4GS9A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
107
Chain Sequence
b'FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 107
sequence length 113
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9A00
3GDIA 1LL8A 3CAXA 3LIAA 1T19A 1OT9A 1GSXA 1T1CA 5HWWA 3GECA 1S4RA 1NWZA 3PYPA 4HIAA 4WF0A 3MQQA 4HOIA 3IS2A 4I38A 2VLGA 4YWZA 3EEHA 3BWLA 4EXOA 2GJ3A 2ZOIA 1OTIA 1N9LA 2YKHA 3B33A 1GSVA 2P7JA 1N9NA 4XT2B 2VV6A 4JGPA 1S4SA 5J7EA 4HJ4A 3LYXA 1GSWA 1XJ4A 1DP6A 3UB7A 5HWTA 5HSQA 4I3AA 3H82A 4M4XA 5DJTA 1DRMA 2JN7A 2V1BA 3G6OA 3LICA 3LIDA 5F5YA 4R38A 3MR0A 3LIEA 4F3LA 1P0ZA 3ULFA 5DJUA 4I3IA 4HH2A 4NXGA 4HP4A 4E04A 1TS0A 4MN6A 1P97A 5TBMB 3VE3A 5DKKA 1S1YA 3A0VA 4JGOA 3K3CA 4L9FA 2QJ5A 3NOPC 2W27A 5F6AA 1ODVA 2HV1A 3MQOA 2J80A 4LRZE 3MXQA 3IBRA 2QWSA 4DJ2A 4RQ9A 2L1MA 1S67L 4K08A 5J4EA 2PHYA 1D7EA 3VE4A 3MFXA 3ICYA 3SW1A 1OTBA 4H6JA 2QJ7A 4NXEA 4BBTA 1XJ2A 3F1NB 4LRYC 4EETB 5A8BA 3P7NA 2VV8A 3RH8B 3LIBA 3RTYA 4GS9A 4JGQA 4KUKA 4DJ3A 4L9GA 1LT0A 2PD8A 3C8CA 3D72A 1OTDA 3H7WA 2L4RA 4HI4A 2OWHA 1F9IA 2Z6DA 3F1PB 1N9OA 2D02A 4EESA 3T50A 5HD3A 2PDRA 5HWVA 1TS6A 2QKPA 3F1OA 2A24A 5I5LA 2M1CA 5HD5A 3LUQA 1V9YA 3UMDA 3UB6A 4BBVA 4GHIA 4PKYA 5F68A 4HH3A 1BYWA 3IS2B 4HJ6A 2V0UA 4R70A 3UE6A 2V0WA 2OWJA 4PKYG 3E4PA 4WL9A 1XJ6A 2R78A 4WUJA 4R6LA 1D06A 4EQ1A 4B9OA 5G4ZA 4HNBA 3CLOA 5IU1A 1DP8A 2INWA 4R3AA 3C2WA 3BY8A 5KIZA 3PHYA 4NXBA 4EEPA 3NJAA 4GW9A 3K3DA 3CWFA 4XT2A 2PYRA 1UWPX 2PR6A 4HY8A 1F98A 2CMNA 2K7SA 1UWNX 1JNUA 2QHKA 4HHDA 3FG8A 1UGUA 3H82B 5F69A 5AVFA 2B02A 1LSWA 5DKLA 4EW7A 2KX6A 2PD7A 4HP9A 5HZHA 1XJ3A 4F3LB 3HJIA 2PR5A 5IS1A 3KX0X 3A0RA 2VV7A 2W0NA 1MZUA 1TS7A 4JGRA 3OLOA 5HDSA 1T18A 3H9WA 4I3JA 1T1BA 3BY9A 3MJQA 1X0OA 1OTAA 1V9ZA 3E4OA 4WLAA 3NOTC 1TS8A 2KDKA 2V1AA 5TBMA 5G4YA 3A0SA 2D01A 3NOUC 3UMEA 3UB8A 2EA9A 3VOLA 2WKQA 4BBUA 5J3WA 3HJKA 4EERA 1OT6A 1T1AA 4LLOB 3UB9A 4LPZA 4H6JB 4LRXC 2WKPA 2OOLA 3LI8A 4HQAA 5HDDA 4L9EA 2WKRA 1S66L 4KQDA 1S1ZA 2JHEA 2PYPA 2H28A 4GS9B 3F1NA 1EW0A 2VEAA 2V9AA 1LSVA 2I9VA 3H7WB 1G28A 1OJ5A 2BASA 4HJ3A 1DP9A 4GCZA 1Y28A 4WN5A 3NHQA 2ZOHA 4EEUA 5AVEA 1LSXA 5EFWA 1XFQA 4NXFA 2L0WA 3LI9A 2YKFA 1KOUA 3F1PA 3EWKA 3LIFA 4KUOA 1VB6A 5HDCA 2Z6CA 4I39A 3F1OB 2ZBBA 1XFNA 2A24B 1WA9A 4MN5A 4I5SA 1OJGA 1OTEA 3E4QA 3FC7A 3ZQ5A 4GHIB
chains in the Genus database with same CATH superfamily
3MF0A 3G2ZA 1T19A 3VV4A 3HLEA 1OT9A 2EX6A 4NG2A 3OCLA 1IYPA 1NWZA 2Y2JA 4OLDA 1HVBA 4S2KA 3V50A 3S4XA 3MQQA 3IS2A 4I38A 3S7PA 2VLGA 2EXAA 2DCFA 1I5QA 5GHZA 5HPIA 4DRTA 4JBFA 4ZDXA 2XF3A 1HLUP 1PNEA 3C7UA 2V8CA 4Y2FA 3UE1A 3NCKA 3SH7A 1PWGA 1FILA 5HFOA 4P87A 1K4EA 3SS4A 3IWOA 2FFFB 1N9NA 3ZGAB 5HL6A 3C4OA 3BRMA 3IH8A 1S4SA 4ZRRA 2VX8A 5J7EA 4GZBA 5FEGA 2W1TA 3CI6A 1K57A 2J9OA 2H10A 5HWTA 4S2NC 5HSQA 1Y54A 4EBNA 3H82A 3LR5A 4QWOA 2W3FA 4S2MA 1PI4A 5GLCA 4OOMA 1S6RA 3T4OA 5FQJA 2V1BA 5F5YA 3ZG9B 4JXGA 4UAAA 2VKSA 5GLAA 1CQAA 4HP4A 4CJNA 4Y17A 1XXMA 4UA9A 5A92A 3HREA 4BLMA 3VP2A 5G18A 1VQQA 1ES5A 3T4JA 4OPRA 1C3BA 5FI6A 1SCWA 1FQGA 1ES4A 3BFFA 4KZ4A 3A0VA 4X55A 3GTCA 5AQBA 3QNBA 3NOPC 2W27A 4BD0A 5F6AA 4Y15A 5CERA 2RCXA 3MQOA 2J80A 4LRZE 3OPHA 5HL1A 4N1XA 2EWWA 1SZVA 4XUXA 2Y2IA 4RQ9A 5K5BA 1K54A 4P0MA 2L1MA 1TVFA 3A3FA 4B4ZA 5J4EA 1PIOA 1D7EA 1W8QA 3C4PA 1OTBA 5DF9A 3UE0A 3LY3A 4NXEA 3PAGA 4B4XA 2ZQ9A 3F1NB 2LB5A 1K25A 2P9VB 2IA2A 1YLJA 4EETB 2VV8A 3D4FA 3UY6A 3RH8B 4ZBEA 3C38A 1G68A 1MC0A 4GDBA 4GS9A 1JTDA 2UV0E 2FZ0A 4K0XA 2PD8A 1N9BA 1OTDA 3H7WA 4IEDA 3VOYA 4R23A 2W3GA 1YKDA 3IHBA 4EESA 1LHYA 3ZVTA 5HD3A 3GQZA 1KE3A 2VGLS 4QU3A 3IT9A 1YAXA 5KSCA 3EGXC 1ERMA 4NETA 2HP5A 4GHIA 3DW0A 5DFXA 5F68A 1BYWA 4Q0JA 1RGZA 3CHWP 4PM6A 5CTNA 2ZC4B 3IS2B 2BG1A 4PM5A 1NXYA 2EX9A 3JVUA 2V0UA 3N7WA 4ZAMA 2WKEA 5TGFA 2ZQCA 3QP6A 4H8RA 1W7FA 4PKYG 4KZ9A 4WL9A 2R78A 4Y5FA 3S22A 5CECA 1D06A 4KQRA 3A3DA 4BD1A 2V1ZA 2ZD8A 1Z6FA 3DBAA 4R3AA 2Y2HA 4OOLA 3BY8A 4LV3A 4EEPA 4DE3A 3V3SA 4U0TA 3K3DA 4XT2A 3ZG5A 2X01A 2FFYA 2R9WA 1QMFA 1UWPX 1NLZA 2W1TB 3LFVA 3V3RA 2CMNA 2K7SA 2ACGA 3FG8A 1PZPA 3H82B 3ITAA 4S2OA 2B02A 5FQIA 4EQIA 4UQIS 5F82A 2AVXA 3MSHA 3UE3A 2M7UA 2PD7A 4HP9A 1MKIA 1XJ3A 1OPXA 3HJIA 2Z2LB 2Y2QA 4BL3A 3UPOA 3T1QB 3G30A 4B88A 3OLOA 3IHAA 3UN7A 2Y2PA 4OP5A 3FYZA 4I3JA 3LEZA 3BY9A 3HLDA 3E4OA 2XA7M 2A49A 4P6BA 3U4LP 2V1AA 3SH8A 1SKFA 4N1HA 1GHMA 3UMEA 2OAP1 3VOLA 3T4SA 2E8IA 5AQ9A 1BLPA 2JKRM 3VP0A 3HL9A 4KZAA 3T12B 4BBUA 4R4RA 4E3LA 1VETA 2I72A 5DTSA 1T1AA 4OP8A 2B18A 4F94A 3HLFA 3LI8A 2ZQAA 3QP1A 1S1ZA 3HLCA 1FSYA 3CZDA 2H28A 3IF6A 4GS9B 3IXBA 2KLIA 1EW0A 3MFDA 3T4LA 1G6OA 1YT4A 2Q0OA 3H7WB 4KZ3A 1CI9A 1SDNA 1DP9A 2ZC7A 2G7UA 3NHQA 1L0GA 2V20A 4EEUA 1ESIA 4KQOA 3PR6A 5EFWA 4NXFA 3LI9A 5HDCA 2Z6CA 3VFHA 4YOFA 1E25A 1GA0A 2ZC6B 1DJBA 2ZJ9A 2Y59A 3CUEC 4C6YA 4QD4A 4FD8A 3ZHHA 4MNRA 3Q7VA 1M40A 4GHIB 3QNCA 4JF4A 1ZKJA 3CAXA 4ZJ2A 3PBQA 5DFYA 4C75A 1H5XA 1S4RA 3C30A 3DTIA 4JLFA 1W63M 1XX2A 1ALQA 4HIAA 4K0WA 1YLWA 4N92A 1PW1A 5FSRA 1BULA 2HP6A 4AFIA 2BLSA 1IEMA 5DTKA 2O0YA 5CGXA 4B93A 2GJ3A 3OCNA 1W63Q 4FH4A 3G32A 1N9LA 2OLUA 2O9AA 2PU2A 3B33A 4X68A 2JCHA 5CEBA 5FAOA 4E3IA 2J8YA 5FDHA 4ESPA 4MMNA 3PXPA 3L9KA 1XKZA 4XT2B 4EUZA 1LI9A 1MWTA 4JGPA 1IOUA 3NIAA 4HJ4A 3AGEA 1G6AA 2VGKA 1W8YA 3LYXA 2WYXA 3OBFA 3CJMA 1XJ4A 3TSGA 4S2IA 3ZVWA 1H0MA 2ZM0A 3HBRA 3B42A 5DJTA 5FL3A 2DRWA 4MCWA 3UO9A 2JN7A 4RA7A 4GKUA 4E6XA 3UNWA 2B95A 3G6OA 3MXSA 2WAEA 1GCEA 5J8XA 2H0YA 4R38A 4N9KA 5HAQA 4F3LA 1P0ZA 4CLCD 1K55C 4Y13A 4I3IA 4NXGA 2ZQDA 1Q2PA 1TS0A 4YFMA 3LR3A 4LENA 2VGLM 4QB8A 4KZBA 5M18A 4JPMA 3WRZA 5FI2A 2ZQ8A 3S7OA 3N8LA 1J3WA 3CMZA 3D9YA 4E3NA 3IXHA 3VE3A 3WWXA 4R3BA 2HF6A 3LGOA 4EV4A 1PZOA 2HV1A 1BLHA 1H8ZA 2PAVP 1VETB 3MXQA 3P98A 2HDQA 4R1GA 3HLWA 5FAPA 3VE4A 3SW1A 3ICYA 1E4DA 2JKTM 3IF6B 2JC7A 2Y2LA 3BQAA 3LCEA 5A8BA 3P7NA 2H5SA 1HZOA 3LIBA 3QP8A 3RTYA 3KYQA 4DJ3A 2ZC5B 4RX2A 2O99A 3DAVA 3O87A 3UB5P 3D72A 1LL9A 1LI0A 1DJAA 2OWHA 4GJ4A 1MKMA 4Y3IA 1N9OA 2D02A 4PMAA 4UQIM 2ZMVA 5EVEA 4WZ5A 5JYOA 2ZM8A 1YSQA 4PAUA 2XD5A 4IBXA 1FCOA 3Q7VB 3SS5A 3RFBA 5HD5A 3BEBA 4EUVA 1YLTA 1V9YA 3WRTA 4OQ0A 5E2HA 3UMDA 2XFTA 4II7A 2EFUA 3BFCA 1NZOA 4X53A 1U60A 5AQ7A 1MPLA 4GD8A 1GHPA 3A3IA 4KENB 3T4KA 1L0DA 2A3UA 5MC7A 1PFLA 3W2ZA 2J3TC 2C6WB 2J7VA 2QYBA 2PBDP 3KYEA 2Y4AA 1FCMA 1XJ6A 4R6LA 2WZXA 3TJZC 5G4ZA 1XA1A 1DP8A 2INWA 3C2WA 2Z2MB 5KIZA 2RL3A 3JVVA 1JTGA 4IUHA 3NJAA 3CWFA 4IJGA 1ONGA 4R4SA 4KZ5A 4X6TA 3HUOA 4HY8A 5FDSA 4HESA 4NEED 1JNUA 4KZ6A 2EFXA 3MKFA 3QP4A 5HAPA 3W4OA 5AVFA 3ITBA 4EU0A 2HDSA 3TOIA 4DDSA 4F3LB 4DE2A 1KE0A 1FCNA 5IS1A 1ACFA 3KX0X 2W0NA 4G3VA 1MZUA 2EWVA 3ZG8B 4UA6A 4JGRA 5HDSA 1K6SA 3NY4A 3CUEA 5DTTA 2XDMA 3MZDA 4CLCA 1ZG6A 4GOGA 2HPBA 1TEMA 1OTAA 2HDUA 4GB7A 3S7QA 2XK1A 1K4FA 1MWSA 5E2FA 4OONA 1IYSA 3T4QA 4R0QA 3IWQA 5TBMA 3FZCA 5CHUA 3PTEA 5G4YA 1A0KA 4ZJ3A 4ZTKA 4IHQA 1WYBA 4U3TA 3NOUC 2P74A 1SDEA 3R7WA 3IH9A 4OPQA 1STZA 3AGFA 1IKGA 1RGYA 3UPNA 5EVIC 1H8YA 4GN2A 4LLOB 4NKPA 5EE8A 3VP4A 4FCFA 5CGSA 3ZCZA 3DWZA 4DE0A 5TR7A 4DF6A 4HQAA 3MBZA 4BQMA 2HJEA 2MJ6A 2Y91A 4C3QA 2JHEA 4LCLA 2HP9A 4ETXA 2IWDA 5HPFA 3UDFA 3VMAA 4WMCA 3G4PA 5F83A 4JKTA 4UEYA 3EQUA 1G28A 5TJJA 2BASA 2X71A 4QY5A 3S7NA 4Y0UA 2GDNA 3HLGA 1BLCA 4N9LA 2ZOHA 5FA7A 3GRJA 5HAIA 1FR1A 3NDEA 3SZTA 2YKFA 4HBUA 3LIFA 4D60A 4I39A 1N4OA 4Z9QA 2ZBBA 2W3HA 2J3WA 4MN5A 3EGDC 2V8FA 1EI5A 3P01A 1JVJA 1K55A 1GHIA 1XGIA 5JYPA 3NECA 2IWBA 3FC7A 3NBLA 2XR0A 2ZMAA 3ZQ5A 5DF7A 4HBTA 5IHVA 3GDIA 5CTMA 1LL8A 4OQGA 2PT7A 4GLQA 5A93A 1KDWA 1GSXA 4K91A 2Y2NA 2OLVA 4WF0A 4YNRA 4IUKA 4IBRA 3PBNA 2ZM2A 4YWZA 2XH9A 3BWLA 3EEHA 1Z09A 4EXOA 2ZOIA 2UWXA 4KG6A 2WADA 3E0YA 4GNUA 5HARA 4PM8A 1PRQA 3BW6A 2XD1A 1GSVA 2X02A 3HUNA 3IQAA 2PRFA 4O01A 2G2UA 3R4KA 3TG9A 3FPVA 5GLBA 1AXBA 3B47A 3VOZA 2VK3A 4Y0TA 4I3AA 2Y79A 1I2WA 4M4XA 3S1YA 3OZHA 3OC2A 4E3KA 3G31A 3IX8A 2K2NA 3CG5A 1DRMA 3FWLA 3PAEA 4X69A 1NRFA 1NZUA 1MXOA 3LICA 3LIDA 4EBLA 4JF5A 2HDRA 3LIEA 3ULFA 2Y2MA 4ARZA 5DJUA 4E04A 4CLCB 3SS3A 4MN6A 4LGWA 4S2NA 5A90A 2ZC3B 4NK3A 3WS1A 2Y55A 3BFEA 4FUWA 4LV2A 2IWCA 1W5DA 4S2LA 5TBMB 5DKKA 3K3CA 4JXVA 1KGGA 2QJ5A 3FKWA 4JXSA 3R7WB 3ZFZA 4E6WA 1ODVA 4MEZA 1YSPA 1IFQA 2XEPA 4KZ8A 3CITA 5AQAA 2P08A 3U2AA 4Z1WA 5TFQA 4O0PA 4GDNA 1IYQA 2QWSA 4DJ2A 2Y2OA 1IKIA 3G2YA 1ONHA 2VA0A 3MFXA 4FH2A 4X1LA 1MWRA 4H6JA 5F1GA 2QJ7A 1OMEA 2E8JA 4BBTA 1XJ2A 1PYYA 2V2FF 3FKVA 4R3JA 3GSGA 4LCMA 4JGQA 4KUKA 4L9GA 3BFGA 1NRJA 3HLBA 2Y8HA 1MWUA 1KE4A 1ES2A 1BUEA 3Q1FA 3C8CA 4RYEA 2L4RA 5GL9A 4HI4A 2WGVA 3MZEA 1K6RA 3M2JA 1J9MA 1F9IA 2Z6DA 3W4PA 1CK3A 5L8MA 1QMEA 3RXWA 5FQMA 1CI8A 5HWVA 1G5UA 2QKPA 3F1OA 3E2LA 3PBRA 3IXDA 3O86A 2JKRI 1XGJA 2M1CA 2VGJA 4G3WA 2WK0A 3ZG0A 3IX4A 4O7DA 3UB6A 4BBVA 2KOIA 3V5MA 4PKYA 4IVKA 4BENA 1XA7A 1F5MA 3ZG7B 2G2WA 4RVAA 5CXWA 2A2LA 3Q81A 1Y4OA 4A5RA 3NI9A 3C5AA 2QPNA 5FATA 1K56A 3UE6A 2Q9MA 3UPPA 3Q07A 5FQQA 3GR2A 3E4PA 4LV0A 4WUJA 3W4QA 4CPKA 3VP3A 5L09A 4EQ1A 4B9OA 2HGVA 3SOIA 3CLOA 5IU1A 3MQ0A 5EVIA 3ISGA 3E2KA 3O3VA 1RP5A 3BFDA 1TDLA 3ZNYA 3PBTA 3QP2A 4GW9A 3T4TA 4D2OA 1FR6A 1FIKA 4MBFA 2PR6A 1F98A 1UWNX 5M19A 3N8RA 4HHDA 3T1RA 3HVFA 1P9WA 5F69A 4UA7A 1LSWA 4WMCD 4ME4A 1YQSA 2KX6A 1JWPA 1P9RA 4BL2A 2Y2GA 2PR5A 4ARZB 1E3UD 1EROA 2VV7A 1H3QA 1S0WA 3OPPA 2BTFP 3IWIA 3C7VA 3BM6A 3P09A 4DE1A 4WEKA 4XUZA 1CJFA 1T18A 2OSUA 5EPHA 3TW8A 1V9ZA 3IBJA 4WLAA 4FTXA 3BLMA 3M6BA 2EX2A 3O88A 1PW8A 3A0SA 2H0TA 3KO6A 4MN7A 3EOIA 3IF6C 4OPZA 2C5WB 2XGNA 3UB8A 2ZL1A 5KMWA 3EQVA 4CQHA 3ZNTA 1SKOA 2WKQA 2ZMFA 1O7EA 5J3WA 3HJKA 4EERA 4MBKA 1OT6A 4Y7PA 5EM1A 3LO7A 4H6JB 4LRXC 2WKPA 1GA9A 4JF6A 5KZHA 5U47A 1SHVA 5HDDA 2GX5A 2WKRA 4KQDA 5CRFA 5DF8A 1ERQA 3DTEA 3IXGA 1AWIA 1LSVA 4BMWA 5I94A 2XROA 5HX9A 1Q2QA 4PM9A 4GCZA 1Y28A 4WN5A 3V39A 5FEFA 4S2JA 3LY4A 3LR0A 1NLYA 5AVEA 5EVLA 1XFQA 3GMWA 3F1PA 4KUOA 3WS5A 3F1OB 3WS4A 1XFNA 1BT5A 1I2SA 1WA9A 4I5SA 4KQQA 1OJGA 3EEAA 3KSGA 5M1AA 1BSGA 3CPTA 1TD5A 3NULA 3IX3A 1M6KA 4X25A 1TDGA 3LIAA 3VSKA 2HZ5A 1PWDA 4Q8IA 1T1CA 5HWWA 3GECA 2JKTI 3PYPA 4WBGA 4GD6A 4HOIA 2VZWA 3T1XA 5FQKA 1CEFA 3LR4A 5FASA 5GLDA 3VFFA 1K38A 1OTIA 1XP4A 2YKHA 3QP5A 2Q9NA 1TF1A 2J3TD 4FSFA 1FSWA 2LB9A 5EVIB 5L10A 4PM7A 4KZ7A 5CEDA 4DMZA 5E2GA 4DXCA 2J9PA 4Y0OA 4OOYA 2P7JA 1HTZA 1ZTUA 2O9CA 4QJGA 3E98A 2W1RA 1YLPA 3BJNA 3DTKA 3ZYTA 4QY6A 1GSWA 1DP6A 4P6ZS 3UB7A 3BLSA 3I7JA 5IT5A 1L0FA 4IVIA 5CHJA 3BECA 1LL5A 2VJWA 5E2EA 4M3KA 3NC8A 3JPUA 2DMWA 3HCYA 3V67A 1YMSA 2WZZA 3MR0A 3RJUA 1ZG4A 2XRNA 5LBRA 3ZDJA 4HH2A 2EX8A 4L0LA 3OOVA 5A91A 1ESUA 1E3UA 5EV0A 1W79A 3Q82A 4EBPA 1P97A 3WS0A 3RXXA 5EOEA 4X56A 2W3DA 1K0KA 3DTMA 1S1YA 4OQHA 1BTLA 4YINA 4E3MA 1VEUA 1NY0A 4JGOA 1KGFA 5GHXA 3G35A 4L9FA 2ZL1B 5CHMA 4E3OA 3DWKA 1RCJA 1SKOB 3GV9A 3KSIA 3MZFA 1YM1A 1KDSA 3IBRA 3O5YA 1K56D 1CEGA 1XPBA 3KYZA 4LV1A 1S67L 2OAQ1 4K08A 1NJ4A 2PHYA 1FOFA 3UDXA 2JE5A 4WZ4A 4WEJA 2WGWA 4OQIA 1ZC2A 2JBFA 5DVAA 5HW3A 3B3XA 3N6IA 3PBOA 4LRYC 4WZ5C 4PHTA 5AJGA 5EVID 5FQ9A 2JKGA 1LT0A 1K57C 3AGDA 4S2PA 5CX7A 1WYCA 4WM9A 3N4IA 1HD8A 5F1FA 1O07A 3F1PB 1IELA 3QHYA 3T50A 4Q0IA 4P85A 5EM0A 1KGEA 1MBLA 2PDRA 1DY6A 3Q7ZA 1TS6A 3W8KA 2A24A 2GZAA 3G34A 5FAQA 3VP1A 5D3OA 3WS2A 5I5LA 1VM1A 3CPTB 2W3EA 3MKEA 3LUQA 1D1JA 3K2NA 3M6HA 2GNXA 4DN0A 4WELA 4ID4A 1L2SA 3N8SA 3MMHA 4HH3A 2WUQA 1YLYA 1DJCA 1PI5A 1YLZA 1F2KA 4HJ6A 5EUAA 3PBSA 1BZAA 4R70A 4MLLA 2V0WA 2OWJA 4PPRA 4HEFA 4BJPA 5BOHA 3JYIA 2XQZA 5GHYA 3IF5A 3BYDA 1K54C 3GVBA 2DNSA 4HNBA 4EWFA 3D3OA 1ES3A 1IYOA 2WGIA 3PHYA 4NXBA 2WAFA 1L0EA 2FH5A 4U0XA 2PYRA 2NUPC 2QHKA 1PWCA 4FOFA 1UGUA 4CLCC 3MS6A 3UDIA 1VHMA 4LFUA 4MDZA 5DKLA 2PBYA 4EW7A 1WE4A 4ETZA 5HZHA 2CC1A 4KG2A 3A3EA 2EXBA 5C5KA 3OPRA 3A0RA 3MXRA 1TS7A 3FPWA 3T1SA 3KSHA 4QHCA 3FV7A 2ZLYA 2WKHA 4UHUA 3H9WA 2M7VA 4DKIA 1KVMA 5CGWA 1T1BA 5E43A 3OPLA 3MJQA 1X0OA 5KSHA 2QZ6A 2HJ9C 2JKFA 1NYMA 3NOTC 5L2FA 1VEUB 1TS8A 2KDKA 1MY8A 2OV5A 4CLCE 3LEQA 1JWVA 2D01A 4G3KA 2EA9A 1JWZA 4DXBA 1CF0A 3L7HA 3SH9A 4OKPA 3UB9A 4LPZA 2WGWB 3TRCA 2NUTC 4OH0A 2WKIA 4ZJ1A 2OOLA 3A3JA 1H8MA 4KG5A 4O8GA 4OLGA 2R9XA 4L9EA 1S66L 2PYPA 5EOOA 1EWZA 2XFSA 3F1NA 2P9VA 2VEAA 2V9AA 3M2KA 2I9VA 4MBHA 4DDYA 1L3LA 3TE8A 1OJ5A 2QMIA 4QPRA 4HJ3A 3KSFA 1KVLA 1NYYA 2XSSA 4RX3A 3NDGA 4P6ZM 1YMXA 4X1MA 3BQ8A 1LSXA 2L0WA 2B5RA 1KOUA 2PU4A 1YPRA 3EWKA 1VB6A 3VSLA 1ZHHB 4OVDA 4WYYA 5L07A 2A24B 2K31A 1BLSA 5EECA 2Y2KA 4JXWA 4BWIA 2XLNA 4XXRA 4Q0HA 2P04A 1OTEA 4E3JA 5FI7A 2O9BA 3E4QA 3HUMA 2ZQ7A 2XA7S 1LLBA 4OPYA 2VV6A
chains in the Genus database with same CATH topology
3GDIA 3MF0A 1LL8A 3CAXA 2PT7A 3PBQA 4GLQA 5DFYA 3LIAA 1T19A 3VV4A 1OT9A 1GSXA 1T1CA 3OCLA 5HWWA 3GECA 2JKTI 1S4RA 1NWZA 3C30A 3PYPA 1W63M 4HIAA 4WF0A 4YNRA 4IUKA 3MQQA 4HOIA 2VZWA 3IS2A 4I38A 3S7PA 3PBNA 4AFIA 2VLGA 4YWZA 3EEHA 3BWLA 4EXOA 2O0YA 3LR4A 4B93A 2GJ3A 3OCNA 5HPIA 1W63Q 2ZOIA 1OTIA 1N9LA 2YKHA 2O9AA 1TF1A 3B33A 2J3TD 4FSFA 4Y2FA 3E0YA 2LB9A 4DMZA 3BW6A 1GSVA 4MMNA 3PXPA 2P7JA 1ZTUA 1N9NA 4O01A 4XT2B 3R4KA 5HL6A 2O9CA 4JGPA 1IOUA 3E98A 1S4SA 2W1RA 3FPVA 4ZRRA 2VX8A 5J7EA 4HJ4A 3BJNA 3B47A 3LYXA 3OBFA 3ZYTA 1GSWA 1XJ4A 2W1TA 3CI6A 1DP6A 4P6ZS 3UB7A 5HWTA 5HSQA 4I3AA 2Y79A 3B42A 3H82A 4M4XA 5IT5A 3LR5A 5DJTA 5FL3A 3OC2A 2W3FA 4MCWA 2K2NA 2VJWA 1DRMA 2JN7A 4OOMA 3T4OA 2DMWA 2V1BA 3G6OA 3HCYA 3V67A 3LICA 3LIDA 5F5YA 4R38A 3MR0A 3LIEA 2VKSA 4F3LA 1P0ZA 2XRNA 5LBRA 3ULFA 4CLCD 4ARZA 5DJUA 4I3IA 4HH2A 4NXGA 4HP4A 4E04A 1TS0A 4L0LA 3OOVA 4CLCB 3LR3A 4MN6A 2VGLM 3S7OA 1P97A 5TBMB 3T4JA 3VE3A 5DKKA 2W3DA 1S1YA 3A0VA 4JGOA 3K3CA 4L9FA 2QJ5A 2HF6A 3R7WB 3NOPC 2W27A 5F6AA 1ODVA 1YSPA 1IFQA 2HV1A 3CITA 3KSIA 3MQOA 2P08A 3U2AA 4Z1WA 2J80A 4LRZE 3MXQA 2EWWA 4O0PA 3IBRA 3O5YA 2QWSA 4DJ2A 4RQ9A 3KYZA 5K5BA 2L1MA 1S67L 2OAQ1 4K08A 5J4EA 2PHYA 1D7EA 2VA0A 3MFXA 3ICYA 3VE4A 3SW1A 1OTBA 4WEJA 4H6JA 5DF9A 2JKTM 2QJ7A 4NXEA 4BBTA 1XJ2A 3F1NB 2LB5A 3PBOA 4LRYC 2IA2A 4EETB 5A8BA 3BQAA 3P7NA 2VV8A 4PHTA 3RH8B 5AJGA 3LIBA 3C38A 3RTYA 1MC0A 3KYQA 4GS9A 4JGQA 4KUKA 4DJ3A 4L9GA 1LT0A 1NRJA 2O99A 2Y8HA 4GHIB 2FZ0A 5CX7A 2PD8A 3C8CA 3D72A 1OTDA 3H7WA 2L4RA 4HI4A 2OWHA 4GJ4A 2W3GA 1F9IA 1YKDA 2Z6DA 1MKMA 4Y3IA 3F1PB 1N9OA 2D02A 4EESA 4UQIM 5L8MA 3T50A 4Q0IA 5HD3A 2ZMVA 2PDRA 1YSQA 5HWVA 1TS6A 2QKPA 2VGLS 3F1OA 4PAUA 3PBRA 2A24A 2GZAA 2JKRI 5I5LA 2M1CA 2W3EA 1YAXA 4G3WA 3EGXC 3RFBA 5HD5A 3LUQA 3K2NA 4EUVA 1V9YA 2GNXA 3UMDA 4DN0A 4II7A 3UB6A 4WELA 4BBVA 2KOIA 4GHIA 4PKYA 5DFXA 5F68A 1F5MA 3MMHA 4HH3A 1BYWA 4Q0JA 3T4KA 5MC7A 2A2LA 3W2ZA 3IS2B 4HJ6A 2J3TC 3JVUA 2V0UA 3PBSA 4R70A 3UE6A 2QYBA 2V0WA 2OWJA 4BJPA 4PKYG 3E4PA 4WL9A 1XJ6A 2R78A 4Y5FA 4WUJA 4R6LA 3TJZC 1D06A 4EQ1A 4B9OA 2HGVA 5G4ZA 4HNBA 3CLOA 3D3OA 5IU1A 3MQ0A 1DP8A 2INWA 3DBAA 4R3AA 3C2WA 4OOLA 3BY8A 5KIZA 3PHYA 4NXBA 4EEPA 3JVVA 3PBTA 4IUHA 3NJAA 4GW9A 3K3DA 3CWFA 4IJGA 2FH5A 4XT2A 2PYRA 3T4TA 2NUPC 1UWPX 1NLZA 2W1TB 3LFVA 2PR6A 4HY8A 1F98A 2CMNA 4NEED 2K7SA 1UWNX 1JNUA 2QHKA 4FOFA 4HHDA 3FG8A 1UGUA 3H82B 4CLCC 1P9WA 5F69A 1VHMA 5AVFA 2B02A 1LSWA 4MDZA 4ME4A 4UQIS 5DKLA 4EU0A 4EW7A 3UE3A 2M7UA 2KX6A 2PD7A 4HP9A 4ETZA 5HZHA 1XJ3A 4F3LB 1OPXA 1P9RA 3HJIA 2PR5A 5IS1A 4ARZB 5C5KA 3KX0X 3A0RA 2VV7A 2W0NA 4G3VA 1MZUA 1H3QA 2EWVA 1TS7A 3FPWA 3KSHA 4JGRA 3OLOA 5HDSA 4WEKA 1T18A 3CUEA 3H9WA 2M7VA 4CLCA 3TW8A 4I3JA 1T1BA 3BY9A 3MJQA 1X0OA 1OTAA 3S7QA 5KSHA 1V9ZA 2HJ9C 3E4OA 3IBJA 4WLAA 2XA7M 3NOTC 3T4QA 1TS8A 2KDKA 2V1AA 5TBMA 4CLCE 5G4YA 3A0SA 4IHQA 2D01A 3NOUC 3UMEA 3KO6A 4G3KA 2OAP1 4MN7A 3EOIA 3UB8A 2EA9A 3R7WA 3T4SA 3VOLA 3EQVA 4CQHA 2JKRM 2WKQA 2ZMFA 1STZA 4BBUA 5J3WA 3HJKA 4EERA 1OT6A 1T1AA 4LLOB 4NKPA 3UB9A 4LPZA 2B18A 4H6JB 2NUTC 4LRXC 3TRCA 2WKPA 2OOLA 3LI8A 4HQAA 1H8MA 4O8GA 5HDDA 4L9EA 2HJEA 2GX5A 2WKRA 1S66L 4KQDA 1S1ZA 2MJ6A 2JHEA 2PYPA 2H28A 4GS9B 3F1NA 2KLIA 4ETXA 5HPFA 1EW0A 2VEAA 2V9AA 1LSVA 3T4LA 1G6OA 4BMWA 2I9VA 4UEYA 3EQUA 3H7WB 2XROA 1G28A 3TE8A 1OJ5A 5TJJA 2BASA 4QPRA 4HJ3A 3KSFA 1DP9A 4GCZA 3S7NA 1Y28A 2XSSA 4WN5A 2G7UA 4P6ZM 3NHQA 2ZOHA 3LR0A 1NLYA 4EEUA 5AVEA 4KQOA 3BQ8A 1LSXA 3PR6A 5EFWA 1XFQA 4NXFA 2L0WA 3LI9A 2YKFA 1KOUA 3F1PA 3EWKA 3LIFA 4KUOA 1VB6A 5HDCA 2Z6CA 4I39A 4YOFA 1ZHHB 3F1OB 2ZBBA 1XFNA 2A24B 2W3HA 1WA9A 2J3WA 2K31A 4MN5A 3EGDC 4I5SA 4BWIA 3P01A 2P04A 4Q0HA 1OJGA 1OTEA 3CUEC 3EEAA 3KSGA 2O9BA 3E4QA 3FC7A 2XA7S 1TD5A 3ZQ5A 2VV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDI A;  1LL8 A;  3CAX A;  3LIA A;  1T19 A;  1OT9 A;  1GSX A;  1T1C A;  5HWW A;  3GEC A;  1S4R A;  1NWZ A;  3PYP A;  4HIA A;  4WF0 A;  3MQQ A;  4HOI A;  3IS2 A;  4I38 A;  2VLG A;  4YWZ A;  3EEH A;  3BWL A;  4EXO A;  2GJ3 A;  2ZOI A;  1OTI A;  1N9L A;  2YKH A;  3B33 A;  1GSV A;  2P7J A;  1N9N A;  4XT2 B;  2VV6 A;  4JGP A;  1S4S A;  5J7E A;  4HJ4 A;  3LYX A;  1GSW A;  1XJ4 A;  1DP6 A;  3UB7 A;  5HWT A;  5HSQ A;  4I3A A;  3H82 A;  4M4X A;  5DJT A;  1DRM A;  2JN7 A;  2V1B A;  3G6O A;  3LIC A;  3LID A;  5F5Y A;  4R38 A;  3MR0 A;  3LIE A;  4F3L A;  1P0Z A;  3ULF A;  5DJU A;  4I3I A;  4HH2 A;  4NXG A;  4HP4 A;  4E04 A;  1TS0 A;  4MN6 A;  1P97 A;  5TBM B;  3VE3 A;  5DKK A;  1S1Y A;  3A0V A;  4JGO A;  3K3C A;  4L9F A;  2QJ5 A;  3NOP C;  2W27 A;  5F6A A;  1ODV A;  2HV1 A;  3MQO A;  2J80 A;  4LRZ E;  3MXQ A;  3IBR A;  2QWS A;  4DJ2 A;  4RQ9 A;  2L1M A;  1S67 L;  4K08 A;  5J4E A;  2PHY A;  1D7E A;  3VE4 A;  3MFX A;  3ICY A;  3SW1 A;  1OTB A;  4H6J A;  2QJ7 A;  4NXE A;  4BBT A;  1XJ2 A;  3F1N B;  4LRY C;  4EET B;  5A8B A;  3P7N A;  2VV8 A;  3RH8 B;  3LIB A;  3RTY A;  4GS9 A;  4JGQ A;  4KUK A;  4DJ3 A;  4L9G A;  1LT0 A;  2PD8 A;  3C8C A;  3D72 A;  1OTD A;  3H7W A;  2L4R A;  4HI4 A;  2OWH A;  1F9I A;  2Z6D A;  3F1P B;  1N9O A;  2D02 A;  4EES A;  3T50 A;  5HD3 A;  2PDR A;  5HWV A;  1TS6 A;  2QKP A;  3F1O A;  2A24 A;  5I5L A;  2M1C A;  5HD5 A;  3LUQ A;  1V9Y A;  3UMD A;  3UB6 A;  4BBV A;  4GHI A;  4PKY A;  5F68 A;  4HH3 A;  1BYW A;  3IS2 B;  4HJ6 A;  2V0U A;  4R70 A;  3UE6 A;  2V0W A;  2OWJ A;  4PKY G;  3E4P A;  4WL9 A;  1XJ6 A;  2R78 A;  4WUJ A;  4R6L A;  1D06 A;  4EQ1 A;  4B9O A;  5G4Z A;  4HNB A;  3CLO A;  5IU1 A;  1DP8 A;  2INW A;  4R3A A;  3C2W A;  3BY8 A;  5KIZ A;  3PHY A;  4NXB A;  4EEP A;  3NJA A;  4GW9 A;  3K3D A;  3CWF A;  4XT2 A;  2PYR A;  1UWP X;  2PR6 A;  4HY8 A;  1F98 A;  2CMN A;  2K7S A;  1UWN X;  1JNU A;  2QHK A;  4HHD A;  3FG8 A;  1UGU A;  3H82 B;  5F69 A;  5AVF A;  2B02 A;  1LSW A;  5DKL A;  4EW7 A;  2KX6 A;  2PD7 A;  4HP9 A;  5HZH A;  1XJ3 A;  4F3L B;  3HJI A;  2PR5 A;  5IS1 A;  3KX0 X;  3A0R A;  2VV7 A;  2W0N A;  1MZU A;  1TS7 A;  4JGR A;  3OLO A;  5HDS A;  1T18 A;  3H9W A;  4I3J A;  1T1B A;  3BY9 A;  3MJQ A;  1X0O A;  1OTA A;  1V9Z A;  3E4O A;  4WLA A;  3NOT C;  1TS8 A;  2KDK A;  2V1A A;  5TBM A;  5G4Y A;  3A0S A;  2D01 A;  3NOU C;  3UME A;  3UB8 A;  2EA9 A;  3VOL A;  2WKQ A;  4BBU A;  5J3W A;  3HJK A;  4EER A;  1OT6 A;  1T1A A;  4LLO B;  3UB9 A;  4LPZ A;  4H6J B;  4LRX C;  2WKP A;  2OOL A;  3LI8 A;  4HQA A;  5HDD A;  4L9E A;  2WKR A;  1S66 L;  4KQD A;  1S1Z A;  2JHE A;  2PYP A;  2H28 A;  4GS9 B;  3F1N A;  1EW0 A;  2VEA A;  2V9A A;  1LSV A;  2I9V A;  3H7W B;  1G28 A;  1OJ5 A;  2BAS A;  4HJ3 A;  1DP9 A;  4GCZ A;  1Y28 A;  4WN5 A;  3NHQ A;  2ZOH A;  4EEU A;  5AVE A;  1LSX A;  5EFW A;  1XFQ A;  4NXF A;  2L0W A;  3LI9 A;  2YKF A;  1KOU A;  3F1P A;  3EWK A;  3LIF A;  4KUO A;  1VB6 A;  5HDC A;  2Z6C A;  4I39 A;  3F1O B;  2ZBB A;  1XFN A;  2A24 B;  1WA9 A;  4MN5 A;  4I5S A;  1OJG A;  1OTE A;  3E4Q A;  3FC7 A;  3ZQ5 A;  4GHI B; 
#chains in the Genus database with same CATH topology
 3MF0 A;  3G2Z A;  1T19 A;  3VV4 A;  3HLE A;  1OT9 A;  2EX6 A;  4NG2 A;  3OCL A;  1IYP A;  1NWZ A;  2Y2J A;  4OLD A;  1HVB A;  4S2K A;  3V50 A;  3S4X A;  3MQQ A;  3IS2 A;  4I38 A;  3S7P A;  2VLG A;  2EXA A;  2DCF A;  1I5Q A;  5GHZ A;  5HPI A;  4DRT A;  4JBF A;  4ZDX A;  2XF3 A;  1HLU P;  1PNE A;  3C7U A;  2V8C A;  4Y2F A;  3UE1 A;  3NCK A;  3SH7 A;  1PWG A;  1FIL A;  5HFO A;  4P87 A;  1K4E A;  3SS4 A;  3IWO A;  2FFF B;  1N9N A;  3ZGA B;  5HL6 A;  3C4O A;  3BRM A;  3IH8 A;  1S4S A;  4ZRR A;  2VX8 A;  5J7E A;  4GZB A;  5FEG A;  2W1T A;  3CI6 A;  1K57 A;  2J9O A;  2H10 A;  5HWT A;  4S2N C;  5HSQ A;  1Y54 A;  4EBN A;  3H82 A;  3LR5 A;  4QWO A;  2W3F A;  4S2M A;  1PI4 A;  5GLC A;  4OOM A;  1S6R A;  3T4O A;  5FQJ A;  2V1B A;  5F5Y A;  3ZG9 B;  4JXG A;  4UAA A;  2VKS A;  5GLA A;  1CQA A;  4HP4 A;  4CJN A;  4Y17 A;  1XXM A;  4UA9 A;  5A92 A;  3HRE A;  4BLM A;  3VP2 A;  5G18 A;  1VQQ A;  1ES5 A;  3T4J A;  4OPR A;  1C3B A;  5FI6 A;  1SCW A;  1FQG A;  1ES4 A;  3BFF A;  4KZ4 A;  3A0V A;  4X55 A;  3GTC A;  5AQB A;  3QNB A;  3NOP C;  2W27 A;  4BD0 A;  5F6A A;  4Y15 A;  5CER A;  2RCX A;  3MQO A;  2J80 A;  4LRZ E;  3OPH A;  5HL1 A;  4N1X A;  2EWW A;  1SZV A;  4XUX A;  2Y2I A;  4RQ9 A;  5K5B A;  1K54 A;  4P0M A;  2L1M A;  1TVF A;  3A3F A;  4B4Z A;  5J4E A;  1PIO A;  1D7E A;  1W8Q A;  3C4P A;  1OTB A;  5DF9 A;  3UE0 A;  3LY3 A;  4NXE A;  3PAG A;  4B4X A;  2ZQ9 A;  3F1N B;  2LB5 A;  1K25 A;  2P9V B;  2IA2 A;  1YLJ A;  4EET B;  2VV8 A;  3D4F A;  3UY6 A;  3RH8 B;  4ZBE A;  3C38 A;  1G68 A;  1MC0 A;  4GDB A;  4GS9 A;  1JTD A;  2UV0 E;  2FZ0 A;  4K0X A;  2PD8 A;  1N9B A;  1OTD A;  3H7W A;  4IED A;  3VOY A;  4R23 A;  2W3G A;  1YKD A;  3IHB A;  4EES A;  1LHY A;  3ZVT A;  5HD3 A;  3GQZ A;  1KE3 A;  2VGL S;  4QU3 A;  3IT9 A;  1YAX A;  5KSC A;  3EGX C;  1ERM A;  4NET A;  2HP5 A;  4GHI A;  3DW0 A;  5DFX A;  5F68 A;  1BYW A;  4Q0J A;  1RGZ A;  3CHW P;  4PM6 A;  5CTN A;  2ZC4 B;  3IS2 B;  2BG1 A;  4PM5 A;  1NXY A;  2EX9 A;  3JVU A;  2V0U A;  3N7W A;  4ZAM A;  2WKE A;  5TGF A;  2ZQC A;  3QP6 A;  4H8R A;  1W7F A;  4PKY G;  4KZ9 A;  4WL9 A;  2R78 A;  4Y5F A;  3S22 A;  5CEC A;  1D06 A;  4KQR A;  3A3D A;  4BD1 A;  2V1Z A;  2ZD8 A;  1Z6F A;  3DBA A;  4R3A A;  2Y2H A;  4OOL A;  3BY8 A;  4LV3 A;  4EEP A;  4DE3 A;  3V3S A;  4U0T A;  3K3D A;  4XT2 A;  3ZG5 A;  2X01 A;  2FFY A;  2R9W A;  1QMF A;  1UWP X;  1NLZ A;  2W1T B;  3LFV A;  3V3R A;  2CMN A;  2K7S A;  2ACG A;  3FG8 A;  1PZP A;  3H82 B;  3ITA A;  4S2O A;  2B02 A;  5FQI A;  4EQI A;  4UQI S;  5F82 A;  2AVX A;  3MSH A;  3UE3 A;  2M7U A;  2PD7 A;  4HP9 A;  1MKI A;  1XJ3 A;  1OPX A;  3HJI A;  2Z2L B;  2Y2Q A;  4BL3 A;  3UPO A;  3T1Q B;  3G30 A;  4B88 A;  3OLO A;  3IHA A;  3UN7 A;  2Y2P A;  4OP5 A;  3FYZ A;  4I3J A;  3LEZ A;  3BY9 A;  3HLD A;  3E4O A;  2XA7 M;  2A49 A;  4P6B A;  3U4L P;  2V1A A;  3SH8 A;  1SKF A;  4N1H A;  1GHM A;  3UME A;  2OAP 1;  3VOL A;  3T4S A;  2E8I A;  5AQ9 A;  1BLP A;  2JKR M;  3VP0 A;  3HL9 A;  4KZA A;  3T12 B;  4BBU A;  4R4R A;  4E3L A;  1VET A;  2I72 A;  5DTS A;  1T1A A;  4OP8 A;  2B18 A;  4F94 A;  3HLF A;  3LI8 A;  2ZQA A;  3QP1 A;  1S1Z A;  3HLC A;  1FSY A;  3CZD A;  2H28 A;  3IF6 A;  4GS9 B;  3IXB A;  2KLI A;  1EW0 A;  3MFD A;  3T4L A;  1G6O A;  1YT4 A;  2Q0O A;  3H7W B;  4KZ3 A;  1CI9 A;  1SDN A;  1DP9 A;  2ZC7 A;  2G7U A;  3NHQ A;  1L0G A;  2V20 A;  4EEU A;  1ESI A;  4KQO A;  3PR6 A;  5EFW A;  4NXF A;  3LI9 A;  5HDC A;  2Z6C A;  3VFH A;  4YOF A;  1E25 A;  1GA0 A;  2ZC6 B;  1DJB A;  2ZJ9 A;  2Y59 A;  3CUE C;  4C6Y A;  4QD4 A;  4FD8 A;  3ZHH A;  4MNR A;  3Q7V A;  1M40 A;  4GHI B;  3QNC A;  4JF4 A;  1ZKJ A;  3CAX A;  4ZJ2 A;  3PBQ A;  5DFY A;  4C75 A;  1H5X A;  1S4R A;  3C30 A;  3DTI A;  4JLF A;  1W63 M;  1XX2 A;  1ALQ A;  4HIA A;  4K0W A;  1YLW A;  4N92 A;  1PW1 A;  5FSR A;  1BUL A;  2HP6 A;  4AFI A;  2BLS A;  1IEM A;  5DTK A;  2O0Y A;  5CGX A;  4B93 A;  2GJ3 A;  3OCN A;  1W63 Q;  4FH4 A;  3G32 A;  1N9L A;  2OLU A;  2O9A A;  2PU2 A;  3B33 A;  4X68 A;  2JCH A;  5CEB A;  5FAO A;  4E3I A;  2J8Y A;  5FDH A;  4ESP A;  4MMN A;  3PXP A;  3L9K A;  1XKZ A;  4XT2 B;  4EUZ A;  1LI9 A;  1MWT A;  4JGP A;  1IOU A;  3NIA A;  4HJ4 A;  3AGE A;  1G6A A;  2VGK A;  1W8Y A;  3LYX A;  2WYX A;  3OBF A;  3CJM A;  1XJ4 A;  3TSG A;  4S2I A;  3ZVW A;  1H0M A;  2ZM0 A;  3HBR A;  3B42 A;  5DJT A;  5FL3 A;  2DRW A;  4MCW A;  3UO9 A;  2JN7 A;  4RA7 A;  4GKU A;  4E6X A;  3UNW A;  2B95 A;  3G6O A;  3MXS A;  2WAE A;  1GCE A;  5J8X A;  2H0Y A;  4R38 A;  4N9K A;  5HAQ A;  4F3L A;  1P0Z A;  4CLC D;  1K55 C;  4Y13 A;  4I3I A;  4NXG A;  2ZQD A;  1Q2P A;  1TS0 A;  4YFM A;  3LR3 A;  4LEN A;  2VGL M;  4QB8 A;  4KZB A;  5M18 A;  4JPM A;  3WRZ A;  5FI2 A;  2ZQ8 A;  3S7O A;  3N8L A;  1J3W A;  3CMZ A;  3D9Y A;  4E3N A;  3IXH A;  3VE3 A;  3WWX A;  4R3B A;  2HF6 A;  3LGO A;  4EV4 A;  1PZO A;  2HV1 A;  1BLH A;  1H8Z A;  2PAV P;  1VET B;  3MXQ A;  3P98 A;  2HDQ A;  4R1G A;  3HLW A;  5FAP A;  3VE4 A;  3SW1 A;  3ICY A;  1E4D A;  2JKT M;  3IF6 B;  2JC7 A;  2Y2L A;  3BQA A;  3LCE A;  5A8B A;  3P7N A;  2H5S A;  1HZO A;  3LIB A;  3QP8 A;  3RTY A;  3KYQ A;  4DJ3 A;  2ZC5 B;  4RX2 A;  2O99 A;  3DAV A;  3O87 A;  3UB5 P;  3D72 A;  1LL9 A;  1LI0 A;  1DJA A;  2OWH A;  4GJ4 A;  1MKM A;  4Y3I A;  1N9O A;  2D02 A;  4PMA A;  4UQI M;  2ZMV A;  5EVE A;  4WZ5 A;  5JYO A;  2ZM8 A;  1YSQ A;  4PAU A;  2XD5 A;  4IBX A;  1FCO A;  3Q7V B;  3SS5 A;  3RFB A;  5HD5 A;  3BEB A;  4EUV A;  1YLT A;  1V9Y A;  3WRT A;  4OQ0 A;  5E2H A;  3UMD A;  2XFT A;  4II7 A;  2EFU A;  3BFC A;  1NZO A;  4X53 A;  1U60 A;  5AQ7 A;  1MPL A;  4GD8 A;  1GHP A;  3A3I A;  4KEN B;  3T4K A;  1L0D A;  2A3U A;  5MC7 A;  1PFL A;  3W2Z A;  2J3T C;  2C6W B;  2J7V A;  2QYB A;  2PBD P;  3KYE A;  2Y4A A;  1FCM A;  1XJ6 A;  4R6L A;  2WZX A;  3TJZ C;  5G4Z A;  1XA1 A;  1DP8 A;  2INW A;  3C2W A;  2Z2M B;  5KIZ A;  2RL3 A;  3JVV A;  1JTG A;  4IUH A;  3NJA A;  3CWF A;  4IJG A;  1ONG A;  4R4S A;  4KZ5 A;  4X6T A;  3HUO A;  4HY8 A;  5FDS A;  4HES A;  4NEE D;  1JNU A;  4KZ6 A;  2EFX A;  3MKF A;  3QP4 A;  5HAP A;  3W4O A;  5AVF A;  3ITB A;  4EU0 A;  2HDS A;  3TOI A;  4DDS A;  4F3L B;  4DE2 A;  1KE0 A;  1FCN A;  5IS1 A;  1ACF A;  3KX0 X;  2W0N A;  4G3V A;  1MZU A;  2EWV A;  3ZG8 B;  4UA6 A;  4JGR A;  5HDS A;  1K6S A;  3NY4 A;  3CUE A;  5DTT A;  2XDM A;  3MZD A;  4CLC A;  1ZG6 A;  4GOG A;  2HPB A;  1TEM A;  1OTA A;  2HDU A;  4GB7 A;  3S7Q A;  2XK1 A;  1K4F A;  1MWS A;  5E2F A;  4OON A;  1IYS A;  3T4Q A;  4R0Q A;  3IWQ A;  5TBM A;  3FZC A;  5CHU A;  3PTE A;  5G4Y A;  1A0K A;  4ZJ3 A;  4ZTK A;  4IHQ A;  1WYB A;  4U3T A;  3NOU C;  2P74 A;  1SDE A;  3R7W A;  3IH9 A;  4OPQ A;  1STZ A;  3AGF A;  1IKG A;  1RGY A;  3UPN A;  5EVI C;  1H8Y A;  4GN2 A;  4LLO B;  4NKP A;  5EE8 A;  3VP4 A;  4FCF A;  5CGS A;  3ZCZ A;  3DWZ A;  4DE0 A;  5TR7 A;  4DF6 A;  4HQA A;  3MBZ A;  4BQM A;  2HJE A;  2MJ6 A;  2Y91 A;  4C3Q A;  2JHE A;  4LCL A;  2HP9 A;  4ETX A;  2IWD A;  5HPF A;  3UDF A;  3VMA A;  4WMC A;  3G4P A;  5F83 A;  4JKT A;  4UEY A;  3EQU A;  1G28 A;  5TJJ A;  2BAS A;  2X71 A;  4QY5 A;  3S7N A;  4Y0U A;  2GDN A;  3HLG A;  1BLC A;  4N9L A;  2ZOH A;  5FA7 A;  3GRJ A;  5HAI A;  1FR1 A;  3NDE A;  3SZT A;  2YKF A;  4HBU A;  3LIF A;  4D60 A;  4I39 A;  1N4O A;  4Z9Q A;  2ZBB A;  2W3H A;  2J3W A;  4MN5 A;  3EGD C;  2V8F A;  1EI5 A;  3P01 A;  1JVJ A;  1K55 A;  1GHI A;  1XGI A;  5JYP A;  3NEC A;  2IWB A;  3FC7 A;  3NBL A;  2XR0 A;  2ZMA A;  3ZQ5 A;  5DF7 A;  4HBT A;  5IHV A;  3GDI A;  5CTM A;  1LL8 A;  4OQG A;  2PT7 A;  4GLQ A;  5A93 A;  1KDW A;  1GSX A;  4K91 A;  2Y2N A;  2OLV A;  4WF0 A;  4YNR A;  4IUK A;  4IBR A;  3PBN A;  2ZM2 A;  4YWZ A;  2XH9 A;  3BWL A;  3EEH A;  1Z09 A;  4EXO A;  2ZOI A;  2UWX A;  4KG6 A;  2WAD A;  3E0Y A;  4GNU A;  5HAR A;  4PM8 A;  1PRQ A;  3BW6 A;  2XD1 A;  1GSV A;  2X02 A;  3HUN A;  3IQA A;  2PRF A;  4O01 A;  2G2U A;  3R4K A;  3TG9 A;  3FPV A;  5GLB A;  1AXB A;  3B47 A;  3VOZ A;  2VK3 A;  4Y0T A;  4I3A A;  2Y79 A;  1I2W A;  4M4X A;  3S1Y A;  3OZH A;  3OC2 A;  4E3K A;  3G31 A;  3IX8 A;  2K2N A;  3CG5 A;  1DRM A;  3FWL A;  3PAE A;  4X69 A;  1NRF A;  1NZU A;  1MXO A;  3LIC A;  3LID A;  4EBL A;  4JF5 A;  2HDR A;  3LIE A;  3ULF A;  2Y2M A;  4ARZ A;  5DJU A;  4E04 A;  4CLC B;  3SS3 A;  4MN6 A;  4LGW A;  4S2N A;  5A90 A;  2ZC3 B;  4NK3 A;  3WS1 A;  2Y55 A;  3BFE A;  4FUW A;  4LV2 A;  2IWC A;  1W5D A;  4S2L A;  5TBM B;  5DKK A;  3K3C A;  4JXV A;  1KGG A;  2QJ5 A;  3FKW A;  4JXS A;  3R7W B;  3ZFZ A;  4E6W A;  1ODV A;  4MEZ A;  1YSP A;  1IFQ A;  2XEP A;  4KZ8 A;  3CIT A;  5AQA A;  2P08 A;  3U2A A;  4Z1W A;  5TFQ A;  4O0P A;  4GDN A;  1IYQ A;  2QWS A;  4DJ2 A;  2Y2O A;  1IKI A;  3G2Y A;  1ONH A;  2VA0 A;  3MFX A;  4FH2 A;  4X1L A;  1MWR A;  4H6J A;  5F1G A;  2QJ7 A;  1OME A;  2E8J A;  4BBT A;  1XJ2 A;  1PYY A;  2V2F F;  3FKV A;  4R3J A;  3GSG A;  4LCM A;  4JGQ A;  4KUK A;  4L9G A;  3BFG A;  1NRJ A;  3HLB A;  2Y8H A;  1MWU A;  1KE4 A;  1ES2 A;  1BUE A;  3Q1F A;  3C8C A;  4RYE A;  2L4R A;  5GL9 A;  4HI4 A;  2WGV A;  3MZE A;  1K6R A;  3M2J A;  1J9M A;  1F9I A;  2Z6D A;  3W4P A;  1CK3 A;  5L8M A;  1QME A;  3RXW A;  5FQM A;  1CI8 A;  5HWV A;  1G5U A;  2QKP A;  3F1O A;  3E2L A;  3PBR A;  3IXD A;  3O86 A;  2JKR I;  1XGJ A;  2M1C A;  2VGJ A;  4G3W A;  2WK0 A;  3ZG0 A;  3IX4 A;  4O7D A;  3UB6 A;  4BBV A;  2KOI A;  3V5M A;  4PKY A;  4IVK A;  4BEN A;  1XA7 A;  1F5M A;  3ZG7 B;  2G2W A;  4RVA A;  5CXW A;  2A2L A;  3Q81 A;  1Y4O A;  4A5R A;  3NI9 A;  3C5A A;  2QPN A;  5FAT A;  1K56 A;  3UE6 A;  2Q9M A;  3UPP A;  3Q07 A;  5FQQ A;  3GR2 A;  3E4P A;  4LV0 A;  4WUJ A;  3W4Q A;  4CPK A;  3VP3 A;  5L09 A;  4EQ1 A;  4B9O A;  2HGV A;  3SOI A;  3CLO A;  5IU1 A;  3MQ0 A;  5EVI A;  3ISG A;  3E2K A;  3O3V A;  1RP5 A;  3BFD A;  1TDL A;  3ZNY A;  3PBT A;  3QP2 A;  4GW9 A;  3T4T A;  4D2O A;  1FR6 A;  1FIK A;  4MBF A;  2PR6 A;  1F98 A;  1UWN X;  5M19 A;  3N8R A;  4HHD A;  3T1R A;  3HVF A;  1P9W A;  5F69 A;  4UA7 A;  1LSW A;  4WMC D;  4ME4 A;  1YQS A;  2KX6 A;  1JWP A;  1P9R A;  4BL2 A;  2Y2G A;  2PR5 A;  4ARZ B;  1E3U D;  1ERO A;  2VV7 A;  1H3Q A;  1S0W A;  3OPP A;  2BTF P;  3IWI A;  3C7V A;  3BM6 A;  3P09 A;  4DE1 A;  4WEK A;  4XUZ A;  1CJF A;  1T18 A;  2OSU A;  5EPH A;  3TW8 A;  1V9Z A;  3IBJ A;  4WLA A;  4FTX A;  3BLM A;  3M6B A;  2EX2 A;  3O88 A;  1PW8 A;  3A0S A;  2H0T A;  3KO6 A;  4MN7 A;  3EOI A;  3IF6 C;  4OPZ A;  2C5W B;  2XGN A;  3UB8 A;  2ZL1 A;  5KMW A;  3EQV A;  4CQH A;  3ZNT A;  1SKO A;  2WKQ A;  2ZMF A;  1O7E A;  5J3W A;  3HJK A;  4EER A;  4MBK A;  1OT6 A;  4Y7P A;  5EM1 A;  3LO7 A;  4H6J B;  4LRX C;  2WKP A;  1GA9 A;  4JF6 A;  5KZH A;  5U47 A;  1SHV A;  5HDD A;  2GX5 A;  2WKR A;  4KQD A;  5CRF A;  5DF8 A;  1ERQ A;  3DTE A;  3IXG A;  1AWI A;  1LSV A;  4BMW A;  5I94 A;  2XRO A;  5HX9 A;  1Q2Q A;  4PM9 A;  4GCZ A;  1Y28 A;  4WN5 A;  3V39 A;  5FEF A;  4S2J A;  3LY4 A;  3LR0 A;  1NLY A;  5AVE A;  5EVL A;  1XFQ A;  3GMW A;  3F1P A;  4KUO A;  3WS5 A;  3F1O B;  3WS4 A;  1XFN A;  1BT5 A;  1I2S A;  1WA9 A;  4I5S A;  4KQQ A;  1OJG A;  3EEA A;  3KSG A;  5M1A A;  1BSG A;  3CPT A;  1TD5 A;  3NUL A;  3IX3 A;  1M6K A;  4X25 A;  1TDG A;  3LIA A;  3VSK A;  2HZ5 A;  1PWD A;  4Q8I A;  1T1C A;  5HWW A;  3GEC A;  2JKT I;  3PYP A;  4WBG A;  4GD6 A;  4HOI A;  2VZW A;  3T1X A;  5FQK A;  1CEF A;  3LR4 A;  5FAS A;  5GLD A;  3VFF A;  1K38 A;  1OTI A;  1XP4 A;  2YKH A;  3QP5 A;  2Q9N A;  1TF1 A;  2J3T D;  4FSF A;  1FSW A;  2LB9 A;  5EVI B;  5L10 A;  4PM7 A;  4KZ7 A;  5CED A;  4DMZ A;  5E2G A;  4DXC A;  2J9P A;  4Y0O A;  4OOY A;  2P7J A;  1HTZ A;  1ZTU A;  2O9C A;  4QJG A;  3E98 A;  2W1R A;  1YLP A;  3BJN A;  3DTK A;  3ZYT A;  4QY6 A;  1GSW A;  1DP6 A;  4P6Z S;  3UB7 A;  3BLS A;  3I7J A;  5IT5 A;  1L0F A;  4IVI A;  5CHJ A;  3BEC A;  1LL5 A;  2VJW A;  5E2E A;  4M3K A;  3NC8 A;  3JPU A;  2DMW A;  3HCY A;  3V67 A;  1YMS A;  2WZZ A;  3MR0 A;  3RJU A;  1ZG4 A;  2XRN A;  5LBR A;  3ZDJ A;  4HH2 A;  2EX8 A;  4L0L A;  3OOV A;  5A91 A;  1ESU A;  1E3U A;  5EV0 A;  1W79 A;  3Q82 A;  4EBP A;  1P97 A;  3WS0 A;  3RXX A;  5EOE A;  4X56 A;  2W3D A;  1K0K A;  3DTM A;  1S1Y A;  4OQH A;  1BTL A;  4YIN A;  4E3M A;  1VEU A;  1NY0 A;  4JGO A;  1KGF A;  5GHX A;  3G35 A;  4L9F A;  2ZL1 B;  5CHM A;  4E3O A;  3DWK A;  1RCJ A;  1SKO B;  3GV9 A;  3KSI A;  3MZF A;  1YM1 A;  1KDS A;  3IBR A;  3O5Y A;  1K56 D;  1CEG A;  1XPB A;  3KYZ A;  4LV1 A;  1S67 L;  2OAQ 1;  4K08 A;  1NJ4 A;  2PHY A;  1FOF A;  3UDX A;  2JE5 A;  4WZ4 A;  4WEJ A;  2WGW A;  4OQI A;  1ZC2 A;  2JBF A;  5DVA A;  5HW3 A;  3B3X A;  3N6I A;  3PBO A;  4LRY C;  4WZ5 C;  4PHT A;  5AJG A;  5EVI D;  5FQ9 A;  2JKG A;  1LT0 A;  1K57 C;  3AGD A;  4S2P A;  5CX7 A;  1WYC A;  4WM9 A;  3N4I A;  1HD8 A;  5F1F A;  1O07 A;  3F1P B;  1IEL A;  3QHY A;  3T50 A;  4Q0I A;  4P85 A;  5EM0 A;  1KGE A;  1MBL A;  2PDR A;  1DY6 A;  3Q7Z A;  1TS6 A;  3W8K A;  2A24 A;  2GZA A;  3G34 A;  5FAQ A;  3VP1 A;  5D3O A;  3WS2 A;  5I5L A;  1VM1 A;  3CPT B;  2W3E A;  3MKE A;  3LUQ A;  1D1J A;  3K2N A;  3M6H A;  2GNX A;  4DN0 A;  4WEL A;  4ID4 A;  1L2S A;  3N8S A;  3MMH A;  4HH3 A;  2WUQ A;  1YLY A;  1DJC A;  1PI5 A;  1YLZ A;  1F2K A;  4HJ6 A;  5EUA A;  3PBS A;  1BZA A;  4R70 A;  4MLL A;  2V0W A;  2OWJ A;  4PPR A;  4HEF A;  4BJP A;  5BOH A;  3JYI A;  2XQZ A;  5GHY A;  3IF5 A;  3BYD A;  1K54 C;  3GVB A;  2DNS A;  4HNB A;  4EWF A;  3D3O A;  1ES3 A;  1IYO A;  2WGI A;  3PHY A;  4NXB A;  2WAF A;  1L0E A;  2FH5 A;  4U0X A;  2PYR A;  2NUP C;  2QHK A;  1PWC A;  4FOF A;  1UGU A;  4CLC C;  3MS6 A;  3UDI A;  1VHM A;  4LFU A;  4MDZ A;  5DKL A;  2PBY A;  4EW7 A;  1WE4 A;  4ETZ A;  5HZH A;  2CC1 A;  4KG2 A;  3A3E A;  2EXB A;  5C5K A;  3OPR A;  3A0R A;  3MXR A;  1TS7 A;  3FPW A;  3T1S A;  3KSH A;  4QHC A;  3FV7 A;  2ZLY A;  2WKH A;  4UHU A;  3H9W A;  2M7V A;  4DKI A;  1KVM A;  5CGW A;  1T1B A;  5E43 A;  3OPL A;  3MJQ A;  1X0O A;  5KSH A;  2QZ6 A;  2HJ9 C;  2JKF A;  1NYM A;  3NOT C;  5L2F A;  1VEU B;  1TS8 A;  2KDK A;  1MY8 A;  2OV5 A;  4CLC E;  3LEQ A;  1JWV A;  2D01 A;  4G3K A;  2EA9 A;  1JWZ A;  4DXB A;  1CF0 A;  3L7H A;  3SH9 A;  4OKP A;  3UB9 A;  4LPZ A;  2WGW B;  3TRC A;  2NUT C;  4OH0 A;  2WKI A;  4ZJ1 A;  2OOL A;  3A3J A;  1H8M A;  4KG5 A;  4O8G A;  4OLG A;  2R9X A;  4L9E A;  1S66 L;  2PYP A;  5EOO A;  1EWZ A;  2XFS A;  3F1N A;  2P9V A;  2VEA A;  2V9A A;  3M2K A;  2I9V A;  4MBH A;  4DDY A;  1L3L A;  3TE8 A;  1OJ5 A;  2QMI A;  4QPR A;  4HJ3 A;  3KSF A;  1KVL A;  1NYY A;  2XSS A;  4RX3 A;  3NDG A;  4P6Z M;  1YMX A;  4X1M A;  3BQ8 A;  1LSX A;  2L0W A;  2B5R A;  1KOU A;  2PU4 A;  1YPR A;  3EWK A;  1VB6 A;  3VSL A;  1ZHH B;  4OVD A;  4WYY A;  5L07 A;  2A24 B;  2K31 A;  1BLS A;  5EEC A;  2Y2K A;  4JXW A;  4BWI A;  2XLN A;  4XXR A;  4Q0H A;  2P04 A;  1OTE A;  4E3J A;  5FI7 A;  2O9B A;  3E4Q A;  3HUM A;  2ZQ7 A;  2XA7 S;  1LLB A;  4OPY A;  2VV6 A; 
#chains in the Genus database with same CATH homology
 3GDI A;  3MF0 A;  1LL8 A;  3CAX A;  2PT7 A;  3PBQ A;  4GLQ A;  5DFY A;  3LIA A;  1T19 A;  3VV4 A;  1OT9 A;  1GSX A;  1T1C A;  3OCL A;  5HWW A;  3GEC A;  2JKT I;  1S4R A;  1NWZ A;  3C30 A;  3PYP A;  1W63 M;  4HIA A;  4WF0 A;  4YNR A;  4IUK A;  3MQQ A;  4HOI A;  2VZW A;  3IS2 A;  4I38 A;  3S7P A;  3PBN A;  4AFI A;  2VLG A;  4YWZ A;  3EEH A;  3BWL A;  4EXO A;  2O0Y A;  3LR4 A;  4B93 A;  2GJ3 A;  3OCN A;  5HPI A;  1W63 Q;  2ZOI A;  1OTI A;  1N9L A;  2YKH A;  2O9A A;  1TF1 A;  3B33 A;  2J3T D;  4FSF A;  4Y2F A;  3E0Y A;  2LB9 A;  4DMZ A;  3BW6 A;  1GSV A;  4MMN A;  3PXP A;  2P7J A;  1ZTU A;  1N9N A;  4O01 A;  4XT2 B;  3R4K A;  5HL6 A;  2O9C A;  4JGP A;  1IOU A;  3E98 A;  1S4S A;  2W1R A;  3FPV A;  4ZRR A;  2VX8 A;  5J7E A;  4HJ4 A;  3BJN A;  3B47 A;  3LYX A;  3OBF A;  3ZYT A;  1GSW A;  1XJ4 A;  2W1T A;  3CI6 A;  1DP6 A;  4P6Z S;  3UB7 A;  5HWT A;  5HSQ A;  4I3A A;  2Y79 A;  3B42 A;  3H82 A;  4M4X A;  5IT5 A;  3LR5 A;  5DJT A;  5FL3 A;  3OC2 A;  2W3F A;  4MCW A;  2K2N A;  2VJW A;  1DRM A;  2JN7 A;  4OOM A;  3T4O A;  2DMW A;  2V1B A;  3G6O A;  3HCY A;  3V67 A;  3LIC A;  3LID A;  5F5Y A;  4R38 A;  3MR0 A;  3LIE A;  2VKS A;  4F3L A;  1P0Z A;  2XRN A;  5LBR A;  3ULF A;  4CLC D;  4ARZ A;  5DJU A;  4I3I A;  4HH2 A;  4NXG A;  4HP4 A;  4E04 A;  1TS0 A;  4L0L A;  3OOV A;  4CLC B;  3LR3 A;  4MN6 A;  2VGL M;  3S7O A;  1P97 A;  5TBM B;  3T4J A;  3VE3 A;  5DKK A;  2W3D A;  1S1Y A;  3A0V A;  4JGO A;  3K3C A;  4L9F A;  2QJ5 A;  2HF6 A;  3R7W B;  3NOP C;  2W27 A;  5F6A A;  1ODV A;  1YSP A;  1IFQ A;  2HV1 A;  3CIT A;  3KSI A;  3MQO A;  2P08 A;  3U2A A;  4Z1W A;  2J80 A;  4LRZ E;  3MXQ A;  2EWW A;  4O0P A;  3IBR A;  3O5Y A;  2QWS A;  4DJ2 A;  4RQ9 A;  3KYZ A;  5K5B A;  2L1M A;  1S67 L;  2OAQ 1;  4K08 A;  5J4E A;  2PHY A;  1D7E A;  2VA0 A;  3MFX A;  3ICY A;  3VE4 A;  3SW1 A;  1OTB A;  4WEJ A;  4H6J A;  5DF9 A;  2JKT M;  2QJ7 A;  4NXE A;  4BBT A;  1XJ2 A;  3F1N B;  2LB5 A;  3PBO A;  4LRY C;  2IA2 A;  4EET B;  5A8B A;  3BQA A;  3P7N A;  2VV8 A;  4PHT A;  3RH8 B;  5AJG A;  3LIB A;  3C38 A;  3RTY A;  1MC0 A;  3KYQ A;  4GS9 A;  4JGQ A;  4KUK A;  4DJ3 A;  4L9G A;  1LT0 A;  1NRJ A;  2O99 A;  2Y8H A;  4GHI B;  2FZ0 A;  5CX7 A;  2PD8 A;  3C8C A;  3D72 A;  1OTD A;  3H7W A;  2L4R A;  4HI4 A;  2OWH A;  4GJ4 A;  2W3G A;  1F9I A;  1YKD A;  2Z6D A;  1MKM A;  4Y3I A;  3F1P B;  1N9O A;  2D02 A;  4EES A;  4UQI M;  5L8M A;  3T50 A;  4Q0I A;  5HD3 A;  2ZMV A;  2PDR A;  1YSQ A;  5HWV A;  1TS6 A;  2QKP A;  2VGL S;  3F1O A;  4PAU A;  3PBR A;  2A24 A;  2GZA A;  2JKR I;  5I5L A;  2M1C A;  2W3E A;  1YAX A;  4G3W A;  3EGX C;  3RFB A;  5HD5 A;  3LUQ A;  3K2N A;  4EUV A;  1V9Y A;  2GNX A;  3UMD A;  4DN0 A;  4II7 A;  3UB6 A;  4WEL A;  4BBV A;  2KOI A;  4GHI A;  4PKY A;  5DFX A;  5F68 A;  1F5M A;  3MMH A;  4HH3 A;  1BYW A;  4Q0J A;  3T4K A;  5MC7 A;  2A2L A;  3W2Z A;  3IS2 B;  4HJ6 A;  2J3T C;  3JVU A;  2V0U A;  3PBS A;  4R70 A;  3UE6 A;  2QYB A;  2V0W A;  2OWJ A;  4BJP A;  4PKY G;  3E4P A;  4WL9 A;  1XJ6 A;  2R78 A;  4Y5F A;  4WUJ A;  4R6L A;  3TJZ C;  1D06 A;  4EQ1 A;  4B9O A;  2HGV A;  5G4Z A;  4HNB A;  3CLO A;  3D3O A;  5IU1 A;  3MQ0 A;  1DP8 A;  2INW A;  3DBA A;  4R3A A;  3C2W A;  4OOL A;  3BY8 A;  5KIZ A;  3PHY A;  4NXB A;  4EEP A;  3JVV A;  3PBT A;  4IUH A;  3NJA A;  4GW9 A;  3K3D A;  3CWF A;  4IJG A;  2FH5 A;  4XT2 A;  2PYR A;  3T4T A;  2NUP C;  1UWP X;  1NLZ A;  2W1T B;  3LFV A;  2PR6 A;  4HY8 A;  1F98 A;  2CMN A;  4NEE D;  2K7S A;  1UWN X;  1JNU A;  2QHK A;  4FOF A;  4HHD A;  3FG8 A;  1UGU A;  3H82 B;  4CLC C;  1P9W A;  5F69 A;  1VHM A;  5AVF A;  2B02 A;  1LSW A;  4MDZ A;  4ME4 A;  4UQI S;  5DKL A;  4EU0 A;  4EW7 A;  3UE3 A;  2M7U A;  2KX6 A;  2PD7 A;  4HP9 A;  4ETZ A;  5HZH A;  1XJ3 A;  4F3L B;  1OPX A;  1P9R A;  3HJI A;  2PR5 A;  5IS1 A;  4ARZ B;  5C5K A;  3KX0 X;  3A0R A;  2VV7 A;  2W0N A;  4G3V A;  1MZU A;  1H3Q A;  2EWV A;  1TS7 A;  3FPW A;  3KSH A;  4JGR A;  3OLO A;  5HDS A;  4WEK A;  1T18 A;  3CUE A;  3H9W A;  2M7V A;  4CLC A;  3TW8 A;  4I3J A;  1T1B A;  3BY9 A;  3MJQ A;  1X0O A;  1OTA A;  3S7Q A;  5KSH A;  1V9Z A;  2HJ9 C;  3E4O A;  3IBJ A;  4WLA A;  2XA7 M;  3NOT C;  3T4Q A;  1TS8 A;  2KDK A;  2V1A A;  5TBM A;  4CLC E;  5G4Y A;  3A0S A;  4IHQ A;  2D01 A;  3NOU C;  3UME A;  3KO6 A;  4G3K A;  2OAP 1;  4MN7 A;  3EOI A;  3UB8 A;  2EA9 A;  3R7W A;  3T4S A;  3VOL A;  3EQV A;  4CQH A;  2JKR M;  2WKQ A;  2ZMF A;  1STZ A;  4BBU A;  5J3W A;  3HJK A;  4EER A;  1OT6 A;  1T1A A;  4LLO B;  4NKP A;  3UB9 A;  4LPZ A;  2B18 A;  4H6J B;  2NUT C;  4LRX C;  3TRC A;  2WKP A;  2OOL A;  3LI8 A;  4HQA A;  1H8M A;  4O8G A;  5HDD A;  4L9E A;  2HJE A;  2GX5 A;  2WKR A;  1S66 L;  4KQD A;  1S1Z A;  2MJ6 A;  2JHE A;  2PYP A;  2H28 A;  4GS9 B;  3F1N A;  2KLI A;  4ETX A;  5HPF A;  1EW0 A;  2VEA A;  2V9A A;  1LSV A;  3T4L A;  1G6O A;  4BMW A;  2I9V A;  4UEY A;  3EQU A;  3H7W B;  2XRO A;  1G28 A;  3TE8 A;  1OJ5 A;  5TJJ A;  2BAS A;  4QPR A;  4HJ3 A;  3KSF A;  1DP9 A;  4GCZ A;  3S7N A;  1Y28 A;  2XSS A;  4WN5 A;  2G7U A;  4P6Z M;  3NHQ A;  2ZOH A;  3LR0 A;  1NLY A;  4EEU A;  5AVE A;  4KQO A;  3BQ8 A;  1LSX A;  3PR6 A;  5EFW A;  1XFQ A;  4NXF A;  2L0W A;  3LI9 A;  2YKF A;  1KOU A;  3F1P A;  3EWK A;  3LIF A;  4KUO A;  1VB6 A;  5HDC A;  2Z6C A;  4I39 A;  4YOF A;  1ZHH B;  3F1O B;  2ZBB A;  1XFN A;  2A24 B;  2W3H A;  1WA9 A;  2J3W A;  2K31 A;  4MN5 A;  3EGD C;  4I5S A;  4BWI A;  3P01 A;  2P04 A;  4Q0H A;  1OJG A;  1OTE A;  3CUE C;  3EEA A;  3KSG A;  2O9B A;  3E4Q A;  3FC7 A;  2XA7 S;  1TD5 A;  3ZQ5 A;  2VV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...