1W63M

Ap1 clathrin adaptor core
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
422
structure length
388
Chain Sequence
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEFITQEGHKLETGVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFGLKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQAIPWVRYITQNGDYQLRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Clathrin Adaptor Protein 1 Core
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
total genus 67
structure length 388
sequence length 422
chains with identical sequence N, O, P, R, V
ec nomenclature
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1w63M01
4P6ZS 3TJZC 2VGLM 2JKRI 2JKTI 2XA7S 5MC7A 2VGLS 4UQIS 4P6ZM 1W63M 4NEED 4UQIM 2JKTM 2JKRM 2FH5A 1NRJA 2HF6A 1W63Q 2XA7M
chains in the Genus database with same CATH superfamily
1LI9A 3IBJA 1YKDA 3OC2A 5A92A 1SDNA 4WL9A 2E8JA 2XR0A 2HP6A 1ZTUA 2Y91A 1GHMA 5FI6A 3VOYA 3GV9A 1STZA 3IF6A 1K55C 2JKRM 3IS2A 3OCLA 3U2AA 1F5MA 2ZOIA 3OLOA 4FH4A 2WGVA 4M4XA 1LSWA 5M1AA 2WKEA 3S1YA 1WE4A 5LBRA 4I3IA 1DP6A 3LIAA 5KSCA 5K5BA 1ESUA 2GZAA 4PPRA 2OOLA 3ZVWA 1PI5A 4F94A 1WA9A 5HDDA 1FOFA 1S1YA 1CJFA 3HUNA 4G3VA 3NOPC 2H10A 1NRJA 4KG5A 1LL5A 5HD3A 1K4FA 4N9KA 2I72A 2QZ6A 3EEHA 2DNSA 2Q9NA 3EGXC 3C8CA 2P7JA 1XGJA 1IYOA 4GCZA 1G6AA 4N1XA 3BQ8A 2D01A 3N6IA 4OPZA 5KIZA 4LCMA 4S2NA 3EGDC 1Y54A 5L09A 2Z2MB 3A0SA 1S4RA 3MR0A 2PR5A 5GHYA 1XA7A 3IXGA 1KDSA 3L9KA 1MKIA 1PIOA 3WWXA 4I5SA 1IKGA 1RGZA 5FDHA 2J8YA 3SS3A 1L3LA 2X02A 4JF6A 3MZDA 2EXBA 5IU1A 1PZPA 3MZFA 3RH8B 4WEKA 4OPQA 3NOUC 4EBNA 4HBTA 1F98A 1KOUA 3AGFA 2QJ5A 1K6RA 1FILA 5EE8A 2E8IA 1TS7A 2Y59A 2H5SA 1HD8A 5EVEA 1SKFA 4CLCD 4OP8A 4IBRA 3N8SA 3FC7A 3SZTA 3CZDA 3ISGA 3LYXA 4KG6A 3G4PA 4GLQA 1HZOA 2FFYA 4UQIS 5HPFA 1XP4A 5HDCA 5HWWA 1LSXA 3JVUA 2PT7A 1LL9A 3OPLA 5HDSA 2J9OA 3LGOA 3B47A 2WZZA 4QHCA 5A8BA 1IYPA 1IELA 4Q0HA 1D7EA 1Q2PA 1MY8A 5GLAA 3S7QA 3IH8A 2C5WB 5CECA 3LEZA 1CF0A 4EESA 3A3IA 3R4KA 1VM1A 4KQQA 5CEBA 4MBHA 3ITBA 4JF5A 3IBRA 2HJ9C 1NYYA 2VKSA 4WZ5C 3ZG9B 4R6LA 4BBVA 1GHPA 2VGLM 3E98A 4JBFA 4JGOA 4DE2A 3FKWA 3CPTA 2V1ZA 3F1PA 4K0WA 1P0ZA 3PXPA 4EEUA 2ZQ8A 1K38A 1JTDA 2IWBA 2ZMVA 3CI6A 4F3LA 4JXVA 3QP4A 1KE0A 1O07A 4X1MA 5E2EA 2WYXA 3ZHHA 2HZ5A 3LO7A 3FYZA 1K56D 5U47A 1H8ZA 5I5LA 3T1RA 4OQHA 3UB7A 3MQ0A 2PD8A 1OT9A 5HSQA 5CX7A 2W3EA 2JN7A 2W1TB 1H8MA 3W4PA 1EWZA 3UB9A 5A91A 4R70A 3ZNTA 1L0EA 1KE3A 5GHZA 3V5MA 3SH9A 4DE3A 3K3DA 2ZMAA 2P9VA 2B5RA 3NJAA 4DF6A 3UE6A 3C4OA 1U60A 3P98A 3GECA 2ZQ7A 4OKPA 1YQSA 4FD8A 1S6RA 1W8YA 4GS9A 4ZRRA 3ZCZA 3TW8A 4EEPA 1RGYA 3UPNA 4PM5A 4DE1A 1FR1A 1OT6A 3RFBA 1QMEA 2KDKA 2ZLYA 4UEYA 5EPHA 3FG8A 5EVLA 5G4YA 4X1LA 2ZQCA 3DTIA 1Z6FA 4IJGA 2PR6A 2Y2GA 3ICYA 3TRCA 2FFFB 2VEAA 2FZ0A 3KSHA 1VHMA 5HL1A 4KZ5A 4EUVA 2A3UA 1FQGA 1XXMA 3UN7A 1K6SA 3OPPA 4I39A 4GD8A 1ERQA 3M6HA 1ODVA 4R1GA 1DRMA 2PU4A 5DTKA 2JCHA 2G2WA 3N8RA 5FQJA 1ONHA 3RXXA 4P6BA 2QWSA 3EOIA 5FL3A 1K57C 3HL9A 1LSVA 2HDSA 2PYPA 5HWVA 4O0PA 2CC1A 3UE0A 5KSHA 5DKLA 4C3QA 5DFXA 4FSFA 2V1BA 3KX0X 4KZ7A 2P08A 2WKQA 3UMEA 3E0YA 1T18A 3GTCA 1IYQA 2XSSA 1ZG4A 4JKTA 1PZOA 1FIKA 3LR4A 2YKHA 2KX6A 1YLYA 4HESA 4LENA 4CLCC 1SDEA 3IXBA 1W5DA 1BYWA 1PW8A 3VSLA 2DMWA 4N92A 4GN2A 5AQ9A 2K31A 4IEDA 3HCYA 3P09A 4P6ZM 2VV6A 4II7A 1OJGA 2XK1A 3MS6A 5E2FA 2EWVA 1YPRA 3A3EA 3T1XA 1DJBA 2HGVA 4X53A 3T4SA 3F1NB 4JPMA 3UMDA 2HP9A 4YFMA 4OLGA 4H8RA 4MN5A 5HZHA 4QJGA 1QMFA 4EW7A 1Y4OA 5GLDA 3QP5A 4NXGA 3QNBA 3Q7ZA 4QU3A 5F82A 5A93A 5CTNA 4L0LA 5TR7A 5FSRA 4MBFA 1CK3A 4C6YA 2WKIA 1I2SA 3U4LP 3P7NA 3T4QA 3H9WA 5FDSA 3E4PA 3PBTA 4DDSA 5FQ9A 1JNUA 1V9YA 2XEPA 3Q7VA 2XROA 1G5UA 1MPLA 5EVIC 1KDWA 2QPNA 1PFLA 2WKPA 4WN5A 4WUJA 2Y2QA 2HPBA 3OCNA 3B42A 2VLGA 4IBXA 3LR5A 2AVXA 2L0WA 1W79A 5JYPA 5E2HA 4QY6A 5EUAA 5E43A 2Z2LB 5FASA 3KO6A 4S2KA 4B93A 3G32A 2PBDP 2CMNA 3DTMA 3C7VA 4X25A 5F83A 1W7FA 1XJ6A 3SOIA 2G7UA 1K57A 1WYBA 3HLBA 1K4EA 3IWQA 3P01A 5TFQA 2IA2A 4Y0TA 1GSVA 2XA7M 1S66L 1C3BA 5J8XA 3QP1A 1G6OA 3M6BA 3FWLA 4JGPA 3BFEA 5F6AA 5CGXA 3GRJA 2Y2PA 2J3TD 4FCFA 1M40A 3OPHA 1UGUA 2K7SA 1TDGA 4RYEA 1VEUB 5M19A 4KQRA 3HLCA 1E3UD 3EEAA 3UE3A 2XH9A 4MCWA 1W63M 2Y2OA 2X01A 3JYIA 1BZAA 4Q0JA 2L4RA 2QJ7A 2ZBBA 3NIAA 4KENB 4KQOA 2ZQAA 2NUPC 4CPKA 3N7WA 3Q81A 4JF4A 1J9MA 3NBLA 3G2YA 2HJEA 4Y2FA 3MSHA 3PHYA 1ZKJA 4ESPA 4S2LA 5HX9A 2VX8A 1CQAA 4ETXA 4Y13A 2LB9A 2ZM8A 3MMHA 3CPTB 1T1AA 4E6XA 3UDXA 3DWKA 3C2WA 3UDIA 3D3OA 1FSYA 3WS2A 4BD1A 3B3XA 2OLUA 2Y2IA 1Q2QA 4NKPA 4MEZA 2RL3A 1K54C 2JKTM 4DRTA 4LLOB 3WS5A 2JE5A 2ZM0A 2W0NA 3LY4A 1TVFA 3LCEA 5CHUA 3VFFA 4KQDA 3NULA 3MQQA 2R9XA 5CTMA 2MJ6A 3SS4A 5DF7A 2V8FA 3OOVA 3T1QB 4NXBA 3RJUA 2EFXA 4BL2A 5TJJA 3T4JA 3HBRA 4CQHA 1ZC2A 1YLWA 1TS8A 1XA1A 5HARA 4OPRA 3C7UA 3BRMA 3ULFA 2R9WA 1IFQA 1ZHHB 4PHTA 3T12B 4HI4A 3F1OA 3GMWA 1S67L 2W3FA 2J7VA 2XRNA 4PM9A 5BOHA 1GSWA 4WZ4A 3O3VA 4LRYC 1LLBA 5TGFA 3VE4A 2BLSA 1PNEA 1OTEA 2EFUA 3V39A 1H0MA 1WYCA 4DN0A 1M6KA 1I2WA 1MC0A 5IS1A 4XUXA 1OJ5A 4PM7A 2VZWA 5AJGA 4WF0A 1N9NA 3VFHA 3LY3A 1NRFA 4XUZA 2W3DA 1DJAA 3A3JA 1FCNA 4O8GA 2Y2LA 4S2JA 3ZGAB 4WELA 1BLHA 4HIAA 3UE1A 3V67A 4DJ3A 2W27A 3G31A 4LV1A 2PD7A 2ZC5B 4BJPA 2P74A 1W63Q 3O87A 2VK3A 4LPZA 4K0XA 2EWWA 4CJNA 3TG9A 3QP2A 1TDLA 4I38A 3WRZA 3IWOA 5L8MA 4QY5A 2FH5A 5DF9A 3MBZA 2WGWA 4HJ6A 3ZDJA 5J7EA 2WK0A 4RA7A 3LI9A 2PHYA 4WM9A 3ZFZA 3T50A 3G2ZA 2J3TC 5IT5A 3LR0A 3KSFA 5FAQA 3TSGA 4WBGA 3BFCA 2ZMFA 4NEED 4E6WA 4PAUA 2VGLS 2OWJA 2L1MA 4QD4A 4G3KA 3HJIA 3H7WA 2J80A 1K55A 3HLDA 1S1ZA 2J9PA 4H6JA 3QP8A 4OQGA 3PYPA 2ACGA 3BY9A 3BWLA 2XFSA 1VEUA 1MZUA 2HF6A 3S22A 2XA7S 3FPWA 1GA9A 3PAEA 3CAXA 2UV0E 3DW0A 4G3WA 4JGRA 3BLSA 1MBLA 4NXFA 2B18A 2ZD8A 1LL8A 3TE8A 4F3LB 5FI2A 1HLUP 2Y2NA 4E3MA 4AFIA 5F1FA 2G2UA 1O7EA 5DVAA 5I94A 2ZQ9A 2WUQA 1Y28A 5FATA 3CWFA 3IS2B 4R4SA 5FQKA 2Y2MA 4MMNA 1G68A 4WEJA 3L7HA 3D9YA 2EX2A 2H0TA 2HV1A 2H0YA 3B33A 2PDRA 3N4IA 2D02A 5IHVA 3UB8A 2ZC4B 3E2LA 4K08A 4E3NA 2VA0A 3T4OA 4S2PA 1MWUA 4KUOA 2GNXA 4N9LA 1PRQA 3V3SA 4Y5FA 4OQIA 1ONGA 4UA7A 1N9OA 4ARZA 4BL3A 1XJ4A 4WYYA 4E3IA 3A0RA 1YLZA 2WZXA 5AVFA 1N9BA 5DTSA 4RX3A 2V8CA 1V9ZA 5HWTA 4EBPA 4UA9A 4FH2A 5EM1A 4EERA 3ZG7B 3IQAA 1VETB 5DFYA 3UPOA 2WAFA 5CRFA 3ZNYA 4ZJ1A 4X69A 4EV4A 3RXWA 3C5AA 2V20A 3UPPA 2W3HA 2Y79A 3WRTA 4CLCB 4BWIA 1BLPA 3GVBA 4NXEA 1YMXA 3MF0A 4KUKA 2Q9MA 4Y17A 1L0DA 1TD5A 2BG1A 1ERMA 3CG5A 1ES3A 1H3QA 5EM0A 3V3RA 2NUTC 1DP9A 3WS0A 3IXDA 3T1SA 5J3WA 2C6WB 3KSIA 4OOLA 4PM8A 4KG2A 3BFFA 3E4OA 5CGWA 4BENA 1LT0A 1HVBA 1UWNX 2OLVA 2VGJA 2ZOHA 4ZAMA 2O9CA 1CEFA 3IX3A 4R3BA 4Y0UA 2XF3A 2WKHA 3W8KA 1P97A 4S2OA 5HAIA 3PBQA 2V0WA 1JWVA 3O5YA 5M18A 2EX9A 3PBNA 5CGSA 2EX8A 4YOFA 4WLAA 4Q8IA 4DDYA 2PRFA 5HAPA 2WADA 4OH0A 4UA6A 2RCXA 3NDEA 1KE4A 3CHWP 4LGWA 3TJZC 4HY8A 1NWZA 3GSGA 3IHAA 5HL6A 3ZQ5A 4U3TA 2JC7A 4IUHA 3LIFA 4R38A 1KGFA 3VV4A 3C38A 1YLPA 1OTAA 4GJ4A 4I3AA 1ES4A 3IX8A 1F2KA 1K0KA 3S7NA 4JXWA 2YKFA 1MWTA 3K3CA 1SCWA 3MXQA 1MWRA 1K56A 1NLZA 1PWCA 4X55A 2GDNA 3H82B 2PAVP 4B4ZA 3A0VA 4HNBA 1TF1A 4ME4A 5AVEA 2M7VA 3DAVA 3VMAA 2X71A 5CXWA 4U0XA 3CUEA 4EBLA 1MXOA 1YLJA 3DTEA 4KZ4A 2O99A 2HDRA 1UWPX 4GHIA 3NCKA 1VB6A 4CLCE 4GW9A 4XT2B 1T1BA 4UQIM 5GLCA 4S2IA 5GLBA 3PTEA 4LV2A 2Y55A 3FKVA 2R78A 2HDUA 3PAGA 3BW6A 4O01A 3VP1A 2XD5A 1MWSA 3JPUA 2B02A 2KOIA 3PBRA 1F9IA 3G6OA 3LR3A 1FR6A 5HFOA 4MN7A 3OPRA 4GNUA 1H8YA 4EETB 2EXAA 2ZM2A 1CI8A 4EUZA 3IWIA 4GHIB 1SZVA 3HLGA 4PMAA 1YSQA 1YSPA 4ID4A 3UO9A 1ALQA 1IKIA 3CLOA 1VQQA 2JKGA 3D72A 1I5QA 3IH9A 2XFTA 1NY0A 2Z6DA 1NZUA 3DWZA 4ZJ3A 5F68A 3VP0A 3MFXA 4QPRA 1SKOB 4OPYA 1OTIA 1VETA 3UDFA 3ZG8B 2DRWA 5FA7A 5FEFA 1FSWA 3AGDA 1BLCA 5KZHA 4HH3A 4LV3A 1TS0A 5AQAA 4B88A 3ZVTA 3SH7A 2ZJ9A 5FQIA 4ARZB 5F5YA 2A24B 1GHIA 3S7PA 4R3JA 3PR6A 5GHXA 5CEDA 1KVLA 2ZL1B 4BLMA 4BMWA 4R3AA 4XXRA 1BT5A 4GZBA 3WS1A 4L9EA 2PYRA 1FCMA 1XFQA 2M1CA 2ZL1A 4K91A 3NI9A 5FQMA 3BFGA 2GJ3A 4Q0IA 4OP5A 5C5KA 2M7UA 1AWIA 5L10A 3RTYA 3IF6B 2H28A 4R0QA 1XX2A 4FOFA 2I9VA 1PYYA 2BASA 1XJ3A 5J4EA 3NDGA 1GCEA 4OQ0A 4D60A 3A3FA 5KMWA 1SHVA 2DCFA 1A0KA 3EQUA 2JKTI 1T19A 3H7WB 1JTGA 1PWDA 3UB6A 3F1NA 4YINA 4GS9B 1NYMA 3VOZA 2EX6A 1ESIA 3S7OA 3M2KA 2QKPA 3VOLA 4GB7A 5A90A 4OOYA 4N1HA 1BLSA 4OLDA 2Y2KA 3LUQA 5JYOA 1OTBA 2A49A 5EOOA 3VSKA 3HREA 3D4FA 4DMZA 4GOGA 3UB5P 2Y2HA 3T4TA 4BBUA 3KYZA 3Q07A 4UAAA 1RCJA 5FAOA 2Z6CA 5FAPA 1S0WA 5DKKA 1P9WA 4U0TA 3KSGA 4GKUA 1E3UA 4HEFA 4HQAA 1T1CA 1XFNA 2P9VB 4ZTKA 1RP5A 2JBFA 3MXSA 3IF6C 4UHUA 2VV7A 3IHBA 3LFVA 2V0UA 3KYQA 1XPBA 4PM6A 4WZ5A 1GA0A 2O0YA 1D06A 4HOIA 2HDQA 3GDIA 1L0GA 3R7WB 1D1JA 4X68A 5EVIB 1ES2A 5HAQA 4BQMA 1KVMA 1NLYA 4GDNA 3WS4A 3ZG5A 1XJ2A 2OWHA 4EU0A 1ACFA 4Y7PA 4EWFA 4L9FA 4Y15A 4Y0OA 3E2KA 4R23A 4ZJ2A 2IWDA 3MKFA 2KLIA 5TBMA 4NETA 5DJTA 3OBFA 4NG2A 3BM6A 1EW0A 3HJKA 4QB8A 2ZQDA 4PKYA 5EVID 4YWZA 2GX5A 3V50A 1DP8A 4I3JA 5D3OA 2XGNA 3C4PA 2JKRI 1FCOA 2EA9A 2INWA 4H6JB 2OSUA 3FZCA 5EVIA 4E3OA 1JVJA 4QWOA 5CHMA 2W1RA 4DE0A 3TOIA 3BQAA 1PI4A 4LRZE 1CI9A 4ZDXA 1ZG6A 3HLWA 2Y8HA 2ZC7A 5DF8A 5TBMB 1CEGA 2O9BA 4RQ9A 3VP4A 3MFDA 3LICA 4WMCD 4OOMA 3VP2A 2IWCA 1K54A 4Z9QA 3CMZA 2A24A 3HUMA 4GD6A 3W4OA 1OPXA 5EECA 3VP3A 2WGWB 1BUEA 4M3KA 1NXYA 3OZHA 4A5RA 1YAXA 3GQZA 1GSXA 1N9LA 4YNRA 2JHEA 5DJUA 1EROA 2XD1A 2V1AA 1BTLA 1JWPA 5EFWA 3BFDA 3M2JA 3G34A 4S2NC 2A2LA 3ITAA 3T4LA 3CUEC 3EWKA 2VGKA 3I7JA 3PBOA 4FUWA 4JGQA 4PKYG 3LIBA 5FEGA 1N4OA 2O9AA 4MNRA 1MKMA 4B9OA 3NOTC 3HUOA 4GDBA 4KZ6A 3LIEA 4MLLA 1XKZA 2Q0OA 4ETZA 4HH2A 3NY4A 4FTXA 4KZBA 1OTDA 3HLEA 2WKRA 3F1PB 1W8QA 3MKEA 4IHQA 2Y2JA 2W1TA 1EI5A 1G28A 3H82A 3DBAA 3O86A 2B95A 1Z09A 3NC8A 3ZG0A 3GR2A 3QNCA 1DJCA 1L2SA 1IOUA 5F69A 5E2GA 3PBSA 2OV5A 1L0FA 5MC7A 1BULA 1NJ4A 3EQVA 4P6ZS 4E3KA 3N8LA 1H5XA 3IX4A 4XT2A 4BBTA 3Q82A 3QHYA 2HP5A 4P0MA 3AGEA 1OMEA 2WAEA 3NHQA 3S4XA 3BECA 2JKFA 4MN6A 2ZC6B 2VV8A 2QMIA 4O7DA 1KGGA 2Y4AA 4KZ3A 3R7WA 4E3LA 1TEMA 4P85A 2XQZA 5DTTA 2XLNA 1K25A 4DXBA 5HD5A 3CITA 3W4QA 3SH8A 4IUKA 1E25A 1ES5A 2J3WA 3W2ZA 5L2FA 5HW3A 3LI8A 3IT9A 1LHYA 2OAP1 3O88A 4KZ9A 3C30A 2WGIA 1AXBA 4EQ1A 4EXOA 3F1OB 1KGEA 2UWXA 3BEBA 3FPVA 4IVIA 3ZYTA 3UNWA 5AQBA 3BJNA 4MBKA 4Z1WA 3K2NA 1P9RA 4HHDA 1PW1A 3A3DA 1E4DA 5EV0A 3MJQA 1J3WA 3VE3A 1DY6A 4ZBEA 3DTKA 4LRXC 4R4RA 3SW1A 4D2OA 5CERA 4OVDA 5CHJA 3BLMA 3HVFA 4B4XA 3Q7VB 2ZC3B 3T4KA 4E04A 1X0OA 1XGIA 4L9GA 3LEQA 1JWZA 3MZEA 4HJ3A 4S2MA 3JVVA 4WMCA 4X56A 2XDMA 4X6TA 4DKIA 1IYSA 4MDZA 2LB5A 4P87A 3G35A 5FI7A 5EOEA 3LIDA 5HPIA 1SKOA 4NK3A 4BD0A 3HLFA 2OAQ1 5AQ7A 2QHKA 1LI0A 4JXSA 1PWGA 4E3JA 4DXCA 5GL9A 4Y3IA 5L07A 4KZAA 2VJWA 4HP4A 3Q1FA 5FQQA 3SS5A 4RVAA 2V9AA 4LFUA 2PU2A 4IVKA 3BY8A 3IXHA 5G18A 3NECA 1S4SA 3E4QA 4DJ2A 1YMSA 4CLCA 4JXGA 2V2FF 3IF5A 1YM1A 2PBYA 3MXRA 1YLTA 2BTFP 2P04A 2QYBA 3KYEA 5F1GA 1TS6A 3FV7A 3UY6A 4C75A 4HJ4A 1BSGA 1HTZA 4RX2A 3G30A 4OONA 4EQIA 3BYDA 4LCLA 2K2NA 3QP6A 4LV0A 4KZ8A 3MQOA 1IEMA 5G4ZA 3CJMA 1YT4A 4HP9A 2W3GA 1NZOA 4JLFA 4HBUA
chains in the Genus database with same CATH topology
2K31A 2QKPA 3VOLA 3HCYA 4P6ZM 4MMNA 2VV6A 3IBJA 4WEJA 3LUQA 1YKDA 4II7A 1OJGA 3OC2A 1OTBA 2HV1A 3B33A 2EWVA 2PDRA 4WL9A 2D02A 4DMZA 3T4TA 2HGVA 3UB8A 1ZTUA 3T4SA 3F1NB 4BBUA 3UMDA 4K08A 3KYZA 2VA0A 3T4OA 4KUOA 2Z6CA 2GNXA 4MN5A 1STZA 5DKKA 2JKRM 1P9WA 3IS2A 3OCLA 3U2AA 5HZHA 1F5MA 4Y5FA 3KSGA 4EW7A 2ZOIA 3OLOA 1N9OA 4HQAA 4M4XA 4ARZA 1T1CA 1LSWA 1XJ4A 1XFNA 4NXGA 3A0RA 5LBRA 4I3IA 5AVFA 1DP6A 3LIAA 5K5BA 2GZAA 2OOLA 4L0LA 1V9ZA 2VV7A 3LFVA 5HWTA 1WA9A 5HDDA 4EERA 1S1YA 2V0UA 4G3VA 3KYQA 3NOPC 3P7NA 1NRJA 3T4QA 3H9WA 5DFYA 3E4PA 5HD3A 3PBTA 1JNUA 1V9YA 2O0YA 1D06A 4HOIA 2XROA 3GDIA 2W3HA 3R7WB 2Y79A 3EEHA 3EGXC 4CLCB 3C8CA 4BWIA 2P7JA 2WKPA 4WN5A 4WUJA 3OCNA 3MF0A 4GCZA 3B42A 4KUKA 1NLYA 2VLGA 4NXEA 1TD5A 1XJ2A 2OWHA 3LR5A 4EU0A 2L0WA 3BQ8A 2D01A 4L9FA 1H3QA 5KIZA 3KO6A 2NUTC 2KLIA 5TBMA 3EGDC 4B93A 1DP9A 5DJTA 3OBFA 3A0SA 2CMNA 1EW0A 5J3WA 1S4RA 3MR0A 3KSIA 2PR5A 4OOLA 3HJKA 4PKYA 3E4OA 1XJ6A 2G7UA 4YWZA 2GX5A 1LT0A 1DP8A 4I3JA 1UWNX 2ZOHA 2JKRI 3P01A 2O9CA 4I5SA 2IA2A 2EA9A 2INWA 4H6JB 1GSVA 2XA7M 1S66L 1P97A 1G6OA 4JGPA 5F6AA 5IU1A 3RH8B 2W1RA 3PBQA 4WEKA 2V0WA 3O5YA 2J3TD 3BQAA 3NOUC 3PBNA 4LRZE 1UGUA 1F98A 1KOUA 2K7SA 4YOFA 4WLAA 2Y8HA 2QJ5A 5TBMB 2O9BA 4RQ9A 1TS7A 3EEAA 3LICA 4OOMA 3UE3A 4CLCD 3FC7A 2A24A 4MCWA 3LYXA 1W63M 4GLQA 3TJZC 4HY8A 4UQIS 4Q0JA 1OPXA 1NWZA 5HPFA 5HDCA 2L4RA 2QJ7A 5HWWA 2ZBBA 1LSXA 4KQOA 3JVUA 1YAXA 2NUPC 1GSXA 1N9LA 4YNRA 2JHEA 2PT7A 5HL6A 3ZQ5A 5DJUA 2HJEA 2V1AA 4Y2FA 5EFWA 3PHYA 5HDSA 4IUHA 3LIFA 4R38A 3B47A 3VV4A 5A8BA 3C38A 2A2LA 4Q0HA 2VX8A 3T4LA 1OTAA 1D7EA 4GJ4A 4I3AA 3CUEC 3EWKA 3S7QA 4ETXA 3PBOA 3S7NA 4JGQA 2LB9A 4PKYG 3LIBA 2YKFA 3MMHA 3K3CA 1T1AA 4EESA 3MXQA 2O9AA 1NLZA 3C2WA 1MKMA 4B9OA 3NOTC 3H82B 3R4KA 3A0VA 4HNBA 1TF1A 3LIEA 4ME4A 3D3OA 5AVEA 2M7VA 4ETZA 4HH2A 3IBRA 3CUEA 1OTDA 2HJ9C 2VKSA 2WKRA 3F1PB 4NKPA 2JKTM 4IHQA 2W1TA 4R6LA 1G28A 3H82A 4BBVA 2O99A 4LLOB 3DBAA 1UWPX 2VGLM 3E98A 2W0NA 4GHIA 4JGOA 1VB6A 4CLCE 4GW9A 4KQDA 3MQQA 4XT2B 3F1PA 1T1BA 4UQIM 1P0ZA 3PXPA 2MJ6A 1IOUA 4EEUA 5F69A 3PBSA 3OOVA 5MC7A 4NXBA 2ZMVA 3CI6A 3EQVA 4P6ZS 4F3LA 5TJJA 3T4JA 2R78A 4XT2A 4CQHA 4BBTA 1TS8A 3BW6A 4O01A 3ULFA 3NHQA 2B02A 2KOIA 1IFQA 4MN6A 1ZHHB 2VV8A 4PHTA 4HI4A 3PBRA 1F9IA 5I5LA 3G6OA 3F1OA 3R7WA 3UB7A 3LR3A 1S67L 2W3FA 2XRNA 3MQ0A 2PD8A 1OT9A 1GSWA 4MN7A 5CX7A 5HSQA 4LRYC 2W3EA 3VE4A 4EETB 2JN7A 1OTEA 2W1TB 1H8MA 4GHIB 5HD5A 3CITA 3UB9A 4DN0A 4R70A 1YSQA 1YSPA 4IUKA 3K3DA 3CLOA 2J3WA 3W2ZA 1MC0A 3D72A 5IS1A 3LI8A 3NJAA 2OAP1 1OJ5A 3UE6A 2Z6DA 2VZWA 4WF0A 5AJGA 1N9NA 3C30A 5F68A 3MFXA 3GECA 3F1OB 4EQ1A 4EXOA 4QPRA 2W3DA 1OTIA 3FPVA 4GS9A 3ZYTA 4ZRRA 4O8GA 3TW8A 3BJNA 4EEPA 4WELA 4HIAA 4Z1WA 3K2NA 3V67A 1P9RA 4HHDA 4DJ3A 2W27A 1OT6A 3RFBA 4HH3A 2PD7A 3MJQA 2KDKA 1TS0A 3VE3A 4UEYA 4BJPA 1W63Q 4LRXC 4LPZA 3SW1A 2EWWA 3FG8A 5G4YA 4I38A 4E04A 3T4KA 1X0OA 4L9GA 4HJ3A 4ARZB 5F5YA 5L8MA 4IJGA 2A24B 2PR6A 3ICYA 3TRCA 2FH5A 3S7PA 3JVVA 5DF9A 3PR6A 4MDZA 2LB5A 4HJ6A 2VEAA 4BMWA 4R3AA 5J7EA 2FZ0A 3KSHA 3LIDA 5HPIA 1VHMA 3LI9A 2PHYA 4EUVA 3T50A 4L9EA 2J3TC 2PYRA 5IT5A 3LR0A 3KSFA 1XFQA 2M1CA 2OAQ1 4I39A 2QHKA 2GJ3A 4Q0IA 2ZMFA 4NEED 5C5KA 2M7UA 4PAUA 2VGLS 4Y3IA 1ODVA 2OWJA 2VJWA 1DRMA 4HP4A 3RTYA 2L1MA 2V9AA 2H28A 4G3KA 3HJIA 3BY8A 3H7WA 2J80A 2QWSA 1S1ZA 4H6JA 3EOIA 4FOFA 5FL3A 3PYPA 1S4SA 3E4QA 3BY9A 4DJ2A 4CLCA 2I9VA 3BWLA 1LSVA 2BASA 2PYPA 1XJ3A 5J4EA 1MZUA 5HWVA 4O0PA 2HF6A 5KSHA 5DKLA 2XA7S 3FPWA 5DFXA 2P04A 2QYBA 4FSFA 2V1BA 3KX0X 3CAXA 1TS6A 4G3WA 3EQUA 2P08A 2JKTI 4HJ4A 2WKQA 3UMEA 4JGRA 3E0YA 1T18A 1T19A 2XSSA 4NXFA 2B18A 3H7WB 3LR4A 2YKHA 2KX6A 1LL8A 3TE8A 4F3LB 2K2NA 3UB6A 3F1NA 3MQOA 4CLCC 5G4ZA 4AFIA 4GS9B 1BYWA 1Y28A 4HP9A 2DMWA 2W3GA 3CWFA 3IS2B 3S7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P6Z S;  3TJZ C;  2VGL M;  2JKR I;  2JKT I;  2XA7 S;  5MC7 A;  2VGL S;  4UQI S;  4P6Z M;  1W63 M;  4NEE D;  4UQI M;  2JKT M;  2JKR M;  2FH5 A;  1NRJ A;  2HF6 A;  1W63 Q;  2XA7 M; 
#chains in the Genus database with same CATH topology
 1LI9 A;  3IBJ A;  1YKD A;  3OC2 A;  5A92 A;  1SDN A;  4WL9 A;  2E8J A;  2XR0 A;  2HP6 A;  1ZTU A;  2Y91 A;  1GHM A;  5FI6 A;  3VOY A;  3GV9 A;  1STZ A;  3IF6 A;  1K55 C;  2JKR M;  3IS2 A;  3OCL A;  3U2A A;  1F5M A;  2ZOI A;  3OLO A;  4FH4 A;  2WGV A;  4M4X A;  1LSW A;  5M1A A;  2WKE A;  3S1Y A;  1WE4 A;  5LBR A;  4I3I A;  1DP6 A;  3LIA A;  5KSC A;  5K5B A;  1ESU A;  2GZA A;  4PPR A;  2OOL A;  3ZVW A;  1PI5 A;  4F94 A;  1WA9 A;  5HDD A;  1FOF A;  1S1Y A;  1CJF A;  3HUN A;  4G3V A;  3NOP C;  2H10 A;  1NRJ A;  4KG5 A;  1LL5 A;  5HD3 A;  1K4F A;  4N9K A;  2I72 A;  2QZ6 A;  3EEH A;  2DNS A;  2Q9N A;  3EGX C;  3C8C A;  2P7J A;  1XGJ A;  1IYO A;  4GCZ A;  1G6A A;  4N1X A;  3BQ8 A;  2D01 A;  3N6I A;  4OPZ A;  5KIZ A;  4LCM A;  4S2N A;  3EGD C;  1Y54 A;  5L09 A;  2Z2M B;  3A0S A;  1S4R A;  3MR0 A;  2PR5 A;  5GHY A;  1XA7 A;  3IXG A;  1KDS A;  3L9K A;  1MKI A;  1PIO A;  3WWX A;  4I5S A;  1IKG A;  1RGZ A;  5FDH A;  2J8Y A;  3SS3 A;  1L3L A;  2X02 A;  4JF6 A;  3MZD A;  2EXB A;  5IU1 A;  1PZP A;  3MZF A;  3RH8 B;  4WEK A;  4OPQ A;  3NOU C;  4EBN A;  4HBT A;  1F98 A;  1KOU A;  3AGF A;  2QJ5 A;  1K6R A;  1FIL A;  5EE8 A;  2E8I A;  1TS7 A;  2Y59 A;  2H5S A;  1HD8 A;  5EVE A;  1SKF A;  4CLC D;  4OP8 A;  4IBR A;  3N8S A;  3FC7 A;  3SZT A;  3CZD A;  3ISG A;  3LYX A;  4KG6 A;  3G4P A;  4GLQ A;  1HZO A;  2FFY A;  4UQI S;  5HPF A;  1XP4 A;  5HDC A;  5HWW A;  1LSX A;  3JVU A;  2PT7 A;  1LL9 A;  3OPL A;  5HDS A;  2J9O A;  3LGO A;  3B47 A;  2WZZ A;  4QHC A;  5A8B A;  1IYP A;  1IEL A;  4Q0H A;  1D7E A;  1Q2P A;  1MY8 A;  5GLA A;  3S7Q A;  3IH8 A;  2C5W B;  5CEC A;  3LEZ A;  1CF0 A;  4EES A;  3A3I A;  3R4K A;  1VM1 A;  4KQQ A;  5CEB A;  4MBH A;  3ITB A;  4JF5 A;  3IBR A;  2HJ9 C;  1NYY A;  2VKS A;  4WZ5 C;  3ZG9 B;  4R6L A;  4BBV A;  1GHP A;  2VGL M;  3E98 A;  4JBF A;  4JGO A;  4DE2 A;  3FKW A;  3CPT A;  2V1Z A;  3F1P A;  4K0W A;  1P0Z A;  3PXP A;  4EEU A;  2ZQ8 A;  1K38 A;  1JTD A;  2IWB A;  2ZMV A;  3CI6 A;  4F3L A;  4JXV A;  3QP4 A;  1KE0 A;  1O07 A;  4X1M A;  5E2E A;  2WYX A;  3ZHH A;  2HZ5 A;  3LO7 A;  3FYZ A;  1K56 D;  5U47 A;  1H8Z A;  5I5L A;  3T1R A;  4OQH A;  3UB7 A;  3MQ0 A;  2PD8 A;  1OT9 A;  5HSQ A;  5CX7 A;  2W3E A;  2JN7 A;  2W1T B;  1H8M A;  3W4P A;  1EWZ A;  3UB9 A;  5A91 A;  4R70 A;  3ZNT A;  1L0E A;  1KE3 A;  5GHZ A;  3V5M A;  3SH9 A;  4DE3 A;  3K3D A;  2ZMA A;  2P9V A;  2B5R A;  3NJA A;  4DF6 A;  3UE6 A;  3C4O A;  1U60 A;  3P98 A;  3GEC A;  2ZQ7 A;  4OKP A;  1YQS A;  4FD8 A;  1S6R A;  1W8Y A;  4GS9 A;  4ZRR A;  3ZCZ A;  3TW8 A;  4EEP A;  1RGY A;  3UPN A;  4PM5 A;  4DE1 A;  1FR1 A;  1OT6 A;  3RFB A;  1QME A;  2KDK A;  2ZLY A;  4UEY A;  5EPH A;  3FG8 A;  5EVL A;  5G4Y A;  4X1L A;  2ZQC A;  3DTI A;  1Z6F A;  4IJG A;  2PR6 A;  2Y2G A;  3ICY A;  3TRC A;  2FFF B;  2VEA A;  2FZ0 A;  3KSH A;  1VHM A;  5HL1 A;  4KZ5 A;  4EUV A;  2A3U A;  1FQG A;  1XXM A;  3UN7 A;  1K6S A;  3OPP A;  4I39 A;  4GD8 A;  1ERQ A;  3M6H A;  1ODV A;  4R1G A;  1DRM A;  2PU4 A;  5DTK A;  2JCH A;  2G2W A;  3N8R A;  5FQJ A;  1ONH A;  3RXX A;  4P6B A;  2QWS A;  3EOI A;  5FL3 A;  1K57 C;  3HL9 A;  1LSV A;  2HDS A;  2PYP A;  5HWV A;  4O0P A;  2CC1 A;  3UE0 A;  5KSH A;  5DKL A;  4C3Q A;  5DFX A;  4FSF A;  2V1B A;  3KX0 X;  4KZ7 A;  2P08 A;  2WKQ A;  3UME A;  3E0Y A;  1T18 A;  3GTC A;  1IYQ A;  2XSS A;  1ZG4 A;  4JKT A;  1PZO A;  1FIK A;  3LR4 A;  2YKH A;  2KX6 A;  1YLY A;  4HES A;  4LEN A;  4CLC C;  1SDE A;  3IXB A;  1W5D A;  1BYW A;  1PW8 A;  3VSL A;  2DMW A;  4N92 A;  4GN2 A;  5AQ9 A;  2K31 A;  4IED A;  3HCY A;  3P09 A;  4P6Z M;  2VV6 A;  4II7 A;  1OJG A;  2XK1 A;  3MS6 A;  5E2F A;  2EWV A;  1YPR A;  3A3E A;  3T1X A;  1DJB A;  2HGV A;  4X53 A;  3T4S A;  3F1N B;  4JPM A;  3UMD A;  2HP9 A;  4YFM A;  4OLG A;  4H8R A;  4MN5 A;  5HZH A;  4QJG A;  1QMF A;  4EW7 A;  1Y4O A;  5GLD A;  3QP5 A;  4NXG A;  3QNB A;  3Q7Z A;  4QU3 A;  5F82 A;  5A93 A;  5CTN A;  4L0L A;  5TR7 A;  5FSR A;  4MBF A;  1CK3 A;  4C6Y A;  2WKI A;  1I2S A;  3U4L P;  3P7N A;  3T4Q A;  3H9W A;  5FDS A;  3E4P A;  3PBT A;  4DDS A;  5FQ9 A;  1JNU A;  1V9Y A;  2XEP A;  3Q7V A;  2XRO A;  1G5U A;  1MPL A;  5EVI C;  1KDW A;  2QPN A;  1PFL A;  2WKP A;  4WN5 A;  4WUJ A;  2Y2Q A;  2HPB A;  3OCN A;  3B42 A;  2VLG A;  4IBX A;  3LR5 A;  2AVX A;  2L0W A;  1W79 A;  5JYP A;  5E2H A;  4QY6 A;  5EUA A;  5E43 A;  2Z2L B;  5FAS A;  3KO6 A;  4S2K A;  4B93 A;  3G32 A;  2PBD P;  2CMN A;  3DTM A;  3C7V A;  4X25 A;  5F83 A;  1W7F A;  1XJ6 A;  3SOI A;  2G7U A;  1K57 A;  1WYB A;  3HLB A;  1K4E A;  3IWQ A;  3P01 A;  5TFQ A;  2IA2 A;  4Y0T A;  1GSV A;  2XA7 M;  1S66 L;  1C3B A;  5J8X A;  3QP1 A;  1G6O A;  3M6B A;  3FWL A;  4JGP A;  3BFE A;  5F6A A;  5CGX A;  3GRJ A;  2Y2P A;  2J3T D;  4FCF A;  1M40 A;  3OPH A;  1UGU A;  2K7S A;  1TDG A;  4RYE A;  1VEU B;  5M19 A;  4KQR A;  3HLC A;  1E3U D;  3EEA A;  3UE3 A;  2XH9 A;  4MCW A;  1W63 M;  2Y2O A;  2X01 A;  3JYI A;  1BZA A;  4Q0J A;  2L4R A;  2QJ7 A;  2ZBB A;  3NIA A;  4KEN B;  4KQO A;  2ZQA A;  2NUP C;  4CPK A;  3N7W A;  3Q81 A;  4JF4 A;  1J9M A;  3NBL A;  3G2Y A;  2HJE A;  4Y2F A;  3MSH A;  3PHY A;  1ZKJ A;  4ESP A;  4S2L A;  5HX9 A;  2VX8 A;  1CQA A;  4ETX A;  4Y13 A;  2LB9 A;  2ZM8 A;  3MMH A;  3CPT B;  1T1A A;  4E6X A;  3UDX A;  3DWK A;  3C2W A;  3UDI A;  3D3O A;  1FSY A;  3WS2 A;  4BD1 A;  3B3X A;  2OLU A;  2Y2I A;  1Q2Q A;  4NKP A;  4MEZ A;  2RL3 A;  1K54 C;  2JKT M;  4DRT A;  4LLO B;  3WS5 A;  2JE5 A;  2ZM0 A;  2W0N A;  3LY4 A;  1TVF A;  3LCE A;  5CHU A;  3VFF A;  4KQD A;  3NUL A;  3MQQ A;  2R9X A;  5CTM A;  2MJ6 A;  3SS4 A;  5DF7 A;  2V8F A;  3OOV A;  3T1Q B;  4NXB A;  3RJU A;  2EFX A;  4BL2 A;  5TJJ A;  3T4J A;  3HBR A;  4CQH A;  1ZC2 A;  1YLW A;  1TS8 A;  1XA1 A;  5HAR A;  4OPR A;  3C7U A;  3BRM A;  3ULF A;  2R9W A;  1IFQ A;  1ZHH B;  4PHT A;  3T12 B;  4HI4 A;  3F1O A;  3GMW A;  1S67 L;  2W3F A;  2J7V A;  2XRN A;  4PM9 A;  5BOH A;  1GSW A;  4WZ4 A;  3O3V A;  4LRY C;  1LLB A;  5TGF A;  3VE4 A;  2BLS A;  1PNE A;  1OTE A;  2EFU A;  3V39 A;  1H0M A;  1WYC A;  4DN0 A;  1M6K A;  1I2W A;  1MC0 A;  5IS1 A;  4XUX A;  1OJ5 A;  4PM7 A;  2VZW A;  5AJG A;  4WF0 A;  1N9N A;  3VFH A;  3LY3 A;  1NRF A;  4XUZ A;  2W3D A;  1DJA A;  3A3J A;  1FCN A;  4O8G A;  2Y2L A;  4S2J A;  3ZGA B;  4WEL A;  1BLH A;  4HIA A;  3UE1 A;  3V67 A;  4DJ3 A;  2W27 A;  3G31 A;  4LV1 A;  2PD7 A;  2ZC5 B;  4BJP A;  2P74 A;  1W63 Q;  3O87 A;  2VK3 A;  4LPZ A;  4K0X A;  2EWW A;  4CJN A;  3TG9 A;  3QP2 A;  1TDL A;  4I38 A;  3WRZ A;  3IWO A;  5L8M A;  4QY5 A;  2FH5 A;  5DF9 A;  3MBZ A;  2WGW A;  4HJ6 A;  3ZDJ A;  5J7E A;  2WK0 A;  4RA7 A;  3LI9 A;  2PHY A;  4WM9 A;  3ZFZ A;  3T50 A;  3G2Z A;  2J3T C;  5IT5 A;  3LR0 A;  3KSF A;  5FAQ A;  3TSG A;  4WBG A;  3BFC A;  2ZMF A;  4NEE D;  4E6W A;  4PAU A;  2VGL S;  2OWJ A;  2L1M A;  4QD4 A;  4G3K A;  3HJI A;  3H7W A;  2J80 A;  1K55 A;  3HLD A;  1S1Z A;  2J9P A;  4H6J A;  3QP8 A;  4OQG A;  3PYP A;  2ACG A;  3BY9 A;  3BWL A;  2XFS A;  1VEU A;  1MZU A;  2HF6 A;  3S22 A;  2XA7 S;  3FPW A;  1GA9 A;  3PAE A;  3CAX A;  2UV0 E;  3DW0 A;  4G3W A;  4JGR A;  3BLS A;  1MBL A;  4NXF A;  2B18 A;  2ZD8 A;  1LL8 A;  3TE8 A;  4F3L B;  5FI2 A;  1HLU P;  2Y2N A;  4E3M A;  4AFI A;  5F1F A;  2G2U A;  1O7E A;  5DVA A;  5I94 A;  2ZQ9 A;  2WUQ A;  1Y28 A;  5FAT A;  3CWF A;  3IS2 B;  4R4S A;  5FQK A;  2Y2M A;  4MMN A;  1G68 A;  4WEJ A;  3L7H A;  3D9Y A;  2EX2 A;  2H0T A;  2HV1 A;  2H0Y A;  3B33 A;  2PDR A;  3N4I A;  2D02 A;  5IHV A;  3UB8 A;  2ZC4 B;  3E2L A;  4K08 A;  4E3N A;  2VA0 A;  3T4O A;  4S2P A;  1MWU A;  4KUO A;  2GNX A;  4N9L A;  1PRQ A;  3V3S A;  4Y5F A;  4OQI A;  1ONG A;  4UA7 A;  1N9O A;  4ARZ A;  4BL3 A;  1XJ4 A;  4WYY A;  4E3I A;  3A0R A;  1YLZ A;  2WZX A;  5AVF A;  1N9B A;  5DTS A;  4RX3 A;  2V8C A;  1V9Z A;  5HWT A;  4EBP A;  4UA9 A;  4FH2 A;  5EM1 A;  4EER A;  3ZG7 B;  3IQA A;  1VET B;  5DFY A;  3UPO A;  2WAF A;  5CRF A;  3ZNY A;  4ZJ1 A;  4X69 A;  4EV4 A;  3RXW A;  3C5A A;  2V20 A;  3UPP A;  2W3H A;  2Y79 A;  3WRT A;  4CLC B;  4BWI A;  1BLP A;  3GVB A;  4NXE A;  1YMX A;  3MF0 A;  4KUK A;  2Q9M A;  4Y17 A;  1L0D A;  1TD5 A;  2BG1 A;  1ERM A;  3CG5 A;  1ES3 A;  1H3Q A;  5EM0 A;  3V3R A;  2NUT C;  1DP9 A;  3WS0 A;  3IXD A;  3T1S A;  5J3W A;  2C6W B;  3KSI A;  4OOL A;  4PM8 A;  4KG2 A;  3BFF A;  3E4O A;  5CGW A;  4BEN A;  1LT0 A;  1HVB A;  1UWN X;  2OLV A;  2VGJ A;  2ZOH A;  4ZAM A;  2O9C A;  1CEF A;  3IX3 A;  4R3B A;  4Y0U A;  2XF3 A;  2WKH A;  3W8K A;  1P97 A;  4S2O A;  5HAI A;  3PBQ A;  2V0W A;  1JWV A;  3O5Y A;  5M18 A;  2EX9 A;  3PBN A;  5CGS A;  2EX8 A;  4YOF A;  4WLA A;  4Q8I A;  4DDY A;  2PRF A;  5HAP A;  2WAD A;  4OH0 A;  4UA6 A;  2RCX A;  3NDE A;  1KE4 A;  3CHW P;  4LGW A;  3TJZ C;  4HY8 A;  1NWZ A;  3GSG A;  3IHA A;  5HL6 A;  3ZQ5 A;  4U3T A;  2JC7 A;  4IUH A;  3LIF A;  4R38 A;  1KGF A;  3VV4 A;  3C38 A;  1YLP A;  1OTA A;  4GJ4 A;  4I3A A;  1ES4 A;  3IX8 A;  1F2K A;  1K0K A;  3S7N A;  4JXW A;  2YKF A;  1MWT A;  3K3C A;  1SCW A;  3MXQ A;  1MWR A;  1K56 A;  1NLZ A;  1PWC A;  4X55 A;  2GDN A;  3H82 B;  2PAV P;  4B4Z A;  3A0V A;  4HNB A;  1TF1 A;  4ME4 A;  5AVE A;  2M7V A;  3DAV A;  3VMA A;  2X71 A;  5CXW A;  4U0X A;  3CUE A;  4EBL A;  1MXO A;  1YLJ A;  3DTE A;  4KZ4 A;  2O99 A;  2HDR A;  1UWP X;  4GHI A;  3NCK A;  1VB6 A;  4CLC E;  4GW9 A;  4XT2 B;  1T1B A;  4UQI M;  5GLC A;  4S2I A;  5GLB A;  3PTE A;  4LV2 A;  2Y55 A;  3FKV A;  2R78 A;  2HDU A;  3PAG A;  3BW6 A;  4O01 A;  3VP1 A;  2XD5 A;  1MWS A;  3JPU A;  2B02 A;  2KOI A;  3PBR A;  1F9I A;  3G6O A;  3LR3 A;  1FR6 A;  5HFO A;  4MN7 A;  3OPR A;  4GNU A;  1H8Y A;  4EET B;  2EXA A;  2ZM2 A;  1CI8 A;  4EUZ A;  3IWI A;  4GHI B;  1SZV A;  3HLG A;  4PMA A;  1YSQ A;  1YSP A;  4ID4 A;  3UO9 A;  1ALQ A;  1IKI A;  3CLO A;  1VQQ A;  2JKG A;  3D72 A;  1I5Q A;  3IH9 A;  2XFT A;  1NY0 A;  2Z6D A;  1NZU A;  3DWZ A;  4ZJ3 A;  5F68 A;  3VP0 A;  3MFX A;  4QPR A;  1SKO B;  4OPY A;  1OTI A;  1VET A;  3UDF A;  3ZG8 B;  2DRW A;  5FA7 A;  5FEF A;  1FSW A;  3AGD A;  1BLC A;  5KZH A;  4HH3 A;  4LV3 A;  1TS0 A;  5AQA A;  4B88 A;  3ZVT A;  3SH7 A;  2ZJ9 A;  5FQI A;  4ARZ B;  5F5Y A;  2A24 B;  1GHI A;  3S7P A;  4R3J A;  3PR6 A;  5GHX A;  5CED A;  1KVL A;  2ZL1 B;  4BLM A;  4BMW A;  4R3A A;  4XXR A;  1BT5 A;  4GZB A;  3WS1 A;  4L9E A;  2PYR A;  1FCM A;  1XFQ A;  2M1C A;  2ZL1 A;  4K91 A;  3NI9 A;  5FQM A;  3BFG A;  2GJ3 A;  4Q0I A;  4OP5 A;  5C5K A;  2M7U A;  1AWI A;  5L10 A;  3RTY A;  3IF6 B;  2H28 A;  4R0Q A;  1XX2 A;  4FOF A;  2I9V A;  1PYY A;  2BAS A;  1XJ3 A;  5J4E A;  3NDG A;  1GCE A;  4OQ0 A;  4D60 A;  3A3F A;  5KMW A;  1SHV A;  2DCF A;  1A0K A;  3EQU A;  2JKT I;  1T19 A;  3H7W B;  1JTG A;  1PWD A;  3UB6 A;  3F1N A;  4YIN A;  4GS9 B;  1NYM A;  3VOZ A;  2EX6 A;  1ESI A;  3S7O A;  3M2K A;  2QKP A;  3VOL A;  4GB7 A;  5A90 A;  4OOY A;  4N1H A;  1BLS A;  4OLD A;  2Y2K A;  3LUQ A;  5JYO A;  1OTB A;  2A49 A;  5EOO A;  3VSK A;  3HRE A;  3D4F A;  4DMZ A;  4GOG A;  3UB5 P;  2Y2H A;  3T4T A;  4BBU A;  3KYZ A;  3Q07 A;  4UAA A;  1RCJ A;  5FAO A;  2Z6C A;  5FAP A;  1S0W A;  5DKK A;  1P9W A;  4U0T A;  3KSG A;  4GKU A;  1E3U A;  4HEF A;  4HQA A;  1T1C A;  1XFN A;  2P9V B;  4ZTK A;  1RP5 A;  2JBF A;  3MXS A;  3IF6 C;  4UHU A;  2VV7 A;  3IHB A;  3LFV A;  2V0U A;  3KYQ A;  1XPB A;  4PM6 A;  4WZ5 A;  1GA0 A;  2O0Y A;  1D06 A;  4HOI A;  2HDQ A;  3GDI A;  1L0G A;  3R7W B;  1D1J A;  4X68 A;  5EVI B;  1ES2 A;  5HAQ A;  4BQM A;  1KVM A;  1NLY A;  4GDN A;  3WS4 A;  3ZG5 A;  1XJ2 A;  2OWH A;  4EU0 A;  1ACF A;  4Y7P A;  4EWF A;  4L9F A;  4Y15 A;  4Y0O A;  3E2K A;  4R23 A;  4ZJ2 A;  2IWD A;  3MKF A;  2KLI A;  5TBM A;  4NET A;  5DJT A;  3OBF A;  4NG2 A;  3BM6 A;  1EW0 A;  3HJK A;  4QB8 A;  2ZQD A;  4PKY A;  5EVI D;  4YWZ A;  2GX5 A;  3V50 A;  1DP8 A;  4I3J A;  5D3O A;  2XGN A;  3C4P A;  2JKR I;  1FCO A;  2EA9 A;  2INW A;  4H6J B;  2OSU A;  3FZC A;  5EVI A;  4E3O A;  1JVJ A;  4QWO A;  5CHM A;  2W1R A;  4DE0 A;  3TOI A;  3BQA A;  1PI4 A;  4LRZ E;  1CI9 A;  4ZDX A;  1ZG6 A;  3HLW A;  2Y8H A;  2ZC7 A;  5DF8 A;  5TBM B;  1CEG A;  2O9B A;  4RQ9 A;  3VP4 A;  3MFD A;  3LIC A;  4WMC D;  4OOM A;  3VP2 A;  2IWC A;  1K54 A;  4Z9Q A;  3CMZ A;  2A24 A;  3HUM A;  4GD6 A;  3W4O A;  1OPX A;  5EEC A;  3VP3 A;  2WGW B;  1BUE A;  4M3K A;  1NXY A;  3OZH A;  4A5R A;  1YAX A;  3GQZ A;  1GSX A;  1N9L A;  4YNR A;  2JHE A;  5DJU A;  1ERO A;  2XD1 A;  2V1A A;  1BTL A;  1JWP A;  5EFW A;  3BFD A;  3M2J A;  3G34 A;  4S2N C;  2A2L A;  3ITA A;  3T4L A;  3CUE C;  3EWK A;  2VGK A;  3I7J A;  3PBO A;  4FUW A;  4JGQ A;  4PKY G;  3LIB A;  5FEG A;  1N4O A;  2O9A A;  4MNR A;  1MKM A;  4B9O A;  3NOT C;  3HUO A;  4GDB A;  4KZ6 A;  3LIE A;  4MLL A;  1XKZ A;  2Q0O A;  4ETZ A;  4HH2 A;  3NY4 A;  4FTX A;  4KZB A;  1OTD A;  3HLE A;  2WKR A;  3F1P B;  1W8Q A;  3MKE A;  4IHQ A;  2Y2J A;  2W1T A;  1EI5 A;  1G28 A;  3H82 A;  3DBA A;  3O86 A;  2B95 A;  1Z09 A;  3NC8 A;  3ZG0 A;  3GR2 A;  3QNC A;  1DJC A;  1L2S A;  1IOU A;  5F69 A;  5E2G A;  3PBS A;  2OV5 A;  1L0F A;  5MC7 A;  1BUL A;  1NJ4 A;  3EQV A;  4P6Z S;  4E3K A;  3N8L A;  1H5X A;  3IX4 A;  4XT2 A;  4BBT A;  3Q82 A;  3QHY A;  2HP5 A;  4P0M A;  3AGE A;  1OME A;  2WAE A;  3NHQ A;  3S4X A;  3BEC A;  2JKF A;  4MN6 A;  2ZC6 B;  2VV8 A;  2QMI A;  4O7D A;  1KGG A;  2Y4A A;  4KZ3 A;  3R7W A;  4E3L A;  1TEM A;  4P85 A;  2XQZ A;  5DTT A;  2XLN A;  1K25 A;  4DXB A;  5HD5 A;  3CIT A;  3W4Q A;  3SH8 A;  4IUK A;  1E25 A;  1ES5 A;  2J3W A;  3W2Z A;  5L2F A;  5HW3 A;  3LI8 A;  3IT9 A;  1LHY A;  2OAP 1;  3O88 A;  4KZ9 A;  3C30 A;  2WGI A;  1AXB A;  4EQ1 A;  4EXO A;  3F1O B;  1KGE A;  2UWX A;  3BEB A;  3FPV A;  4IVI A;  3ZYT A;  3UNW A;  5AQB A;  3BJN A;  4MBK A;  4Z1W A;  3K2N A;  1P9R A;  4HHD A;  1PW1 A;  3A3D A;  1E4D A;  5EV0 A;  3MJQ A;  1J3W A;  3VE3 A;  1DY6 A;  4ZBE A;  3DTK A;  4LRX C;  4R4R A;  3SW1 A;  4D2O A;  5CER A;  4OVD A;  5CHJ A;  3BLM A;  3HVF A;  4B4X A;  3Q7V B;  2ZC3 B;  3T4K A;  4E04 A;  1X0O A;  1XGI A;  4L9G A;  3LEQ A;  1JWZ A;  3MZE A;  4HJ3 A;  4S2M A;  3JVV A;  4WMC A;  4X56 A;  2XDM A;  4X6T A;  4DKI A;  1IYS A;  4MDZ A;  2LB5 A;  4P87 A;  3G35 A;  5FI7 A;  5EOE A;  3LID A;  5HPI A;  1SKO A;  4NK3 A;  4BD0 A;  3HLF A;  2OAQ 1;  5AQ7 A;  2QHK A;  1LI0 A;  4JXS A;  1PWG A;  4E3J A;  4DXC A;  5GL9 A;  4Y3I A;  5L07 A;  4KZA A;  2VJW A;  4HP4 A;  3Q1F A;  5FQQ A;  3SS5 A;  4RVA A;  2V9A A;  4LFU A;  2PU2 A;  4IVK A;  3BY8 A;  3IXH A;  5G18 A;  3NEC A;  1S4S A;  3E4Q A;  4DJ2 A;  1YMS A;  4CLC A;  4JXG A;  2V2F F;  3IF5 A;  1YM1 A;  2PBY A;  3MXR A;  1YLT A;  2BTF P;  2P04 A;  2QYB A;  3KYE A;  5F1G A;  1TS6 A;  3FV7 A;  3UY6 A;  4C75 A;  4HJ4 A;  1BSG A;  1HTZ A;  4RX2 A;  3G30 A;  4OON A;  4EQI A;  3BYD A;  4LCL A;  2K2N A;  3QP6 A;  4LV0 A;  4KZ8 A;  3MQO A;  1IEM A;  5G4Z A;  3CJM A;  1YT4 A;  4HP9 A;  2W3G A;  1NZO A;  4JLF A;  4HBU A; 
#chains in the Genus database with same CATH homology
 2K31 A;  2QKP A;  3VOL A;  3HCY A;  4P6Z M;  4MMN A;  2VV6 A;  3IBJ A;  4WEJ A;  3LUQ A;  1YKD A;  4II7 A;  1OJG A;  3OC2 A;  1OTB A;  2HV1 A;  3B33 A;  2EWV A;  2PDR A;  4WL9 A;  2D02 A;  4DMZ A;  3T4T A;  2HGV A;  3UB8 A;  1ZTU A;  3T4S A;  3F1N B;  4BBU A;  3UMD A;  4K08 A;  3KYZ A;  2VA0 A;  3T4O A;  4KUO A;  2Z6C A;  2GNX A;  4MN5 A;  1STZ A;  5DKK A;  2JKR M;  1P9W A;  3IS2 A;  3OCL A;  3U2A A;  5HZH A;  1F5M A;  4Y5F A;  3KSG A;  4EW7 A;  2ZOI A;  3OLO A;  1N9O A;  4HQA A;  4M4X A;  4ARZ A;  1T1C A;  1LSW A;  1XJ4 A;  1XFN A;  4NXG A;  3A0R A;  5LBR A;  4I3I A;  5AVF A;  1DP6 A;  3LIA A;  5K5B A;  2GZA A;  2OOL A;  4L0L A;  1V9Z A;  2VV7 A;  3LFV A;  5HWT A;  1WA9 A;  5HDD A;  4EER A;  1S1Y A;  2V0U A;  4G3V A;  3KYQ A;  3NOP C;  3P7N A;  1NRJ A;  3T4Q A;  3H9W A;  5DFY A;  3E4P A;  5HD3 A;  3PBT A;  1JNU A;  1V9Y A;  2O0Y A;  1D06 A;  4HOI A;  2XRO A;  3GDI A;  2W3H A;  3R7W B;  2Y79 A;  3EEH A;  3EGX C;  4CLC B;  3C8C A;  4BWI A;  2P7J A;  2WKP A;  4WN5 A;  4WUJ A;  3OCN A;  3MF0 A;  4GCZ A;  3B42 A;  4KUK A;  1NLY A;  2VLG A;  4NXE A;  1TD5 A;  1XJ2 A;  2OWH A;  3LR5 A;  4EU0 A;  2L0W A;  3BQ8 A;  2D01 A;  4L9F A;  1H3Q A;  5KIZ A;  3KO6 A;  2NUT C;  2KLI A;  5TBM A;  3EGD C;  4B93 A;  1DP9 A;  5DJT A;  3OBF A;  3A0S A;  2CMN A;  1EW0 A;  5J3W A;  1S4R A;  3MR0 A;  3KSI A;  2PR5 A;  4OOL A;  3HJK A;  4PKY A;  3E4O A;  1XJ6 A;  2G7U A;  4YWZ A;  2GX5 A;  1LT0 A;  1DP8 A;  4I3J A;  1UWN X;  2ZOH A;  2JKR I;  3P01 A;  2O9C A;  4I5S A;  2IA2 A;  2EA9 A;  2INW A;  4H6J B;  1GSV A;  2XA7 M;  1S66 L;  1P97 A;  1G6O A;  4JGP A;  5F6A A;  5IU1 A;  3RH8 B;  2W1R A;  3PBQ A;  4WEK A;  2V0W A;  3O5Y A;  2J3T D;  3BQA A;  3NOU C;  3PBN A;  4LRZ E;  1UGU A;  1F98 A;  1KOU A;  2K7S A;  4YOF A;  4WLA A;  2Y8H A;  2QJ5 A;  5TBM B;  2O9B A;  4RQ9 A;  1TS7 A;  3EEA A;  3LIC A;  4OOM A;  3UE3 A;  4CLC D;  3FC7 A;  2A24 A;  4MCW A;  3LYX A;  1W63 M;  4GLQ A;  3TJZ C;  4HY8 A;  4UQI S;  4Q0J A;  1OPX A;  1NWZ A;  5HPF A;  5HDC A;  2L4R A;  2QJ7 A;  5HWW A;  2ZBB A;  1LSX A;  4KQO A;  3JVU A;  1YAX A;  2NUP C;  1GSX A;  1N9L A;  4YNR A;  2JHE A;  2PT7 A;  5HL6 A;  3ZQ5 A;  5DJU A;  2HJE A;  2V1A A;  4Y2F A;  5EFW A;  3PHY A;  5HDS A;  4IUH A;  3LIF A;  4R38 A;  3B47 A;  3VV4 A;  5A8B A;  3C38 A;  2A2L A;  4Q0H A;  2VX8 A;  3T4L A;  1OTA A;  1D7E A;  4GJ4 A;  4I3A A;  3CUE C;  3EWK A;  3S7Q A;  4ETX A;  3PBO A;  3S7N A;  4JGQ A;  2LB9 A;  4PKY G;  3LIB A;  2YKF A;  3MMH A;  3K3C A;  1T1A A;  4EES A;  3MXQ A;  2O9A A;  1NLZ A;  3C2W A;  1MKM A;  4B9O A;  3NOT C;  3H82 B;  3R4K A;  3A0V A;  4HNB A;  1TF1 A;  3LIE A;  4ME4 A;  3D3O A;  5AVE A;  2M7V A;  4ETZ A;  4HH2 A;  3IBR A;  3CUE A;  1OTD A;  2HJ9 C;  2VKS A;  2WKR A;  3F1P B;  4NKP A;  2JKT M;  4IHQ A;  2W1T A;  4R6L A;  1G28 A;  3H82 A;  4BBV A;  2O99 A;  4LLO B;  3DBA A;  1UWP X;  2VGL M;  3E98 A;  2W0N A;  4GHI A;  4JGO A;  1VB6 A;  4CLC E;  4GW9 A;  4KQD A;  3MQQ A;  4XT2 B;  3F1P A;  1T1B A;  4UQI M;  1P0Z A;  3PXP A;  2MJ6 A;  1IOU A;  4EEU A;  5F69 A;  3PBS A;  3OOV A;  5MC7 A;  4NXB A;  2ZMV A;  3CI6 A;  3EQV A;  4P6Z S;  4F3L A;  5TJJ A;  3T4J A;  2R78 A;  4XT2 A;  4CQH A;  4BBT A;  1TS8 A;  3BW6 A;  4O01 A;  3ULF A;  3NHQ A;  2B02 A;  2KOI A;  1IFQ A;  4MN6 A;  1ZHH B;  2VV8 A;  4PHT A;  4HI4 A;  3PBR A;  1F9I A;  5I5L A;  3G6O A;  3F1O A;  3R7W A;  3UB7 A;  3LR3 A;  1S67 L;  2W3F A;  2XRN A;  3MQ0 A;  2PD8 A;  1OT9 A;  1GSW A;  4MN7 A;  5CX7 A;  5HSQ A;  4LRY C;  2W3E A;  3VE4 A;  4EET B;  2JN7 A;  1OTE A;  2W1T B;  1H8M A;  4GHI B;  5HD5 A;  3CIT A;  3UB9 A;  4DN0 A;  4R70 A;  1YSQ A;  1YSP A;  4IUK A;  3K3D A;  3CLO A;  2J3W A;  3W2Z A;  1MC0 A;  3D72 A;  5IS1 A;  3LI8 A;  3NJA A;  2OAP 1;  1OJ5 A;  3UE6 A;  2Z6D A;  2VZW A;  4WF0 A;  5AJG A;  1N9N A;  3C30 A;  5F68 A;  3MFX A;  3GEC A;  3F1O B;  4EQ1 A;  4EXO A;  4QPR A;  2W3D A;  1OTI A;  3FPV A;  4GS9 A;  3ZYT A;  4ZRR A;  4O8G A;  3TW8 A;  3BJN A;  4EEP A;  4WEL A;  4HIA A;  4Z1W A;  3K2N A;  3V67 A;  1P9R A;  4HHD A;  4DJ3 A;  2W27 A;  1OT6 A;  3RFB A;  4HH3 A;  2PD7 A;  3MJQ A;  2KDK A;  1TS0 A;  3VE3 A;  4UEY A;  4BJP A;  1W63 Q;  4LRX C;  4LPZ A;  3SW1 A;  2EWW A;  3FG8 A;  5G4Y A;  4I38 A;  4E04 A;  3T4K A;  1X0O A;  4L9G A;  4HJ3 A;  4ARZ B;  5F5Y A;  5L8M A;  4IJG A;  2A24 B;  2PR6 A;  3ICY A;  3TRC A;  2FH5 A;  3S7P A;  3JVV A;  5DF9 A;  3PR6 A;  4MDZ A;  2LB5 A;  4HJ6 A;  2VEA A;  4BMW A;  4R3A A;  5J7E A;  2FZ0 A;  3KSH A;  3LID A;  5HPI A;  1VHM A;  3LI9 A;  2PHY A;  4EUV A;  3T50 A;  4L9E A;  2J3T C;  2PYR A;  5IT5 A;  3LR0 A;  3KSF A;  1XFQ A;  2M1C A;  2OAQ 1;  4I39 A;  2QHK A;  2GJ3 A;  4Q0I A;  2ZMF A;  4NEE D;  5C5K A;  2M7U A;  4PAU A;  2VGL S;  4Y3I A;  1ODV A;  2OWJ A;  2VJW A;  1DRM A;  4HP4 A;  3RTY A;  2L1M A;  2V9A A;  2H28 A;  4G3K A;  3HJI A;  3BY8 A;  3H7W A;  2J80 A;  2QWS A;  1S1Z A;  4H6J A;  3EOI A;  4FOF A;  5FL3 A;  3PYP A;  1S4S A;  3E4Q A;  3BY9 A;  4DJ2 A;  4CLC A;  2I9V A;  3BWL A;  1LSV A;  2BAS A;  2PYP A;  1XJ3 A;  5J4E A;  1MZU A;  5HWV A;  4O0P A;  2HF6 A;  5KSH A;  5DKL A;  2XA7 S;  3FPW A;  5DFX A;  2P04 A;  2QYB A;  4FSF A;  2V1B A;  3KX0 X;  3CAX A;  1TS6 A;  4G3W A;  3EQU A;  2P08 A;  2JKT I;  4HJ4 A;  2WKQ A;  3UME A;  4JGR A;  3E0Y A;  1T18 A;  1T19 A;  2XSS A;  4NXF A;  2B18 A;  3H7W B;  3LR4 A;  2YKH A;  2KX6 A;  1LL8 A;  3TE8 A;  4F3L B;  2K2N A;  3UB6 A;  3F1N A;  3MQO A;  4CLC C;  5G4Z A;  4AFI A;  4GS9 B;  1BYW A;  1Y28 A;  4HP9 A;  2DMW A;  2W3G A;  3CWF A;  3IS2 B;  3S7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...