4GS9A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
107
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 107
sequence length 113
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9A00
3ICYA 4HOIA 1P97A 4R3AA 5F69A 2W27A 4MN6A 5IU1A 4LLOB 4F3LB 5DJUA 2M1CA 3LYXA 3CAXA 2JHEA 3E4PA 2OWHA 1TS6A 4HH3A 2QKPA 1T1CA 1ODVA 3UB6A 3VE4A 3NOTC 4EEPA 3FG8A 4EEUA 4EQ1A 2PR6A 2HV1A 2CMNA 3D72A 3FC7A 1DP8A 3NOPC 4WUJA 3T50A 5A8BA 4JGPA 2KDKA 3LIBA 1T19A 1N9LA 1N9NA 2WKRA 4HJ6A 2Z6DA 3MJQA 3UE6A 1GSVA 2GJ3A 5AVEA 3ZQ5A 1VB6A 4B9OA 5DKKA 4BBVA 5HDCA 3G6OA 4WL9A 1LSXA 4HJ3A 3OLOA 3E4OA 2VV8A 3NOUC 4NXEA 1MZUA 4HP4A 4GHIA 2ZOHA 3RTYA 3UMDA 5TBMB 3GECA 4HIAA 4I3IA 2J80A 1LL8A 1N9OA 2VV7A 4I38A 5HDSA 4HP9A 3F1PB 4HY8A 4HH2A 3MXQA 2R78A 1F9IA 4L9FA 1JNUA 5HWWA 1LSWA 1XJ3A 5J7EA 2D02A 1OJ5A 3BY9A 2YKHA 4R6LA 1Y28A 4E04A 4H6JA 2QWSA 3NHQA 5J3WA 2V1AA 3A0VA 4R70A 1LT0A 3B33A 3VE3A 4BBTA 1V9ZA 4L9EA 5HZHA 3H82A 2P7JA 2PYRA 2L4RA 2WKQA 3H7WA 4EERA 1G28A 2ZOIA 2D01A 2L1MA 2B02A 4GS9B 3LIEA 2EA9A 3UB8A 2Z6CA 4KUKA 3A0RA 1LSVA 3LI8A 5DKLA 3BWLA 3IS2B 4F3LA 5I5LA 4LPZA 3F1NB 1OT9A 3HJKA 2VLGA 5F6AA 1OTEA 3UB9A 1OTBA 1V9YA 4HQAA 2WKPA 1DRMA 1S1YA 3KX0X 3MQQA 1WA9A 4RQ9A 1XFQA 4L9GA 1OTIA 4EESA 5HD3A 4PKYG 4HJ4A 2A24B 2L0WA 5G4YA 2YKFA 3P7NA 4DJ2A 4NXFA 1S66L 4LRYC 5HDDA 1D7EA 4WN5A 4EETB 2QJ5A 3GDIA 2H28A 3EWKA 2I9VA 2W0NA 3MQOA 3PHYA 1DP6A 2PD7A 5HSQA 3F1OB 4DJ3A 4XT2B 4MN5A 4NXGA 2ZBBA 3E4QA 4GW9A 5F5YA 3LIFA 5TBMA 4M4XA 1NWZA 4JGQA 5AVFA 3F1PA 5J4EA 3LICA 3NJAA 5DJTA 5HD5A 5IS1A 4KQDA 5HWVA 3C8CA 3SW1A 3LI9A 2PYPA 4HHDA 1S1ZA 4HI4A 4JGRA 2KX6A 1XFNA 1OT6A 1OTDA 3PYPA 4EXOA 1UGUA 1P0ZA 2OOLA 5KIZA 1XJ2A 2V9AA 1TS8A 4EW7A 3K3DA 4R38A 2PR5A 1KOUA 2PD8A 4KUOA 1S67L 5F68A 1GSXA 2PHYA 5EFWA 2JN7A 4GHIB 3C2WA 4WLAA 2K7SA 1S4SA 4GS9A 3LIDA 1XJ4A 1TS7A 4WF0A 3LIAA 3K3CA 3MR0A 3RH8B 2V0UA 1T18A 3IS2A 1D06A 3F1NA 1OJGA 1UWPX 2QJ7A 1X0OA 2VEAA 2INWA 4YWZA 3EEHA 3UB7A 1UWNX 4JGOA 1T1BA 1OTAA 4I3AA 3BY8A 4NXBA 4K08A 3MFXA 1TS0A 3UMEA 4LRXC 3HJIA 4GCZA 4BBUA 4H6JB 1S4RA 1F98A 2QHKA 3CWFA 2A24A 3ULFA 4LRZE 3IBRA 3LUQA 4PKYA 4I3JA 1BYWA 2V0WA 2VV6A 1DP9A 2V1BA 1GSWA 3H82B 3VOLA 3CLOA 3H7WB 4HNBA 1T1AA 3H9WA 2PDRA 3A0SA 3F1OA 1XJ6A 4I39A 1EW0A 4I5SA 4XT2A 2BASA 5G4ZA 2OWJA 5HWTA
chains in the Genus database with same CATH superfamily
5M18A 4HOIA 3O88A 4QY5A 4MN6A 5L10A 5I94A 4FH4A 1KDSA 2JKFA 3ZVWA 1IYSA 3WS4A 3IH9A 3OPHA 2ZL1B 5A90A 1MPLA 4OP8A 1Y4OA 3VSLA 1KE0A 4HH3A 4GNUA 4RA7A 1ODVA 1ES3A 4EEPA 4S2KA 4X1LA 2V8FA 3G31A 4EEUA 4EQ1A 5EV0A 4RVAA 1YM1A 2CMNA 2X02A 1EROA 1L0DA 3D72A 2O9BA 3T50A 3PBRA 2O9CA 3ITBA 5KZHA 3LY4A 1T19A 2JKGA 1N9LA 4HJ6A 2WKRA 2Z6DA 3MKFA 3MJQA 4CQHA 2ZC7A 1K0KA 2GJ3A 1AXBA 1BTLA 5TGFA 3DTIA 2XEPA 2OV5A 2ZC3B 3OLOA 3NULA 5EUAA 2XSSA 4ME4A 4E3JA 4ZAMA 3IWIA 3IF6A 1MZUA 2ZOHA 1KDWA 1PIOA 3C7UA 5HARA 4GD6A 4OLDA 3RTYA 2GX5A 4Z9QA 2ZLYA 1AWIA 2J80A 4I38A 2ZC6B 4S2JA 4ZJ2A 4E3LA 2UV0E 3CG5A 4JXVA 3S7OA 4ZJ1A 5FEFA 3RJUA 5DVAA 4EBLA 4AFIA 4B88A 1Z09A 2EX8A 1NLZA 5FI6A 3G32A 1PZOA 2J8YA 1GHMA 4EUZA 4H6JA 2V1AA 3VOYA 1JTGA 2V1ZA 1CI8A 4Y7PA 3T4QA 2WKIA 2J3TC 3VE3A 1TF1A 4Y17A 4ZRRA 5CGXA 4ZTKA 5F82A 3HREA 1K55C 5IHVA 3H82A 1H8ZA 1K54A 4EERA 3N4IA 2O9AA 3T1SA 2D01A 3IH8A 1SDEA 1ALQA 1PW8A 2B02A 1FQGA 2Y2IA 2EA9A 2P9VA 5DF9A 3BRMA 1XX2A 3MZDA 2Z6CA 1U60A 3A0RA 4XXRA 1LSVA 5DKLA 1G6OA 2ZQDA 4DXCA 4LPZA 3F1NB 3B42A 3V3SA 3BFEA 1YLJA 3PBQA 4BD0A 2ZL1A 3AGDA 1TDGA 3UE3A 1GHPA 5DFYA 2P74A 2G7UA 2WAFA 2B5RA 3UN7A 1XFQA 3BYDA 1NZOA 4P6ZM 4WM9A 5CGSA 3LGOA 5G4YA 1F2KA 4OONA 2XGNA 4DE1A 1TEMA 4CLCD 4UEYA 5HL6A 3V39A 2QJ5A 1O07A 2H28A 4RX2A 3ZVTA 3PHYA 2V8CA 3G2YA 4YOFA 2H5SA 5CHMA 3F1OB 2XFSA 2PT7A 2X71A 2XA7S 4DDYA 4QB8A 3W4QA 3CZDA 3QNBA 2R9WA 4JKTA 5M1AA 4KZBA 1SCWA 5EM1A 4EV4A 3LR3A 4GDBA 3BECA 4JXGA 4R3BA 3HLWA 3GRJA 4LV3A 3O5YA 1N4OA 4BWIA 2PU2A 1H8MA 3N8RA 5L2FA 2M7VA 2H0TA 4S2OA 5AVFA 4E3NA 2O0YA 3VSKA 3WRZA 3EGDC 1CEFA 1LL5A 4WZ5A 4O01A 5HWVA 1OMEA 1WYCA 1KVMA 2ZC5B 2OLVA 5CRFA 3OOVA 3M2KA 2EX9A 1XFNA 1OT6A 3D4FA 5FEGA 1MWSA 2FFFB 2Y4AA 5FDSA 5GHZA 1ZKJA 2PBYA 2PR5A 4R38A 2Y2LA 1Z6FA 3TG9A 1KOUA 1C3BA 2HDQA 3UY6A 5DTTA 3T1RA 1KVLA 3N6IA 2ZMAA 4N1HA 2Y59A 4GHIB 2O99A 1YPRA 1ES2A 4II7A 3ZG8B 3V3RA 5HW3A 2EXBA 4S2NA 1L2SA 3V5MA 4WF0A 1DJBA 2Y2HA 3Q1FA 1IYQA 1YQSA 3BFFA 3IX4A 1D06A 2IWBA 3F1NA 1BLHA 2WGIA 1HD8A 1H3QA 5TFQA 4BMWA 3D3OA 2XDMA 1T1BA 3BY8A 4JPMA 4JLFA 4EU0A 5AJGA 4FD8A 2WYXA 4K08A 1BUEA 5CTMA 2AVXA 3PAGA 5U47A 1NRFA 3A3IA 2WZZA 2QHKA 1IYOA 1LI0A 5KSCA 2VA0A 4LRZE 1VEUB 4EBPA 2MJ6A 1PZPA 3TJZC 1I2SA 4ETZA 4KZ6A 5TJJA 3ZG0A 4WEKA 2VV6A 1DP9A 4KZ5A 2HP5A 1ESIA 4X6TA 4NK3A 3HLBA 3H7WB 4CLCC 2PDRA 4X55A 3F1OA 4X1MA 1XP4A 5A91A 1ES4A 3S1YA 3MKEA 4HESA 4R3AA 3PXPA 1CQAA 5FQ9A 5IU1A 1XA7A 5KSHA 4ID4A 4F3LB 4WMCA 2M1CA 2JHEA 3IBJA 2JKRM 3TW8A 3IF5A 2OWHA 3MMHA 2QKPA 3VV4A 2Y2PA 4N9KA 4WBGA 3VE4A 4X69A 3HBRA 3NOTC 4C6YA 1ES5A 3FG8A 2IWCA 1W79A 4Z1WA 3S22A 4UA7A 2HV1A 2VZWA 3LR5A 3NOPC 4ZBEA 5EVIB 4WUJA 5A8BA 4Y0TA 4JGPA 4CPKA 1YMSA 3ZNYA 3DBAA 3LIBA 3T4TA 1PI4A 3E0YA 1YSPA 4MLLA 1MWRA 3CUEA 2ACGA 1ONGA 5CX7A 4P6BA 5AVEA 3ZQ5A 3DWZA 1VB6A 4BBVA 1LSXA 4FTXA 1ZC2A 3OPLA 3E4OA 3KYZA 3NY4A 3NOUC 3PBTA 2OSUA 4KG5A 4HP4A 4RYEA 2XF3A 4GHIA 5EECA 3BM6A 3DTEA 3UMDA 3BQAA 1VETB 4FCFA 1MWTA 2A49A 4ARZB 4DF6A 1YKDA 1LI9A 1W8YA 3W4OA 1WYBA 2VV7A 3CHWP 4QPRA 3Q7VB 4OVDA 1E4DA 5AQAA 5IT5A 4FH2A 3CI6A 4HH2A 1YLWA 3PBSA 5FAQA 2J3WA 3FWLA 4GD8A 4G3KA 1OJ5A 1L3LA 1E25A 4DE2A 3UPOA 2YKHA 4R6LA 2P9VB 1Y28A 4E04A 2QWSA 2RL3A 4KENB 1VQQA 3ITAA 3QP1A 1VEUA 1BULA 3B33A 2PRFA 4UHUA 3M2JA 4OKPA 5E2FA 1V9ZA 4L9EA 5FAPA 4LGWA 4FSFA 3NDGA 2PYRA 4X68A 4ZDXA 3H7WA 4A5RA 3IF6C 1PWDA 1G28A 1KGGA 2HZ5A 3DW0A 2L1MA 3NC8A 4LENA 5GLCA 2XA7M 3C4OA 1NYMA 3UB8A 3Q07A 5CECA 3T4OA 1K4FA 4H8RA 2V2FF 5HL1A 4F3LA 5I5LA 4MMNA 4GOGA 2VLGA 3ZNTA 2WKHA 5M19A 3ZHHA 1DRMA 5D3OA 2JE5A 3A3EA 4IVKA 4DXBA 5FQIA 1IKGA 4RQ9A 4UA9A 5HD3A 4PKYG 5A93A 3BEBA 1NXYA 2L0WA 3P7NA 1FCMA 3NCKA 3UO9A 4KZ7A 2OAQ1 5EVIA 2EFUA 1K57A 3NIAA 5L8MA 4P0MA 5HDDA 1D7EA 4JF6A 2I9VA 3OCNA 4U0XA 1QMFA 4N1XA 5FA7A 2EXAA 2PD7A 4XUXA 4XT2B 3E98A 4NXGA 2ZBBA 1WE4A 1EI5A 4OQHA 1K6RA 2WUQA 4P87A 3E4QA 3P98A 3PBOA 5C5KA 5F5YA 4XUZA 4N9LA 4PM5A 2Z2MB 2G2WA 3C30A 1K4EA 1L0EA 1VETA 2PU4A 3LIFA 1MKMA 1S6RA 4ARZA 3ISGA 3GSGA 4M4XA 5CGWA 3K2NA 5HPIA 4E6XA 1ACFA 2EWWA 2VJWA 1PWCA 3B47A 5EE8A 5J4EA 3Q7VA 3UE0A 1BLCA 1I5QA 1M40A 4NKPA 3HLFA 2Q0OA 3QHYA 3W4PA 5LBRA 5HFOA 4BL3A 5IS1A 4KQDA 2I72A 3C8CA 3LI9A 2DMWA 2PAVP 4OPRA 5FASA 1TDLA 1MKIA 2HDRA 2KX6A 2DCFA 2KOIA 3PYPA 1CJFA 3EOIA 3KO6A 1UGUA 5GLAA 3HUNA 4B93A 3RFBA 3G4PA 2J9PA 4PM9A 4QU3A 1XJ2A 5FATA 1TS8A 1VM1A 3RXXA 3K3DA 3PAEA 4JBFA 3OBFA 4Y0UA 3VFHA 1K56D 1XA1A 2HP6A 1LLBA 4BL2A 4DN0A 1GSXA 4Q0IA 3IX3A 2JN7A 4B4ZA 4WMCD 2M7UA 4EBNA 2Z2LB 1G68A 2IA2A 1S4SA 3T4JA 1JVJA 1XJ4A 4IEDA 1YAXA 2ZMFA 2LB9A 2DNSA 3LIAA 3K3CA 2XR0A 2V0UA 4OLGA 3MS6A 4E3IA 1K55A 3O3VA 2OLUA 1X0OA 3QP6A 3FKWA 1UWNX 4JGOA 3CJMA 3CPTB 4NXBA 3IT9A 4X56A 1I2WA 3UMEA 4LRXC 5FQJA 5GL9A 4BBUA 1G6AA 4PPRA 2Y2KA 5AQ9A 1F98A 4BD1A 3Q7ZA 3IBRA 3T12B 3LUQA 3C38A 4PKYA 4I3JA 1GHIA 2V0WA 3GMWA 2V1BA 1GSWA 2WZXA 2W3FA 2Y91A 3DWKA 4HNBA 1T1AA 4IUHA 1YLPA 1M6KA 1XJ6A 4I39A 2R9XA 4I5SA 4XT2A 2BASA 1NY0A 2Y2GA 1W7FA 3S7PA 3ICYA 1P97A 3JPUA 4S2NC 5F69A 1IFQA 4LLOB 4DDSA 1DJCA 2GNXA 5HAQA 5DJUA 3CAXA 4BJPA 1JTDA 2WK0A 3LR4A 3IHBA 3HLEA 3IXHA 4OH0A 3HUOA 3SH7A 1TS6A 4O7DA 1KE3A 1T1CA 5FQMA 1RGZA 3QNCA 4LCLA 1JWVA 4E3MA 5AQ7A 5CERA 5DTSA 4BLMA 3DTMA 3LR0A 3FC7A 1DP8A 1YT4A 3GTCA 2KDKA 3ZYTA 1PRQA 5G18A 1RCJA 2JBFA 4WZ4A 3UE6A 3OZHA 2VGKA 1GSVA 3SOIA 2HJ9C 5TR7A 1LHYA 5EOEA 5HDCA 1NLYA 1MY8A 1DJAA 4HJ3A 4NEED 2Q9NA 2VV8A 3Q81A 4YFMA 3JVUA 3W2ZA 5GLDA 3AGEA 2GDNA 4JXSA 2Y2NA 4LV1A 1NJ4A 4GN2A 3KYQA 4MN7A 1ZG4A 4I3IA 1IKIA 1ZTUA 2K31A 1LL8A 1N9OA 3L7HA 4QHCA 3KSHA 1VHMA 4K91A 1W63Q 3R4KA 3FKVA 2VGLS 2GZAA 2R78A 1F9IA 2J9OA 2ZC4B 4IBRA 5EVID 3UNWA 5HWWA 3CPTA 1LSWA 3N7WA 2XLNA 3N8SA 1IELA 3G30A 5J7EA 2D02A 1QMEA 5JYPA 3FYZA 3EGXC 1KGFA 3T4SA 3BY9A 1DY6A 3VFFA 1F5MA 3V67A 4KZAA 3LEQA 3NHQA 5J3WA 5GHXA 4PM7A 3UDIA 3A0VA 3CUEC 1LT0A 3EQUA 3G2ZA 1JWZA 5HAPA 3SZTA 4BBTA 2BTFP 3QP2A 3IXGA 1SHVA 4WELA 5EOOA 5HZHA 4BQMA 2P7JA 2WKQA 1S0WA 2OAP1 2XQZA 3ZFZA 2QMIA 2JKRI 3UDXA 2ZOIA 2H0YA 1KGEA 3EQVA 4DE3A 3DTKA 2XRNA 3C5AA 3S7QA 4HBUA 4OPQA 2JKTM 3P09A 4OOLA 1FOFA 3BWLA 2WAEA 4IHQA 5E2GA 4ETXA 4O8GA 3P01A 4NETA 5F6AA 1OTEA 3NECA 4KQRA 3SS4A 3A3DA 1O7EA 2ZM2A 4HQAA 1NZUA 1EWZA 3KX0X 3MQQA 1WA9A 3R7WB 2QPNA 1PYYA 4OQ0A 1MC0A 1IEMA 1PFLA 5GLBA 4HJ4A 4P85A 2A24B 3MSHA 4OQGA 2YKFA 4DJ2A 2LB5A 2EX2A 1S66L 4LRYC 4QWOA 2H10A 1NYYA 4EETB 1CF0A 4OPYA 5E2HA 2W3GA 2E8JA 4WYYA 2HP9A 4PMAA 4UAAA 1DP6A 2UWXA 1SZVA 4PM6A 4Y13A 2K2NA 4DJ3A 4E3KA 3M6BA 1SKOB 2P04A 4DKIA 3PBNA 1XGIA 3DAVA 4GW9A 2P08A 5E2EA 3GR2A 2Y2MA 1Q2QA 3UB5P 1JWPA 4Y15A 3UDFA 4JGQA 4IVIA 2XFTA 4MBHA 3LEZA 4BENA 4EUVA 4JXWA 2G2UA 3S4XA 1ERQA 1KE4A 3BLMA 3NJAA 5AQBA 1HVBA 3OC2A 5DJTA 5HD5A 3IXBA 3TOIA 2Y2JA 4GZBA 3IX8A 3SW1A 5EVEA 4MNRA 2PYPA 4HHDA 1E3UA 2W3EA 1S1ZA 4JGRA 2Y55A 4EXOA 1OTDA 1MBLA 1XPBA 2QZ6A 2NUTC 5EVIC 1K57C 2HF6A 2J7VA 2OOLA 3OPRA 1BSGA 1P9WA 4EW7A 1FCNA 1L0FA 2W1RA 2PD8A 4KUOA 1RGYA 1S67L 5F68A 3QP4A 2PHYA 3OPPA 3GV9A 4WLAA 4ZJ3A 3QP5A 1K6SA 3I7JA 5FL3A 3WS1A 4IUKA 2W1TB 4WEJA 3BFCA 3MR0A 2VGJA 4U0TA 4S2PA 3RH8B 4GDNA 4Y5FA 5E43A 2XROA 1GA0A 1K25A 5DF8A 1UWPX 2QJ7A 3UB7A 3IXDA 1OTAA 2KLIA 3QP8A 4LV0A 1XXMA 5F83A 4UQIS 1K54C 3HVFA 3NDEA 3R7WA 3HJIA 4GCZA 3KSFA 4JF4A 1PNEA 3GVBA 1S4RA 3Q82A 3KYEA 3U4LP 3CWFA 2A24A 2ZQ9A 3E2LA 3UE1A 4KQOA 3NBLA 5CXWA 3UPPA 4Q0HA 3LO7A 2ZM8A 3VP1A 4R23A 1BYWA 1ONHA 3L9KA 4OPZA 5HX9A 2Y2QA 1K38A 3KSGA 2ZQCA 4FUWA 3HL9A 3LFVA 4YINA 1EW0A 5G4ZA 2OWJA 1L0GA 5HWTA 4Q0JA 1SKOA 3A3JA 1BLSA 1A0KA 5L07A 3PR6A 1RP5A 2W27A 3WS5A 1J9MA 2FZ0A 4Y2FA 4O0PA 5FI2A 3VP3A 4QY6A 3C4PA 1W63M 3LYXA 3VOZA 4Y0OA 5JYOA 1MXOA 3E4PA 4R4SA 3HUMA 1CI9A 1OPXA 3HLDA 5K5BA 3M6HA 3UB6A 2HGVA 4OOMA 4D2OA 2CC1A 2ZQ7A 2ZD8A 3BW6A 2VGLM 5FSRA 2NUPC 2PR6A 4KG6A 1YMXA 5F1GA 3MFDA 2DRWA 4QJGA 3U2AA 2HPBA 1N9NA 1FR1A 4S2IA 4E6WA 5MC7A 3MBZA 2XH9A 3SH8A 4B9OA 5DKKA 3G6OA 4WL9A 4QD4A 5DF7A 1IYPA 3E2KA 5FQKA 2ZMVA 4GJ4A 1BLPA 3HLCA 2A2LA 4RX3A 4OQIA 4NXEA 3PTEA 4WZ5C 1Y54A 4DRTA 4UA6A 2IWDA 3A3FA 3JVVA 5CHJA 1H5XA 5TBMB 3GECA 4GB7A 3T4LA 4R1GA 4HIAA 3OCLA 4D60A 5CEBA 5GHYA 4MBKA 5HDSA 2W1TA 4K0XA 4HP9A 3F1PB 2FH5A 2ZM0A 3MXRA 4HY8A 3S7NA 4PAUA 3MXSA 3MZFA 3MXQA 1W5DA 3ZGAB 4L9FA 5L09A 1JNUA 3WS0A 5CEDA 1H0MA 4EWFA 1XJ3A 3RXWA 4KZ4A 4X25A 2EWVA 1YLYA 3VP2A 5HPFA 4F94A 2FFYA 2WGWB 2RCXA 5BOHA 3T1XA 3MF0A 4R70A 2ZJ9A 3ZG5A 1YSQA 4IBXA 2XK1A 4FOFA 3BFDA 1IOUA 4GKUA 2E8IA 1XKZA 4KZ8A 3IWQA 3UPNA 4B4XA 3LY3A 4CLCB 1BZAA 3EEAA 2L4RA 3W8KA 4CJNA 1FCOA 3TRCA 5EPHA 3B3XA 4KQQA 3TE8A 1SDNA 1XGJA 1ZHHB 4GS9B 3LIEA 5KMWA 1FR6A 1PWGA 4OP5A 5DTKA 4KUKA 3FZCA 1ESUA 3LI8A 4KZ3A 3IQAA 3IS2B 4LCMA 3FPWA 5DFXA 4X53A 1OT9A 3HJKA 5FDHA 4HEFA 1HZOA 3UB9A 2ZQAA 1OTBA 1LL9A 3VP0A 1V9YA 1FSYA 1E3UD 1PI5A 2WKPA 4G3VA 3O87A 1CEGA 1S1YA 1CK3A 3SH9A 2QYBA 1FIKA 3IWOA 1H8YA 3WS2A 4L9GA 5FAOA 1OTIA 4C3QA 4EESA 2WADA 4NXFA 3JYIA 3BLSA 2BLSA 4WN5A 3SS5A 3GDIA 4NG2A 3EWKA 2EFXA 3LCEA 4R4RA 4DMZA 1GA9A 2W0NA 3MQOA 5HSQA 4E3OA 4PM8A 3V50A 1Q2PA 2B95A 2VK3A 3NI9A 4MN5A 5FI7A 2X01A 4R3JA 3ZG9B 4R0QA 1ERMA 1P9RA 1G5UA 5HAIA 5TBMA 2Y79A 1TD5A 4C75A 3VP4A 4GLQA 1NWZA 3D9YA 2V20A 1TVFA 3G34A 4IJGA 1J3WA 5CHUA 3ZDJA 3F1PA 3BQ8A 2BG1A 2Y8HA 4MBFA 1HTZA 2B18A 4P6ZS 3LICA 1NRJA 2WKEA 3N8LA 4HBTA 1K56A 4EQIA 4N92A 3CITA 2WGVA 4HI4A 1GCEA 4UQIM 3AGFA 4KZ9A 4S2LA 1P0ZA 5J8XA 1SKFA 3HLGA 3BFGA 1YLTA 2WGWA 5KIZA 3T1QB 2V9AA 2C6WB 5A92A 4L0LA 3CMZA 3C7VA 2JKTI 4Y3IA 4S2MA 2EX6A 3O86A 1ZG6A 2W3HA 1N9BA 3MQ0A 4MDZA 3WWXA 1YLZA 3IF6B 4CLCA 5EFWA 3VMAA 3MZEA 3C2WA 5EVLA 2K7SA 3SS3A 5EM0A 2PBDP 1BT5A 2C5WB 4GS9A 3LIDA 2JC7A 3GQZA 2W3DA 1TS7A 3G35A 4K0WA 4ESPA 4LV2A 2JCHA 2HDSA 1FILA 3ZG7B 1T18A 2Y2OA 3WRTA 3IS2A 2HDUA 4KG2A 1OJGA 4YNRA 1PW1A 2VEAA 2INWA 3EEHA 2VX8A 2Q9MA 4I3AA 4LFUA 3IHAA 4U3TA 3T4KA 4M3KA 4OOYA 3MFXA 1TS0A 2HJEA 3FPVA 1STZA 1D1JA 4JF5A 2A3UA 4G3WA 4H6JB 2J3TD 1W8QA 4DE0A 4PHTA 4MEZA 3ULFA 3TSGA 4Q8IA 2ZQ8A 1MWUA 3KSIA 1HLUP 5F1FA 2VKSA 2XD5A 4CLCE 3HCYA 3H82B 3VOLA 3CLOA 5FQQA 3ZCZA 3FV7A 3H9WA 3BJNA 3A0SA 5CTNA 2XD1A 1FSWA 4YWZA 4MCWA
chains in the Genus database with same CATH topology
3ICYA 4HOIA 1P97A 4R3AA 3PR6A 5F69A 3PXPA 2W27A 4MN6A 5IU1A 2FZ0A 1IFQA 4Y2FA 4LLOB 4O0PA 5KSHA 4F3LB 2GNXA 5DJUA 1W63M 2M1CA 3LYXA 3CAXA 4BJPA 2JHEA 3IBJA 3LR4A 2JKRM 3TW8A 3E4PA 1OPXA 2OWHA 5K5BA 1TS6A 3MMHA 4HH3A 2QKPA 3VV4A 1T1CA 1ODVA 3UB6A 3VE4A 3NOTC 2HGVA 4OOMA 4EEPA 3FG8A 4Z1WA 3BW6A 2VGLM 4EEUA 4EQ1A 2NUPC 2PR6A 2HV1A 2CMNA 2VZWA 3LR5A 3D72A 2O9BA 3FC7A 1DP8A 3LR0A 3NOPC 4WUJA 3T50A 3PBRA 5A8BA 4JGPA 2O9CA 2KDKA 3ZYTA 3DBAA 3LIBA 3T4TA 1T19A 3E0YA 1YSPA 3U2AA 1N9LA 1N9NA 2WKRA 4HJ6A 2Z6DA 3CUEA 3MJQA 3UE6A 4CQHA 1GSVA 5CX7A 5MC7A 2HJ9C 2GJ3A 5AVEA 3ZQ5A 1VB6A 4B9OA 5DKKA 4BBVA 5HDCA 1NLYA 3G6OA 4WL9A 1LSXA 4HJ3A 3OLOA 3E4OA 3KYZA 2ZMVA 4GJ4A 2XSSA 4ME4A 4NEED 2VV8A 2A2LA 3JVUA 3NOUC 4NXEA 3PBTA 3W2ZA 1MZUA 4HP4A 4GHIA 2ZOHA 3JVVA 3RTYA 3UMDA 3BQAA 5TBMB 3GECA 3KYQA 2GX5A 3T4LA 4MN7A 4ARZB 4HIAA 1YKDA 4I3IA 3OCLA 2J80A 1ZTUA 2K31A 1LL8A 1N9OA 2VV7A 2W1TA 4I38A 5HDSA 4HP9A 4QPRA 3F1PB 3KSHA 1VHMA 2FH5A 1W63Q 3R4KA 5IT5A 3S7OA 4HY8A 3S7NA 3CI6A 4PAUA 2VGLS 4HH2A 3MXQA 2GZAA 2R78A 1F9IA 3PBSA 4L9FA 1JNUA 2J3WA 5HWWA 1LSWA 4AFIA 1XJ3A 4G3KA 5J7EA 1NLZA 2D02A 1OJ5A 2EWVA 5HPFA 3EGXC 3T4SA 3BY9A 2YKHA 4R6LA 1Y28A 1F5MA 4E04A 4H6JA 3V67A 2QWSA 3NHQA 5J3WA 2V1AA 3A0VA 3MF0A 4R70A 3CUEC 3T4QA 1LT0A 3EQUA 1YSQA 3B33A 2J3TC 3VE3A 1TF1A 4FOFA 4ZRRA 1IOUA 4BBTA 1V9ZA 4L9EA 4WELA 5HZHA 4FSFA 4CLCB 3H82A 3EEAA 2P7JA 2PYRA 2L4RA 2OAP1 2WKQA 3H7WA 4EERA 2JKRI 2O9AA 1G28A 2ZOIA 3TRCA 2D01A 2L1MA 3TE8A 2B02A 1ZHHB 4GS9B 3EQVA 3LIEA 2EA9A 2XRNA 2XA7M 5DF9A 3S7QA 3UB8A 2Z6CA 2JKTM 4KUKA 3T4OA 3A0RA 4OOLA 1LSVA 3LI8A 5DKLA 3BWLA 1G6OA 3IS2B 4IHQA 4F3LA 5I5LA 3FPWA 4ETXA 4O8GA 3P01A 4LPZA 3F1NB 4MMNA 5DFXA 3B42A 1OT9A 3HJKA 2VLGA 5F6AA 3PBQA 1OTEA 3UB9A 1OTBA 1V9YA 3UE3A 4HQAA 2WKPA 1DRMA 4G3VA 5DFYA 2G7UA 1S1YA 3KX0X 3MQQA 1WA9A 2QYBA 3R7WB 4RQ9A 1XFQA 4L9GA 1MC0A 1OTIA 4P6ZM 4EESA 5HD3A 4PKYG 4HJ4A 2A24B 2L0WA 5G4YA 2YKFA 3P7NA 4DJ2A 2LB5A 4NXFA 2OAQ1 5L8MA 1S66L 4LRYC 5HDDA 1D7EA 4CLCD 4UEYA 4WN5A 5HL6A 4EETB 2QJ5A 3GDIA 2H28A 3EWKA 2I9VA 3OCNA 4DMZA 2W3GA 2W0NA 3MQOA 3PHYA 1DP6A 2PD7A 5HSQA 4YOFA 3F1OB 2K2NA 4DJ3A 2PT7A 4XT2B 4MN5A 3E98A 4NXGA 2XA7S 2ZBBA 2P04A 3PBNA 3E4QA 3PBOA 4GW9A 5C5KA 2P08A 5F5YA 1P9RA 3LR3A 3C30A 3LIFA 5TBMA 1MKMA 3O5YA 2Y79A 1TD5A 4ARZA 4BWIA 1H8MA 4GLQA 4M4XA 1NWZA 2M7VA 3K2NA 4JGQA 5HPIA 4IJGA 2EWWA 2VJWA 5AVFA 4EUVA 3B47A 3F1PA 5J4EA 2O0YA 3BQ8A 4NKPA 2Y8HA 5LBRA 2B18A 4P6ZS 3EGDC 3LICA 3NJAA 1NRJA 5DJTA 3OC2A 5HD5A 5IS1A 4KQDA 4O01A 5HWVA 3C8CA 3SW1A 3LI9A 2DMWA 2PYPA 4HHDA 3CITA 2W3EA 1S1ZA 4HI4A 3OOVA 4JGRA 5HWTA 2KX6A 1XFNA 1OT6A 1OTDA 2KOIA 3PYPA 4UQIM 4EXOA 3EOIA 3KO6A 1UGUA 1P0ZA 2NUTC 2HF6A 4B93A 2OOLA 3RFBA 5KIZA 1XJ2A 1P9WA 2V9AA 1TS8A 4EW7A 3K3DA 2PR5A 4L0LA 4R38A 2W1RA 2JKTI 1KOUA 3OBFA 4Y3IA 2PD8A 4KUOA 1S67L 5F68A 4DN0A 1GSXA 2PHYA 2W3HA 3MQ0A 4MDZA 4Q0IA 4CLCA 5EFWA 2JN7A 4GHIB 3C2WA 2O99A 4WLAA 2M7UA 2K7SA 4II7A 3S7PA 2IA2A 1S4SA 4GS9A 3LIDA 3T4JA 1XJ4A 2W3DA 1YAXA 2ZMFA 5FL3A 1TS7A 4WF0A 2LB9A 4IUKA 2W1TB 3LIAA 3K3CA 4WEJA 3MR0A 3RH8B 2V0UA 1T18A 4Y5FA 3IS2A 1D06A 3F1NA 1OJGA 4YNRA 2XROA 1UWPX 2QJ7A 1X0OA 1H3QA 2VEAA 4BMWA 3D3OA 2INWA 3EEHA 3UB7A 2VX8A 1UWNX 4JGOA 1T1BA 1OTAA 4I3AA 2KLIA 3BY8A 4NXBA 4EU0A 3T4KA 5AJGA 4K08A 3MFXA 1TS0A 4UQIS 2HJEA 3FPVA 1STZA 3UMEA 4LRXC 3R7WA 3HJIA 4GCZA 4BBUA 3KSFA 4G3WA 4H6JB 2J3TD 1S4RA 1F98A 2QHKA 3CWFA 4PHTA 2A24A 4KQOA 3ULFA 2VA0A 4LRZE 3IBRA 4Q0HA 2MJ6A 3KSIA 3LUQA 3TJZC 4ETZA 3C38A 5TJJA 4PKYA 4I3JA 2VKSA 4WEKA 1BYWA 2V0WA 2VV6A 1DP9A 4CLCE 2V1BA 1GSWA 3HCYA 3H82B 3VOLA 2W3FA 3CLOA 3H7WB 3KSGA 4HNBA 4CLCC 1T1AA 4IUHA 3H9WA 3BJNA 2PDRA 3LFVA 3A0SA 3F1OA 1XJ6A 4I39A 1EW0A 4I5SA 4XT2A 2BASA 5G4ZA 2OWJA 4YWZA 4MCWA 4Q0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICY A;  4HOI A;  1P97 A;  4R3A A;  5F69 A;  2W27 A;  4MN6 A;  5IU1 A;  4LLO B;  4F3L B;  5DJU A;  2M1C A;  3LYX A;  3CAX A;  2JHE A;  3E4P A;  2OWH A;  1TS6 A;  4HH3 A;  2QKP A;  1T1C A;  1ODV A;  3UB6 A;  3VE4 A;  3NOT C;  4EEP A;  3FG8 A;  4EEU A;  4EQ1 A;  2PR6 A;  2HV1 A;  2CMN A;  3D72 A;  3FC7 A;  1DP8 A;  3NOP C;  4WUJ A;  3T50 A;  5A8B A;  4JGP A;  2KDK A;  3LIB A;  1T19 A;  1N9L A;  1N9N A;  2WKR A;  4HJ6 A;  2Z6D A;  3MJQ A;  3UE6 A;  1GSV A;  2GJ3 A;  5AVE A;  3ZQ5 A;  1VB6 A;  4B9O A;  5DKK A;  4BBV A;  5HDC A;  3G6O A;  4WL9 A;  1LSX A;  4HJ3 A;  3OLO A;  3E4O A;  2VV8 A;  3NOU C;  4NXE A;  1MZU A;  4HP4 A;  4GHI A;  2ZOH A;  3RTY A;  3UMD A;  5TBM B;  3GEC A;  4HIA A;  4I3I A;  2J80 A;  1LL8 A;  1N9O A;  2VV7 A;  4I38 A;  5HDS A;  4HP9 A;  3F1P B;  4HY8 A;  4HH2 A;  3MXQ A;  2R78 A;  1F9I A;  4L9F A;  1JNU A;  5HWW A;  1LSW A;  1XJ3 A;  5J7E A;  2D02 A;  1OJ5 A;  3BY9 A;  2YKH A;  4R6L A;  1Y28 A;  4E04 A;  4H6J A;  2QWS A;  3NHQ A;  5J3W A;  2V1A A;  3A0V A;  4R70 A;  1LT0 A;  3B33 A;  3VE3 A;  4BBT A;  1V9Z A;  4L9E A;  5HZH A;  3H82 A;  2P7J A;  2PYR A;  2L4R A;  2WKQ A;  3H7W A;  4EER A;  1G28 A;  2ZOI A;  2D01 A;  2L1M A;  2B02 A;  4GS9 B;  3LIE A;  2EA9 A;  3UB8 A;  2Z6C A;  4KUK A;  3A0R A;  1LSV A;  3LI8 A;  5DKL A;  3BWL A;  3IS2 B;  4F3L A;  5I5L A;  4LPZ A;  3F1N B;  1OT9 A;  3HJK A;  2VLG A;  5F6A A;  1OTE A;  3UB9 A;  1OTB A;  1V9Y A;  4HQA A;  2WKP A;  1DRM A;  1S1Y A;  3KX0 X;  3MQQ A;  1WA9 A;  4RQ9 A;  1XFQ A;  4L9G A;  1OTI A;  4EES A;  5HD3 A;  4PKY G;  4HJ4 A;  2A24 B;  2L0W A;  5G4Y A;  2YKF A;  3P7N A;  4DJ2 A;  4NXF A;  1S66 L;  4LRY C;  5HDD A;  1D7E A;  4WN5 A;  4EET B;  2QJ5 A;  3GDI A;  2H28 A;  3EWK A;  2I9V A;  2W0N A;  3MQO A;  3PHY A;  1DP6 A;  2PD7 A;  5HSQ A;  3F1O B;  4DJ3 A;  4XT2 B;  4MN5 A;  4NXG A;  2ZBB A;  3E4Q A;  4GW9 A;  5F5Y A;  3LIF A;  5TBM A;  4M4X A;  1NWZ A;  4JGQ A;  5AVF A;  3F1P A;  5J4E A;  3LIC A;  3NJA A;  5DJT A;  5HD5 A;  5IS1 A;  4KQD A;  5HWV A;  3C8C A;  3SW1 A;  3LI9 A;  2PYP A;  4HHD A;  1S1Z A;  4HI4 A;  4JGR A;  2KX6 A;  1XFN A;  1OT6 A;  1OTD A;  3PYP A;  4EXO A;  1UGU A;  1P0Z A;  2OOL A;  5KIZ A;  1XJ2 A;  2V9A A;  1TS8 A;  4EW7 A;  3K3D A;  4R38 A;  2PR5 A;  1KOU A;  2PD8 A;  4KUO A;  1S67 L;  5F68 A;  1GSX A;  2PHY A;  5EFW A;  2JN7 A;  4GHI B;  3C2W A;  4WLA A;  2K7S A;  1S4S A;  4GS9 A;  3LID A;  1XJ4 A;  1TS7 A;  4WF0 A;  3LIA A;  3K3C A;  3MR0 A;  3RH8 B;  2V0U A;  1T18 A;  3IS2 A;  1D06 A;  3F1N A;  1OJG A;  1UWP X;  2QJ7 A;  1X0O A;  2VEA A;  2INW A;  4YWZ A;  3EEH A;  3UB7 A;  1UWN X;  4JGO A;  1T1B A;  1OTA A;  4I3A A;  3BY8 A;  4NXB A;  4K08 A;  3MFX A;  1TS0 A;  3UME A;  4LRX C;  3HJI A;  4GCZ A;  4BBU A;  4H6J B;  1S4R A;  1F98 A;  2QHK A;  3CWF A;  2A24 A;  3ULF A;  4LRZ E;  3IBR A;  3LUQ A;  4PKY A;  4I3J A;  1BYW A;  2V0W A;  2VV6 A;  1DP9 A;  2V1B A;  1GSW A;  3H82 B;  3VOL A;  3CLO A;  3H7W B;  4HNB A;  1T1A A;  3H9W A;  2PDR A;  3A0S A;  3F1O A;  1XJ6 A;  4I39 A;  1EW0 A;  4I5S A;  4XT2 A;  2BAS A;  5G4Z A;  2OWJ A;  5HWT A; 
#chains in the Genus database with same CATH topology
 5M18 A;  4HOI A;  3O88 A;  4QY5 A;  4MN6 A;  5L10 A;  5I94 A;  4FH4 A;  1KDS A;  2JKF A;  3ZVW A;  1IYS A;  3WS4 A;  3IH9 A;  3OPH A;  2ZL1 B;  5A90 A;  1MPL A;  4OP8 A;  1Y4O A;  3VSL A;  1KE0 A;  4HH3 A;  4GNU A;  4RA7 A;  1ODV A;  1ES3 A;  4EEP A;  4S2K A;  4X1L A;  2V8F A;  3G31 A;  4EEU A;  4EQ1 A;  5EV0 A;  4RVA A;  1YM1 A;  2CMN A;  2X02 A;  1ERO A;  1L0D A;  3D72 A;  2O9B A;  3T50 A;  3PBR A;  2O9C A;  3ITB A;  5KZH A;  3LY4 A;  1T19 A;  2JKG A;  1N9L A;  4HJ6 A;  2WKR A;  2Z6D A;  3MKF A;  3MJQ A;  4CQH A;  2ZC7 A;  1K0K A;  2GJ3 A;  1AXB A;  1BTL A;  5TGF A;  3DTI A;  2XEP A;  2OV5 A;  2ZC3 B;  3OLO A;  3NUL A;  5EUA A;  2XSS A;  4ME4 A;  4E3J A;  4ZAM A;  3IWI A;  3IF6 A;  1MZU A;  2ZOH A;  1KDW A;  1PIO A;  3C7U A;  5HAR A;  4GD6 A;  4OLD A;  3RTY A;  2GX5 A;  4Z9Q A;  2ZLY A;  1AWI A;  2J80 A;  4I38 A;  2ZC6 B;  4S2J A;  4ZJ2 A;  4E3L A;  2UV0 E;  3CG5 A;  4JXV A;  3S7O A;  4ZJ1 A;  5FEF A;  3RJU A;  5DVA A;  4EBL A;  4AFI A;  4B88 A;  1Z09 A;  2EX8 A;  1NLZ A;  5FI6 A;  3G32 A;  1PZO A;  2J8Y A;  1GHM A;  4EUZ A;  4H6J A;  2V1A A;  3VOY A;  1JTG A;  2V1Z A;  1CI8 A;  4Y7P A;  3T4Q A;  2WKI A;  2J3T C;  3VE3 A;  1TF1 A;  4Y17 A;  4ZRR A;  5CGX A;  4ZTK A;  5F82 A;  3HRE A;  1K55 C;  5IHV A;  3H82 A;  1H8Z A;  1K54 A;  4EER A;  3N4I A;  2O9A A;  3T1S A;  2D01 A;  3IH8 A;  1SDE A;  1ALQ A;  1PW8 A;  2B02 A;  1FQG A;  2Y2I A;  2EA9 A;  2P9V A;  5DF9 A;  3BRM A;  1XX2 A;  3MZD A;  2Z6C A;  1U60 A;  3A0R A;  4XXR A;  1LSV A;  5DKL A;  1G6O A;  2ZQD A;  4DXC A;  4LPZ A;  3F1N B;  3B42 A;  3V3S A;  3BFE A;  1YLJ A;  3PBQ A;  4BD0 A;  2ZL1 A;  3AGD A;  1TDG A;  3UE3 A;  1GHP A;  5DFY A;  2P74 A;  2G7U A;  2WAF A;  2B5R A;  3UN7 A;  1XFQ A;  3BYD A;  1NZO A;  4P6Z M;  4WM9 A;  5CGS A;  3LGO A;  5G4Y A;  1F2K A;  4OON A;  2XGN A;  4DE1 A;  1TEM A;  4CLC D;  4UEY A;  5HL6 A;  3V39 A;  2QJ5 A;  1O07 A;  2H28 A;  4RX2 A;  3ZVT A;  3PHY A;  2V8C A;  3G2Y A;  4YOF A;  2H5S A;  5CHM A;  3F1O B;  2XFS A;  2PT7 A;  2X71 A;  2XA7 S;  4DDY A;  4QB8 A;  3W4Q A;  3CZD A;  3QNB A;  2R9W A;  4JKT A;  5M1A A;  4KZB A;  1SCW A;  5EM1 A;  4EV4 A;  3LR3 A;  4GDB A;  3BEC A;  4JXG A;  4R3B A;  3HLW A;  3GRJ A;  4LV3 A;  3O5Y A;  1N4O A;  4BWI A;  2PU2 A;  1H8M A;  3N8R A;  5L2F A;  2M7V A;  2H0T A;  4S2O A;  5AVF A;  4E3N A;  2O0Y A;  3VSK A;  3WRZ A;  3EGD C;  1CEF A;  1LL5 A;  4WZ5 A;  4O01 A;  5HWV A;  1OME A;  1WYC A;  1KVM A;  2ZC5 B;  2OLV A;  5CRF A;  3OOV A;  3M2K A;  2EX9 A;  1XFN A;  1OT6 A;  3D4F A;  5FEG A;  1MWS A;  2FFF B;  2Y4A A;  5FDS A;  5GHZ A;  1ZKJ A;  2PBY A;  2PR5 A;  4R38 A;  2Y2L A;  1Z6F A;  3TG9 A;  1KOU A;  1C3B A;  2HDQ A;  3UY6 A;  5DTT A;  3T1R A;  1KVL A;  3N6I A;  2ZMA A;  4N1H A;  2Y59 A;  4GHI B;  2O99 A;  1YPR A;  1ES2 A;  4II7 A;  3ZG8 B;  3V3R A;  5HW3 A;  2EXB A;  4S2N A;  1L2S A;  3V5M A;  4WF0 A;  1DJB A;  2Y2H A;  3Q1F A;  1IYQ A;  1YQS A;  3BFF A;  3IX4 A;  1D06 A;  2IWB A;  3F1N A;  1BLH A;  2WGI A;  1HD8 A;  1H3Q A;  5TFQ A;  4BMW A;  3D3O A;  2XDM A;  1T1B A;  3BY8 A;  4JPM A;  4JLF A;  4EU0 A;  5AJG A;  4FD8 A;  2WYX A;  4K08 A;  1BUE A;  5CTM A;  2AVX A;  3PAG A;  5U47 A;  1NRF A;  3A3I A;  2WZZ A;  2QHK A;  1IYO A;  1LI0 A;  5KSC A;  2VA0 A;  4LRZ E;  1VEU B;  4EBP A;  2MJ6 A;  1PZP A;  3TJZ C;  1I2S A;  4ETZ A;  4KZ6 A;  5TJJ A;  3ZG0 A;  4WEK A;  2VV6 A;  1DP9 A;  4KZ5 A;  2HP5 A;  1ESI A;  4X6T A;  4NK3 A;  3HLB A;  3H7W B;  4CLC C;  2PDR A;  4X55 A;  3F1O A;  4X1M A;  1XP4 A;  5A91 A;  1ES4 A;  3S1Y A;  3MKE A;  4HES A;  4R3A A;  3PXP A;  1CQA A;  5FQ9 A;  5IU1 A;  1XA7 A;  5KSH A;  4ID4 A;  4F3L B;  4WMC A;  2M1C A;  2JHE A;  3IBJ A;  2JKR M;  3TW8 A;  3IF5 A;  2OWH A;  3MMH A;  2QKP A;  3VV4 A;  2Y2P A;  4N9K A;  4WBG A;  3VE4 A;  4X69 A;  3HBR A;  3NOT C;  4C6Y A;  1ES5 A;  3FG8 A;  2IWC A;  1W79 A;  4Z1W A;  3S22 A;  4UA7 A;  2HV1 A;  2VZW A;  3LR5 A;  3NOP C;  4ZBE A;  5EVI B;  4WUJ A;  5A8B A;  4Y0T A;  4JGP A;  4CPK A;  1YMS A;  3ZNY A;  3DBA A;  3LIB A;  3T4T A;  1PI4 A;  3E0Y A;  1YSP A;  4MLL A;  1MWR A;  3CUE A;  2ACG A;  1ONG A;  5CX7 A;  4P6B A;  5AVE A;  3ZQ5 A;  3DWZ A;  1VB6 A;  4BBV A;  1LSX A;  4FTX A;  1ZC2 A;  3OPL A;  3E4O A;  3KYZ A;  3NY4 A;  3NOU C;  3PBT A;  2OSU A;  4KG5 A;  4HP4 A;  4RYE A;  2XF3 A;  4GHI A;  5EEC A;  3BM6 A;  3DTE A;  3UMD A;  3BQA A;  1VET B;  4FCF A;  1MWT A;  2A49 A;  4ARZ B;  4DF6 A;  1YKD A;  1LI9 A;  1W8Y A;  3W4O A;  1WYB A;  2VV7 A;  3CHW P;  4QPR A;  3Q7V B;  4OVD A;  1E4D A;  5AQA A;  5IT5 A;  4FH2 A;  3CI6 A;  4HH2 A;  1YLW A;  3PBS A;  5FAQ A;  2J3W A;  3FWL A;  4GD8 A;  4G3K A;  1OJ5 A;  1L3L A;  1E25 A;  4DE2 A;  3UPO A;  2YKH A;  4R6L A;  2P9V B;  1Y28 A;  4E04 A;  2QWS A;  2RL3 A;  4KEN B;  1VQQ A;  3ITA A;  3QP1 A;  1VEU A;  1BUL A;  3B33 A;  2PRF A;  4UHU A;  3M2J A;  4OKP A;  5E2F A;  1V9Z A;  4L9E A;  5FAP A;  4LGW A;  4FSF A;  3NDG A;  2PYR A;  4X68 A;  4ZDX A;  3H7W A;  4A5R A;  3IF6 C;  1PWD A;  1G28 A;  1KGG A;  2HZ5 A;  3DW0 A;  2L1M A;  3NC8 A;  4LEN A;  5GLC A;  2XA7 M;  3C4O A;  1NYM A;  3UB8 A;  3Q07 A;  5CEC A;  3T4O A;  1K4F A;  4H8R A;  2V2F F;  5HL1 A;  4F3L A;  5I5L A;  4MMN A;  4GOG A;  2VLG A;  3ZNT A;  2WKH A;  5M19 A;  3ZHH A;  1DRM A;  5D3O A;  2JE5 A;  3A3E A;  4IVK A;  4DXB A;  5FQI A;  1IKG A;  4RQ9 A;  4UA9 A;  5HD3 A;  4PKY G;  5A93 A;  3BEB A;  1NXY A;  2L0W A;  3P7N A;  1FCM A;  3NCK A;  3UO9 A;  4KZ7 A;  2OAQ 1;  5EVI A;  2EFU A;  1K57 A;  3NIA A;  5L8M A;  4P0M A;  5HDD A;  1D7E A;  4JF6 A;  2I9V A;  3OCN A;  4U0X A;  1QMF A;  4N1X A;  5FA7 A;  2EXA A;  2PD7 A;  4XUX A;  4XT2 B;  3E98 A;  4NXG A;  2ZBB A;  1WE4 A;  1EI5 A;  4OQH A;  1K6R A;  2WUQ A;  4P87 A;  3E4Q A;  3P98 A;  3PBO A;  5C5K A;  5F5Y A;  4XUZ A;  4N9L A;  4PM5 A;  2Z2M B;  2G2W A;  3C30 A;  1K4E A;  1L0E A;  1VET A;  2PU4 A;  3LIF A;  1MKM A;  1S6R A;  4ARZ A;  3ISG A;  3GSG A;  4M4X A;  5CGW A;  3K2N A;  5HPI A;  4E6X A;  1ACF A;  2EWW A;  2VJW A;  1PWC A;  3B47 A;  5EE8 A;  5J4E A;  3Q7V A;  3UE0 A;  1BLC A;  1I5Q A;  1M40 A;  4NKP A;  3HLF A;  2Q0O A;  3QHY A;  3W4P A;  5LBR A;  5HFO A;  4BL3 A;  5IS1 A;  4KQD A;  2I72 A;  3C8C A;  3LI9 A;  2DMW A;  2PAV P;  4OPR A;  5FAS A;  1TDL A;  1MKI A;  2HDR A;  2KX6 A;  2DCF A;  2KOI A;  3PYP A;  1CJF A;  3EOI A;  3KO6 A;  1UGU A;  5GLA A;  3HUN A;  4B93 A;  3RFB A;  3G4P A;  2J9P A;  4PM9 A;  4QU3 A;  1XJ2 A;  5FAT A;  1TS8 A;  1VM1 A;  3RXX A;  3K3D A;  3PAE A;  4JBF A;  3OBF A;  4Y0U A;  3VFH A;  1K56 D;  1XA1 A;  2HP6 A;  1LLB A;  4BL2 A;  4DN0 A;  1GSX A;  4Q0I A;  3IX3 A;  2JN7 A;  4B4Z A;  4WMC D;  2M7U A;  4EBN A;  2Z2L B;  1G68 A;  2IA2 A;  1S4S A;  3T4J A;  1JVJ A;  1XJ4 A;  4IED A;  1YAX A;  2ZMF A;  2LB9 A;  2DNS A;  3LIA A;  3K3C A;  2XR0 A;  2V0U A;  4OLG A;  3MS6 A;  4E3I A;  1K55 A;  3O3V A;  2OLU A;  1X0O A;  3QP6 A;  3FKW A;  1UWN X;  4JGO A;  3CJM A;  3CPT B;  4NXB A;  3IT9 A;  4X56 A;  1I2W A;  3UME A;  4LRX C;  5FQJ A;  5GL9 A;  4BBU A;  1G6A A;  4PPR A;  2Y2K A;  5AQ9 A;  1F98 A;  4BD1 A;  3Q7Z A;  3IBR A;  3T12 B;  3LUQ A;  3C38 A;  4PKY A;  4I3J A;  1GHI A;  2V0W A;  3GMW A;  2V1B A;  1GSW A;  2WZX A;  2W3F A;  2Y91 A;  3DWK A;  4HNB A;  1T1A A;  4IUH A;  1YLP A;  1M6K A;  1XJ6 A;  4I39 A;  2R9X A;  4I5S A;  4XT2 A;  2BAS A;  1NY0 A;  2Y2G A;  1W7F A;  3S7P A;  3ICY A;  1P97 A;  3JPU A;  4S2N C;  5F69 A;  1IFQ A;  4LLO B;  4DDS A;  1DJC A;  2GNX A;  5HAQ A;  5DJU A;  3CAX A;  4BJP A;  1JTD A;  2WK0 A;  3LR4 A;  3IHB A;  3HLE A;  3IXH A;  4OH0 A;  3HUO A;  3SH7 A;  1TS6 A;  4O7D A;  1KE3 A;  1T1C A;  5FQM A;  1RGZ A;  3QNC A;  4LCL A;  1JWV A;  4E3M A;  5AQ7 A;  5CER A;  5DTS A;  4BLM A;  3DTM A;  3LR0 A;  3FC7 A;  1DP8 A;  1YT4 A;  3GTC A;  2KDK A;  3ZYT A;  1PRQ A;  5G18 A;  1RCJ A;  2JBF A;  4WZ4 A;  3UE6 A;  3OZH A;  2VGK A;  1GSV A;  3SOI A;  2HJ9 C;  5TR7 A;  1LHY A;  5EOE A;  5HDC A;  1NLY A;  1MY8 A;  1DJA A;  4HJ3 A;  4NEE D;  2Q9N A;  2VV8 A;  3Q81 A;  4YFM A;  3JVU A;  3W2Z A;  5GLD A;  3AGE A;  2GDN A;  4JXS A;  2Y2N A;  4LV1 A;  1NJ4 A;  4GN2 A;  3KYQ A;  4MN7 A;  1ZG4 A;  4I3I A;  1IKI A;  1ZTU A;  2K31 A;  1LL8 A;  1N9O A;  3L7H A;  4QHC A;  3KSH A;  1VHM A;  4K91 A;  1W63 Q;  3R4K A;  3FKV A;  2VGL S;  2GZA A;  2R78 A;  1F9I A;  2J9O A;  2ZC4 B;  4IBR A;  5EVI D;  3UNW A;  5HWW A;  3CPT A;  1LSW A;  3N7W A;  2XLN A;  3N8S A;  1IEL A;  3G30 A;  5J7E A;  2D02 A;  1QME A;  5JYP A;  3FYZ A;  3EGX C;  1KGF A;  3T4S A;  3BY9 A;  1DY6 A;  3VFF A;  1F5M A;  3V67 A;  4KZA A;  3LEQ A;  3NHQ A;  5J3W A;  5GHX A;  4PM7 A;  3UDI A;  3A0V A;  3CUE C;  1LT0 A;  3EQU A;  3G2Z A;  1JWZ A;  5HAP A;  3SZT A;  4BBT A;  2BTF P;  3QP2 A;  3IXG A;  1SHV A;  4WEL A;  5EOO A;  5HZH A;  4BQM A;  2P7J A;  2WKQ A;  1S0W A;  2OAP 1;  2XQZ A;  3ZFZ A;  2QMI A;  2JKR I;  3UDX A;  2ZOI A;  2H0Y A;  1KGE A;  3EQV A;  4DE3 A;  3DTK A;  2XRN A;  3C5A A;  3S7Q A;  4HBU A;  4OPQ A;  2JKT M;  3P09 A;  4OOL A;  1FOF A;  3BWL A;  2WAE A;  4IHQ A;  5E2G A;  4ETX A;  4O8G A;  3P01 A;  4NET A;  5F6A A;  1OTE A;  3NEC A;  4KQR A;  3SS4 A;  3A3D A;  1O7E A;  2ZM2 A;  4HQA A;  1NZU A;  1EWZ A;  3KX0 X;  3MQQ A;  1WA9 A;  3R7W B;  2QPN A;  1PYY A;  4OQ0 A;  1MC0 A;  1IEM A;  1PFL A;  5GLB A;  4HJ4 A;  4P85 A;  2A24 B;  3MSH A;  4OQG A;  2YKF A;  4DJ2 A;  2LB5 A;  2EX2 A;  1S66 L;  4LRY C;  4QWO A;  2H10 A;  1NYY A;  4EET B;  1CF0 A;  4OPY A;  5E2H A;  2W3G A;  2E8J A;  4WYY A;  2HP9 A;  4PMA A;  4UAA A;  1DP6 A;  2UWX A;  1SZV A;  4PM6 A;  4Y13 A;  2K2N A;  4DJ3 A;  4E3K A;  3M6B A;  1SKO B;  2P04 A;  4DKI A;  3PBN A;  1XGI A;  3DAV A;  4GW9 A;  2P08 A;  5E2E A;  3GR2 A;  2Y2M A;  1Q2Q A;  3UB5 P;  1JWP A;  4Y15 A;  3UDF A;  4JGQ A;  4IVI A;  2XFT A;  4MBH A;  3LEZ A;  4BEN A;  4EUV A;  4JXW A;  2G2U A;  3S4X A;  1ERQ A;  1KE4 A;  3BLM A;  3NJA A;  5AQB A;  1HVB A;  3OC2 A;  5DJT A;  5HD5 A;  3IXB A;  3TOI A;  2Y2J A;  4GZB A;  3IX8 A;  3SW1 A;  5EVE A;  4MNR A;  2PYP A;  4HHD A;  1E3U A;  2W3E A;  1S1Z A;  4JGR A;  2Y55 A;  4EXO A;  1OTD A;  1MBL A;  1XPB A;  2QZ6 A;  2NUT C;  5EVI C;  1K57 C;  2HF6 A;  2J7V A;  2OOL A;  3OPR A;  1BSG A;  1P9W A;  4EW7 A;  1FCN A;  1L0F A;  2W1R A;  2PD8 A;  4KUO A;  1RGY A;  1S67 L;  5F68 A;  3QP4 A;  2PHY A;  3OPP A;  3GV9 A;  4WLA A;  4ZJ3 A;  3QP5 A;  1K6S A;  3I7J A;  5FL3 A;  3WS1 A;  4IUK A;  2W1T B;  4WEJ A;  3BFC A;  3MR0 A;  2VGJ A;  4U0T A;  4S2P A;  3RH8 B;  4GDN A;  4Y5F A;  5E43 A;  2XRO A;  1GA0 A;  1K25 A;  5DF8 A;  1UWP X;  2QJ7 A;  3UB7 A;  3IXD A;  1OTA A;  2KLI A;  3QP8 A;  4LV0 A;  1XXM A;  5F83 A;  4UQI S;  1K54 C;  3HVF A;  3NDE A;  3R7W A;  3HJI A;  4GCZ A;  3KSF A;  4JF4 A;  1PNE A;  3GVB A;  1S4R A;  3Q82 A;  3KYE A;  3U4L P;  3CWF A;  2A24 A;  2ZQ9 A;  3E2L A;  3UE1 A;  4KQO A;  3NBL A;  5CXW A;  3UPP A;  4Q0H A;  3LO7 A;  2ZM8 A;  3VP1 A;  4R23 A;  1BYW A;  1ONH A;  3L9K A;  4OPZ A;  5HX9 A;  2Y2Q A;  1K38 A;  3KSG A;  2ZQC A;  4FUW A;  3HL9 A;  3LFV A;  4YIN A;  1EW0 A;  5G4Z A;  2OWJ A;  1L0G A;  5HWT A;  4Q0J A;  1SKO A;  3A3J A;  1BLS A;  1A0K A;  5L07 A;  3PR6 A;  1RP5 A;  2W27 A;  3WS5 A;  1J9M A;  2FZ0 A;  4Y2F A;  4O0P A;  5FI2 A;  3VP3 A;  4QY6 A;  3C4P A;  1W63 M;  3LYX A;  3VOZ A;  4Y0O A;  5JYO A;  1MXO A;  3E4P A;  4R4S A;  3HUM A;  1CI9 A;  1OPX A;  3HLD A;  5K5B A;  3M6H A;  3UB6 A;  2HGV A;  4OOM A;  4D2O A;  2CC1 A;  2ZQ7 A;  2ZD8 A;  3BW6 A;  2VGL M;  5FSR A;  2NUP C;  2PR6 A;  4KG6 A;  1YMX A;  5F1G A;  3MFD A;  2DRW A;  4QJG A;  3U2A A;  2HPB A;  1N9N A;  1FR1 A;  4S2I A;  4E6W A;  5MC7 A;  3MBZ A;  2XH9 A;  3SH8 A;  4B9O A;  5DKK A;  3G6O A;  4WL9 A;  4QD4 A;  5DF7 A;  1IYP A;  3E2K A;  5FQK A;  2ZMV A;  4GJ4 A;  1BLP A;  3HLC A;  2A2L A;  4RX3 A;  4OQI A;  4NXE A;  3PTE A;  4WZ5 C;  1Y54 A;  4DRT A;  4UA6 A;  2IWD A;  3A3F A;  3JVV A;  5CHJ A;  1H5X A;  5TBM B;  3GEC A;  4GB7 A;  3T4L A;  4R1G A;  4HIA A;  3OCL A;  4D60 A;  5CEB A;  5GHY A;  4MBK A;  5HDS A;  2W1T A;  4K0X A;  4HP9 A;  3F1P B;  2FH5 A;  2ZM0 A;  3MXR A;  4HY8 A;  3S7N A;  4PAU A;  3MXS A;  3MZF A;  3MXQ A;  1W5D A;  3ZGA B;  4L9F A;  5L09 A;  1JNU A;  3WS0 A;  5CED A;  1H0M A;  4EWF A;  1XJ3 A;  3RXW A;  4KZ4 A;  4X25 A;  2EWV A;  1YLY A;  3VP2 A;  5HPF A;  4F94 A;  2FFY A;  2WGW B;  2RCX A;  5BOH A;  3T1X A;  3MF0 A;  4R70 A;  2ZJ9 A;  3ZG5 A;  1YSQ A;  4IBX A;  2XK1 A;  4FOF A;  3BFD A;  1IOU A;  4GKU A;  2E8I A;  1XKZ A;  4KZ8 A;  3IWQ A;  3UPN A;  4B4X A;  3LY3 A;  4CLC B;  1BZA A;  3EEA A;  2L4R A;  3W8K A;  4CJN A;  1FCO A;  3TRC A;  5EPH A;  3B3X A;  4KQQ A;  3TE8 A;  1SDN A;  1XGJ A;  1ZHH B;  4GS9 B;  3LIE A;  5KMW A;  1FR6 A;  1PWG A;  4OP5 A;  5DTK A;  4KUK A;  3FZC A;  1ESU A;  3LI8 A;  4KZ3 A;  3IQA A;  3IS2 B;  4LCM A;  3FPW A;  5DFX A;  4X53 A;  1OT9 A;  3HJK A;  5FDH A;  4HEF A;  1HZO A;  3UB9 A;  2ZQA A;  1OTB A;  1LL9 A;  3VP0 A;  1V9Y A;  1FSY A;  1E3U D;  1PI5 A;  2WKP A;  4G3V A;  3O87 A;  1CEG A;  1S1Y A;  1CK3 A;  3SH9 A;  2QYB A;  1FIK A;  3IWO A;  1H8Y A;  3WS2 A;  4L9G A;  5FAO A;  1OTI A;  4C3Q A;  4EES A;  2WAD A;  4NXF A;  3JYI A;  3BLS A;  2BLS A;  4WN5 A;  3SS5 A;  3GDI A;  4NG2 A;  3EWK A;  2EFX A;  3LCE A;  4R4R A;  4DMZ A;  1GA9 A;  2W0N A;  3MQO A;  5HSQ A;  4E3O A;  4PM8 A;  3V50 A;  1Q2P A;  2B95 A;  2VK3 A;  3NI9 A;  4MN5 A;  5FI7 A;  2X01 A;  4R3J A;  3ZG9 B;  4R0Q A;  1ERM A;  1P9R A;  1G5U A;  5HAI A;  5TBM A;  2Y79 A;  1TD5 A;  4C75 A;  3VP4 A;  4GLQ A;  1NWZ A;  3D9Y A;  2V20 A;  1TVF A;  3G34 A;  4IJG A;  1J3W A;  5CHU A;  3ZDJ A;  3F1P A;  3BQ8 A;  2BG1 A;  2Y8H A;  4MBF A;  1HTZ A;  2B18 A;  4P6Z S;  3LIC A;  1NRJ A;  2WKE A;  3N8L A;  4HBT A;  1K56 A;  4EQI A;  4N92 A;  3CIT A;  2WGV A;  4HI4 A;  1GCE A;  4UQI M;  3AGF A;  4KZ9 A;  4S2L A;  1P0Z A;  5J8X A;  1SKF A;  3HLG A;  3BFG A;  1YLT A;  2WGW A;  5KIZ A;  3T1Q B;  2V9A A;  2C6W B;  5A92 A;  4L0L A;  3CMZ A;  3C7V A;  2JKT I;  4Y3I A;  4S2M A;  2EX6 A;  3O86 A;  1ZG6 A;  2W3H A;  1N9B A;  3MQ0 A;  4MDZ A;  3WWX A;  1YLZ A;  3IF6 B;  4CLC A;  5EFW A;  3VMA A;  3MZE A;  3C2W A;  5EVL A;  2K7S A;  3SS3 A;  5EM0 A;  2PBD P;  1BT5 A;  2C5W B;  4GS9 A;  3LID A;  2JC7 A;  3GQZ A;  2W3D A;  1TS7 A;  3G35 A;  4K0W A;  4ESP A;  4LV2 A;  2JCH A;  2HDS A;  1FIL A;  3ZG7 B;  1T18 A;  2Y2O A;  3WRT A;  3IS2 A;  2HDU A;  4KG2 A;  1OJG A;  4YNR A;  1PW1 A;  2VEA A;  2INW A;  3EEH A;  2VX8 A;  2Q9M A;  4I3A A;  4LFU A;  3IHA A;  4U3T A;  3T4K A;  4M3K A;  4OOY A;  3MFX A;  1TS0 A;  2HJE A;  3FPV A;  1STZ A;  1D1J A;  4JF5 A;  2A3U A;  4G3W A;  4H6J B;  2J3T D;  1W8Q A;  4DE0 A;  4PHT A;  4MEZ A;  3ULF A;  3TSG A;  4Q8I A;  2ZQ8 A;  1MWU A;  3KSI A;  1HLU P;  5F1F A;  2VKS A;  2XD5 A;  4CLC E;  3HCY A;  3H82 B;  3VOL A;  3CLO A;  5FQQ A;  3ZCZ A;  3FV7 A;  3H9W A;  3BJN A;  3A0S A;  5CTN A;  2XD1 A;  1FSW A;  4YWZ A;  4MCW A; 
#chains in the Genus database with same CATH homology
 3ICY A;  4HOI A;  1P97 A;  4R3A A;  3PR6 A;  5F69 A;  3PXP A;  2W27 A;  4MN6 A;  5IU1 A;  2FZ0 A;  1IFQ A;  4Y2F A;  4LLO B;  4O0P A;  5KSH A;  4F3L B;  2GNX A;  5DJU A;  1W63 M;  2M1C A;  3LYX A;  3CAX A;  4BJP A;  2JHE A;  3IBJ A;  3LR4 A;  2JKR M;  3TW8 A;  3E4P A;  1OPX A;  2OWH A;  5K5B A;  1TS6 A;  3MMH A;  4HH3 A;  2QKP A;  3VV4 A;  1T1C A;  1ODV A;  3UB6 A;  3VE4 A;  3NOT C;  2HGV A;  4OOM A;  4EEP A;  3FG8 A;  4Z1W A;  3BW6 A;  2VGL M;  4EEU A;  4EQ1 A;  2NUP C;  2PR6 A;  2HV1 A;  2CMN A;  2VZW A;  3LR5 A;  3D72 A;  2O9B A;  3FC7 A;  1DP8 A;  3LR0 A;  3NOP C;  4WUJ A;  3T50 A;  3PBR A;  5A8B A;  4JGP A;  2O9C A;  2KDK A;  3ZYT A;  3DBA A;  3LIB A;  3T4T A;  1T19 A;  3E0Y A;  1YSP A;  3U2A A;  1N9L A;  1N9N A;  2WKR A;  4HJ6 A;  2Z6D A;  3CUE A;  3MJQ A;  3UE6 A;  4CQH A;  1GSV A;  5CX7 A;  5MC7 A;  2HJ9 C;  2GJ3 A;  5AVE A;  3ZQ5 A;  1VB6 A;  4B9O A;  5DKK A;  4BBV A;  5HDC A;  1NLY A;  3G6O A;  4WL9 A;  1LSX A;  4HJ3 A;  3OLO A;  3E4O A;  3KYZ A;  2ZMV A;  4GJ4 A;  2XSS A;  4ME4 A;  4NEE D;  2VV8 A;  2A2L A;  3JVU A;  3NOU C;  4NXE A;  3PBT A;  3W2Z A;  1MZU A;  4HP4 A;  4GHI A;  2ZOH A;  3JVV A;  3RTY A;  3UMD A;  3BQA A;  5TBM B;  3GEC A;  3KYQ A;  2GX5 A;  3T4L A;  4MN7 A;  4ARZ B;  4HIA A;  1YKD A;  4I3I A;  3OCL A;  2J80 A;  1ZTU A;  2K31 A;  1LL8 A;  1N9O A;  2VV7 A;  2W1T A;  4I38 A;  5HDS A;  4HP9 A;  4QPR A;  3F1P B;  3KSH A;  1VHM A;  2FH5 A;  1W63 Q;  3R4K A;  5IT5 A;  3S7O A;  4HY8 A;  3S7N A;  3CI6 A;  4PAU A;  2VGL S;  4HH2 A;  3MXQ A;  2GZA A;  2R78 A;  1F9I A;  3PBS A;  4L9F A;  1JNU A;  2J3W A;  5HWW A;  1LSW A;  4AFI A;  1XJ3 A;  4G3K A;  5J7E A;  1NLZ A;  2D02 A;  1OJ5 A;  2EWV A;  5HPF A;  3EGX C;  3T4S A;  3BY9 A;  2YKH A;  4R6L A;  1Y28 A;  1F5M A;  4E04 A;  4H6J A;  3V67 A;  2QWS A;  3NHQ A;  5J3W A;  2V1A A;  3A0V A;  3MF0 A;  4R70 A;  3CUE C;  3T4Q A;  1LT0 A;  3EQU A;  1YSQ A;  3B33 A;  2J3T C;  3VE3 A;  1TF1 A;  4FOF A;  4ZRR A;  1IOU A;  4BBT A;  1V9Z A;  4L9E A;  4WEL A;  5HZH A;  4FSF A;  4CLC B;  3H82 A;  3EEA A;  2P7J A;  2PYR A;  2L4R A;  2OAP 1;  2WKQ A;  3H7W A;  4EER A;  2JKR I;  2O9A A;  1G28 A;  2ZOI A;  3TRC A;  2D01 A;  2L1M A;  3TE8 A;  2B02 A;  1ZHH B;  4GS9 B;  3EQV A;  3LIE A;  2EA9 A;  2XRN A;  2XA7 M;  5DF9 A;  3S7Q A;  3UB8 A;  2Z6C A;  2JKT M;  4KUK A;  3T4O A;  3A0R A;  4OOL A;  1LSV A;  3LI8 A;  5DKL A;  3BWL A;  1G6O A;  3IS2 B;  4IHQ A;  4F3L A;  5I5L A;  3FPW A;  4ETX A;  4O8G A;  3P01 A;  4LPZ A;  3F1N B;  4MMN A;  5DFX A;  3B42 A;  1OT9 A;  3HJK A;  2VLG A;  5F6A A;  3PBQ A;  1OTE A;  3UB9 A;  1OTB A;  1V9Y A;  3UE3 A;  4HQA A;  2WKP A;  1DRM A;  4G3V A;  5DFY A;  2G7U A;  1S1Y A;  3KX0 X;  3MQQ A;  1WA9 A;  2QYB A;  3R7W B;  4RQ9 A;  1XFQ A;  4L9G A;  1MC0 A;  1OTI A;  4P6Z M;  4EES A;  5HD3 A;  4PKY G;  4HJ4 A;  2A24 B;  2L0W A;  5G4Y A;  2YKF A;  3P7N A;  4DJ2 A;  2LB5 A;  4NXF A;  2OAQ 1;  5L8M A;  1S66 L;  4LRY C;  5HDD A;  1D7E A;  4CLC D;  4UEY A;  4WN5 A;  5HL6 A;  4EET B;  2QJ5 A;  3GDI A;  2H28 A;  3EWK A;  2I9V A;  3OCN A;  4DMZ A;  2W3G A;  2W0N A;  3MQO A;  3PHY A;  1DP6 A;  2PD7 A;  5HSQ A;  4YOF A;  3F1O B;  2K2N A;  4DJ3 A;  2PT7 A;  4XT2 B;  4MN5 A;  3E98 A;  4NXG A;  2XA7 S;  2ZBB A;  2P04 A;  3PBN A;  3E4Q A;  3PBO A;  4GW9 A;  5C5K A;  2P08 A;  5F5Y A;  1P9R A;  3LR3 A;  3C30 A;  3LIF A;  5TBM A;  1MKM A;  3O5Y A;  2Y79 A;  1TD5 A;  4ARZ A;  4BWI A;  1H8M A;  4GLQ A;  4M4X A;  1NWZ A;  2M7V A;  3K2N A;  4JGQ A;  5HPI A;  4IJG A;  2EWW A;  2VJW A;  5AVF A;  4EUV A;  3B47 A;  3F1P A;  5J4E A;  2O0Y A;  3BQ8 A;  4NKP A;  2Y8H A;  5LBR A;  2B18 A;  4P6Z S;  3EGD C;  3LIC A;  3NJA A;  1NRJ A;  5DJT A;  3OC2 A;  5HD5 A;  5IS1 A;  4KQD A;  4O01 A;  5HWV A;  3C8C A;  3SW1 A;  3LI9 A;  2DMW A;  2PYP A;  4HHD A;  3CIT A;  2W3E A;  1S1Z A;  4HI4 A;  3OOV A;  4JGR A;  5HWT A;  2KX6 A;  1XFN A;  1OT6 A;  1OTD A;  2KOI A;  3PYP A;  4UQI M;  4EXO A;  3EOI A;  3KO6 A;  1UGU A;  1P0Z A;  2NUT C;  2HF6 A;  4B93 A;  2OOL A;  3RFB A;  5KIZ A;  1XJ2 A;  1P9W A;  2V9A A;  1TS8 A;  4EW7 A;  3K3D A;  2PR5 A;  4L0L A;  4R38 A;  2W1R A;  2JKT I;  1KOU A;  3OBF A;  4Y3I A;  2PD8 A;  4KUO A;  1S67 L;  5F68 A;  4DN0 A;  1GSX A;  2PHY A;  2W3H A;  3MQ0 A;  4MDZ A;  4Q0I A;  4CLC A;  5EFW A;  2JN7 A;  4GHI B;  3C2W A;  2O99 A;  4WLA A;  2M7U A;  2K7S A;  4II7 A;  3S7P A;  2IA2 A;  1S4S A;  4GS9 A;  3LID A;  3T4J A;  1XJ4 A;  2W3D A;  1YAX A;  2ZMF A;  5FL3 A;  1TS7 A;  4WF0 A;  2LB9 A;  4IUK A;  2W1T B;  3LIA A;  3K3C A;  4WEJ A;  3MR0 A;  3RH8 B;  2V0U A;  1T18 A;  4Y5F A;  3IS2 A;  1D06 A;  3F1N A;  1OJG A;  4YNR A;  2XRO A;  1UWP X;  2QJ7 A;  1X0O A;  1H3Q A;  2VEA A;  4BMW A;  3D3O A;  2INW A;  3EEH A;  3UB7 A;  2VX8 A;  1UWN X;  4JGO A;  1T1B A;  1OTA A;  4I3A A;  2KLI A;  3BY8 A;  4NXB A;  4EU0 A;  3T4K A;  5AJG A;  4K08 A;  3MFX A;  1TS0 A;  4UQI S;  2HJE A;  3FPV A;  1STZ A;  3UME A;  4LRX C;  3R7W A;  3HJI A;  4GCZ A;  4BBU A;  3KSF A;  4G3W A;  4H6J B;  2J3T D;  1S4R A;  1F98 A;  2QHK A;  3CWF A;  4PHT A;  2A24 A;  4KQO A;  3ULF A;  2VA0 A;  4LRZ E;  3IBR A;  4Q0H A;  2MJ6 A;  3KSI A;  3LUQ A;  3TJZ C;  4ETZ A;  3C38 A;  5TJJ A;  4PKY A;  4I3J A;  2VKS A;  4WEK A;  1BYW A;  2V0W A;  2VV6 A;  1DP9 A;  4CLC E;  2V1B A;  1GSW A;  3HCY A;  3H82 B;  3VOL A;  2W3F A;  3CLO A;  3H7W B;  3KSG A;  4HNB A;  4CLC C;  1T1A A;  4IUH A;  3H9W A;  3BJN A;  2PDR A;  3LFV A;  3A0S A;  3F1O A;  1XJ6 A;  4I39 A;  1EW0 A;  4I5S A;  4XT2 A;  2BAS A;  5G4Z A;  2OWJ A;  4YWZ A;  4MCW A;  4Q0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...