4GS9A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
107
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 29
structure length 107
sequence length 113
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9A00
1WA9A 3PYPA 4LPZA 4NXFA 2OWHA 2QKPA 3LIAA 3NHQA 3H7WA 3B33A 3LIEA 3OLOA 4EERA 3CAXA 1OTIA 2I9VA 1XFQA 1S1ZA 4HIAA 4M4XA 2V0UA 4NXGA 5G4ZA 3UE6A 1OTDA 2V1AA 2WKQA 1F9IA 1TS7A 1X0OA 2CMNA 2EA9A 3E4QA 4GS9B 4GS9A 4GCZA 2WKRA 5F69A 4BBUA 2KDKA 4LRZE 3BY8A 4B9OA 2QJ7A 3H7WB 4WL9A 4WF0A 3GDIA 2INWA 2L4RA 3LIBA 3LUQA 3LYXA 4PKYA 3EWKA 2KX6A 5DKLA 5HD5A 5TBMB 2A24B 3BY9A 4HHDA 3H9WA 1UWPX 4HNBA 4WUJA 5AVFA 5TBMA 5IS1A 4YWZA 2L1MA 1T1CA 2VV8A 4EXOA 2V0WA 4R3AA 3VOLA 2YKHA 4NXBA 5J3WA 4BBVA 4HP4A 5I5LA 3UB9A 4HJ4A 4HJ6A 1Y28A 2W0NA 4LRXC 4JGOA 5A8BA 1LSWA 4H6JB 5HWVA 4MN5A 4I3JA 3K3DA 2PYPA 4F3LB 3IBRA 3F1PB 1KOUA 2QJ5A 1XJ2A 1ODVA 1JNUA 1LT0A 3C8CA 3F1NB 4KUKA 3A0VA 4NXEA 1DP9A 1NWZA 4XT2B 2WKPA 2Z6DA 5HSQA 2V9AA 4H6JA 3F1OA 3UB7A 1S4SA 1UWNX 2K7SA 3IS2B 1LSVA 4LRYC 4DJ2A 4HQAA 2PYRA 4R38A 1T19A 4R70A 2QWSA 3H82A 2QHKA 3LICA 3EEHA 5AVEA 4HOIA 1N9LA 1S1YA 5EFWA 1BYWA 4MN6A 4I39A 4XT2A 3SW1A 3BWLA 4GHIA 3MXQA 3MQOA 2V1BA 1D7EA 4L9GA 1XJ3A 1VB6A 4EESA 3E4PA 5HWWA 3GECA 5F6AA 3ICYA 2OOLA 2W27A 1UGUA 2PDRA 5HDSA 3UB8A 4E04A 1OTBA 3H82B 3HJIA 2ZOIA 5DJUA 1LL8A 5J4EA 4L9FA 1DP8A 1N9NA 1S4RA 1V9ZA 3IS2A 3LI8A 3NOTC 3T50A 4BBTA 2ZOHA 4L9EA 4DJ3A 4EEPA 1D06A 2PR6A 4I3IA 1TS6A 4JGRA 5HZHA 3KX0X 3ULFA 5KIZA 1OTEA 1S67L 1GSVA 2VEAA 2PR5A 3NOPC 4HY8A 4I38A 3UMDA 4EW7A 1OJGA 4I5SA 1GSXA 2J80A 1F98A 1OTAA 2H28A 1GSWA 3RH8B 3NJAA 2A24A 4RQ9A 5G4YA 3MFXA 1OT6A 3CLOA 3FG8A 4HJ3A 1T1AA 3F1PA 1V9YA 2D02A 3NOUC 4JGQA 4R6LA 2L0WA 2R78A 3CWFA 3D72A 4HI4A 2D01A 3C2WA 3G6OA 2OWJA 4GW9A 4HH3A 4JGPA 4EEUA 1XJ6A 4KUOA 1OT9A 5HD3A 1S66L 2JHEA 3VE3A 4LLOB 5J7EA 2M1CA 5DKKA 3MQQA 1LSXA 2PHYA 2BASA 2VLGA 2P7JA 3A0SA 3UMEA 3F1NA 5HWTA 2GJ3A 3LIFA 3ZQ5A 2VV7A 4K08A 4EETB 2YKFA 3E4OA 4WLAA 4KQDA 3K3CA 1P0ZA 2PD7A 2Z6CA 3F1OB 2PD8A 1T1BA 1OJ5A 3UB6A 1XFNA 4I3AA 1DP6A 3LIDA 5DJTA 2VV6A 5HDCA 3RTYA 4EQ1A 1DRMA 1TS0A 3LI9A 4HH2A 3HJKA 4HP9A 1MZUA 1EW0A 1XJ4A 5IU1A 2B02A 3VE4A 3MJQA 4F3LA 3A0RA 3FC7A 3P7NA 4WN5A 1T18A 3PHYA 5F68A 2HV1A 1N9OA 4GHIB 4PKYG 2ZBBA 5F5YA 1G28A 5HDDA 1TS8A 3MR0A 2JN7A 1P97A
chains in the Genus database with same CATH superfamily
1WA9A 2HDSA 4XUZA 4S2IA 3U4LP 2EXBA 5DTSA 3EQVA 4OP5A 1ZHHB 5G4ZA 4Y7PA 3KO6A 2WK0A 3R4KA 4C6YA 2EA9A 4BBUA 5KSHA 2H10A 5F69A 4C3QA 1YLTA 1ZG4A 1Q2PA 1K54A 4B4ZA 4WZ5C 5HD5A 4U3TA 5KSCA 4WUJA 5TBMA 3T4OA 2HP6A 5FEGA 4NXBA 2Y2MA 3UB9A 5A8BA 4JGOA 4CLCD 2HJ9C 2VGKA 2Y2OA 3FWLA 1CEFA 3NI9A 3VSKA 2QJ5A 3LCEA 1DP9A 2ZL1B 3C4PA 4MMNA 4LFUA 4LRYC 5E43A 4MN6A 4I39A 3LEZA 2K31A 3MXQA 5K5BA 3WS0A 3ICYA 3DWKA 4CJNA 1D06A 4MNRA 2ZQDA 1PYYA 3LY4A 3DTKA 5CHMA 2GZAA 2WZZA 1WYBA 3DTMA 4GZBA 1MWUA 2Y59A 3ITBA 2A24A 4BD1A 2FFFB 4IUHA 4S2LA 4KZ8A 1TEMA 4Z1WA 5M1AA 3NCKA 3VE3A 4R4SA 5DKKA 2WKEA 2G2UA 3KYQA 4K08A 1F2KA 2ZM8A 2Z2MB 3CITA 4MDZA 4D60A 4Y13A 1KGGA 4P87A 4S2MA 3SH9A 3FC7A 1KE4A 2A2LA 4PM8A 2HZ5A 1S6RA 1PWDA 4NKPA 4KZ4A 4JXGA 1FQGA 1XFQA 3KSHA 1P9WA 3H7WB 4N1HA 3BFEA 4WF0A 3VFHA 3LIBA 1H3QA 5AVFA 2VGJA 2OLUA 2IWBA 4ETZA 1XGJA 5EUAA 4H6JB 2J9OA 4EV4A 2X02A 2W1RA 5DVAA 1W63M 2VK3A 3MBZA 5JYOA 1Y54A 1T19A 4QY5A 1BYWA 5FSRA 5FQKA 4L9GA 3CJMA 2JKFA 5F6AA 3SH7A 3FPWA 2JBFA 1FR6A 4S2KA 1BLSA 2WYXA 4Y3IA 3KX0X 3ULFA 5EM0A 4KQQA 5LBRA 3Q07A 1MKIA 3LR4A 1STZA 1YMXA 3FG8A 1L3LA 4BLMA 4X68A 3MXRA 2J3TC 3G6OA 4E3OA 2O9AA 3NDGA 3MQQA 2BASA 5DTTA 1Z6FA 4IJGA 3VOZA 2EWVA 5FI2A 4FTXA 5FASA 2HP9A 3RTYA 2NUPC 4F3LA 3K2NA 1T18A 3N7WA 3ZNYA 4U0XA 4IHQA 5CEBA 4NXFA 3HCYA 4EERA 4DE1A 4WM9A 4M3KA 1OTDA 3DW0A 4DRTA 4QWOA 2OAQ1 1Q2QA 3LYXA 2KX6A 4HHDA 4UA7A 3ZG0A 3M2KA 2YKHA 3EGDC 5HW3A 4LRXC 3T1SA 2OV5A 3EQUA 3VFFA 1WYCA 1CK3A 1IOUA 2EFUA 1YSPA 2WKPA 3F1OA 3MQ0A 2K7SA 3T4QA 4R70A 4G3VA 3EEHA 1N9LA 4DXBA 4XT2A 4JF6A 3GVBA 3IF6B 3BQAA 5HDSA 3UB8A 3VOYA 5I94A 1DP8A 3G2ZA 3NOTC 5EVIC 4OP8A 3V3SA 4UA9A 2KLIA 3GV9A 5C5KA 5D3OA 4FOFA 2C6WB 3OC2A 3MFXA 5CX7A 1K6SA 2ZLYA 4CPKA 3D72A 1K57A 2O9CA 5CRFA 5HPIA 4N1XA 3F1NA 2QZ6A 1CEGA 2BG1A 1OJ5A 1DRMA 4X69A 3UDXA 3VP0A 1XJ4A 1EW0A 2VZWA 2B02A 4H8RA 3ITAA 1L0GA 3PHYA 1K55C 4PKYG 3ISGA 3IS2A 4MLLA 4LPZA 1H0MA 1PFLA 2Q9MA 1YM1A 4PM5A 1OTIA 4EBNA 2HPBA 3KSGA 3AGFA 1KVLA 4GS9B 3HLEA 3FYZA 3NIAA 2QJ7A 2V8FA 3NDEA 4EQIA 3NC8A 2NUTC 5FAPA 3H9WA 3C4OA 4GD6A 4OH0A 1Y28A 5HWVA 1ZKJA 3O86A 1PZOA 2Y2QA 2ZMVA 4IEDA 4XUXA 4MCWA 1JNUA 3QP2A 1P9RA 4OKPA 4R3JA 2PYRA 3IWIA 3P09A 5EFWA 1NLZA 3IF6A 3OBFA 3SZTA 1YMSA 3GECA 2W27A 1UGUA 4DKIA 5E2HA 4NK3A 5HAQA 1A0KA 4L9EA 2EX9A 2XR0A 5J8XA 1K54C 2K2NA 5GLDA 1OJGA 1E3UA 1GSXA 4WMCD 4ETXA 4KZ3A 2XDMA 4X6TA 4PMAA 5G4YA 3AGEA 3CLOA 2W3HA 1T1AA 4O8GA 4KZAA 4GW9A 2H0YA 4KUOA 1J3WA 1JTGA 2IWDA 2WADA 3HLBA 2EXAA 4EETB 2YKFA 4ZDXA 2PD7A 3T4KA 3S7PA 3ZCZA 3UB6A 4EQ1A 3VP3A 2WKIA 3MZFA 3WS1A 3HLFA 5FA7A 2ZQAA 3T4SA 4R1GA 2ZBBA 4JXVA 1K4FA 2JN7A 1GSVA 1P97A 3OLOA 2I9VA 1NY0A 4N9KA 2KDKA 4B9OA 3GRJA 4QPRA 2ZQ8A 5TBMB 5KZHA 1JWPA 4EXOA 2V0WA 4BBVA 1ES2A 3E98A 5HL6A 4RX3A 3VP2A 2B18A 5EVIA 4ZJ1A 4DE3A 4ESPA 5DFXA 2J7VA 3IT9A 4R38A 3IHBA 3MZEA 4HOIA 1PW1A 2JCHA 2V1BA 1VB6A 4CLCB 2HP5A 3H82B 3SS3A 3PTEA 4S2PA 5J4EA 2XROA 3EGXC 4O0PA 3OPHA 3B42A 1J9MA 5FDSA 2EFXA 3IXDA 3A3JA 3BJNA 2ZM2A 4PAUA 2G2WA 3BLSA 1KE0A 3ZDJA 4QHCA 2L0WA 5TJJA 3C2WA 4NEED 3UPPA 3V3RA 4BWIA 3S4XA 5FEFA 2WAEA 3PXPA 4PPRA 3FKVA 3IWQA 1XFNA 5AQ9A 2OLVA 1NZUA 1MY8A 5M18A 1MZUA 1L0DA 1K4EA 3RJUA 2OWHA 2QKPA 3MKEA 2V1ZA 1XGIA 3N8RA 4OPZA 3OOVA 1LI9A 4DE2A 2RCXA 2EX2A 2WAFA 3W4OA 1ZC2A 4X53A 1IEMA 2XEPA 3GDIA 1L0FA 2INWA 3W4QA 2L1MA 1T1CA 5GL9A 1LSWA 4JLFA 4R4RA 1KGEA 4S2JA 1XA7A 1KOUA 4EWFA 5L8MA 1OMEA 4DJ2A 3JVVA 3LICA 5AVEA 2LB9A 4NG2A 3BEBA 4XXRA 4QD4A 1TVFA 1OTBA 5GLBA 1ALQA 4L9FA 3LR0A 4A5RA 4DJ3A 4GNUA 1OTEA 3KSFA 3UMDA 4I5SA 2XH9A 2XF3A 4X1MA 1I5QA 3V39A 1ONHA 4HJ3A 3BFGA 3NOUC 3ZG5A 5CGWA 4HH3A 4JXSA 5AQBA 5EPHA 3A0SA 4ZAMA 1O07A 3BFCA 3TE8A 4GDBA 5FQJA 3LIDA 4QY6A 2HDQA 4HH2A 3QNBA 3SS5A 3QP1A 3IXBA 1TS8A 2ZC5B 5DF9A 2Z2LB 5GHZA 4IBXA 3QNCA 3TOIA 5CXWA 4LRZE 3N4IA 2Y91A 4BQMA 3MSHA 1W7FA 1H8ZA 4E6XA 2HJEA 1K25A 3IH9A 5I5LA 2OAP1 4LV1A 3G2YA 4N92A 5FATA 3IX8A 2XSSA 1FCNA 3UB7A 3QP5A 1UWNX 4WEKA 5E2FA 1GHPA 2QWSA 3T4TA 4U0TA 4JF4A 1KDWA 3CG5A 3UE1A 2ZOIA 1YLYA 3VV4A 3LI8A 1CF0A 1W8QA 2J3WA 2PR6A 4LV3A 1S67L 3NOPC 4KG6A 1OPXA 4RA7A 1VHMA 1OTAA 1GSWA 1OT6A 4HBUA 4GN2A 4HI4A 3CWFA 3N6IA 3HVFA 1VM1A 3GMWA 3LR3A 1GCEA 2PHYA 2P7JA 3G31A 3N8LA 3QP4A 3E4OA 5E2EA 2PRFA 1T1BA 3QP6A 4DDSA 3P7NA 4F94A 1YLJA 1PNEA 2JC7A 4B93A 3HUNA 2Q0OA 4X1LA 3HUMA 3A3IA 3B33A 1AXBA 1SDEA 4GOGA 3HLCA 3SOIA 4GS9A 3E4QA 1X0OA 1XXMA 1XX2A 1F5MA 3IX3A 3PAGA 3U2AA 4FSFA 3BY9A 5IS1A 1VEUA 3VOLA 2W3EA 4HJ6A 2W3FA 4UAAA 2WGWB 4IUKA 4LV2A 2X71A 2XFTA 3OPRA 1EROA 4OPYA 2PBYA 4GHIA 3L7HA 3CPTB 1V9ZA 2ZOHA 2EX8A 3SS4A 2E8IA 4LCMA 4EW7A 3HBRA 2A3UA 4ME4A 3NJAA 1YLZA 4K91A 1YT4A 4OQHA 4JGQA 2D02A 5GLCA 5GHXA 2OWJA 1NXYA 4OQ0A 3LR5A 3C5AA 2PD8A 1ZG6A 3F1OB 5FQMA 5FL3A 4GDNA 3RXWA 2Y4AA 4BENA 2AVXA 5KMWA 4X25A 3MS6A 5GHYA 3ZFZA 1O7EA 2JKTI 1KDSA 4HIAA 1RGZA 3B3XA 3BRMA 5DFYA 2Y79A 2ZM0A 5EOEA 5M19A 1MXOA 1HLUP 3HLWA 3UY6A 3MZDA 3WS5A 4WL9A 1CI9A 5CEDA 2DCFA 1M40A 2DMWA 4UHUA 3UN7A 1VEUB 3BLMA 4HP4A 2ZC4B 4Y5FA 2Y2PA 3KYEA 4DDYA 4ZJ3A 3F1PB 2V20A 3T1RA 3C8CA 1LT0A 5F5YA 4XT2B 4FH2A 4BD0A 3WRZA 3FV7A 4ID4A 1TD5A 3LY3A 1FOFA 4Y17A 5GLAA 1JVJA 1PRQA 3HLGA 4EESA 1KE3A 2RL3A 2W3DA 1ONGA 3ZVWA 3CPTA 4BMWA 4BBTA 4EUZA 3MXSA 4I3IA 1G6OA 2VGLM 5FAOA 3JVUA 5IHVA 1E4DA 2H28A 1QMEA 3RH8B 2XQZA 1FILA 4RQ9A 5DF7A 5F83A 4D2OA 4X56A 3IH8A 4R6LA 1YPRA 3MF0A 4R3BA 4IVIA 3WWXA 1TDGA 4KZ6A 2B95A 3NBLA 1PZPA 1JWZA 5L10A 2JKGA 4G3KA 5HWTA 3LIFA 4WLAA 2O99A 3K3CA 4Y0UA 4C75A 4Y0TA 3DBAA 4Z9QA 1U60A 4IBRA 4FCFA 1MC0A 3I7JA 3A0RA 4IVKA 5A92A 1HVBA 1GHMA 2X01A 3ZYTA 3OCNA 4PM9A 5CGSA 2JKRI 3G30A 1EI5A 4Q0IA 2WKHA 1S1ZA 4BJPA 3Q82A 4YNRA 1L0EA 2HF6A 3N8SA 2L4RA 1EWZA 4PKYA 3VP4A 3BFDA 1BZAA 4OPRA 1KVMA 2W0NA 5FI6A 5DTKA 1KGFA 2W1TA 5HX9A 2XLNA 2IWCA 4E3LA 4HEFA 4CLCC 3CMZA 3BECA 4HQAA 5EE8A 3DAVA 3IBJA 3UE0A 4WMCA 2WUQA 3FPVA 2ACGA 3S7QA 1I2SA 3JPUA 2XA7M 3HL9A 1W63Q 2J80A 3WS2A 4YFMA 1F98A 2XRNA 3GQZA 1BULA 3ZHHA 1M6KA 2FZ0A 1SKFA 1IYSA 2ZQCA 2D01A 2H5SA 2WGWA 3UMEA 2QPNA 4NETA 4E3MA 5HARA 4R0QA 3NY4A 5EV0A 1IKGA 3MJQA 1VETB 1G6AA 2HV1A 5HDDA 1I2WA 4UA6A 4CLCE 2PBDP 3H7WA 5CHJA 2EX6A 4ZBEA 4M4XA 2VKSA 4KZBA 2XGNA 4DMZA 4LV0A 2BLSA 1SKOA 1BLPA 5DKLA 2Y8HA 5CHUA 1ES5A 1ES3A 4YWZA 3UDFA 4PM6A 1NRJA 2IA2A 4PHTA 4AFIA 2JKTM 3IHAA 4E3NA 3K3DA 5TFQA 2PYPA 1HTZA 4GJ4A 5JYPA 2V2FF 4FH4A 4NXEA 3GTCA 3PBRA 2Z6DA 3CUEC 3O3VA 3EEAA 2XD1A 3IF5A 3IS2B 3A3DA 4CLCA 1K0KA 4LGWA 3UDIA 1E25A 3MQOA 1XJ3A 1PI4A 1NYMA 3LFVA 3GR2A 1N9NA 2Y2HA 2ZC7A 3PBNA 1L2SA 2Y2NA 1TS6A 3C7VA 3DTIA 3VMAA 1NJ4A 1K55A 4HY8A 5FAQA 1BT5A 3G35A 5EVEA 5L07A 3M2JA 3Q7ZA 3PBQA 1MWSA 2V8CA 3BFFA 3E2LA 5FQQA 2P08A 4WEJA 3LGOA 3UE3A 2JE5A 1WE4A 5FI7A 2GJ3A 3ZQ5A 2VV7A 1LHYA 1P0ZA 1SZVA 4OPQA 5DJTA 3LI9A 5IU1A 1YLPA 4P6ZS 3PYPA 3OCLA 1RP5A 2VX8A 2V1AA 1F9IA 4QB8A 2LB5A 2WKRA 3V67A 5CTNA 1HZOA 5CECA 4E3KA 1PI5A 1ACFA 4YINA 4QU3A 2A24B 4GD8A 3W8KA 4JXWA 5J3WA 4HJ4A 2JKRM 4GKUA 1IFQA 3M6BA 3O5YA 4MN5A 4I3JA 2J8YA 4L0LA 3IBRA 2HDUA 3ZVTA 4KUKA 3C30A 5HSQA 2V9AA 4H6JA 4LENA 1S4SA 4EBLA 2VA0A 4P6ZM 2C5WB 2ZMFA 1S1YA 3S1YA 3GSGA 2QYBA 1PWCA 5G18A 4E04A 4E3JA 1LL5A 5EECA 3UPOA 2VJWA 1G68A 1MPLA 3PBOA 3T50A 1K6RA 3V50A 4QJGA 4JGRA 3E0YA 3FZCA 2PR5A 5EVIB 3ZGAB 1SHVA 3V5MA 4GB7A 2R78A 1IYPA 5HL1A 5FQIA 2UWXA 1XA1A 2J9PA 2M1CA 3MMHA 3BM6A 2J3TD 3OZHA 3PBTA 5A93A 4OOLA 3TW8A 3CUEA 2Y2GA 4JF5A 5E2GA 3RXXA 3S7OA 2ZMAA 2ZD8A 5F68A 2HGVA 3LEQA 5L09A 3QP8A 3LO7A 3UNWA 2BTFP 3A3EA 4GCZA 4ARZB 1TDLA 3LUQA 5A91A 4BL2A 3EWKA 1FSWA 1Y4OA 3T4JA 1DJBA 4OVDA 4EBPA 4KQOA 4BL3A 5FQ9A 3T4LA 4Q0JA 3BYDA 3OPPA 3W2ZA 4DF6A 1MWTA 4F3LB 3Q1FA 2WZXA 1DJAA 4FUWA 3A0VA 3CZDA 1K56A 2O0YA 2ZL1A 3T1QB 2P04A 2E8JA 4WELA 1VETA 3BW6A 1D7EA 1W79A 1JWVA 2Q9NA 4X55A 1S4RA 4B4XA 2CC1A 5HZHA 1SCWA 4I38A 1FCMA 1BUEA 3KYZA 3IQAA 1DY6A 5AQ7A 3IWOA 4EUVA 1LI0A 4KZ9A 4WBGA 4KG2A 1OT9A 3HUOA 1S66L 1C3BA 4LLOB 2XD5A 1N4OA 3PBSA 4B88A 1IKIA 3IX4A 2Z6CA 4P85A 5TR7A 1HD8A 1ZTUA 3UPNA 2PU2A 1N9OA 4GHIB 4DXCA 4RVAA 4Y2FA 1BTLA 2WKQA 4UEYA 2WGVA 2UV0E 3PAEA 2M7VA 1QMFA 4HNBA 3ZG9B 1DJCA 3S22A 3R7WA 3Q81A 5MC7A 1D1JA 2PU4A 2PAVP 2W1TB 4MBKA 4OQIA 1XJ2A 3F1NB 2QMIA 1S0WA 5EOOA 2ZC3B 1BSGA 2G7UA 3H82A 3HLDA 4OONA 4O7DA 5U47A 5CGXA 2PDRA 1SDNA 5DJUA 2P9VB 1LL8A 1NLYA 5A90A 1W8YA 3Q7VA 1LL9A 2VEAA 3W4PA 1BLHA 4MEZA 3NECA 5DF8A 3C38A 1G5UA 4JGPA 4PM7A 2W3GA 3PR6A 1LSXA 4OQGA 4E6WA 1XKZA 3TRCA 1NYYA 3O88A 5HDCA 1DP6A 1FR1A 4HP9A 4UQIM 1PWGA 2EWWA 2Y2LA 4OLGA 1ERQA 4JBFA 1ESUA 3TSGA 4S2NA 4DE0A 3WS4A 3BQ8A 4R23A 3NHQA 1YQSA 2M7UA 3TJZC 4RYEA 5L2FA 3LIEA 1XP4A 4NXGA 3UE6A 1TS7A 2GX5A 3L9KA 1CI8A 1YLWA 2A49A 2O9BA 3BY8A 3A3FA 4MBHA 4RX2A 2Y2IA 3TG9A 3CI6A 3R7WB 1K56D 3O87A 4R3AA 3D3OA 1IYOA 1IELA 1K57C 1PIOA 3P98A 3JYIA 2VGLS 3D9YA 4WZ4A 3MFDA 3G4PA 1E3UD 1LSVA 4FD8A 1LLBA 2R9XA 5EVID 2QHKA 1NZOA 2R9WA 3DWZA 3SW1A 5TGFA 5F1FA 1FSYA 1ES4A 4LCLA 4MBFA 2P9VA 4K0WA 3HJIA 2PT7A 2KOIA 2ZQ9A 3Q7VB 1IYQA 4S2OA 4ARZA 4ZTKA 1BLCA 1N9BA 4GLQA 4JPMA 4JKTA 5HAPA 2WGIA 4UQIS 4HBTA 4G3WA 1V9YA 5AQAA 4EU0A 5HAIA 5FDHA 2OSUA 1YSQA 4EEUA 3IF6C 3VP1A 2JHEA 5EVLA 2ZJ9A 3D4FA 1FCOA 4KQRA 2Y55A 3G34A 3WRTA 3M6HA 4Y15A 5HFOA 3IXHA 3ZNTA 1TS0A 3HJKA 1GHIA 3VE4A 2Y2JA 3T1XA 4HESA 1Z09A 4KENB 3MKFA 4KZ7A 4S2NC 3RFBA 1GA0A 3LIAA 3IXGA 4Y0OA 4N9LA 4Q8IA 3CAXA 1K38A 5F82A 4OLDA 3ZG7B 2MJ6A 2V0UA 4E3IA 2P74A 2CMNA 3UO9A 3S7NA 2I72A 1MKMA 3VSLA 4K0XA 1TF1A 4OOMA 1H8MA 2GDNA 1UWPX 3QHYA 2VV8A 1FIKA 1MWRA 1YAXA 3CHWP 4KG5A 5IT5A 2FFYA 2XFSA 4YOFA 5CERA 2B5RA 4WZ5A 2GNXA 5BOHA 1ODVA 3KSIA 1NWZA 1ERMA 1NRFA 1XPBA 1RCJA 3NULA 3G32A 1ESIA 5CTMA 5F1GA 4OOYA 1H5XA 4ZJ2A 1YKDA 1W5DA 3BWLA 3E2KA 4P6BA 5EM1A 3C7UA 2ZQ7A 1AWIA 3E4PA 4MN7A 5HWWA 4O01A 1H8YA 2OOLA 2ZC6B 3DTEA 3OPLA 1MBLA 4Q0HA 4EEPA 1GA9A 2HDRA 3ZG8B 5KIZA 4DN0A 1CJFA 3EOIA 4P0MA 1SKOB 1RGYA 3B47A 3T12B 5AJGA 3FKWA 2H0TA 5HPFA 2DNSA 3F1PA 4CQHA 1XJ6A 4II7A 2XA7S 5HD3A 5J7EA 3AGDA 2Y2KA 2VLGA 4ZRRA 4KQDA 4WYYA 1VQQA 4I3AA 2VV6A 2FH5A 1CQAA 4KZ5A 1JTDA 4WN5A 3HREA 3UB5P 2DRWA 3P01A 2XK1A 1G28A 3SH8A 1PW8A 3MR0A
chains in the Genus database with same CATH topology
1WA9A 2JKTI 3EQVA 3OLOA 1ZHHB 2I9VA 4HIAA 5G4ZA 3KO6A 3R4KA 2EA9A 2Y79A 5DFYA 4BBUA 4GCZA 5KSHA 5F69A 2KDKA 4ARZB 4B9OA 4WL9A 4QPRA 3LUQA 5HD5A 3EWKA 5TBMB 2DMWA 4WUJA 5TBMA 3T4OA 3T4JA 4EXOA 2V0WA 4KQOA 4NXBA 4BBVA 3T4LA 4HP4A 3UB9A 3E98A 4Q0JA 5HL6A 5A8BA 4JGOA 4Y5FA 4CLCD 2B18A 2HJ9C 3W2ZA 4F3LB 3F1PB 2QJ5A 3C8CA 1LT0A 5F5YA 3A0VA 4XT2B 1DP9A 5DFXA 4MMNA 2O0YA 2P04A 4WELA 4LRYC 4R38A 1TD5A 3BW6A 4HOIA 4MN6A 4I39A 2K31A 3MXQA 5K5BA 2V1BA 1D7EA 4EESA 1VB6A 2W3DA 3ICYA 4CLCB 4BMWA 3H82B 5J4EA 2XROA 1S4RA 4BBTA 1D06A 4I3IA 3EGXC 4O0PA 1G6OA 5HZHA 2VGLM 3B42A 4I38A 3JVUA 2GZAA 3KYZA 3BJNA 2H28A 3RH8B 4PAUA 2A24A 4RQ9A 4IUHA 4EUVA 4R6LA 3MF0A 2L0WA 5TJJA 3C2WA 4NEED 4Z1WA 4BWIA 1OT9A 1S66L 3VE3A 4LLOB 5DKKA 3PBSA 4G3KA 3KYQA 5HWTA 3LIFA 3PXPA 4K08A 4WLAA 2O99A 3K3CA 2Z6CA 3CITA 4MDZA 1XFNA 3DBAA 1MC0A 1ZTUA 1MZUA 3A0RA 3FC7A 1N9OA 2A2LA 4GHIB 3ZYTA 3OCNA 2OWHA 2QKPA 4NKPA 2JKRI 4Q0IA 4Y2FA 1XFQA 1S1ZA 3OOVA 3KSHA 2WKQA 4UEYA 4BJPA 4YNRA 1P9WA 2HF6A 3H7WB 4WF0A 3GDIA 2INWA 2L4RA 3LIBA 4PKYA 2M7VA 1H3QA 5AVFA 4HNBA 3R7WA 2L1MA 1T1CA 4ETZA 5MC7A 2W0NA 1LSWA 4H6JB 2W1TB 2W1RA 2W1TA 1KOUA 1XJ2A 3F1NB 1W63M 4CLCC 5L8MA 4DJ2A 3JVVA 4HQAA 1T19A 2G7UA 3H82A 3LICA 5AVEA 2LB9A 1BYWA 3IBJA 4L9GA 3FPVA 5F6AA 2PDRA 3FPWA 1OTBA 5DJUA 1LL8A 4L9FA 1NLYA 3S7QA 3LR0A 4DJ3A 4Y3IA 3KX0X 3ULFA 2XA7M 1OTEA 3KSFA 2VEAA 3UMDA 4I5SA 1W63Q 2J80A 5LBRA 1F98A 2XRNA 3LR4A 1STZA 2FZ0A 3FG8A 4HJ3A 3NOUC 3C38A 2J3TC 2D01A 3G6OA 4JGPA 4HH3A 2W3GA 2O9AA 3PR6A 3MQQA 1LSXA 2BASA 3A0SA 3UMEA 4IJGA 2EWVA 3TE8A 3TRCA 5HDCA 1DP6A 3LIDA 3RTYA 4HH2A 4HP9A 4UQIM 2EWWA 2NUPC 4F3LA 3MJQA 3K2NA 1T18A 2HV1A 5HDDA 1TS8A 4CLCE 4IHQA 3BQ8A 4NXFA 3TJZC 3NHQA 5DF9A 2M7UA 3H7WA 3LIEA 3HCYA 4EERA 4M4XA 4NXGA 3UE6A 2VKSA 1OTDA 1TS7A 2GX5A 4LRZE 2O9BA 3BY8A 1P97A 4DMZA 2OAQ1 3LYXA 3CI6A 2KX6A 5DKLA 4HHDA 2Y8HA 3R7WB 4YWZA 2HJEA 4R3AA 2YKHA 3D3OA 3EGDC 1NRJA 2IA2A 4PHTA 2OAP1 4LRXC 5I5LA 4AFIA 2JKTM 3K3DA 3EQUA 2PYPA 2VGLS 4GJ4A 2XSSA 1IOUA 4NXEA 1YSPA 3PBRA 2WKPA 2Z6DA 3CUEC 3EEAA 3UB7A 3F1OA 3MQ0A 1UWNX 3IS2B 2K7SA 4WEKA 1LSVA 4CLCA 3T4QA 4R70A 2QWSA 4G3VA 2QHKA 3EEHA 3T4TA 1N9LA 4XT2A 3SW1A 3MQOA 1XJ3A 3BQAA 5HDSA 3UB8A 3HJIA 2ZOIA 3LFVA 1DP8A 1N9NA 3LI8A 3NOTC 2PT7A 3VV4A 2KOIA 3PBNA 2J3WA 2PR6A 1TS6A 2KLIA 4ARZA 1S67L 3NOPC 1OPXA 4HY8A 4GLQA 5C5KA 1VHMA 1OTAA 1GSWA 4FOFA 3OC2A 3MFXA 5CX7A 4UQIS 1OT6A 3PBQA 4G3WA 1V9YA 4EU0A 3D72A 3CWFA 4HI4A 1YSQA 4EEUA 2O9CA 2P08A 4WEJA 5HPIA 2JHEA 3UE3A 3LR3A 2PHYA 2P7JA 3F1NA 2GJ3A 3ZQ5A 2VV7A 3E4OA 1P0ZA 1T1BA 1OJ5A 5DJTA 1DRMA 1TS0A 3LI9A 3HJKA 1XJ4A 1EW0A 2VZWA 5IU1A 2B02A 3VE4A 3P7NA 3PHYA 4PKYG 3IS2A 4P6ZS 3RFBA 3PYPA 4LPZA 4B93A 3LIAA 3OCLA 3B33A 3CAXA 1OTIA 2VX8A 2MJ6A 2V0UA 3KSGA 2V1AA 4GS9A 1F9IA 1X0OA 2CMNA 3E4QA 4GS9B 3S7NA 2LB5A 2WKRA 3V67A 1F5MA 1MKMA 2QJ7A 1TF1A 3U2AA 4FSFA 4OOMA 2NUTC 1H8MA 2A24B 3BY9A 3H9WA 1UWPX 5IS1A 2VV8A 3VOLA 1YAXA 5J3WA 5IT5A 2W3EA 4HJ4A 4HJ6A 1Y28A 2JKRM 2W3FA 4YOFA 5HWVA 1IFQA 4MN5A 3O5YA 4I3JA 2GNXA 4L0LA 4IUKA 3IBRA 2ZMVA 4MCWA 1ODVA 3KSIA 1JNUA 4KUKA 3C30A 5HSQA 1NWZA 2V9AA 1P9RA 4H6JA 1S4SA 2PYRA 2VA0A 4P6ZM 2ZMFA 5EFWA 1S1YA 1YKDA 3BWLA 4GHIA 1NLZA 2QYBA 3OBFA 4MN7A 3E4PA 5HWWA 4O01A 3GECA 2OOLA 2W27A 1UGUA 4E04A 2VJWA 4Q0HA 3PBOA 1V9ZA 3T50A 2ZOHA 4L9EA 4EEPA 2K2NA 4JGRA 3E0YA 5KIZA 4DN0A 2PR5A 4EW7A 3EOIA 1OJGA 1GSXA 4ME4A 4ETXA 3NJAA 3B47A 5G4YA 5AJGA 3CLOA 2W3HA 5HPFA 1T1AA 3F1PA 4JGQA 2D02A 4CQHA 2R78A 4O8GA 2OWJA 4GW9A 1XJ6A 4KUOA 4II7A 2XA7S 5HD3A 5J7EA 2M1CA 3MMHA 2VLGA 4ZRRA 4EETB 2YKFA 2J3TD 3LR5A 4KQDA 2PD7A 3PBTA 3F1OB 2PD8A 4OOLA 3TW8A 3T4KA 3S7PA 3CUEA 3UB6A 4I3AA 4EQ1A 2VV6A 5FL3A 2FH5A 3S7OA 4WN5A 5F68A 2HGVA 3T4SA 3P01A 2ZBBA 1G28A 3MR0A 2JN7A 1GSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA9 A;  3PYP A;  4LPZ A;  4NXF A;  2OWH A;  2QKP A;  3LIA A;  3NHQ A;  3H7W A;  3B33 A;  3LIE A;  3OLO A;  4EER A;  3CAX A;  1OTI A;  2I9V A;  1XFQ A;  1S1Z A;  4HIA A;  4M4X A;  2V0U A;  4NXG A;  5G4Z A;  3UE6 A;  1OTD A;  2V1A A;  2WKQ A;  1F9I A;  1TS7 A;  1X0O A;  2CMN A;  2EA9 A;  3E4Q A;  4GS9 B;  4GS9 A;  4GCZ A;  2WKR A;  5F69 A;  4BBU A;  2KDK A;  4LRZ E;  3BY8 A;  4B9O A;  2QJ7 A;  3H7W B;  4WL9 A;  4WF0 A;  3GDI A;  2INW A;  2L4R A;  3LIB A;  3LUQ A;  3LYX A;  4PKY A;  3EWK A;  2KX6 A;  5DKL A;  5HD5 A;  5TBM B;  2A24 B;  3BY9 A;  4HHD A;  3H9W A;  1UWP X;  4HNB A;  4WUJ A;  5AVF A;  5TBM A;  5IS1 A;  4YWZ A;  2L1M A;  1T1C A;  2VV8 A;  4EXO A;  2V0W A;  4R3A A;  3VOL A;  2YKH A;  4NXB A;  5J3W A;  4BBV A;  4HP4 A;  5I5L A;  3UB9 A;  4HJ4 A;  4HJ6 A;  1Y28 A;  2W0N A;  4LRX C;  4JGO A;  5A8B A;  1LSW A;  4H6J B;  5HWV A;  4MN5 A;  4I3J A;  3K3D A;  2PYP A;  4F3L B;  3IBR A;  3F1P B;  1KOU A;  2QJ5 A;  1XJ2 A;  1ODV A;  1JNU A;  1LT0 A;  3C8C A;  3F1N B;  4KUK A;  3A0V A;  4NXE A;  1DP9 A;  1NWZ A;  4XT2 B;  2WKP A;  2Z6D A;  5HSQ A;  2V9A A;  4H6J A;  3F1O A;  3UB7 A;  1S4S A;  1UWN X;  2K7S A;  3IS2 B;  1LSV A;  4LRY C;  4DJ2 A;  4HQA A;  2PYR A;  4R38 A;  1T19 A;  4R70 A;  2QWS A;  3H82 A;  2QHK A;  3LIC A;  3EEH A;  5AVE A;  4HOI A;  1N9L A;  1S1Y A;  5EFW A;  1BYW A;  4MN6 A;  4I39 A;  4XT2 A;  3SW1 A;  3BWL A;  4GHI A;  3MXQ A;  3MQO A;  2V1B A;  1D7E A;  4L9G A;  1XJ3 A;  1VB6 A;  4EES A;  3E4P A;  5HWW A;  3GEC A;  5F6A A;  3ICY A;  2OOL A;  2W27 A;  1UGU A;  2PDR A;  5HDS A;  3UB8 A;  4E04 A;  1OTB A;  3H82 B;  3HJI A;  2ZOI A;  5DJU A;  1LL8 A;  5J4E A;  4L9F A;  1DP8 A;  1N9N A;  1S4R A;  1V9Z A;  3IS2 A;  3LI8 A;  3NOT C;  3T50 A;  4BBT A;  2ZOH A;  4L9E A;  4DJ3 A;  4EEP A;  1D06 A;  2PR6 A;  4I3I A;  1TS6 A;  4JGR A;  5HZH A;  3KX0 X;  3ULF A;  5KIZ A;  1OTE A;  1S67 L;  1GSV A;  2VEA A;  2PR5 A;  3NOP C;  4HY8 A;  4I38 A;  3UMD A;  4EW7 A;  1OJG A;  4I5S A;  1GSX A;  2J80 A;  1F98 A;  1OTA A;  2H28 A;  1GSW A;  3RH8 B;  3NJA A;  2A24 A;  4RQ9 A;  5G4Y A;  3MFX A;  1OT6 A;  3CLO A;  3FG8 A;  4HJ3 A;  1T1A A;  3F1P A;  1V9Y A;  2D02 A;  3NOU C;  4JGQ A;  4R6L A;  2L0W A;  2R78 A;  3CWF A;  3D72 A;  4HI4 A;  2D01 A;  3C2W A;  3G6O A;  2OWJ A;  4GW9 A;  4HH3 A;  4JGP A;  4EEU A;  1XJ6 A;  4KUO A;  1OT9 A;  5HD3 A;  1S66 L;  2JHE A;  3VE3 A;  4LLO B;  5J7E A;  2M1C A;  5DKK A;  3MQQ A;  1LSX A;  2PHY A;  2BAS A;  2VLG A;  2P7J A;  3A0S A;  3UME A;  3F1N A;  5HWT A;  2GJ3 A;  3LIF A;  3ZQ5 A;  2VV7 A;  4K08 A;  4EET B;  2YKF A;  3E4O A;  4WLA A;  4KQD A;  3K3C A;  1P0Z A;  2PD7 A;  2Z6C A;  3F1O B;  2PD8 A;  1T1B A;  1OJ5 A;  3UB6 A;  1XFN A;  4I3A A;  1DP6 A;  3LID A;  5DJT A;  2VV6 A;  5HDC A;  3RTY A;  4EQ1 A;  1DRM A;  1TS0 A;  3LI9 A;  4HH2 A;  3HJK A;  4HP9 A;  1MZU A;  1EW0 A;  1XJ4 A;  5IU1 A;  2B02 A;  3VE4 A;  3MJQ A;  4F3L A;  3A0R A;  3FC7 A;  3P7N A;  4WN5 A;  1T18 A;  3PHY A;  5F68 A;  2HV1 A;  1N9O A;  4GHI B;  4PKY G;  2ZBB A;  5F5Y A;  1G28 A;  5HDD A;  1TS8 A;  3MR0 A;  2JN7 A;  1P97 A; 
#chains in the Genus database with same CATH topology
 1WA9 A;  2HDS A;  4XUZ A;  4S2I A;  3U4L P;  2EXB A;  5DTS A;  3EQV A;  4OP5 A;  1ZHH B;  5G4Z A;  4Y7P A;  3KO6 A;  2WK0 A;  3R4K A;  4C6Y A;  2EA9 A;  4BBU A;  5KSH A;  2H10 A;  5F69 A;  4C3Q A;  1YLT A;  1ZG4 A;  1Q2P A;  1K54 A;  4B4Z A;  4WZ5 C;  5HD5 A;  4U3T A;  5KSC A;  4WUJ A;  5TBM A;  3T4O A;  2HP6 A;  5FEG A;  4NXB A;  2Y2M A;  3UB9 A;  5A8B A;  4JGO A;  4CLC D;  2HJ9 C;  2VGK A;  2Y2O A;  3FWL A;  1CEF A;  3NI9 A;  3VSK A;  2QJ5 A;  3LCE A;  1DP9 A;  2ZL1 B;  3C4P A;  4MMN A;  4LFU A;  4LRY C;  5E43 A;  4MN6 A;  4I39 A;  3LEZ A;  2K31 A;  3MXQ A;  5K5B A;  3WS0 A;  3ICY A;  3DWK A;  4CJN A;  1D06 A;  4MNR A;  2ZQD A;  1PYY A;  3LY4 A;  3DTK A;  5CHM A;  2GZA A;  2WZZ A;  1WYB A;  3DTM A;  4GZB A;  1MWU A;  2Y59 A;  3ITB A;  2A24 A;  4BD1 A;  2FFF B;  4IUH A;  4S2L A;  4KZ8 A;  1TEM A;  4Z1W A;  5M1A A;  3NCK A;  3VE3 A;  4R4S A;  5DKK A;  2WKE A;  2G2U A;  3KYQ A;  4K08 A;  1F2K A;  2ZM8 A;  2Z2M B;  3CIT A;  4MDZ A;  4D60 A;  4Y13 A;  1KGG A;  4P87 A;  4S2M A;  3SH9 A;  3FC7 A;  1KE4 A;  2A2L A;  4PM8 A;  2HZ5 A;  1S6R A;  1PWD A;  4NKP A;  4KZ4 A;  4JXG A;  1FQG A;  1XFQ A;  3KSH A;  1P9W A;  3H7W B;  4N1H A;  3BFE A;  4WF0 A;  3VFH A;  3LIB A;  1H3Q A;  5AVF A;  2VGJ A;  2OLU A;  2IWB A;  4ETZ A;  1XGJ A;  5EUA A;  4H6J B;  2J9O A;  4EV4 A;  2X02 A;  2W1R A;  5DVA A;  1W63 M;  2VK3 A;  3MBZ A;  5JYO A;  1Y54 A;  1T19 A;  4QY5 A;  1BYW A;  5FSR A;  5FQK A;  4L9G A;  3CJM A;  2JKF A;  5F6A A;  3SH7 A;  3FPW A;  2JBF A;  1FR6 A;  4S2K A;  1BLS A;  2WYX A;  4Y3I A;  3KX0 X;  3ULF A;  5EM0 A;  4KQQ A;  5LBR A;  3Q07 A;  1MKI A;  3LR4 A;  1STZ A;  1YMX A;  3FG8 A;  1L3L A;  4BLM A;  4X68 A;  3MXR A;  2J3T C;  3G6O A;  4E3O A;  2O9A A;  3NDG A;  3MQQ A;  2BAS A;  5DTT A;  1Z6F A;  4IJG A;  3VOZ A;  2EWV A;  5FI2 A;  4FTX A;  5FAS A;  2HP9 A;  3RTY A;  2NUP C;  4F3L A;  3K2N A;  1T18 A;  3N7W A;  3ZNY A;  4U0X A;  4IHQ A;  5CEB A;  4NXF A;  3HCY A;  4EER A;  4DE1 A;  4WM9 A;  4M3K A;  1OTD A;  3DW0 A;  4DRT A;  4QWO A;  2OAQ 1;  1Q2Q A;  3LYX A;  2KX6 A;  4HHD A;  4UA7 A;  3ZG0 A;  3M2K A;  2YKH A;  3EGD C;  5HW3 A;  4LRX C;  3T1S A;  2OV5 A;  3EQU A;  3VFF A;  1WYC A;  1CK3 A;  1IOU A;  2EFU A;  1YSP A;  2WKP A;  3F1O A;  3MQ0 A;  2K7S A;  3T4Q A;  4R70 A;  4G3V A;  3EEH A;  1N9L A;  4DXB A;  4XT2 A;  4JF6 A;  3GVB A;  3IF6 B;  3BQA A;  5HDS A;  3UB8 A;  3VOY A;  5I94 A;  1DP8 A;  3G2Z A;  3NOT C;  5EVI C;  4OP8 A;  3V3S A;  4UA9 A;  2KLI A;  3GV9 A;  5C5K A;  5D3O A;  4FOF A;  2C6W B;  3OC2 A;  3MFX A;  5CX7 A;  1K6S A;  2ZLY A;  4CPK A;  3D72 A;  1K57 A;  2O9C A;  5CRF A;  5HPI A;  4N1X A;  3F1N A;  2QZ6 A;  1CEG A;  2BG1 A;  1OJ5 A;  1DRM A;  4X69 A;  3UDX A;  3VP0 A;  1XJ4 A;  1EW0 A;  2VZW A;  2B02 A;  4H8R A;  3ITA A;  1L0G A;  3PHY A;  1K55 C;  4PKY G;  3ISG A;  3IS2 A;  4MLL A;  4LPZ A;  1H0M A;  1PFL A;  2Q9M A;  1YM1 A;  4PM5 A;  1OTI A;  4EBN A;  2HPB A;  3KSG A;  3AGF A;  1KVL A;  4GS9 B;  3HLE A;  3FYZ A;  3NIA A;  2QJ7 A;  2V8F A;  3NDE A;  4EQI A;  3NC8 A;  2NUT C;  5FAP A;  3H9W A;  3C4O A;  4GD6 A;  4OH0 A;  1Y28 A;  5HWV A;  1ZKJ A;  3O86 A;  1PZO A;  2Y2Q A;  2ZMV A;  4IED A;  4XUX A;  4MCW A;  1JNU A;  3QP2 A;  1P9R A;  4OKP A;  4R3J A;  2PYR A;  3IWI A;  3P09 A;  5EFW A;  1NLZ A;  3IF6 A;  3OBF A;  3SZT A;  1YMS A;  3GEC A;  2W27 A;  1UGU A;  4DKI A;  5E2H A;  4NK3 A;  5HAQ A;  1A0K A;  4L9E A;  2EX9 A;  2XR0 A;  5J8X A;  1K54 C;  2K2N A;  5GLD A;  1OJG A;  1E3U A;  1GSX A;  4WMC D;  4ETX A;  4KZ3 A;  2XDM A;  4X6T A;  4PMA A;  5G4Y A;  3AGE A;  3CLO A;  2W3H A;  1T1A A;  4O8G A;  4KZA A;  4GW9 A;  2H0Y A;  4KUO A;  1J3W A;  1JTG A;  2IWD A;  2WAD A;  3HLB A;  2EXA A;  4EET B;  2YKF A;  4ZDX A;  2PD7 A;  3T4K A;  3S7P A;  3ZCZ A;  3UB6 A;  4EQ1 A;  3VP3 A;  2WKI A;  3MZF A;  3WS1 A;  3HLF A;  5FA7 A;  2ZQA A;  3T4S A;  4R1G A;  2ZBB A;  4JXV A;  1K4F A;  2JN7 A;  1GSV A;  1P97 A;  3OLO A;  2I9V A;  1NY0 A;  4N9K A;  2KDK A;  4B9O A;  3GRJ A;  4QPR A;  2ZQ8 A;  5TBM B;  5KZH A;  1JWP A;  4EXO A;  2V0W A;  4BBV A;  1ES2 A;  3E98 A;  5HL6 A;  4RX3 A;  3VP2 A;  2B18 A;  5EVI A;  4ZJ1 A;  4DE3 A;  4ESP A;  5DFX A;  2J7V A;  3IT9 A;  4R38 A;  3IHB A;  3MZE A;  4HOI A;  1PW1 A;  2JCH A;  2V1B A;  1VB6 A;  4CLC B;  2HP5 A;  3H82 B;  3SS3 A;  3PTE A;  4S2P A;  5J4E A;  2XRO A;  3EGX C;  4O0P A;  3OPH A;  3B42 A;  1J9M A;  5FDS A;  2EFX A;  3IXD A;  3A3J A;  3BJN A;  2ZM2 A;  4PAU A;  2G2W A;  3BLS A;  1KE0 A;  3ZDJ A;  4QHC A;  2L0W A;  5TJJ A;  3C2W A;  4NEE D;  3UPP A;  3V3R A;  4BWI A;  3S4X A;  5FEF A;  2WAE A;  3PXP A;  4PPR A;  3FKV A;  3IWQ A;  1XFN A;  5AQ9 A;  2OLV A;  1NZU A;  1MY8 A;  5M18 A;  1MZU A;  1L0D A;  1K4E A;  3RJU A;  2OWH A;  2QKP A;  3MKE A;  2V1Z A;  1XGI A;  3N8R A;  4OPZ A;  3OOV A;  1LI9 A;  4DE2 A;  2RCX A;  2EX2 A;  2WAF A;  3W4O A;  1ZC2 A;  4X53 A;  1IEM A;  2XEP A;  3GDI A;  1L0F A;  2INW A;  3W4Q A;  2L1M A;  1T1C A;  5GL9 A;  1LSW A;  4JLF A;  4R4R A;  1KGE A;  4S2J A;  1XA7 A;  1KOU A;  4EWF A;  5L8M A;  1OME A;  4DJ2 A;  3JVV A;  3LIC A;  5AVE A;  2LB9 A;  4NG2 A;  3BEB A;  4XXR A;  4QD4 A;  1TVF A;  1OTB A;  5GLB A;  1ALQ A;  4L9F A;  3LR0 A;  4A5R A;  4DJ3 A;  4GNU A;  1OTE A;  3KSF A;  3UMD A;  4I5S A;  2XH9 A;  2XF3 A;  4X1M A;  1I5Q A;  3V39 A;  1ONH A;  4HJ3 A;  3BFG A;  3NOU C;  3ZG5 A;  5CGW A;  4HH3 A;  4JXS A;  5AQB A;  5EPH A;  3A0S A;  4ZAM A;  1O07 A;  3BFC A;  3TE8 A;  4GDB A;  5FQJ A;  3LID A;  4QY6 A;  2HDQ A;  4HH2 A;  3QNB A;  3SS5 A;  3QP1 A;  3IXB A;  1TS8 A;  2ZC5 B;  5DF9 A;  2Z2L B;  5GHZ A;  4IBX A;  3QNC A;  3TOI A;  5CXW A;  4LRZ E;  3N4I A;  2Y91 A;  4BQM A;  3MSH A;  1W7F A;  1H8Z A;  4E6X A;  2HJE A;  1K25 A;  3IH9 A;  5I5L A;  2OAP 1;  4LV1 A;  3G2Y A;  4N92 A;  5FAT A;  3IX8 A;  2XSS A;  1FCN A;  3UB7 A;  3QP5 A;  1UWN X;  4WEK A;  5E2F A;  1GHP A;  2QWS A;  3T4T A;  4U0T A;  4JF4 A;  1KDW A;  3CG5 A;  3UE1 A;  2ZOI A;  1YLY A;  3VV4 A;  3LI8 A;  1CF0 A;  1W8Q A;  2J3W A;  2PR6 A;  4LV3 A;  1S67 L;  3NOP C;  4KG6 A;  1OPX A;  4RA7 A;  1VHM A;  1OTA A;  1GSW A;  1OT6 A;  4HBU A;  4GN2 A;  4HI4 A;  3CWF A;  3N6I A;  3HVF A;  1VM1 A;  3GMW A;  3LR3 A;  1GCE A;  2PHY A;  2P7J A;  3G31 A;  3N8L A;  3QP4 A;  3E4O A;  5E2E A;  2PRF A;  1T1B A;  3QP6 A;  4DDS A;  3P7N A;  4F94 A;  1YLJ A;  1PNE A;  2JC7 A;  4B93 A;  3HUN A;  2Q0O A;  4X1L A;  3HUM A;  3A3I A;  3B33 A;  1AXB A;  1SDE A;  4GOG A;  3HLC A;  3SOI A;  4GS9 A;  3E4Q A;  1X0O A;  1XXM A;  1XX2 A;  1F5M A;  3IX3 A;  3PAG A;  3U2A A;  4FSF A;  3BY9 A;  5IS1 A;  1VEU A;  3VOL A;  2W3E A;  4HJ6 A;  2W3F A;  4UAA A;  2WGW B;  4IUK A;  4LV2 A;  2X71 A;  2XFT A;  3OPR A;  1ERO A;  4OPY A;  2PBY A;  4GHI A;  3L7H A;  3CPT B;  1V9Z A;  2ZOH A;  2EX8 A;  3SS4 A;  2E8I A;  4LCM A;  4EW7 A;  3HBR A;  2A3U A;  4ME4 A;  3NJA A;  1YLZ A;  4K91 A;  1YT4 A;  4OQH A;  4JGQ A;  2D02 A;  5GLC A;  5GHX A;  2OWJ A;  1NXY A;  4OQ0 A;  3LR5 A;  3C5A A;  2PD8 A;  1ZG6 A;  3F1O B;  5FQM A;  5FL3 A;  4GDN A;  3RXW A;  2Y4A A;  4BEN A;  2AVX A;  5KMW A;  4X25 A;  3MS6 A;  5GHY A;  3ZFZ A;  1O7E A;  2JKT I;  1KDS A;  4HIA A;  1RGZ A;  3B3X A;  3BRM A;  5DFY A;  2Y79 A;  2ZM0 A;  5EOE A;  5M19 A;  1MXO A;  1HLU P;  3HLW A;  3UY6 A;  3MZD A;  3WS5 A;  4WL9 A;  1CI9 A;  5CED A;  2DCF A;  1M40 A;  2DMW A;  4UHU A;  3UN7 A;  1VEU B;  3BLM A;  4HP4 A;  2ZC4 B;  4Y5F A;  2Y2P A;  3KYE A;  4DDY A;  4ZJ3 A;  3F1P B;  2V20 A;  3T1R A;  3C8C A;  1LT0 A;  5F5Y A;  4XT2 B;  4FH2 A;  4BD0 A;  3WRZ A;  3FV7 A;  4ID4 A;  1TD5 A;  3LY3 A;  1FOF A;  4Y17 A;  5GLA A;  1JVJ A;  1PRQ A;  3HLG A;  4EES A;  1KE3 A;  2RL3 A;  2W3D A;  1ONG A;  3ZVW A;  3CPT A;  4BMW A;  4BBT A;  4EUZ A;  3MXS A;  4I3I A;  1G6O A;  2VGL M;  5FAO A;  3JVU A;  5IHV A;  1E4D A;  2H28 A;  1QME A;  3RH8 B;  2XQZ A;  1FIL A;  4RQ9 A;  5DF7 A;  5F83 A;  4D2O A;  4X56 A;  3IH8 A;  4R6L A;  1YPR A;  3MF0 A;  4R3B A;  4IVI A;  3WWX A;  1TDG A;  4KZ6 A;  2B95 A;  3NBL A;  1PZP A;  1JWZ A;  5L10 A;  2JKG A;  4G3K A;  5HWT A;  3LIF A;  4WLA A;  2O99 A;  3K3C A;  4Y0U A;  4C75 A;  4Y0T A;  3DBA A;  4Z9Q A;  1U60 A;  4IBR A;  4FCF A;  1MC0 A;  3I7J A;  3A0R A;  4IVK A;  5A92 A;  1HVB A;  1GHM A;  2X01 A;  3ZYT A;  3OCN A;  4PM9 A;  5CGS A;  2JKR I;  3G30 A;  1EI5 A;  4Q0I A;  2WKH A;  1S1Z A;  4BJP A;  3Q82 A;  4YNR A;  1L0E A;  2HF6 A;  3N8S A;  2L4R A;  1EWZ A;  4PKY A;  3VP4 A;  3BFD A;  1BZA A;  4OPR A;  1KVM A;  2W0N A;  5FI6 A;  5DTK A;  1KGF A;  2W1T A;  5HX9 A;  2XLN A;  2IWC A;  4E3L A;  4HEF A;  4CLC C;  3CMZ A;  3BEC A;  4HQA A;  5EE8 A;  3DAV A;  3IBJ A;  3UE0 A;  4WMC A;  2WUQ A;  3FPV A;  2ACG A;  3S7Q A;  1I2S A;  3JPU A;  2XA7 M;  3HL9 A;  1W63 Q;  2J80 A;  3WS2 A;  4YFM A;  1F98 A;  2XRN A;  3GQZ A;  1BUL A;  3ZHH A;  1M6K A;  2FZ0 A;  1SKF A;  1IYS A;  2ZQC A;  2D01 A;  2H5S A;  2WGW A;  3UME A;  2QPN A;  4NET A;  4E3M A;  5HAR A;  4R0Q A;  3NY4 A;  5EV0 A;  1IKG A;  3MJQ A;  1VET B;  1G6A A;  2HV1 A;  5HDD A;  1I2W A;  4UA6 A;  4CLC E;  2PBD P;  3H7W A;  5CHJ A;  2EX6 A;  4ZBE A;  4M4X A;  2VKS A;  4KZB A;  2XGN A;  4DMZ A;  4LV0 A;  2BLS A;  1SKO A;  1BLP A;  5DKL A;  2Y8H A;  5CHU A;  1ES5 A;  1ES3 A;  4YWZ A;  3UDF A;  4PM6 A;  1NRJ A;  2IA2 A;  4PHT A;  4AFI A;  2JKT M;  3IHA A;  4E3N A;  3K3D A;  5TFQ A;  2PYP A;  1HTZ A;  4GJ4 A;  5JYP A;  2V2F F;  4FH4 A;  4NXE A;  3GTC A;  3PBR A;  2Z6D A;  3CUE C;  3O3V A;  3EEA A;  2XD1 A;  3IF5 A;  3IS2 B;  3A3D A;  4CLC A;  1K0K A;  4LGW A;  3UDI A;  1E25 A;  3MQO A;  1XJ3 A;  1PI4 A;  1NYM A;  3LFV A;  3GR2 A;  1N9N A;  2Y2H A;  2ZC7 A;  3PBN A;  1L2S A;  2Y2N A;  1TS6 A;  3C7V A;  3DTI A;  3VMA A;  1NJ4 A;  1K55 A;  4HY8 A;  5FAQ A;  1BT5 A;  3G35 A;  5EVE A;  5L07 A;  3M2J A;  3Q7Z A;  3PBQ A;  1MWS A;  2V8C A;  3BFF A;  3E2L A;  5FQQ A;  2P08 A;  4WEJ A;  3LGO A;  3UE3 A;  2JE5 A;  1WE4 A;  5FI7 A;  2GJ3 A;  3ZQ5 A;  2VV7 A;  1LHY A;  1P0Z A;  1SZV A;  4OPQ A;  5DJT A;  3LI9 A;  5IU1 A;  1YLP A;  4P6Z S;  3PYP A;  3OCL A;  1RP5 A;  2VX8 A;  2V1A A;  1F9I A;  4QB8 A;  2LB5 A;  2WKR A;  3V67 A;  5CTN A;  1HZO A;  5CEC A;  4E3K A;  1PI5 A;  1ACF A;  4YIN A;  4QU3 A;  2A24 B;  4GD8 A;  3W8K A;  4JXW A;  5J3W A;  4HJ4 A;  2JKR M;  4GKU A;  1IFQ A;  3M6B A;  3O5Y A;  4MN5 A;  4I3J A;  2J8Y A;  4L0L A;  3IBR A;  2HDU A;  3ZVT A;  4KUK A;  3C30 A;  5HSQ A;  2V9A A;  4H6J A;  4LEN A;  1S4S A;  4EBL A;  2VA0 A;  4P6Z M;  2C5W B;  2ZMF A;  1S1Y A;  3S1Y A;  3GSG A;  2QYB A;  1PWC A;  5G18 A;  4E04 A;  4E3J A;  1LL5 A;  5EEC A;  3UPO A;  2VJW A;  1G68 A;  1MPL A;  3PBO A;  3T50 A;  1K6R A;  3V50 A;  4QJG A;  4JGR A;  3E0Y A;  3FZC A;  2PR5 A;  5EVI B;  3ZGA B;  1SHV A;  3V5M A;  4GB7 A;  2R78 A;  1IYP A;  5HL1 A;  5FQI A;  2UWX A;  1XA1 A;  2J9P A;  2M1C A;  3MMH A;  3BM6 A;  2J3T D;  3OZH A;  3PBT A;  5A93 A;  4OOL A;  3TW8 A;  3CUE A;  2Y2G A;  4JF5 A;  5E2G A;  3RXX A;  3S7O A;  2ZMA A;  2ZD8 A;  5F68 A;  2HGV A;  3LEQ A;  5L09 A;  3QP8 A;  3LO7 A;  3UNW A;  2BTF P;  3A3E A;  4GCZ A;  4ARZ B;  1TDL A;  3LUQ A;  5A91 A;  4BL2 A;  3EWK A;  1FSW A;  1Y4O A;  3T4J A;  1DJB A;  4OVD A;  4EBP A;  4KQO A;  4BL3 A;  5FQ9 A;  3T4L A;  4Q0J A;  3BYD A;  3OPP A;  3W2Z A;  4DF6 A;  1MWT A;  4F3L B;  3Q1F A;  2WZX A;  1DJA A;  4FUW A;  3A0V A;  3CZD A;  1K56 A;  2O0Y A;  2ZL1 A;  3T1Q B;  2P04 A;  2E8J A;  4WEL A;  1VET A;  3BW6 A;  1D7E A;  1W79 A;  1JWV A;  2Q9N A;  4X55 A;  1S4R A;  4B4X A;  2CC1 A;  5HZH A;  1SCW A;  4I38 A;  1FCM A;  1BUE A;  3KYZ A;  3IQA A;  1DY6 A;  5AQ7 A;  3IWO A;  4EUV A;  1LI0 A;  4KZ9 A;  4WBG A;  4KG2 A;  1OT9 A;  3HUO A;  1S66 L;  1C3B A;  4LLO B;  2XD5 A;  1N4O A;  3PBS A;  4B88 A;  1IKI A;  3IX4 A;  2Z6C A;  4P85 A;  5TR7 A;  1HD8 A;  1ZTU A;  3UPN A;  2PU2 A;  1N9O A;  4GHI B;  4DXC A;  4RVA A;  4Y2F A;  1BTL A;  2WKQ A;  4UEY A;  2WGV A;  2UV0 E;  3PAE A;  2M7V A;  1QMF A;  4HNB A;  3ZG9 B;  1DJC A;  3S22 A;  3R7W A;  3Q81 A;  5MC7 A;  1D1J A;  2PU4 A;  2PAV P;  2W1T B;  4MBK A;  4OQI A;  1XJ2 A;  3F1N B;  2QMI A;  1S0W A;  5EOO A;  2ZC3 B;  1BSG A;  2G7U A;  3H82 A;  3HLD A;  4OON A;  4O7D A;  5U47 A;  5CGX A;  2PDR A;  1SDN A;  5DJU A;  2P9V B;  1LL8 A;  1NLY A;  5A90 A;  1W8Y A;  3Q7V A;  1LL9 A;  2VEA A;  3W4P A;  1BLH A;  4MEZ A;  3NEC A;  5DF8 A;  3C38 A;  1G5U A;  4JGP A;  4PM7 A;  2W3G A;  3PR6 A;  1LSX A;  4OQG A;  4E6W A;  1XKZ A;  3TRC A;  1NYY A;  3O88 A;  5HDC A;  1DP6 A;  1FR1 A;  4HP9 A;  4UQI M;  1PWG A;  2EWW A;  2Y2L A;  4OLG A;  1ERQ A;  4JBF A;  1ESU A;  3TSG A;  4S2N A;  4DE0 A;  3WS4 A;  3BQ8 A;  4R23 A;  3NHQ A;  1YQS A;  2M7U A;  3TJZ C;  4RYE A;  5L2F A;  3LIE A;  1XP4 A;  4NXG A;  3UE6 A;  1TS7 A;  2GX5 A;  3L9K A;  1CI8 A;  1YLW A;  2A49 A;  2O9B A;  3BY8 A;  3A3F A;  4MBH A;  4RX2 A;  2Y2I A;  3TG9 A;  3CI6 A;  3R7W B;  1K56 D;  3O87 A;  4R3A A;  3D3O A;  1IYO A;  1IEL A;  1K57 C;  1PIO A;  3P98 A;  3JYI A;  2VGL S;  3D9Y A;  4WZ4 A;  3MFD A;  3G4P A;  1E3U D;  1LSV A;  4FD8 A;  1LLB A;  2R9X A;  5EVI D;  2QHK A;  1NZO A;  2R9W A;  3DWZ A;  3SW1 A;  5TGF A;  5F1F A;  1FSY A;  1ES4 A;  4LCL A;  4MBF A;  2P9V A;  4K0W A;  3HJI A;  2PT7 A;  2KOI A;  2ZQ9 A;  3Q7V B;  1IYQ A;  4S2O A;  4ARZ A;  4ZTK A;  1BLC A;  1N9B A;  4GLQ A;  4JPM A;  4JKT A;  5HAP A;  2WGI A;  4UQI S;  4HBT A;  4G3W A;  1V9Y A;  5AQA A;  4EU0 A;  5HAI A;  5FDH A;  2OSU A;  1YSQ A;  4EEU A;  3IF6 C;  3VP1 A;  2JHE A;  5EVL A;  2ZJ9 A;  3D4F A;  1FCO A;  4KQR A;  2Y55 A;  3G34 A;  3WRT A;  3M6H A;  4Y15 A;  5HFO A;  3IXH A;  3ZNT A;  1TS0 A;  3HJK A;  1GHI A;  3VE4 A;  2Y2J A;  3T1X A;  4HES A;  1Z09 A;  4KEN B;  3MKF A;  4KZ7 A;  4S2N C;  3RFB A;  1GA0 A;  3LIA A;  3IXG A;  4Y0O A;  4N9L A;  4Q8I A;  3CAX A;  1K38 A;  5F82 A;  4OLD A;  3ZG7 B;  2MJ6 A;  2V0U A;  4E3I A;  2P74 A;  2CMN A;  3UO9 A;  3S7N A;  2I72 A;  1MKM A;  3VSL A;  4K0X A;  1TF1 A;  4OOM A;  1H8M A;  2GDN A;  1UWP X;  3QHY A;  2VV8 A;  1FIK A;  1MWR A;  1YAX A;  3CHW P;  4KG5 A;  5IT5 A;  2FFY A;  2XFS A;  4YOF A;  5CER A;  2B5R A;  4WZ5 A;  2GNX A;  5BOH A;  1ODV A;  3KSI A;  1NWZ A;  1ERM A;  1NRF A;  1XPB A;  1RCJ A;  3NUL A;  3G32 A;  1ESI A;  5CTM A;  5F1G A;  4OOY A;  1H5X A;  4ZJ2 A;  1YKD A;  1W5D A;  3BWL A;  3E2K A;  4P6B A;  5EM1 A;  3C7U A;  2ZQ7 A;  1AWI A;  3E4P A;  4MN7 A;  5HWW A;  4O01 A;  1H8Y A;  2OOL A;  2ZC6 B;  3DTE A;  3OPL A;  1MBL A;  4Q0H A;  4EEP A;  1GA9 A;  2HDR A;  3ZG8 B;  5KIZ A;  4DN0 A;  1CJF A;  3EOI A;  4P0M A;  1SKO B;  1RGY A;  3B47 A;  3T12 B;  5AJG A;  3FKW A;  2H0T A;  5HPF A;  2DNS A;  3F1P A;  4CQH A;  1XJ6 A;  4II7 A;  2XA7 S;  5HD3 A;  5J7E A;  3AGD A;  2Y2K A;  2VLG A;  4ZRR A;  4KQD A;  4WYY A;  1VQQ A;  4I3A A;  2VV6 A;  2FH5 A;  1CQA A;  4KZ5 A;  1JTD A;  4WN5 A;  3HRE A;  3UB5 P;  2DRW A;  3P01 A;  2XK1 A;  1G28 A;  3SH8 A;  1PW8 A;  3MR0 A; 
#chains in the Genus database with same CATH homology
 1WA9 A;  2JKT I;  3EQV A;  3OLO A;  1ZHH B;  2I9V A;  4HIA A;  5G4Z A;  3KO6 A;  3R4K A;  2EA9 A;  2Y79 A;  5DFY A;  4BBU A;  4GCZ A;  5KSH A;  5F69 A;  2KDK A;  4ARZ B;  4B9O A;  4WL9 A;  4QPR A;  3LUQ A;  5HD5 A;  3EWK A;  5TBM B;  2DMW A;  4WUJ A;  5TBM A;  3T4O A;  3T4J A;  4EXO A;  2V0W A;  4KQO A;  4NXB A;  4BBV A;  3T4L A;  4HP4 A;  3UB9 A;  3E98 A;  4Q0J A;  5HL6 A;  5A8B A;  4JGO A;  4Y5F A;  4CLC D;  2B18 A;  2HJ9 C;  3W2Z A;  4F3L B;  3F1P B;  2QJ5 A;  3C8C A;  1LT0 A;  5F5Y A;  3A0V A;  4XT2 B;  1DP9 A;  5DFX A;  4MMN A;  2O0Y A;  2P04 A;  4WEL A;  4LRY C;  4R38 A;  1TD5 A;  3BW6 A;  4HOI A;  4MN6 A;  4I39 A;  2K31 A;  3MXQ A;  5K5B A;  2V1B A;  1D7E A;  4EES A;  1VB6 A;  2W3D A;  3ICY A;  4CLC B;  4BMW A;  3H82 B;  5J4E A;  2XRO A;  1S4R A;  4BBT A;  1D06 A;  4I3I A;  3EGX C;  4O0P A;  1G6O A;  5HZH A;  2VGL M;  3B42 A;  4I38 A;  3JVU A;  2GZA A;  3KYZ A;  3BJN A;  2H28 A;  3RH8 B;  4PAU A;  2A24 A;  4RQ9 A;  4IUH A;  4EUV A;  4R6L A;  3MF0 A;  2L0W A;  5TJJ A;  3C2W A;  4NEE D;  4Z1W A;  4BWI A;  1OT9 A;  1S66 L;  3VE3 A;  4LLO B;  5DKK A;  3PBS A;  4G3K A;  3KYQ A;  5HWT A;  3LIF A;  3PXP A;  4K08 A;  4WLA A;  2O99 A;  3K3C A;  2Z6C A;  3CIT A;  4MDZ A;  1XFN A;  3DBA A;  1MC0 A;  1ZTU A;  1MZU A;  3A0R A;  3FC7 A;  1N9O A;  2A2L A;  4GHI B;  3ZYT A;  3OCN A;  2OWH A;  2QKP A;  4NKP A;  2JKR I;  4Q0I A;  4Y2F A;  1XFQ A;  1S1Z A;  3OOV A;  3KSH A;  2WKQ A;  4UEY A;  4BJP A;  4YNR A;  1P9W A;  2HF6 A;  3H7W B;  4WF0 A;  3GDI A;  2INW A;  2L4R A;  3LIB A;  4PKY A;  2M7V A;  1H3Q A;  5AVF A;  4HNB A;  3R7W A;  2L1M A;  1T1C A;  4ETZ A;  5MC7 A;  2W0N A;  1LSW A;  4H6J B;  2W1T B;  2W1R A;  2W1T A;  1KOU A;  1XJ2 A;  3F1N B;  1W63 M;  4CLC C;  5L8M A;  4DJ2 A;  3JVV A;  4HQA A;  1T19 A;  2G7U A;  3H82 A;  3LIC A;  5AVE A;  2LB9 A;  1BYW A;  3IBJ A;  4L9G A;  3FPV A;  5F6A A;  2PDR A;  3FPW A;  1OTB A;  5DJU A;  1LL8 A;  4L9F A;  1NLY A;  3S7Q A;  3LR0 A;  4DJ3 A;  4Y3I A;  3KX0 X;  3ULF A;  2XA7 M;  1OTE A;  3KSF A;  2VEA A;  3UMD A;  4I5S A;  1W63 Q;  2J80 A;  5LBR A;  1F98 A;  2XRN A;  3LR4 A;  1STZ A;  2FZ0 A;  3FG8 A;  4HJ3 A;  3NOU C;  3C38 A;  2J3T C;  2D01 A;  3G6O A;  4JGP A;  4HH3 A;  2W3G A;  2O9A A;  3PR6 A;  3MQQ A;  1LSX A;  2BAS A;  3A0S A;  3UME A;  4IJG A;  2EWV A;  3TE8 A;  3TRC A;  5HDC A;  1DP6 A;  3LID A;  3RTY A;  4HH2 A;  4HP9 A;  4UQI M;  2EWW A;  2NUP C;  4F3L A;  3MJQ A;  3K2N A;  1T18 A;  2HV1 A;  5HDD A;  1TS8 A;  4CLC E;  4IHQ A;  3BQ8 A;  4NXF A;  3TJZ C;  3NHQ A;  5DF9 A;  2M7U A;  3H7W A;  3LIE A;  3HCY A;  4EER A;  4M4X A;  4NXG A;  3UE6 A;  2VKS A;  1OTD A;  1TS7 A;  2GX5 A;  4LRZ E;  2O9B A;  3BY8 A;  1P97 A;  4DMZ A;  2OAQ 1;  3LYX A;  3CI6 A;  2KX6 A;  5DKL A;  4HHD A;  2Y8H A;  3R7W B;  4YWZ A;  2HJE A;  4R3A A;  2YKH A;  3D3O A;  3EGD C;  1NRJ A;  2IA2 A;  4PHT A;  2OAP 1;  4LRX C;  5I5L A;  4AFI A;  2JKT M;  3K3D A;  3EQU A;  2PYP A;  2VGL S;  4GJ4 A;  2XSS A;  1IOU A;  4NXE A;  1YSP A;  3PBR A;  2WKP A;  2Z6D A;  3CUE C;  3EEA A;  3UB7 A;  3F1O A;  3MQ0 A;  1UWN X;  3IS2 B;  2K7S A;  4WEK A;  1LSV A;  4CLC A;  3T4Q A;  4R70 A;  2QWS A;  4G3V A;  2QHK A;  3EEH A;  3T4T A;  1N9L A;  4XT2 A;  3SW1 A;  3MQO A;  1XJ3 A;  3BQA A;  5HDS A;  3UB8 A;  3HJI A;  2ZOI A;  3LFV A;  1DP8 A;  1N9N A;  3LI8 A;  3NOT C;  2PT7 A;  3VV4 A;  2KOI A;  3PBN A;  2J3W A;  2PR6 A;  1TS6 A;  2KLI A;  4ARZ A;  1S67 L;  3NOP C;  1OPX A;  4HY8 A;  4GLQ A;  5C5K A;  1VHM A;  1OTA A;  1GSW A;  4FOF A;  3OC2 A;  3MFX A;  5CX7 A;  4UQI S;  1OT6 A;  3PBQ A;  4G3W A;  1V9Y A;  4EU0 A;  3D72 A;  3CWF A;  4HI4 A;  1YSQ A;  4EEU A;  2O9C A;  2P08 A;  4WEJ A;  5HPI A;  2JHE A;  3UE3 A;  3LR3 A;  2PHY A;  2P7J A;  3F1N A;  2GJ3 A;  3ZQ5 A;  2VV7 A;  3E4O A;  1P0Z A;  1T1B A;  1OJ5 A;  5DJT A;  1DRM A;  1TS0 A;  3LI9 A;  3HJK A;  1XJ4 A;  1EW0 A;  2VZW A;  5IU1 A;  2B02 A;  3VE4 A;  3P7N A;  3PHY A;  4PKY G;  3IS2 A;  4P6Z S;  3RFB A;  3PYP A;  4LPZ A;  4B93 A;  3LIA A;  3OCL A;  3B33 A;  3CAX A;  1OTI A;  2VX8 A;  2MJ6 A;  2V0U A;  3KSG A;  2V1A A;  4GS9 A;  1F9I A;  1X0O A;  2CMN A;  3E4Q A;  4GS9 B;  3S7N A;  2LB5 A;  2WKR A;  3V67 A;  1F5M A;  1MKM A;  2QJ7 A;  1TF1 A;  3U2A A;  4FSF A;  4OOM A;  2NUT C;  1H8M A;  2A24 B;  3BY9 A;  3H9W A;  1UWP X;  5IS1 A;  2VV8 A;  3VOL A;  1YAX A;  5J3W A;  5IT5 A;  2W3E A;  4HJ4 A;  4HJ6 A;  1Y28 A;  2JKR M;  2W3F A;  4YOF A;  5HWV A;  1IFQ A;  4MN5 A;  3O5Y A;  4I3J A;  2GNX A;  4L0L A;  4IUK A;  3IBR A;  2ZMV A;  4MCW A;  1ODV A;  3KSI A;  1JNU A;  4KUK A;  3C30 A;  5HSQ A;  1NWZ A;  2V9A A;  1P9R A;  4H6J A;  1S4S A;  2PYR A;  2VA0 A;  4P6Z M;  2ZMF A;  5EFW A;  1S1Y A;  1YKD A;  3BWL A;  4GHI A;  1NLZ A;  2QYB A;  3OBF A;  4MN7 A;  3E4P A;  5HWW A;  4O01 A;  3GEC A;  2OOL A;  2W27 A;  1UGU A;  4E04 A;  2VJW A;  4Q0H A;  3PBO A;  1V9Z A;  3T50 A;  2ZOH A;  4L9E A;  4EEP A;  2K2N A;  4JGR A;  3E0Y A;  5KIZ A;  4DN0 A;  2PR5 A;  4EW7 A;  3EOI A;  1OJG A;  1GSX A;  4ME4 A;  4ETX A;  3NJA A;  3B47 A;  5G4Y A;  5AJG A;  3CLO A;  2W3H A;  5HPF A;  1T1A A;  3F1P A;  4JGQ A;  2D02 A;  4CQH A;  2R78 A;  4O8G A;  2OWJ A;  4GW9 A;  1XJ6 A;  4KUO A;  4II7 A;  2XA7 S;  5HD3 A;  5J7E A;  2M1C A;  3MMH A;  2VLG A;  4ZRR A;  4EET B;  2YKF A;  2J3T D;  3LR5 A;  4KQD A;  2PD7 A;  3PBT A;  3F1O B;  2PD8 A;  4OOL A;  3TW8 A;  3T4K A;  3S7P A;  3CUE A;  3UB6 A;  4I3A A;  4EQ1 A;  2VV6 A;  5FL3 A;  2FH5 A;  3S7O A;  4WN5 A;  5F68 A;  2HGV A;  3T4S A;  3P01 A;  2ZBB A;  1G28 A;  3MR0 A;  2JN7 A;  1GSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...