5FQMA

Last common ancestor of gram negative bacteria (gnca) class a beta- lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADWRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
molecule keywords GNCA BETA LACTAMASE
total genus 99
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqmA00
5CGSA 5EOEA 3DWZA 3SH8A 1GHMA 3BFFA 3Q82A 4BL3A 4OQGA 1AXBA 2JE5A 4EWFA 3GV9A 4E3MA 3G34A 3UY6A 1RCJA 3NIAA 4X68A 2A3UA 3N8RA 1PZPA 4KZ3A 3RXXA 1BZAA 2EXBA 1PI5A 1IYOA 2Y55A 3BLSA 4OPRA 4X69A 5DTTA 5CERA 5U47A 1WE4A 4MNRA 4DDYA 2ZD8A 3BFGA 4R23A 5FI6A 4S2LA 1TVFA 3UPPA 3N6IA 4S2MA 5DF8A 5GLCA 5HAPA 1DY6A 3ZG9B 1BT5A 2ZJ9A 4ZJ3A 1YM1A 2Y2IA 1OMEA 2J9PA 1CI8A 4GN2A 5CXWA 1K4FA 1BLSA 4KZ9A 5A91A 5BOHA 2X02A 5EVIB 2WUQA 2VGKA 2OLUA 3IXBA 4LCMA 1L0DA 5EOOA 2EX9A 4KZAA 3W4QA 3IWOA 4WZ5A 1H8ZA 2HDSA 4U0TA 5FI7A 1J9MA 2WGVA 1IEMA 3IF5A 4Y7PA 4UA7A 3SOIA 2WKIA 1K38A 4KG6A 4DKIA 3UN7A 1JWZA 3GR2A 4K0XA 4FCFA 2HP9A 2WAFA 4JKTA 5GLAA 1KE0A 1K54A 2Y2JA 1HD8A 2ZM8A 4KQOA 4LV1A 4FD8A 1DJAA 3NBLA 2RCXA 2IWCA 4JF4A 5DF9A 3UDIA 3ZGAB 4DXBA 3IWIA 1NYMA 2XLNA 1IKIA 4JF6A 5L2FA 3IXGA 5HAIA 1MPLA 2EFXA 2XH9A 2IWDA 1YT4A 1ES4A 3G30A 2ZQ8A 1GA9A 1GA0A 1O7EA 2OSUA 1YMSA 4LV2A 4UA6A 1XGIA 3CMZA 2WKHA 3M2KA 4S2IA 1K25A 4X56A 3GVBA 3BEBA 3IH8A 3ZG8B 3PBTA 4N1HA 3IWQA 2WGIA 3DWKA 3PBSA 5FQJA 2Z2MB 1CEGA 3FKWA 1ES2A 1NJ4A 3D4FA 4S2KA 5HW3A 4JXVA 4DDSA 2HDUA 3FKVA 1ES3A 1YMXA 5KSCA 3C4OA 1YLYA 4Y0UA 5GHZA 3NDGA 1MKIA 1BLPA 1G6AA 2Y2PA 2H5SA 1E3UA 1ONHA 1XA7A 1XXMA 2EX2A 2RL3A 2UWXA 3IF6C 5M18A 1IYQA 5FQMA 2P9VB 3SS5A 3M6HA 4DE1A 2WADA 3HLGA 3MKFA 1FCOA 3A3DA 4EQIA 3IXHA 5CHJA 4JXGA 3UE3A 2ZC6B 4OPZA 3HLWA 3NDEA 3HUOA 4FH2A 3IHAA 5F82A 1YLJA 1JVJA 3DTMA 2DCFA 3JYIA 1LLBA 2HDQA 4S2JA 3ITAA 1FCMA 1MWSA 3RXWA 5EVIC 4GDBA 3TSGA 2J7VA 5FATA 1GHPA 1CEFA 1YLWA 3OCLA 1FCNA 3Q7VA 4LCLA 1L0FA 4PMAA 3ZVWA 3LO7A 1TDLA 4K0WA 2HP6A 3WRTA 2ZQAA 3TOIA 3W8KA 4CPKA 5KZHA 2C5WB 4O7DA 1NRFA 5FAQA 3ZHHA 2ZMAA 3QNBA 1PZOA 5FQKA 1RGZA 2XD5A 1U60A 3PBOA 4GKUA 3HREA 4OLGA 4WBGA 5JYPA 5GL9A 4E3KA 1KGFA 3C5AA 4LV0A 5FAPA 5TFQA 4QD4A 4C6YA 2OV5A 1YLPA 3C7VA 3ZNTA 1PYYA 3IT9A 1MWRA 5AQAA 3VP0A 4C3QA 4D2OA 4E3JA 1SCWA 2C6WB 2Y59A 5CRFA 4R3BA 4JF5A 4B4ZA 4P6BA 3E2LA 5E2GA 3O86A 4PM8A 3Q1FA 4OP5A 2B5RA 2G2UA 3VP2A 4BQMA 5A90A 5DTKA 1WYBA 4R4SA 3P98A 3BECA 5EE8A 3WS4A 3ZCZA 4OQIA 1ZG4A 2WGWB 1ERQA 2Z2LB 2ZC4B 4WEJA 3G2YA 1XP4A 5TR7A 4WZ5C 4P87A 3MZFA 3Q7VB 5GLDA 3WS2A 3BLMA 4PPRA 3VFFA 1M6KA 4GNUA 3MFDA 3BRMA 3HLEA 3IF6B 1KE4A 5EPHA 4BENA 4N9LA 3QHYA 4GD6A 2R9XA 5EECA 3IQAA 3G35A 1XPBA 3CZDA 3SS4A 3UE1A 5I94A 4ZBEA 4DE2A 3OZHA 1S0WA 4OOYA 4MBHA 2WKEA 4YFMA 4BD1A 5KMWA 3O88A 5G18A 5CHMA 1GHIA 3W4PA 4DE0A 2EX8A 1TDGA 3UDFA 3ZVTA 2FFFB 3NC8A 1NXYA 3LY4A 5GLBA 4KZ6A 4IEDA 2P74A 5F1GA 1Z6FA 1CI9A 5JYOA 4OH0A 1ESIA 3GQZA 1N4OA 4PM7A 2XGNA 1H5XA 1MWUA 3HLCA 4WMCD 1FSYA 3UDXA 1W8YA 2JBFA 3RJUA 4QHCA 5A92A 3PTEA 3ITBA 4KZ8A 4R3JA 1W79A 5DVAA 2J9OA 1HZOA 1QMEA 4MBFA 3N4IA 2QMIA 4WM9A 1W5DA 3IXDA 3G4PA 2ZQ7A 5FQQA 5FASA 2WGWA 5GHXA 1JTGA 1KVLA 1TEMA 5CECA 4KG5A 4GOGA 1KDWA 4OOLA 5M1AA 1E25A 1K55C 1ESUA 1SKFA 4X6TA 5D3OA 3IF6A 2DNSA 5AQ7A 2GDNA 3CG5A 3G31A 1LI0A 3N8SA 4OVDA 5KSHA 3MZDA 1FR6A 1G68A 3HVFA 5J8XA 4R0QA 2G2WA 4IVIA 4JXWA 4WMCA 2OLVA 3FV7A 2IWBA 3AGFA 4IBXA 4UHUA 3V3SA 4RYEA 1K6RA 5CEBA 1XX2A 4M3KA 3S4XA 1FSWA 3LY3A 1E3UD 2PU4A 5HARA 5HFOA 3QNCA 4OQHA 4WZ4A 3BFDA 2J8YA 4L0LA 4Y0TA 3UNWA 1BLHA 2PU2A 2ZC7A 2Y2QA 1SDEA 1I5QA 4X55A 4XXRA 1KVMA 2QPNA 2QZ6A 1K6SA 1Q2PA 1SDNA 3B3XA 5AQBA 4ZAMA 5FA7A 3SH9A 2Q9MA 2WAEA 2XDMA 2R9WA 3CJMA 4EV4A 4JPMA 2V20A 4GB7A 4QY5A 4HESA 5CGXA 3GTCA 3SH7A 4EBNA 4N92A 2V1ZA 4P0MA 2A49A 4FH4A 3VP1A 2BG1A 1L0EA 2P9VA 4C75A 1YLZA 3HBRA 3LCEA 4GD8A 4CJNA 4RA7A 2HPBA 4E3IA 4KENB 3V50A 1HVBA 3PBRA 3ZG7B 4OOMA 4DF6A 3P09A 1ALQA 3FWLA 3WS0A 4QY6A 3O3VA 2WZZA 3PBNA 2XD1A 5E43A 1ONGA 3DW0A 1SHVA 1BSGA 4JBFA 4P85A 5HX9A 3E2KA 4X53A 1S6RA 3ZG5A 2ZM0A 2H0YA 1IYPA 2Y91A 3AGDA 4OKPA 1PW1A 4OONA 3OPHA 3IH9A 1K54C 1K57A 2ZLYA 5DF7A 3O87A 3BYDA 5CTNA 3MXSA 3W4OA 3A3JA 4PM5A 1I2WA 2Y2OA 4KQQA 1LI9A 3M6BA 5FQIA 1E4DA 1CK3A 1MBLA 1MY8A 4ZDXA 1JWVA 4BLMA 1PI4A 4KZ7A 1L2SA 1DJBA 2JCHA 3PBQA 1KE3A 5CTMA 3VSLA 3Q81A 5FAOA 4LENA 3HLDA 1K57C 3HLFA 3FYZA 4GDNA 4KZBA 3UE0A 1BUEA 3LEZA 1ZG6A 3A3IA 4Z9QA 3V3RA 3VP4A 2EX6A 3V39A 3FZCA 1FOFA 3EQUA 3VOZA 2ZC3B 3NCKA 2EFUA 3Q7ZA 4UAAA 1KDSA 1LHYA 3OCNA 2E8IA 4K91A 5CEDA 4QB8A 2WK0A 1XGJA 3C7UA 4IBRA 2Y2HA 1Q2QA 3WS5A 2HP5A 4B4XA 5HL1A 4OP8A 5TGFA 5F83A 4DE3A 1H8YA 1EROA 3EQVA 1K56A 3OPPA 1K56D 1VM1A 4PM9A 3C4PA 4QJGA 2WYXA 5IHVA 5EVID 3S1YA 1ES5A 5EVIA 5FSRA 1WYCA 5F1FA 1JTDA 2CC1A 2Y2KA 2Y2GA 4RX3A 4R1GA 3ZFZA 3HLBA 2XFSA 2HDRA 5DTSA 3VFHA 4FSFA 4Y0OA 4S2NC 1NYYA 4MLLA 3MZEA 1KGEA 1RP5A 3G2ZA 2V2FF 1DJCA 4RVAA 2XR0A 3N8LA 3TG9A 1M40A 4KZ5A 5GHYA 3ZNYA 2Q9NA 2FFYA 3MKEA 1GCEA 2VGJA 2XF3A 2Y2LA 4R4RA 1IELA 2XK1A 4LV3A 3VMAA 3ZDJA 1JWPA 4XUZA 2XQZA 3HUMA 1ZC2A 3OPRA 3UO9A 1YQSA 4N1XA 1W7FA 4E3LA 4OLDA 3MBZA 5E2EA 2JC7A 1Y54A 2EXAA 4BL2A 2XEPA 3A3EA 4YINA 3V5MA 1VQQA 1ZKJA 1HTZA 4S2PA 4WEKA 4NETA 3NY4A 3ZG0A 4A5RA 4OQ0A 3UPOA 1PWDA 2X71A 1NZOA 4JXSA 4B88A 1QMFA 3AGEA 4N9KA 4WYYA 4E3OA 3WWXA 3HL9A 1ERMA 3NI9A 2ZM2A 1IKGA 1YLTA 3OC2A 1LL5A 4UA9A 4BJPA 3PAGA 4H8RA 1RGYA 4KZ4A 1PIOA 4EBLA 1KGGA 1NZUA 2X01A 3BM6A 4JLFA 1BTLA 3GMWA 3PAEA 4MBKA 3I7JA 5E2HA 1XKZA 1EI5A 5FQ9A 4ID4A 5E2FA 4MEZA 1K4EA 4QU3A 2ZC5B 4U0XA 4OPQA 3S22A 5HAQA 1EWZA 4EBPA 2ZQ9A 4ZJ2A 2WZXA 1XA1A 4NK3A 1IYSA 3G32A 4S2OA 1LL9A 3IHBA 5A93A 2XFTA 1FR1A 3HUNA 3WS1A 1PWCA 3VP3A 3ISGA 5EUAA 1W8QA 5FDHA 2BLSA 2H10A 4U3TA 5AQ9A 4ZTKA 4DXCA 5M19A 4E3NA 3N7WA 5EVLA 3MXRA 5CGWA 3GRJA 4WELA 3A3FA 4KQRA 4HEFA 4RX2A 2ZQDA 2Y2MA 4KG2A 1L0GA 1C3BA 4GZBA 4IVKA 4PM6A 1NY0A 2Y4AA 3BFCA 1O07A 4E6XA 4BD0A 4DRTA 2I72A 1I2SA 1PWGA 5CHUA 3SS3A 4F94A 1MXOA 3VOYA 4Q8IA 3VSKA 3BFEA 1N9BA 2ZQCA 1K55A 3M2JA 4HBTA 4XUXA 4OPYA 4ZJ1A 4E6WA 4S2NA 3UPNA 2Y2NA 1FQGA 1BULA 4EUZA 2DRWA 1PW8A 1MWTA 3OPLA 2PBYA 5FI2A 3WRZA 3GSGA 3Q07A 2H0TA 4HBUA 1BLCA
chains in the Genus database with same CATH superfamily
4E3MA 2A3UA 3N8RA 4KZ3A 3RFBA 1BZAA 1TS8A 1WE4A 3VV4A 2VA0A 3VE4A 4S2LA 1TVFA 4LLOB 2KX6A 1BT5A 2Y2IA 1CI8A 4GN2A 1K4FA 2QJ5A 2WUQA 3IXBA 1T1BA 3T1SA 4JGOA 4BBVA 4KZAA 3IWOA 2HDSA 5HL6A 1J9MA 3SOIA 1F5MA 1K38A 4KG6A 4E04A 1K54A 1XFQA 2RCXA 5DF9A 2W1RA 2XLNA 1MPLA 2INWA 3BJNA 4UA6A 3CMZA 4K08A 3M2KA 4S2IA 5HDCA 4EW7A 1K25A 4X56A 2VJWA 4R38A 3IH8A 3D9YA 4N1HA 3IWQA 2Z2MB 1CEGA 1ES2A 3D4FA 4S2KA 3T4TA 2HDUA 1ES3A 4Z1WA 5GHZA 1MKIA 1G6AA 2H5SA 1E3UA 2EX2A 2UWXA 3IF6C 3LIDA 3A3DA 4EQIA 5CHJA 3A0SA 4JXGA 2ZC6B 2J3WA 3T1XA 2HF6A 1LLBA 2J7VA 5TJJA 2PT7A 3B42A 4P6ZS 3Q7VA 1L0FA 2ACGA 4IHQA 4PMAA 4EXOA 3ZVWA 3LO7A 3LR3A 1MKMA 4CPKA 1CQAA 2VGLM 3D72A 3OOVA 5KZHA 1PZOA 1OTBA 3L7HA 5FQKA 2XD5A 5MC7A 3HREA 2NUPC 5FDSA 2QKPA 5G4ZA 2JKTI 5GL9A 4E3KA 3C5AA 1XJ4A 3IX4A 2OV5A 1YLPA 1MWRA 3CWFA 4FTXA 4C3QA 4HNBA 5CRFA 3NOTC 3E2LA 5E2GA 4PM8A 2G2UA 1F98A 5AJGA 4OQIA 3EEAA 2WGWB 3TW8A 2ZC4B 1XP4A 3LR0A 5TR7A 4WZ5C 4PPRA 3VFFA 1M6KA 1W63Q 3BRMA 1OTIA 5EPHA 3QHYA 2R9XA 3F1NA 1XPBA 3UE1A 1S0WA 4MBHA 2KLIA 4HI4A 4LRXC 2OAP1 3BWLA 3ZVTA 2K7SA 4IEDA 2ZBBA 5F1GA 5JYOA 1CI9A 1N4OA 2GZAA 1H5XA 3HLCA 1FSYA 1W8YA 5HDSA 3LI9A 1IFQA 1W79A 2VGLS 4QPRA 1QMEA 1W5DA 5FQQA 5FASA 2WGWA 2PAVP 4OOLA 1KDWA 4EQ1A 5M1AA 1K55C 4ETXA 3F1PA 4X6TA 5K5BA 5KSHA 4JGQA 2A2LA 1G68A 5J8XA 1P0ZA 5EV0A 2G2WA 4IVIA 4JXWA 4BBTA 1K6RA 3SW1A 3LY3A 2PU4A 2QHKA 1EW0A 3KSHA 2Y2QA 1H0MA 4LPZA 1Q2PA 3B3XA 4ZAMA 3CJMA 1NLYA 3JPUA 1XJ3A 4DMZA 4GB7A 4QY5A 4Y3IA 4EBNA 4N92A 2V1ZA 1VETB 4YNRA 1H3QA 4IUKA 4X1LA 4CJNA 1AWIA 2XROA 1LSXA 3SZTA 3FWLA 3WS0A 2XD1A 2A24B 2D01A 1BSGA 5KIZA 2PR5A 3RH8B 3B33A 4WF0A 3IH9A 3CI6A 1K57A 2ZLYA 5DF7A 5DFXA 3MXSA 1I2WA 4KQQA 1LI9A 1MBLA 1MY8A 5J3WA 4KZ7A 2G7UA 1D06A 3LEZA 3V39A 4EERA 1T1AA 1X0OA 4GS9A 4UAAA 4LFUA 4WUJA 4K91A 2O9CA 2WK0A 1XGJA 2A24A 5AVEA 3WS5A 2HP5A 4Y17A 2Z6CA 2K2NA 3EQVA 1K56A 3OPPA 4CLCA 4PM9A 3C4PA 4MDZA 1YPRA 5FSRA 4RX3A 3ZFZA 4R1GA 3MFXA 2VZWA 3HLBA 2XFSA 4FSFA 4S2NC 2JKFA 2W0NA 1DJCA 2JN7A 4H6JB 4RVAA 3UMDA 4EEPA 1FIKA 4Y13A 3MKEA 1GCEA 1ZC2A 3OPRA 4ARZB 2V1AA 2VEAA 2XEPA 4YINA 2V9AA 1ZKJA 4S2PA 4ETZA 2HJ9C 4A5RA 5AVFA 1QMFA 2W3FA 2ZM2A 3P7NA 4UA9A 4BJPA 3CUEA 1NZUA 1BTLA 3QP8A 3LIFA 3FC7A 2ZC5B 3FPWA 2E8JA 1G28A 2LB9A 2ZMFA 3CHWP 2ZQ9A 4ZJ2A 3H82A 5EUAA 1DP8A 5HD5A 5M19A 4E3NA 3N7WA 5CGWA 4WELA 1Z09A 1SKOA 2VLGA 4HEFA 1V9YA 2HJEA 4MN7A 3BFCA 1PWGA 1VEUA 5CHUA 3MQOA 3VOYA 1J3WA 3VSKA 2OWJA 1N9BA 2ZQCA 4XUXA 4OPYA 3UPNA 1FQGA 1BULA 4EUZA 1PW8A 1LSWA 2PR6A 3H82B 4Y15A 1BLCA 5EOEA 1GHMA 2XA7S 3JVVA 4OQGA 4EWFA 1NWZA 1OTAA 5DTTA 2Y55A 2PD8A 4MNRA 4DDYA 2O99A 4R23A 1OT6A 3N6IA 5DF8A 3UMEA 3ZG9B 5EM0A 1BLSA 5EVIB 2VGKA 3KYZA 2W1TB 1OPXA 2XRNA 1H8ZA 4GHIB 2ZOIA 2PYPA 3IF5A 3UN7A 2JKGA 2HP9A 3G6OA 4FD8A 3NBLA 3ZGAB 2IWCA 3UDIA 4DXBA 5HAIA 4II7A 5HWWA 4D60A 2ZQ8A 1TS0A 1XGIA 1S1YA 3MXQA 2WKHA 3GVBA 3LFVA 3MJQA 3PBSA 5FQJA 3FKWA 2DMWA 4JXVA 3FKVA 2YKHA 2ZL1B 4GHIA 1BLPA 2Y2PA 5M18A 1XXMA 4XT2B 5FQMA 2P9VB 3M6HA 2WADA 3IXHA 4OPZA 3IX3A 1Y28A 4FH2A 3DTMA 3TRCA 3UE6A 2HDQA 3ITAA 3RXWA 5IT5A 3TSGA 5FATA 2KOIA 1GHPA 1CEFA 1YLWA 1FCNA 1TDLA 4HIAA 4I3AA 2HP6A 2ZQAA 3TOIA 1NRFA 5FAQA 1KOUA 2K31A 1HLUP 4GKUA 4OLGA 4LV0A 5FEFA 3C30A 3LIBA 3C7VA 4F3LA 2BASA 1CF0A 1PYYA 3IT9A 4XT2A 5A8BA 5AQAA 3VP0A 1MZUA 4D2OA 4BMWA 1SCWA 2W3GA 3O86A 2QWSA 2B5RA 5A90A 5DTKA 1WYBA 4UQIS 3BECA 5EE8A 3ZCZA 3T4QA 2Z2LB 4WLAA 5GLDA 3BLMA 2EWWA 4GNUA 2ZMVA 3E98A 3L9KA 1KE4A 4JGRA 4GD6A 5EECA 3G35A 3CZDA 5I94A 3EEHA 3ZYTA 1XJ2A 3MQ0A 2WKEA 4YFMA 4HQAA 4DE0A 1TDGA 3UDFA 2JKRM 4KUOA 1JNUA 1TS6A 3LY4A 5GLBA 4KZ6A 1Z6FA 4OH0A 1ESIA 3GQZA 3UDXA 3B47A 3C38A 3PTEA 1G6OA 4GLQA 5L09A 1ZHHB 1HZOA 4MBFA 4LGWA 3PHYA 3IXDA 3G4PA 3IBRA 1JTGA 1KVLA 5CECA 1E25A 4DJ3A 1SKFA 5D3OA 1N9OA 1TF1A 2GDNA 3CG5A 2VKSA 3TE8A 2Y8HA 3PYPA 3HVFA 2VK3A 3FV7A 4UHUA 3V3SA 3S4XA 4UQIM 1E3UD 5HARA 3QNCA 4WZ4A 3F1OA 1LSVA 2P08A 1SDNA 5FL3A 3SH9A 2R9WA 3IS2B 4JPMA 5CGXA 3GTCA 4P0MA 3BY8A 2HZ5A 3LCEA 1STZA 3LI8A 4KENB 3ZG7B 3PXPA 4DF6A 1F2KA 4G3WA 3O3VA 2WZZA 5DKKA 1LT0A 2PYRA 3EGDC 3DW0A 4R3AA 4JBFA 5HX9A 1YAXA 3E2KA 5F5YA 1S6RA 3ZG5A 1IYPA 3AGDA 4OKPA 4CLCB 4OONA 1DP9A 3NULA 1ACFA 2Y2OA 5FQIA 4L9EA 1CK3A 4NXFA 1JWVA 3Q81A 3R4KA 1K57C 4H6JA 1BUEA 3A3IA 3V3RA 4Z9QA 3EQUA 3VOZA 3NCKA 2EFUA 3MS6A 3T4KA 1LHYA 3OCNA 2E8IA 4YOFA 1S1ZA 4QB8A 3DTEA 3C7UA 4IBRA 2Y2HA 3KSIA 5HL1A 5TGFA 3LIEA 5F83A 1H8YA 1K56D 3MQQA 4QJGA 3QP6A 1VB6A 4X25A 5EVID 4EU0A 3ICYA 4HHDA 2W1TA 5F1FA 3C2WA 5DKLA 4Y0OA 3DAVA 4MLLA 1KGEA 3G2ZA 2XR0A 5GHYA 4KZ5A 3TJZC 2VGJA 3VMAA 4RQ9A 1UWPX 1W7FA 4E3LA 5HZHA 2HGVA 1Y54A 3KSFA 3V5MA 4Y5FA 4MN5A 4WEKA 4HP9A 4NETA 3NY4A 2W3DA 3T4SA 3UPOA 3E4OA 1NZOA 4N9KA 4WYYA 3LYXA 3DTIA 3HL9A 3NI9A 1LL5A 1V9ZA 4EBLA 1KGGA 1Y4OA 3NHQA 3I7JA 4MN6A 4ID4A 1K4EA 4QU3A 3ZQ5A 3S22A 1EWZA 3T4JA 3D3OA 3LICA 1XA1A 1GSWA 5HDDA 3IHBA 3HUNA 1W8QA 4UEYA 4LRYC 2H10A 5HPIA 4DXCA 1P97A 3MXRA 3A3FA 4KQRA 4F3LB 3LGOA 1L0GA 1K0KA 4GZBA 1O07A 4NXBA 3SS3A 3BFEA 3M2JA 4CQHA 4E6WA 2R78A 2DRWA 4HJ4A 3WRZA 4EETB 3V67A 1CJFA 4HBUA 1OT9A 3BFFA 3Q82A 4BL3A 1AXBA 2J3TC 3G34A 3NIAA 3RXXA 1PZPA 2EXBA 3BLSA 4X69A 3KSGA 4OPRA 3T12B 1N9LA 3BFGA 5FI6A 1DY6A 4ZJ3A 2J9PA 4ZRRA 5CXWA 4KZ9A 3UB9A 1W63M 2X02A 2OLUA 5EOOA 5F69A 2ZL1A 2EX9A 3W4QA 4WZ5A 4U0TA 5L8MA 4CLCC 4CLCD 2WGVA 1IEMA 2PD7A 4Y7PA 1A0KA 3F1PB 4DKIA 4JKTA 2WAFA 5G4YA 2WKQA 4KQOA 3ULFA 4JF4A 1GSXA 1NYMA 1IKIA 1S4RA 2XH9A 4HH2A 1GA9A 1YMSA 1O7EA 2OSUA 4PAUA 3LUQA 3PBTA 3FG8A 5HPFA 2WGIA 3DWKA 1NJ4A 4DDSA 2Y79A 4Y0UA 3NDGA 2RL3A 1ONHA 1IYQA 3SS5A 4HH3A 3MKFA 1FCOA 3IHAA 5F82A 2DCFA 1MWSA 3RTYA 5EVIC 5IU1A 4LCLA 3WRTA 3W8KA 2C5WB 4O7DA 3ZHHA 2ZMAA 3QNBA 1RGZA 3PBOA 5JYPA 1KGFA 5EVEA 5FAPA 5TFQA 1ZTUA 4C6YA 3DTKA 3UB8A 3ZNTA 4DN0A 2Y59A 4JF5A 4P6BA 3WS4A 2EA9A 2V0WA 1ZG4A 4WEJA 3G2YA 3MZFA 1ODVA 3WS2A 3MFDA 3IF6B 2M7VA 2BTFP 1D7EA 4N9LA 3IQAA 3NOPC 3K3DA 2PDRA 3VE3A 4OOYA 3BY9A 5DFYA 5LBRA 5KMWA 3O88A 5CHMA 3W4PA 3OLOA 5EM1A 2FFFB 1NXYA 2P74A 4O8GA 1MWUA 2JBFA 3RJUA 4QHCA 4KZ8A 2J9OA 3N4IA 2QMIA 3IS2A 3CAXA 4ARZA 4KG5A 3IF6A 2DNSA 3KX0X 5AQ7A 1WA9A 4OVDA 3K3CA 3MZDA 4WN5A 4R0QA 4WMCA 2IWBA 3QP1A 4IBXA 4RYEA 2VV8A 5CEBA 4YWZA 1XX2A 1L3LA 1FSWA 2WKPA 5HFOA 4GW9A 5DJUA 2J8YA 4L0LA 1TD5A 4Y0TA 1IOUA 3UNWA 1BLHA 2ZC7A 1SDEA 4X55A 1KVMA 5FA7A 2Q9MA 2WAEA 4PHTA 2V20A 3SH7A 3LIAA 4FH4A 1S66L 3VP1A 3UB7A 2O0YA 4C75A 3JVUA 2FZ0A 4NEED 4GD8A 4RA7A 2HPBA 1SZVA 4E3IA 1HVBA 3PBRA 2V8CA 3BW6A 3P09A 5E43A 2M7UA 3PR6A 1SHVA 4M4XA 5EFWA 1MC0A 4X53A 3BQAA 2ZM0A 3MMHA 2H0YA 2Y91A 4O0PA 5J4EA 3BYDA 5CTNA 3W4OA 3A3JA 3M6BA 4BLMA 1PI4A 1L2SA 1DJBA 2JCHA 3VSLA 3LEQA 4LENA 2OOLA 3HLFA 3FYZA 1S67L 4KZBA 4ESPA 4I38A 3UE0A 3VP4A 2B18A 3Q7ZA 1T19A 3R7WB 1T18A 2W3EA 3T4OA 4Y2FA 5CEDA 2Z6DA 1Q2QA 3BQ8A 4B4XA 4DJ2A 4OP8A 3F1NB 1EROA 4L9GA 2EWVA 5IHVA 3S1YA 5EVIA 3DBAA 2Y2GA 3EGXC 1UGUA 2OAQ1 4BWIA 4ME4A 5DTSA 3VFHA 1NYYA 3MZEA 2V2FF 2XSSA 4I3JA 2Q9NA 2FFYA 2Y2LA 1IELA 3R7WA 4LV3A 3ZDJA 2GNXA 4XUZA 2V8FA 4Q0IA 3VOLA 3HUMA 3UO9A 4N1XA 3T4LA 2M1CA 2EXAA 4BL2A 2XA7M 1VQQA 3GECA 1HTZA 2Q0OA 2VX8A 2MJ6A 2X71A 4MMNA 4B88A 2JHEA 3AGEA 4E3OA 5HD3A 1YLTA 3OC2A 3HCYA 5HWVA 2NUTC 3A0RA 1RGYA 4KZ4A 4NKPA 2X01A 3BM6A 4JLFA 3GMWA 4MBKA 5E2HA 5FQ9A 5E2FA 4MEZA 4OPQA 5HAQA 4EBPA 3CUEC 2JKRI 3S7OA 4NK3A 1BYWA 1FR1A 3WS1A 4R70A 2I9VA 5FDHA 2BLSA 3T1QB 5EVLA 4B9OA 2ZQDA 4KG2A 5I5LA 1C3BA 4IVKA 4PM6A 1NY0A 3IBJA 4E6XA 4DRTA 2I72A 1I2SA 3H7WA 4F94A 1MXOA 1DP6A 4Q8IA 2W3HA 4ZJ1A 1F9IA 2Y2NA 5CX7A 1GSVA 1MWTA 2H28A 5FEGA 3GSGA 4G3KA 2H0TA 1DRMA 5CGSA 3DWZA 3SH8A 4I5SA 5IS1A 1S4SA 2JE5A 2JKTM 3GV9A 3UY6A 4GS9B 1RCJA 4X68A 1XFNA 5U47A 1PI5A 1IYOA 3KYEA 2PHYA 5CERA 4Q0JA 2ZD8A 2IA2A 1PFLA 4GJ4A 3UPPA 4S2MA 5HAPA 5GLCA 2ZJ9A 1YM1A 3H7WB 1OMEA 5A91A 5BOHA 4LCMA 1L0DA 4NXEA 5FI7A 3P01A 4X1MA 4UA7A 3EOIA 1PNEA 2WKIA 1P9RA 5DJTA 1JWZA 3GR2A 4K0XA 4FCFA 5GLAA 1KE0A 2Y2JA 4HY8A 1HD8A 2PBDP 2ZM8A 4LV1A 1DJAA 4AFIA 3IWIA 5L2FA 4PKYA 4JF6A 3IXGA 2LB5A 2EFXA 2IWDA 1YT4A 1ES4A 3G30A 3W2ZA 1GA0A 4LV2A 2YKFA 4IJGA 3BEBA 2J3TD 3ZG8B 2UV0E 5HW3A 4EUVA 1YMXA 5KSCA 3C4OA 4CLCE 1YLYA 3NOUC 1XA7A 4DE1A 3HLGA 3QP5A 3E4QA 3UE3A 3HLWA 3NDEA 3HUOA 1YLJA 1JVJA 3C8CA 3JYIA 1FILA 4S2JA 1FCMA 3NECA 4GDBA 5TBMA 3OCLA 4EEUA 3U4LP 4K0WA 4LRZE 5C5KA 3CPTA 2OWHA 1G5UA 1U60A 4WBGA 4QD4A 4HP4A 1SKOB 1OJGA 2AVXA 2B95A 4E3JA 2C6WB 4R3BA 3H9WA 4B4ZA 5HSQA 2QJ7A 1VEUB 3Q1FA 4OP5A 1OJ5A 3VP2A 4BQMA 2PRFA 4R4SA 3P98A 1TS7A 2FH5A 1ERQA 4Q0HA 2KDKA 3QP2A 4P87A 3Q7VB 4FUWA 3HLEA 3MR0A 4BENA 3CITA 4HOIA 3SS4A 4ZBEA 4DE2A 3OZHA 3QP4A 4BD1A 5G18A 1GHIA 5L10A 4R6LA 2EX8A 3T1RA 3NC8A 2V1BA 1XJ6A 4PM7A 2XGNA 1LL8A 4WMCD 4L9FA 5A92A 3ITBA 4R3JA 5DVAA 3HJIA 4WM9A 3LR4A 2ZQ7A 4QWOA 4G3VA 1D1JA 3UB6A 5GHXA 1TEMA 1T1CA 4GOGA 2L4RA 1ESUA 2HV1A 5F6AA 2GX5A 3G31A 2L1MA 1LI0A 3N8SA 2ZOHA 3CLOA 1FR6A 2QYBA 2OLVA 3AGFA 4M3KA 3MSHA 4OQHA 3BFDA 1NLZA 2PU2A 5L07A 4PKYG 4XXRA 1I5QA 2O9AA 2QPNA 2QZ6A 1K6SA 2J80A 5AQBA 2XDMA 4BBUA 4EESA 2P7JA 4EV4A 4HESA 4FOFA 2A49A 2WKRA 2BG1A 1L0EA 4WL9A 2P9VA 1YLZA 2VV7A 3HBRA 3UB5P 2O9BA 3V50A 3O5YA 4OOMA 3OBFA 1ALQA 4JGPA 4QY6A 3PBNA 4I39A 1ONGA 4P85A 5F68A 1VHMA 1PW1A 3OPHA 2W27A 1K54C 3O87A 3KO6A 1YSPA 4PM5A 1E4DA 4ZDXA 3PBQA 1KE3A 1VETA 5CTMA 2L0WA 3IX8A 5FAOA 3HLDA 4GDNA 5HWTA 1ZG6A 2EX6A 3FZCA 1FOFA 1UWNX 2ZC3B 1P9WA 5J7EA 1KDSA 1YKDA 4HJ6A 4DE3A 1VM1A 2WYXA 1ES5A 4NG2A 1WYCA 3A0VA 1JTDA 2CC1A 2Y2KA 2V0UA 1YSQA 2HDRA 3K2NA 1RP5A 3KYQA 3S7QA 3N8LA 3TG9A 4B93A 4GCZA 1M40A 1OTDA 3ZNYA 2D02A 4R4RA 2XF3A 2XK1A 1JWPA 2XQZA 2B02A 1YQSA 4OLDA 3MBZA 4KUKA 5E2EA 2JC7A 2CMNA 4IUHA 3A3EA 3ZG0A 4OQ0A 3T50A 1PWDA 1NRJA 3HJKA 4JXSA 3WWXA 1ERMA 1IKGA 2P04A 3PAGA 4H8RA 3S7PA 1PIOA 4MCWA 3F1OB 3FPVA 3PAEA 1XKZA 1EI5A 4O01A 3EWKA 4U0XA 1H8MA 5TBMB 2WZXA 1PRQA 3S7NA 1IYSA 3G32A 4S2OA 1LL9A 5A93A 2XFTA 1PWCA 3VP3A 3CPTB 3ISGA 3GDIA 3LR5A 4NXGA 4U3TA 5AQ9A 4ZTKA 3GRJA 3E4PA 4RX2A 4P6ZM 2Y2MA 4KQDA 2Y4AA 3U2AA 4BD0A 2GJ3A 1N9NA 4I3IA 1OTEA 2VV6A 1K55A 4HBTA 4S2NA 3MF0A 4HJ3A 3NJAA 3OPLA 2PBYA 5FI2A 3Q07A 3E0YA
chains in the Genus database with same CATH topology
5CGSA 5EOEA 3DWZA 3SH8A 1GHMA 3BFFA 3Q82A 4BL3A 4OQGA 1AXBA 2JE5A 4EWFA 3GV9A 4E3MA 3G34A 3UY6A 1RCJA 3NIAA 4X68A 2A3UA 3N8RA 1PZPA 4KZ3A 3RXXA 1BZAA 2EXBA 1PI5A 1IYOA 2Y55A 3BLSA 4OPRA 4X69A 5DTTA 5CERA 5U47A 1WE4A 4MNRA 4DDYA 2ZD8A 3BFGA 4R23A 5FI6A 4S2LA 1TVFA 3UPPA 3N6IA 4S2MA 5DF8A 5GLCA 5HAPA 1DY6A 3ZG9B 1BT5A 2ZJ9A 4ZJ3A 1YM1A 2Y2IA 1OMEA 2J9PA 1CI8A 4GN2A 5CXWA 1K4FA 1BLSA 4KZ9A 5A91A 5BOHA 2X02A 5EVIB 2WUQA 2VGKA 2OLUA 3IXBA 4LCMA 1L0DA 5EOOA 2EX9A 4KZAA 3W4QA 3IWOA 4WZ5A 1H8ZA 2HDSA 4U0TA 5FI7A 1J9MA 2WGVA 1IEMA 3IF5A 4Y7PA 4UA7A 3SOIA 2WKIA 1K38A 4KG6A 4DKIA 3UN7A 1JWZA 3GR2A 4K0XA 4FCFA 2HP9A 2WAFA 4JKTA 5GLAA 1KE0A 1K54A 2Y2JA 1HD8A 2ZM8A 4KQOA 4LV1A 4FD8A 1DJAA 3NBLA 2RCXA 2IWCA 4JF4A 5DF9A 3UDIA 3ZGAB 4DXBA 3IWIA 1NYMA 2XLNA 1IKIA 4JF6A 5L2FA 3IXGA 5HAIA 1MPLA 2EFXA 2XH9A 2IWDA 1YT4A 1ES4A 3G30A 2ZQ8A 1GA9A 1GA0A 1O7EA 2OSUA 1YMSA 4LV2A 4UA6A 1XGIA 3CMZA 2WKHA 3M2KA 4S2IA 1K25A 4X56A 3GVBA 3BEBA 3IH8A 3ZG8B 3PBTA 4N1HA 3IWQA 2WGIA 3DWKA 3PBSA 5FQJA 2Z2MB 1CEGA 3FKWA 1ES2A 1NJ4A 3D4FA 4S2KA 5HW3A 4JXVA 4DDSA 2HDUA 3FKVA 1ES3A 1YMXA 5KSCA 3C4OA 1YLYA 4Y0UA 5GHZA 3NDGA 1MKIA 1BLPA 1G6AA 2Y2PA 2H5SA 1E3UA 1ONHA 1XA7A 1XXMA 2EX2A 2RL3A 2UWXA 3IF6C 5M18A 1IYQA 5FQMA 2P9VB 3SS5A 3M6HA 4DE1A 2WADA 3HLGA 3MKFA 1FCOA 3A3DA 4EQIA 3IXHA 5CHJA 4JXGA 3UE3A 2ZC6B 4OPZA 3HLWA 3NDEA 3HUOA 4FH2A 3IHAA 5F82A 1YLJA 1JVJA 3DTMA 2DCFA 3JYIA 1LLBA 2HDQA 4S2JA 3ITAA 1FCMA 1MWSA 3RXWA 5EVIC 4GDBA 3TSGA 2J7VA 5FATA 1GHPA 1CEFA 1YLWA 3OCLA 1FCNA 3Q7VA 4LCLA 1L0FA 4PMAA 3ZVWA 3LO7A 1TDLA 4K0WA 2HP6A 3WRTA 2ZQAA 3TOIA 3W8KA 4CPKA 5KZHA 2C5WB 4O7DA 1NRFA 5FAQA 3ZHHA 2ZMAA 3QNBA 1PZOA 5FQKA 1RGZA 2XD5A 1U60A 3PBOA 4GKUA 3HREA 4OLGA 4WBGA 5JYPA 5GL9A 4E3KA 1KGFA 3C5AA 4LV0A 5FAPA 5TFQA 4QD4A 4C6YA 2OV5A 1YLPA 3C7VA 3ZNTA 1PYYA 3IT9A 1MWRA 5AQAA 3VP0A 4C3QA 4D2OA 4E3JA 1SCWA 2C6WB 2Y59A 5CRFA 4R3BA 4JF5A 4B4ZA 4P6BA 3E2LA 5E2GA 3O86A 4PM8A 3Q1FA 4OP5A 2B5RA 2G2UA 3VP2A 4BQMA 5A90A 5DTKA 1WYBA 4R4SA 3P98A 3BECA 5EE8A 3WS4A 3ZCZA 4OQIA 1ZG4A 2WGWB 1ERQA 2Z2LB 2ZC4B 4WEJA 3G2YA 1XP4A 5TR7A 4WZ5C 4P87A 3MZFA 3Q7VB 5GLDA 3WS2A 3BLMA 4PPRA 3VFFA 1M6KA 4GNUA 3MFDA 3BRMA 3HLEA 3IF6B 1KE4A 5EPHA 4BENA 4N9LA 3QHYA 4GD6A 2R9XA 5EECA 3IQAA 3G35A 1XPBA 3CZDA 3SS4A 3UE1A 5I94A 4ZBEA 4DE2A 3OZHA 1S0WA 4OOYA 4MBHA 2WKEA 4YFMA 4BD1A 5KMWA 3O88A 5G18A 5CHMA 1GHIA 3W4PA 4DE0A 2EX8A 1TDGA 3UDFA 3ZVTA 2FFFB 3NC8A 1NXYA 3LY4A 5GLBA 4KZ6A 4IEDA 2P74A 5F1GA 1Z6FA 1CI9A 5JYOA 4OH0A 1ESIA 3GQZA 1N4OA 4PM7A 2XGNA 1H5XA 1MWUA 3HLCA 4WMCD 1FSYA 3UDXA 1W8YA 2JBFA 3RJUA 4QHCA 5A92A 3PTEA 3ITBA 4KZ8A 4R3JA 1W79A 5DVAA 2J9OA 1HZOA 1QMEA 4MBFA 3N4IA 2QMIA 4WM9A 1W5DA 3IXDA 3G4PA 2ZQ7A 5FQQA 5FASA 2WGWA 5GHXA 1JTGA 1KVLA 1TEMA 5CECA 4KG5A 4GOGA 1KDWA 4OOLA 5M1AA 1E25A 1K55C 1ESUA 1SKFA 4X6TA 5D3OA 3IF6A 2DNSA 5AQ7A 2GDNA 3CG5A 3G31A 1LI0A 3N8SA 4OVDA 5KSHA 3MZDA 1FR6A 1G68A 3HVFA 5J8XA 4R0QA 2G2WA 4IVIA 4JXWA 4WMCA 2OLVA 3FV7A 2IWBA 3AGFA 4IBXA 4UHUA 3V3SA 4RYEA 1K6RA 5CEBA 1XX2A 4M3KA 3S4XA 1FSWA 3LY3A 1E3UD 2PU4A 5HARA 5HFOA 3QNCA 4OQHA 4WZ4A 3BFDA 2J8YA 4L0LA 4Y0TA 3UNWA 1BLHA 2PU2A 2ZC7A 2Y2QA 1SDEA 1I5QA 4X55A 4XXRA 1KVMA 2QPNA 2QZ6A 1K6SA 1Q2PA 1SDNA 3B3XA 5AQBA 4ZAMA 5FA7A 3SH9A 2Q9MA 2WAEA 2XDMA 2R9WA 3CJMA 4EV4A 4JPMA 2V20A 4GB7A 4QY5A 4HESA 5CGXA 3GTCA 3SH7A 4EBNA 4N92A 2V1ZA 4P0MA 2A49A 4FH4A 3VP1A 2BG1A 1L0EA 2P9VA 4C75A 1YLZA 3HBRA 3LCEA 4GD8A 4CJNA 4RA7A 2HPBA 4E3IA 4KENB 3V50A 1HVBA 3PBRA 3ZG7B 4OOMA 4DF6A 3P09A 1ALQA 3FWLA 3WS0A 4QY6A 3O3VA 2WZZA 3PBNA 2XD1A 5E43A 1ONGA 3DW0A 1SHVA 1BSGA 4JBFA 4P85A 5HX9A 3E2KA 4X53A 1S6RA 3ZG5A 2ZM0A 2H0YA 1IYPA 2Y91A 3AGDA 4OKPA 1PW1A 4OONA 3OPHA 3IH9A 1K54C 1K57A 2ZLYA 5DF7A 3O87A 3BYDA 5CTNA 3MXSA 3W4OA 3A3JA 4PM5A 1I2WA 2Y2OA 4KQQA 1LI9A 3M6BA 5FQIA 1E4DA 1CK3A 1MBLA 1MY8A 4ZDXA 1JWVA 4BLMA 1PI4A 4KZ7A 1L2SA 1DJBA 2JCHA 3PBQA 1KE3A 5CTMA 3VSLA 3Q81A 5FAOA 4LENA 3HLDA 1K57C 3HLFA 3FYZA 4GDNA 4KZBA 3UE0A 1BUEA 3LEZA 1ZG6A 3A3IA 4Z9QA 3V3RA 3VP4A 2EX6A 3V39A 3FZCA 1FOFA 3EQUA 3VOZA 2ZC3B 3NCKA 2EFUA 3Q7ZA 4UAAA 1KDSA 1LHYA 3OCNA 2E8IA 4K91A 5CEDA 4QB8A 2WK0A 1XGJA 3C7UA 4IBRA 2Y2HA 1Q2QA 3WS5A 2HP5A 4B4XA 5HL1A 4OP8A 5TGFA 5F83A 4DE3A 1H8YA 1EROA 3EQVA 1K56A 3OPPA 1K56D 1VM1A 4PM9A 3C4PA 4QJGA 2WYXA 5IHVA 5EVID 3S1YA 1ES5A 5EVIA 5FSRA 1WYCA 5F1FA 1JTDA 2CC1A 2Y2KA 2Y2GA 4RX3A 4R1GA 3ZFZA 3HLBA 2XFSA 2HDRA 5DTSA 3VFHA 4FSFA 4Y0OA 4S2NC 1NYYA 4MLLA 3MZEA 1KGEA 1RP5A 3G2ZA 2V2FF 1DJCA 4RVAA 2XR0A 3N8LA 3TG9A 1M40A 4KZ5A 5GHYA 3ZNYA 2Q9NA 2FFYA 3MKEA 1GCEA 2VGJA 2XF3A 2Y2LA 4R4RA 1IELA 2XK1A 4LV3A 3VMAA 3ZDJA 1JWPA 4XUZA 2XQZA 3HUMA 1ZC2A 3OPRA 3UO9A 1YQSA 4N1XA 1W7FA 4E3LA 4OLDA 3MBZA 5E2EA 2JC7A 1Y54A 2EXAA 4BL2A 2XEPA 3A3EA 4YINA 3V5MA 1VQQA 1ZKJA 1HTZA 4S2PA 4WEKA 4NETA 3NY4A 3ZG0A 4A5RA 4OQ0A 3UPOA 1PWDA 2X71A 1NZOA 4JXSA 4B88A 1QMFA 3AGEA 4N9KA 4WYYA 4E3OA 3WWXA 3HL9A 1ERMA 3NI9A 2ZM2A 1IKGA 1YLTA 3OC2A 1LL5A 4UA9A 4BJPA 3PAGA 4H8RA 1RGYA 4KZ4A 1PIOA 4EBLA 1KGGA 1NZUA 2X01A 3BM6A 4JLFA 1BTLA 3GMWA 3PAEA 4MBKA 3I7JA 5E2HA 1XKZA 1EI5A 5FQ9A 4ID4A 5E2FA 4MEZA 1K4EA 4QU3A 2ZC5B 4U0XA 4OPQA 3S22A 5HAQA 1EWZA 4EBPA 2ZQ9A 4ZJ2A 2WZXA 1XA1A 4NK3A 1IYSA 3G32A 4S2OA 1LL9A 3IHBA 5A93A 2XFTA 1FR1A 3HUNA 3WS1A 1PWCA 3VP3A 3ISGA 5EUAA 1W8QA 5FDHA 2BLSA 2H10A 4U3TA 5AQ9A 4ZTKA 4DXCA 5M19A 4E3NA 3N7WA 5EVLA 3MXRA 5CGWA 3GRJA 4WELA 3A3FA 4KQRA 4HEFA 4RX2A 2ZQDA 2Y2MA 4KG2A 1L0GA 1C3BA 4GZBA 4IVKA 4PM6A 1NY0A 2Y4AA 3BFCA 1O07A 4E6XA 4BD0A 4DRTA 2I72A 1I2SA 1PWGA 5CHUA 3SS3A 4F94A 1MXOA 3VOYA 4Q8IA 3VSKA 3BFEA 1N9BA 2ZQCA 1K55A 3M2JA 4HBTA 4XUXA 4OPYA 4ZJ1A 4E6WA 4S2NA 3UPNA 2Y2NA 1FQGA 1BULA 4EUZA 2DRWA 1PW8A 1MWTA 3OPLA 2PBYA 5FI2A 3WRZA 3GSGA 3Q07A 2H0TA 4HBUA 1BLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGS A;  5EOE A;  3DWZ A;  3SH8 A;  1GHM A;  3BFF A;  3Q82 A;  4BL3 A;  4OQG A;  1AXB A;  2JE5 A;  4EWF A;  3GV9 A;  4E3M A;  3G34 A;  3UY6 A;  1RCJ A;  3NIA A;  4X68 A;  2A3U A;  3N8R A;  1PZP A;  4KZ3 A;  3RXX A;  1BZA A;  2EXB A;  1PI5 A;  1IYO A;  2Y55 A;  3BLS A;  4OPR A;  4X69 A;  5DTT A;  5CER A;  5U47 A;  1WE4 A;  4MNR A;  4DDY A;  2ZD8 A;  3BFG A;  4R23 A;  5FI6 A;  4S2L A;  1TVF A;  3UPP A;  3N6I A;  4S2M A;  5DF8 A;  5GLC A;  5HAP A;  1DY6 A;  3ZG9 B;  1BT5 A;  2ZJ9 A;  4ZJ3 A;  1YM1 A;  2Y2I A;  1OME A;  2J9P A;  1CI8 A;  4GN2 A;  5CXW A;  1K4F A;  1BLS A;  4KZ9 A;  5A91 A;  5BOH A;  2X02 A;  5EVI B;  2WUQ A;  2VGK A;  2OLU A;  3IXB A;  4LCM A;  1L0D A;  5EOO A;  2EX9 A;  4KZA A;  3W4Q A;  3IWO A;  4WZ5 A;  1H8Z A;  2HDS A;  4U0T A;  5FI7 A;  1J9M A;  2WGV A;  1IEM A;  3IF5 A;  4Y7P A;  4UA7 A;  3SOI A;  2WKI A;  1K38 A;  4KG6 A;  4DKI A;  3UN7 A;  1JWZ A;  3GR2 A;  4K0X A;  4FCF A;  2HP9 A;  2WAF A;  4JKT A;  5GLA A;  1KE0 A;  1K54 A;  2Y2J A;  1HD8 A;  2ZM8 A;  4KQO A;  4LV1 A;  4FD8 A;  1DJA A;  3NBL A;  2RCX A;  2IWC A;  4JF4 A;  5DF9 A;  3UDI A;  3ZGA B;  4DXB A;  3IWI A;  1NYM A;  2XLN A;  1IKI A;  4JF6 A;  5L2F A;  3IXG A;  5HAI A;  1MPL A;  2EFX A;  2XH9 A;  2IWD A;  1YT4 A;  1ES4 A;  3G30 A;  2ZQ8 A;  1GA9 A;  1GA0 A;  1O7E A;  2OSU A;  1YMS A;  4LV2 A;  4UA6 A;  1XGI A;  3CMZ A;  2WKH A;  3M2K A;  4S2I A;  1K25 A;  4X56 A;  3GVB A;  3BEB A;  3IH8 A;  3ZG8 B;  3PBT A;  4N1H A;  3IWQ A;  2WGI A;  3DWK A;  3PBS A;  5FQJ A;  2Z2M B;  1CEG A;  3FKW A;  1ES2 A;  1NJ4 A;  3D4F A;  4S2K A;  5HW3 A;  4JXV A;  4DDS A;  2HDU A;  3FKV A;  1ES3 A;  1YMX A;  5KSC A;  3C4O A;  1YLY A;  4Y0U A;  5GHZ A;  3NDG A;  1MKI A;  1BLP A;  1G6A A;  2Y2P A;  2H5S A;  1E3U A;  1ONH A;  1XA7 A;  1XXM A;  2EX2 A;  2RL3 A;  2UWX A;  3IF6 C;  5M18 A;  1IYQ A;  5FQM A;  2P9V B;  3SS5 A;  3M6H A;  4DE1 A;  2WAD A;  3HLG A;  3MKF A;  1FCO A;  3A3D A;  4EQI A;  3IXH A;  5CHJ A;  4JXG A;  3UE3 A;  2ZC6 B;  4OPZ A;  3HLW A;  3NDE A;  3HUO A;  4FH2 A;  3IHA A;  5F82 A;  1YLJ A;  1JVJ A;  3DTM A;  2DCF A;  3JYI A;  1LLB A;  2HDQ A;  4S2J A;  3ITA A;  1FCM A;  1MWS A;  3RXW A;  5EVI C;  4GDB A;  3TSG A;  2J7V A;  5FAT A;  1GHP A;  1CEF A;  1YLW A;  3OCL A;  1FCN A;  3Q7V A;  4LCL A;  1L0F A;  4PMA A;  3ZVW A;  3LO7 A;  1TDL A;  4K0W A;  2HP6 A;  3WRT A;  2ZQA A;  3TOI A;  3W8K A;  4CPK A;  5KZH A;  2C5W B;  4O7D A;  1NRF A;  5FAQ A;  3ZHH A;  2ZMA A;  3QNB A;  1PZO A;  5FQK A;  1RGZ A;  2XD5 A;  1U60 A;  3PBO A;  4GKU A;  3HRE A;  4OLG A;  4WBG A;  5JYP A;  5GL9 A;  4E3K A;  1KGF A;  3C5A A;  4LV0 A;  5FAP A;  5TFQ A;  4QD4 A;  4C6Y A;  2OV5 A;  1YLP A;  3C7V A;  3ZNT A;  1PYY A;  3IT9 A;  1MWR A;  5AQA A;  3VP0 A;  4C3Q A;  4D2O A;  4E3J A;  1SCW A;  2C6W B;  2Y59 A;  5CRF A;  4R3B A;  4JF5 A;  4B4Z A;  4P6B A;  3E2L A;  5E2G A;  3O86 A;  4PM8 A;  3Q1F A;  4OP5 A;  2B5R A;  2G2U A;  3VP2 A;  4BQM A;  5A90 A;  5DTK A;  1WYB A;  4R4S A;  3P98 A;  3BEC A;  5EE8 A;  3WS4 A;  3ZCZ A;  4OQI A;  1ZG4 A;  2WGW B;  1ERQ A;  2Z2L B;  2ZC4 B;  4WEJ A;  3G2Y A;  1XP4 A;  5TR7 A;  4WZ5 C;  4P87 A;  3MZF A;  3Q7V B;  5GLD A;  3WS2 A;  3BLM A;  4PPR A;  3VFF A;  1M6K A;  4GNU A;  3MFD A;  3BRM A;  3HLE A;  3IF6 B;  1KE4 A;  5EPH A;  4BEN A;  4N9L A;  3QHY A;  4GD6 A;  2R9X A;  5EEC A;  3IQA A;  3G35 A;  1XPB A;  3CZD A;  3SS4 A;  3UE1 A;  5I94 A;  4ZBE A;  4DE2 A;  3OZH A;  1S0W A;  4OOY A;  4MBH A;  2WKE A;  4YFM A;  4BD1 A;  5KMW A;  3O88 A;  5G18 A;  5CHM A;  1GHI A;  3W4P A;  4DE0 A;  2EX8 A;  1TDG A;  3UDF A;  3ZVT A;  2FFF B;  3NC8 A;  1NXY A;  3LY4 A;  5GLB A;  4KZ6 A;  4IED A;  2P74 A;  5F1G A;  1Z6F A;  1CI9 A;  5JYO A;  4OH0 A;  1ESI A;  3GQZ A;  1N4O A;  4PM7 A;  2XGN A;  1H5X A;  1MWU A;  3HLC A;  4WMC D;  1FSY A;  3UDX A;  1W8Y A;  2JBF A;  3RJU A;  4QHC A;  5A92 A;  3PTE A;  3ITB A;  4KZ8 A;  4R3J A;  1W79 A;  5DVA A;  2J9O A;  1HZO A;  1QME A;  4MBF A;  3N4I A;  2QMI A;  4WM9 A;  1W5D A;  3IXD A;  3G4P A;  2ZQ7 A;  5FQQ A;  5FAS A;  2WGW A;  5GHX A;  1JTG A;  1KVL A;  1TEM A;  5CEC A;  4KG5 A;  4GOG A;  1KDW A;  4OOL A;  5M1A A;  1E25 A;  1K55 C;  1ESU A;  1SKF A;  4X6T A;  5D3O A;  3IF6 A;  2DNS A;  5AQ7 A;  2GDN A;  3CG5 A;  3G31 A;  1LI0 A;  3N8S A;  4OVD A;  5KSH A;  3MZD A;  1FR6 A;  1G68 A;  3HVF A;  5J8X A;  4R0Q A;  2G2W A;  4IVI A;  4JXW A;  4WMC A;  2OLV A;  3FV7 A;  2IWB A;  3AGF A;  4IBX A;  4UHU A;  3V3S A;  4RYE A;  1K6R A;  5CEB A;  1XX2 A;  4M3K A;  3S4X A;  1FSW A;  3LY3 A;  1E3U D;  2PU4 A;  5HAR A;  5HFO A;  3QNC A;  4OQH A;  4WZ4 A;  3BFD A;  2J8Y A;  4L0L A;  4Y0T A;  3UNW A;  1BLH A;  2PU2 A;  2ZC7 A;  2Y2Q A;  1SDE A;  1I5Q A;  4X55 A;  4XXR A;  1KVM A;  2QPN A;  2QZ6 A;  1K6S A;  1Q2P A;  1SDN A;  3B3X A;  5AQB A;  4ZAM A;  5FA7 A;  3SH9 A;  2Q9M A;  2WAE A;  2XDM A;  2R9W A;  3CJM A;  4EV4 A;  4JPM A;  2V20 A;  4GB7 A;  4QY5 A;  4HES A;  5CGX A;  3GTC A;  3SH7 A;  4EBN A;  4N92 A;  2V1Z A;  4P0M A;  2A49 A;  4FH4 A;  3VP1 A;  2BG1 A;  1L0E A;  2P9V A;  4C75 A;  1YLZ A;  3HBR A;  3LCE A;  4GD8 A;  4CJN A;  4RA7 A;  2HPB A;  4E3I A;  4KEN B;  3V50 A;  1HVB A;  3PBR A;  3ZG7 B;  4OOM A;  4DF6 A;  3P09 A;  1ALQ A;  3FWL A;  3WS0 A;  4QY6 A;  3O3V A;  2WZZ A;  3PBN A;  2XD1 A;  5E43 A;  1ONG A;  3DW0 A;  1SHV A;  1BSG A;  4JBF A;  4P85 A;  5HX9 A;  3E2K A;  4X53 A;  1S6R A;  3ZG5 A;  2ZM0 A;  2H0Y A;  1IYP A;  2Y91 A;  3AGD A;  4OKP A;  1PW1 A;  4OON A;  3OPH A;  3IH9 A;  1K54 C;  1K57 A;  2ZLY A;  5DF7 A;  3O87 A;  3BYD A;  5CTN A;  3MXS A;  3W4O A;  3A3J A;  4PM5 A;  1I2W A;  2Y2O A;  4KQQ A;  1LI9 A;  3M6B A;  5FQI A;  1E4D A;  1CK3 A;  1MBL A;  1MY8 A;  4ZDX A;  1JWV A;  4BLM A;  1PI4 A;  4KZ7 A;  1L2S A;  1DJB A;  2JCH A;  3PBQ A;  1KE3 A;  5CTM A;  3VSL A;  3Q81 A;  5FAO A;  4LEN A;  3HLD A;  1K57 C;  3HLF A;  3FYZ A;  4GDN A;  4KZB A;  3UE0 A;  1BUE A;  3LEZ A;  1ZG6 A;  3A3I A;  4Z9Q A;  3V3R A;  3VP4 A;  2EX6 A;  3V39 A;  3FZC A;  1FOF A;  3EQU A;  3VOZ A;  2ZC3 B;  3NCK A;  2EFU A;  3Q7Z A;  4UAA A;  1KDS A;  1LHY A;  3OCN A;  2E8I A;  4K91 A;  5CED A;  4QB8 A;  2WK0 A;  1XGJ A;  3C7U A;  4IBR A;  2Y2H A;  1Q2Q A;  3WS5 A;  2HP5 A;  4B4X A;  5HL1 A;  4OP8 A;  5TGF A;  5F83 A;  4DE3 A;  1H8Y A;  1ERO A;  3EQV A;  1K56 A;  3OPP A;  1K56 D;  1VM1 A;  4PM9 A;  3C4P A;  4QJG A;  2WYX A;  5IHV A;  5EVI D;  3S1Y A;  1ES5 A;  5EVI A;  5FSR A;  1WYC A;  5F1F A;  1JTD A;  2CC1 A;  2Y2K A;  2Y2G A;  4RX3 A;  4R1G A;  3ZFZ A;  3HLB A;  2XFS A;  2HDR A;  5DTS A;  3VFH A;  4FSF A;  4Y0O A;  4S2N C;  1NYY A;  4MLL A;  3MZE A;  1KGE A;  1RP5 A;  3G2Z A;  2V2F F;  1DJC A;  4RVA A;  2XR0 A;  3N8L A;  3TG9 A;  1M40 A;  4KZ5 A;  5GHY A;  3ZNY A;  2Q9N A;  2FFY A;  3MKE A;  1GCE A;  2VGJ A;  2XF3 A;  2Y2L A;  4R4R A;  1IEL A;  2XK1 A;  4LV3 A;  3VMA A;  3ZDJ A;  1JWP A;  4XUZ A;  2XQZ A;  3HUM A;  1ZC2 A;  3OPR A;  3UO9 A;  1YQS A;  4N1X A;  1W7F A;  4E3L A;  4OLD A;  3MBZ A;  5E2E A;  2JC7 A;  1Y54 A;  2EXA A;  4BL2 A;  2XEP A;  3A3E A;  4YIN A;  3V5M A;  1VQQ A;  1ZKJ A;  1HTZ A;  4S2P A;  4WEK A;  4NET A;  3NY4 A;  3ZG0 A;  4A5R A;  4OQ0 A;  3UPO A;  1PWD A;  2X71 A;  1NZO A;  4JXS A;  4B88 A;  1QMF A;  3AGE A;  4N9K A;  4WYY A;  4E3O A;  3WWX A;  3HL9 A;  1ERM A;  3NI9 A;  2ZM2 A;  1IKG A;  1YLT A;  3OC2 A;  1LL5 A;  4UA9 A;  4BJP A;  3PAG A;  4H8R A;  1RGY A;  4KZ4 A;  1PIO A;  4EBL A;  1KGG A;  1NZU A;  2X01 A;  3BM6 A;  4JLF A;  1BTL A;  3GMW A;  3PAE A;  4MBK A;  3I7J A;  5E2H A;  1XKZ A;  1EI5 A;  5FQ9 A;  4ID4 A;  5E2F A;  4MEZ A;  1K4E A;  4QU3 A;  2ZC5 B;  4U0X A;  4OPQ A;  3S22 A;  5HAQ A;  1EWZ A;  4EBP A;  2ZQ9 A;  4ZJ2 A;  2WZX A;  1XA1 A;  4NK3 A;  1IYS A;  3G32 A;  4S2O A;  1LL9 A;  3IHB A;  5A93 A;  2XFT A;  1FR1 A;  3HUN A;  3WS1 A;  1PWC A;  3VP3 A;  3ISG A;  5EUA A;  1W8Q A;  5FDH A;  2BLS A;  2H10 A;  4U3T A;  5AQ9 A;  4ZTK A;  4DXC A;  5M19 A;  4E3N A;  3N7W A;  5EVL A;  3MXR A;  5CGW A;  3GRJ A;  4WEL A;  3A3F A;  4KQR A;  4HEF A;  4RX2 A;  2ZQD A;  2Y2M A;  4KG2 A;  1L0G A;  1C3B A;  4GZB A;  4IVK A;  4PM6 A;  1NY0 A;  2Y4A A;  3BFC A;  1O07 A;  4E6X A;  4BD0 A;  4DRT A;  2I72 A;  1I2S A;  1PWG A;  5CHU A;  3SS3 A;  4F94 A;  1MXO A;  3VOY A;  4Q8I A;  3VSK A;  3BFE A;  1N9B A;  2ZQC A;  1K55 A;  3M2J A;  4HBT A;  4XUX A;  4OPY A;  4ZJ1 A;  4E6W A;  4S2N A;  3UPN A;  2Y2N A;  1FQG A;  1BUL A;  4EUZ A;  2DRW A;  1PW8 A;  1MWT A;  3OPL A;  2PBY A;  5FI2 A;  3WRZ A;  3GSG A;  3Q07 A;  2H0T A;  4HBU A;  1BLC A; 
#chains in the Genus database with same CATH topology
 4E3M A;  2A3U A;  3N8R A;  4KZ3 A;  3RFB A;  1BZA A;  1TS8 A;  1WE4 A;  3VV4 A;  2VA0 A;  3VE4 A;  4S2L A;  1TVF A;  4LLO B;  2KX6 A;  1BT5 A;  2Y2I A;  1CI8 A;  4GN2 A;  1K4F A;  2QJ5 A;  2WUQ A;  3IXB A;  1T1B A;  3T1S A;  4JGO A;  4BBV A;  4KZA A;  3IWO A;  2HDS A;  5HL6 A;  1J9M A;  3SOI A;  1F5M A;  1K38 A;  4KG6 A;  4E04 A;  1K54 A;  1XFQ A;  2RCX A;  5DF9 A;  2W1R A;  2XLN A;  1MPL A;  2INW A;  3BJN A;  4UA6 A;  3CMZ A;  4K08 A;  3M2K A;  4S2I A;  5HDC A;  4EW7 A;  1K25 A;  4X56 A;  2VJW A;  4R38 A;  3IH8 A;  3D9Y A;  4N1H A;  3IWQ A;  2Z2M B;  1CEG A;  1ES2 A;  3D4F A;  4S2K A;  3T4T A;  2HDU A;  1ES3 A;  4Z1W A;  5GHZ A;  1MKI A;  1G6A A;  2H5S A;  1E3U A;  2EX2 A;  2UWX A;  3IF6 C;  3LID A;  3A3D A;  4EQI A;  5CHJ A;  3A0S A;  4JXG A;  2ZC6 B;  2J3W A;  3T1X A;  2HF6 A;  1LLB A;  2J7V A;  5TJJ A;  2PT7 A;  3B42 A;  4P6Z S;  3Q7V A;  1L0F A;  2ACG A;  4IHQ A;  4PMA A;  4EXO A;  3ZVW A;  3LO7 A;  3LR3 A;  1MKM A;  4CPK A;  1CQA A;  2VGL M;  3D72 A;  3OOV A;  5KZH A;  1PZO A;  1OTB A;  3L7H A;  5FQK A;  2XD5 A;  5MC7 A;  3HRE A;  2NUP C;  5FDS A;  2QKP A;  5G4Z A;  2JKT I;  5GL9 A;  4E3K A;  3C5A A;  1XJ4 A;  3IX4 A;  2OV5 A;  1YLP A;  1MWR A;  3CWF A;  4FTX A;  4C3Q A;  4HNB A;  5CRF A;  3NOT C;  3E2L A;  5E2G A;  4PM8 A;  2G2U A;  1F98 A;  5AJG A;  4OQI A;  3EEA A;  2WGW B;  3TW8 A;  2ZC4 B;  1XP4 A;  3LR0 A;  5TR7 A;  4WZ5 C;  4PPR A;  3VFF A;  1M6K A;  1W63 Q;  3BRM A;  1OTI A;  5EPH A;  3QHY A;  2R9X A;  3F1N A;  1XPB A;  3UE1 A;  1S0W A;  4MBH A;  2KLI A;  4HI4 A;  4LRX C;  2OAP 1;  3BWL A;  3ZVT A;  2K7S A;  4IED A;  2ZBB A;  5F1G A;  5JYO A;  1CI9 A;  1N4O A;  2GZA A;  1H5X A;  3HLC A;  1FSY A;  1W8Y A;  5HDS A;  3LI9 A;  1IFQ A;  1W79 A;  2VGL S;  4QPR A;  1QME A;  1W5D A;  5FQQ A;  5FAS A;  2WGW A;  2PAV P;  4OOL A;  1KDW A;  4EQ1 A;  5M1A A;  1K55 C;  4ETX A;  3F1P A;  4X6T A;  5K5B A;  5KSH A;  4JGQ A;  2A2L A;  1G68 A;  5J8X A;  1P0Z A;  5EV0 A;  2G2W A;  4IVI A;  4JXW A;  4BBT A;  1K6R A;  3SW1 A;  3LY3 A;  2PU4 A;  2QHK A;  1EW0 A;  3KSH A;  2Y2Q A;  1H0M A;  4LPZ A;  1Q2P A;  3B3X A;  4ZAM A;  3CJM A;  1NLY A;  3JPU A;  1XJ3 A;  4DMZ A;  4GB7 A;  4QY5 A;  4Y3I A;  4EBN A;  4N92 A;  2V1Z A;  1VET B;  4YNR A;  1H3Q A;  4IUK A;  4X1L A;  4CJN A;  1AWI A;  2XRO A;  1LSX A;  3SZT A;  3FWL A;  3WS0 A;  2XD1 A;  2A24 B;  2D01 A;  1BSG A;  5KIZ A;  2PR5 A;  3RH8 B;  3B33 A;  4WF0 A;  3IH9 A;  3CI6 A;  1K57 A;  2ZLY A;  5DF7 A;  5DFX A;  3MXS A;  1I2W A;  4KQQ A;  1LI9 A;  1MBL A;  1MY8 A;  5J3W A;  4KZ7 A;  2G7U A;  1D06 A;  3LEZ A;  3V39 A;  4EER A;  1T1A A;  1X0O A;  4GS9 A;  4UAA A;  4LFU A;  4WUJ A;  4K91 A;  2O9C A;  2WK0 A;  1XGJ A;  2A24 A;  5AVE A;  3WS5 A;  2HP5 A;  4Y17 A;  2Z6C A;  2K2N A;  3EQV A;  1K56 A;  3OPP A;  4CLC A;  4PM9 A;  3C4P A;  4MDZ A;  1YPR A;  5FSR A;  4RX3 A;  3ZFZ A;  4R1G A;  3MFX A;  2VZW A;  3HLB A;  2XFS A;  4FSF A;  4S2N C;  2JKF A;  2W0N A;  1DJC A;  2JN7 A;  4H6J B;  4RVA A;  3UMD A;  4EEP A;  1FIK A;  4Y13 A;  3MKE A;  1GCE A;  1ZC2 A;  3OPR A;  4ARZ B;  2V1A A;  2VEA A;  2XEP A;  4YIN A;  2V9A A;  1ZKJ A;  4S2P A;  4ETZ A;  2HJ9 C;  4A5R A;  5AVF A;  1QMF A;  2W3F A;  2ZM2 A;  3P7N A;  4UA9 A;  4BJP A;  3CUE A;  1NZU A;  1BTL A;  3QP8 A;  3LIF A;  3FC7 A;  2ZC5 B;  3FPW A;  2E8J A;  1G28 A;  2LB9 A;  2ZMF A;  3CHW P;  2ZQ9 A;  4ZJ2 A;  3H82 A;  5EUA A;  1DP8 A;  5HD5 A;  5M19 A;  4E3N A;  3N7W A;  5CGW A;  4WEL A;  1Z09 A;  1SKO A;  2VLG A;  4HEF A;  1V9Y A;  2HJE A;  4MN7 A;  3BFC A;  1PWG A;  1VEU A;  5CHU A;  3MQO A;  3VOY A;  1J3W A;  3VSK A;  2OWJ A;  1N9B A;  2ZQC A;  4XUX A;  4OPY A;  3UPN A;  1FQG A;  1BUL A;  4EUZ A;  1PW8 A;  1LSW A;  2PR6 A;  3H82 B;  4Y15 A;  1BLC A;  5EOE A;  1GHM A;  2XA7 S;  3JVV A;  4OQG A;  4EWF A;  1NWZ A;  1OTA A;  5DTT A;  2Y55 A;  2PD8 A;  4MNR A;  4DDY A;  2O99 A;  4R23 A;  1OT6 A;  3N6I A;  5DF8 A;  3UME A;  3ZG9 B;  5EM0 A;  1BLS A;  5EVI B;  2VGK A;  3KYZ A;  2W1T B;  1OPX A;  2XRN A;  1H8Z A;  4GHI B;  2ZOI A;  2PYP A;  3IF5 A;  3UN7 A;  2JKG A;  2HP9 A;  3G6O A;  4FD8 A;  3NBL A;  3ZGA B;  2IWC A;  3UDI A;  4DXB A;  5HAI A;  4II7 A;  5HWW A;  4D60 A;  2ZQ8 A;  1TS0 A;  1XGI A;  1S1Y A;  3MXQ A;  2WKH A;  3GVB A;  3LFV A;  3MJQ A;  3PBS A;  5FQJ A;  3FKW A;  2DMW A;  4JXV A;  3FKV A;  2YKH A;  2ZL1 B;  4GHI A;  1BLP A;  2Y2P A;  5M18 A;  1XXM A;  4XT2 B;  5FQM A;  2P9V B;  3M6H A;  2WAD A;  3IXH A;  4OPZ A;  3IX3 A;  1Y28 A;  4FH2 A;  3DTM A;  3TRC A;  3UE6 A;  2HDQ A;  3ITA A;  3RXW A;  5IT5 A;  3TSG A;  5FAT A;  2KOI A;  1GHP A;  1CEF A;  1YLW A;  1FCN A;  1TDL A;  4HIA A;  4I3A A;  2HP6 A;  2ZQA A;  3TOI A;  1NRF A;  5FAQ A;  1KOU A;  2K31 A;  1HLU P;  4GKU A;  4OLG A;  4LV0 A;  5FEF A;  3C30 A;  3LIB A;  3C7V A;  4F3L A;  2BAS A;  1CF0 A;  1PYY A;  3IT9 A;  4XT2 A;  5A8B A;  5AQA A;  3VP0 A;  1MZU A;  4D2O A;  4BMW A;  1SCW A;  2W3G A;  3O86 A;  2QWS A;  2B5R A;  5A90 A;  5DTK A;  1WYB A;  4UQI S;  3BEC A;  5EE8 A;  3ZCZ A;  3T4Q A;  2Z2L B;  4WLA A;  5GLD A;  3BLM A;  2EWW A;  4GNU A;  2ZMV A;  3E98 A;  3L9K A;  1KE4 A;  4JGR A;  4GD6 A;  5EEC A;  3G35 A;  3CZD A;  5I94 A;  3EEH A;  3ZYT A;  1XJ2 A;  3MQ0 A;  2WKE A;  4YFM A;  4HQA A;  4DE0 A;  1TDG A;  3UDF A;  2JKR M;  4KUO A;  1JNU A;  1TS6 A;  3LY4 A;  5GLB A;  4KZ6 A;  1Z6F A;  4OH0 A;  1ESI A;  3GQZ A;  3UDX A;  3B47 A;  3C38 A;  3PTE A;  1G6O A;  4GLQ A;  5L09 A;  1ZHH B;  1HZO A;  4MBF A;  4LGW A;  3PHY A;  3IXD A;  3G4P A;  3IBR A;  1JTG A;  1KVL A;  5CEC A;  1E25 A;  4DJ3 A;  1SKF A;  5D3O A;  1N9O A;  1TF1 A;  2GDN A;  3CG5 A;  2VKS A;  3TE8 A;  2Y8H A;  3PYP A;  3HVF A;  2VK3 A;  3FV7 A;  4UHU A;  3V3S A;  3S4X A;  4UQI M;  1E3U D;  5HAR A;  3QNC A;  4WZ4 A;  3F1O A;  1LSV A;  2P08 A;  1SDN A;  5FL3 A;  3SH9 A;  2R9W A;  3IS2 B;  4JPM A;  5CGX A;  3GTC A;  4P0M A;  3BY8 A;  2HZ5 A;  3LCE A;  1STZ A;  3LI8 A;  4KEN B;  3ZG7 B;  3PXP A;  4DF6 A;  1F2K A;  4G3W A;  3O3V A;  2WZZ A;  5DKK A;  1LT0 A;  2PYR A;  3EGD C;  3DW0 A;  4R3A A;  4JBF A;  5HX9 A;  1YAX A;  3E2K A;  5F5Y A;  1S6R A;  3ZG5 A;  1IYP A;  3AGD A;  4OKP A;  4CLC B;  4OON A;  1DP9 A;  3NUL A;  1ACF A;  2Y2O A;  5FQI A;  4L9E A;  1CK3 A;  4NXF A;  1JWV A;  3Q81 A;  3R4K A;  1K57 C;  4H6J A;  1BUE A;  3A3I A;  3V3R A;  4Z9Q A;  3EQU A;  3VOZ A;  3NCK A;  2EFU A;  3MS6 A;  3T4K A;  1LHY A;  3OCN A;  2E8I A;  4YOF A;  1S1Z A;  4QB8 A;  3DTE A;  3C7U A;  4IBR A;  2Y2H A;  3KSI A;  5HL1 A;  5TGF A;  3LIE A;  5F83 A;  1H8Y A;  1K56 D;  3MQQ A;  4QJG A;  3QP6 A;  1VB6 A;  4X25 A;  5EVI D;  4EU0 A;  3ICY A;  4HHD A;  2W1T A;  5F1F A;  3C2W A;  5DKL A;  4Y0O A;  3DAV A;  4MLL A;  1KGE A;  3G2Z A;  2XR0 A;  5GHY A;  4KZ5 A;  3TJZ C;  2VGJ A;  3VMA A;  4RQ9 A;  1UWP X;  1W7F A;  4E3L A;  5HZH A;  2HGV A;  1Y54 A;  3KSF A;  3V5M A;  4Y5F A;  4MN5 A;  4WEK A;  4HP9 A;  4NET A;  3NY4 A;  2W3D A;  3T4S A;  3UPO A;  3E4O A;  1NZO A;  4N9K A;  4WYY A;  3LYX A;  3DTI A;  3HL9 A;  3NI9 A;  1LL5 A;  1V9Z A;  4EBL A;  1KGG A;  1Y4O A;  3NHQ A;  3I7J A;  4MN6 A;  4ID4 A;  1K4E A;  4QU3 A;  3ZQ5 A;  3S22 A;  1EWZ A;  3T4J A;  3D3O A;  3LIC A;  1XA1 A;  1GSW A;  5HDD A;  3IHB A;  3HUN A;  1W8Q A;  4UEY A;  4LRY C;  2H10 A;  5HPI A;  4DXC A;  1P97 A;  3MXR A;  3A3F A;  4KQR A;  4F3L B;  3LGO A;  1L0G A;  1K0K A;  4GZB A;  1O07 A;  4NXB A;  3SS3 A;  3BFE A;  3M2J A;  4CQH A;  4E6W A;  2R78 A;  2DRW A;  4HJ4 A;  3WRZ A;  4EET B;  3V67 A;  1CJF A;  4HBU A;  1OT9 A;  3BFF A;  3Q82 A;  4BL3 A;  1AXB A;  2J3T C;  3G34 A;  3NIA A;  3RXX A;  1PZP A;  2EXB A;  3BLS A;  4X69 A;  3KSG A;  4OPR A;  3T12 B;  1N9L A;  3BFG A;  5FI6 A;  1DY6 A;  4ZJ3 A;  2J9P A;  4ZRR A;  5CXW A;  4KZ9 A;  3UB9 A;  1W63 M;  2X02 A;  2OLU A;  5EOO A;  5F69 A;  2ZL1 A;  2EX9 A;  3W4Q A;  4WZ5 A;  4U0T A;  5L8M A;  4CLC C;  4CLC D;  2WGV A;  1IEM A;  2PD7 A;  4Y7P A;  1A0K A;  3F1P B;  4DKI A;  4JKT A;  2WAF A;  5G4Y A;  2WKQ A;  4KQO A;  3ULF A;  4JF4 A;  1GSX A;  1NYM A;  1IKI A;  1S4R A;  2XH9 A;  4HH2 A;  1GA9 A;  1YMS A;  1O7E A;  2OSU A;  4PAU A;  3LUQ A;  3PBT A;  3FG8 A;  5HPF A;  2WGI A;  3DWK A;  1NJ4 A;  4DDS A;  2Y79 A;  4Y0U A;  3NDG A;  2RL3 A;  1ONH A;  1IYQ A;  3SS5 A;  4HH3 A;  3MKF A;  1FCO A;  3IHA A;  5F82 A;  2DCF A;  1MWS A;  3RTY A;  5EVI C;  5IU1 A;  4LCL A;  3WRT A;  3W8K A;  2C5W B;  4O7D A;  3ZHH A;  2ZMA A;  3QNB A;  1RGZ A;  3PBO A;  5JYP A;  1KGF A;  5EVE A;  5FAP A;  5TFQ A;  1ZTU A;  4C6Y A;  3DTK A;  3UB8 A;  3ZNT A;  4DN0 A;  2Y59 A;  4JF5 A;  4P6B A;  3WS4 A;  2EA9 A;  2V0W A;  1ZG4 A;  4WEJ A;  3G2Y A;  3MZF A;  1ODV A;  3WS2 A;  3MFD A;  3IF6 B;  2M7V A;  2BTF P;  1D7E A;  4N9L A;  3IQA A;  3NOP C;  3K3D A;  2PDR A;  3VE3 A;  4OOY A;  3BY9 A;  5DFY A;  5LBR A;  5KMW A;  3O88 A;  5CHM A;  3W4P A;  3OLO A;  5EM1 A;  2FFF B;  1NXY A;  2P74 A;  4O8G A;  1MWU A;  2JBF A;  3RJU A;  4QHC A;  4KZ8 A;  2J9O A;  3N4I A;  2QMI A;  3IS2 A;  3CAX A;  4ARZ A;  4KG5 A;  3IF6 A;  2DNS A;  3KX0 X;  5AQ7 A;  1WA9 A;  4OVD A;  3K3C A;  3MZD A;  4WN5 A;  4R0Q A;  4WMC A;  2IWB A;  3QP1 A;  4IBX A;  4RYE A;  2VV8 A;  5CEB A;  4YWZ A;  1XX2 A;  1L3L A;  1FSW A;  2WKP A;  5HFO A;  4GW9 A;  5DJU A;  2J8Y A;  4L0L A;  1TD5 A;  4Y0T A;  1IOU A;  3UNW A;  1BLH A;  2ZC7 A;  1SDE A;  4X55 A;  1KVM A;  5FA7 A;  2Q9M A;  2WAE A;  4PHT A;  2V20 A;  3SH7 A;  3LIA A;  4FH4 A;  1S66 L;  3VP1 A;  3UB7 A;  2O0Y A;  4C75 A;  3JVU A;  2FZ0 A;  4NEE D;  4GD8 A;  4RA7 A;  2HPB A;  1SZV A;  4E3I A;  1HVB A;  3PBR A;  2V8C A;  3BW6 A;  3P09 A;  5E43 A;  2M7U A;  3PR6 A;  1SHV A;  4M4X A;  5EFW A;  1MC0 A;  4X53 A;  3BQA A;  2ZM0 A;  3MMH A;  2H0Y A;  2Y91 A;  4O0P A;  5J4E A;  3BYD A;  5CTN A;  3W4O A;  3A3J A;  3M6B A;  4BLM A;  1PI4 A;  1L2S A;  1DJB A;  2JCH A;  3VSL A;  3LEQ A;  4LEN A;  2OOL A;  3HLF A;  3FYZ A;  1S67 L;  4KZB A;  4ESP A;  4I38 A;  3UE0 A;  3VP4 A;  2B18 A;  3Q7Z A;  1T19 A;  3R7W B;  1T18 A;  2W3E A;  3T4O A;  4Y2F A;  5CED A;  2Z6D A;  1Q2Q A;  3BQ8 A;  4B4X A;  4DJ2 A;  4OP8 A;  3F1N B;  1ERO A;  4L9G A;  2EWV A;  5IHV A;  3S1Y A;  5EVI A;  3DBA A;  2Y2G A;  3EGX C;  1UGU A;  2OAQ 1;  4BWI A;  4ME4 A;  5DTS A;  3VFH A;  1NYY A;  3MZE A;  2V2F F;  2XSS A;  4I3J A;  2Q9N A;  2FFY A;  2Y2L A;  1IEL A;  3R7W A;  4LV3 A;  3ZDJ A;  2GNX A;  4XUZ A;  2V8F A;  4Q0I A;  3VOL A;  3HUM A;  3UO9 A;  4N1X A;  3T4L A;  2M1C A;  2EXA A;  4BL2 A;  2XA7 M;  1VQQ A;  3GEC A;  1HTZ A;  2Q0O A;  2VX8 A;  2MJ6 A;  2X71 A;  4MMN A;  4B88 A;  2JHE A;  3AGE A;  4E3O A;  5HD3 A;  1YLT A;  3OC2 A;  3HCY A;  5HWV A;  2NUT C;  3A0R A;  1RGY A;  4KZ4 A;  4NKP A;  2X01 A;  3BM6 A;  4JLF A;  3GMW A;  4MBK A;  5E2H A;  5FQ9 A;  5E2F A;  4MEZ A;  4OPQ A;  5HAQ A;  4EBP A;  3CUE C;  2JKR I;  3S7O A;  4NK3 A;  1BYW A;  1FR1 A;  3WS1 A;  4R70 A;  2I9V A;  5FDH A;  2BLS A;  3T1Q B;  5EVL A;  4B9O A;  2ZQD A;  4KG2 A;  5I5L A;  1C3B A;  4IVK A;  4PM6 A;  1NY0 A;  3IBJ A;  4E6X A;  4DRT A;  2I72 A;  1I2S A;  3H7W A;  4F94 A;  1MXO A;  1DP6 A;  4Q8I A;  2W3H A;  4ZJ1 A;  1F9I A;  2Y2N A;  5CX7 A;  1GSV A;  1MWT A;  2H28 A;  5FEG A;  3GSG A;  4G3K A;  2H0T A;  1DRM A;  5CGS A;  3DWZ A;  3SH8 A;  4I5S A;  5IS1 A;  1S4S A;  2JE5 A;  2JKT M;  3GV9 A;  3UY6 A;  4GS9 B;  1RCJ A;  4X68 A;  1XFN A;  5U47 A;  1PI5 A;  1IYO A;  3KYE A;  2PHY A;  5CER A;  4Q0J A;  2ZD8 A;  2IA2 A;  1PFL A;  4GJ4 A;  3UPP A;  4S2M A;  5HAP A;  5GLC A;  2ZJ9 A;  1YM1 A;  3H7W B;  1OME A;  5A91 A;  5BOH A;  4LCM A;  1L0D A;  4NXE A;  5FI7 A;  3P01 A;  4X1M A;  4UA7 A;  3EOI A;  1PNE A;  2WKI A;  1P9R A;  5DJT A;  1JWZ A;  3GR2 A;  4K0X A;  4FCF A;  5GLA A;  1KE0 A;  2Y2J A;  4HY8 A;  1HD8 A;  2PBD P;  2ZM8 A;  4LV1 A;  1DJA A;  4AFI A;  3IWI A;  5L2F A;  4PKY A;  4JF6 A;  3IXG A;  2LB5 A;  2EFX A;  2IWD A;  1YT4 A;  1ES4 A;  3G30 A;  3W2Z A;  1GA0 A;  4LV2 A;  2YKF A;  4IJG A;  3BEB A;  2J3T D;  3ZG8 B;  2UV0 E;  5HW3 A;  4EUV A;  1YMX A;  5KSC A;  3C4O A;  4CLC E;  1YLY A;  3NOU C;  1XA7 A;  4DE1 A;  3HLG A;  3QP5 A;  3E4Q A;  3UE3 A;  3HLW A;  3NDE A;  3HUO A;  1YLJ A;  1JVJ A;  3C8C A;  3JYI A;  1FIL A;  4S2J A;  1FCM A;  3NEC A;  4GDB A;  5TBM A;  3OCL A;  4EEU A;  3U4L P;  4K0W A;  4LRZ E;  5C5K A;  3CPT A;  2OWH A;  1G5U A;  1U60 A;  4WBG A;  4QD4 A;  4HP4 A;  1SKO B;  1OJG A;  2AVX A;  2B95 A;  4E3J A;  2C6W B;  4R3B A;  3H9W A;  4B4Z A;  5HSQ A;  2QJ7 A;  1VEU B;  3Q1F A;  4OP5 A;  1OJ5 A;  3VP2 A;  4BQM A;  2PRF A;  4R4S A;  3P98 A;  1TS7 A;  2FH5 A;  1ERQ A;  4Q0H A;  2KDK A;  3QP2 A;  4P87 A;  3Q7V B;  4FUW A;  3HLE A;  3MR0 A;  4BEN A;  3CIT A;  4HOI A;  3SS4 A;  4ZBE A;  4DE2 A;  3OZH A;  3QP4 A;  4BD1 A;  5G18 A;  1GHI A;  5L10 A;  4R6L A;  2EX8 A;  3T1R A;  3NC8 A;  2V1B A;  1XJ6 A;  4PM7 A;  2XGN A;  1LL8 A;  4WMC D;  4L9F A;  5A92 A;  3ITB A;  4R3J A;  5DVA A;  3HJI A;  4WM9 A;  3LR4 A;  2ZQ7 A;  4QWO A;  4G3V A;  1D1J A;  3UB6 A;  5GHX A;  1TEM A;  1T1C A;  4GOG A;  2L4R A;  1ESU A;  2HV1 A;  5F6A A;  2GX5 A;  3G31 A;  2L1M A;  1LI0 A;  3N8S A;  2ZOH A;  3CLO A;  1FR6 A;  2QYB A;  2OLV A;  3AGF A;  4M3K A;  3MSH A;  4OQH A;  3BFD A;  1NLZ A;  2PU2 A;  5L07 A;  4PKY G;  4XXR A;  1I5Q A;  2O9A A;  2QPN A;  2QZ6 A;  1K6S A;  2J80 A;  5AQB A;  2XDM A;  4BBU A;  4EES A;  2P7J A;  4EV4 A;  4HES A;  4FOF A;  2A49 A;  2WKR A;  2BG1 A;  1L0E A;  4WL9 A;  2P9V A;  1YLZ A;  2VV7 A;  3HBR A;  3UB5 P;  2O9B A;  3V50 A;  3O5Y A;  4OOM A;  3OBF A;  1ALQ A;  4JGP A;  4QY6 A;  3PBN A;  4I39 A;  1ONG A;  4P85 A;  5F68 A;  1VHM A;  1PW1 A;  3OPH A;  2W27 A;  1K54 C;  3O87 A;  3KO6 A;  1YSP A;  4PM5 A;  1E4D A;  4ZDX A;  3PBQ A;  1KE3 A;  1VET A;  5CTM A;  2L0W A;  3IX8 A;  5FAO A;  3HLD A;  4GDN A;  5HWT A;  1ZG6 A;  2EX6 A;  3FZC A;  1FOF A;  1UWN X;  2ZC3 B;  1P9W A;  5J7E A;  1KDS A;  1YKD A;  4HJ6 A;  4DE3 A;  1VM1 A;  2WYX A;  1ES5 A;  4NG2 A;  1WYC A;  3A0V A;  1JTD A;  2CC1 A;  2Y2K A;  2V0U A;  1YSQ A;  2HDR A;  3K2N A;  1RP5 A;  3KYQ A;  3S7Q A;  3N8L A;  3TG9 A;  4B93 A;  4GCZ A;  1M40 A;  1OTD A;  3ZNY A;  2D02 A;  4R4R A;  2XF3 A;  2XK1 A;  1JWP A;  2XQZ A;  2B02 A;  1YQS A;  4OLD A;  3MBZ A;  4KUK A;  5E2E A;  2JC7 A;  2CMN A;  4IUH A;  3A3E A;  3ZG0 A;  4OQ0 A;  3T50 A;  1PWD A;  1NRJ A;  3HJK A;  4JXS A;  3WWX A;  1ERM A;  1IKG A;  2P04 A;  3PAG A;  4H8R A;  3S7P A;  1PIO A;  4MCW A;  3F1O B;  3FPV A;  3PAE A;  1XKZ A;  1EI5 A;  4O01 A;  3EWK A;  4U0X A;  1H8M A;  5TBM B;  2WZX A;  1PRQ A;  3S7N A;  1IYS A;  3G32 A;  4S2O A;  1LL9 A;  5A93 A;  2XFT A;  1PWC A;  3VP3 A;  3CPT B;  3ISG A;  3GDI A;  3LR5 A;  4NXG A;  4U3T A;  5AQ9 A;  4ZTK A;  3GRJ A;  3E4P A;  4RX2 A;  4P6Z M;  2Y2M A;  4KQD A;  2Y4A A;  3U2A A;  4BD0 A;  2GJ3 A;  1N9N A;  4I3I A;  1OTE A;  2VV6 A;  1K55 A;  4HBT A;  4S2N A;  3MF0 A;  4HJ3 A;  3NJA A;  3OPL A;  2PBY A;  5FI2 A;  3Q07 A;  3E0Y A; 
#chains in the Genus database with same CATH homology
 5CGS A;  5EOE A;  3DWZ A;  3SH8 A;  1GHM A;  3BFF A;  3Q82 A;  4BL3 A;  4OQG A;  1AXB A;  2JE5 A;  4EWF A;  3GV9 A;  4E3M A;  3G34 A;  3UY6 A;  1RCJ A;  3NIA A;  4X68 A;  2A3U A;  3N8R A;  1PZP A;  4KZ3 A;  3RXX A;  1BZA A;  2EXB A;  1PI5 A;  1IYO A;  2Y55 A;  3BLS A;  4OPR A;  4X69 A;  5DTT A;  5CER A;  5U47 A;  1WE4 A;  4MNR A;  4DDY A;  2ZD8 A;  3BFG A;  4R23 A;  5FI6 A;  4S2L A;  1TVF A;  3UPP A;  3N6I A;  4S2M A;  5DF8 A;  5GLC A;  5HAP A;  1DY6 A;  3ZG9 B;  1BT5 A;  2ZJ9 A;  4ZJ3 A;  1YM1 A;  2Y2I A;  1OME A;  2J9P A;  1CI8 A;  4GN2 A;  5CXW A;  1K4F A;  1BLS A;  4KZ9 A;  5A91 A;  5BOH A;  2X02 A;  5EVI B;  2WUQ A;  2VGK A;  2OLU A;  3IXB A;  4LCM A;  1L0D A;  5EOO A;  2EX9 A;  4KZA A;  3W4Q A;  3IWO A;  4WZ5 A;  1H8Z A;  2HDS A;  4U0T A;  5FI7 A;  1J9M A;  2WGV A;  1IEM A;  3IF5 A;  4Y7P A;  4UA7 A;  3SOI A;  2WKI A;  1K38 A;  4KG6 A;  4DKI A;  3UN7 A;  1JWZ A;  3GR2 A;  4K0X A;  4FCF A;  2HP9 A;  2WAF A;  4JKT A;  5GLA A;  1KE0 A;  1K54 A;  2Y2J A;  1HD8 A;  2ZM8 A;  4KQO A;  4LV1 A;  4FD8 A;  1DJA A;  3NBL A;  2RCX A;  2IWC A;  4JF4 A;  5DF9 A;  3UDI A;  3ZGA B;  4DXB A;  3IWI A;  1NYM A;  2XLN A;  1IKI A;  4JF6 A;  5L2F A;  3IXG A;  5HAI A;  1MPL A;  2EFX A;  2XH9 A;  2IWD A;  1YT4 A;  1ES4 A;  3G30 A;  2ZQ8 A;  1GA9 A;  1GA0 A;  1O7E A;  2OSU A;  1YMS A;  4LV2 A;  4UA6 A;  1XGI A;  3CMZ A;  2WKH A;  3M2K A;  4S2I A;  1K25 A;  4X56 A;  3GVB A;  3BEB A;  3IH8 A;  3ZG8 B;  3PBT A;  4N1H A;  3IWQ A;  2WGI A;  3DWK A;  3PBS A;  5FQJ A;  2Z2M B;  1CEG A;  3FKW A;  1ES2 A;  1NJ4 A;  3D4F A;  4S2K A;  5HW3 A;  4JXV A;  4DDS A;  2HDU A;  3FKV A;  1ES3 A;  1YMX A;  5KSC A;  3C4O A;  1YLY A;  4Y0U A;  5GHZ A;  3NDG A;  1MKI A;  1BLP A;  1G6A A;  2Y2P A;  2H5S A;  1E3U A;  1ONH A;  1XA7 A;  1XXM A;  2EX2 A;  2RL3 A;  2UWX A;  3IF6 C;  5M18 A;  1IYQ A;  5FQM A;  2P9V B;  3SS5 A;  3M6H A;  4DE1 A;  2WAD A;  3HLG A;  3MKF A;  1FCO A;  3A3D A;  4EQI A;  3IXH A;  5CHJ A;  4JXG A;  3UE3 A;  2ZC6 B;  4OPZ A;  3HLW A;  3NDE A;  3HUO A;  4FH2 A;  3IHA A;  5F82 A;  1YLJ A;  1JVJ A;  3DTM A;  2DCF A;  3JYI A;  1LLB A;  2HDQ A;  4S2J A;  3ITA A;  1FCM A;  1MWS A;  3RXW A;  5EVI C;  4GDB A;  3TSG A;  2J7V A;  5FAT A;  1GHP A;  1CEF A;  1YLW A;  3OCL A;  1FCN A;  3Q7V A;  4LCL A;  1L0F A;  4PMA A;  3ZVW A;  3LO7 A;  1TDL A;  4K0W A;  2HP6 A;  3WRT A;  2ZQA A;  3TOI A;  3W8K A;  4CPK A;  5KZH A;  2C5W B;  4O7D A;  1NRF A;  5FAQ A;  3ZHH A;  2ZMA A;  3QNB A;  1PZO A;  5FQK A;  1RGZ A;  2XD5 A;  1U60 A;  3PBO A;  4GKU A;  3HRE A;  4OLG A;  4WBG A;  5JYP A;  5GL9 A;  4E3K A;  1KGF A;  3C5A A;  4LV0 A;  5FAP A;  5TFQ A;  4QD4 A;  4C6Y A;  2OV5 A;  1YLP A;  3C7V A;  3ZNT A;  1PYY A;  3IT9 A;  1MWR A;  5AQA A;  3VP0 A;  4C3Q A;  4D2O A;  4E3J A;  1SCW A;  2C6W B;  2Y59 A;  5CRF A;  4R3B A;  4JF5 A;  4B4Z A;  4P6B A;  3E2L A;  5E2G A;  3O86 A;  4PM8 A;  3Q1F A;  4OP5 A;  2B5R A;  2G2U A;  3VP2 A;  4BQM A;  5A90 A;  5DTK A;  1WYB A;  4R4S A;  3P98 A;  3BEC A;  5EE8 A;  3WS4 A;  3ZCZ A;  4OQI A;  1ZG4 A;  2WGW B;  1ERQ A;  2Z2L B;  2ZC4 B;  4WEJ A;  3G2Y A;  1XP4 A;  5TR7 A;  4WZ5 C;  4P87 A;  3MZF A;  3Q7V B;  5GLD A;  3WS2 A;  3BLM A;  4PPR A;  3VFF A;  1M6K A;  4GNU A;  3MFD A;  3BRM A;  3HLE A;  3IF6 B;  1KE4 A;  5EPH A;  4BEN A;  4N9L A;  3QHY A;  4GD6 A;  2R9X A;  5EEC A;  3IQA A;  3G35 A;  1XPB A;  3CZD A;  3SS4 A;  3UE1 A;  5I94 A;  4ZBE A;  4DE2 A;  3OZH A;  1S0W A;  4OOY A;  4MBH A;  2WKE A;  4YFM A;  4BD1 A;  5KMW A;  3O88 A;  5G18 A;  5CHM A;  1GHI A;  3W4P A;  4DE0 A;  2EX8 A;  1TDG A;  3UDF A;  3ZVT A;  2FFF B;  3NC8 A;  1NXY A;  3LY4 A;  5GLB A;  4KZ6 A;  4IED A;  2P74 A;  5F1G A;  1Z6F A;  1CI9 A;  5JYO A;  4OH0 A;  1ESI A;  3GQZ A;  1N4O A;  4PM7 A;  2XGN A;  1H5X A;  1MWU A;  3HLC A;  4WMC D;  1FSY A;  3UDX A;  1W8Y A;  2JBF A;  3RJU A;  4QHC A;  5A92 A;  3PTE A;  3ITB A;  4KZ8 A;  4R3J A;  1W79 A;  5DVA A;  2J9O A;  1HZO A;  1QME A;  4MBF A;  3N4I A;  2QMI A;  4WM9 A;  1W5D A;  3IXD A;  3G4P A;  2ZQ7 A;  5FQQ A;  5FAS A;  2WGW A;  5GHX A;  1JTG A;  1KVL A;  1TEM A;  5CEC A;  4KG5 A;  4GOG A;  1KDW A;  4OOL A;  5M1A A;  1E25 A;  1K55 C;  1ESU A;  1SKF A;  4X6T A;  5D3O A;  3IF6 A;  2DNS A;  5AQ7 A;  2GDN A;  3CG5 A;  3G31 A;  1LI0 A;  3N8S A;  4OVD A;  5KSH A;  3MZD A;  1FR6 A;  1G68 A;  3HVF A;  5J8X A;  4R0Q A;  2G2W A;  4IVI A;  4JXW A;  4WMC A;  2OLV A;  3FV7 A;  2IWB A;  3AGF A;  4IBX A;  4UHU A;  3V3S A;  4RYE A;  1K6R A;  5CEB A;  1XX2 A;  4M3K A;  3S4X A;  1FSW A;  3LY3 A;  1E3U D;  2PU4 A;  5HAR A;  5HFO A;  3QNC A;  4OQH A;  4WZ4 A;  3BFD A;  2J8Y A;  4L0L A;  4Y0T A;  3UNW A;  1BLH A;  2PU2 A;  2ZC7 A;  2Y2Q A;  1SDE A;  1I5Q A;  4X55 A;  4XXR A;  1KVM A;  2QPN A;  2QZ6 A;  1K6S A;  1Q2P A;  1SDN A;  3B3X A;  5AQB A;  4ZAM A;  5FA7 A;  3SH9 A;  2Q9M A;  2WAE A;  2XDM A;  2R9W A;  3CJM A;  4EV4 A;  4JPM A;  2V20 A;  4GB7 A;  4QY5 A;  4HES A;  5CGX A;  3GTC A;  3SH7 A;  4EBN A;  4N92 A;  2V1Z A;  4P0M A;  2A49 A;  4FH4 A;  3VP1 A;  2BG1 A;  1L0E A;  2P9V A;  4C75 A;  1YLZ A;  3HBR A;  3LCE A;  4GD8 A;  4CJN A;  4RA7 A;  2HPB A;  4E3I A;  4KEN B;  3V50 A;  1HVB A;  3PBR A;  3ZG7 B;  4OOM A;  4DF6 A;  3P09 A;  1ALQ A;  3FWL A;  3WS0 A;  4QY6 A;  3O3V A;  2WZZ A;  3PBN A;  2XD1 A;  5E43 A;  1ONG A;  3DW0 A;  1SHV A;  1BSG A;  4JBF A;  4P85 A;  5HX9 A;  3E2K A;  4X53 A;  1S6R A;  3ZG5 A;  2ZM0 A;  2H0Y A;  1IYP A;  2Y91 A;  3AGD A;  4OKP A;  1PW1 A;  4OON A;  3OPH A;  3IH9 A;  1K54 C;  1K57 A;  2ZLY A;  5DF7 A;  3O87 A;  3BYD A;  5CTN A;  3MXS A;  3W4O A;  3A3J A;  4PM5 A;  1I2W A;  2Y2O A;  4KQQ A;  1LI9 A;  3M6B A;  5FQI A;  1E4D A;  1CK3 A;  1MBL A;  1MY8 A;  4ZDX A;  1JWV A;  4BLM A;  1PI4 A;  4KZ7 A;  1L2S A;  1DJB A;  2JCH A;  3PBQ A;  1KE3 A;  5CTM A;  3VSL A;  3Q81 A;  5FAO A;  4LEN A;  3HLD A;  1K57 C;  3HLF A;  3FYZ A;  4GDN A;  4KZB A;  3UE0 A;  1BUE A;  3LEZ A;  1ZG6 A;  3A3I A;  4Z9Q A;  3V3R A;  3VP4 A;  2EX6 A;  3V39 A;  3FZC A;  1FOF A;  3EQU A;  3VOZ A;  2ZC3 B;  3NCK A;  2EFU A;  3Q7Z A;  4UAA A;  1KDS A;  1LHY A;  3OCN A;  2E8I A;  4K91 A;  5CED A;  4QB8 A;  2WK0 A;  1XGJ A;  3C7U A;  4IBR A;  2Y2H A;  1Q2Q A;  3WS5 A;  2HP5 A;  4B4X A;  5HL1 A;  4OP8 A;  5TGF A;  5F83 A;  4DE3 A;  1H8Y A;  1ERO A;  3EQV A;  1K56 A;  3OPP A;  1K56 D;  1VM1 A;  4PM9 A;  3C4P A;  4QJG A;  2WYX A;  5IHV A;  5EVI D;  3S1Y A;  1ES5 A;  5EVI A;  5FSR A;  1WYC A;  5F1F A;  1JTD A;  2CC1 A;  2Y2K A;  2Y2G A;  4RX3 A;  4R1G A;  3ZFZ A;  3HLB A;  2XFS A;  2HDR A;  5DTS A;  3VFH A;  4FSF A;  4Y0O A;  4S2N C;  1NYY A;  4MLL A;  3MZE A;  1KGE A;  1RP5 A;  3G2Z A;  2V2F F;  1DJC A;  4RVA A;  2XR0 A;  3N8L A;  3TG9 A;  1M40 A;  4KZ5 A;  5GHY A;  3ZNY A;  2Q9N A;  2FFY A;  3MKE A;  1GCE A;  2VGJ A;  2XF3 A;  2Y2L A;  4R4R A;  1IEL A;  2XK1 A;  4LV3 A;  3VMA A;  3ZDJ A;  1JWP A;  4XUZ A;  2XQZ A;  3HUM A;  1ZC2 A;  3OPR A;  3UO9 A;  1YQS A;  4N1X A;  1W7F A;  4E3L A;  4OLD A;  3MBZ A;  5E2E A;  2JC7 A;  1Y54 A;  2EXA A;  4BL2 A;  2XEP A;  3A3E A;  4YIN A;  3V5M A;  1VQQ A;  1ZKJ A;  1HTZ A;  4S2P A;  4WEK A;  4NET A;  3NY4 A;  3ZG0 A;  4A5R A;  4OQ0 A;  3UPO A;  1PWD A;  2X71 A;  1NZO A;  4JXS A;  4B88 A;  1QMF A;  3AGE A;  4N9K A;  4WYY A;  4E3O A;  3WWX A;  3HL9 A;  1ERM A;  3NI9 A;  2ZM2 A;  1IKG A;  1YLT A;  3OC2 A;  1LL5 A;  4UA9 A;  4BJP A;  3PAG A;  4H8R A;  1RGY A;  4KZ4 A;  1PIO A;  4EBL A;  1KGG A;  1NZU A;  2X01 A;  3BM6 A;  4JLF A;  1BTL A;  3GMW A;  3PAE A;  4MBK A;  3I7J A;  5E2H A;  1XKZ A;  1EI5 A;  5FQ9 A;  4ID4 A;  5E2F A;  4MEZ A;  1K4E A;  4QU3 A;  2ZC5 B;  4U0X A;  4OPQ A;  3S22 A;  5HAQ A;  1EWZ A;  4EBP A;  2ZQ9 A;  4ZJ2 A;  2WZX A;  1XA1 A;  4NK3 A;  1IYS A;  3G32 A;  4S2O A;  1LL9 A;  3IHB A;  5A93 A;  2XFT A;  1FR1 A;  3HUN A;  3WS1 A;  1PWC A;  3VP3 A;  3ISG A;  5EUA A;  1W8Q A;  5FDH A;  2BLS A;  2H10 A;  4U3T A;  5AQ9 A;  4ZTK A;  4DXC A;  5M19 A;  4E3N A;  3N7W A;  5EVL A;  3MXR A;  5CGW A;  3GRJ A;  4WEL A;  3A3F A;  4KQR A;  4HEF A;  4RX2 A;  2ZQD A;  2Y2M A;  4KG2 A;  1L0G A;  1C3B A;  4GZB A;  4IVK A;  4PM6 A;  1NY0 A;  2Y4A A;  3BFC A;  1O07 A;  4E6X A;  4BD0 A;  4DRT A;  2I72 A;  1I2S A;  1PWG A;  5CHU A;  3SS3 A;  4F94 A;  1MXO A;  3VOY A;  4Q8I A;  3VSK A;  3BFE A;  1N9B A;  2ZQC A;  1K55 A;  3M2J A;  4HBT A;  4XUX A;  4OPY A;  4ZJ1 A;  4E6W A;  4S2N A;  3UPN A;  2Y2N A;  1FQG A;  1BUL A;  4EUZ A;  2DRW A;  1PW8 A;  1MWT A;  3OPL A;  2PBY A;  5FI2 A;  3WRZ A;  3GSG A;  3Q07 A;  2H0T A;  4HBU A;  1BLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...