 5KIZA 3A0RA 5HWWA 1F98A 4JGOA 4F3LA 4GW9A 5DJTA 4B9OA 2L1MA 1S1ZA 3UB7A 4R38A 3UB6A 2YKHA 5IS1A 3VE3A 2QJ7A 3KX0X 1XJ2A 2QJ5A 3IS2A 3H82B 3K3CA 3OLOA 4GS9B 5AVFA 3F1OA 4XT2A 2J80A 1TS7A 1V9YA 1V9ZA 1OTBA 2CMNA 1UGUA 2KDKA 4HY8A 1LSXA 3CWFA 3LI9A 1Y28A 2WKQA 2V1AA 5HSQA 4H6JB 5HZHA 3NOUC 3CAXA 1P0ZA 4GHIA 5DKKA 1LL8A 2V9AA 5DJUA 4NXBA 3RH8B 2D02A 2ZOHA 3RTYA 5HWVA 4L9GA 3C8CA 2W27A 1DP6A 2KX6A 4NXGA 5A8BA 3F1NB 1G28A 3D72A 2K7SA
chains in the Genus database with same CATH superfamily
2PYPA 2PU2A 5E2GA 4PM6A 2HJ9C 1TD5A 2DMWA 4GCZA 2D01A 1SDEA 1LSVA 2JE5A 3HLWA 5EOEA 4S2MA 5J4EA 1NYYA 5IT5A 3S1YA 3QP2A 2QKPA 2Y2HA 4MEZA 4OLGA 4PAUA 5FAPA 5G4ZA 1I2WA 2ZQ7A 2K2NA 3E4OA 1PWGA 5L8MA 5TGFA 4OPRA 4DJ3A 4S2KA 3KYZA 1YLWA 5A90A 1YLJA 1ZG6A 2VX8A 2OAP1 2BTFP 1VHMA 3GDIA 5G18A 5EV0A 2FZ0A 3A0SA 2EWVA 3O5YA 1N9NA 4ZJ2A 3E98A 1FSYA 2HDQA 2O9AA 3S7OA 1KGGA 2XFSA 2WKPA 1LHYA 1MKIA 1YMXA 3VOLA 2CC1A 3VMAA 3DTMA 4GHIB 5GLAA 4EU0A 2EWWA 3MFDA 3TG9A 3VOYA 1JWVA 4S2NC 4HJ3A 4EQ1A 2V0UA 1SZVA 2J7VA 1LI0A 1RP5A 3FG8A 3KSHA 4IBRA 4S2LA 2ZC6B 3MMHA 1IEMA 3CZDA 4RA7A 3IBJA 3ZDJA 4QPRA 2JKFA 4I3IA 4QHCA 4MBKA 3BY9A 5FQMA 3PAEA 5BOHA 4YINA 2PR6A 4S2NA 1BLSA 3B3XA 3RJUA 3ZCZA 1LSWA 2ZM2A 4FOFA 3NECA 3E4QA 4P6BA 5A92A 4ME4A 3PR6A 4LCLA 1Y4OA 2L4RA 3DBAA 2P08A 2EX8A 3MXQA 4WMCA 4PKYG 4EXOA 4LPZA 2H28A 2ZD8A 4GD6A 3CI6A 4EEUA 2Y91A 3C7VA 3CLOA 3M6BA 2G2WA 3JPUA 3C30A 2B18A 3BFFA 2XFTA 3EOIA 1G6AA 3MQ0A 5AQ7A 3I7JA 4OKPA 5CXWA 3BLMA 1U60A 4R70A 2Y4AA 3LUQA 1T1BA 1H8ZA 2PDRA 4CLCE 2LB9A 5C5KA 1E25A 5F5YA 1NRJA 1QMEA 1T19A 3GECA 4EUZA 2B5RA 4KG5A 3IS2B 2R78A 3FYZA 3LY3A 4ETXA 3FKWA 2C5WB 1M40A 3EGDC 1LI9A 4S2JA 2VEAA 4KZ8A 3D9YA 3UMEA 1STZA 1CF0A 2O99A 2WADA 3MZEA 5AQAA 4E04A 3Q7ZA 1W7FA 4HQAA 4KG2A 4E3OA 4MMNA 1PI5A 3D4FA 2PR5A 4DKIA 3LR3A 4P85A 3VP1A 1OJGA 4R0QA 3A3EA 3E4PA 3C5AA 1PFLA 3N8RA 3PBTA 5EM1A 3RFBA 1YPRA 3FC7A 3HREA 5HAIA 3UB9A 3ZG7B 2WKRA 5HX9A 4QU3A 5HD5A 3WRZA 4KUOA 4O8GA 2O9CA 2ZL1A 3EEHA 4HBTA 4ZJ3A 3TE8A 2VK3A 2PBYA 2R9WA 4EEPA 2V1ZA 4D60A 4WZ5C 3SH9A 4JKTA 1GCEA 4BD1A 4HH2A 4OLDA 2PU4A 2QMIA 3ZG9B 1ERQA 1WA9A 2IWBA 2VJWA 3UNWA 2JBFA 2XGNA 4HIAA 2Y55A 3LO7A 1N4OA 3BYDA 1UWPX 3NBLA 2HP6A 5HDDA 4OH0A 3EQUA 3UB5P 3T4TA 1RCJA 4JXGA 5CHJA 3VE4A 4ESPA 3Q7VA 5KSCA 1S66L 4RQ9A 1XJ3A 4CLCD 4UHUA 5J3WA 3HBRA 4Y7PA 3LICA 4DDYA 1ZHHB 4HP4A 5HD3A 4Y13A 1MWRA 3MR0A 3ISGA 3PAGA 2ZQCA 2BLSA 4BBUA 1FR1A 2ZQ9A 2KLIA 3WS2A 5EVID 1NJ4A 4KQDA 3CJMA 3NOPC 3MQOA 4GJ4A 4O0PA 1NZUA 3G35A 2Y2LA 1K4EA 5FAQA 4NXEA 1D7EA 1T1CA 4I3AA 3TJZC 3UMDA 2W1TB 3P7NA 4X6TA 4P0MA 4U0XA 4K91A 5AQBA 4GKUA 2L1MA 1S1ZA 4PM9A 2YKHA 4P6ZS 2Y2NA 5IS1A 1YLTA 1JTGA 4BQMA 3ZG8B 3EQVA 3HLDA 5HL6A 4N1XA 1JWPA 2JKTI 1XJ2A 3KX0X 4Q0JA 5E43A 3K3CA 4KZ4A 2PAVP 1SDNA 3LCEA 1OPXA 3W2ZA 4JF5A 5E2EA 4XT2A 4ZAMA 2ZC7A 1V9YA 1OMEA 1OTBA 3VP0A 1UGUA 3Q7VB 3MS6A 3CWFA 5HAQA 1Y28A 1K57C 1I5QA 4CJNA 3L9KA 1GHIA 3CAXA 1XPBA 4B4ZA 4OOLA 5DJUA 3BFCA 4HEFA 2XR0A 3O3VA 4MCWA 5A8BA 2XD1A 3P01A 2JCHA 1K6SA 5E2HA 3IWQA 1K57A 4LGWA 2K7SA 4WEKA 5HW3A 3QNBA 3WWXA 3LI8A 2A24A 1MC0A 5FQQA 4K0XA 2XK1A 4WZ4A 3OCLA 3UDFA 5HWTA 1OTAA 1SCWA 4L9FA 1N9LA 2ZM0A 4LV2A 5L10A 4HJ6A 3LIFA 3U4LP 2P04A 4Z1WA 3GMWA 1HD8A 1OT9A 4CQHA 3BY8A 1F9IA 1TEMA 1NZOA 3UB8A 2FH5A 3QP8A 4PMAA 5KMWA 5DKLA 2V8FA 5FI2A 5M18A 5CHMA 3R4KA 2XLNA 4O7DA 3PBRA 2XSSA 1XA7A 1MKMA 1JTDA 2JN7A 4GD8A 2V20A 3DW0A 3ZVWA 2KOIA 4E3LA 2ZMFA 4KZBA 3S22A 2W3EA 1VB6A 1EW0A 4MBFA 3MJQA 4UQIS 4LCMA 2INWA 3C4OA 4IEDA 1GSWA 3HLGA 2JHEA 3IXGA 3MFXA 3KSGA 2A24B 3C7UA 4KZ5A 1PZPA 2ZQDA 5DF9A 4HP9A 1BT5A 5FQJA 3IWOA 4XUZA 3DTIA 1C3BA 2QZ6A 3M2JA 3FWLA 3HLEA 3KSFA 2K31A 2HZ5A 2H10A 2OWHA 4JBFA 4HHDA 3HJKA 2DCFA 3FPWA 5EECA 2Y2KA 4OOYA 5F82A 2Y8HA 1K0KA 2EFXA 2NUTC 2EXBA 1VEUB 4WEJA 3W4QA 3LR5A 1DJAA 1VETB 2M7VA 2X71A 3GV9A 4ARZA 4BL2A 4I5SA 3NOTC 3IXDA 3S7PA 4EW7A 1T1AA 3QHYA 2XA7S 2GNXA 1PYYA 1MZUA 3QNCA 4R4SA 3OOVA 3BW6A 2WKIA 5IHVA 4PKYA 3NDGA 4E6WA 2W0NA 2EX9A 2PD8A 4YFMA 3E2LA 5F6AA 3LR0A 3S4XA 3C38A 3AGDA 5CECA 5F1FA 1KGFA 4E3NA 3Q07A 2E8IA 4C6YA 3RXWA 3MXRA 4UA6A 3HCYA 5D3OA 4MN6A 2DRWA 4QWOA 5K5BA 4R1GA 3MKEA 1MBLA 3L7HA 5GLDA 1CQAA 3IF5A 1YSPA 2G7UA 3WS0A 4Y15A 4EERA 3G32A 5CHUA 2Y59A 1P9RA 1E4DA 1ES4A 4FH4A 1P9WA 1YSQA 4M4XA 5AQ9A 1ESUA 3ICYA 4DDSA 2EXAA 3Q82A 4FD8A 5EE8A 4Q0HA 4E3MA 1JNUA 5F1GA 1NLYA 2EX2A 4JLFA 5TR7A 2GZAA 3N7WA 1HVBA 3B47A 3IX8A 2H0YA 3T4SA 2ZC5B 3IX3A 1PRQA 1K54C 1IELA 2PHYA 1FSWA 1ODVA 4KQQA 1CEGA 1FCNA 1W63Q 2VGJA 5G4YA 1L0EA 5HDSA 3O86A 3OPHA 4FUWA 4G3VA 2Y2OA 3KO6A 5JYOA 3ZQ5A 4OQGA 5FI6A 1NYMA 3PBSA 1BLPA 5HPIA 1K54A 3D3OA 3T4LA 2ZBBA 2BG1A 1GHPA 1T18A 1Q2QA 5DTTA 3NDEA 2J3TC 3GVBA 3BFEA 4R3JA 1XGJA 2WGWA 1ESIA 4C3QA 4NKPA 1DRMA 5DF7A 1HTZA 4BJPA 4D2OA 4RYEA 5I5LA 4Q0IA 4EBPA 1DP9A 4P6ZM 4QY5A 4DN0A 1F2KA 4OPZA 1MY8A 5DF8A 4ZJ1A 1NWZA 3FV7A 5J8XA 4WL9A 1TDLA 2WYXA 3IF6C 1ERMA 1KOUA 1SHVA 4OONA 1PW8A 3R7WA 4IBXA 1H8YA 2VV7A 2V8CA 3A0RA 1F98A 5M19A 1XKZA 1QMFA 5DFXA 4F3LA 3KSIA 4BMWA 1MXOA 2P9VA 5DJTA 3IF6A 2VGLS 2O9BA 3WS1A 2ZMAA 2JKTM 4Y0OA 2J3WA 2HF6A 2W3GA 1IYOA 3VSLA 2EFUA 3UPPA 2WZZA 4KZ3A 4B88A 1YM1A 4PPRA 1FILA 5A93A 4HESA 1JWZA 4PM8A 3BFGA 1KE4A 1ZG4A 4OP8A 2V1AA 3LEQA 5HSQA 3NOUC 3IXHA 1ES5A 2OSUA 4OQHA 3LFVA 3A3JA 1CJFA 4KZ9A 3C4PA 1PNEA 4NXBA 2MJ6A 4A5RA 4ZRRA 2ZOHA 1VQQA 3C8CA 2W27A 3VP2A 2KX6A 1G28A 1L0DA 2RCXA 3T4OA 4II7A 3BM6A 2VA0A 3BQ8A 3HL9A 4N92A 4F3LB 4UEYA 3UE3A 2XH9A 2WAEA 2P9VB 3IF6B 3P09A 3U2AA 1YQSA 3VFHA 3HUOA 3NY4A 3E0YA 2FFFB 5EVEA 4U0TA 2XRNA 5F83A 4UQIM 3A3IA 4DRTA 3UDXA 1GA9A 5A91A 3UY6A 4R4RA 2ZL1B 5HFOA 4OPYA 4QD4A 4MNRA 1J3WA 4EWFA 4R6LA 2HDUA 4Y17A 2Z6CA 3FPVA 3AGFA 3ZGAB 3TRCA 5MC7A 3UDIA 2ZM8A 2AVXA 3FKVA 2PYRA 4JGQA 4JGPA 4LRZE 1TS6A 2ZOIA 5CGXA 3G2YA 4CLCA 1OJ5A 1IYPA 2Z6DA 2VGKA 2Q9NA 4KZ7A 3UE1A 1D1JA 2XA7M 4DXCA 1E3UA 3N8LA 4GDNA 4GOGA 4I3JA 4LRYC 5GLBA 4E3JA 2J9OA 4DE2A 3IX4A 2P74A 4GZBA 1CI8A 1XFNA 1OT6A 4FCFA 4Y2FA 4S2PA 4E3KA 3LEZA 4FSFA 1N9OA 1TS8A 1S0WA 1S6RA 4IUKA 4BLMA 2GDNA 3E2KA 1G68A 1BTLA 3PXPA 2HV1A 4HNBA 3LIDA 1K38A 4HBUA 4S2OA 4L0LA 3UE6A 3ZG0A 4LLOB 1NXYA 1PZOA 2QPNA 3ZNYA 5FEFA 2OAQ1 4EBNA 1NRFA 1TVFA 3SW1A 3WS4A 4K0WA 2R9XA 4B93A 4DMZA 3H7WA 1Y54A 1A0KA 2V1BA 1OTIA 3G4PA 3GR2A 1W63M 1WYBA 2PRFA 1LL5A 3NI9A 2EX6A 3G31A 1K25A 2ZLYA 5EVLA 2HP5A 2PT7A 1LT0A 1IOUA 2HJEA 1O7EA 4I39A 4E3IA 2A2LA 2WGVA 4E6XA 3W4PA 3PBNA 1X0OA 3PBOA 4BBTA 1BUEA 1S4RA 2ZC4B 1K55C 4XT2B 4DJ2A 4ETZA 1S4SA 5FDHA 3LIEA 3TSGA 4PM5A 4X69A 3OZHA 5CEDA 3QP5A 3OPLA 1SKOA 3OBFA 4LENA 3T12B 1S1YA 4R3AA 1K55A 1GHMA 3BFDA 3UPNA 2DNSA 2I9VA 5HAPA 4BBVA 3BRMA 2Q0OA 3OPPA 2Z2LB 3N4IA 4QB8A 1TS0A 3HLCA 2OV5A 1PW1A 1LLBA 3KYQA 5HPFA 4WLAA 3H7WB 3DTKA 3W4OA 3SOIA 1XJ4A 3IH9A 5CERA 1MWUA 1FR6A 1KVLA 4UAAA 3QP1A 1KVMA 1CEFA 2WUQA 3H9WA 4JXWA 3HUNA 3VOZA 3M6HA 3IHAA 3V50A 2W1RA 4GB7A 3GRJA 2Y2IA 3IH8A 2J9PA 5F68A 5CGWA 4X1MA 4F94A 5FQIA 1RGYA 5JYPA 2G2UA 1YLPA 1JVJA 3H82A 3CHWP 4X53A 2BASA 2Y2MA 1AWIA 4MN7A 2ZJ9A 4YWZA 1F5MA 2WGIA 1XGIA 4JXSA 1FIKA 5FQKA 2VGLM 3MZDA 3MF0A 3HVFA 2EA9A 3CITA 2A3UA 2YKFA 5DVAA 1SKOB 2XROA 4IJGA 3IWIA 1YLYA 4HH3A 4H6JA 4R23A 4MDZA 5EUAA 3MXSA 1YKDA 3LYXA 4NG2A 5E2FA 4KZ6A 4NXFA 1XFQA 1YAXA 5FSRA 2IWDA 4GN2A 4N1HA 4N9LA 3NHQA 3DTEA 1BLHA 1CI9A 4XXRA 3SZTA 1K56A 3F1NA 3UO9A 3JVUA 1KE3A 1L0GA 1FQGA 2JKRM 3S7QA 5HWWA 3T4JA 2Y2QA 4WMCD 3BLSA 1IYQA 2HDSA 2JC7A 1Q2PA 4WELA 4PM7A 3UB7A 4R38A 3UB6A 5FI7A 3IT9A 3PTEA 3VE3A 3CPTA 2Y2GA 4ARZB 1ALQA 3IS2A 3H82B 2HDRA 4AFIA 4OOMA 4NEED 2HPBA 1KDWA 3F1OA 1IKGA 2J80A 5L2FA 2WAFA 1TS7A 2W3DA 1V9ZA 5L07A 4RX2A 2CMNA 3SH8A 4N9KA 3JVVA 2E8JA 2ACGA 4HY8A 5HARA 1LSXA 3LI9A 4ZBEA 5AJGA 2J3TD 3OC2A 2WKQA 4H6JB 2XD5A 2VKSA 3LGOA 2B95A 1ONHA 3V3RA 1P0ZA 4GNUA 1ES2A 3DAVA 5FDSA 1WE4A 3ZYTA 3RH8B 2XQZA 2VZWA 1YMSA 5HWVA 2WK0A 2WZXA 1RGZA 3ZVTA 3RXXA 2XDMA 3DWZA 4Y5FA 4ZDXA 3F1NB 2WKHA 2LB5A 1DY6A 2H0TA 3D72A 5M1AA 1XX2A 3T1RA 5J7EA 4Q8IA 4LV0A 5FA7A 3EWKA 4OQIA 3K3DA 1M6KA 4KENB 1FCOA 4OQ0A 5CTMA 3MKFA 1NLZA 1L2SA 1J9MA 2OLUA 3SS3A 1EROA 5FAOA 4KUKA 1P97A 3NJAA 4LV3A 1UWNX 1ES3A 4S2IA 3JYIA 1KGEA 3QP6A 4L9EA 3CPTB 1WYCA 2NUPC 3VSKA 4X1LA 3V67A 2V0WA 4KZAA 4Z9QA 1PWDA 4BENA 3GSGA 1IFQA 1BYWA 3F1OB 3QP4A 4HOIA 1D06A 2PD7A 4ZTKA 3LIAA 4HJ4A 3ZHHA 4C75A 2QWSA 5AVEA 3TOIA 1W8QA 2OLVA 1DJCA 3NIAA 2JKRI 3NC8A 4DE0A 3MQQA 4GLQA 4IHQA 3A0VA 1GA0A 4B4XA 4BD0A 1TDGA 4Y0TA 1O07A 1S67L 4I38A 1CK3A 4JGRA 1W8YA 2QHKA 1LL9A 1DJBA 5LBRA 1GSXA 2IWCA 2WGWB 3CUEC 3MSHA 2M7UA 3T1SA 4WUJA 3OPRA 4WYYA 1MPLA 3C2WA 3WRTA 3DWKA 4WBGA 4X25A 4XUXA 3BWLA 1TF1A 2J8YA 5GHZA 1AXBA 3WS5A 5TBMA 1OTEA 1BSGA 3PYPA 3F1PA 2W1TA 3G30A 1MWTA 2VV6A 5KSHA 3CUEA 4JF6A 4ID4A 4U3TA 2FFYA 1YLZA 1H5XA 4LV1A 2GX5A 3BECA 1XP4A 2JKGA 3ZFZA 2UWXA 3R7WB 3HJIA 1G5UA 2WKEA 4G3WA 1BZAA 1XA1A 2IA2A 2H5SA 3IBRA 3IQAA 4EQIA 4WZ5A 1PI4A 3O88A 3BQAA 4X68A 5DFYA 5GHXA 5GL9A 5I94A 3NULA 2L0WA 1Z6FA 5EOOA 2RL3A 3G6OA 4WM9A 3LIBA 3B42A 3P98A 4KG6A 1VM1A 2W3FA 3ULFA 3Q81A 3PHYA 3A3FA 4QY6A 1IYSA 2ZMVA 4O01A 5CRFA 1E3UD 4EUVA 2Q9MA 3UE0A 4EBLA 4X55A 1GSVA 2OOLA 3N8SA 5EFWA 5F69A 3V3SA 5EPHA 4UA7A 3SS5A 4QJGA 1EI5A 3VFFA 4CPKA 4CLCC 4WF0A 1SKFA 1ZTUA 1YT4A 1L0FA 1H0MA 3BJNA 4OP5A 3K2NA 4EV4A 2V2FF 4HI4A 5TBMB 2X02A 3F1PB 5TFQA 3HLBA 1PWCA 1MWSA 5EVIC 4RVAA 5HDCA 4OPQA 3KYEA 3T4QA 2C6WB 2Z2MB 4UA9A 5IU1A 4H8RA 4K08A 3GTCA 1N9BA 4WN5A 3M2KA 4EETB 1ONGA 2GJ3A 1H3QA 1K6RA 4NETA 3UN7A 5L09A 4LFUA 5EM0A 5EVIA 3IHBA 5FATA 5FL3A 3LY4A 3MBZA 2PBDP 2P7JA 3S7NA 1FOFA 2ZQAA 3OCNA 4JF4A 2UV0E 3EGXC 5TJJA 1ZKJA 5FEGA 2O0YA 4EESA 3LR4A 5CTNA 4KQRA 4BL3A 3V5MA 4YOFA 4G3KA 2XF3A 3N6IA 1XJ6A 3BEBA 4GS9A 1FCMA 5U47A 1ACFA 5FQ9A 2M1CA 5CX7A 2OWJA 1OTDA 1ZC2A 1HZOA 5CGSA 1I2SA 1G6OA 1K4FA 4CLCB 1DP8A 1BLCA 1H8MA 1KDSA 1W5DA 2XEPA 3IXBA 3CMZA 2B02A 2Y2JA 2A49A 4MBHA 4R3BA 4OVDA 2VLGA 3B33A 5KZHA 4X56A 5CEBA 3O87A 3SH7A 4LRXC 4MN5A 2VV8A 3AGEA 3SS4A 5EVIB 3T1QB 4Y0UA 1VEUA 3ITAA 4M3KA 1VETA 3UPOA 4DE3A 4RX3A 4P87A 3T50A 5KIZA 2HP9A 4FH2A 4JGOA 3VP3A 2Y79A 3G34A 3CG5A 4GDBA 2QYBA 4GW9A 4B9OA 3A3DA 3EEAA 4YNRA 2I72A 3VP4A 1PIOA 3ZNTA 4JPMA 1XXMA 3G2ZA 2QJ7A 1W79A 1KE0A 3Q1FA 4JXVA 3W8KA 4FTXA 2QJ5A 2W3HA 3FZCA 3OLOA 3HLFA 4GS9B 4IVIA 4KQOA 1NY0A 5GHYA 4BWIA 5DTSA 5AVFA 4DXBA 1HLUP 4DE1A 5FASA 2ZC3B 2Y2PA 2HGVA 2KDKA 5GLCA 1L3LA 5DTKA 3MZFA 5HL1A 4IUHA 5HZHA 3PBQA 2X01A 3VV4A 3ZG5A 3HUMA 3ITBA 3GQZA 4MLLA 3T1XA 4GHIA 5DKKA 1LL8A 2V9AA 3TW8A 1K56D 2D02A 4Y3IA 4PHTA 3RTYA 4NK3A 1BULA 4L9GA 1EWZA 1IKIA 1DP6A 4NXGA 3T4KA 1Z09A 4IVKA 3V39A 3NCKA 2ZQ8A 4DF6A
chains in the Genus database with same CATH topology
2VA0A 2PYPA 5J7EA 3BQ8A 3LI8A 2A24A 3EWKA 1MC0A 3K3DA 2HJ9C 4F3LB 4UEYA 1TD5A 2DMWA 4GCZA 2D01A 3UE3A 3OCLA 1NLZA 1LSVA 3U2AA 5HWTA 1OTAA 5J4EA 3E0YA 4L9FA 5IT5A 1N9LA 4KUKA 2QKPA 1P97A 3NJAA 4HJ6A 3LIFA 1UWNX 2XRNA 4L9EA 4PAUA 5G4ZA 4UQIM 2NUPC 2P04A 2K2NA 3E4OA 4Z1WA 5L8MA 3V67A 2V0WA 4DJ3A 1OT9A 4CQHA 3KYZA 3BY8A 1F9IA 1IFQA 1BYWA 3F1OB 4HOIA 2VX8A 1D06A 2PD7A 2OAP1 3LIAA 4HJ4A 3UB8A 2FH5A 1VHMA 3GDIA 2QWSA 5AVEA 5DKLA 4R6LA 2FZ0A 2Z6CA 2JKRI 3A0SA 3FPVA 2EWVA 3O5YA 3MQQA 1N9NA 3TRCA 4GLQA 5MC7A 3S7OA 3E98A 4IHQA 2O9AA 3A0VA 3R4KA 2PYRA 4JGQA 4JGPA 4LRZE 1S67L 1TS6A 2WKPA 3PBRA 4I38A 3VOLA 2XSSA 2ZOIA 1MKMA 4JGRA 2JN7A 4GHIB 2KOIA 2QHKA 4EU0A 2ZMFA 2EWWA 4CLCA 1OJ5A 2Z6DA 4HJ3A 4EQ1A 2V0UA 5LBRA 3FG8A 2W3EA 1GSXA 1VB6A 2XA7M 3CUEC 1EW0A 2M7UA 3KSHA 4WUJA 3MJQA 3MMHA 3C2WA 4I3JA 4LRYC 4UQIS 3IBJA 4QPRA 3BWLA 1TF1A 2INWA 4I3IA 1GSWA 3MFXA 2JHEA 1XFNA 1OT6A 4Y2FA 3BY9A 3KSGA 2A24B 5TBMA 1OTEA 3PYPA 4FSFA 1N9OA 3F1PA 1TS8A 5DF9A 2PR6A 4IUKA 4HP9A 2W1TA 1LSWA 2VV6A 5KSHA 4FOFA 3PXPA 3CUEA 2HV1A 4HNBA 3E4QA 3KSFA 3LIDA 2K31A 4L0LA 3UE6A 2OWHA 4LLOB 4ME4A 3PR6A 4HHDA 3HJKA 2L4RA 3DBAA 3FPWA 2P08A 2Y8HA 2OAQ1 2GX5A 2NUTC 3MXQA 4PKYG 4EXOA 3SW1A 4LPZA 2H28A 4WEJA 3LR5A 4B93A 3R7WB 3HJIA 4DMZA 3H7WA 2M7VA 4G3WA 4ARZA 2V1BA 3CI6A 4EEUA 1OTIA 4I5SA 3NOTC 2IA2A 3CLOA 3IBRA 3S7PA 3C30A 4EW7A 2B18A 1W63M 3EOIA 1T1AA 3MQ0A 2XA7S 2GNXA 2PT7A 1LT0A 3BQAA 5DFYA 1IOUA 2HJEA 1MZUA 2L0WA 3OOVA 4R70A 4I39A 3G6OA 3LUQA 1T1BA 3BW6A 2PDRA 3B42A 3LIBA 4PKYA 2A2LA 2W0NA 2W3FA 4CLCE 2LB9A 5C5KA 2PD8A 3ULFA 3PBNA 3PHYA 5F5YA 1X0OA 1NRJA 3GECA 1T19A 3PBOA 5F6AA 2ZMVA 3LR0A 4BBTA 3C38A 3IS2B 1S4RA 4O01A 4EUVA 2R78A 1GSVA 2OOLA 5EFWA 5F69A 4ETXA 4XT2B 4DJ2A 4ETZA 1S4SA 4CLCC 4WF0A 3EGDC 1ZTUA 3LIEA 3HCYA 3BJNA 2VEAA 4MN6A 5K5BA 3K2NA 4HI4A 5TBMB 1YSPA 3F1PB 2G7UA 4EERA 3UMEA 3OBFA 1STZA 1P9RA 2O99A 1S1YA 4R3AA 5HDCA 3T4QA 1P9WA 1YSQA 4M4XA 4E04A 5IU1A 2I9VA 4K08A 4WN5A 4HQAA 4BBVA 4EETB 3ICYA 4MMNA 2GJ3A 1H3QA 4Q0HA 2PR5A 1JNUA 1NLYA 1TS0A 3LR3A 3KYQA 5HPFA 1OJGA 2GZAA 4WLAA 3H7WB 3E4PA 3B47A 3PBTA 3T4SA 1XJ4A 3RFBA 5FL3A 3FC7A 3UB9A 2PHYA 2WKRA 2P7JA 3S7NA 5HD5A 1ODVA 1W63Q 4KUOA 3OCNA 4O8GA 5G4YA 2O9CA 5HDSA 3EEHA 3H9WA 3TE8A 4G3VA 4EEPA 2W1RA 3KO6A 3EGXC 3ZQ5A 3PBSA 5TJJA 5F68A 2O0YA 5HPIA 3D3OA 4EESA 4HH2A 3LR4A 3T4LA 4YOFA 1WA9A 2VJWA 2ZBBA 4G3KA 4HIAA 3H82A 1T18A 1XJ6A 1UWPX 2BASA 4GS9A 2J3TC 4MN7A 4YWZA 1F5MA 5HDDA 3EQUA 2VGLM 3T4TA 4NKPA 3MF0A 3VE4A 1DRMA 2M1CA 2EA9A 3CITA 1S66L 4RQ9A 5CX7A 4BJPA 2YKFA 2OWJA 1XJ3A 5I5LA 4Q0IA 1OTDA 4CLCD 2XROA 1DP9A 4P6ZM 4IJGA 5J3WA 4HH3A 4H6JA 4MDZA 4DN0A 1G6OA 1YKDA 3LICA 1ZHHB 3LYXA 4CLCB 1DP8A 1H8MA 4HP4A 5HD3A 3MR0A 4NXFA 1XFQA 1YAXA 2B02A 4BBUA 1NWZA 2KLIA 2VLGA 3B33A 3NHQA 4KQDA 4WL9A 3NOPC 4LRXC 1KOUA 4MN5A 3MQOA 2VV8A 3F1NA 4GJ4A 4O0PA 4NXEA 3JVUA 3R7WA 1D7EA 1T1CA 4I3AA 3TJZC 3UMDA 2VV7A 2W1TB 3P7NA 2JKRM 3T50A 3S7QA 5KIZA 3A0RA 5HWWA 1F98A 4JGOA 5DFXA 4F3LA 2Y79A 3T4JA 3KSIA 4BMWA 2QYBA 4GW9A 5DJTA 2VGLS 2O9BA 4B9OA 3EEAA 4WELA 4YNRA 2L1MA 1S1ZA 3UB7A 4R38A 3UB6A 2YKHA 4P6ZS 2JKTM 5IS1A 3VE3A 2J3WA 2HF6A 2QJ7A 2W3GA 4ARZB 3EQVA 5HL6A 2JKTI 1XJ2A 3KX0X 4Q0JA 2QJ5A 2W3HA 3IS2A 3H82B 3K3CA 3OLOA 4AFIA 4OOMA 4NEED 4GS9B 4KQOA 4BWIA 1OPXA 3W2ZA 5AVFA 3F1OA 4XT2A 2J80A 1TS7A 1V9YA 2W3DA 1V9ZA 1OTBA 2CMNA 1UGUA 2HGVA 2KDKA 3JVVA 4HY8A 1LSXA 3CWFA 3LI9A 5AJGA 1Y28A 2J3TD 3OC2A 2WKQA 2V1AA 5HSQA 4H6JB 4IUHA 5HZHA 3NOUC 3PBQA 2VKSA 3VV4A 3LFVA 3CAXA 1P0ZA 4GHIA 5DKKA 1LL8A 2V9AA 4OOLA 3TW8A 3ZYTA 5DJUA 4NXBA 2MJ6A 3RH8B 2D02A 2VZWA 4Y3IA 4ZRRA 2ZOHA 4PHTA 3RTYA 5HWVA 4L9GA 3C8CA 2W27A 4MCWA 1DP6A 2KX6A 4NXGA 4Y5FA 3T4KA 5A8BA 3F1NB 3P01A 1G28A 2LB5A 3T4OA 4II7A 3D72A 2K7SA 4WEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYP A;  5J7E A;  3LI8 A;  2A24 A;  3EWK A;  3K3D A;  4F3L B;  4GCZ A;  2D01 A;  1LSV A;  5HWT A;  1OTA A;  5J4E A;  4L9F A;  1N9L A;  4KUK A;  2QKP A;  1P97 A;  3NJA A;  4HJ6 A;  3LIF A;  1UWN X;  4L9E A;  5G4Z A;  3E4O A;  2V0W A;  4DJ3 A;  1OT9 A;  3BY8 A;  1F9I A;  1BYW A;  3F1O B;  4HOI A;  1D06 A;  2PD7 A;  3LIA A;  4HJ4 A;  3UB8 A;  3GDI A;  2QWS A;  5AVE A;  5DKL A;  4R6L A;  2Z6C A;  3A0S A;  3MQQ A;  1N9N A;  3A0V A;  2PYR A;  4JGQ A;  4JGP A;  4LRZ E;  1S67 L;  1TS6 A;  2WKP A;  4I38 A;  3VOL A;  2ZOI A;  4JGR A;  2JN7 A;  4GHI B;  2QHK A;  1OJ5 A;  2Z6D A;  4HJ3 A;  4EQ1 A;  2V0U A;  3FG8 A;  1GSX A;  1VB6 A;  1EW0 A;  4WUJ A;  3MJQ A;  3C2W A;  4I3J A;  4LRY C;  3BWL A;  2INW A;  4I3I A;  1GSW A;  3MFX A;  2JHE A;  1XFN A;  1OT6 A;  3BY9 A;  2A24 B;  5TBM A;  1OTE A;  3PYP A;  1N9O A;  3F1P A;  1TS8 A;  2PR6 A;  4HP9 A;  1LSW A;  2VV6 A;  2HV1 A;  4HNB A;  3E4Q A;  3LID A;  3UE6 A;  2OWH A;  4LLO B;  4HHD A;  3HJK A;  2L4R A;  3MXQ A;  4PKY G;  4EXO A;  3SW1 A;  4LPZ A;  2H28 A;  3HJI A;  3H7W A;  2V1B A;  4EEU A;  1OTI A;  4I5S A;  3NOT C;  3CLO A;  3IBR A;  4EW7 A;  1T1A A;  1LT0 A;  1MZU A;  2L0W A;  4R70 A;  4I39 A;  3G6O A;  3LUQ A;  1T1B A;  3LIB A;  2PDR A;  4PKY A;  2W0N A;  2PD8 A;  3ULF A;  3PHY A;  5F5Y A;  1X0O A;  3GEC A;  1T19 A;  5F6A A;  4BBT A;  3IS2 B;  1S4R A;  2R78 A;  1GSV A;  2OOL A;  5EFW A;  5F69 A;  4XT2 B;  4DJ2 A;  1S4S A;  4WF0 A;  3LIE A;  2VEA A;  4MN6 A;  4HI4 A;  5TBM B;  3F1P B;  4EER A;  3UME A;  1S1Y A;  4R3A A;  5HDC A;  4M4X A;  4E04 A;  5IU1 A;  2I9V A;  4K08 A;  4WN5 A;  4HQA A;  4BBV A;  4EET B;  3ICY A;  2GJ3 A;  2PR5 A;  1JNU A;  1TS0 A;  1OJG A;  4WLA A;  3H7W B;  3E4P A;  1XJ4 A;  3FC7 A;  3UB9 A;  2PHY A;  2WKR A;  2P7J A;  5HD5 A;  1ODV A;  4KUO A;  5G4Y A;  5HDS A;  3EEH A;  3H9W A;  4EEP A;  3ZQ5 A;  5F68 A;  4EES A;  4HH2 A;  1WA9 A;  2ZBB A;  4HIA A;  3H82 A;  1T18 A;  1XJ6 A;  1UWP X;  2BAS A;  4GS9 A;  4YWZ A;  5HDD A;  3VE4 A;  1DRM A;  2M1C A;  2EA9 A;  1S66 L;  4RQ9 A;  2YKF A;  2OWJ A;  1XJ3 A;  5I5L A;  1OTD A;  1DP9 A;  5J3W A;  4HH3 A;  4H6J A;  3LIC A;  3LYX A;  1DP8 A;  4HP4 A;  5HD3 A;  3MR0 A;  4NXF A;  1XFQ A;  2B02 A;  4BBU A;  1NWZ A;  2VLG A;  3B33 A;  3NHQ A;  4KQD A;  4WL9 A;  3NOP C;  4LRX C;  1KOU A;  4MN5 A;  3MQO A;  2VV8 A;  3F1N A;  4NXE A;  1D7E A;  1T1C A;  4I3A A;  3UMD A;  2VV7 A;  3P7N A;  3T50 A;  5KIZ A;  3A0R A;  5HWW A;  1F98 A;  4JGO A;  4F3L A;  4GW9 A;  5DJT A;  4B9O A;  2L1M A;  1S1Z A;  3UB7 A;  4R38 A;  3UB6 A;  2YKH A;  5IS1 A;  3VE3 A;  2QJ7 A;  3KX0 X;  1XJ2 A;  2QJ5 A;  3IS2 A;  3H82 B;  3K3C A;  3OLO A;  4GS9 B;  5AVF A;  3F1O A;  4XT2 A;  2J80 A;  1TS7 A;  1V9Y A;  1V9Z A;  1OTB A;  2CMN A;  1UGU A;  2KDK A;  4HY8 A;  1LSX A;  3CWF A;  3LI9 A;  1Y28 A;  2WKQ A;  2V1A A;  5HSQ A;  4H6J B;  5HZH A;  3NOU C;  3CAX A;  1P0Z A;  4GHI A;  5DKK A;  1LL8 A;  2V9A A;  5DJU A;  4NXB A;  3RH8 B;  2D02 A;  2ZOH A;  3RTY A;  5HWV A;  4L9G A;  3C8C A;  2W27 A;  1DP6 A;  2KX6 A;  4NXG A;  5A8B A;  3F1N B;  1G28 A;  3D72 A;  2K7S A; 
#chains in the Genus database with same CATH topology
 2PYP A;  2PU2 A;  5E2G A;  4PM6 A;  2HJ9 C;  1TD5 A;  2DMW A;  4GCZ A;  2D01 A;  1SDE A;  1LSV A;  2JE5 A;  3HLW A;  5EOE A;  4S2M A;  5J4E A;  1NYY A;  5IT5 A;  3S1Y A;  3QP2 A;  2QKP A;  2Y2H A;  4MEZ A;  4OLG A;  4PAU A;  5FAP A;  5G4Z A;  1I2W A;  2ZQ7 A;  2K2N A;  3E4O A;  1PWG A;  5L8M A;  5TGF A;  4OPR A;  4DJ3 A;  4S2K A;  3KYZ A;  1YLW A;  5A90 A;  1YLJ A;  1ZG6 A;  2VX8 A;  2OAP 1;  2BTF P;  1VHM A;  3GDI A;  5G18 A;  5EV0 A;  2FZ0 A;  3A0S A;  2EWV A;  3O5Y A;  1N9N A;  4ZJ2 A;  3E98 A;  1FSY A;  2HDQ A;  2O9A A;  3S7O A;  1KGG A;  2XFS A;  2WKP A;  1LHY A;  1MKI A;  1YMX A;  3VOL A;  2CC1 A;  3VMA A;  3DTM A;  4GHI B;  5GLA A;  4EU0 A;  2EWW A;  3MFD A;  3TG9 A;  3VOY A;  1JWV A;  4S2N C;  4HJ3 A;  4EQ1 A;  2V0U A;  1SZV A;  2J7V A;  1LI0 A;  1RP5 A;  3FG8 A;  3KSH A;  4IBR A;  4S2L A;  2ZC6 B;  3MMH A;  1IEM A;  3CZD A;  4RA7 A;  3IBJ A;  3ZDJ A;  4QPR A;  2JKF A;  4I3I A;  4QHC A;  4MBK A;  3BY9 A;  5FQM A;  3PAE A;  5BOH A;  4YIN A;  2PR6 A;  4S2N A;  1BLS A;  3B3X A;  3RJU A;  3ZCZ A;  1LSW A;  2ZM2 A;  4FOF A;  3NEC A;  3E4Q A;  4P6B A;  5A92 A;  4ME4 A;  3PR6 A;  4LCL A;  1Y4O A;  2L4R A;  3DBA A;  2P08 A;  2EX8 A;  3MXQ A;  4WMC A;  4PKY G;  4EXO A;  4LPZ A;  2H28 A;  2ZD8 A;  4GD6 A;  3CI6 A;  4EEU A;  2Y91 A;  3C7V A;  3CLO A;  3M6B A;  2G2W A;  3JPU A;  3C30 A;  2B18 A;  3BFF A;  2XFT A;  3EOI A;  1G6A A;  3MQ0 A;  5AQ7 A;  3I7J A;  4OKP A;  5CXW A;  3BLM A;  1U60 A;  4R70 A;  2Y4A A;  3LUQ A;  1T1B A;  1H8Z A;  2PDR A;  4CLC E;  2LB9 A;  5C5K A;  1E25 A;  5F5Y A;  1NRJ A;  1QME A;  1T19 A;  3GEC A;  4EUZ A;  2B5R A;  4KG5 A;  3IS2 B;  2R78 A;  3FYZ A;  3LY3 A;  4ETX A;  3FKW A;  2C5W B;  1M40 A;  3EGD C;  1LI9 A;  4S2J A;  2VEA A;  4KZ8 A;  3D9Y A;  3UME A;  1STZ A;  1CF0 A;  2O99 A;  2WAD A;  3MZE A;  5AQA A;  4E04 A;  3Q7Z A;  1W7F A;  4HQA A;  4KG2 A;  4E3O A;  4MMN A;  1PI5 A;  3D4F A;  2PR5 A;  4DKI A;  3LR3 A;  4P85 A;  3VP1 A;  1OJG A;  4R0Q A;  3A3E A;  3E4P A;  3C5A A;  1PFL A;  3N8R A;  3PBT A;  5EM1 A;  3RFB A;  1YPR A;  3FC7 A;  3HRE A;  5HAI A;  3UB9 A;  3ZG7 B;  2WKR A;  5HX9 A;  4QU3 A;  5HD5 A;  3WRZ A;  4KUO A;  4O8G A;  2O9C A;  2ZL1 A;  3EEH A;  4HBT A;  4ZJ3 A;  3TE8 A;  2VK3 A;  2PBY A;  2R9W A;  4EEP A;  2V1Z A;  4D60 A;  4WZ5 C;  3SH9 A;  4JKT A;  1GCE A;  4BD1 A;  4HH2 A;  4OLD A;  2PU4 A;  2QMI A;  3ZG9 B;  1ERQ A;  1WA9 A;  2IWB A;  2VJW A;  3UNW A;  2JBF A;  2XGN A;  4HIA A;  2Y55 A;  3LO7 A;  1N4O A;  3BYD A;  1UWP X;  3NBL A;  2HP6 A;  5HDD A;  4OH0 A;  3EQU A;  3UB5 P;  3T4T A;  1RCJ A;  4JXG A;  5CHJ A;  3VE4 A;  4ESP A;  3Q7V A;  5KSC A;  1S66 L;  4RQ9 A;  1XJ3 A;  4CLC D;  4UHU A;  5J3W A;  3HBR A;  4Y7P A;  3LIC A;  4DDY A;  1ZHH B;  4HP4 A;  5HD3 A;  4Y13 A;  1MWR A;  3MR0 A;  3ISG A;  3PAG A;  2ZQC A;  2BLS A;  4BBU A;  1FR1 A;  2ZQ9 A;  2KLI A;  3WS2 A;  5EVI D;  1NJ4 A;  4KQD A;  3CJM A;  3NOP C;  3MQO A;  4GJ4 A;  4O0P A;  1NZU A;  3G35 A;  2Y2L A;  1K4E A;  5FAQ A;  4NXE A;  1D7E A;  1T1C A;  4I3A A;  3TJZ C;  3UMD A;  2W1T B;  3P7N A;  4X6T A;  4P0M A;  4U0X A;  4K91 A;  5AQB A;  4GKU A;  2L1M A;  1S1Z A;  4PM9 A;  2YKH A;  4P6Z S;  2Y2N A;  5IS1 A;  1YLT A;  1JTG A;  4BQM A;  3ZG8 B;  3EQV A;  3HLD A;  5HL6 A;  4N1X A;  1JWP A;  2JKT I;  1XJ2 A;  3KX0 X;  4Q0J A;  5E43 A;  3K3C A;  4KZ4 A;  2PAV P;  1SDN A;  3LCE A;  1OPX A;  3W2Z A;  4JF5 A;  5E2E A;  4XT2 A;  4ZAM A;  2ZC7 A;  1V9Y A;  1OME A;  1OTB A;  3VP0 A;  1UGU A;  3Q7V B;  3MS6 A;  3CWF A;  5HAQ A;  1Y28 A;  1K57 C;  1I5Q A;  4CJN A;  3L9K A;  1GHI A;  3CAX A;  1XPB A;  4B4Z A;  4OOL A;  5DJU A;  3BFC A;  4HEF A;  2XR0 A;  3O3V A;  4MCW A;  5A8B A;  2XD1 A;  3P01 A;  2JCH A;  1K6S A;  5E2H A;  3IWQ A;  1K57 A;  4LGW A;  2K7S A;  4WEK A;  5HW3 A;  3QNB A;  3WWX A;  3LI8 A;  2A24 A;  1MC0 A;  5FQQ A;  4K0X A;  2XK1 A;  4WZ4 A;  3OCL A;  3UDF A;  5HWT A;  1OTA A;  1SCW A;  4L9F A;  1N9L A;  2ZM0 A;  4LV2 A;  5L10 A;  4HJ6 A;  3LIF A;  3U4L P;  2P04 A;  4Z1W A;  3GMW A;  1HD8 A;  1OT9 A;  4CQH A;  3BY8 A;  1F9I A;  1TEM A;  1NZO A;  3UB8 A;  2FH5 A;  3QP8 A;  4PMA A;  5KMW A;  5DKL A;  2V8F A;  5FI2 A;  5M18 A;  5CHM A;  3R4K A;  2XLN A;  4O7D A;  3PBR A;  2XSS A;  1XA7 A;  1MKM A;  1JTD A;  2JN7 A;  4GD8 A;  2V20 A;  3DW0 A;  3ZVW A;  2KOI A;  4E3L A;  2ZMF A;  4KZB A;  3S22 A;  2W3E A;  1VB6 A;  1EW0 A;  4MBF A;  3MJQ A;  4UQI S;  4LCM A;  2INW A;  3C4O A;  4IED A;  1GSW A;  3HLG A;  2JHE A;  3IXG A;  3MFX A;  3KSG A;  2A24 B;  3C7U A;  4KZ5 A;  1PZP A;  2ZQD A;  5DF9 A;  4HP9 A;  1BT5 A;  5FQJ A;  3IWO A;  4XUZ A;  3DTI A;  1C3B A;  2QZ6 A;  3M2J A;  3FWL A;  3HLE A;  3KSF A;  2K31 A;  2HZ5 A;  2H10 A;  2OWH A;  4JBF A;  4HHD A;  3HJK A;  2DCF A;  3FPW A;  5EEC A;  2Y2K A;  4OOY A;  5F82 A;  2Y8H A;  1K0K A;  2EFX A;  2NUT C;  2EXB A;  1VEU B;  4WEJ A;  3W4Q A;  3LR5 A;  1DJA A;  1VET B;  2M7V A;  2X71 A;  3GV9 A;  4ARZ A;  4BL2 A;  4I5S A;  3NOT C;  3IXD A;  3S7P A;  4EW7 A;  1T1A A;  3QHY A;  2XA7 S;  2GNX A;  1PYY A;  1MZU A;  3QNC A;  4R4S A;  3OOV A;  3BW6 A;  2WKI A;  5IHV A;  4PKY A;  3NDG A;  4E6W A;  2W0N A;  2EX9 A;  2PD8 A;  4YFM A;  3E2L A;  5F6A A;  3LR0 A;  3S4X A;  3C38 A;  3AGD A;  5CEC A;  5F1F A;  1KGF A;  4E3N A;  3Q07 A;  2E8I A;  4C6Y A;  3RXW A;  3MXR A;  4UA6 A;  3HCY A;  5D3O A;  4MN6 A;  2DRW A;  4QWO A;  5K5B A;  4R1G A;  3MKE A;  1MBL A;  3L7H A;  5GLD A;  1CQA A;  3IF5 A;  1YSP A;  2G7U A;  3WS0 A;  4Y15 A;  4EER A;  3G32 A;  5CHU A;  2Y59 A;  1P9R A;  1E4D A;  1ES4 A;  4FH4 A;  1P9W A;  1YSQ A;  4M4X A;  5AQ9 A;  1ESU A;  3ICY A;  4DDS A;  2EXA A;  3Q82 A;  4FD8 A;  5EE8 A;  4Q0H A;  4E3M A;  1JNU A;  5F1G A;  1NLY A;  2EX2 A;  4JLF A;  5TR7 A;  2GZA A;  3N7W A;  1HVB A;  3B47 A;  3IX8 A;  2H0Y A;  3T4S A;  2ZC5 B;  3IX3 A;  1PRQ A;  1K54 C;  1IEL A;  2PHY A;  1FSW A;  1ODV A;  4KQQ A;  1CEG A;  1FCN A;  1W63 Q;  2VGJ A;  5G4Y A;  1L0E A;  5HDS A;  3O86 A;  3OPH A;  4FUW A;  4G3V A;  2Y2O A;  3KO6 A;  5JYO A;  3ZQ5 A;  4OQG A;  5FI6 A;  1NYM A;  3PBS A;  1BLP A;  5HPI A;  1K54 A;  3D3O A;  3T4L A;  2ZBB A;  2BG1 A;  1GHP A;  1T18 A;  1Q2Q A;  5DTT A;  3NDE A;  2J3T C;  3GVB A;  3BFE A;  4R3J A;  1XGJ A;  2WGW A;  1ESI A;  4C3Q A;  4NKP A;  1DRM A;  5DF7 A;  1HTZ A;  4BJP A;  4D2O A;  4RYE A;  5I5L A;  4Q0I A;  4EBP A;  1DP9 A;  4P6Z M;  4QY5 A;  4DN0 A;  1F2K A;  4OPZ A;  1MY8 A;  5DF8 A;  4ZJ1 A;  1NWZ A;  3FV7 A;  5J8X A;  4WL9 A;  1TDL A;  2WYX A;  3IF6 C;  1ERM A;  1KOU A;  1SHV A;  4OON A;  1PW8 A;  3R7W A;  4IBX A;  1H8Y A;  2VV7 A;  2V8C A;  3A0R A;  1F98 A;  5M19 A;  1XKZ A;  1QMF A;  5DFX A;  4F3L A;  3KSI A;  4BMW A;  1MXO A;  2P9V A;  5DJT A;  3IF6 A;  2VGL S;  2O9B A;  3WS1 A;  2ZMA A;  2JKT M;  4Y0O A;  2J3W A;  2HF6 A;  2W3G A;  1IYO A;  3VSL A;  2EFU A;  3UPP A;  2WZZ A;  4KZ3 A;  4B88 A;  1YM1 A;  4PPR A;  1FIL A;  5A93 A;  4HES A;  1JWZ A;  4PM8 A;  3BFG A;  1KE4 A;  1ZG4 A;  4OP8 A;  2V1A A;  3LEQ A;  5HSQ A;  3NOU C;  3IXH A;  1ES5 A;  2OSU A;  4OQH A;  3LFV A;  3A3J A;  1CJF A;  4KZ9 A;  3C4P A;  1PNE A;  4NXB A;  2MJ6 A;  4A5R A;  4ZRR A;  2ZOH A;  1VQQ A;  3C8C A;  2W27 A;  3VP2 A;  2KX6 A;  1G28 A;  1L0D A;  2RCX A;  3T4O A;  4II7 A;  3BM6 A;  2VA0 A;  3BQ8 A;  3HL9 A;  4N92 A;  4F3L B;  4UEY A;  3UE3 A;  2XH9 A;  2WAE A;  2P9V B;  3IF6 B;  3P09 A;  3U2A A;  1YQS A;  3VFH A;  3HUO A;  3NY4 A;  3E0Y A;  2FFF B;  5EVE A;  4U0T A;  2XRN A;  5F83 A;  4UQI M;  3A3I A;  4DRT A;  3UDX A;  1GA9 A;  5A91 A;  3UY6 A;  4R4R A;  2ZL1 B;  5HFO A;  4OPY A;  4QD4 A;  4MNR A;  1J3W A;  4EWF A;  4R6L A;  2HDU A;  4Y17 A;  2Z6C A;  3FPV A;  3AGF A;  3ZGA B;  3TRC A;  5MC7 A;  3UDI A;  2ZM8 A;  2AVX A;  3FKV A;  2PYR A;  4JGQ A;  4JGP A;  4LRZ E;  1TS6 A;  2ZOI A;  5CGX A;  3G2Y A;  4CLC A;  1OJ5 A;  1IYP A;  2Z6D A;  2VGK A;  2Q9N A;  4KZ7 A;  3UE1 A;  1D1J A;  2XA7 M;  4DXC A;  1E3U A;  3N8L A;  4GDN A;  4GOG A;  4I3J A;  4LRY C;  5GLB A;  4E3J A;  2J9O A;  4DE2 A;  3IX4 A;  2P74 A;  4GZB A;  1CI8 A;  1XFN A;  1OT6 A;  4FCF A;  4Y2F A;  4S2P A;  4E3K A;  3LEZ A;  4FSF A;  1N9O A;  1TS8 A;  1S0W A;  1S6R A;  4IUK A;  4BLM A;  2GDN A;  3E2K A;  1G68 A;  1BTL A;  3PXP A;  2HV1 A;  4HNB A;  3LID A;  1K38 A;  4HBU A;  4S2O A;  4L0L A;  3UE6 A;  3ZG0 A;  4LLO B;  1NXY A;  1PZO A;  2QPN A;  3ZNY A;  5FEF A;  2OAQ 1;  4EBN A;  1NRF A;  1TVF A;  3SW1 A;  3WS4 A;  4K0W A;  2R9X A;  4B93 A;  4DMZ A;  3H7W A;  1Y54 A;  1A0K A;  2V1B A;  1OTI A;  3G4P A;  3GR2 A;  1W63 M;  1WYB A;  2PRF A;  1LL5 A;  3NI9 A;  2EX6 A;  3G31 A;  1K25 A;  2ZLY A;  5EVL A;  2HP5 A;  2PT7 A;  1LT0 A;  1IOU A;  2HJE A;  1O7E A;  4I39 A;  4E3I A;  2A2L A;  2WGV A;  4E6X A;  3W4P A;  3PBN A;  1X0O A;  3PBO A;  4BBT A;  1BUE A;  1S4R A;  2ZC4 B;  1K55 C;  4XT2 B;  4DJ2 A;  4ETZ A;  1S4S A;  5FDH A;  3LIE A;  3TSG A;  4PM5 A;  4X69 A;  3OZH A;  5CED A;  3QP5 A;  3OPL A;  1SKO A;  3OBF A;  4LEN A;  3T12 B;  1S1Y A;  4R3A A;  1K55 A;  1GHM A;  3BFD A;  3UPN A;  2DNS A;  2I9V A;  5HAP A;  4BBV A;  3BRM A;  2Q0O A;  3OPP A;  2Z2L B;  3N4I A;  4QB8 A;  1TS0 A;  3HLC A;  2OV5 A;  1PW1 A;  1LLB A;  3KYQ A;  5HPF A;  4WLA A;  3H7W B;  3DTK A;  3W4O A;  3SOI A;  1XJ4 A;  3IH9 A;  5CER A;  1MWU A;  1FR6 A;  1KVL A;  4UAA A;  3QP1 A;  1KVM A;  1CEF A;  2WUQ A;  3H9W A;  4JXW A;  3HUN A;  3VOZ A;  3M6H A;  3IHA A;  3V50 A;  2W1R A;  4GB7 A;  3GRJ A;  2Y2I A;  3IH8 A;  2J9P A;  5F68 A;  5CGW A;  4X1M A;  4F94 A;  5FQI A;  1RGY A;  5JYP A;  2G2U A;  1YLP A;  1JVJ A;  3H82 A;  3CHW P;  4X53 A;  2BAS A;  2Y2M A;  1AWI A;  4MN7 A;  2ZJ9 A;  4YWZ A;  1F5M A;  2WGI A;  1XGI A;  4JXS A;  1FIK A;  5FQK A;  2VGL M;  3MZD A;  3MF0 A;  3HVF A;  2EA9 A;  3CIT A;  2A3U A;  2YKF A;  5DVA A;  1SKO B;  2XRO A;  4IJG A;  3IWI A;  1YLY A;  4HH3 A;  4H6J A;  4R23 A;  4MDZ A;  5EUA A;  3MXS A;  1YKD A;  3LYX A;  4NG2 A;  5E2F A;  4KZ6 A;  4NXF A;  1XFQ A;  1YAX A;  5FSR A;  2IWD A;  4GN2 A;  4N1H A;  4N9L A;  3NHQ A;  3DTE A;  1BLH A;  1CI9 A;  4XXR A;  3SZT A;  1K56 A;  3F1N A;  3UO9 A;  3JVU A;  1KE3 A;  1L0G A;  1FQG A;  2JKR M;  3S7Q A;  5HWW A;  3T4J A;  2Y2Q A;  4WMC D;  3BLS A;  1IYQ A;  2HDS A;  2JC7 A;  1Q2P A;  4WEL A;  4PM7 A;  3UB7 A;  4R38 A;  3UB6 A;  5FI7 A;  3IT9 A;  3PTE A;  3VE3 A;  3CPT A;  2Y2G A;  4ARZ B;  1ALQ A;  3IS2 A;  3H82 B;  2HDR A;  4AFI A;  4OOM A;  4NEE D;  2HPB A;  1KDW A;  3F1O A;  1IKG A;  2J80 A;  5L2F A;  2WAF A;  1TS7 A;  2W3D A;  1V9Z A;  5L07 A;  4RX2 A;  2CMN A;  3SH8 A;  4N9K A;  3JVV A;  2E8J A;  2ACG A;  4HY8 A;  5HAR A;  1LSX A;  3LI9 A;  4ZBE A;  5AJG A;  2J3T D;  3OC2 A;  2WKQ A;  4H6J B;  2XD5 A;  2VKS A;  3LGO A;  2B95 A;  1ONH A;  3V3R A;  1P0Z A;  4GNU A;  1ES2 A;  3DAV A;  5FDS A;  1WE4 A;  3ZYT A;  3RH8 B;  2XQZ A;  2VZW A;  1YMS A;  5HWV A;  2WK0 A;  2WZX A;  1RGZ A;  3ZVT A;  3RXX A;  2XDM A;  3DWZ A;  4Y5F A;  4ZDX A;  3F1N B;  2WKH A;  2LB5 A;  1DY6 A;  2H0T A;  3D72 A;  5M1A A;  1XX2 A;  3T1R A;  5J7E A;  4Q8I A;  4LV0 A;  5FA7 A;  3EWK A;  4OQI A;  3K3D A;  1M6K A;  4KEN B;  1FCO A;  4OQ0 A;  5CTM A;  3MKF A;  1NLZ A;  1L2S A;  1J9M A;  2OLU A;  3SS3 A;  1ERO A;  5FAO A;  4KUK A;  1P97 A;  3NJA A;  4LV3 A;  1UWN X;  1ES3 A;  4S2I A;  3JYI A;  1KGE A;  3QP6 A;  4L9E A;  3CPT B;  1WYC A;  2NUP C;  3VSK A;  4X1L A;  3V67 A;  2V0W A;  4KZA A;  4Z9Q A;  1PWD A;  4BEN A;  3GSG A;  1IFQ A;  1BYW A;  3F1O B;  3QP4 A;  4HOI A;  1D06 A;  2PD7 A;  4ZTK A;  3LIA A;  4HJ4 A;  3ZHH A;  4C75 A;  2QWS A;  5AVE A;  3TOI A;  1W8Q A;  2OLV A;  1DJC A;  3NIA A;  2JKR I;  3NC8 A;  4DE0 A;  3MQQ A;  4GLQ A;  4IHQ A;  3A0V A;  1GA0 A;  4B4X A;  4BD0 A;  1TDG A;  4Y0T A;  1O07 A;  1S67 L;  4I38 A;  1CK3 A;  4JGR A;  1W8Y A;  2QHK A;  1LL9 A;  1DJB A;  5LBR A;  1GSX A;  2IWC A;  2WGW B;  3CUE C;  3MSH A;  2M7U A;  3T1S A;  4WUJ A;  3OPR A;  4WYY A;  1MPL A;  3C2W A;  3WRT A;  3DWK A;  4WBG A;  4X25 A;  4XUX A;  3BWL A;  1TF1 A;  2J8Y A;  5GHZ A;  1AXB A;  3WS5 A;  5TBM A;  1OTE A;  1BSG A;  3PYP A;  3F1P A;  2W1T A;  3G30 A;  1MWT A;  2VV6 A;  5KSH A;  3CUE A;  4JF6 A;  4ID4 A;  4U3T A;  2FFY A;  1YLZ A;  1H5X A;  4LV1 A;  2GX5 A;  3BEC A;  1XP4 A;  2JKG A;  3ZFZ A;  2UWX A;  3R7W B;  3HJI A;  1G5U A;  2WKE A;  4G3W A;  1BZA A;  1XA1 A;  2IA2 A;  2H5S A;  3IBR A;  3IQA A;  4EQI A;  4WZ5 A;  1PI4 A;  3O88 A;  3BQA A;  4X68 A;  5DFY A;  5GHX A;  5GL9 A;  5I94 A;  3NUL A;  2L0W A;  1Z6F A;  5EOO A;  2RL3 A;  3G6O A;  4WM9 A;  3LIB A;  3B42 A;  3P98 A;  4KG6 A;  1VM1 A;  2W3F A;  3ULF A;  3Q81 A;  3PHY A;  3A3F A;  4QY6 A;  1IYS A;  2ZMV A;  4O01 A;  5CRF A;  1E3U D;  4EUV A;  2Q9M A;  3UE0 A;  4EBL A;  4X55 A;  1GSV A;  2OOL A;  3N8S A;  5EFW A;  5F69 A;  3V3S A;  5EPH A;  4UA7 A;  3SS5 A;  4QJG A;  1EI5 A;  3VFF A;  4CPK A;  4CLC C;  4WF0 A;  1SKF A;  1ZTU A;  1YT4 A;  1L0F A;  1H0M A;  3BJN A;  4OP5 A;  3K2N A;  4EV4 A;  2V2F F;  4HI4 A;  5TBM B;  2X02 A;  3F1P B;  5TFQ A;  3HLB A;  1PWC A;  1MWS A;  5EVI C;  4RVA A;  5HDC A;  4OPQ A;  3KYE A;  3T4Q A;  2C6W B;  2Z2M B;  4UA9 A;  5IU1 A;  4H8R A;  4K08 A;  3GTC A;  1N9B A;  4WN5 A;  3M2K A;  4EET B;  1ONG A;  2GJ3 A;  1H3Q A;  1K6R A;  4NET A;  3UN7 A;  5L09 A;  4LFU A;  5EM0 A;  5EVI A;  3IHB A;  5FAT A;  5FL3 A;  3LY4 A;  3MBZ A;  2PBD P;  2P7J A;  3S7N A;  1FOF A;  2ZQA A;  3OCN A;  4JF4 A;  2UV0 E;  3EGX C;  5TJJ A;  1ZKJ A;  5FEG A;  2O0Y A;  4EES A;  3LR4 A;  5CTN A;  4KQR A;  4BL3 A;  3V5M A;  4YOF A;  4G3K A;  2XF3 A;  3N6I A;  1XJ6 A;  3BEB A;  4GS9 A;  1FCM A;  5U47 A;  1ACF A;  5FQ9 A;  2M1C A;  5CX7 A;  2OWJ A;  1OTD A;  1ZC2 A;  1HZO A;  5CGS A;  1I2S A;  1G6O A;  1K4F A;  4CLC B;  1DP8 A;  1BLC A;  1H8M A;  1KDS A;  1W5D A;  2XEP A;  3IXB A;  3CMZ A;  2B02 A;  2Y2J A;  2A49 A;  4MBH A;  4R3B A;  4OVD A;  2VLG A;  3B33 A;  5KZH A;  4X56 A;  5CEB A;  3O87 A;  3SH7 A;  4LRX C;  4MN5 A;  2VV8 A;  3AGE A;  3SS4 A;  5EVI B;  3T1Q B;  4Y0U A;  1VEU A;  3ITA A;  4M3K A;  1VET A;  3UPO A;  4DE3 A;  4RX3 A;  4P87 A;  3T50 A;  5KIZ A;  2HP9 A;  4FH2 A;  4JGO A;  3VP3 A;  2Y79 A;  3G34 A;  3CG5 A;  4GDB A;  2QYB A;  4GW9 A;  4B9O A;  3A3D A;  3EEA A;  4YNR A;  2I72 A;  3VP4 A;  1PIO A;  3ZNT A;  4JPM A;  1XXM A;  3G2Z A;  2QJ7 A;  1W79 A;  1KE0 A;  3Q1F A;  4JXV A;  3W8K A;  4FTX A;  2QJ5 A;  2W3H A;  3FZC A;  3OLO A;  3HLF A;  4GS9 B;  4IVI A;  4KQO A;  1NY0 A;  5GHY A;  4BWI A;  5DTS A;  5AVF A;  4DXB A;  1HLU P;  4DE1 A;  5FAS A;  2ZC3 B;  2Y2P A;  2HGV A;  2KDK A;  5GLC A;  1L3L A;  5DTK A;  3MZF A;  5HL1 A;  4IUH A;  5HZH A;  3PBQ A;  2X01 A;  3VV4 A;  3ZG5 A;  3HUM A;  3ITB A;  3GQZ A;  4MLL A;  3T1X A;  4GHI A;  5DKK A;  1LL8 A;  2V9A A;  3TW8 A;  1K56 D;  2D02 A;  4Y3I A;  4PHT A;  3RTY A;  4NK3 A;  1BUL A;  4L9G A;  1EWZ A;  1IKI A;  1DP6 A;  4NXG A;  3T4K A;  1Z09 A;  4IVK A;  3V39 A;  3NCK A;  2ZQ8 A;  4DF6 A; 
#chains in the Genus database with same CATH homology
 2VA0 A;  2PYP A;  5J7E A;  3BQ8 A;  3LI8 A;  2A24 A;  3EWK A;  1MC0 A;  3K3D A;  2HJ9 C;  4F3L B;  4UEY A;  1TD5 A;  2DMW A;  4GCZ A;  2D01 A;  3UE3 A;  3OCL A;  1NLZ A;  1LSV A;  3U2A A;  5HWT A;  1OTA A;  5J4E A;  3E0Y A;  4L9F A;  5IT5 A;  1N9L A;  4KUK A;  2QKP A;  1P97 A;  3NJA A;  4HJ6 A;  3LIF A;  1UWN X;  2XRN A;  4L9E A;  4PAU A;  5G4Z A;  4UQI M;  2NUP C;  2P04 A;  2K2N A;  3E4O A;  4Z1W A;  5L8M A;  3V67 A;  2V0W A;  4DJ3 A;  1OT9 A;  4CQH A;  3KYZ A;  3BY8 A;  1F9I A;  1IFQ A;  1BYW A;  3F1O B;  4HOI A;  2VX8 A;  1D06 A;  2PD7 A;  2OAP 1;  3LIA A;  4HJ4 A;  3UB8 A;  2FH5 A;  1VHM A;  3GDI A;  2QWS A;  5AVE A;  5DKL A;  4R6L A;  2FZ0 A;  2Z6C A;  2JKR I;  3A0S A;  3FPV A;  2EWV A;  3O5Y A;  3MQQ A;  1N9N A;  3TRC A;  4GLQ A;  5MC7 A;  3S7O A;  3E98 A;  4IHQ A;  2O9A A;  3A0V A;  3R4K A;  2PYR A;  4JGQ A;  4JGP A;  4LRZ E;  1S67 L;  1TS6 A;  2WKP A;  3PBR A;  4I38 A;  3VOL A;  2XSS A;  2ZOI A;  1MKM A;  4JGR A;  2JN7 A;  4GHI B;  2KOI A;  2QHK A;  4EU0 A;  2ZMF A;  2EWW A;  4CLC A;  1OJ5 A;  2Z6D A;  4HJ3 A;  4EQ1 A;  2V0U A;  5LBR A;  3FG8 A;  2W3E A;  1GSX A;  1VB6 A;  2XA7 M;  3CUE C;  1EW0 A;  2M7U A;  3KSH A;  4WUJ A;  3MJQ A;  3MMH A;  3C2W A;  4I3J A;  4LRY C;  4UQI S;  3IBJ A;  4QPR A;  3BWL A;  1TF1 A;  2INW A;  4I3I A;  1GSW A;  3MFX A;  2JHE A;  1XFN A;  1OT6 A;  4Y2F A;  3BY9 A;  3KSG A;  2A24 B;  5TBM A;  1OTE A;  3PYP A;  4FSF A;  1N9O A;  3F1P A;  1TS8 A;  5DF9 A;  2PR6 A;  4IUK A;  4HP9 A;  2W1T A;  1LSW A;  2VV6 A;  5KSH A;  4FOF A;  3PXP A;  3CUE A;  2HV1 A;  4HNB A;  3E4Q A;  3KSF A;  3LID A;  2K31 A;  4L0L A;  3UE6 A;  2OWH A;  4LLO B;  4ME4 A;  3PR6 A;  4HHD A;  3HJK A;  2L4R A;  3DBA A;  3FPW A;  2P08 A;  2Y8H A;  2OAQ 1;  2GX5 A;  2NUT C;  3MXQ A;  4PKY G;  4EXO A;  3SW1 A;  4LPZ A;  2H28 A;  4WEJ A;  3LR5 A;  4B93 A;  3R7W B;  3HJI A;  4DMZ A;  3H7W A;  2M7V A;  4G3W A;  4ARZ A;  2V1B A;  3CI6 A;  4EEU A;  1OTI A;  4I5S A;  3NOT C;  2IA2 A;  3CLO A;  3IBR A;  3S7P A;  3C30 A;  4EW7 A;  2B18 A;  1W63 M;  3EOI A;  1T1A A;  3MQ0 A;  2XA7 S;  2GNX A;  2PT7 A;  1LT0 A;  3BQA A;  5DFY A;  1IOU A;  2HJE A;  1MZU A;  2L0W A;  3OOV A;  4R70 A;  4I39 A;  3G6O A;  3LUQ A;  1T1B A;  3BW6 A;  2PDR A;  3B42 A;  3LIB A;  4PKY A;  2A2L A;  2W0N A;  2W3F A;  4CLC E;  2LB9 A;  5C5K A;  2PD8 A;  3ULF A;  3PBN A;  3PHY A;  5F5Y A;  1X0O A;  1NRJ A;  3GEC A;  1T19 A;  3PBO A;  5F6A A;  2ZMV A;  3LR0 A;  4BBT A;  3C38 A;  3IS2 B;  1S4R A;  4O01 A;  4EUV A;  2R78 A;  1GSV A;  2OOL A;  5EFW A;  5F69 A;  4ETX A;  4XT2 B;  4DJ2 A;  4ETZ A;  1S4S A;  4CLC C;  4WF0 A;  3EGD C;  1ZTU A;  3LIE A;  3HCY A;  3BJN A;  2VEA A;  4MN6 A;  5K5B A;  3K2N A;  4HI4 A;  5TBM B;  1YSP A;  3F1P B;  2G7U A;  4EER A;  3UME A;  3OBF A;  1STZ A;  1P9R A;  2O99 A;  1S1Y A;  4R3A A;  5HDC A;  3T4Q A;  1P9W A;  1YSQ A;  4M4X A;  4E04 A;  5IU1 A;  2I9V A;  4K08 A;  4WN5 A;  4HQA A;  4BBV A;  4EET B;  3ICY A;  4MMN A;  2GJ3 A;  1H3Q A;  4Q0H A;  2PR5 A;  1JNU A;  1NLY A;  1TS0 A;  3LR3 A;  3KYQ A;  5HPF A;  1OJG A;  2GZA A;  4WLA A;  3H7W B;  3E4P A;  3B47 A;  3PBT A;  3T4S A;  1XJ4 A;  3RFB A;  5FL3 A;  3FC7 A;  3UB9 A;  2PHY A;  2WKR A;  2P7J A;  3S7N A;  5HD5 A;  1ODV A;  1W63 Q;  4KUO A;  3OCN A;  4O8G A;  5G4Y A;  2O9C A;  5HDS A;  3EEH A;  3H9W A;  3TE8 A;  4G3V A;  4EEP A;  2W1R A;  3KO6 A;  3EGX C;  3ZQ5 A;  3PBS A;  5TJJ A;  5F68 A;  2O0Y A;  5HPI A;  3D3O A;  4EES A;  4HH2 A;  3LR4 A;  3T4L A;  4YOF A;  1WA9 A;  2VJW A;  2ZBB A;  4G3K A;  4HIA A;  3H82 A;  1T18 A;  1XJ6 A;  1UWP X;  2BAS A;  4GS9 A;  2J3T C;  4MN7 A;  4YWZ A;  1F5M A;  5HDD A;  3EQU A;  2VGL M;  3T4T A;  4NKP A;  3MF0 A;  3VE4 A;  1DRM A;  2M1C A;  2EA9 A;  3CIT A;  1S66 L;  4RQ9 A;  5CX7 A;  4BJP A;  2YKF A;  2OWJ A;  1XJ3 A;  5I5L A;  4Q0I A;  1OTD A;  4CLC D;  2XRO A;  1DP9 A;  4P6Z M;  4IJG A;  5J3W A;  4HH3 A;  4H6J A;  4MDZ A;  4DN0 A;  1G6O A;  1YKD A;  3LIC A;  1ZHH B;  3LYX A;  4CLC B;  1DP8 A;  1H8M A;  4HP4 A;  5HD3 A;  3MR0 A;  4NXF A;  1XFQ A;  1YAX A;  2B02 A;  4BBU A;  1NWZ A;  2KLI A;  2VLG A;  3B33 A;  3NHQ A;  4KQD A;  4WL9 A;  3NOP C;  4LRX C;  1KOU A;  4MN5 A;  3MQO A;  2VV8 A;  3F1N A;  4GJ4 A;  4O0P A;  4NXE A;  3JVU A;  3R7W A;  1D7E A;  1T1C A;  4I3A A;  3TJZ C;  3UMD A;  2VV7 A;  2W1T B;  3P7N A;  2JKR M;  3T50 A;  3S7Q A;  5KIZ A;  3A0R A;  5HWW A;  1F98 A;  4JGO A;  5DFX A;  4F3L A;  2Y79 A;  3T4J A;  3KSI A;  4BMW A;  2QYB A;  4GW9 A;  5DJT A;  2VGL S;  2O9B A;  4B9O A;  3EEA A;  4WEL A;  4YNR A;  2L1M A;  1S1Z A;  3UB7 A;  4R38 A;  3UB6 A;  2YKH A;  4P6Z S;  2JKT M;  5IS1 A;  3VE3 A;  2J3W A;  2HF6 A;  2QJ7 A;  2W3G A;  4ARZ B;  3EQV A;  5HL6 A;  2JKT I;  1XJ2 A;  3KX0 X;  4Q0J A;  2QJ5 A;  2W3H A;  3IS2 A;  3H82 B;  3K3C A;  3OLO A;  4AFI A;  4OOM A;  4NEE D;  4GS9 B;  4KQO A;  4BWI A;  1OPX A;  3W2Z A;  5AVF A;  3F1O A;  4XT2 A;  2J80 A;  1TS7 A;  1V9Y A;  2W3D A;  1V9Z A;  1OTB A;  2CMN A;  1UGU A;  2HGV A;  2KDK A;  3JVV A;  4HY8 A;  1LSX A;  3CWF A;  3LI9 A;  5AJG A;  1Y28 A;  2J3T D;  3OC2 A;  2WKQ A;  2V1A A;  5HSQ A;  4H6J B;  4IUH A;  5HZH A;  3NOU C;  3PBQ A;  2VKS A;  3VV4 A;  3LFV A;  3CAX A;  1P0Z A;  4GHI A;  5DKK A;  1LL8 A;  2V9A A;  4OOL A;  3TW8 A;  3ZYT A;  5DJU A;  4NXB A;  2MJ6 A;  3RH8 B;  2D02 A;  2VZW A;  4Y3I A;  4ZRR A;  2ZOH A;  4PHT A;  3RTY A;  5HWV A;  4L9G A;  3C8C A;  2W27 A;  4MCW A;  1DP6 A;  2KX6 A;  4NXG A;  4Y5F A;  3T4K A;  5A8B A;  3F1N B;  3P01 A;  1G28 A;  2LB5 A;  3T4O A;  4II7 A;  3D72 A;  2K7S A;  4WEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...