4GHIB

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a benzoxadiazole antagonist
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Allosteric inhibition of hypoxia inducible factor-2 with small molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 31
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ghiB01
4HP9A 1UWPX 4HJ4A 1XJ4A 4L9EA 1JNUA 5F5YA 1GSWA 2VEAA 1V9YA 2ZOHA 3B33A 3NOTC 1XJ6A 1OJ5A 3MQQA 1DP9A 2QWSA 1S1ZA 4L9FA 2BASA 2EA9A 4GW9A 1LL8A 4EESA 4LRYC 3D72A 2W0NA 1T18A 1T1BA 2VV8A 4BBTA 5HDDA 1OT9A 4R38A 1S66L 4HH3A 4GCZA 1DP8A 2B02A 4K08A 3A0RA 1TS7A 3C2WA 2PR6A 1OTDA 3MR0A 4EXOA 5F69A 3LI8A 1OTBA 1TS8A 4JGPA 5TBMA 2PHYA 4YWZA 5HWTA 2QKPA 2L1MA 1N9OA 3UB7A 4KUOA 1G28A 4BBVA 3LICA 5TBMB 2D02A 3BY8A 2GJ3A 5HDCA 2VV7A 1LSVA 4I39A 4I3AA 3FC7A 4B9OA 1N9NA 2OWHA 1P0ZA 4HNBA 5DKLA 3A0VA 3UMEA 5HD3A 4I3IA 2PYPA 2KDKA 2QHKA 4M4XA 3MFXA 3CWFA 1T19A 4WN5A 4LLOB 4I5SA 2D01A 5G4ZA 3ULFA 4XT2A 3MJQA 2V0WA 3UB6A 3K3DA 2PD7A 1LT0A 4NXBA 1X0OA 5I5LA 4JGRA 1F98A 4LRXC 5J4EA 4XT2B 4E04A 3PYPA 4I38A 3UB9A 2YKHA 1MZUA 3LI9A 1XFQA 2P7JA 4LPZA 2PD8A 2WKRA 3FG8A 3T50A 4RQ9A 3LIEA 4HH2A 3NOPC 2OWJA 3PHYA 2VLGA 3IS2A 2KX6A 1TS0A 4NXEA 4DJ2A 2WKQA 1S4RA 4JGOA 4R70A 2A24A 5HWVA 1KOUA 2PR5A 4EW7A 3LIBA 4HY8A 1WA9A 4MN6A 4NXGA 3MXQA 1NWZA 4EQ1A 3P7NA 1S4SA 4F3LA 3IS2B 2Z6CA 3RH8B 2W27A 4HI4A 2A24B 5HD5A 2J80A 3F1NA 3VOLA 4L9GA 1T1AA 4WL9A 1OTEA 3F1PA 1TS6A 5F68A 2HV1A 2H28A 4GHIA 2JHEA 5IU1A 4F3LB 3ICYA 5DJUA 4EETB 1D7EA 5IS1A 2INWA 4PKYA 3F1NB 3ZQ5A 3C8CA 1D06A 3UB8A 2VV6A 3E4PA 1P97A 3A0SA 4GHIB 4JGQA 2V1AA 3MQOA 4BBUA 3BWLA 3HJKA 2Z6DA 1LSXA 4NXFA 1OTAA 1V9ZA 5KIZA 4HJ3A 1XJ3A 3VE4A 3EEHA 1XJ2A 3RTYA 5DJTA 1ODVA 1OT6A 2V0UA 2I9VA 2QJ7A 2PYRA 3UE6A 1Y28A 4EEUA 4LRZE 1DP6A 4GS9A 3H9WA 5HDSA 2R78A 5AVEA 1OJGA 5EFWA 2CMNA 4KUKA 5AVFA 3GDIA 3BY9A 3HJIA 3H82A 4GS9B 4R3AA 2WKPA 3E4QA 4H6JA 1GSXA 3IBRA 1VB6A 3CLOA 3LUQA 4HIAA 3G6OA 1XFNA 3F1OA 4MN5A 3VE3A 4DJ3A 2OOLA 5G4YA 2K7SA 2V9AA 4HOIA 5HZHA 3H82B 5HWWA 4EERA 1UGUA 3H7WA 4HQAA 3LIDA 1F9IA 3KX0X 3K3CA 3LYXA 4HJ6A 4H6JB 1LSWA 3SW1A 3EWKA 3LIAA 1DRMA 3E4OA 1UWNX 3F1OB 2M1CA 3OLOA 4I3JA 4WF0A 3GECA 4HP4A 1GSVA 5J3WA 2PDRA 3H7WB 1S67L 3F1PB 4KQDA 2JN7A 3NOUC 2L0WA 1OTIA 3CAXA 2ZOIA 3NHQA 2YKFA 2V1BA 5F6AA 4EEPA 5DKKA 2ZBBA 4HHDA 4WLAA 5A8BA 2QJ5A 3LIFA 3UMDA 3NJAA 5J7EA 1N9LA 4WUJA 1T1CA 1S1YA 4R6LA 1EW0A 2L4RA 1BYWA 5HSQA 4PKYG
chains in the Genus database with same CATH superfamily
5F5YA 1XJ4A 4L9EA 5CERA 3FPVA 3WS1A 1IKIA 1V9YA 2ZOHA 5G18A 1XJ6A 2J3TC 1NXYA 1N9BA 1FQGA 2EX2A 4L9FA 3GMWA 2BASA 3IWIA 2ZC5B 3D72A 4WBGA 3W2ZA 1FILA 3V50A 1LI0A 1T18A 3WRTA 5EVIB 1SHVA 2ZC7A 4RX2A 2VV8A 1K4EA 5HDDA 1YMXA 1JWPA 5F1FA 2B02A 4Q0IA 3FKVA 5L07A 5FEGA 3CUEC 1IOUA 4DF6A 3CI6A 1OTDA 5EVIC 1SCWA 2ZC3B 4XUZA 2Y2PA 4R4SA 1PW1A 4Z1WA 1E3UA 5FQMA 1QMEA 3A3DA 5HWTA 5DTKA 2IWCA 4ZJ3A 1N9OA 5HAPA 5DFXA 3IQAA 5FI7A 1MWRA 2P74A 3LICA 4AFIA 2P04A 2D02A 2V20A 1ERMA 3OPLA 4IEDA 2Y55A 3W4QA 2WUQA 4I39A 2EFUA 4IBRA 4OP8A 1JTDA 3PBNA 2WGIA 3T4SA 1N9NA 2OAP1 4HNBA 2ZJ9A 1W8QA 3A0VA 5HD3A 1L0EA 4N92A 1BTLA 2O0YA 4UAAA 5DFYA 1VEUA 3CWFA 5GLBA 4CJNA 1T19A 4WN5A 1Y4OA 3D9YA 4Y0OA 3MJQA 4U3TA 3GRJA 5CECA 3BM6A 1G6AA 4YOFA 2PBDP 3OPHA 3UE0A 4B4XA 3TE8A 2ZMFA 4ID4A 1F98A 3NECA 2Z2LB 2DMWA 4QWOA 4I38A 2Y79A 3DTEA 4OH0A 4Y13A 1VETB 1E4DA 1XFQA 4X1LA 3BECA 3B42A 2PD8A 2WKRA 4GB7A 3UN7A 4K0WA 3NOPC 2XA7M 2VLGA 4HBUA 2KX6A 4BD1A 1K55C 2WKQA 4S2MA 2HDQA 3HLWA 3HUMA 1KOUA 4DN0A 3V3RA 4QU3A 1H8MA 2HPBA 1WA9A 4MN6A 5CX7A 5J8XA 2V2FF 4CLCE 3C7VA 3P7NA 1KE0A 2WKEA 3IS2B 3M6BA 3RH8B 2XK1A 1PWCA 1ES3A 2A24B 1ONGA 4P85A 1FOFA 4L9GA 3MFDA 3V5MA 1OTEA 2DCFA 3WS2A 3Q81A 3KO6A 5TFQA 3PBOA 3S7NA 3ITBA 4ZJ1A 5EV0A 3T1SA 4GHIA 5IU1A 3ICYA 1D7EA 4BWIA 2GDNA 3SS5A 2XFTA 2H10A 5IT5A 4EWFA 4X53A 3ZQ5A 1D06A 4DE0A 3UB8A 2VV6A 3IX3A 2P9VB 2Y2QA 1P97A 1RCJA 3A0SA 3QNBA 4YINA 3UE1A 3HLDA 2UWXA 3C4OA 5K5BA 2Z6DA 2EWVA 4OLGA 3IH8A 3SS4A 5KIZA 1BLPA 4IVIA 4RX3A 1VQQA 1PW8A 1HTZA 3VE4A 4ZDXA 1ES4A 3EEHA 4JXWA 3RTYA 4GKUA 1G68A 2AVXA 1ODVA 1K54C 1YM1A 1OT6A 4U0TA 1YQSA 2I9VA 4K0XA 2PYRA 2RL3A 4BL3A 3GV9A 2GX5A 4LRZE 1NZUA 4XXRA 2ZC4B 5GLAA 1K38A 1W7FA 1IYSA 4KUKA 4LCLA 4PM6A 5HW3A 1L0GA 3BY9A 2O9AA 5A92A 1FCNA 2XQZA 4DXCA 3HJIA 4GS9B 4R3AA 3PAEA 4WELA 4PHTA 4JXSA 2IWDA 3LUQA 4ZTKA 4JKTA 2JKTM 4OPQA 3T4QA 3TG9A 3F1OA 1KE3A 1XX2A 3EQVA 2Y2KA 3ZVTA 5L2FA 4OQGA 5HZHA 3T12B 4JF6A 4EERA 1UGUA 4X1MA 3PBTA 4HQAA 3LIDA 3KX0X 4R1GA 1BLHA 2J9PA 3EWKA 1PNEA 3LIAA 5FATA 3JPUA 4KZ4A 1UWNX 2NUPC 4I3JA 1CI8A 4LV2A 2XGNA 4HP4A 5CHJA 1K54A 1J3WA 3IXHA 3IF6C 4ZRRA 1MWUA 3IWOA 2Y8HA 4KQDA 2JN7A 3PTEA 3NDGA 2G7UA 3T4JA 1ES5A 3CAXA 3NHQA 5E2HA 3JVUA 5GHYA 4EUZA 4S2IA 2V1BA 5E43A 1CEGA 3WS5A 4EEPA 5DKKA 4WLAA 1AWIA 2QJ5A 2JKRI 4OQIA 2J9OA 1NRFA 2QMIA 5J7EA 1N9LA 2G2WA 3BFDA 3BYDA 3S7PA 3HBRA 4ME4A 3S1YA 3ZG7B 4NG2A 1PZPA 5DF8A 1NZOA 3E2LA 3G4PA 1TF1A 2B95A 2VEAA 3NOTC 3P98A 2M7UA 3R7WB 5GHXA 4DDYA 3NIAA 2W3DA 3OPRA 4UA6A 3ITAA 2QWSA 3QP4A 4HESA 4IUHA 4KZ3A 4QY5A 5FI2A 3N8RA 4GW9A 4II7A 4EESA 4LRYC 5DTSA 5TJJA 4CLCC 2HDRA 3NCKA 4JF5A 1IYPA 2R9XA 4FTXA 1T1BA 4IJGA 1I2WA 1OPXA 2ZM8A 3C5AA 4M3KA 4Q8IA 4BBTA 3IF6A 1HLUP 5M19A 3HCYA 4K08A 1C3BA 1TS7A 1H8YA 4MMNA 5DVAA 3S4XA 3C2WA 5E2FA 1YSPA 4R3BA 2RCXA 5EECA 3VP1A 5GHZA 4UHUA 2XSSA 2C6WB 1K56D 1G6OA 4JLFA 4EXOA 5F69A 2Y2GA 3LI8A 4S2PA 3G35A 4JF4A 3QP8A 3N8LA 2V8FA 4PPRA 5AQAA 4YWZA 5EVLA 4D2OA 3T4TA 2QKPA 2L1MA 2KLIA 5EM1A 1EROA 2XF3A 1BULA 4KUOA 5HX9A 4DDSA 3IT9A 2WKHA 3IHBA 4BBVA 1K0KA 4Y0TA 2O99A 1MXOA 2GJ3A 5HDCA 3E2KA 2VV7A 3HUOA 3UNWA 4NKPA 1SDEA 1DJCA 3C30A 4I3AA 3FC7A 4FOFA 2EX8A 1KVLA 2ZD8A 3MBZA 4RVAA 2C5WB 2Y59A 4CLCA 4I3IA 4QB8A 4JXVA 4M4XA 1K25A 4OOYA 3UDIA 4WZ5C 4CPKA 3PBQA 3ULFA 5JYOA 3KSIA 1PI4A 4OQ0A 3TOIA 1TDGA 1DY6A 4ZBEA 1L3LA 1YLZA 1LT0A 3C4PA 5I5LA 1VEUB 4BL2A 3MKFA 4CLCD 4P6ZM 3G31A 1YKDA 3MZEA 4LRXC 5J4EA 4R4RA 3V3SA 3IBJA 4KENB 4KZ9A 2YKHA 4N9KA 1KGEA 5FQKA 1CK3A 4GJ4A 1N4OA 1LHYA 2P7JA 4LV3A 3FG8A 2WYXA 2FFYA 4RQ9A 2VX8A 3LIEA 4PM5A 1XKZA 3VSKA 1MWSA 2JKFA 2XFSA 4JGOA 4R70A 3W4OA 1YT4A 5FSRA 4DE2A 3I7JA 5DTTA 2WGWA 3FWLA 4E3LA 1L0FA 1H8ZA 3GSGA 3IHAA 2OV5A 3CPTA 5EVEA 3BFGA 3N4IA 4F3LA 3VP2A 2Z6CA 3BLSA 3BFEA 1ZC2A 4WZ5A 5HD5A 3FKWA 2J80A 5FL3A 3NY4A 2ACGA 4D60A 5F68A 2HV1A 3CJMA 2JHEA 4KQRA 3PXPA 4OPYA 5IS1A 2INWA 1H5XA 3D3OA 5F82A 4ZJ2A 1PYYA 2VKSA 3LO7A 3E4PA 4N1XA 3CITA 4GHIB 2P08A 4N1HA 5I94A 2V1AA 4EBNA 3MQOA 5TR7A 3A3JA 4BBUA 3HJKA 1JVJA 1FIKA 1LSXA 3HLGA 4L0LA 1I5QA 2ZC6B 4YNRA 4PAUA 1XJ3A 3HUNA 3Q1FA 4O0PA 3HLEA 5FAPA 4LV1A 1ERQA 3A3EA 2XA7S 1GCEA 3T1QB 4UA7A 3SZTA 3UPPA 5GLDA 3IH9A 4UQIM 5AQ7A 3LR0A 1PWGA 4ARZA 2Y2IA 2ZQAA 4KG5A 1W63M 4OKPA 2J3WA 5HDSA 2PRFA 3CMZA 4ETZA 5AVEA 2A2LA 4WZ4A 4BENA 3VOYA 1BZAA 2HF6A 3KSFA 1IYOA 5AVFA 2E8IA 3Q82A 4PM7A 2BLSA 1VM1A 2HJ9C 4OOLA 3LR5A 3K2NA 3UB5P 4E3OA 1W63Q 1ESIA 1RGYA 2H0YA 4S2LA 3IBRA 3JVVA 3CLOA 3IXBA 4O8GA 3T4OA 3G6OA 3VOZA 4MNRA 5CXWA 1ZG4A 1HVBA 4MN5A 4UA9A 1F2KA 2VJWA 2OOLA 3EEAA 5G4YA 2PT7A 3V67A 2W3HA 3E98A 1WE4A 4DKIA 4OPZA 1F9IA 3LYXA 2ZQCA 1PZOA 1ACFA 3G2ZA 1DRMA 1NRJA 4U0XA 1FCOA 3F1OB 2M1CA 5EM0A 4BMWA 3VFFA 5EOOA 1NLYA 1JWVA 3C7UA 2B5RA 3MXSA 5J3WA 5AQBA 1BT5A 2NUTC 4OLDA 3F1PB 4MBFA 4KZBA 4LV0A 2Z2MB 3ZGAB 4S2OA 1K57A 1WYCA 4KG6A 3VP3A 5JYPA 2ZQ9A 1G5UA 2HZ5A 3LCEA 4OOMA 5F6AA 1TD5A 2ZBBA 3AGEA 5A8BA 3RFBA 2LB9A 1KGFA 3LY3A 5KSHA 1K6SA 3T1RA 4WUJA 2A3UA 1HD8A 1T1CA 4JPMA 4GNUA 1S1YA 5EUAA 4R6LA 1L0DA 1YMSA 3D4FA 1PIOA 2L4RA 5L10A 4OPRA 5HSQA 3T1XA 4PKYG 2ZL1A 4HP9A 1UWPX 1SKOB 1GSWA 3MSHA 3B33A 2VA0A 5KMWA 3MQQA 4LFUA 3MS6A 3IF5A 2EX9A 1S1ZA 1K4FA 2EA9A 5M18A 1LL8A 1NJ4A 2Q0OA 4S2KA 2J8YA 2XLNA 1E25A 4KQOA 3SS3A 4WEJA 4E3NA 4GOGA 4EQIA 3T4LA 4BJPA 2JKTI 2J7VA 3N7WA 2JBFA 1OT9A 4HH3A 4GCZA 3A0RA 3O87A 1STZA 2ZLYA 5M1AA 2HP5A 3O3VA 4KZ5A 1ALQA 4QD4A 3MR0A 4JBFA 3G2YA 1XPBA 4PM9A 3IF6B 3ISGA 2HP6A 4JGPA 5TBMA 3UPNA 1YAXA 2Y2JA 3KYQA 5FQQA 4A5RA 5FDSA 4Q0HA 2WK0A 4E3JA 3CHWP 5KSCA 5CTMA 5E2GA 2QYBA 3VSLA 4R3JA 4EBPA 4EU0A 4E6XA 3BY8A 3HREA 4HEFA 4MN7A 3HL9A 4N9LA 5CGXA 2KOIA 2WKIA 5HPFA 4GZBA 3DAVA 3U2AA 4X25A 2CC1A 5CGWA 1P0ZA 2W3EA 5CTNA 3UMEA 3UY6A 1DJBA 3ZDJA 4E3IA 1GA9A 3MFXA 4KQQA 4KZ8A 3BW6A 3ZG0A 4LLOB 4I5SA 4FH4A 2D01A 5G4ZA 4XT2A 1KE4A 2ZQ8A 2V0WA 3TW8A 4BD0A 4QJGA 1YSQA 3UB6A 1WYBA 4Y3IA 4KZ7A 1P9WA 1Q2PA 4CLCB 2PD7A 3WRZA 1ZHHB 4Y15A 1L2SA 4NXBA 1X0OA 1PFLA 1GHIA 4S2NA 4WEKA 1CI9A 3CG5A 4X69A 1OMEA 3BQ8A 1K56A 4E04A 3PYPA 3Q07A 4OP5A 5TGFA 1ZTUA 3UB9A 1MZUA 3FPWA 2IWBA 1TDLA 3LI9A 3ZNTA 1GHMA 4QPRA 1LL9A 1MBLA 4O7DA 1QMFA 4LPZA 3UO9A 2VGKA 5L8MA 1ES2A 4EBLA 2VGLS 4HH2A 4Y0UA 1XP4A 5L09A 1D1JA 2XH9A 2ZM2A 1H0MA 3UDFA 3QP5A 4DJ2A 3HLBA 1SZVA 3HLCA 5HWVA 4GN2A 4EW7A 3MXRA 4HY8A 5CEBA 5CHMA 4NXGA 2G2UA 3QHYA 4DXBA 3HVFA 3LEQA 1S4SA 1ESUA 1NYYA 2W27A 3PAGA 3Q7ZA 3SH8A 4HI4A 1BUEA 3MZFA 5GL9A 3BJNA 2XD1A 3F1NA 1RGZA 4IVKA 2WAEA 3VOLA 1T1AA 4WL9A 2WGWB 1TS6A 4BQMA 2JE5A 4B4ZA 2H28A 3CPTB 2O9CA 1IYQA 1S6RA 2ZQ7A 1FSWA 2EWWA 3KSGA 4F3LB 1W79A 4EETB 4PKYA 3Q7VA 1U60A 5F1GA 4C75A 1SDNA 1VHMA 4E3MA 5HFOA 3NI9A 3ZFZA 1XXMA 2HGVA 1LLBA 3M6HA 4P6ZS 2XRNA 3TRCA 1Z09A 4DRTA 1W5DA 4G3KA 1BLSA 2I72A 4GLQA 1NLZA 2HP9A 3GR2A 4ETXA 4NXFA 3KYZA 1V9ZA 4FUWA 3OCNA 4PM8A 3OC2A 3SOIA 3VMAA 2JC7A 2Y2NA 5HAQA 4OVDA 1XJ2A 3VFHA 5DJTA 1A0KA 2PAVP 5D3OA 2V0UA 4MLLA 4H8RA 2QJ7A 3O5YA 3UE6A 1Y28A 4EEUA 5EE8A 2O9BA 3H9WA 5A90A 4B88A 1KGGA 1ZG6A 2H5SA 3B47A 1OJGA 4EUVA 1KDWA 5EFWA 3MF0A 4LCMA 4C3QA 4Z9QA 3A3FA 3IXDA 2OAQ1 5HPIA 3ZHHA 2PU4A 4ARZB 3DWZA 2K2NA 2W1TA 3ZVWA 3N6IA 3EGDC 4GD8A 5FDHA 4X68A 3H82A 5BOHA 2X71A 3RXXA 1Z6FA 4H6JA 5FAOA 2Y91A 1VB6A 4UEYA 2VGJA 4OONA 3BFFA 2X02A 5HAIA 3LR4A 3VE3A 2QZ6A 4ZAMA 1ONHA 2V9AA 1FSYA 5HL1A 3QP6A 5HWWA 4HBTA 3H7WA 3K3CA 2XDMA 3SH9A 4HJ6A 1LSWA 2Y2LA 3OOVA 3SW1A 5CRFA 2PBYA 3E4OA 3U4LP 1MKIA 3AGDA 3QP1A 5E2EA 1LI9A 4XUXA 5A93A 4K91A 4WF0A 4OQHA 4P6BA 3BQAA 2PDRA 3G30A 1O07A 3ZG8B 1MKMA 5FQJA 2L0WA 3S7QA 1IEMA 2JCHA 3ZYTA 1OTIA 2WZZA 1GA0A 4LGWA 4UQIS 1H3QA 4DMZA 1RP5A 1E3UD 2OLUA 3UE3A 3SH7A 4R0QA 5AJGA 2HJEA 4IHQA 2WZXA 2ZMVA 3UMDA 3NJAA 3PBRA 3QNCA 2GZAA 2B18A 2JKGA 4PMAA 3ZCZA 5FQ9A 1BYWA 3DW0A 2J3TD 3LGOA 5FQIA 4HJ4A 3CUEA 1JNUA 1IKGA 1SKFA 1OJ5A 5EVIA 5GLCA 1IFQA 1K57C 4MEZA 1DP9A 2V8CA 1YPRA 4O01A 2FH5A 1XA7A 1YLTA 2ZL1B 2W0NA 2HDUA 3WS4A 2Y2MA 3V39A 2BTFP 3BEBA 3L7HA 4X55A 4RYEA 4R38A 1S66L 1DP8A 3B3XA 4GD6A 2X01A 3FZCA 5EVID 1YLWA 4E3KA 1JTGA 2PR6A 1P9RA 4G3VA 2R9WA 3G32A 3TJZC 3EQUA 5CHUA 1OTBA 1TS8A 1FCMA 1M40A 2PHYA 2E8JA 3MZDA 3UB7A 3QP2A 1G28A 2LB5A 1MY8A 4MBHA 3W4PA 5TBMB 1S0WA 2EFXA 4X6TA 3KYEA 1LSVA 1O7EA 2FZ0A 4B9OA 3IWQA 2WGVA 2OWHA 1CF0A 1CEFA 1KDSA 5CGSA 5DKLA 1EI5A 2PYPA 4QHCA 3A3IA 3LEZA 3VP0A 2KDKA 4MBKA 2QHKA 2Y4AA 2Y2HA 3N8SA 2XEPA 3L9KA 3BLMA 2VZWA 3MQ0A 3PR6A 3K3DA 1K55A 1VETA 1W8YA 1CQAA 3P09A 2QPNA 4Y5FA 4JGRA 4F94A 2UV0E 3DTMA 3JYIA 4NEED 4KG2A 5HL6A 4NK3A 1YLPA 4KZAA 4XT2B 3O86A 4GDNA 3M2JA 1ZKJA 1Q2QA 1TVFA 5AQ9A 4WM9A 1PWDA 3BFCA 3NC8A 1MWTA 1LL5A 3T50A 4S2JA 1XGIA 2OWJA 3PHYA 3IS2A 1KVMA 1TS0A 3CZDA 4NXEA 2GNXA 3PBSA 3WS0A 5A91A 1S4RA 4MCWA 2A24A 4Y7PA 3GQZA 4S2NC 2PR5A 1M6KA 3LIBA 1IELA 3DTKA 3FV7A 5EOEA 3NBLA 3OBFA 3S22A 3IX8A 1NWZA 3MXQA 2V1ZA 4EQ1A 3KSHA 4NETA 2IA2A 4IUKA 3RJUA 1TEMA 5FAQA 5FA7A 3ZG5A 3F1PA 2A49A 2P9VA 3LY4A 4YFMA 3M2KA 3IXGA 5DJUA 4KZ6A 5C5KA 3F1NB 3VV4A 3EOIA 3C8CA 3GTCA 1CJFA 3DWKA 3OCLA 3T4KA 3DBAA 3ZG9B 4DE1A 4P0MA 5HARA 3FYZA 4IBXA 3NDEA 4JGQA 2W1RA 1PRQA 5DF9A 1DJAA 3Q7VB 4FSFA 4MDZA 3BWLA 4WMCA 1GHPA 1OTAA 1BSGA 3DTIA 3GVBA 1SKOA 4GDBA 1YLYA 2OSUA 4HJ3A 2PU2A 2Q9NA 5LBRA 2ZQDA 2M7VA 2JKRM 5IHVA 2W3FA 4Y2FA 3G34A 5MC7A 2W3GA 3LFVA 3P01A 1FR6A 2ZM0A 1BLCA 1DP6A 4ESPA 4GS9A 2ZMAA 1F5MA 2R78A 4X56A 4WMCD 3MKEA 4JXGA 2WADA 2CMNA 3OPPA 1NY0A 4EV4A 3GDIA 4P87A 5U47A 3O88A 2WKPA 1K6RA 4LENA 3E4QA 1FR1A 4FD8A 1GSXA 4FH2A 2BG1A 2XD5A 2Y2OA 1XGJA 4HIAA 2EXBA 3UDXA 4QY6A 5EPHA 5FASA 4RA7A 2Q9MA 1XFNA 3ZNYA 3S7OA 4B93A 4DJ3A 2K31A 2DNSA 2MJ6A 2XROA 2K7SA 2VK3A 5KZHA 2W1TB 3HLFA 4HOIA 1YLJA 3H82B 2EXAA 2OLVA 4Q0JA 4H6JB 2WAFA 1J9MA 1HZOA 3EGXC 4FCFA 3AGFA 5DF7A 5CEDA 2VGLM 3OLOA 4DE3A 3IX4A 3GECA 1I2SA 1GSVA 1EWZA 3H7WB 1S67L 5F83A 1XA1A 4E6WA 4CQHA 3NOUC 3R4KA 2FFFB 3TSGA 1PI5A 1MC0A 2DRWA 2ZOIA 3NULA 4C6YA 3W8KA 3BRMA 2YKFA 2HDSA 3OZHA 3UPOA 1Y54A 4R23A 2EX6A 3C38A 5FEFA 2H0TA 4HHDA 1NYMA 1AXBA 3LR3A 4WYYA 5FI6A 1JWZA 1MPLA 2XR0A 3R7WA 3LIFA 3MMHA 3VP4A 3E0YA 3RXWA 3WWXA 1EW0A 4BLMA 4G3WA 4Y17A
chains in the Genus database with same CATH topology
4HP9A 1UWPX 3CUEA 1XJ4A 4HJ4A 1JNUA 3FPVA 4L9EA 5F5YA 1TF1A 1GSWA 2VEAA 1V9YA 2ZOHA 3B33A 3NOTC 1XJ6A 2VA0A 2M7UA 1OJ5A 3R7WB 3MQQA 1IFQA 2J3TC 1DP9A 2W3DA 2QWSA 4O01A 4IUHA 1S1ZA 2FH5A 4L9FA 2BASA 2EA9A 4GW9A 4II7A 1LL8A 4EESA 4LRYC 3D72A 5TJJA 3W2ZA 4CLCC 2W0NA 4KQOA 4IJGA 1T18A 1T1BA 1OPXA 4WEJA 3T4LA 4BJPA 2JKTI 2VV8A 4BBTA 5HDDA 1OT9A 4R38A 1S66L 4HH3A 4GCZA 1DP8A 2B02A 3HCYA 3A0RA 4K08A 1TS7A 4Q0IA 1STZA 4MMNA 3CUEC 3C2WA 1YSPA 1IOUA 3CI6A 2PR6A 1P9RA 2XSSA 4G3VA 1OTDA 3MR0A 1G6OA 4EXOA 3TJZC 5F69A 3LI8A 3EQUA 1OTBA 1TS8A 4JGPA 5TBMA 4Z1WA 1YAXA 2PHYA 3KYQA 4YWZA 5HWTA 4Q0HA 3T4TA 2QKPA 2L1MA 1N9OA 2KLIA 5DFXA 3UB7A 4KUOA 2QYBA 1G28A 4EU0A 4BBVA 3LICA 2LB5A 4AFIA 5TBMB 2P04A 2D02A 3BY8A 2O99A 2GJ3A 4MN7A 5HDCA 2KOIA 2VV7A 4NKPA 1LSVA 5HPFA 4I39A 3C30A 4I3AA 3FC7A 3U2AA 3PBNA 2FZ0A 4B9OA 3T4SA 1N9NA 4FOFA 2OAP1 2OWHA 1P0ZA 2W3EA 4HNBA 5DKLA 3A0VA 3UMEA 5HD3A 4CLCA 4I3IA 2PYPA 2KDKA 2O0YA 5DFYA 2QHKA 4M4XA 3MFXA 3CWFA 3BW6A 1T19A 4WN5A 4LLOB 4I5SA 2D01A 5G4ZA 3PBQA 3ULFA 4XT2A 3KSIA 3MJQA 2VZWA 3TW8A 2V0WA 3MQ0A 1YSQA 3UB6A 4Y3IA 3PR6A 1P9WA 4CLCB 3K3DA 4YOFA 2PD7A 1ZHHB 1LT0A 4NXBA 1X0OA 5I5LA 4Y5FA 4JGRA 4WEKA 4CLCD 4NEED 3TE8A 4P6ZM 2ZMFA 1F98A 5HL6A 1YKDA 3BQ8A 4LRXC 5J4EA 4XT2B 4E04A 3PYPA 2DMWA 3IBJA 4I38A 1ZTUA 2Y79A 3UB9A 2YKHA 1MZUA 3FPWA 4GJ4A 3LI9A 1XFQA 4QPRA 3B42A 2P7JA 4LPZA 2PD8A 2WKRA 3FG8A 5L8MA 3T50A 2VGLS 4RQ9A 2VX8A 3LIEA 4HH2A 3NOPC 2OWJA 2XA7M 3PHYA 2VLGA 3IS2A 2KX6A 1TS0A 4NXEA 2GNXA 3PBSA 4DJ2A 2WKQA 1S4RA 4JGOA 4R70A 4MCWA 2A24A 5HWVA 1KOUA 4DN0A 2PR5A 4EW7A 1H8MA 3LIBA 4HY8A 1WA9A 4MN6A 5CX7A 4NXGA 3OBFA 3MXQA 1NWZA 4CLCE 4EQ1A 3P7NA 1S4SA 4F3LA 3IS2B 3KSHA 2Z6CA 3RH8B 2W27A 2IA2A 4IUKA 4HI4A 2A24B 5HD5A 2J80A 5FL3A 3BJNA 3F1NA 3VOLA 4L9GA 1T1AA 4WL9A 1OTEA 3F1PA 1TS6A 3KO6A 5F68A 2HV1A 3PBOA 3S7NA 2H28A 4GHIA 2JHEA 2O9CA 5IU1A 3PXPA 2EWWA 3KSGA 4F3LB 3ICYA 5DJUA 4EETB 1D7EA 4BWIA 5IS1A 2INWA 4PKYA 5C5KA 3F1NB 1VHMA 5IT5A 3VV4A 3D3OA 3C8CA 3EOIA 3ZQ5A 1D06A 3UB8A 2VKSA 3OCLA 3T4KA 3DBAA 2VV6A 3E4PA 2HGVA 1P97A 3A0SA 4P6ZS 3CITA 2XRNA 4GHIB 2P08A 3TRCA 4JGQA 2V1AA 4G3KA 2W1RA 3MQOA 5DF9A 4BBUA 4GLQA 1NLZA 4FSFA 5K5BA 3BWLA 3HJKA 2Z6DA 2EWVA 1LSXA 4MDZA 4L0LA 4NXFA 4ETXA 3KYZA 1OTAA 1V9ZA 5KIZA 3OCNA 3OC2A 4YNRA 4PAUA 4HJ3A 1XJ3A 4O0PA 3VE4A 5LBRA 3EEHA 2M7VA 1XJ2A 2JKRM 2XA7S 3RTYA 2W3FA 5DJTA 4Y2FA 1ODVA 4UQIM 5MC7A 1OT6A 3LR0A 2V0UA 2W3GA 3LFVA 4ARZA 2I9VA 2QJ7A 3P01A 2PYRA 3O5YA 3UE6A 1Y28A 4EEUA 4LRZE 1W63M 2GX5A 1DP6A 2O9BA 4GS9A 2J3WA 3H9WA 5HDSA 1F5MA 2R78A 4ETZA 5AVEA 2A2LA 3B47A 1OJGA 4EUVA 5EFWA 2HF6A 3MF0A 2CMNA 3KSFA 4KUKA 5AVFA 2OAQ1 5HPIA 4ARZB 3GDIA 2HJ9C 3BY9A 4OOLA 2O9AA 2K2NA 3LR5A 2W1TA 3K2NA 3EGDC 3HJIA 1W63Q 3H82A 4GS9B 4R3AA 2WKPA 4WELA 4PHTA 3E4QA 4H6JA 1GSXA 3IBRA 1VB6A 3CLOA 3JVVA 3LUQA 4UEYA 4O8GA 4HIAA 3T4OA 2JKTM 3G6OA 3T4QA 1XFNA 3S7OA 3F1OA 3LR4A 4MN5A 3VE3A 4B93A 4DJ3A 2K31A 3EQVA 2VJWA 2OOLA 2XROA 2MJ6A 3EEAA 2K7SA 2V9AA 5G4YA 2PT7A 2W1TB 3V67A 4HOIA 5HZHA 3H82B 5HWWA 2W3HA 3E98A 4EERA 1UGUA 3H7WA 3PBTA 4HQAA 4Q0JA 3LIDA 1F9IA 3KX0X 3K3CA 3LYXA 4HJ6A 4H6JB 1LSWA 3OOVA 3EGXC 3SW1A 3EWKA 3LIAA 1DRMA 3E4OA 1NRJA 1UWNX 3F1OB 2NUPC 2M1CA 2VGLM 4BMWA 3OLOA 4I3JA 4WF0A 1NLYA 3GECA 4HP4A 1GSVA 5J3WA 3BQAA 2PDRA 3H7WB 1S67L 4ZRRA 2NUTC 2Y8HA 3F1PB 4KQDA 2JN7A 4CQHA 1MKMA 3NOUC 2L0WA 3R4KA 3S7QA 1MC0A 3ZYTA 2G7UA 3T4JA 1OTIA 4UQIS 3CAXA 2ZOIA 3NHQA 1H3QA 4DMZA 3JVUA 2YKFA 3UE3A 2V1BA 4OOMA 5F6AA 1TD5A 3C38A 5AJGA 4EEPA 5DKKA 2ZBBA 2HJEA 4HHDA 4WLAA 3LR3A 5A8BA 4IHQA 2QJ5A 2JKRI 3RFBA 3R7WA 2LB9A 2ZMVA 3LIFA 3MMHA 3UMDA 3E0YA 3NJAA 5KSHA 5J7EA 1N9LA 3PBRA 4WUJA 1T1CA 2GZAA 2B18A 1S1YA 4R6LA 1EW0A 3S7PA 2L4RA 4ME4A 1BYWA 5HSQA 4G3WA 4PKYG 2J3TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HP9 A;  1UWP X;  4HJ4 A;  1XJ4 A;  4L9E A;  1JNU A;  5F5Y A;  1GSW A;  2VEA A;  1V9Y A;  2ZOH A;  3B33 A;  3NOT C;  1XJ6 A;  1OJ5 A;  3MQQ A;  1DP9 A;  2QWS A;  1S1Z A;  4L9F A;  2BAS A;  2EA9 A;  4GW9 A;  1LL8 A;  4EES A;  4LRY C;  3D72 A;  2W0N A;  1T18 A;  1T1B A;  2VV8 A;  4BBT A;  5HDD A;  1OT9 A;  4R38 A;  1S66 L;  4HH3 A;  4GCZ A;  1DP8 A;  2B02 A;  4K08 A;  3A0R A;  1TS7 A;  3C2W A;  2PR6 A;  1OTD A;  3MR0 A;  4EXO A;  5F69 A;  3LI8 A;  1OTB A;  1TS8 A;  4JGP A;  5TBM A;  2PHY A;  4YWZ A;  5HWT A;  2QKP A;  2L1M A;  1N9O A;  3UB7 A;  4KUO A;  1G28 A;  4BBV A;  3LIC A;  5TBM B;  2D02 A;  3BY8 A;  2GJ3 A;  5HDC A;  2VV7 A;  1LSV A;  4I39 A;  4I3A A;  3FC7 A;  4B9O A;  1N9N A;  2OWH A;  1P0Z A;  4HNB A;  5DKL A;  3A0V A;  3UME A;  5HD3 A;  4I3I A;  2PYP A;  2KDK A;  2QHK A;  4M4X A;  3MFX A;  3CWF A;  1T19 A;  4WN5 A;  4LLO B;  4I5S A;  2D01 A;  5G4Z A;  3ULF A;  4XT2 A;  3MJQ A;  2V0W A;  3UB6 A;  3K3D A;  2PD7 A;  1LT0 A;  4NXB A;  1X0O A;  5I5L A;  4JGR A;  1F98 A;  4LRX C;  5J4E A;  4XT2 B;  4E04 A;  3PYP A;  4I38 A;  3UB9 A;  2YKH A;  1MZU A;  3LI9 A;  1XFQ A;  2P7J A;  4LPZ A;  2PD8 A;  2WKR A;  3FG8 A;  3T50 A;  4RQ9 A;  3LIE A;  4HH2 A;  3NOP C;  2OWJ A;  3PHY A;  2VLG A;  3IS2 A;  2KX6 A;  1TS0 A;  4NXE A;  4DJ2 A;  2WKQ A;  1S4R A;  4JGO A;  4R70 A;  2A24 A;  5HWV A;  1KOU A;  2PR5 A;  4EW7 A;  3LIB A;  4HY8 A;  1WA9 A;  4MN6 A;  4NXG A;  3MXQ A;  1NWZ A;  4EQ1 A;  3P7N A;  1S4S A;  4F3L A;  3IS2 B;  2Z6C A;  3RH8 B;  2W27 A;  4HI4 A;  2A24 B;  5HD5 A;  2J80 A;  3F1N A;  3VOL A;  4L9G A;  1T1A A;  4WL9 A;  1OTE A;  3F1P A;  1TS6 A;  5F68 A;  2HV1 A;  2H28 A;  4GHI A;  2JHE A;  5IU1 A;  4F3L B;  3ICY A;  5DJU A;  4EET B;  1D7E A;  5IS1 A;  2INW A;  4PKY A;  3F1N B;  3ZQ5 A;  3C8C A;  1D06 A;  3UB8 A;  2VV6 A;  3E4P A;  1P97 A;  3A0S A;  4GHI B;  4JGQ A;  2V1A A;  3MQO A;  4BBU A;  3BWL A;  3HJK A;  2Z6D A;  1LSX A;  4NXF A;  1OTA A;  1V9Z A;  5KIZ A;  4HJ3 A;  1XJ3 A;  3VE4 A;  3EEH A;  1XJ2 A;  3RTY A;  5DJT A;  1ODV A;  1OT6 A;  2V0U A;  2I9V A;  2QJ7 A;  2PYR A;  3UE6 A;  1Y28 A;  4EEU A;  4LRZ E;  1DP6 A;  4GS9 A;  3H9W A;  5HDS A;  2R78 A;  5AVE A;  1OJG A;  5EFW A;  2CMN A;  4KUK A;  5AVF A;  3GDI A;  3BY9 A;  3HJI A;  3H82 A;  4GS9 B;  4R3A A;  2WKP A;  3E4Q A;  4H6J A;  1GSX A;  3IBR A;  1VB6 A;  3CLO A;  3LUQ A;  4HIA A;  3G6O A;  1XFN A;  3F1O A;  4MN5 A;  3VE3 A;  4DJ3 A;  2OOL A;  5G4Y A;  2K7S A;  2V9A A;  4HOI A;  5HZH A;  3H82 B;  5HWW A;  4EER A;  1UGU A;  3H7W A;  4HQA A;  3LID A;  1F9I A;  3KX0 X;  3K3C A;  3LYX A;  4HJ6 A;  4H6J B;  1LSW A;  3SW1 A;  3EWK A;  3LIA A;  1DRM A;  3E4O A;  1UWN X;  3F1O B;  2M1C A;  3OLO A;  4I3J A;  4WF0 A;  3GEC A;  4HP4 A;  1GSV A;  5J3W A;  2PDR A;  3H7W B;  1S67 L;  3F1P B;  4KQD A;  2JN7 A;  3NOU C;  2L0W A;  1OTI A;  3CAX A;  2ZOI A;  3NHQ A;  2YKF A;  2V1B A;  5F6A A;  4EEP A;  5DKK A;  2ZBB A;  4HHD A;  4WLA A;  5A8B A;  2QJ5 A;  3LIF A;  3UMD A;  3NJA A;  5J7E A;  1N9L A;  4WUJ A;  1T1C A;  1S1Y A;  4R6L A;  1EW0 A;  2L4R A;  1BYW A;  5HSQ A;  4PKY G; 
#chains in the Genus database with same CATH topology
 5F5Y A;  1XJ4 A;  4L9E A;  5CER A;  3FPV A;  3WS1 A;  1IKI A;  1V9Y A;  2ZOH A;  5G18 A;  1XJ6 A;  2J3T C;  1NXY A;  1N9B A;  1FQG A;  2EX2 A;  4L9F A;  3GMW A;  2BAS A;  3IWI A;  2ZC5 B;  3D72 A;  4WBG A;  3W2Z A;  1FIL A;  3V50 A;  1LI0 A;  1T18 A;  3WRT A;  5EVI B;  1SHV A;  2ZC7 A;  4RX2 A;  2VV8 A;  1K4E A;  5HDD A;  1YMX A;  1JWP A;  5F1F A;  2B02 A;  4Q0I A;  3FKV A;  5L07 A;  5FEG A;  3CUE C;  1IOU A;  4DF6 A;  3CI6 A;  1OTD A;  5EVI C;  1SCW A;  2ZC3 B;  4XUZ A;  2Y2P A;  4R4S A;  1PW1 A;  4Z1W A;  1E3U A;  5FQM A;  1QME A;  3A3D A;  5HWT A;  5DTK A;  2IWC A;  4ZJ3 A;  1N9O A;  5HAP A;  5DFX A;  3IQA A;  5FI7 A;  1MWR A;  2P74 A;  3LIC A;  4AFI A;  2P04 A;  2D02 A;  2V20 A;  1ERM A;  3OPL A;  4IED A;  2Y55 A;  3W4Q A;  2WUQ A;  4I39 A;  2EFU A;  4IBR A;  4OP8 A;  1JTD A;  3PBN A;  2WGI A;  3T4S A;  1N9N A;  2OAP 1;  4HNB A;  2ZJ9 A;  1W8Q A;  3A0V A;  5HD3 A;  1L0E A;  4N92 A;  1BTL A;  2O0Y A;  4UAA A;  5DFY A;  1VEU A;  3CWF A;  5GLB A;  4CJN A;  1T19 A;  4WN5 A;  1Y4O A;  3D9Y A;  4Y0O A;  3MJQ A;  4U3T A;  3GRJ A;  5CEC A;  3BM6 A;  1G6A A;  4YOF A;  2PBD P;  3OPH A;  3UE0 A;  4B4X A;  3TE8 A;  2ZMF A;  4ID4 A;  1F98 A;  3NEC A;  2Z2L B;  2DMW A;  4QWO A;  4I38 A;  2Y79 A;  3DTE A;  4OH0 A;  4Y13 A;  1VET B;  1E4D A;  1XFQ A;  4X1L A;  3BEC A;  3B42 A;  2PD8 A;  2WKR A;  4GB7 A;  3UN7 A;  4K0W A;  3NOP C;  2XA7 M;  2VLG A;  4HBU A;  2KX6 A;  4BD1 A;  1K55 C;  2WKQ A;  4S2M A;  2HDQ A;  3HLW A;  3HUM A;  1KOU A;  4DN0 A;  3V3R A;  4QU3 A;  1H8M A;  2HPB A;  1WA9 A;  4MN6 A;  5CX7 A;  5J8X A;  2V2F F;  4CLC E;  3C7V A;  3P7N A;  1KE0 A;  2WKE A;  3IS2 B;  3M6B A;  3RH8 B;  2XK1 A;  1PWC A;  1ES3 A;  2A24 B;  1ONG A;  4P85 A;  1FOF A;  4L9G A;  3MFD A;  3V5M A;  1OTE A;  2DCF A;  3WS2 A;  3Q81 A;  3KO6 A;  5TFQ A;  3PBO A;  3S7N A;  3ITB A;  4ZJ1 A;  5EV0 A;  3T1S A;  4GHI A;  5IU1 A;  3ICY A;  1D7E A;  4BWI A;  2GDN A;  3SS5 A;  2XFT A;  2H10 A;  5IT5 A;  4EWF A;  4X53 A;  3ZQ5 A;  1D06 A;  4DE0 A;  3UB8 A;  2VV6 A;  3IX3 A;  2P9V B;  2Y2Q A;  1P97 A;  1RCJ A;  3A0S A;  3QNB A;  4YIN A;  3UE1 A;  3HLD A;  2UWX A;  3C4O A;  5K5B A;  2Z6D A;  2EWV A;  4OLG A;  3IH8 A;  3SS4 A;  5KIZ A;  1BLP A;  4IVI A;  4RX3 A;  1VQQ A;  1PW8 A;  1HTZ A;  3VE4 A;  4ZDX A;  1ES4 A;  3EEH A;  4JXW A;  3RTY A;  4GKU A;  1G68 A;  2AVX A;  1ODV A;  1K54 C;  1YM1 A;  1OT6 A;  4U0T A;  1YQS A;  2I9V A;  4K0X A;  2PYR A;  2RL3 A;  4BL3 A;  3GV9 A;  2GX5 A;  4LRZ E;  1NZU A;  4XXR A;  2ZC4 B;  5GLA A;  1K38 A;  1W7F A;  1IYS A;  4KUK A;  4LCL A;  4PM6 A;  5HW3 A;  1L0G A;  3BY9 A;  2O9A A;  5A92 A;  1FCN A;  2XQZ A;  4DXC A;  3HJI A;  4GS9 B;  4R3A A;  3PAE A;  4WEL A;  4PHT A;  4JXS A;  2IWD A;  3LUQ A;  4ZTK A;  4JKT A;  2JKT M;  4OPQ A;  3T4Q A;  3TG9 A;  3F1O A;  1KE3 A;  1XX2 A;  3EQV A;  2Y2K A;  3ZVT A;  5L2F A;  4OQG A;  5HZH A;  3T12 B;  4JF6 A;  4EER A;  1UGU A;  4X1M A;  3PBT A;  4HQA A;  3LID A;  3KX0 X;  4R1G A;  1BLH A;  2J9P A;  3EWK A;  1PNE A;  3LIA A;  5FAT A;  3JPU A;  4KZ4 A;  1UWN X;  2NUP C;  4I3J A;  1CI8 A;  4LV2 A;  2XGN A;  4HP4 A;  5CHJ A;  1K54 A;  1J3W A;  3IXH A;  3IF6 C;  4ZRR A;  1MWU A;  3IWO A;  2Y8H A;  4KQD A;  2JN7 A;  3PTE A;  3NDG A;  2G7U A;  3T4J A;  1ES5 A;  3CAX A;  3NHQ A;  5E2H A;  3JVU A;  5GHY A;  4EUZ A;  4S2I A;  2V1B A;  5E43 A;  1CEG A;  3WS5 A;  4EEP A;  5DKK A;  4WLA A;  1AWI A;  2QJ5 A;  2JKR I;  4OQI A;  2J9O A;  1NRF A;  2QMI A;  5J7E A;  1N9L A;  2G2W A;  3BFD A;  3BYD A;  3S7P A;  3HBR A;  4ME4 A;  3S1Y A;  3ZG7 B;  4NG2 A;  1PZP A;  5DF8 A;  1NZO A;  3E2L A;  3G4P A;  1TF1 A;  2B95 A;  2VEA A;  3NOT C;  3P98 A;  2M7U A;  3R7W B;  5GHX A;  4DDY A;  3NIA A;  2W3D A;  3OPR A;  4UA6 A;  3ITA A;  2QWS A;  3QP4 A;  4HES A;  4IUH A;  4KZ3 A;  4QY5 A;  5FI2 A;  3N8R A;  4GW9 A;  4II7 A;  4EES A;  4LRY C;  5DTS A;  5TJJ A;  4CLC C;  2HDR A;  3NCK A;  4JF5 A;  1IYP A;  2R9X A;  4FTX A;  1T1B A;  4IJG A;  1I2W A;  1OPX A;  2ZM8 A;  3C5A A;  4M3K A;  4Q8I A;  4BBT A;  3IF6 A;  1HLU P;  5M19 A;  3HCY A;  4K08 A;  1C3B A;  1TS7 A;  1H8Y A;  4MMN A;  5DVA A;  3S4X A;  3C2W A;  5E2F A;  1YSP A;  4R3B A;  2RCX A;  5EEC A;  3VP1 A;  5GHZ A;  4UHU A;  2XSS A;  2C6W B;  1K56 D;  1G6O A;  4JLF A;  4EXO A;  5F69 A;  2Y2G A;  3LI8 A;  4S2P A;  3G35 A;  4JF4 A;  3QP8 A;  3N8L A;  2V8F A;  4PPR A;  5AQA A;  4YWZ A;  5EVL A;  4D2O A;  3T4T A;  2QKP A;  2L1M A;  2KLI A;  5EM1 A;  1ERO A;  2XF3 A;  1BUL A;  4KUO A;  5HX9 A;  4DDS A;  3IT9 A;  2WKH A;  3IHB A;  4BBV A;  1K0K A;  4Y0T A;  2O99 A;  1MXO A;  2GJ3 A;  5HDC A;  3E2K A;  2VV7 A;  3HUO A;  3UNW A;  4NKP A;  1SDE A;  1DJC A;  3C30 A;  4I3A A;  3FC7 A;  4FOF A;  2EX8 A;  1KVL A;  2ZD8 A;  3MBZ A;  4RVA A;  2C5W B;  2Y59 A;  4CLC A;  4I3I A;  4QB8 A;  4JXV A;  4M4X A;  1K25 A;  4OOY A;  3UDI A;  4WZ5 C;  4CPK A;  3PBQ A;  3ULF A;  5JYO A;  3KSI A;  1PI4 A;  4OQ0 A;  3TOI A;  1TDG A;  1DY6 A;  4ZBE A;  1L3L A;  1YLZ A;  1LT0 A;  3C4P A;  5I5L A;  1VEU B;  4BL2 A;  3MKF A;  4CLC D;  4P6Z M;  3G31 A;  1YKD A;  3MZE A;  4LRX C;  5J4E A;  4R4R A;  3V3S A;  3IBJ A;  4KEN B;  4KZ9 A;  2YKH A;  4N9K A;  1KGE A;  5FQK A;  1CK3 A;  4GJ4 A;  1N4O A;  1LHY A;  2P7J A;  4LV3 A;  3FG8 A;  2WYX A;  2FFY A;  4RQ9 A;  2VX8 A;  3LIE A;  4PM5 A;  1XKZ A;  3VSK A;  1MWS A;  2JKF A;  2XFS A;  4JGO A;  4R70 A;  3W4O A;  1YT4 A;  5FSR A;  4DE2 A;  3I7J A;  5DTT A;  2WGW A;  3FWL A;  4E3L A;  1L0F A;  1H8Z A;  3GSG A;  3IHA A;  2OV5 A;  3CPT A;  5EVE A;  3BFG A;  3N4I A;  4F3L A;  3VP2 A;  2Z6C A;  3BLS A;  3BFE A;  1ZC2 A;  4WZ5 A;  5HD5 A;  3FKW A;  2J80 A;  5FL3 A;  3NY4 A;  2ACG A;  4D60 A;  5F68 A;  2HV1 A;  3CJM A;  2JHE A;  4KQR A;  3PXP A;  4OPY A;  5IS1 A;  2INW A;  1H5X A;  3D3O A;  5F82 A;  4ZJ2 A;  1PYY A;  2VKS A;  3LO7 A;  3E4P A;  4N1X A;  3CIT A;  4GHI B;  2P08 A;  4N1H A;  5I94 A;  2V1A A;  4EBN A;  3MQO A;  5TR7 A;  3A3J A;  4BBU A;  3HJK A;  1JVJ A;  1FIK A;  1LSX A;  3HLG A;  4L0L A;  1I5Q A;  2ZC6 B;  4YNR A;  4PAU A;  1XJ3 A;  3HUN A;  3Q1F A;  4O0P A;  3HLE A;  5FAP A;  4LV1 A;  1ERQ A;  3A3E A;  2XA7 S;  1GCE A;  3T1Q B;  4UA7 A;  3SZT A;  3UPP A;  5GLD A;  3IH9 A;  4UQI M;  5AQ7 A;  3LR0 A;  1PWG A;  4ARZ A;  2Y2I A;  2ZQA A;  4KG5 A;  1W63 M;  4OKP A;  2J3W A;  5HDS A;  2PRF A;  3CMZ A;  4ETZ A;  5AVE A;  2A2L A;  4WZ4 A;  4BEN A;  3VOY A;  1BZA A;  2HF6 A;  3KSF A;  1IYO A;  5AVF A;  2E8I A;  3Q82 A;  4PM7 A;  2BLS A;  1VM1 A;  2HJ9 C;  4OOL A;  3LR5 A;  3K2N A;  3UB5 P;  4E3O A;  1W63 Q;  1ESI A;  1RGY A;  2H0Y A;  4S2L A;  3IBR A;  3JVV A;  3CLO A;  3IXB A;  4O8G A;  3T4O A;  3G6O A;  3VOZ A;  4MNR A;  5CXW A;  1ZG4 A;  1HVB A;  4MN5 A;  4UA9 A;  1F2K A;  2VJW A;  2OOL A;  3EEA A;  5G4Y A;  2PT7 A;  3V67 A;  2W3H A;  3E98 A;  1WE4 A;  4DKI A;  4OPZ A;  1F9I A;  3LYX A;  2ZQC A;  1PZO A;  1ACF A;  3G2Z A;  1DRM A;  1NRJ A;  4U0X A;  1FCO A;  3F1O B;  2M1C A;  5EM0 A;  4BMW A;  3VFF A;  5EOO A;  1NLY A;  1JWV A;  3C7U A;  2B5R A;  3MXS A;  5J3W A;  5AQB A;  1BT5 A;  2NUT C;  4OLD A;  3F1P B;  4MBF A;  4KZB A;  4LV0 A;  2Z2M B;  3ZGA B;  4S2O A;  1K57 A;  1WYC A;  4KG6 A;  3VP3 A;  5JYP A;  2ZQ9 A;  1G5U A;  2HZ5 A;  3LCE A;  4OOM A;  5F6A A;  1TD5 A;  2ZBB A;  3AGE A;  5A8B A;  3RFB A;  2LB9 A;  1KGF A;  3LY3 A;  5KSH A;  1K6S A;  3T1R A;  4WUJ A;  2A3U A;  1HD8 A;  1T1C A;  4JPM A;  4GNU A;  1S1Y A;  5EUA A;  4R6L A;  1L0D A;  1YMS A;  3D4F A;  1PIO A;  2L4R A;  5L10 A;  4OPR A;  5HSQ A;  3T1X A;  4PKY G;  2ZL1 A;  4HP9 A;  1UWP X;  1SKO B;  1GSW A;  3MSH A;  3B33 A;  2VA0 A;  5KMW A;  3MQQ A;  4LFU A;  3MS6 A;  3IF5 A;  2EX9 A;  1S1Z A;  1K4F A;  2EA9 A;  5M18 A;  1LL8 A;  1NJ4 A;  2Q0O A;  4S2K A;  2J8Y A;  2XLN A;  1E25 A;  4KQO A;  3SS3 A;  4WEJ A;  4E3N A;  4GOG A;  4EQI A;  3T4L A;  4BJP A;  2JKT I;  2J7V A;  3N7W A;  2JBF A;  1OT9 A;  4HH3 A;  4GCZ A;  3A0R A;  3O87 A;  1STZ A;  2ZLY A;  5M1A A;  2HP5 A;  3O3V A;  4KZ5 A;  1ALQ A;  4QD4 A;  3MR0 A;  4JBF A;  3G2Y A;  1XPB A;  4PM9 A;  3IF6 B;  3ISG A;  2HP6 A;  4JGP A;  5TBM A;  3UPN A;  1YAX A;  2Y2J A;  3KYQ A;  5FQQ A;  4A5R A;  5FDS A;  4Q0H A;  2WK0 A;  4E3J A;  3CHW P;  5KSC A;  5CTM A;  5E2G A;  2QYB A;  3VSL A;  4R3J A;  4EBP A;  4EU0 A;  4E6X A;  3BY8 A;  3HRE A;  4HEF A;  4MN7 A;  3HL9 A;  4N9L A;  5CGX A;  2KOI A;  2WKI A;  5HPF A;  4GZB A;  3DAV A;  3U2A A;  4X25 A;  2CC1 A;  5CGW A;  1P0Z A;  2W3E A;  5CTN A;  3UME A;  3UY6 A;  1DJB A;  3ZDJ A;  4E3I A;  1GA9 A;  3MFX A;  4KQQ A;  4KZ8 A;  3BW6 A;  3ZG0 A;  4LLO B;  4I5S A;  4FH4 A;  2D01 A;  5G4Z A;  4XT2 A;  1KE4 A;  2ZQ8 A;  2V0W A;  3TW8 A;  4BD0 A;  4QJG A;  1YSQ A;  3UB6 A;  1WYB A;  4Y3I A;  4KZ7 A;  1P9W A;  1Q2P A;  4CLC B;  2PD7 A;  3WRZ A;  1ZHH B;  4Y15 A;  1L2S A;  4NXB A;  1X0O A;  1PFL A;  1GHI A;  4S2N A;  4WEK A;  1CI9 A;  3CG5 A;  4X69 A;  1OME A;  3BQ8 A;  1K56 A;  4E04 A;  3PYP A;  3Q07 A;  4OP5 A;  5TGF A;  1ZTU A;  3UB9 A;  1MZU A;  3FPW A;  2IWB A;  1TDL A;  3LI9 A;  3ZNT A;  1GHM A;  4QPR A;  1LL9 A;  1MBL A;  4O7D A;  1QMF A;  4LPZ A;  3UO9 A;  2VGK A;  5L8M A;  1ES2 A;  4EBL A;  2VGL S;  4HH2 A;  4Y0U A;  1XP4 A;  5L09 A;  1D1J A;  2XH9 A;  2ZM2 A;  1H0M A;  3UDF A;  3QP5 A;  4DJ2 A;  3HLB A;  1SZV A;  3HLC A;  5HWV A;  4GN2 A;  4EW7 A;  3MXR A;  4HY8 A;  5CEB A;  5CHM A;  4NXG A;  2G2U A;  3QHY A;  4DXB A;  3HVF A;  3LEQ A;  1S4S A;  1ESU A;  1NYY A;  2W27 A;  3PAG A;  3Q7Z A;  3SH8 A;  4HI4 A;  1BUE A;  3MZF A;  5GL9 A;  3BJN A;  2XD1 A;  3F1N A;  1RGZ A;  4IVK A;  2WAE A;  3VOL A;  1T1A A;  4WL9 A;  2WGW B;  1TS6 A;  4BQM A;  2JE5 A;  4B4Z A;  2H28 A;  3CPT B;  2O9C A;  1IYQ A;  1S6R A;  2ZQ7 A;  1FSW A;  2EWW A;  3KSG A;  4F3L B;  1W79 A;  4EET B;  4PKY A;  3Q7V A;  1U60 A;  5F1G A;  4C75 A;  1SDN A;  1VHM A;  4E3M A;  5HFO A;  3NI9 A;  3ZFZ A;  1XXM A;  2HGV A;  1LLB A;  3M6H A;  4P6Z S;  2XRN A;  3TRC A;  1Z09 A;  4DRT A;  1W5D A;  4G3K A;  1BLS A;  2I72 A;  4GLQ A;  1NLZ A;  2HP9 A;  3GR2 A;  4ETX A;  4NXF A;  3KYZ A;  1V9Z A;  4FUW A;  3OCN A;  4PM8 A;  3OC2 A;  3SOI A;  3VMA A;  2JC7 A;  2Y2N A;  5HAQ A;  4OVD A;  1XJ2 A;  3VFH A;  5DJT A;  1A0K A;  2PAV P;  5D3O A;  2V0U A;  4MLL A;  4H8R A;  2QJ7 A;  3O5Y A;  3UE6 A;  1Y28 A;  4EEU A;  5EE8 A;  2O9B A;  3H9W A;  5A90 A;  4B88 A;  1KGG A;  1ZG6 A;  2H5S A;  3B47 A;  1OJG A;  4EUV A;  1KDW A;  5EFW A;  3MF0 A;  4LCM A;  4C3Q A;  4Z9Q A;  3A3F A;  3IXD A;  2OAQ 1;  5HPI A;  3ZHH A;  2PU4 A;  4ARZ B;  3DWZ A;  2K2N A;  2W1T A;  3ZVW A;  3N6I A;  3EGD C;  4GD8 A;  5FDH A;  4X68 A;  3H82 A;  5BOH A;  2X71 A;  3RXX A;  1Z6F A;  4H6J A;  5FAO A;  2Y91 A;  1VB6 A;  4UEY A;  2VGJ A;  4OON A;  3BFF A;  2X02 A;  5HAI A;  3LR4 A;  3VE3 A;  2QZ6 A;  4ZAM A;  1ONH A;  2V9A A;  1FSY A;  5HL1 A;  3QP6 A;  5HWW A;  4HBT A;  3H7W A;  3K3C A;  2XDM A;  3SH9 A;  4HJ6 A;  1LSW A;  2Y2L A;  3OOV A;  3SW1 A;  5CRF A;  2PBY A;  3E4O A;  3U4L P;  1MKI A;  3AGD A;  3QP1 A;  5E2E A;  1LI9 A;  4XUX A;  5A93 A;  4K91 A;  4WF0 A;  4OQH A;  4P6B A;  3BQA A;  2PDR A;  3G30 A;  1O07 A;  3ZG8 B;  1MKM A;  5FQJ A;  2L0W A;  3S7Q A;  1IEM A;  2JCH A;  3ZYT A;  1OTI A;  2WZZ A;  1GA0 A;  4LGW A;  4UQI S;  1H3Q A;  4DMZ A;  1RP5 A;  1E3U D;  2OLU A;  3UE3 A;  3SH7 A;  4R0Q A;  5AJG A;  2HJE A;  4IHQ A;  2WZX A;  2ZMV A;  3UMD A;  3NJA A;  3PBR A;  3QNC A;  2GZA A;  2B18 A;  2JKG A;  4PMA A;  3ZCZ A;  5FQ9 A;  1BYW A;  3DW0 A;  2J3T D;  3LGO A;  5FQI A;  4HJ4 A;  3CUE A;  1JNU A;  1IKG A;  1SKF A;  1OJ5 A;  5EVI A;  5GLC A;  1IFQ A;  1K57 C;  4MEZ A;  1DP9 A;  2V8C A;  1YPR A;  4O01 A;  2FH5 A;  1XA7 A;  1YLT A;  2ZL1 B;  2W0N A;  2HDU A;  3WS4 A;  2Y2M A;  3V39 A;  2BTF P;  3BEB A;  3L7H A;  4X55 A;  4RYE A;  4R38 A;  1S66 L;  1DP8 A;  3B3X A;  4GD6 A;  2X01 A;  3FZC A;  5EVI D;  1YLW A;  4E3K A;  1JTG A;  2PR6 A;  1P9R A;  4G3V A;  2R9W A;  3G32 A;  3TJZ C;  3EQU A;  5CHU A;  1OTB A;  1TS8 A;  1FCM A;  1M40 A;  2PHY A;  2E8J A;  3MZD A;  3UB7 A;  3QP2 A;  1G28 A;  2LB5 A;  1MY8 A;  4MBH A;  3W4P A;  5TBM B;  1S0W A;  2EFX A;  4X6T A;  3KYE A;  1LSV A;  1O7E A;  2FZ0 A;  4B9O A;  3IWQ A;  2WGV A;  2OWH A;  1CF0 A;  1CEF A;  1KDS A;  5CGS A;  5DKL A;  1EI5 A;  2PYP A;  4QHC A;  3A3I A;  3LEZ A;  3VP0 A;  2KDK A;  4MBK A;  2QHK A;  2Y4A A;  2Y2H A;  3N8S A;  2XEP A;  3L9K A;  3BLM A;  2VZW A;  3MQ0 A;  3PR6 A;  3K3D A;  1K55 A;  1VET A;  1W8Y A;  1CQA A;  3P09 A;  2QPN A;  4Y5F A;  4JGR A;  4F94 A;  2UV0 E;  3DTM A;  3JYI A;  4NEE D;  4KG2 A;  5HL6 A;  4NK3 A;  1YLP A;  4KZA A;  4XT2 B;  3O86 A;  4GDN A;  3M2J A;  1ZKJ A;  1Q2Q A;  1TVF A;  5AQ9 A;  4WM9 A;  1PWD A;  3BFC A;  3NC8 A;  1MWT A;  1LL5 A;  3T50 A;  4S2J A;  1XGI A;  2OWJ A;  3PHY A;  3IS2 A;  1KVM A;  1TS0 A;  3CZD A;  4NXE A;  2GNX A;  3PBS A;  3WS0 A;  5A91 A;  1S4R A;  4MCW A;  2A24 A;  4Y7P A;  3GQZ A;  4S2N C;  2PR5 A;  1M6K A;  3LIB A;  1IEL A;  3DTK A;  3FV7 A;  5EOE A;  3NBL A;  3OBF A;  3S22 A;  3IX8 A;  1NWZ A;  3MXQ A;  2V1Z A;  4EQ1 A;  3KSH A;  4NET A;  2IA2 A;  4IUK A;  3RJU A;  1TEM A;  5FAQ A;  5FA7 A;  3ZG5 A;  3F1P A;  2A49 A;  2P9V A;  3LY4 A;  4YFM A;  3M2K A;  3IXG A;  5DJU A;  4KZ6 A;  5C5K A;  3F1N B;  3VV4 A;  3EOI A;  3C8C A;  3GTC A;  1CJF A;  3DWK A;  3OCL A;  3T4K A;  3DBA A;  3ZG9 B;  4DE1 A;  4P0M A;  5HAR A;  3FYZ A;  4IBX A;  3NDE A;  4JGQ A;  2W1R A;  1PRQ A;  5DF9 A;  1DJA A;  3Q7V B;  4FSF A;  4MDZ A;  3BWL A;  4WMC A;  1GHP A;  1OTA A;  1BSG A;  3DTI A;  3GVB A;  1SKO A;  4GDB A;  1YLY A;  2OSU A;  4HJ3 A;  2PU2 A;  2Q9N A;  5LBR A;  2ZQD A;  2M7V A;  2JKR M;  5IHV A;  2W3F A;  4Y2F A;  3G34 A;  5MC7 A;  2W3G A;  3LFV A;  3P01 A;  1FR6 A;  2ZM0 A;  1BLC A;  1DP6 A;  4ESP A;  4GS9 A;  2ZMA A;  1F5M A;  2R78 A;  4X56 A;  4WMC D;  3MKE A;  4JXG A;  2WAD A;  2CMN A;  3OPP A;  1NY0 A;  4EV4 A;  3GDI A;  4P87 A;  5U47 A;  3O88 A;  2WKP A;  1K6R A;  4LEN A;  3E4Q A;  1FR1 A;  4FD8 A;  1GSX A;  4FH2 A;  2BG1 A;  2XD5 A;  2Y2O A;  1XGJ A;  4HIA A;  2EXB A;  3UDX A;  4QY6 A;  5EPH A;  5FAS A;  4RA7 A;  2Q9M A;  1XFN A;  3ZNY A;  3S7O A;  4B93 A;  4DJ3 A;  2K31 A;  2DNS A;  2MJ6 A;  2XRO A;  2K7S A;  2VK3 A;  5KZH A;  2W1T B;  3HLF A;  4HOI A;  1YLJ A;  3H82 B;  2EXA A;  2OLV A;  4Q0J A;  4H6J B;  2WAF A;  1J9M A;  1HZO A;  3EGX C;  4FCF A;  3AGF A;  5DF7 A;  5CED A;  2VGL M;  3OLO A;  4DE3 A;  3IX4 A;  3GEC A;  1I2S A;  1GSV A;  1EWZ A;  3H7W B;  1S67 L;  5F83 A;  1XA1 A;  4E6W A;  4CQH A;  3NOU C;  3R4K A;  2FFF B;  3TSG A;  1PI5 A;  1MC0 A;  2DRW A;  2ZOI A;  3NUL A;  4C6Y A;  3W8K A;  3BRM A;  2YKF A;  2HDS A;  3OZH A;  3UPO A;  1Y54 A;  4R23 A;  2EX6 A;  3C38 A;  5FEF A;  2H0T A;  4HHD A;  1NYM A;  1AXB A;  3LR3 A;  4WYY A;  5FI6 A;  1JWZ A;  1MPL A;  2XR0 A;  3R7W A;  3LIF A;  3MMH A;  3VP4 A;  3E0Y A;  3RXW A;  3WWX A;  1EW0 A;  4BLM A;  4G3W A;  4Y17 A; 
#chains in the Genus database with same CATH homology
 4HP9 A;  1UWP X;  3CUE A;  1XJ4 A;  4HJ4 A;  1JNU A;  3FPV A;  4L9E A;  5F5Y A;  1TF1 A;  1GSW A;  2VEA A;  1V9Y A;  2ZOH A;  3B33 A;  3NOT C;  1XJ6 A;  2VA0 A;  2M7U A;  1OJ5 A;  3R7W B;  3MQQ A;  1IFQ A;  2J3T C;  1DP9 A;  2W3D A;  2QWS A;  4O01 A;  4IUH A;  1S1Z A;  2FH5 A;  4L9F A;  2BAS A;  2EA9 A;  4GW9 A;  4II7 A;  1LL8 A;  4EES A;  4LRY C;  3D72 A;  5TJJ A;  3W2Z A;  4CLC C;  2W0N A;  4KQO A;  4IJG A;  1T18 A;  1T1B A;  1OPX A;  4WEJ A;  3T4L A;  4BJP A;  2JKT I;  2VV8 A;  4BBT A;  5HDD A;  1OT9 A;  4R38 A;  1S66 L;  4HH3 A;  4GCZ A;  1DP8 A;  2B02 A;  3HCY A;  3A0R A;  4K08 A;  1TS7 A;  4Q0I A;  1STZ A;  4MMN A;  3CUE C;  3C2W A;  1YSP A;  1IOU A;  3CI6 A;  2PR6 A;  1P9R A;  2XSS A;  4G3V A;  1OTD A;  3MR0 A;  1G6O A;  4EXO A;  3TJZ C;  5F69 A;  3LI8 A;  3EQU A;  1OTB A;  1TS8 A;  4JGP A;  5TBM A;  4Z1W A;  1YAX A;  2PHY A;  3KYQ A;  4YWZ A;  5HWT A;  4Q0H A;  3T4T A;  2QKP A;  2L1M A;  1N9O A;  2KLI A;  5DFX A;  3UB7 A;  4KUO A;  2QYB A;  1G28 A;  4EU0 A;  4BBV A;  3LIC A;  2LB5 A;  4AFI A;  5TBM B;  2P04 A;  2D02 A;  3BY8 A;  2O99 A;  2GJ3 A;  4MN7 A;  5HDC A;  2KOI A;  2VV7 A;  4NKP A;  1LSV A;  5HPF A;  4I39 A;  3C30 A;  4I3A A;  3FC7 A;  3U2A A;  3PBN A;  2FZ0 A;  4B9O A;  3T4S A;  1N9N A;  4FOF A;  2OAP 1;  2OWH A;  1P0Z A;  2W3E A;  4HNB A;  5DKL A;  3A0V A;  3UME A;  5HD3 A;  4CLC A;  4I3I A;  2PYP A;  2KDK A;  2O0Y A;  5DFY A;  2QHK A;  4M4X A;  3MFX A;  3CWF A;  3BW6 A;  1T19 A;  4WN5 A;  4LLO B;  4I5S A;  2D01 A;  5G4Z A;  3PBQ A;  3ULF A;  4XT2 A;  3KSI A;  3MJQ A;  2VZW A;  3TW8 A;  2V0W A;  3MQ0 A;  1YSQ A;  3UB6 A;  4Y3I A;  3PR6 A;  1P9W A;  4CLC B;  3K3D A;  4YOF A;  2PD7 A;  1ZHH B;  1LT0 A;  4NXB A;  1X0O A;  5I5L A;  4Y5F A;  4JGR A;  4WEK A;  4CLC D;  4NEE D;  3TE8 A;  4P6Z M;  2ZMF A;  1F98 A;  5HL6 A;  1YKD A;  3BQ8 A;  4LRX C;  5J4E A;  4XT2 B;  4E04 A;  3PYP A;  2DMW A;  3IBJ A;  4I38 A;  1ZTU A;  2Y79 A;  3UB9 A;  2YKH A;  1MZU A;  3FPW A;  4GJ4 A;  3LI9 A;  1XFQ A;  4QPR A;  3B42 A;  2P7J A;  4LPZ A;  2PD8 A;  2WKR A;  3FG8 A;  5L8M A;  3T50 A;  2VGL S;  4RQ9 A;  2VX8 A;  3LIE A;  4HH2 A;  3NOP C;  2OWJ A;  2XA7 M;  3PHY A;  2VLG A;  3IS2 A;  2KX6 A;  1TS0 A;  4NXE A;  2GNX A;  3PBS A;  4DJ2 A;  2WKQ A;  1S4R A;  4JGO A;  4R70 A;  4MCW A;  2A24 A;  5HWV A;  1KOU A;  4DN0 A;  2PR5 A;  4EW7 A;  1H8M A;  3LIB A;  4HY8 A;  1WA9 A;  4MN6 A;  5CX7 A;  4NXG A;  3OBF A;  3MXQ A;  1NWZ A;  4CLC E;  4EQ1 A;  3P7N A;  1S4S A;  4F3L A;  3IS2 B;  3KSH A;  2Z6C A;  3RH8 B;  2W27 A;  2IA2 A;  4IUK A;  4HI4 A;  2A24 B;  5HD5 A;  2J80 A;  5FL3 A;  3BJN A;  3F1N A;  3VOL A;  4L9G A;  1T1A A;  4WL9 A;  1OTE A;  3F1P A;  1TS6 A;  3KO6 A;  5F68 A;  2HV1 A;  3PBO A;  3S7N A;  2H28 A;  4GHI A;  2JHE A;  2O9C A;  5IU1 A;  3PXP A;  2EWW A;  3KSG A;  4F3L B;  3ICY A;  5DJU A;  4EET B;  1D7E A;  4BWI A;  5IS1 A;  2INW A;  4PKY A;  5C5K A;  3F1N B;  1VHM A;  5IT5 A;  3VV4 A;  3D3O A;  3C8C A;  3EOI A;  3ZQ5 A;  1D06 A;  3UB8 A;  2VKS A;  3OCL A;  3T4K A;  3DBA A;  2VV6 A;  3E4P A;  2HGV A;  1P97 A;  3A0S A;  4P6Z S;  3CIT A;  2XRN A;  4GHI B;  2P08 A;  3TRC A;  4JGQ A;  2V1A A;  4G3K A;  2W1R A;  3MQO A;  5DF9 A;  4BBU A;  4GLQ A;  1NLZ A;  4FSF A;  5K5B A;  3BWL A;  3HJK A;  2Z6D A;  2EWV A;  1LSX A;  4MDZ A;  4L0L A;  4NXF A;  4ETX A;  3KYZ A;  1OTA A;  1V9Z A;  5KIZ A;  3OCN A;  3OC2 A;  4YNR A;  4PAU A;  4HJ3 A;  1XJ3 A;  4O0P A;  3VE4 A;  5LBR A;  3EEH A;  2M7V A;  1XJ2 A;  2JKR M;  2XA7 S;  3RTY A;  2W3F A;  5DJT A;  4Y2F A;  1ODV A;  4UQI M;  5MC7 A;  1OT6 A;  3LR0 A;  2V0U A;  2W3G A;  3LFV A;  4ARZ A;  2I9V A;  2QJ7 A;  3P01 A;  2PYR A;  3O5Y A;  3UE6 A;  1Y28 A;  4EEU A;  4LRZ E;  1W63 M;  2GX5 A;  1DP6 A;  2O9B A;  4GS9 A;  2J3W A;  3H9W A;  5HDS A;  1F5M A;  2R78 A;  4ETZ A;  5AVE A;  2A2L A;  3B47 A;  1OJG A;  4EUV A;  5EFW A;  2HF6 A;  3MF0 A;  2CMN A;  3KSF A;  4KUK A;  5AVF A;  2OAQ 1;  5HPI A;  4ARZ B;  3GDI A;  2HJ9 C;  3BY9 A;  4OOL A;  2O9A A;  2K2N A;  3LR5 A;  2W1T A;  3K2N A;  3EGD C;  3HJI A;  1W63 Q;  3H82 A;  4GS9 B;  4R3A A;  2WKP A;  4WEL A;  4PHT A;  3E4Q A;  4H6J A;  1GSX A;  3IBR A;  1VB6 A;  3CLO A;  3JVV A;  3LUQ A;  4UEY A;  4O8G A;  4HIA A;  3T4O A;  2JKT M;  3G6O A;  3T4Q A;  1XFN A;  3S7O A;  3F1O A;  3LR4 A;  4MN5 A;  3VE3 A;  4B93 A;  4DJ3 A;  2K31 A;  3EQV A;  2VJW A;  2OOL A;  2XRO A;  2MJ6 A;  3EEA A;  2K7S A;  2V9A A;  5G4Y A;  2PT7 A;  2W1T B;  3V67 A;  4HOI A;  5HZH A;  3H82 B;  5HWW A;  2W3H A;  3E98 A;  4EER A;  1UGU A;  3H7W A;  3PBT A;  4HQA A;  4Q0J A;  3LID A;  1F9I A;  3KX0 X;  3K3C A;  3LYX A;  4HJ6 A;  4H6J B;  1LSW A;  3OOV A;  3EGX C;  3SW1 A;  3EWK A;  3LIA A;  1DRM A;  3E4O A;  1NRJ A;  1UWN X;  3F1O B;  2NUP C;  2M1C A;  2VGL M;  4BMW A;  3OLO A;  4I3J A;  4WF0 A;  1NLY A;  3GEC A;  4HP4 A;  1GSV A;  5J3W A;  3BQA A;  2PDR A;  3H7W B;  1S67 L;  4ZRR A;  2NUT C;  2Y8H A;  3F1P B;  4KQD A;  2JN7 A;  4CQH A;  1MKM A;  3NOU C;  2L0W A;  3R4K A;  3S7Q A;  1MC0 A;  3ZYT A;  2G7U A;  3T4J A;  1OTI A;  4UQI S;  3CAX A;  2ZOI A;  3NHQ A;  1H3Q A;  4DMZ A;  3JVU A;  2YKF A;  3UE3 A;  2V1B A;  4OOM A;  5F6A A;  1TD5 A;  3C38 A;  5AJG A;  4EEP A;  5DKK A;  2ZBB A;  2HJE A;  4HHD A;  4WLA A;  3LR3 A;  5A8B A;  4IHQ A;  2QJ5 A;  2JKR I;  3RFB A;  3R7W A;  2LB9 A;  2ZMV A;  3LIF A;  3MMH A;  3UMD A;  3E0Y A;  3NJA A;  5KSH A;  5J7E A;  1N9L A;  3PBR A;  4WUJ A;  1T1C A;  2GZA A;  2B18 A;  1S1Y A;  4R6L A;  1EW0 A;  3S7P A;  2L4R A;  4ME4 A;  1BYW A;  5HSQ A;  4G3W A;  4PKY G;  2J3T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...