1W63M

Ap1 clathrin adaptor core
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
422
structure length
388
Chain Sequence
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEFITQEGHKLETGVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFGLKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQAIPWVRYITQNGDYQLRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords ADAPTER-RELATED PROTEIN COMPLEX 1 GAMMA 1 SUBUNIT
publication title Crystal Structure of the Clathrin Adaptor Protein 1 Core
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 388
sequence length 422
chains with identical sequence N, O, P, R, V
ec nomenclature
pdb deposition date 2004-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1w63M01
4UQIM 4UQIS 4NEED 2FH5A 1W63M 2JKRI 5MC7A 2JKTI 2JKRM 2VGLM 1W63Q 2JKTM 2VGLS 3TJZC 2XA7M 2XA7S 4P6ZM 4P6ZS 1NRJA 2HF6A
chains in the Genus database with same CATH superfamily
4DE3A 2PD8A 5HDSA 4EEUA 3T4OA 4M4XA 4Y13A 5HX9A 2R78A 1SHVA 3LIBA 1SCWA 1LI0A 2VJWA 3S7NA 4G3KA 4Y0TA 3N7WA 1P97A 4PMAA 5TGFA 3P01A 3IF5A 1LLBA 4C75A 2QPNA 3VSLA 1IYOA 3MZEA 1DP6A 4HNBA 3N8LA 4EUZA 1S66L 3BECA 2BG1A 5HFOA 2Z2MB 4EEPA 2G7UA 3T50A 5F1GA 4DDSA 4LV2A 3HREA 3BYDA 3IWIA 1VEUA 3T1QB 1H8MA 1STZA 4F3LA 4BD1A 5GHYA 2XR0A 1TVFA 1YMXA 3D4FA 3ICYA 3HLGA 1RP5A 2J9PA 2HP9A 4HJ6A 1H0MA 1SKFA 4CJNA 4PKYG 3LR5A 5G18A 1VEUB 4RQ9A 4LRYC 4F3LB 3HCYA 3SH9A 1O07A 5CERA 5DKKA 3G2ZA 3MQ0A 3T1RA 1K56A 3DTKA 3ZG5A 2C6WB 3MKEA 5HWWA 4QJGA 1K57A 2HDQA 4IEDA 2G2WA 5A91A 1F2KA 4WBGA 4OOLA 5KSHA 4R1GA 3TSGA 1YLTA 4A5RA 3P98A 1NY0A 3C30A 1AXBA 3IS2A 1YLYA 2ZQ7A 3V67A 5DVAA 5CTNA 5A90A 3RFBA 4KZ8A 1YPRA 1EWZA 1FCOA 3T4SA 3NDEA 2EFUA 3MQQA 1MWSA 3IX3A 4KZAA 2Y2KA 3SW1A 1KE3A 5DFXA 2W0NA 4JXGA 5TR7A 2HJEA 3LY4A 1M40A 4E3OA 1Z09A 3C8CA 3MFXA 2QJ5A 3N4IA 3BRMA 2CMNA 1W8QA 2WZZA 5IS1A 4N9KA 3ITBA 1FCNA 4BL3A 2W27A 4HESA 4H6JB 3SS3A 1KGGA 2XA7S 3M2JA 4H8RA 4IVIA 2A49A 3UE0A 4NG2A 5FQIA 4MBKA 1XGIA 4WL9A 3T4TA 3BEBA 2X01A 1YQSA 4HP9A 4JXVA 4MN7A 4X25A 4GOGA 1G6OA 2XA7M 4OOMA 3VOZA 4QY5A 3NULA 3HJKA 4MLLA 3NY4A 4UA9A 2WZXA 5AVEA 2JHEA 3DWKA 4OLGA 5TBMA 3UE1A 2FH5A 3IHAA 3FC7A 1LL8A 1V9YA 2Y2GA 2XD1A 5FA7A 1NWZA 1XA7A 1OTIA 3PYPA 2Y2MA 4KQOA 2HZ5A 3HL9A 3ZG0A 2OAP1 2EX2A 5FDHA 3GSGA 1OMEA 4ZJ2A 4WM9A 3OLOA 2WADA 4I39A 2VZWA 5I5LA 1YLZA 3PBNA 5HL6A 1BSGA 1Z6FA 1BLCA 1P9WA 4R3BA 3WS2A 3IF6B 2HPBA 3CITA 5CTMA 5HAIA 3OZHA 2V1BA 4I3JA 2J3TD 2ZC4B 3MXSA 1PWCA 4IBXA 3Q07A 1C3BA 3BY9A 5FQJA 3MF0A 1MWUA 3CHWP 4I3AA 1L3LA 4GHIA 3ZCZA 4L9GA 4P6ZS 1V9ZA 4RX2A 3HLFA 4MBHA 5GL9A 1EROA 4ID4A 3B42A 5JYOA 1NYMA 2J80A 3UB6A 5IU1A 3WS0A 3TW8A 4GHIB 3G4PA 2H0YA 3ZDJA 1E3UD 3LR0A 5CGWA 3UB5P 1MC0A 4Y0OA 3UDXA 2NUTC 4P6ZM 5G4ZA 2VA0A 4C3QA 1JNUA 3MFDA 3Q7VA 4NXBA 4WMCD 4OP8A 1IFQA 2HJ9C 2O9BA 4I5SA 3L9KA 1GHIA 5CECA 4R38A 2ZQDA 1XJ4A 4JBFA 1TDGA 3DWZA 4ME4A 2ZC5B 3Q7VB 3L7HA 2VGLS 5M18A 1S6RA 3ZG7B 5CX7A 3HUNA 4OVDA 1KDWA 3PBQA 1XGJA 2EWVA 3G31A 1IYPA 3LUQA 1G68A 3S22A 3DTIA 4OONA 1RGYA 4WZ5C 2VGLM 4QU3A 3OPPA 3FPVA 4JXWA 4BD0A 2W3FA 1TS8A 2WGWB 3NOPC 5HSQA 3KX0X 3Q82A 4MMNA 2DNSA 2ZMFA 4GDBA 1DP8A 2GDNA 1CEGA 3IBJA 3KO6A 4OH0A 4HH3A 3W8KA 1SDEA 5CHMA 4WUJA 2JKTM 1SKOA 3O86A 3ZG8B 1JTGA 1S4RA 3BWLA 1ERQA 3B3XA 2Y91A 1H3QA 4L9FA 4N9LA 1IYQA 1T1AA 3UN7A 5F82A 4S2JA 4EERA 4DDYA 4Y7PA 1IOUA 5F6AA 3KSFA 4ZAMA 3LFVA 1BUEA 4EQ1A 3C4PA 4B88A 3IF6C 4OPQA 3KYZA 4XXRA 3B33A 4B4ZA 5EVID 5CEDA 2O9CA 1J9MA 3MXQA 1XP4A 2QHKA 4II7A 3S1YA 3ZNYA 1PWDA 4YWZA 3GMWA 4FOFA 4CLCC 5F68A 4DXCA 1ALQA 2J7VA 1NXYA 3LR4A 3G2YA 4QWOA 3NOTC 5E2GA 3T12B 4OPYA 2PD7A 2HDUA 4Q8IA 3ZNTA 4GB7A 4HH2A 3D9YA 2ZM0A 5AQBA 3PTEA 2PR6A 1BZAA 4FD8A 4Y0UA 1D7EA 3SH7A 3A3DA 2Y59A 1IEMA 2L4RA 3ZYTA 2Y2NA 1GSVA 1PWGA 4OQGA 1H5XA 2Q9MA 1L2SA 3GR2A 4KG2A 3FZCA 3VV4A 4FCFA 5AQAA 1KOUA 5HPIA 1G28A 1VETA 4HIAA 2Y2QA 3C38A 3WWXA 5HDDA 1PZOA 3UB8A 4E3LA 3CG5A 3IWQA 3RH8B 4EETB 1QMEA 3QP8A 3AGEA 1ZC2A 4R3AA 4E6XA 4EV4A 3OC2A 2P7JA 4EBNA 3JYIA 1OTBA 3PBSA 1KGFA 4HOIA 4DE1A 1W63M 2V9AA 3UNWA 4DE0A 4GS9B 2QKPA 1PW8A 3NOUC 3VE4A 2KOIA 2M1CA 2B95A 1BTLA 1I2SA 3ITAA 2V0WA 3LIEA 1P0ZA 1YKDA 1RGZA 4MN5A 3AGFA 2KLIA 5A93A 3M6BA 2OOLA 3MZFA 1K38A 3DAVA 4NXEA 2X02A 1UGUA 3BM6A 2ZC6B 3T4QA 1G5UA 2XLNA 1GA0A 3IH8A 5EVEA 2Y55A 3CUEC 1NJ4A 4DE2A 3EGDC 1FQGA 2GX5A 5AJGA 3WS1A 1CI9A 4HJ3A 4IUKA 4DKIA 1HVBA 2WKRA 2OSUA 5L09A 3NHQA 3NECA 2KDKA 3QHYA 4E3MA 5M19A 2J3WA 2ZMAA 3QP4A 4HBUA 1ONGA 4S2KA 1S1ZA 3BQAA 1Q2QA 2Y2IA 4R70A 2R9XA 4PM7A 4ZJ3A 1DY6A 1L0DA 1ZKJA 1F98A 5L07A 5JYPA 2V1ZA 3ZG9B 4AFIA 4EBLA 1XKZA 2OAQ1 3S7OA 2C5WB 2H28A 2VKSA 5EV0A 2OWHA 4U0TA 1IELA 4ZJ1A 4BQMA 1TDLA 3HLWA 1SZVA 4I38A 1BT5A 4K91A 2H5SA 4KZ9A 1K25A 2B18A 3IBRA 4PKYA 5EUAA 2DRWA 5I94A 4NXGA 1CEFA 4QY6A 3UPNA 2V2FF 2P9VB 3W4OA 3ZQ5A 4KQDA 2LB5A 4CQHA 3OBFA 1K56D 3T4JA 2E8JA 4JGPA 1W63Q 5FDSA 3O87A 1MXOA 1CK3A 2WKIA 3LI8A 1N9LA 1PZPA 3VP1A 1YT4A 2EXAA 4EWFA 3M2KA 3OCNA 3FWLA 2IWDA 5J3WA 1F9IA 2GJ3A 3DBAA 4YNRA 3VOLA 4LFUA 2D02A 3PXPA 5AQ9A 1PI4A 1YLWA 5A92A 4KZ5A 4KZ7A 1L0GA 4QPRA 5FASA 4X1MA 2W1TB 4H6JA 2Z6DA 1PI5A 1PRQA 3LEZA 5F69A 3E0YA 1P9RA 4QHCA 1ES4A 4GCZA 4JF6A 2K2NA 3LIAA 3GVBA 2WAFA 4BL2A 2K31A 4MEZA 4EESA 3PBTA 3V50A 4WZ5A 1FSWA 2VX8A 2JE5A 3KYEA 4JPMA 4RYEA 4EW7A 2VGJA 3HUOA 2XD5A 3PBRA 2HGVA 2K7SA 4S2NC 2ZC7A 4X6TA 1NYYA 2XFTA 2PU4A 3CMZA 5DF7A 2PR5A 5E2EA 2FFYA 4JLFA 4FUWA 2P74A 1ES2A 3NC8A 3U4LP 3G32A 1S67L 1OTAA 1JWZA 4HI4A 3UB7A 3G6OA 1NZOA 4P0MA 1FILA 3T4LA 2EWWA 4BMWA 5CGXA 2EXBA 1ERMA 1NRFA 2EFXA 2EX6A 4LV3A 2O9AA 4R4RA 3IF6A 1LHYA 5HZHA 3LGOA 5J8XA 1VM1A 1YSPA 3S7QA 3IT9A 4IHQA 1Q2PA 2JKTI 2W1RA 4E04A 1GCEA 2JBFA 3CWFA 2KX6A 2CC1A 4CLCA 5FI7A 1HZOA 2OV5A 5EM0A 3DTEA 1BLPA 4OQIA 4PPRA 4P85A 3NBLA 3BJNA 4GDNA 1FSYA 5KMWA 3QP2A 4CLCB 1YSQA 5FI2A 5HARA 4Q0HA 5FEFA 4DJ2A 4GLQA 1ZTUA 3FKWA 4E3KA 1H8YA 3E2LA 3BW6A 3C7UA 1FR6A 2PYRA 3F1NA 2XH9A 1LL9A 5GLBA 2QZ6A 3HUMA 2PU2A 3QP6A 3G34A 2ZQCA 1L0EA 1GSXA 4ZRRA 3PAGA 5HAQA 3UMEA 2DCFA 3F1NB 5EM1A 3R7WB 4GKUA 1W79A 1L0FA 2WGVA 4HP4A 2VEAA 1MPLA 4D2OA 4KG5A 5M1AA 2PBYA 4XT2B 4OQ0A 1ODVA 1XXMA 3CI6A 1CF0A 4WMCA 1IKIA 1Y54A 5FAOA 1IYSA 4FH4A 1K6RA 1XX2A 3Q1FA 1DJAA 3MZDA 3W4QA 1OTEA 3BFDA 4L9EA 3FKVA 4GJ4A 5EE8A 5AVFA 1HLUP 2WGWA 4L0LA 4K0XA 4X69A 3HLBA 3H82B 4GN2A 1YMSA 2PHYA 3LCEA 3BQ8A 4G3WA 4LV1A 4LLOB 5EOEA 1OT9A 4S2MA 3C4OA 3UE6A 2GZAA 4E3NA 1OPXA 3EEHA 3UDIA 2UWXA 2ZBBA 3LR3A 3RXWA 1Y28A 3SS4A 4HBTA 4FH2A 3A3FA 3GDIA 1K55C 4ETXA 5KZHA 2ZOIA 2VK3A 4BBTA 3G35A 3W2ZA 3CUEA 1NLZA 2VGKA 1K0KA 1H8ZA 2QWSA 3OPLA 1M6KA 5TFQA 4GW9A 5DJTA 5DFYA 4LV0A 1JWPA 2ZQAA 3OPRA 2PDRA 3V5MA 4MDZA 4C6YA 5CEBA 3P7NA 2OWJA 3UPPA 1K4EA 2G2UA 2WUQA 2WGIA 5DJUA 4MNRA 2QJ7A 3RTYA 3QP1A 3CPTA 2Y2HA 2V1AA 3I7JA 2Y2LA 3ULFA 1T18A 1OT6A 4OOYA 1I2WA 4WF0A 3UO9A 2ZD8A 4QD4A 2V8FA 1PNEA 4RA7A 1HTZA 3LIFA 5KIZA 3CPTB 3LIDA 4ZDXA 4Q0JA 2PBDP 1EI5A 5EVIA 5GHZA 4U3TA 3TG9A 1OJ5A 4OPRA 2MJ6A 4YINA 2I72A 2ZMVA 2R9WA 4GD6A 4E3IA 4NK3A 3C5AA 5F1FA 2Y2PA 1T1BA 4Z9QA 5EVIB 2J3TC 4X55A 4M3KA 4EQIA 2RL3A 3LYXA 1U60A 3C7VA 1JVJA 3UMDA 4WLAA 1A0KA 2PT7A 5EVLA 4GZBA 1KVMA 4ZBEA 2M7VA 4D60A 1QMFA 4Y17A 3JPUA 1TD5A 3HVFA 4PM6A 2XF3A 4S2OA 3OPHA 1YAXA 3IXHA 1BLSA 3LEQA 4KZ6A 5TJJA 1D06A 3JVUA 1ES3A 4O0PA 4UQIS 2ZC3B 4XUZA 5DF9A 3P09A 5MC7A 2JKRM 3GRJA 4P87A 3PHYA 1LI9A 1SDNA 1GSWA 4K0WA 4PM8A 4BBUA 4GS9A 3ZFZA 1W7FA 3HJIA 3DTMA 2Q9NA 4KG6A 2M7UA 4JKTA 3E4PA 3PBOA 2EA9A 3RXXA 4UQIM 4EBPA 4KZBA 5FEGA 1ZG4A 5HAPA 5IHVA 2WKQA 1W8YA 1TS7A 2XEPA 2WKEA 1CI8A 3S7PA 1UWPX 2YKHA 4LPZA 4DN0A 3D72A 3MJQA 4S2PA 2HV1A 4S2NA 5DTKA 5C5KA 3ZVTA 1TS0A 1X0OA 4GNUA 5EOOA 2IWCA 2GNXA 3E98A 4Y2FA 3HLCA 3K3CA 5FATA 2P08A 1LSVA 5DTSA 3TOIA 5DKLA 4YFMA 3KSIA 4B93A 1E25A 3N8SA 1GHMA 4JF4A 1N4OA 2D01A 4MCWA 4X68A 1GA9A 4NKPA 3BFCA 3K3DA 2AVXA 3O88A 3SOIA 3QNCA 1XJ6A 1WE4A 4Y5FA 4PM5A 4LENA 1CQAA 5CHUA 3ZHHA 1YM1A 2B5RA 5EVIC 1XFNA 4QB8A 4O7DA 2BASA 4FTXA 2JN7A 2XQZA 5CRFA 2HP5A 2HDSA 1DP9A 1TEMA 1S1YA 2UV0E 2Y2JA 4DMZA 2P9VA 1ZHHB 1MKMA 1BYWA 2A2LA 3M6HA 3WRZA 2EX9A 4IVKA 1VB6A 2XSSA 3VOYA 5GLAA 2RCXA 1PIOA 2HP6A 3FYZA 2INWA 4JXSA 4UAAA 2Q0OA 2Y4AA 4HEFA 3UY6A 5GHXA 1MBLA 3HBRA 4UA6A 1KE0A 3HLEA 1MWRA 3MQOA 3AGDA 4JGQA 5G4YA 1BLHA 4X56A 2W1TA 3MKFA 3VP4A 3UDFA 2H0TA 4LCMA 4EXOA 1K6SA 5FQ9A 2IA2A 2Y79A 3N6IA 3IX4A 2WK0A 3IXBA 1LT0A 2L1MA 4O8GA 1VHMA 1J3WA 4N1XA 1DJCA 2DMWA 4YOFA 1FCMA 1WA9A 2W3GA 4UA7A 3CZDA 1BULA 5IT5A 3T4KA 3V39A 1KDSA 3IS2B 3TJZC 3IX8A 2WYXA 4LRXC 3Q7ZA 3CJMA 4Y3IA 4I3IA 5E2HA 5FQQA 4KZ3A 5A8BA 3EOIA 4BENA 3HLDA 3N8RA 3MBZA 1NZUA 5HWTA 4IUHA 2VV7A 4MN6A 3ISGA 1K55A 3EQVA 2XK1A 4Q0IA 4Z1WA 4IBRA 4R23A 4ARZA 4ZTKA 1E4DA 3T1XA 5AQ7A 3H9WA 2Y8HA 2WAEA 2ZM2A 3H7WA 4HY8A 3GTCA 3UE3A 2ZLYA 1EW0A 4U0XA 4JF5A 1YLJA 1LSWA 5HWVA 3EGXC 1MY8A 4OP5A 3EWKA 4ARZB 3IXDA 4LRZE 4Y15A 4WN5A 2B02A 3H7WB 1HD8A 3VFHA 3C2WA 4JGOA 2J9OA 1PFLA 3EEAA 1I5QA 2W3DA 3QNBA 4PM9A 3T1SA 1FR1A 2ZJ9A 3B47A 3FV7A 1N9NA 5TBMB 5HD3A 4CLCD 1N9OA 3E4QA 4B9OA 1VQQA 4KQQA 1G6AA 3V3SA 3NDGA 1WYCA 3SS5A 4NEED 2FFFB 1KGEA 4JGRA 2NUPC 3BFEA 1RCJA 1YLPA 2ZOHA 2O0YA 2E8IA 2IWBA 3CAXA 2ACGA 2QYBA 2ZQ8A 5E43A 5F83A 5HPFA 4N92A 1JTDA 3D3OA 5CXWA 3MS6A 3R7WA 3TE8A 3BFGA 1K54A 4OLDA 4XT2A 3RJUA 3VP0A 1ESIA 1E3UA 4DRTA 4KUKA 4ESPA 4R0QA 1K57C 3VMAA 1ES5A 3LO7A 2JKFA 3A0RA 3QP5A 4X1LA 3KSGA 2XRNA 3E4OA 3VP2A 2XDMA 4R6LA 3FPWA 3H82A 4RVAA 3OCLA 3W4PA 4GD8A 2JCHA 3A0SA 2P04A 3A3EA 4B4XA 5FQMA 4DXBA 3UPOA 4FSFA 4E3JA 5CGSA 1O7EA 3BY8A 1ESUA 3EQUA 3KYQA 4KENB 3DW0A 1JWVA 4BJPA 2QMIA 3MMHA 1XJ3A 1IKGA 1Y4OA 4PAUA 4KQRA 4K08A 1CJFA 5L8MA 3U2AA 2EX8A 1MZUA 4F94A 1S4SA 4DF6A 5DF8A 4ETZA 2JKRI 4CPKA 4O01A 3SH8A 3F1OA 3O5YA 3O3VA 4X53A 4P6BA 2BLSA 3LY3A 3E2KA 5HD5A 4BLMA 4WEJA 1NLYA 3LI9A 5HL1A 4E6WA 1OJGA 3NJAA 3F1OB 1UWNX 2W3HA 5LBRA 2Z6CA 2VV6A 4UHUA 3MR0A 4IJGA 2WKHA 1LL5A 1FOFA 2Z2LB 1MWTA 5L10A 1W5DA 1D1JA 2OLUA 1DRMA 2V8CA 3VP3A 5FAPA 1SKOB 1TS6A 5FI6A 2V0UA 1N9BA 3MXRA 4EUVA 3JVVA 1NRJA 3VE3A 4S2IA 4PHTA 2H10A 2JKGA 3WRTA 2OLVA 4NXFA 4OPZA 2JC7A 1OTDA 3GV9A 1GHPA 2I9VA 2J8YA 1T1CA 3PR6A 5EFWA 1AWIA 5E2FA 1WYBA 1XFQA 2ZM8A 5F5YA 4LCLA 1DJBA 3NCKA 1XPBA 4HHDA 2HDRA 3Q81A 5BOHA 4UEYA 2A24A 4EU0A 1XA1A 3WS5A 2LB9A 3GQZA 4G3VA 4WEKA 5FAQA 4R3JA 1K54C 3SZTA 5L2FA 1ONHA 2A24B 3VFFA 2WKPA 1T19A 3PAEA 3TRCA 3IH9A 3WS4A 1K4FA 5FSRA 4CLCE 5GLCA 3V3RA 5DTTA 2PRFA 2PYPA 4WELA 4BWIA 3FG8A 1ACFA 4KUOA 3KSHA 4KZ4A 1LSXA 2HF6A 2XFSA 3IQAA 4HQAA 4HJ4A 3OOVA 2A3UA 3G30A 4R4SA 2VV8A 2L0WA 3UB9A 2XGNA 3BFFA 5GLDA 3VSKA 2VLGA 5J4EA 1ZG6A 3S4XA 5HDCA 1VETB 1MKIA 4BBVA 4MBFA 5FQKA 4RX3A 3IXGA 2V20A 3BLSA 5J7EA 4OQHA 2YKFA 3K2NA 1TF1A 3ZVWA 3IHBA 4N1HA 5EECA 3NIAA 2O99A 5HW3A 2BTFP 1XJ2A 1S0WA 2Y2OA 5KSCA 3F1PA 2W3EA 4XUXA 1F5MA 3LICA 3NI9A 4LGWA 3A0VA 5D3OA 5CHJA 3MSHA 2ZL1A 3GECA 5FL3A 1KE4A 4DJ3A 1KVLA 3F1PB 1FIKA 4OKPA 3BLMA 3IWOA 3A3JA 4WYYA 2FZ0A 5K5BA 2XROA 4WZ4A 2ZL1B 2ZQ9A 5EPHA 3R4KA 3A3IA 2PAVP 5U47A 1PYYA 3ZGAB 1PW1A 2X71A 3CLOA 4NETA 4S2LA
chains in the Genus database with same CATH topology
2PD7A 4HP4A 2VEAA 2PD8A 5HDSA 4EEUA 4HH2A 4XT2B 3T4OA 4M4XA 5HWTA 1ODVA 3CI6A 2R78A 4IUHA 2VV7A 3LIBA 4MN6A 3EQVA 2PR6A 4Q0IA 4Z1WA 2VJWA 3S7NA 1D7EA 4G3KA 4ARZA 1P97A 1OTEA 4L9EA 3P01A 4GJ4A 5AVFA 1DP6A 3H9WA 2Y8HA 4HNBA 1S66L 3H7WA 4HY8A 2L4RA 4L0LA 3UE3A 1EW0A 3ZYTA 4EEPA 1LSWA 2G7UA 5HWVA 3H82B 1GSVA 3EGXC 3T50A 2PHYA 3BQ8A 3EWKA 4G3WA 4ARZB 4LRZE 3VV4A 4LLOB 4WN5A 1H8MA 1KOUA 1OT9A 1STZA 5HPIA 4F3LA 2B02A 1G28A 3UE6A 4HIAA 2GZAA 3H7WB 3ICYA 1OPXA 3C38A 3EEHA 4HJ6A 5HDDA 2ZBBA 3UB8A 3LR3A 3C2WA 4PKYG 3RH8B 1Y28A 4JGOA 3LR5A 3EEAA 4EETB 4RQ9A 2W3DA 4LRYC 4F3LB 3GDIA 4ETXA 3HCYA 4R3AA 2ZOIA 5DKKA 3OC2A 3B47A 2P7JA 1N9NA 4BBTA 3MQ0A 3W2ZA 3CUEA 5TBMB 5HD3A 4CLCD 1NLZA 1N9OA 3E4QA 4B9OA 2QWSA 4GW9A 5DJTA 5DFYA 1OTBA 3PBSA 4HOIA 4NEED 1W63M 5HWWA 2V9AA 4JGRA 2PDRA 4GS9B 2QKPA 2NUPC 3NOUC 3VE4A 4MDZA 2KOIA 4OOLA 3P7NA 2M1CA 5KSHA 2OWJA 2ZOHA 2V0WA 3LIEA 5DJUA 1P0ZA 2O0YA 3C30A 2QJ7A 3IS2A 3RTYA 1YKDA 4MN5A 3CAXA 2QYBA 5HPFA 2KLIA 3V67A 2V1AA 2OOLA 3RFBA 3D3OA 4NXEA 3ULFA 1T18A 1UGUA 1OT6A 3T4SA 4WF0A 3R7WA 3T4QA 3MQQA 3TE8A 3SW1A 5DFXA 3LIFA 2W0NA 5KIZA 3CUEC 3LIDA 4XT2A 3EGDC 2HJEA 4Q0JA 2GX5A 5AJGA 3C8CA 3MFXA 2QJ5A 4HJ3A 4IUKA 2CMNA 1OJ5A 2MJ6A 4KUKA 5IS1A 2WKRA 2ZMVA 2W27A 3A0RA 3KSGA 4H6JB 2XRNA 3E4OA 3NHQA 2XA7S 1T1BA 2J3TC 2KDKA 4R6LA 3FPWA 3H82A 3LYXA 2J3WA 3OCLA 3A0SA 4WLAA 3UMDA 2P04A 2PT7A 1S1ZA 4WL9A 3T4TA 3BQAA 4FSFA 4R70A 4HP9A 4MN7A 2M7VA 3BY8A 3EQUA 1G6OA 1F98A 3KYQA 2XA7M 1TD5A 4AFIA 4BJPA 4OOMA 3MMHA 3HJKA 1YAXA 1XJ3A 4PAUA 4K08A 2OAQ1 5AVEA 5L8MA 3S7OA 5TJJA 2H28A 2JHEA 2VKSA 3U2AA 1D06A 2OWHA 3JVUA 1MZUA 4O0PA 1S4SA 4UQIS 5TBMA 5DF9A 4ETZA 2FH5A 4I38A 2JKRI 3FC7A 5MC7A 1LL8A 1V9YA 2JKRM 1NWZA 4O01A 1OTIA 3PYPA 3F1OA 3PHYA 3O5YA 4KQOA 1GSWA 2B18A 3IBRA 4BBUA 4PKYA 4GS9A 3HJIA 2OAP1 4NXGA 2M7UA 5HD5A 4WEJA 1NLYA 3E4PA 3LI9A 3PBOA 2EA9A 3OLOA 4UQIM 4I39A 1OJGA 3NJAA 3ZQ5A 4KQDA 3F1OB 2LB5A 2VZWA 1UWNX 4CQHA 3OBFA 2W3HA 5LBRA 5I5LA 3T4JA 2Z6CA 3PBNA 1W63Q 4JGPA 5HL6A 2VV6A 1P9WA 3MR0A 4IJGA 3CITA 2WKQA 3LI8A 1N9LA 2V1BA 1TS7A 4I3JA 2J3TD 1DRMA 3OCNA 3S7PA 1UWPX 2YKHA 5J3WA 4LPZA 1F9IA 1TS6A 2GJ3A 3BY9A 3D72A 4DN0A 3DBAA 3MJQA 4YNRA 3MF0A 2HV1A 5C5KA 3VOLA 2V0UA 4I3AA 1TS0A 1X0OA 4GHIA 2D02A 3PXPA 4L9GA 3JVVA 4EUVA 4P6ZS 1NRJA 1V9ZA 3VE3A 4PHTA 4QPRA 2GNXA 2W1TB 4H6JA 2Z6DA 3E98A 3B42A 4Y2FA 5F69A 3E0YA 1P9RA 4GCZA 2J80A 3K3CA 4NXFA 3UB6A 5IU1A 3TW8A 4GHIB 2P08A 1LSVA 2K2NA 3LR0A 1OTDA 5DKLA 3LIAA 2I9VA 1T1CA 1MC0A 2K31A 3KSIA 3PR6A 5EFWA 4B93A 4EESA 3PBTA 2D01A 4MCWA 2NUTC 4P6ZM 5G4ZA 2VA0A 2VX8A 1JNUA 4NKPA 1XFQA 5F5YA 4NXBA 4EW7A 3K3DA 4HHDA 3PBRA 4UEYA 2HGVA 1IFQA 2A24A 2HJ9C 2O9BA 1XJ6A 4EU0A 4I5SA 2K7SA 4Y5FA 2LB9A 4R38A 1XJ4A 4G3VA 4ME4A 4WEKA 2VGLS 2PR5A 2A24B 5CX7A 2WKPA 1XFNA 3PBQA 2BASA 1T19A 2EWVA 2JN7A 3TRCA 1DP9A 1S1YA 1S67L 4CLCE 3LUQA 1OTAA 4HI4A 3UB7A 4DMZA 3G6OA 2PYPA 1ZHHB 2VGLM 4WELA 3T4LA 4BWIA 3FG8A 3FPVA 4KUOA 1MKMA 1BYWA 2A2LA 2W3FA 2EWWA 1TS8A 3KSHA 4BMWA 1LSXA 2HF6A 3NOPC 4HQAA 5HSQA 3KX0X 4HJ4A 3OOVA 4MMNA 2O9AA 1VB6A 2XSSA 2ZMFA 1DP8A 2VV8A 2L0WA 3UB9A 5HZHA 3IBJA 3KO6A 1YSPA 3S7QA 4IHQA 4HH3A 2VLGA 2JKTI 5J4EA 2INWA 5HDCA 4WUJA 2JKTM 2W1RA 4E04A 3CWFA 4BBVA 2KX6A 4CLCA 5J7EA 2YKFA 3K2NA 1TF1A 1S4RA 3BWLA 3MQOA 2O99A 1H3QA 4L9FA 1XJ2A 4JGQA 5G4YA 1T1AA 3BJNA 2W1TA 3F1PA 2W3EA 4EXOA 1F5MA 4CLCB 4EERA 1YSQA 2IA2A 2Y79A 3LICA 3A0VA 1LT0A 2L1MA 4O8GA 1IOUA 4Q0HA 1VHMA 5F6AA 3KSFA 3GECA 3LFVA 2DMWA 4DJ2A 4GLQA 5FL3A 1ZTUA 4YOFA 4DJ3A 4EQ1A 3F1PB 1WA9A 2W3GA 3KYZA 3BW6A 3B33A 2FZ0A 2O9CA 5IT5A 3T4KA 2PYRA 3F1NA 2QHKA 3MXQA 5K5BA 2XROA 4II7A 3IS2B 3TJZC 4YWZA 4FOFA 4CLCC 5F68A 3R4KA 4LRXC 4Y3IA 4I3IA 3LR4A 1GSXA 4ZRRA 3UMEA 3CLOA 3F1NB 5A8BA 3EOIA 3NOTC 3R7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UQI M;  4UQI S;  4NEE D;  2FH5 A;  1W63 M;  2JKR I;  5MC7 A;  2JKT I;  2JKR M;  2VGL M;  1W63 Q;  2JKT M;  2VGL S;  3TJZ C;  2XA7 M;  2XA7 S;  4P6Z M;  4P6Z S;  1NRJ A;  2HF6 A; 
#chains in the Genus database with same CATH topology
 4DE3 A;  2PD8 A;  5HDS A;  4EEU A;  3T4O A;  4M4X A;  4Y13 A;  5HX9 A;  2R78 A;  1SHV A;  3LIB A;  1SCW A;  1LI0 A;  2VJW A;  3S7N A;  4G3K A;  4Y0T A;  3N7W A;  1P97 A;  4PMA A;  5TGF A;  3P01 A;  3IF5 A;  1LLB A;  4C75 A;  2QPN A;  3VSL A;  1IYO A;  3MZE A;  1DP6 A;  4HNB A;  3N8L A;  4EUZ A;  1S66 L;  3BEC A;  2BG1 A;  5HFO A;  2Z2M B;  4EEP A;  2G7U A;  3T50 A;  5F1G A;  4DDS A;  4LV2 A;  3HRE A;  3BYD A;  3IWI A;  1VEU A;  3T1Q B;  1H8M A;  1STZ A;  4F3L A;  4BD1 A;  5GHY A;  2XR0 A;  1TVF A;  1YMX A;  3D4F A;  3ICY A;  3HLG A;  1RP5 A;  2J9P A;  2HP9 A;  4HJ6 A;  1H0M A;  1SKF A;  4CJN A;  4PKY G;  3LR5 A;  5G18 A;  1VEU B;  4RQ9 A;  4LRY C;  4F3L B;  3HCY A;  3SH9 A;  1O07 A;  5CER A;  5DKK A;  3G2Z A;  3MQ0 A;  3T1R A;  1K56 A;  3DTK A;  3ZG5 A;  2C6W B;  3MKE A;  5HWW A;  4QJG A;  1K57 A;  2HDQ A;  4IED A;  2G2W A;  5A91 A;  1F2K A;  4WBG A;  4OOL A;  5KSH A;  4R1G A;  3TSG A;  1YLT A;  4A5R A;  3P98 A;  1NY0 A;  3C30 A;  1AXB A;  3IS2 A;  1YLY A;  2ZQ7 A;  3V67 A;  5DVA A;  5CTN A;  5A90 A;  3RFB A;  4KZ8 A;  1YPR A;  1EWZ A;  1FCO A;  3T4S A;  3NDE A;  2EFU A;  3MQQ A;  1MWS A;  3IX3 A;  4KZA A;  2Y2K A;  3SW1 A;  1KE3 A;  5DFX A;  2W0N A;  4JXG A;  5TR7 A;  2HJE A;  3LY4 A;  1M40 A;  4E3O A;  1Z09 A;  3C8C A;  3MFX A;  2QJ5 A;  3N4I A;  3BRM A;  2CMN A;  1W8Q A;  2WZZ A;  5IS1 A;  4N9K A;  3ITB A;  1FCN A;  4BL3 A;  2W27 A;  4HES A;  4H6J B;  3SS3 A;  1KGG A;  2XA7 S;  3M2J A;  4H8R A;  4IVI A;  2A49 A;  3UE0 A;  4NG2 A;  5FQI A;  4MBK A;  1XGI A;  4WL9 A;  3T4T A;  3BEB A;  2X01 A;  1YQS A;  4HP9 A;  4JXV A;  4MN7 A;  4X25 A;  4GOG A;  1G6O A;  2XA7 M;  4OOM A;  3VOZ A;  4QY5 A;  3NUL A;  3HJK A;  4MLL A;  3NY4 A;  4UA9 A;  2WZX A;  5AVE A;  2JHE A;  3DWK A;  4OLG A;  5TBM A;  3UE1 A;  2FH5 A;  3IHA A;  3FC7 A;  1LL8 A;  1V9Y A;  2Y2G A;  2XD1 A;  5FA7 A;  1NWZ A;  1XA7 A;  1OTI A;  3PYP A;  2Y2M A;  4KQO A;  2HZ5 A;  3HL9 A;  3ZG0 A;  2OAP 1;  2EX2 A;  5FDH A;  3GSG A;  1OME A;  4ZJ2 A;  4WM9 A;  3OLO A;  2WAD A;  4I39 A;  2VZW A;  5I5L A;  1YLZ A;  3PBN A;  5HL6 A;  1BSG A;  1Z6F A;  1BLC A;  1P9W A;  4R3B A;  3WS2 A;  3IF6 B;  2HPB A;  3CIT A;  5CTM A;  5HAI A;  3OZH A;  2V1B A;  4I3J A;  2J3T D;  2ZC4 B;  3MXS A;  1PWC A;  4IBX A;  3Q07 A;  1C3B A;  3BY9 A;  5FQJ A;  3MF0 A;  1MWU A;  3CHW P;  4I3A A;  1L3L A;  4GHI A;  3ZCZ A;  4L9G A;  4P6Z S;  1V9Z A;  4RX2 A;  3HLF A;  4MBH A;  5GL9 A;  1ERO A;  4ID4 A;  3B42 A;  5JYO A;  1NYM A;  2J80 A;  3UB6 A;  5IU1 A;  3WS0 A;  3TW8 A;  4GHI B;  3G4P A;  2H0Y A;  3ZDJ A;  1E3U D;  3LR0 A;  5CGW A;  3UB5 P;  1MC0 A;  4Y0O A;  3UDX A;  2NUT C;  4P6Z M;  5G4Z A;  2VA0 A;  4C3Q A;  1JNU A;  3MFD A;  3Q7V A;  4NXB A;  4WMC D;  4OP8 A;  1IFQ A;  2HJ9 C;  2O9B A;  4I5S A;  3L9K A;  1GHI A;  5CEC A;  4R38 A;  2ZQD A;  1XJ4 A;  4JBF A;  1TDG A;  3DWZ A;  4ME4 A;  2ZC5 B;  3Q7V B;  3L7H A;  2VGL S;  5M18 A;  1S6R A;  3ZG7 B;  5CX7 A;  3HUN A;  4OVD A;  1KDW A;  3PBQ A;  1XGJ A;  2EWV A;  3G31 A;  1IYP A;  3LUQ A;  1G68 A;  3S22 A;  3DTI A;  4OON A;  1RGY A;  4WZ5 C;  2VGL M;  4QU3 A;  3OPP A;  3FPV A;  4JXW A;  4BD0 A;  2W3F A;  1TS8 A;  2WGW B;  3NOP C;  5HSQ A;  3KX0 X;  3Q82 A;  4MMN A;  2DNS A;  2ZMF A;  4GDB A;  1DP8 A;  2GDN A;  1CEG A;  3IBJ A;  3KO6 A;  4OH0 A;  4HH3 A;  3W8K A;  1SDE A;  5CHM A;  4WUJ A;  2JKT M;  1SKO A;  3O86 A;  3ZG8 B;  1JTG A;  1S4R A;  3BWL A;  1ERQ A;  3B3X A;  2Y91 A;  1H3Q A;  4L9F A;  4N9L A;  1IYQ A;  1T1A A;  3UN7 A;  5F82 A;  4S2J A;  4EER A;  4DDY A;  4Y7P A;  1IOU A;  5F6A A;  3KSF A;  4ZAM A;  3LFV A;  1BUE A;  4EQ1 A;  3C4P A;  4B88 A;  3IF6 C;  4OPQ A;  3KYZ A;  4XXR A;  3B33 A;  4B4Z A;  5EVI D;  5CED A;  2O9C A;  1J9M A;  3MXQ A;  1XP4 A;  2QHK A;  4II7 A;  3S1Y A;  3ZNY A;  1PWD A;  4YWZ A;  3GMW A;  4FOF A;  4CLC C;  5F68 A;  4DXC A;  1ALQ A;  2J7V A;  1NXY A;  3LR4 A;  3G2Y A;  4QWO A;  3NOT C;  5E2G A;  3T12 B;  4OPY A;  2PD7 A;  2HDU A;  4Q8I A;  3ZNT A;  4GB7 A;  4HH2 A;  3D9Y A;  2ZM0 A;  5AQB A;  3PTE A;  2PR6 A;  1BZA A;  4FD8 A;  4Y0U A;  1D7E A;  3SH7 A;  3A3D A;  2Y59 A;  1IEM A;  2L4R A;  3ZYT A;  2Y2N A;  1GSV A;  1PWG A;  4OQG A;  1H5X A;  2Q9M A;  1L2S A;  3GR2 A;  4KG2 A;  3FZC A;  3VV4 A;  4FCF A;  5AQA A;  1KOU A;  5HPI A;  1G28 A;  1VET A;  4HIA A;  2Y2Q A;  3C38 A;  3WWX A;  5HDD A;  1PZO A;  3UB8 A;  4E3L A;  3CG5 A;  3IWQ A;  3RH8 B;  4EET B;  1QME A;  3QP8 A;  3AGE A;  1ZC2 A;  4R3A A;  4E6X A;  4EV4 A;  3OC2 A;  2P7J A;  4EBN A;  3JYI A;  1OTB A;  3PBS A;  1KGF A;  4HOI A;  4DE1 A;  1W63 M;  2V9A A;  3UNW A;  4DE0 A;  4GS9 B;  2QKP A;  1PW8 A;  3NOU C;  3VE4 A;  2KOI A;  2M1C A;  2B95 A;  1BTL A;  1I2S A;  3ITA A;  2V0W A;  3LIE A;  1P0Z A;  1YKD A;  1RGZ A;  4MN5 A;  3AGF A;  2KLI A;  5A93 A;  3M6B A;  2OOL A;  3MZF A;  1K38 A;  3DAV A;  4NXE A;  2X02 A;  1UGU A;  3BM6 A;  2ZC6 B;  3T4Q A;  1G5U A;  2XLN A;  1GA0 A;  3IH8 A;  5EVE A;  2Y55 A;  3CUE C;  1NJ4 A;  4DE2 A;  3EGD C;  1FQG A;  2GX5 A;  5AJG A;  3WS1 A;  1CI9 A;  4HJ3 A;  4IUK A;  4DKI A;  1HVB A;  2WKR A;  2OSU A;  5L09 A;  3NHQ A;  3NEC A;  2KDK A;  3QHY A;  4E3M A;  5M19 A;  2J3W A;  2ZMA A;  3QP4 A;  4HBU A;  1ONG A;  4S2K A;  1S1Z A;  3BQA A;  1Q2Q A;  2Y2I A;  4R70 A;  2R9X A;  4PM7 A;  4ZJ3 A;  1DY6 A;  1L0D A;  1ZKJ A;  1F98 A;  5L07 A;  5JYP A;  2V1Z A;  3ZG9 B;  4AFI A;  4EBL A;  1XKZ A;  2OAQ 1;  3S7O A;  2C5W B;  2H28 A;  2VKS A;  5EV0 A;  2OWH A;  4U0T A;  1IEL A;  4ZJ1 A;  4BQM A;  1TDL A;  3HLW A;  1SZV A;  4I38 A;  1BT5 A;  4K91 A;  2H5S A;  4KZ9 A;  1K25 A;  2B18 A;  3IBR A;  4PKY A;  5EUA A;  2DRW A;  5I94 A;  4NXG A;  1CEF A;  4QY6 A;  3UPN A;  2V2F F;  2P9V B;  3W4O A;  3ZQ5 A;  4KQD A;  2LB5 A;  4CQH A;  3OBF A;  1K56 D;  3T4J A;  2E8J A;  4JGP A;  1W63 Q;  5FDS A;  3O87 A;  1MXO A;  1CK3 A;  2WKI A;  3LI8 A;  1N9L A;  1PZP A;  3VP1 A;  1YT4 A;  2EXA A;  4EWF A;  3M2K A;  3OCN A;  3FWL A;  2IWD A;  5J3W A;  1F9I A;  2GJ3 A;  3DBA A;  4YNR A;  3VOL A;  4LFU A;  2D02 A;  3PXP A;  5AQ9 A;  1PI4 A;  1YLW A;  5A92 A;  4KZ5 A;  4KZ7 A;  1L0G A;  4QPR A;  5FAS A;  4X1M A;  2W1T B;  4H6J A;  2Z6D A;  1PI5 A;  1PRQ A;  3LEZ A;  5F69 A;  3E0Y A;  1P9R A;  4QHC A;  1ES4 A;  4GCZ A;  4JF6 A;  2K2N A;  3LIA A;  3GVB A;  2WAF A;  4BL2 A;  2K31 A;  4MEZ A;  4EES A;  3PBT A;  3V50 A;  4WZ5 A;  1FSW A;  2VX8 A;  2JE5 A;  3KYE A;  4JPM A;  4RYE A;  4EW7 A;  2VGJ A;  3HUO A;  2XD5 A;  3PBR A;  2HGV A;  2K7S A;  4S2N C;  2ZC7 A;  4X6T A;  1NYY A;  2XFT A;  2PU4 A;  3CMZ A;  5DF7 A;  2PR5 A;  5E2E A;  2FFY A;  4JLF A;  4FUW A;  2P74 A;  1ES2 A;  3NC8 A;  3U4L P;  3G32 A;  1S67 L;  1OTA A;  1JWZ A;  4HI4 A;  3UB7 A;  3G6O A;  1NZO A;  4P0M A;  1FIL A;  3T4L A;  2EWW A;  4BMW A;  5CGX A;  2EXB A;  1ERM A;  1NRF A;  2EFX A;  2EX6 A;  4LV3 A;  2O9A A;  4R4R A;  3IF6 A;  1LHY A;  5HZH A;  3LGO A;  5J8X A;  1VM1 A;  1YSP A;  3S7Q A;  3IT9 A;  4IHQ A;  1Q2P A;  2JKT I;  2W1R A;  4E04 A;  1GCE A;  2JBF A;  3CWF A;  2KX6 A;  2CC1 A;  4CLC A;  5FI7 A;  1HZO A;  2OV5 A;  5EM0 A;  3DTE A;  1BLP A;  4OQI A;  4PPR A;  4P85 A;  3NBL A;  3BJN A;  4GDN A;  1FSY A;  5KMW A;  3QP2 A;  4CLC B;  1YSQ A;  5FI2 A;  5HAR A;  4Q0H A;  5FEF A;  4DJ2 A;  4GLQ A;  1ZTU A;  3FKW A;  4E3K A;  1H8Y A;  3E2L A;  3BW6 A;  3C7U A;  1FR6 A;  2PYR A;  3F1N A;  2XH9 A;  1LL9 A;  5GLB A;  2QZ6 A;  3HUM A;  2PU2 A;  3QP6 A;  3G34 A;  2ZQC A;  1L0E A;  1GSX A;  4ZRR A;  3PAG A;  5HAQ A;  3UME A;  2DCF A;  3F1N B;  5EM1 A;  3R7W B;  4GKU A;  1W79 A;  1L0F A;  2WGV A;  4HP4 A;  2VEA A;  1MPL A;  4D2O A;  4KG5 A;  5M1A A;  2PBY A;  4XT2 B;  4OQ0 A;  1ODV A;  1XXM A;  3CI6 A;  1CF0 A;  4WMC A;  1IKI A;  1Y54 A;  5FAO A;  1IYS A;  4FH4 A;  1K6R A;  1XX2 A;  3Q1F A;  1DJA A;  3MZD A;  3W4Q A;  1OTE A;  3BFD A;  4L9E A;  3FKV A;  4GJ4 A;  5EE8 A;  5AVF A;  1HLU P;  2WGW A;  4L0L A;  4K0X A;  4X69 A;  3HLB A;  3H82 B;  4GN2 A;  1YMS A;  2PHY A;  3LCE A;  3BQ8 A;  4G3W A;  4LV1 A;  4LLO B;  5EOE A;  1OT9 A;  4S2M A;  3C4O A;  3UE6 A;  2GZA A;  4E3N A;  1OPX A;  3EEH A;  3UDI A;  2UWX A;  2ZBB A;  3LR3 A;  3RXW A;  1Y28 A;  3SS4 A;  4HBT A;  4FH2 A;  3A3F A;  3GDI A;  1K55 C;  4ETX A;  5KZH A;  2ZOI A;  2VK3 A;  4BBT A;  3G35 A;  3W2Z A;  3CUE A;  1NLZ A;  2VGK A;  1K0K A;  1H8Z A;  2QWS A;  3OPL A;  1M6K A;  5TFQ A;  4GW9 A;  5DJT A;  5DFY A;  4LV0 A;  1JWP A;  2ZQA A;  3OPR A;  2PDR A;  3V5M A;  4MDZ A;  4C6Y A;  5CEB A;  3P7N A;  2OWJ A;  3UPP A;  1K4E A;  2G2U A;  2WUQ A;  2WGI A;  5DJU A;  4MNR A;  2QJ7 A;  3RTY A;  3QP1 A;  3CPT A;  2Y2H A;  2V1A A;  3I7J A;  2Y2L A;  3ULF A;  1T18 A;  1OT6 A;  4OOY A;  1I2W A;  4WF0 A;  3UO9 A;  2ZD8 A;  4QD4 A;  2V8F A;  1PNE A;  4RA7 A;  1HTZ A;  3LIF A;  5KIZ A;  3CPT B;  3LID A;  4ZDX A;  4Q0J A;  2PBD P;  1EI5 A;  5EVI A;  5GHZ A;  4U3T A;  3TG9 A;  1OJ5 A;  4OPR A;  2MJ6 A;  4YIN A;  2I72 A;  2ZMV A;  2R9W A;  4GD6 A;  4E3I A;  4NK3 A;  3C5A A;  5F1F A;  2Y2P A;  1T1B A;  4Z9Q A;  5EVI B;  2J3T C;  4X55 A;  4M3K A;  4EQI A;  2RL3 A;  3LYX A;  1U60 A;  3C7V A;  1JVJ A;  3UMD A;  4WLA A;  1A0K A;  2PT7 A;  5EVL A;  4GZB A;  1KVM A;  4ZBE A;  2M7V A;  4D60 A;  1QMF A;  4Y17 A;  3JPU A;  1TD5 A;  3HVF A;  4PM6 A;  2XF3 A;  4S2O A;  3OPH A;  1YAX A;  3IXH A;  1BLS A;  3LEQ A;  4KZ6 A;  5TJJ A;  1D06 A;  3JVU A;  1ES3 A;  4O0P A;  4UQI S;  2ZC3 B;  4XUZ A;  5DF9 A;  3P09 A;  5MC7 A;  2JKR M;  3GRJ A;  4P87 A;  3PHY A;  1LI9 A;  1SDN A;  1GSW A;  4K0W A;  4PM8 A;  4BBU A;  4GS9 A;  3ZFZ A;  1W7F A;  3HJI A;  3DTM A;  2Q9N A;  4KG6 A;  2M7U A;  4JKT A;  3E4P A;  3PBO A;  2EA9 A;  3RXX A;  4UQI M;  4EBP A;  4KZB A;  5FEG A;  1ZG4 A;  5HAP A;  5IHV A;  2WKQ A;  1W8Y A;  1TS7 A;  2XEP A;  2WKE A;  1CI8 A;  3S7P A;  1UWP X;  2YKH A;  4LPZ A;  4DN0 A;  3D72 A;  3MJQ A;  4S2P A;  2HV1 A;  4S2N A;  5DTK A;  5C5K A;  3ZVT A;  1TS0 A;  1X0O A;  4GNU A;  5EOO A;  2IWC A;  2GNX A;  3E98 A;  4Y2F A;  3HLC A;  3K3C A;  5FAT A;  2P08 A;  1LSV A;  5DTS A;  3TOI A;  5DKL A;  4YFM A;  3KSI A;  4B93 A;  1E25 A;  3N8S A;  1GHM A;  4JF4 A;  1N4O A;  2D01 A;  4MCW A;  4X68 A;  1GA9 A;  4NKP A;  3BFC A;  3K3D A;  2AVX A;  3O88 A;  3SOI A;  3QNC A;  1XJ6 A;  1WE4 A;  4Y5F A;  4PM5 A;  4LEN A;  1CQA A;  5CHU A;  3ZHH A;  1YM1 A;  2B5R A;  5EVI C;  1XFN A;  4QB8 A;  4O7D A;  2BAS A;  4FTX A;  2JN7 A;  2XQZ A;  5CRF A;  2HP5 A;  2HDS A;  1DP9 A;  1TEM A;  1S1Y A;  2UV0 E;  2Y2J A;  4DMZ A;  2P9V A;  1ZHH B;  1MKM A;  1BYW A;  2A2L A;  3M6H A;  3WRZ A;  2EX9 A;  4IVK A;  1VB6 A;  2XSS A;  3VOY A;  5GLA A;  2RCX A;  1PIO A;  2HP6 A;  3FYZ A;  2INW A;  4JXS A;  4UAA A;  2Q0O A;  2Y4A A;  4HEF A;  3UY6 A;  5GHX A;  1MBL A;  3HBR A;  4UA6 A;  1KE0 A;  3HLE A;  1MWR A;  3MQO A;  3AGD A;  4JGQ A;  5G4Y A;  1BLH A;  4X56 A;  2W1T A;  3MKF A;  3VP4 A;  3UDF A;  2H0T A;  4LCM A;  4EXO A;  1K6S A;  5FQ9 A;  2IA2 A;  2Y79 A;  3N6I A;  3IX4 A;  2WK0 A;  3IXB A;  1LT0 A;  2L1M A;  4O8G A;  1VHM A;  1J3W A;  4N1X A;  1DJC A;  2DMW A;  4YOF A;  1FCM A;  1WA9 A;  2W3G A;  4UA7 A;  3CZD A;  1BUL A;  5IT5 A;  3T4K A;  3V39 A;  1KDS A;  3IS2 B;  3TJZ C;  3IX8 A;  2WYX A;  4LRX C;  3Q7Z A;  3CJM A;  4Y3I A;  4I3I A;  5E2H A;  5FQQ A;  4KZ3 A;  5A8B A;  3EOI A;  4BEN A;  3HLD A;  3N8R A;  3MBZ A;  1NZU A;  5HWT A;  4IUH A;  2VV7 A;  4MN6 A;  3ISG A;  1K55 A;  3EQV A;  2XK1 A;  4Q0I A;  4Z1W A;  4IBR A;  4R23 A;  4ARZ A;  4ZTK A;  1E4D A;  3T1X A;  5AQ7 A;  3H9W A;  2Y8H A;  2WAE A;  2ZM2 A;  3H7W A;  4HY8 A;  3GTC A;  3UE3 A;  2ZLY A;  1EW0 A;  4U0X A;  4JF5 A;  1YLJ A;  1LSW A;  5HWV A;  3EGX C;  1MY8 A;  4OP5 A;  3EWK A;  4ARZ B;  3IXD A;  4LRZ E;  4Y15 A;  4WN5 A;  2B02 A;  3H7W B;  1HD8 A;  3VFH A;  3C2W A;  4JGO A;  2J9O A;  1PFL A;  3EEA A;  1I5Q A;  2W3D A;  3QNB A;  4PM9 A;  3T1S A;  1FR1 A;  2ZJ9 A;  3B47 A;  3FV7 A;  1N9N A;  5TBM B;  5HD3 A;  4CLC D;  1N9O A;  3E4Q A;  4B9O A;  1VQQ A;  4KQQ A;  1G6A A;  3V3S A;  3NDG A;  1WYC A;  3SS5 A;  4NEE D;  2FFF B;  1KGE A;  4JGR A;  2NUP C;  3BFE A;  1RCJ A;  1YLP A;  2ZOH A;  2O0Y A;  2E8I A;  2IWB A;  3CAX A;  2ACG A;  2QYB A;  2ZQ8 A;  5E43 A;  5F83 A;  5HPF A;  4N92 A;  1JTD A;  3D3O A;  5CXW A;  3MS6 A;  3R7W A;  3TE8 A;  3BFG A;  1K54 A;  4OLD A;  4XT2 A;  3RJU A;  3VP0 A;  1ESI A;  1E3U A;  4DRT A;  4KUK A;  4ESP A;  4R0Q A;  1K57 C;  3VMA A;  1ES5 A;  3LO7 A;  2JKF A;  3A0R A;  3QP5 A;  4X1L A;  3KSG A;  2XRN A;  3E4O A;  3VP2 A;  2XDM A;  4R6L A;  3FPW A;  3H82 A;  4RVA A;  3OCL A;  3W4P A;  4GD8 A;  2JCH A;  3A0S A;  2P04 A;  3A3E A;  4B4X A;  5FQM A;  4DXB A;  3UPO A;  4FSF A;  4E3J A;  5CGS A;  1O7E A;  3BY8 A;  1ESU A;  3EQU A;  3KYQ A;  4KEN B;  3DW0 A;  1JWV A;  4BJP A;  2QMI A;  3MMH A;  1XJ3 A;  1IKG A;  1Y4O A;  4PAU A;  4KQR A;  4K08 A;  1CJF A;  5L8M A;  3U2A A;  2EX8 A;  1MZU A;  4F94 A;  1S4S A;  4DF6 A;  5DF8 A;  4ETZ A;  2JKR I;  4CPK A;  4O01 A;  3SH8 A;  3F1O A;  3O5Y A;  3O3V A;  4X53 A;  4P6B A;  2BLS A;  3LY3 A;  3E2K A;  5HD5 A;  4BLM A;  4WEJ A;  1NLY A;  3LI9 A;  5HL1 A;  4E6W A;  1OJG A;  3NJA A;  3F1O B;  1UWN X;  2W3H A;  5LBR A;  2Z6C A;  2VV6 A;  4UHU A;  3MR0 A;  4IJG A;  2WKH A;  1LL5 A;  1FOF A;  2Z2L B;  1MWT A;  5L10 A;  1W5D A;  1D1J A;  2OLU A;  1DRM A;  2V8C A;  3VP3 A;  5FAP A;  1SKO B;  1TS6 A;  5FI6 A;  2V0U A;  1N9B A;  3MXR A;  4EUV A;  3JVV A;  1NRJ A;  3VE3 A;  4S2I A;  4PHT A;  2H10 A;  2JKG A;  3WRT A;  2OLV A;  4NXF A;  4OPZ A;  2JC7 A;  1OTD A;  3GV9 A;  1GHP A;  2I9V A;  2J8Y A;  1T1C A;  3PR6 A;  5EFW A;  1AWI A;  5E2F A;  1WYB A;  1XFQ A;  2ZM8 A;  5F5Y A;  4LCL A;  1DJB A;  3NCK A;  1XPB A;  4HHD A;  2HDR A;  3Q81 A;  5BOH A;  4UEY A;  2A24 A;  4EU0 A;  1XA1 A;  3WS5 A;  2LB9 A;  3GQZ A;  4G3V A;  4WEK A;  5FAQ A;  4R3J A;  1K54 C;  3SZT A;  5L2F A;  1ONH A;  2A24 B;  3VFF A;  2WKP A;  1T19 A;  3PAE A;  3TRC A;  3IH9 A;  3WS4 A;  1K4F A;  5FSR A;  4CLC E;  5GLC A;  3V3R A;  5DTT A;  2PRF A;  2PYP A;  4WEL A;  4BWI A;  3FG8 A;  1ACF A;  4KUO A;  3KSH A;  4KZ4 A;  1LSX A;  2HF6 A;  2XFS A;  3IQA A;  4HQA A;  4HJ4 A;  3OOV A;  2A3U A;  3G30 A;  4R4S A;  2VV8 A;  2L0W A;  3UB9 A;  2XGN A;  3BFF A;  5GLD A;  3VSK A;  2VLG A;  5J4E A;  1ZG6 A;  3S4X A;  5HDC A;  1VET B;  1MKI A;  4BBV A;  4MBF A;  5FQK A;  4RX3 A;  3IXG A;  2V20 A;  3BLS A;  5J7E A;  4OQH A;  2YKF A;  3K2N A;  1TF1 A;  3ZVW A;  3IHB A;  4N1H A;  5EEC A;  3NIA A;  2O99 A;  5HW3 A;  2BTF P;  1XJ2 A;  1S0W A;  2Y2O A;  5KSC A;  3F1P A;  2W3E A;  4XUX A;  1F5M A;  3LIC A;  3NI9 A;  4LGW A;  3A0V A;  5D3O A;  5CHJ A;  3MSH A;  2ZL1 A;  3GEC A;  5FL3 A;  1KE4 A;  4DJ3 A;  1KVL A;  3F1P B;  1FIK A;  4OKP A;  3BLM A;  3IWO A;  3A3J A;  4WYY A;  2FZ0 A;  5K5B A;  2XRO A;  4WZ4 A;  2ZL1 B;  2ZQ9 A;  5EPH A;  3R4K A;  3A3I A;  2PAV P;  5U47 A;  1PYY A;  3ZGA B;  1PW1 A;  2X71 A;  3CLO A;  4NET A;  4S2L A; 
#chains in the Genus database with same CATH homology
 2PD7 A;  4HP4 A;  2VEA A;  2PD8 A;  5HDS A;  4EEU A;  4HH2 A;  4XT2 B;  3T4O A;  4M4X A;  5HWT A;  1ODV A;  3CI6 A;  2R78 A;  4IUH A;  2VV7 A;  3LIB A;  4MN6 A;  3EQV A;  2PR6 A;  4Q0I A;  4Z1W A;  2VJW A;  3S7N A;  1D7E A;  4G3K A;  4ARZ A;  1P97 A;  1OTE A;  4L9E A;  3P01 A;  4GJ4 A;  5AVF A;  1DP6 A;  3H9W A;  2Y8H A;  4HNB A;  1S66 L;  3H7W A;  4HY8 A;  2L4R A;  4L0L A;  3UE3 A;  1EW0 A;  3ZYT A;  4EEP A;  1LSW A;  2G7U A;  5HWV A;  3H82 B;  1GSV A;  3EGX C;  3T50 A;  2PHY A;  3BQ8 A;  3EWK A;  4G3W A;  4ARZ B;  4LRZ E;  3VV4 A;  4LLO B;  4WN5 A;  1H8M A;  1KOU A;  1OT9 A;  1STZ A;  5HPI A;  4F3L A;  2B02 A;  1G28 A;  3UE6 A;  4HIA A;  2GZA A;  3H7W B;  3ICY A;  1OPX A;  3C38 A;  3EEH A;  4HJ6 A;  5HDD A;  2ZBB A;  3UB8 A;  3LR3 A;  3C2W A;  4PKY G;  3RH8 B;  1Y28 A;  4JGO A;  3LR5 A;  3EEA A;  4EET B;  4RQ9 A;  2W3D A;  4LRY C;  4F3L B;  3GDI A;  4ETX A;  3HCY A;  4R3A A;  2ZOI A;  5DKK A;  3OC2 A;  3B47 A;  2P7J A;  1N9N A;  4BBT A;  3MQ0 A;  3W2Z A;  3CUE A;  5TBM B;  5HD3 A;  4CLC D;  1NLZ A;  1N9O A;  3E4Q A;  4B9O A;  2QWS A;  4GW9 A;  5DJT A;  5DFY A;  1OTB A;  3PBS A;  4HOI A;  4NEE D;  1W63 M;  5HWW A;  2V9A A;  4JGR A;  2PDR A;  4GS9 B;  2QKP A;  2NUP C;  3NOU C;  3VE4 A;  4MDZ A;  2KOI A;  4OOL A;  3P7N A;  2M1C A;  5KSH A;  2OWJ A;  2ZOH A;  2V0W A;  3LIE A;  5DJU A;  1P0Z A;  2O0Y A;  3C30 A;  2QJ7 A;  3IS2 A;  3RTY A;  1YKD A;  4MN5 A;  3CAX A;  2QYB A;  5HPF A;  2KLI A;  3V67 A;  2V1A A;  2OOL A;  3RFB A;  3D3O A;  4NXE A;  3ULF A;  1T18 A;  1UGU A;  1OT6 A;  3T4S A;  4WF0 A;  3R7W A;  3T4Q A;  3MQQ A;  3TE8 A;  3SW1 A;  5DFX A;  3LIF A;  2W0N A;  5KIZ A;  3CUE C;  3LID A;  4XT2 A;  3EGD C;  2HJE A;  4Q0J A;  2GX5 A;  5AJG A;  3C8C A;  3MFX A;  2QJ5 A;  4HJ3 A;  4IUK A;  2CMN A;  1OJ5 A;  2MJ6 A;  4KUK A;  5IS1 A;  2WKR A;  2ZMV A;  2W27 A;  3A0R A;  3KSG A;  4H6J B;  2XRN A;  3E4O A;  3NHQ A;  2XA7 S;  1T1B A;  2J3T C;  2KDK A;  4R6L A;  3FPW A;  3H82 A;  3LYX A;  2J3W A;  3OCL A;  3A0S A;  4WLA A;  3UMD A;  2P04 A;  2PT7 A;  1S1Z A;  4WL9 A;  3T4T A;  3BQA A;  4FSF A;  4R70 A;  4HP9 A;  4MN7 A;  2M7V A;  3BY8 A;  3EQU A;  1G6O A;  1F98 A;  3KYQ A;  2XA7 M;  1TD5 A;  4AFI A;  4BJP A;  4OOM A;  3MMH A;  3HJK A;  1YAX A;  1XJ3 A;  4PAU A;  4K08 A;  2OAQ 1;  5AVE A;  5L8M A;  3S7O A;  5TJJ A;  2H28 A;  2JHE A;  2VKS A;  3U2A A;  1D06 A;  2OWH A;  3JVU A;  1MZU A;  4O0P A;  1S4S A;  4UQI S;  5TBM A;  5DF9 A;  4ETZ A;  2FH5 A;  4I38 A;  2JKR I;  3FC7 A;  5MC7 A;  1LL8 A;  1V9Y A;  2JKR M;  1NWZ A;  4O01 A;  1OTI A;  3PYP A;  3F1O A;  3PHY A;  3O5Y A;  4KQO A;  1GSW A;  2B18 A;  3IBR A;  4BBU A;  4PKY A;  4GS9 A;  3HJI A;  2OAP 1;  4NXG A;  2M7U A;  5HD5 A;  4WEJ A;  1NLY A;  3E4P A;  3LI9 A;  3PBO A;  2EA9 A;  3OLO A;  4UQI M;  4I39 A;  1OJG A;  3NJA A;  3ZQ5 A;  4KQD A;  3F1O B;  2LB5 A;  2VZW A;  1UWN X;  4CQH A;  3OBF A;  2W3H A;  5LBR A;  5I5L A;  3T4J A;  2Z6C A;  3PBN A;  1W63 Q;  4JGP A;  5HL6 A;  2VV6 A;  1P9W A;  3MR0 A;  4IJG A;  3CIT A;  2WKQ A;  3LI8 A;  1N9L A;  2V1B A;  1TS7 A;  4I3J A;  2J3T D;  1DRM A;  3OCN A;  3S7P A;  1UWP X;  2YKH A;  5J3W A;  4LPZ A;  1F9I A;  1TS6 A;  2GJ3 A;  3BY9 A;  3D72 A;  4DN0 A;  3DBA A;  3MJQ A;  4YNR A;  3MF0 A;  2HV1 A;  5C5K A;  3VOL A;  2V0U A;  4I3A A;  1TS0 A;  1X0O A;  4GHI A;  2D02 A;  3PXP A;  4L9G A;  3JVV A;  4EUV A;  4P6Z S;  1NRJ A;  1V9Z A;  3VE3 A;  4PHT A;  4QPR A;  2GNX A;  2W1T B;  4H6J A;  2Z6D A;  3E98 A;  3B42 A;  4Y2F A;  5F69 A;  3E0Y A;  1P9R A;  4GCZ A;  2J80 A;  3K3C A;  4NXF A;  3UB6 A;  5IU1 A;  3TW8 A;  4GHI B;  2P08 A;  1LSV A;  2K2N A;  3LR0 A;  1OTD A;  5DKL A;  3LIA A;  2I9V A;  1T1C A;  1MC0 A;  2K31 A;  3KSI A;  3PR6 A;  5EFW A;  4B93 A;  4EES A;  3PBT A;  2D01 A;  4MCW A;  2NUT C;  4P6Z M;  5G4Z A;  2VA0 A;  2VX8 A;  1JNU A;  4NKP A;  1XFQ A;  5F5Y A;  4NXB A;  4EW7 A;  3K3D A;  4HHD A;  3PBR A;  4UEY A;  2HGV A;  1IFQ A;  2A24 A;  2HJ9 C;  2O9B A;  1XJ6 A;  4EU0 A;  4I5S A;  2K7S A;  4Y5F A;  2LB9 A;  4R38 A;  1XJ4 A;  4G3V A;  4ME4 A;  4WEK A;  2VGL S;  2PR5 A;  2A24 B;  5CX7 A;  2WKP A;  1XFN A;  3PBQ A;  2BAS A;  1T19 A;  2EWV A;  2JN7 A;  3TRC A;  1DP9 A;  1S1Y A;  1S67 L;  4CLC E;  3LUQ A;  1OTA A;  4HI4 A;  3UB7 A;  4DMZ A;  3G6O A;  2PYP A;  1ZHH B;  2VGL M;  4WEL A;  3T4L A;  4BWI A;  3FG8 A;  3FPV A;  4KUO A;  1MKM A;  1BYW A;  2A2L A;  2W3F A;  2EWW A;  1TS8 A;  3KSH A;  4BMW A;  1LSX A;  2HF6 A;  3NOP C;  4HQA A;  5HSQ A;  3KX0 X;  4HJ4 A;  3OOV A;  4MMN A;  2O9A A;  1VB6 A;  2XSS A;  2ZMF A;  1DP8 A;  2VV8 A;  2L0W A;  3UB9 A;  5HZH A;  3IBJ A;  3KO6 A;  1YSP A;  3S7Q A;  4IHQ A;  4HH3 A;  2VLG A;  2JKT I;  5J4E A;  2INW A;  5HDC A;  4WUJ A;  2JKT M;  2W1R A;  4E04 A;  3CWF A;  4BBV A;  2KX6 A;  4CLC A;  5J7E A;  2YKF A;  3K2N A;  1TF1 A;  1S4R A;  3BWL A;  3MQO A;  2O99 A;  1H3Q A;  4L9F A;  1XJ2 A;  4JGQ A;  5G4Y A;  1T1A A;  3BJN A;  2W1T A;  3F1P A;  2W3E A;  4EXO A;  1F5M A;  4CLC B;  4EER A;  1YSQ A;  2IA2 A;  2Y79 A;  3LIC A;  3A0V A;  1LT0 A;  2L1M A;  4O8G A;  1IOU A;  4Q0H A;  1VHM A;  5F6A A;  3KSF A;  3GEC A;  3LFV A;  2DMW A;  4DJ2 A;  4GLQ A;  5FL3 A;  1ZTU A;  4YOF A;  4DJ3 A;  4EQ1 A;  3F1P B;  1WA9 A;  2W3G A;  3KYZ A;  3BW6 A;  3B33 A;  2FZ0 A;  2O9C A;  5IT5 A;  3T4K A;  2PYR A;  3F1N A;  2QHK A;  3MXQ A;  5K5B A;  2XRO A;  4II7 A;  3IS2 B;  3TJZ C;  4YWZ A;  4FOF A;  4CLC C;  5F68 A;  3R4K A;  4LRX C;  4Y3I A;  4I3I A;  3LR4 A;  1GSX A;  4ZRR A;  3UME A;  3CLO A;  3F1N B;  5A8B A;  3EOI A;  3NOT C;  3R7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...