5FQMA

Last common ancestor of gram negative bacteria (gnca) class a beta- lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
b'QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADWRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA BETA LACTAMASE
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqmA00
3ZVTA 4BJPA 4HBUA 2P74A 1RGYA 2WGWB 3AGEA 4HBTA 4S2NC 5EOOA 3HLEA 1DJAA 5AQBA 3SS5A 3WRZA 1NZOA 1WE4A 4N1HA 3PBSA 2C6WB 3HUNA 2H0YA 3UY6A 4E3KA 5GHYA 1C3BA 3MKFA 3CZDA 5DF9A 4OQ0A 5CHUA 3FV7A 1S0WA 4PM5A 4KQOA 3WS2A 3EQVA 4C6YA 1XA7A 5D3OA 4BD1A 2C5WB 4X53A 4BL3A 2P9VA 3LY4A 1CEFA 3FKWA 2Y2QA 5EOEA 4EQIA 4F94A 1ZG6A 3OPHA 1CEGA 2PU2A 5IHVA 4ZAMA 2Y2KA 2XH9A 4NK3A 2ZC6B 5CECA 4YINA 3ITBA 4DF6A 1FR1A 1FCNA 4CPKA 2A49A 5TFQA 2ZC3B 5CTMA 1LI0A 1S6RA 5FQJA 1L0GA 3ZDJA 4DE3A 1CI8A 5HL1A 4PM7A 4E6WA 1HVBA 2J7VA 3HLFA 4M3KA 4MEZA 4GNUA 4QHCA 2QZ6A 4N9KA 4Y0TA 3G31A 4S2KA 3O88A 3UNWA 2UWXA 5CGWA 3CMZA 4S2JA 1YLPA 3O87A 1KE4A 1NJ4A 3HLWA 5CHJA 2VGJA 4ZJ1A 4PM9A 3IWIA 4U0XA 3SS3A 4X68A 2PBYA 4BLMA 4GKUA 4JF5A 4KZ5A 4E3NA 2ZC5B 3WWXA 3IQAA 3BLSA 2WZZA 2Y2PA 3VSLA 3VP0A 3OPLA 2IWDA 1OMEA 2PU4A 4K0WA 4X55A 5CGXA 4P0MA 3TOIA 5FAQA 1HZOA 5CGSA 1KE3A 4KZ3A 1K55C 5DF8A 5E2FA 5EVLA 1Q2QA 5FSRA 2CC1A 3V3RA 1FCMA 1L0FA 3G32A 5EVIC 3DTMA 1N4OA 3N6IA 2V1ZA 4KG2A 2ZQ7A 4R4SA 4WYYA 5DTTA 3V50A 3PBTA 5KMWA 4DXCA 4JXSA 5DTSA 4E3IA 4Y0UA 3QNCA 3VFFA 1RCJA 1YQSA 2Y2NA 3FWLA 3G34A 1EROA 4JF4A 2HP9A 4Y7PA 3SH7A 3W4PA 2Y59A 4OPZA 4IVKA 1LLBA 2H0TA 5FI7A 2EXBA 1PW1A 4K0XA 4KENB 4OLGA 2XGNA 4KZBA 3MZEA 1XP4A 1L0EA 2V20A 4OOMA 5DF7A 4DXBA 3VOZA 4P6BA 4R3JA 1GHPA 2X71A 5FAOA 1LL9A 4RYEA 3IF6C 5CTNA 5G18A 5CHMA 3V3SA 1K54A 3ZG5A 2EX6A 2ZMAA 4WZ4A 1Y54A 1JWPA 3RXXA 2JC7A 2Y2HA 4OOYA 4ZBEA 1ERQA 1N9BA 5M1AA 2HDQA 4C75A 5HAIA 4PPRA 4HEFA 1IKIA 4WM9A 1DJBA 3UPPA 4D2OA 3HLBA 1ALQA 4EBNA 2E8IA 4BL2A 1K57C 3MXRA 1FCOA 1VQQA 1KDSA 4X69A 5E43A 3W8KA 3TG9A 1GA9A 2XEPA 2ZQDA 3NDGA 4RX3A 1FSWA 1QMFA 3QNBA 5FATA 2B5RA 1KGGA 1W8QA 3N7WA 3ISGA 4GZBA 4JF6A 1I5QA 4OOLA 2EX2A 3V5MA 5KZHA 1BLSA 4IEDA 3DW0A 3N8SA 4O7DA 3MBZA 4PM8A 1BSGA 4IVIA 4L0LA 4ZJ3A 2J9OA 4S2OA 3S4XA 4EUZA 3D4FA 4MBFA 1O7EA 1E4DA 1NY0A 2QPNA 2ZLYA 4R23A 4EBLA 3ZFZA 1SDEA 4LV1A 5E2GA 3VFHA 5JYPA 4OP8A 1MXOA 3GMWA 3A3DA 4P87A 5DTKA 3WS0A 1BZAA 1JTGA 3BFCA 3RXWA 1TDGA 1PW8A 5KSHA 1WYCA 5HFOA 5F1FA 4Z9QA 3EQUA 2XLNA 4B88A 4MBHA 4XXRA 2FFFB 2G2UA 4WBGA 4DE2A 2RL3A 3IXBA 2J9PA 3ZG9B 5CEBA 3N8LA 3ZNYA 4EWFA 1ES5A 1RP5A 2WUQA 2WKHA 2WGWA 3VP1A 4WZ5A 4N92A 4DKIA 1NYYA 3W4OA 4R1GA 1BT5A 2WGVA 1KGEA 1K25A 2EXAA 3PTEA 4HESA 3SS4A 1ZC2A 4UA6A 5EVID 5FQIA 1K56D 5EECA 4LCMA 1J9MA 4OQGA 2HDRA 4OP5A 5EVIB 3ZNTA 4GD8A 2WKEA 5GLCA 5FQ9A 2HP6A 2ZQ9A 1MY8A 1W8YA 3VSKA 3IF5A 3VOYA 4OQIA 1YLZA 4GDBA 5A92A 3N4IA 5EUAA 1H8ZA 1K4EA 3BFGA 1IYQA 3WRTA 1L2SA 3NDEA 2BLSA 3ZGAB 2QMIA 1HD8A 4FCFA 1W7FA 3IWQA 1U60A 3C7UA 1AXBA 3BEBA 1SHVA 3PAGA 5JYOA 1YLYA 1XGJA 1LI9A 3A3FA 4K91A 3IF6B 1YLWA 3UN7A 1TEMA 4CJNA 5FDHA 3AGFA 1K4FA 3MZDA 4JPMA 4KZ9A 2R9WA 5TGFA 3LEZA 4S2PA 1NXYA 2ZQ8A 5CEDA 2Z2MB 3G2ZA 1PWGA 1XXMA 4EV4A 3OCLA 4PMAA 3PBRA 4Q8IA 3BFFA 5I94A 2BG1A 1EI5A 2Y4AA 2ZQCA 4BENA 1PWCA 2Y2GA 4UA9A 2GDNA 1PYYA 2G2WA 2Y2OA 2ZQAA 1LHYA 3Q81A 1NRFA 3OPPA 2EX8A 3SH8A 4GB7A 4E6XA 1IYOA 1PZOA 3O86A 2IWCA 4B4XA 3UO9A 3NBLA 2XDMA 4OVDA 2Y2JA 1IYPA 2Y55A 3LCEA 3UE0A 1ZG4A 3B3XA 1XPBA 1YLTA 1ES4A 1W5DA 4KZ8A 4OPRA 4GN2A 4LV2A 5TR7A 4QB8A 4Y0OA 2WK0A 4RA7A 1MWUA 5GHZA 1RGZA 3MZFA 5KSCA 3C4OA 1GHMA 3UDIA 1QMEA 4FH2A 4R0QA 5FQQA 3M6BA 4ID4A 2R9XA 2Q9NA 4KG5A 1DJCA 3GV9A 3BRMA 4LENA 4OKPA 4RX2A 1K6SA 1BLHA 2ZM0A 2DCFA 1KDWA 4NETA 1JWZA 4U3TA 2HDSA 3IXHA 1BLCA 1BULA 3N8RA 1FQGA 4JXWA 1FSYA 3IHBA 3TSGA 3BYDA 4R4RA 4E3JA 4U0TA 2V2FF 4S2NA 3IH8A 5HAPA 1MWSA 3BM6A 4S2LA 5FQMA 3G30A 2ZJ9A 2OSUA 4EBPA 1H5XA 4FSFA 1GCEA 3Q7ZA 4JKTA 4KZ6A 4KZ7A 4YFMA 4JXGA 5HW3A 1MPLA 3GQZA 1SCWA 2OLUA 3S22A 1VM1A 2OLVA 1NZUA 4N9LA 5CXWA 5GLBA 3HVFA 3OZHA 3O3VA 2J8YA 3GRJA 3BECA 5L2FA 2HP5A 4E3OA 3GTCA 4DE1A 3OCNA 3MKEA 5HAQA 2I72A 4H8RA 3IWOA 3M2JA 2ZC7A 4GOGA 2FFYA 1XGIA 5FASA 5E2HA 1KVLA 1IKGA 2EFXA 3A3IA 3V39A 1K6RA 1KE0A 4UAAA 1ZKJA 1Z6FA 1PWDA 3HBRA 3IXDA 4BQMA 5GLDA 2OV5A 3UE3A 2EX9A 5CERA 3BLMA 2WYXA 5U47A 3HLDA 2X02A 1MWTA 4JLFA 1GHIA 3WS5A 3LY3A 5FI6A 1XX2A 2XR0A 3CG5A 3UPNA 1YMXA 3I7JA 4S2IA 1NYMA 3HUMA 2JBFA 1MWRA 2RCXA 3P98A 4DE0A 4DRTA 4WELA 1JVJA 2P9VB 4R3BA 4UA7A 3HREA 5HARA 2A3UA 4JBFA 3UE1A 3GVBA 4X6TA 2ZD8A 4MNRA 2XD1A 1W79A 3NCKA 1IELA 5M18A 4GD6A 4PM6A 1IEMA 4GDNA 3ZVWA 1E25A 1KVMA 1K55A 1FR6A 3ZCZA 2Y2LA 5FAPA 2DRWA 4XUZA 3S1YA 3VP4A 5A90A 4C3QA 2H5SA 5AQAA 4WMCD 5EVIA 3ZG8B 2WGIA 4ZJ2A 1K56A 3Q1FA 3IH9A 4QJGA 3NC8A 4IBRA 5FA7A 3LO7A 4XUXA 5A93A 1YLJA 2HDUA 1ES3A 2XF3A 2HPBA 2H10A 4WEKA 4E3MA 1CI9A 1CK3A 1SDNA 1YM1A 2XFSA 2XQZA 2XK1A 3Q7VB 1L0DA 1SKFA 3PBQA 3FZCA 4KZAA 4OLDA 5GLAA 3SH9A 3UPOA 3VP3A 3ZHHA 1WYBA 4WMCA 2Y2MA 1TVFA 4WZ5C 4FD8A 5J8XA 1ONHA 2ZM8A 4QU3A 2Y91A 4ZDXA 4MBKA 4OQHA 1ES2A 3IF6A 1ERMA 1MKIA 3PAEA 3A3EA 3M6HA 2WKIA 3Q7VA 4A5RA 1FOFA 2DNSA 3DWKA 3BFDA 3NIAA 1Q2PA 3G2YA 3G4PA 2ZM2A 3IXGA 4OH0A 1HTZA 1IYSA 1LL5A 3JYIA 4IBXA 2IWBA 1XA1A 3BFEA 3VMAA 4RVAA 3P09A 4UHUA 4BD0A 1H8YA 4KG6A 1K57A 1DY6A 2Z2LB 3HL9A 3SOIA 2JCHA 5E2EA 3RJUA 5HX9A 4OPQA 3C7VA 5CRFA 3Q07A 2JE5A 4LV0A 4DDSA 5FI2A 2Q9MA 5DVAA 2WAFA 5F82A 1XKZA 1E3UD 4ZTKA 2XFTA 1PI5A 3MXSA 5GHXA 4FH4A 3E2KA 3HLCA 3Q82A 5AQ9A 4KQQA 4P85A 4OPYA 5M19A 5F83A 3ZG7B 1BUEA 3WS1A 5BOHA 3AGDA 1YMSA 2WZXA 3PBNA 3CJMA 1JWVA 4X56A 5F1GA 2WAEA 1M40A 5FQKA 1MBLA 3OPRA 3FKVA 1K38A 3ITAA 4OONA 5AQ7A 3E2LA 3GR2A 3WS4A 4N1XA 1E3UA 1YT4A 2WADA 4KZ4A 1TDLA 3FYZA 3A3JA 3OC2A 4QY5A 1G68A 4WEJA 1PZPA 1JTDA 3GSGA 1EWZA 2VGKA 3C5AA 3W4QA 1I2WA 1O07A 2X01A 3DWZA 1ONGA 1BLPA 4LCLA 3MFDA 4MLLA 1GA0A 4LV3A 3C4PA 3NY4A 3VP2A 1ESIA 5EE8A 3NI9A 1BTLA 1KGFA 3M2KA 3ZG0A 4S2MA 1I2SA 4KQRA 5GL9A 1PI4A 1ESUA 1PIOA 3G35A 1K54C 2ZC4B 3PBOA 4JXVA 3UDXA 4E3LA 4QD4A 3QHYA 4B4ZA 3HLGA 1M6KA 4QY6A 3IT9A 4DDYA 3UDFA 3HUOA 1G6AA 2Y2IA 3IHAA 2XD5A 5A91A 5EPHA 2EFUA
chains in the Genus database with same CATH superfamily
2WGWB 2YKHA 3S7NA 4S2NC 4Q0HA 1DJAA 2EA9A 3MXQA 1WE4A 3PBSA 2C6WB 4E3KA 5DFYA 3CZDA 2PYRA 3EQVA 4C6YA 5D3OA 4BL3A 1F2KA 3C38A 3TE8A 5HDCA 2ACGA 5IHVA 5J3WA 4YINA 3ITBA 4DF6A 1FR1A 2A49A 5HL1A 1HVBA 3HLFA 4MEZA 3MSHA 4GNUA 1FILA 4S2KA 2UWXA 3EGXC 1YLPA 3O87A 1NJ4A 3HLWA 4PM9A 3CAXA 4KZ5A 2J3TD 2ZC5B 2VA0A 4MN5A 3F1OB 3TJZC 2PU4A 4HQAA 2B02A 5CGSA 2HJEA 5FSRA 3V3RA 1FCMA 4KG2A 4WYYA 5KMWA 4E3IA 1AWIA 3VFFA 2Y2NA 5HPFA 3G34A 1EROA 4JF4A 2JKTM 3QP6A 3E0YA 2H0TA 2QJ5A 4OLGA 2XGNA 1WA9A 3MZEA 2JKRI 1DP8A 1VETA 3VOZA 2XA7S 3D9YA 3CPTB 3NULA 3C8CA 5CHMA 3V3SA 3RFBA 3CWFA 4WZ4A 2XSSA 1Y54A 4B9OA 2JC7A 2V9AA 1DJBA 3UPPA 3HLBA 1ALQA 2E8IA 5KIZA 4MMNA 1H0MA 1FSWA 3QNBA 1W8QA 4NG2A 3ISGA 1V9ZA 4WUJA 1I5QA 4GS9A 3V5MA 1BLSA 2J9OA 4EUZA 3D4FA 4MBFA 2QPNA 1E4DA 2ZLYA 4R23A 2D02A 3VFHA 4ARZA 3NOPC 3GMWA 4P87A 1OT6A 5DTKA 1PW8A 5KSHA 2GX5A 5J4EA 1P97A 3EQUA 2XLNA 3C2WA 4XXRA 2FFFB 2G2UA 4LRXC 1BYWA 4WBGA 2RL3A 3IXBA 3ZG9B 4IJGA 2WGWA 4EERA 3KX0X 3F1PB 5EVEA 4CLCB 2WGVA 2PR6A 4GHIB 5EVID 4UA6A 1K56D 2V0UA 4OP5A 4GD8A 4CQHA 5TJJA 1LL8A 4NXGA 3E4QA 3VOYA 4OQIA 1X0OA 1T1BA 5EUAA 1H8ZA 1K4EA 3WRTA 1PRQA 4FCFA 1U60A 3C7UA 4HP9A 2G7UA 5JYOA 1LI9A 3IF6B 3UN7A 2ZOIA 5FDHA 3AGFA 4JPMA 4S2PA 3DTIA 5CEDA 1PFLA 4Q8IA 2JHEA 4LPZA 3MQOA 2PRFA 4LRYC 1T1AA 3OPPA 4DJ3A 4PAUA 4O8GA 4OVDA 2JKTI 3LCEA 3UE0A 1YLTA 1ES4A 5MC7A 5TR7A 2K7SA 1T1CA 4Y0OA 2WK0A 3LEQA 4I38A 5KSCA 1VB6A 5HDSA 4NEED 1S67L 4R0QA 5FQQA 5HDDA 4ID4A 2MJ6A 4OKPA 1BLHA 1CF0A 2ZM0A 2DCFA 3IXHA 3N8RA 4EU0A 1FSYA 3TSGA 4R4RA 3IH8A 5EV0A 1YPRA 3S7OA 3G30A 2ZJ9A 2OSUA 4EBPA 1GCEA 4YFMA 1VM1A 5CXWA 5TBMB 3NOUC 5G4YA 2J8YA 5IT5A 3BECA 4HP4A 4E3OA 3IBJA 3MKEA 3IWOA 2OAP1 2XROA 4R6LA 1OTAA 3A3IA 3V39A 1GSVA 3B33A 2OWHA 3HBRA 4BQMA 3UE3A 2WYXA 5C5KA 3HLDA 4IUKA 1S4RA 1MWTA 1S66L 3WS5A 4WF0A 3BQ8A 4H6JB 1XX2A 2XR0A 3I7JA 3P98A 5F6AA 4DRTA 1Y28A 4PHTA 2A3UA 4MNRA 2VJWA 3F1PA 3LGOA 4GDNA 3ZVWA 4GHIA 1K55A 4L9FA 5A90A 3VP4A 5AQAA 4WMCD 2K2NA 2WGIA 4ZJ2A 5FEGA 1EW0A 4I5SA 5A93A 2HDUA 1SDNA 2W27A 3H9WA 3T4JA 3SH9A 3VP3A 3ZHHA 4WMCA 5HZHA 4FD8A 1J3WA 2Y79A 3IF6A 2WKIA 4A5RA 4DN0A 2DNSA 3BFDA 4EEPA 3DTKA 1LL5A 3BFEA 4RVAA 3MR0A 1DY6A 3HL9A 5EM1A 1ZTUA 5E2EA 4EXOA 3IS2B 3C7VA 5CRFA 5FI2A 5DVAA 5F82A 1XKZA 4ZTKA 2XFTA 3D3OA 5G4ZA 3HLCA 3Q82A 4P85A 4OPYA 5M19A 1TS0A 1OJGA 3LICA 3AGDA 2V8CA 2ZBBA 5F1GA 4OONA 1MZUA 4N1XA 1TDLA 1F98A 1G68A 1EWZA 3W4QA 1MKMA 3FC7A 3ICYA 4PKYG 3NI9A 4Z1WA 5FL3A 3M2KA 3ZG0A 4G3VA 5GL9A 1PI4A 5TBMA 1ESUA 1K54C 5DKKA 4EETB 3HLGA 3T1QB 4JGOA 3IT9A 3EEHA 3HUOA 4HNBA 4PKYA 4FOFA 5A91A 4GJ4A 5AQBA 1MC0A 3SS5A 3T12B 3UB6A 2H0YA 5GHYA 1C3BA 3MS6A 4H6JA 5CHUA 1S0WA 4KQOA 3WS2A 1XA7A 4BD1A 2C5WB 4HJ4A 4X53A 3FKWA 2L1MA 1CEGA 2PU2A 2HF6A 2KOIA 4CLCE 5HWWA 2PR5A 1FCNA 3ZYTA 1TS8A 1CI8A 4PM7A 4E6WA 3NHQA 4Y0TA 4N9KA 3O88A 4ETXA 5CGWA 4XT2B 1KE4A 4U0XA 3SS3A 4MCWA 4X68A 3BLSA 2Y2PA 3VP0A 3OPLA 4K0WA 4CLCC 3EEAA 4X55A 4P0MA 4LLOB 3TOIA 3LR3A 4KZ3A 1K55C 5DF8A 5E2FA 2CC1A 2KX6A 4Y13A 1N4OA 4BBTA 4Y0UA 1DP9A 2HP9A 4Y7PA 1OTIA 1CJFA 2VGLM 1OTDA 3S7PA 2BTFP 4KENB 5L8MA 5DF7A 2M7UA 1GHPA 3IF6C 5G18A 3ZG5A 2M1CA 2EX6A 3TRCA 4ZBEA 5HAIA 1IKIA 4WM9A 4D2OA 1HLUP 3QP1A 4UQIM 4EEUA 4BL2A 4R38A 4X69A 5E43A 3TG9A 1GA9A 4RX3A 1QMFA 1KGGA 3IX3A 2WKRA 3L7HA 3IX8A 4GZBA 2O0YA 4OOLA 4DMZA 5KZHA 4IEDA 3DW0A 2WKPA 3MBZA 4L0LA 1O7EA 4HH3A 1GSWA 1OT9A 4EBLA 1MXOA 3MMHA 3BFCA 1TDGA 3KYQA 5CX7A 3QP4A 4MBHA 1RP5A 3PR6A 2WKHA 1LSVA 1UGUA 3VP1A 2PT7A 4WZ5A 4DKIA 2I9VA 3T1RA 3T4LA 1KGEA 3PTEA 3FPVA 4BBUA 5EECA 4OQGA 2HDRA 5EVIB 4Y2FA 3ZNTA 1W8YA 2V0WA 3A0RA 3IF5A 3PHYA 3P01A 2Z6DA 1YLZA 4Q0IA 3NDEA 2QMIA 3IWQA 1AXBA 3BEBA 1YLYA 2DMWA 4KUKA 4XT2A 1K4FA 3MZDA 5AJGA 4KZ9A 4BMWA 2ZQ8A 4I3AA 1XFQA 1PWGA 4EV4A 4PMAA 3PBRA 5IS1A 3CUEA 4BENA 2Y2GA 3DBAA 2HJ9C 4UA9A 1SZVA 2GDNA 2Y2OA 3Q81A 1W63M 2EX8A 4G3WA 1TD5A 4GB7A 2INWA 1PZOA 3JVVA 1OPXA 2IWCA 2XDMA 1LSXA 2Y2JA 3UMDA 2Y55A 1XPBA 4KZ8A 4O01A 4GN2A 4LV2A 5AVEA 4RA7A 1RGZA 3MZFA 4NXBA 1QMEA 4FH2A 3BQAA 5EM0A 4II7A 4LENA 4BWIA 4LGWA 1SKOB 4U0TA 4FUWA 4FSFA 4KZ7A 5HW3A 3K2NA 1MPLA 1S4SA 1W63Q 3BJNA 2OLVA 1NZUA 4MN7A 5GLBA 3HVFA 3O3VA 3KSGA 3GRJA 5L2FA 2P04A 4Y3IA 3OCNA 4E04A 5HAQA 3M2JA 1JNUA 2VX8A 3DAVA 1XGIA 1S1YA 2EFXA 1IKGA 3HJKA 1T19A 2EX9A 3O5YA 5CERA 3BLMA 4I39A 3T4OA 1GHIA 2V1AA 3LY3A 4LFUA 2JKFA 3UPNA 4S2IA 3HUMA 1IFQA 1MWRA 2RCXA 4DE0A 3BY9A 3G6OA 3CLOA 3B47A 3HREA 1W79A 3NCKA 2W0NA 5M18A 1KVMA 1FR6A 2VV7A 2DRWA 4XUZA 4HH2A 4C3QA 2H5SA 5EVIA 3ZG8B 1K56A 3Q1FA 3NC8A 4IBRA 2OWJA 1CI9A 1TF1A 1YM1A 2XQZA 1L0DA 1SKFA 3PBQA 3FZCA 4KZAA 4OLDA 3UPOA 5HD3A 1TVFA 4WZ5C 1VEUB 2W3FA 1H3QA 4MBKA 3PAEA 4WN5A 3M6HA 4I3JA 3Q7VA 1Q2PA 4YWZA 3BW6A 1IYSA 3JYIA 4IBXA 2IWBA 1XA1A 3U4LP 4UHUA 1H8YA 5FEFA 2HV1A 4B93A 2B18A 2JE5A 4DDSA 2UV0E 1PI5A 2VK3A 5AQ9A 3ULFA 5F83A 3ZG7B 3BWLA 2WZXA 5A8BA 4EQ1A 3CJMA 2W3DA 1M40A 3E2LA 3GR2A 2WADA 2J3TC 2FH5A 1PZPA 1JTDA 1SKOA 3C5AA 4R3AA 4QWOA 3HCYA 2X01A 1ONGA 4WLAA 3MFDA 4JGPA 2O9CA 4LV3A 4GLQA 1BTLA 1KGFA 1I2SA 3G35A 5IU1A 3PBOA 4JXVA 3D72A 3EGDC 4QY6A 4DDYA 1G6AA 2VKSA 2AVXA 3KYEA 3ZVTA 4BJPA 4HBUA 2P74A 4HBTA 2QHKA 2YKFA 3HUNA 1XJ6A 3MKFA 5DF9A 4OQ0A 4JGRA 3FV7A 4PM5A 1DRMA 3LY4A 4YOFA 3EWKA 1CEFA 5EOEA 1ZG6A 3OPHA 4ZAMA 2Y2KA 3LFVA 4NK3A 2ZC6B 3W2ZA 5CECA 4CPKA 5CTMA 4I3IA 4EW7A 3FPWA 3ZQ5A 1D06A 2VV8A 2J7VA 2QZ6A 3G31A 3R7WB 3UNWA 4S2JA 2GNXA 2VGJA 3IWIA 2PBYA 4JF5A 3WWXA 2WZZA 3VSLA 2IWDA 1OMEA 1XJ4A 1VEUA 1HZOA 1P9RA 1KE3A 1Q2QA 1L0FA 3G32A 3LIFA 5EVIC 3DTMA 5DKLA 3N6IA 2V1ZA 2ZQ7A 3PYPA 3V50A 4DXCA 4FTXA 3QP2A 4JXSA 5DTSA 3QNCA 1XFNA 3SH7A 2Q0OA 2Y59A 5FI7A 4K0XA 3KSIA 4KZBA 4R3JA 3VV4A 5FAOA 5CTNA 2E8JA 5L07A 3K3CA 3RXXA 2Y2HA 4OOYA 2PAVP 5M1AA 2HDQA 4PPRA 4HEFA 4P6ZM 3MXRA 3W8KA 2ZQDA 1ACFA 2O9BA 2B5RA 4Y17A 3LR0A 2B95A 4JF6A 4Q0JA 3N8SA 4UEYA 4ZJ3A 2VZWA 1SDEA 5E2GA 5JYPA 3A3DA 3WS0A 1BZAA 5HFOA 4Z9QA 4NXFA 4B88A 4KQDA 2J9PA 5CEBA 3N8LA 1ES5A 2WUQA 1YAXA 3KSFA 3T1SA 3W4OA 4R1GA 1BT5A 1K25A 2VLGA 4ZRRA 1NLZA 4LCMA 1J9MA 4BBVA 1A0KA 5FQ9A 2ZQ9A 3VSKA 3T50A 1H8MA 3T1XA 2P08A 2QWSA 4GDBA 2OOLA 3NJAA 3BFGA 1HD8A 2EWWA 2HZ5A 1SHVA 3PAGA 3A3FA 4K91A 1XJ2A 1YLWA 1TEMA 3R7WA 4X1LA 5TGFA 3LEZA 1NXYA 3EOIA 2Z2MB 3G2ZA 1XXMA 1D7EA 2ZQCA 3DTEA 1G5UA 2HGVA 5DJTA 3SH8A 1IYOA 3NOTC 3NBLA 3IBRA 1D1JA 4DJ2A 3IX4A 3MFXA 2BASA 5AVFA 4QB8A 1MWUA 3T4KA 3UDIA 3M6BA 4RQ9A 2Q9NA 4KG5A 4ESPA 3GV9A 3BRMA 1LT0A 4KUOA 4NETA 1JWZA 3F1NA 2HDSA 1BLCA 1FQGA 4JXWA 1N9OA 3IHBA 5HWTA 3BYDA 4L9GA 2V2FF 5HAPA 3PXPA 4IUHA 1MWSA 4S2LA 5FQMA 2IA2A 1H5XA 3Q7ZA 4JKTA 3C30A 5L10A 3GQZA 1SCWA 4N9LA 1KOUA 3OZHA 3KYZA 3LI8A 4HOIA 2KDKA 2Z6CA 4H8RA 2ZC7A 2FFYA 1F9IA 5FASA 4HHDA 5E2HA 1KVLA 1TS6A 3VE3A 2PDRA 1K6RA 2XA7M 1KE0A 3IXDA 1PWDA 5GLDA 2H28A 3OLOA 5U47A 2L0WA 1DP6A 5FI6A 3E4PA 3CG5A 3LIEA 4EUVA 3OBFA 3UB7A 2Y8HA 4WELA 2P9VB 4UA7A 5HARA 4X6TA 3CI6A 2ZD8A 1IELA 4GD6A 4PM6A 3MQ0A 5FAPA 2VGLS 4QJGA 3QP5A 4XUXA 1NLYA 1ES3A 2XF3A 2HPBA 2H10A 4WEKA 4E3MA 1CK3A 2XK1A 3Q7VB 2R78A 3T4QA 2Y2MA 1F5MA 1ONHA 1P9WA 2Y91A 4ZDXA 1L3LA 4OQHA 1ES2A 3S7QA 1MKIA 3A3EA 3NIAA 4UQIS 3IXGA 2ZM2A 1HTZA 3P7NA 1K57A 1YSQA 2Z2LB 1CQAA 1T18A 4HI4A 3VOLA 2Q9MA 2WAFA 2QKPA 3MXSA 5GHXA 1LSWA 5K5BA 2NUTC 4KQQA 2W3HA 3UB5P 1BUEA 3T4TA 5BOHA 3LYXA 1YMSA 3PBNA 1JWVA 4X56A 5EFWA 1MBLA 3OPRA 3FKVA 3ITAA 5AQ7A 3WS4A 3LI9A 3A3JA 3OC2A 5HWVA 2J3WA 1I2WA 4D60A 1PNEA 3DWZA 2W1RA 3CITA 2QYBA 3NY4A 4L9EA 3VP2A 1ESIA 5EE8A 5LBRA 2WKQA 3H7WA 4S2MA 3VE4A 4E3LA 3QHYA 4B4ZA 2XD5A 3E98A 5EPHA 3KO6A 2EFUA 1NRJA 1RGYA 3AGEA 5EOOA 3HLEA 3WRZA 1NZOA 4MN6A 4N1HA 3UY6A 5HD5A 3LIDA 3UB8A 2P9VA 2PBDP 2Y2QA 4F94A 2O9AA 2XH9A 4MDZA 5TFQA 2ZC3B 2ZMFA 1LI0A 5DJUA 1S6RA 5FQJA 3JVUA 1L0GA 3ZDJA 4DE3A 3K3DA 1YSPA 5DFXA 4M3KA 4QHCA 5L09A 3CMZA 3NECA 3TW8A 5CHJA 4ZJ1A 1G28A 4BLMA 4GKUA 4E3NA 1YKDA 3IQAA 3A0VA 1ODVA 1OTEA 1Z09A 5CGXA 5FAQA 5EVLA 3LUQA 4ETZA 4R4SA 5DTTA 3PBTA 3F1OA 1RCJA 1YQSA 3OOVA 3FWLA 3W4PA 2ZL1B 4OPZA 2V1BA 2K31A 3CHWP 4IVKA 1K0KA 1LLBA 3H82B 2EXBA 1PW1A 2PYPA 1XP4A 1L0EA 2V20A 3MF0A 3CUEC 4OOMA 4DXBA 4P6BA 2X71A 1LL9A 4RYEA 2OAQ1 1K54A 2ZMAA 2NUPC 1JWPA 4X25A 1ERQA 1N9BA 4YNRA 3KSHA 4C75A 2A24B 3CPTA 4LRZE 4EBNA 1K57C 1FCOA 1ZHHB 1VQQA 3LIAA 1KDSA 3MQQA 2XEPA 3NDGA 5FATA 4R70A 3N7WA 2EX2A 4X1MA 4PM8A 4O7DA 4EQIA 4K08A 1BSGA 4IVIA 3S4XA 4S2OA 4EESA 1NY0A 3ZFZA 4LV1A 4OP8A 3GECA 5HL6A 1JTGA 3RXWA 1WYCA 5F1FA 1Y4OA 4DE2A 1P0ZA 1IOUA 3ZNYA 4EWFA 2V8FA 3T4SA 4N92A 4CLCD 1OTBA 1NYYA 2ZMVA 4HY8A 4HJ3A 3UE6A 2EXAA 3U2AA 4HESA 2M7VA 3SS4A 1ZC2A 5FQIA 2LB9A 2W1TB 3A0SA 2WKEA 5GLCA 2HP6A 1MY8A 4CLCA 3FG8A 2EWVA 5A92A 3N4IA 1IYQA 1L2SA 4JGQA 2BLSA 3ZGAB 2PD7A 1OJ5A 1W7FA 1XGJA 4CJNA 5J7EA 2L4RA 4AFIA 2R9WA 3HJIA 4Y5FA 3OCLA 3BFFA 5I94A 4F3LB 2BG1A 5HSQA 1EI5A 2Y4AA 1PWCA 1PYYA 2G2WA 2P7JA 2ZQAA 1LHYA 4WL9A 1NRFA 4E6XA 4O0PA 3O86A 4B4XA 3UO9A 2W3GA 1IYPA 2JKGA 5F69A 1ZG4A 3B3XA 1W5DA 4OPRA 4GCZA 4Y15A 2D01A 5GHZA 2ZL1A 2VV6A 3F1NB 3C4OA 3H82A 1GHMA 1XJ3A 3RH8B 2VEAA 4M4XA 2LB5A 2R9XA 1DJCA 3LR5A 4RX2A 1K6SA 3SW1A 1KDWA 4U3TA 1BULA 5F68A 3V67A 4E3JA 4S2NA 2GJ3A 3BM6A 2A24A 2FZ0A 4KZ6A 4JXGA 2OLUA 3S22A 2O99A 4QPRA 1S1ZA 2HP5A 3GTCA 4DE1A 4HJ6A 2I72A 3LIBA 4GOGA 4HIAA 4UAAA 1ZKJA 1Z6FA 1GSXA 3QP8A 2OV5A 3B42A 2X02A 4JLFA 2PD8A 3MJQA 1YMXA 1NYMA 2JBFA 1JVJA 4R3BA 4JBFA 3SZTA 3GVBA 3UE1A 3LR4A 2XD1A 3E4OA 1IEMA 1E25A 3ZCZA 2Y2LA 3S1YA 2W1TA 2CMNA 1NWZA 1UWNX 3IH9A 5FA7A 3LO7A 1YLJA 2ZOHA 4GW9A 2XFSA 5GLAA 1FIKA 1WYBA 5J8XA 2ZM8A 4QU3A 1ERMA 1FOFA 3DWKA 3G2YA 3G4PA 4P6ZS 4OH0A 1STZA 3R4KA 3VMAA 4F3LA 3P09A 3BY8A 4BD0A 4KG6A 3SOIA 2JCHA 5F5YA 3RJUA 5HX9A 4OPQA 2JN7A 3Q07A 4LV0A 1N9NA 1E3UD 4NKPA 1VETB 2J80A 1N9LA 2XRNA 3UB9A 4FH4A 3E2KA 3WS1A 3IS2A 4IHQA 1G6OA 2JKRM 1TS7A 2WAEA 5FQKA 1K38A 2GZAA 3GDIA 1E3UA 1YT4A 4KZ4A 3FYZA 4ME4A 3RTYA 3L9KA 4QY5A 2KLIA 4WEJA 3GSGA 2QJ7A 1V9YA 2VGKA 3H7WB 4G3KA 5FDSA 1O07A 4LCLA 1BLPA 4MLLA 1GA0A 4GS9B 1VHMA 3C4PA 2A2LA 1UWPX 4KQRA 1PIOA 4ARZB 3UDXA 2ZC4B 4QD4A 5I5LA 1M6KA 2W3EA 3UDFA 5HPIA 2PHYA 2Y2IA 3IHAA 4NXEA 3UMEA 3JPUA
chains in the Genus database with same CATH topology
3ZVTA 4BJPA 4HBUA 2P74A 1RGYA 2WGWB 3AGEA 4HBTA 4S2NC 5EOOA 3HLEA 1DJAA 5AQBA 3SS5A 3WRZA 1NZOA 1WE4A 4N1HA 3PBSA 2C6WB 3HUNA 2H0YA 3UY6A 4E3KA 5GHYA 1C3BA 3MKFA 3CZDA 5DF9A 4OQ0A 5CHUA 3FV7A 1S0WA 4PM5A 4KQOA 3WS2A 3EQVA 4C6YA 1XA7A 5D3OA 4BD1A 2C5WB 4X53A 4BL3A 2P9VA 3LY4A 1CEFA 3FKWA 2Y2QA 5EOEA 4EQIA 4F94A 1ZG6A 3OPHA 1CEGA 2PU2A 5IHVA 4ZAMA 2Y2KA 2XH9A 4NK3A 2ZC6B 5CECA 4YINA 3ITBA 4DF6A 1FR1A 1FCNA 4CPKA 2A49A 5TFQA 2ZC3B 5CTMA 1LI0A 1S6RA 5FQJA 1L0GA 3ZDJA 4DE3A 1CI8A 5HL1A 4PM7A 4E6WA 1HVBA 2J7VA 3HLFA 4M3KA 4MEZA 4GNUA 4QHCA 2QZ6A 4N9KA 4Y0TA 3G31A 4S2KA 3O88A 3UNWA 2UWXA 5CGWA 3CMZA 4S2JA 1YLPA 3O87A 1KE4A 1NJ4A 3HLWA 5CHJA 2VGJA 4ZJ1A 4PM9A 3IWIA 4U0XA 3SS3A 4X68A 2PBYA 4BLMA 4GKUA 4JF5A 4KZ5A 4E3NA 2ZC5B 3WWXA 3IQAA 3BLSA 2WZZA 2Y2PA 3VSLA 3VP0A 3OPLA 2IWDA 1OMEA 2PU4A 4K0WA 4X55A 5CGXA 4P0MA 3TOIA 5FAQA 1HZOA 5CGSA 1KE3A 4KZ3A 1K55C 5DF8A 5E2FA 5EVLA 1Q2QA 5FSRA 2CC1A 3V3RA 1FCMA 1L0FA 3G32A 5EVIC 3DTMA 1N4OA 3N6IA 2V1ZA 4KG2A 2ZQ7A 4R4SA 4WYYA 5DTTA 3V50A 3PBTA 5KMWA 4DXCA 4JXSA 5DTSA 4E3IA 4Y0UA 3QNCA 3VFFA 1RCJA 1YQSA 2Y2NA 3FWLA 3G34A 1EROA 4JF4A 2HP9A 4Y7PA 3SH7A 3W4PA 2Y59A 4OPZA 4IVKA 1LLBA 2H0TA 5FI7A 2EXBA 1PW1A 4K0XA 4KENB 4OLGA 2XGNA 4KZBA 3MZEA 1XP4A 1L0EA 2V20A 4OOMA 5DF7A 4DXBA 3VOZA 4P6BA 4R3JA 1GHPA 2X71A 5FAOA 1LL9A 4RYEA 3IF6C 5CTNA 5G18A 5CHMA 3V3SA 1K54A 3ZG5A 2EX6A 2ZMAA 4WZ4A 1Y54A 1JWPA 3RXXA 2JC7A 2Y2HA 4OOYA 4ZBEA 1ERQA 1N9BA 5M1AA 2HDQA 4C75A 5HAIA 4PPRA 4HEFA 1IKIA 4WM9A 1DJBA 3UPPA 4D2OA 3HLBA 1ALQA 4EBNA 2E8IA 4BL2A 1K57C 3MXRA 1FCOA 1VQQA 1KDSA 4X69A 5E43A 3W8KA 3TG9A 1GA9A 2XEPA 2ZQDA 3NDGA 4RX3A 1FSWA 1QMFA 3QNBA 5FATA 2B5RA 1KGGA 1W8QA 3N7WA 3ISGA 4GZBA 4JF6A 1I5QA 4OOLA 2EX2A 3V5MA 5KZHA 1BLSA 4IEDA 3DW0A 3N8SA 4O7DA 3MBZA 4PM8A 1BSGA 4IVIA 4L0LA 4ZJ3A 2J9OA 4S2OA 3S4XA 4EUZA 3D4FA 4MBFA 1O7EA 1E4DA 1NY0A 2QPNA 2ZLYA 4R23A 4EBLA 3ZFZA 1SDEA 4LV1A 5E2GA 3VFHA 5JYPA 4OP8A 1MXOA 3GMWA 3A3DA 4P87A 5DTKA 3WS0A 1BZAA 1JTGA 3BFCA 3RXWA 1TDGA 1PW8A 5KSHA 1WYCA 5HFOA 5F1FA 4Z9QA 3EQUA 2XLNA 4B88A 4MBHA 4XXRA 2FFFB 2G2UA 4WBGA 4DE2A 2RL3A 3IXBA 2J9PA 3ZG9B 5CEBA 3N8LA 3ZNYA 4EWFA 1ES5A 1RP5A 2WUQA 2WKHA 2WGWA 3VP1A 4WZ5A 4N92A 4DKIA 1NYYA 3W4OA 4R1GA 1BT5A 2WGVA 1KGEA 1K25A 2EXAA 3PTEA 4HESA 3SS4A 1ZC2A 4UA6A 5EVID 5FQIA 1K56D 5EECA 4LCMA 1J9MA 4OQGA 2HDRA 4OP5A 5EVIB 3ZNTA 4GD8A 2WKEA 5GLCA 5FQ9A 2HP6A 2ZQ9A 1MY8A 1W8YA 3VSKA 3IF5A 3VOYA 4OQIA 1YLZA 4GDBA 5A92A 3N4IA 5EUAA 1H8ZA 1K4EA 3BFGA 1IYQA 3WRTA 1L2SA 3NDEA 2BLSA 3ZGAB 2QMIA 1HD8A 4FCFA 1W7FA 3IWQA 1U60A 3C7UA 1AXBA 3BEBA 1SHVA 3PAGA 5JYOA 1YLYA 1XGJA 1LI9A 3A3FA 4K91A 3IF6B 1YLWA 3UN7A 1TEMA 4CJNA 5FDHA 3AGFA 1K4FA 3MZDA 4JPMA 4KZ9A 2R9WA 5TGFA 3LEZA 4S2PA 1NXYA 2ZQ8A 5CEDA 2Z2MB 3G2ZA 1PWGA 1XXMA 4EV4A 3OCLA 4PMAA 3PBRA 4Q8IA 3BFFA 5I94A 2BG1A 1EI5A 2Y4AA 2ZQCA 4BENA 1PWCA 2Y2GA 4UA9A 2GDNA 1PYYA 2G2WA 2Y2OA 2ZQAA 1LHYA 3Q81A 1NRFA 3OPPA 2EX8A 3SH8A 4GB7A 4E6XA 1IYOA 1PZOA 3O86A 2IWCA 4B4XA 3UO9A 3NBLA 2XDMA 4OVDA 2Y2JA 1IYPA 2Y55A 3LCEA 3UE0A 1ZG4A 3B3XA 1XPBA 1YLTA 1ES4A 1W5DA 4KZ8A 4OPRA 4GN2A 4LV2A 5TR7A 4QB8A 4Y0OA 2WK0A 4RA7A 1MWUA 5GHZA 1RGZA 3MZFA 5KSCA 3C4OA 1GHMA 3UDIA 1QMEA 4FH2A 4R0QA 5FQQA 3M6BA 4ID4A 2R9XA 2Q9NA 4KG5A 1DJCA 3GV9A 3BRMA 4LENA 4OKPA 4RX2A 1K6SA 1BLHA 2ZM0A 2DCFA 1KDWA 4NETA 1JWZA 4U3TA 2HDSA 3IXHA 1BLCA 1BULA 3N8RA 1FQGA 4JXWA 1FSYA 3IHBA 3TSGA 3BYDA 4R4RA 4E3JA 4U0TA 2V2FF 4S2NA 3IH8A 5HAPA 1MWSA 3BM6A 4S2LA 5FQMA 3G30A 2ZJ9A 2OSUA 4EBPA 1H5XA 4FSFA 1GCEA 3Q7ZA 4JKTA 4KZ6A 4KZ7A 4YFMA 4JXGA 5HW3A 1MPLA 3GQZA 1SCWA 2OLUA 3S22A 1VM1A 2OLVA 1NZUA 4N9LA 5CXWA 5GLBA 3HVFA 3OZHA 3O3VA 2J8YA 3GRJA 3BECA 5L2FA 2HP5A 4E3OA 3GTCA 4DE1A 3OCNA 3MKEA 5HAQA 2I72A 4H8RA 3IWOA 3M2JA 2ZC7A 4GOGA 2FFYA 1XGIA 5FASA 5E2HA 1KVLA 1IKGA 2EFXA 3A3IA 3V39A 1K6RA 1KE0A 4UAAA 1ZKJA 1Z6FA 1PWDA 3HBRA 3IXDA 4BQMA 5GLDA 2OV5A 3UE3A 2EX9A 5CERA 3BLMA 2WYXA 5U47A 3HLDA 2X02A 1MWTA 4JLFA 1GHIA 3WS5A 3LY3A 5FI6A 1XX2A 2XR0A 3CG5A 3UPNA 1YMXA 3I7JA 4S2IA 1NYMA 3HUMA 2JBFA 1MWRA 2RCXA 3P98A 4DE0A 4DRTA 4WELA 1JVJA 2P9VB 4R3BA 4UA7A 3HREA 5HARA 2A3UA 4JBFA 3UE1A 3GVBA 4X6TA 2ZD8A 4MNRA 2XD1A 1W79A 3NCKA 1IELA 5M18A 4GD6A 4PM6A 1IEMA 4GDNA 3ZVWA 1E25A 1KVMA 1K55A 1FR6A 3ZCZA 2Y2LA 5FAPA 2DRWA 4XUZA 3S1YA 3VP4A 5A90A 4C3QA 2H5SA 5AQAA 4WMCD 5EVIA 3ZG8B 2WGIA 4ZJ2A 1K56A 3Q1FA 3IH9A 4QJGA 3NC8A 4IBRA 5FA7A 3LO7A 4XUXA 5A93A 1YLJA 2HDUA 1ES3A 2XF3A 2HPBA 2H10A 4WEKA 4E3MA 1CI9A 1CK3A 1SDNA 1YM1A 2XFSA 2XQZA 2XK1A 3Q7VB 1L0DA 1SKFA 3PBQA 3FZCA 4KZAA 4OLDA 5GLAA 3SH9A 3UPOA 3VP3A 3ZHHA 1WYBA 4WMCA 2Y2MA 1TVFA 4WZ5C 4FD8A 5J8XA 1ONHA 2ZM8A 4QU3A 2Y91A 4ZDXA 4MBKA 4OQHA 1ES2A 3IF6A 1ERMA 1MKIA 3PAEA 3A3EA 3M6HA 2WKIA 3Q7VA 4A5RA 1FOFA 2DNSA 3DWKA 3BFDA 3NIAA 1Q2PA 3G2YA 3G4PA 2ZM2A 3IXGA 4OH0A 1HTZA 1IYSA 1LL5A 3JYIA 4IBXA 2IWBA 1XA1A 3BFEA 3VMAA 4RVAA 3P09A 4UHUA 4BD0A 1H8YA 4KG6A 1K57A 1DY6A 2Z2LB 3HL9A 3SOIA 2JCHA 5E2EA 3RJUA 5HX9A 4OPQA 3C7VA 5CRFA 3Q07A 2JE5A 4LV0A 4DDSA 5FI2A 2Q9MA 5DVAA 2WAFA 5F82A 1XKZA 1E3UD 4ZTKA 2XFTA 1PI5A 3MXSA 5GHXA 4FH4A 3E2KA 3HLCA 3Q82A 5AQ9A 4KQQA 4P85A 4OPYA 5M19A 5F83A 3ZG7B 1BUEA 3WS1A 5BOHA 3AGDA 1YMSA 2WZXA 3PBNA 3CJMA 1JWVA 4X56A 5F1GA 2WAEA 1M40A 5FQKA 1MBLA 3OPRA 3FKVA 1K38A 3ITAA 4OONA 5AQ7A 3E2LA 3GR2A 3WS4A 4N1XA 1E3UA 1YT4A 2WADA 4KZ4A 1TDLA 3FYZA 3A3JA 3OC2A 4QY5A 1G68A 4WEJA 1PZPA 1JTDA 3GSGA 1EWZA 2VGKA 3C5AA 3W4QA 1I2WA 1O07A 2X01A 3DWZA 1ONGA 1BLPA 4LCLA 3MFDA 4MLLA 1GA0A 4LV3A 3C4PA 3NY4A 3VP2A 1ESIA 5EE8A 3NI9A 1BTLA 1KGFA 3M2KA 3ZG0A 4S2MA 1I2SA 4KQRA 5GL9A 1PI4A 1ESUA 1PIOA 3G35A 1K54C 2ZC4B 3PBOA 4JXVA 3UDXA 4E3LA 4QD4A 3QHYA 4B4ZA 3HLGA 1M6KA 4QY6A 3IT9A 4DDYA 3UDFA 3HUOA 1G6AA 2Y2IA 3IHAA 2XD5A 5A91A 5EPHA 2EFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZVT A;  4BJP A;  4HBU A;  2P74 A;  1RGY A;  2WGW B;  3AGE A;  4HBT A;  4S2N C;  5EOO A;  3HLE A;  1DJA A;  5AQB A;  3SS5 A;  3WRZ A;  1NZO A;  1WE4 A;  4N1H A;  3PBS A;  2C6W B;  3HUN A;  2H0Y A;  3UY6 A;  4E3K A;  5GHY A;  1C3B A;  3MKF A;  3CZD A;  5DF9 A;  4OQ0 A;  5CHU A;  3FV7 A;  1S0W A;  4PM5 A;  4KQO A;  3WS2 A;  3EQV A;  4C6Y A;  1XA7 A;  5D3O A;  4BD1 A;  2C5W B;  4X53 A;  4BL3 A;  2P9V A;  3LY4 A;  1CEF A;  3FKW A;  2Y2Q A;  5EOE A;  4EQI A;  4F94 A;  1ZG6 A;  3OPH A;  1CEG A;  2PU2 A;  5IHV A;  4ZAM A;  2Y2K A;  2XH9 A;  4NK3 A;  2ZC6 B;  5CEC A;  4YIN A;  3ITB A;  4DF6 A;  1FR1 A;  1FCN A;  4CPK A;  2A49 A;  5TFQ A;  2ZC3 B;  5CTM A;  1LI0 A;  1S6R A;  5FQJ A;  1L0G A;  3ZDJ A;  4DE3 A;  1CI8 A;  5HL1 A;  4PM7 A;  4E6W A;  1HVB A;  2J7V A;  3HLF A;  4M3K A;  4MEZ A;  4GNU A;  4QHC A;  2QZ6 A;  4N9K A;  4Y0T A;  3G31 A;  4S2K A;  3O88 A;  3UNW A;  2UWX A;  5CGW A;  3CMZ A;  4S2J A;  1YLP A;  3O87 A;  1KE4 A;  1NJ4 A;  3HLW A;  5CHJ A;  2VGJ A;  4ZJ1 A;  4PM9 A;  3IWI A;  4U0X A;  3SS3 A;  4X68 A;  2PBY A;  4BLM A;  4GKU A;  4JF5 A;  4KZ5 A;  4E3N A;  2ZC5 B;  3WWX A;  3IQA A;  3BLS A;  2WZZ A;  2Y2P A;  3VSL A;  3VP0 A;  3OPL A;  2IWD A;  1OME A;  2PU4 A;  4K0W A;  4X55 A;  5CGX A;  4P0M A;  3TOI A;  5FAQ A;  1HZO A;  5CGS A;  1KE3 A;  4KZ3 A;  1K55 C;  5DF8 A;  5E2F A;  5EVL A;  1Q2Q A;  5FSR A;  2CC1 A;  3V3R A;  1FCM A;  1L0F A;  3G32 A;  5EVI C;  3DTM A;  1N4O A;  3N6I A;  2V1Z A;  4KG2 A;  2ZQ7 A;  4R4S A;  4WYY A;  5DTT A;  3V50 A;  3PBT A;  5KMW A;  4DXC A;  4JXS A;  5DTS A;  4E3I A;  4Y0U A;  3QNC A;  3VFF A;  1RCJ A;  1YQS A;  2Y2N A;  3FWL A;  3G34 A;  1ERO A;  4JF4 A;  2HP9 A;  4Y7P A;  3SH7 A;  3W4P A;  2Y59 A;  4OPZ A;  4IVK A;  1LLB A;  2H0T A;  5FI7 A;  2EXB A;  1PW1 A;  4K0X A;  4KEN B;  4OLG A;  2XGN A;  4KZB A;  3MZE A;  1XP4 A;  1L0E A;  2V20 A;  4OOM A;  5DF7 A;  4DXB A;  3VOZ A;  4P6B A;  4R3J A;  1GHP A;  2X71 A;  5FAO A;  1LL9 A;  4RYE A;  3IF6 C;  5CTN A;  5G18 A;  5CHM A;  3V3S A;  1K54 A;  3ZG5 A;  2EX6 A;  2ZMA A;  4WZ4 A;  1Y54 A;  1JWP A;  3RXX A;  2JC7 A;  2Y2H A;  4OOY A;  4ZBE A;  1ERQ A;  1N9B A;  5M1A A;  2HDQ A;  4C75 A;  5HAI A;  4PPR A;  4HEF A;  1IKI A;  4WM9 A;  1DJB A;  3UPP A;  4D2O A;  3HLB A;  1ALQ A;  4EBN A;  2E8I A;  4BL2 A;  1K57 C;  3MXR A;  1FCO A;  1VQQ A;  1KDS A;  4X69 A;  5E43 A;  3W8K A;  3TG9 A;  1GA9 A;  2XEP A;  2ZQD A;  3NDG A;  4RX3 A;  1FSW A;  1QMF A;  3QNB A;  5FAT A;  2B5R A;  1KGG A;  1W8Q A;  3N7W A;  3ISG A;  4GZB A;  4JF6 A;  1I5Q A;  4OOL A;  2EX2 A;  3V5M A;  5KZH A;  1BLS A;  4IED A;  3DW0 A;  3N8S A;  4O7D A;  3MBZ A;  4PM8 A;  1BSG A;  4IVI A;  4L0L A;  4ZJ3 A;  2J9O A;  4S2O A;  3S4X A;  4EUZ A;  3D4F A;  4MBF A;  1O7E A;  1E4D A;  1NY0 A;  2QPN A;  2ZLY A;  4R23 A;  4EBL A;  3ZFZ A;  1SDE A;  4LV1 A;  5E2G A;  3VFH A;  5JYP A;  4OP8 A;  1MXO A;  3GMW A;  3A3D A;  4P87 A;  5DTK A;  3WS0 A;  1BZA A;  1JTG A;  3BFC A;  3RXW A;  1TDG A;  1PW8 A;  5KSH A;  1WYC A;  5HFO A;  5F1F A;  4Z9Q A;  3EQU A;  2XLN A;  4B88 A;  4MBH A;  4XXR A;  2FFF B;  2G2U A;  4WBG A;  4DE2 A;  2RL3 A;  3IXB A;  2J9P A;  3ZG9 B;  5CEB A;  3N8L A;  3ZNY A;  4EWF A;  1ES5 A;  1RP5 A;  2WUQ A;  2WKH A;  2WGW A;  3VP1 A;  4WZ5 A;  4N92 A;  4DKI A;  1NYY A;  3W4O A;  4R1G A;  1BT5 A;  2WGV A;  1KGE A;  1K25 A;  2EXA A;  3PTE A;  4HES A;  3SS4 A;  1ZC2 A;  4UA6 A;  5EVI D;  5FQI A;  1K56 D;  5EEC A;  4LCM A;  1J9M A;  4OQG A;  2HDR A;  4OP5 A;  5EVI B;  3ZNT A;  4GD8 A;  2WKE A;  5GLC A;  5FQ9 A;  2HP6 A;  2ZQ9 A;  1MY8 A;  1W8Y A;  3VSK A;  3IF5 A;  3VOY A;  4OQI A;  1YLZ A;  4GDB A;  5A92 A;  3N4I A;  5EUA A;  1H8Z A;  1K4E A;  3BFG A;  1IYQ A;  3WRT A;  1L2S A;  3NDE A;  2BLS A;  3ZGA B;  2QMI A;  1HD8 A;  4FCF A;  1W7F A;  3IWQ A;  1U60 A;  3C7U A;  1AXB A;  3BEB A;  1SHV A;  3PAG A;  5JYO A;  1YLY A;  1XGJ A;  1LI9 A;  3A3F A;  4K91 A;  3IF6 B;  1YLW A;  3UN7 A;  1TEM A;  4CJN A;  5FDH A;  3AGF A;  1K4F A;  3MZD A;  4JPM A;  4KZ9 A;  2R9W A;  5TGF A;  3LEZ A;  4S2P A;  1NXY A;  2ZQ8 A;  5CED A;  2Z2M B;  3G2Z A;  1PWG A;  1XXM A;  4EV4 A;  3OCL A;  4PMA A;  3PBR A;  4Q8I A;  3BFF A;  5I94 A;  2BG1 A;  1EI5 A;  2Y4A A;  2ZQC A;  4BEN A;  1PWC A;  2Y2G A;  4UA9 A;  2GDN A;  1PYY A;  2G2W A;  2Y2O A;  2ZQA A;  1LHY A;  3Q81 A;  1NRF A;  3OPP A;  2EX8 A;  3SH8 A;  4GB7 A;  4E6X A;  1IYO A;  1PZO A;  3O86 A;  2IWC A;  4B4X A;  3UO9 A;  3NBL A;  2XDM A;  4OVD A;  2Y2J A;  1IYP A;  2Y55 A;  3LCE A;  3UE0 A;  1ZG4 A;  3B3X A;  1XPB A;  1YLT A;  1ES4 A;  1W5D A;  4KZ8 A;  4OPR A;  4GN2 A;  4LV2 A;  5TR7 A;  4QB8 A;  4Y0O A;  2WK0 A;  4RA7 A;  1MWU A;  5GHZ A;  1RGZ A;  3MZF A;  5KSC A;  3C4O A;  1GHM A;  3UDI A;  1QME A;  4FH2 A;  4R0Q A;  5FQQ A;  3M6B A;  4ID4 A;  2R9X A;  2Q9N A;  4KG5 A;  1DJC A;  3GV9 A;  3BRM A;  4LEN A;  4OKP A;  4RX2 A;  1K6S A;  1BLH A;  2ZM0 A;  2DCF A;  1KDW A;  4NET A;  1JWZ A;  4U3T A;  2HDS A;  3IXH A;  1BLC A;  1BUL A;  3N8R A;  1FQG A;  4JXW A;  1FSY A;  3IHB A;  3TSG A;  3BYD A;  4R4R A;  4E3J A;  4U0T A;  2V2F F;  4S2N A;  3IH8 A;  5HAP A;  1MWS A;  3BM6 A;  4S2L A;  5FQM A;  3G30 A;  2ZJ9 A;  2OSU A;  4EBP A;  1H5X A;  4FSF A;  1GCE A;  3Q7Z A;  4JKT A;  4KZ6 A;  4KZ7 A;  4YFM A;  4JXG A;  5HW3 A;  1MPL A;  3GQZ A;  1SCW A;  2OLU A;  3S22 A;  1VM1 A;  2OLV A;  1NZU A;  4N9L A;  5CXW A;  5GLB A;  3HVF A;  3OZH A;  3O3V A;  2J8Y A;  3GRJ A;  3BEC A;  5L2F A;  2HP5 A;  4E3O A;  3GTC A;  4DE1 A;  3OCN A;  3MKE A;  5HAQ A;  2I72 A;  4H8R A;  3IWO A;  3M2J A;  2ZC7 A;  4GOG A;  2FFY A;  1XGI A;  5FAS A;  5E2H A;  1KVL A;  1IKG A;  2EFX A;  3A3I A;  3V39 A;  1K6R A;  1KE0 A;  4UAA A;  1ZKJ A;  1Z6F A;  1PWD A;  3HBR A;  3IXD A;  4BQM A;  5GLD A;  2OV5 A;  3UE3 A;  2EX9 A;  5CER A;  3BLM A;  2WYX A;  5U47 A;  3HLD A;  2X02 A;  1MWT A;  4JLF A;  1GHI A;  3WS5 A;  3LY3 A;  5FI6 A;  1XX2 A;  2XR0 A;  3CG5 A;  3UPN A;  1YMX A;  3I7J A;  4S2I A;  1NYM A;  3HUM A;  2JBF A;  1MWR A;  2RCX A;  3P98 A;  4DE0 A;  4DRT A;  4WEL A;  1JVJ A;  2P9V B;  4R3B A;  4UA7 A;  3HRE A;  5HAR A;  2A3U A;  4JBF A;  3UE1 A;  3GVB A;  4X6T A;  2ZD8 A;  4MNR A;  2XD1 A;  1W79 A;  3NCK A;  1IEL A;  5M18 A;  4GD6 A;  4PM6 A;  1IEM A;  4GDN A;  3ZVW A;  1E25 A;  1KVM A;  1K55 A;  1FR6 A;  3ZCZ A;  2Y2L A;  5FAP A;  2DRW A;  4XUZ A;  3S1Y A;  3VP4 A;  5A90 A;  4C3Q A;  2H5S A;  5AQA A;  4WMC D;  5EVI A;  3ZG8 B;  2WGI A;  4ZJ2 A;  1K56 A;  3Q1F A;  3IH9 A;  4QJG A;  3NC8 A;  4IBR A;  5FA7 A;  3LO7 A;  4XUX A;  5A93 A;  1YLJ A;  2HDU A;  1ES3 A;  2XF3 A;  2HPB A;  2H10 A;  4WEK A;  4E3M A;  1CI9 A;  1CK3 A;  1SDN A;  1YM1 A;  2XFS A;  2XQZ A;  2XK1 A;  3Q7V B;  1L0D A;  1SKF A;  3PBQ A;  3FZC A;  4KZA A;  4OLD A;  5GLA A;  3SH9 A;  3UPO A;  3VP3 A;  3ZHH A;  1WYB A;  4WMC A;  2Y2M A;  1TVF A;  4WZ5 C;  4FD8 A;  5J8X A;  1ONH A;  2ZM8 A;  4QU3 A;  2Y91 A;  4ZDX A;  4MBK A;  4OQH A;  1ES2 A;  3IF6 A;  1ERM A;  1MKI A;  3PAE A;  3A3E A;  3M6H A;  2WKI A;  3Q7V A;  4A5R A;  1FOF A;  2DNS A;  3DWK A;  3BFD A;  3NIA A;  1Q2P A;  3G2Y A;  3G4P A;  2ZM2 A;  3IXG A;  4OH0 A;  1HTZ A;  1IYS A;  1LL5 A;  3JYI A;  4IBX A;  2IWB A;  1XA1 A;  3BFE A;  3VMA A;  4RVA A;  3P09 A;  4UHU A;  4BD0 A;  1H8Y A;  4KG6 A;  1K57 A;  1DY6 A;  2Z2L B;  3HL9 A;  3SOI A;  2JCH A;  5E2E A;  3RJU A;  5HX9 A;  4OPQ A;  3C7V A;  5CRF A;  3Q07 A;  2JE5 A;  4LV0 A;  4DDS A;  5FI2 A;  2Q9M A;  5DVA A;  2WAF A;  5F82 A;  1XKZ A;  1E3U D;  4ZTK A;  2XFT A;  1PI5 A;  3MXS A;  5GHX A;  4FH4 A;  3E2K A;  3HLC A;  3Q82 A;  5AQ9 A;  4KQQ A;  4P85 A;  4OPY A;  5M19 A;  5F83 A;  3ZG7 B;  1BUE A;  3WS1 A;  5BOH A;  3AGD A;  1YMS A;  2WZX A;  3PBN A;  3CJM A;  1JWV A;  4X56 A;  5F1G A;  2WAE A;  1M40 A;  5FQK A;  1MBL A;  3OPR A;  3FKV A;  1K38 A;  3ITA A;  4OON A;  5AQ7 A;  3E2L A;  3GR2 A;  3WS4 A;  4N1X A;  1E3U A;  1YT4 A;  2WAD A;  4KZ4 A;  1TDL A;  3FYZ A;  3A3J A;  3OC2 A;  4QY5 A;  1G68 A;  4WEJ A;  1PZP A;  1JTD A;  3GSG A;  1EWZ A;  2VGK A;  3C5A A;  3W4Q A;  1I2W A;  1O07 A;  2X01 A;  3DWZ A;  1ONG A;  1BLP A;  4LCL A;  3MFD A;  4MLL A;  1GA0 A;  4LV3 A;  3C4P A;  3NY4 A;  3VP2 A;  1ESI A;  5EE8 A;  3NI9 A;  1BTL A;  1KGF A;  3M2K A;  3ZG0 A;  4S2M A;  1I2S A;  4KQR A;  5GL9 A;  1PI4 A;  1ESU A;  1PIO A;  3G35 A;  1K54 C;  2ZC4 B;  3PBO A;  4JXV A;  3UDX A;  4E3L A;  4QD4 A;  3QHY A;  4B4Z A;  3HLG A;  1M6K A;  4QY6 A;  3IT9 A;  4DDY A;  3UDF A;  3HUO A;  1G6A A;  2Y2I A;  3IHA A;  2XD5 A;  5A91 A;  5EPH A;  2EFU A; 
#chains in the Genus database with same CATH topology
 2WGW B;  2YKH A;  3S7N A;  4S2N C;  4Q0H A;  1DJA A;  2EA9 A;  3MXQ A;  1WE4 A;  3PBS A;  2C6W B;  4E3K A;  5DFY A;  3CZD A;  2PYR A;  3EQV A;  4C6Y A;  5D3O A;  4BL3 A;  1F2K A;  3C38 A;  3TE8 A;  5HDC A;  2ACG A;  5IHV A;  5J3W A;  4YIN A;  3ITB A;  4DF6 A;  1FR1 A;  2A49 A;  5HL1 A;  1HVB A;  3HLF A;  4MEZ A;  3MSH A;  4GNU A;  1FIL A;  4S2K A;  2UWX A;  3EGX C;  1YLP A;  3O87 A;  1NJ4 A;  3HLW A;  4PM9 A;  3CAX A;  4KZ5 A;  2J3T D;  2ZC5 B;  2VA0 A;  4MN5 A;  3F1O B;  3TJZ C;  2PU4 A;  4HQA A;  2B02 A;  5CGS A;  2HJE A;  5FSR A;  3V3R A;  1FCM A;  4KG2 A;  4WYY A;  5KMW A;  4E3I A;  1AWI A;  3VFF A;  2Y2N A;  5HPF A;  3G34 A;  1ERO A;  4JF4 A;  2JKT M;  3QP6 A;  3E0Y A;  2H0T A;  2QJ5 A;  4OLG A;  2XGN A;  1WA9 A;  3MZE A;  2JKR I;  1DP8 A;  1VET A;  3VOZ A;  2XA7 S;  3D9Y A;  3CPT B;  3NUL A;  3C8C A;  5CHM A;  3V3S A;  3RFB A;  3CWF A;  4WZ4 A;  2XSS A;  1Y54 A;  4B9O A;  2JC7 A;  2V9A A;  1DJB A;  3UPP A;  3HLB A;  1ALQ A;  2E8I A;  5KIZ A;  4MMN A;  1H0M A;  1FSW A;  3QNB A;  1W8Q A;  4NG2 A;  3ISG A;  1V9Z A;  4WUJ A;  1I5Q A;  4GS9 A;  3V5M A;  1BLS A;  2J9O A;  4EUZ A;  3D4F A;  4MBF A;  2QPN A;  1E4D A;  2ZLY A;  4R23 A;  2D02 A;  3VFH A;  4ARZ A;  3NOP C;  3GMW A;  4P87 A;  1OT6 A;  5DTK A;  1PW8 A;  5KSH A;  2GX5 A;  5J4E A;  1P97 A;  3EQU A;  2XLN A;  3C2W A;  4XXR A;  2FFF B;  2G2U A;  4LRX C;  1BYW A;  4WBG A;  2RL3 A;  3IXB A;  3ZG9 B;  4IJG A;  2WGW A;  4EER A;  3KX0 X;  3F1P B;  5EVE A;  4CLC B;  2WGV A;  2PR6 A;  4GHI B;  5EVI D;  4UA6 A;  1K56 D;  2V0U A;  4OP5 A;  4GD8 A;  4CQH A;  5TJJ A;  1LL8 A;  4NXG A;  3E4Q A;  3VOY A;  4OQI A;  1X0O A;  1T1B A;  5EUA A;  1H8Z A;  1K4E A;  3WRT A;  1PRQ A;  4FCF A;  1U60 A;  3C7U A;  4HP9 A;  2G7U A;  5JYO A;  1LI9 A;  3IF6 B;  3UN7 A;  2ZOI A;  5FDH A;  3AGF A;  4JPM A;  4S2P A;  3DTI A;  5CED A;  1PFL A;  4Q8I A;  2JHE A;  4LPZ A;  3MQO A;  2PRF A;  4LRY C;  1T1A A;  3OPP A;  4DJ3 A;  4PAU A;  4O8G A;  4OVD A;  2JKT I;  3LCE A;  3UE0 A;  1YLT A;  1ES4 A;  5MC7 A;  5TR7 A;  2K7S A;  1T1C A;  4Y0O A;  2WK0 A;  3LEQ A;  4I38 A;  5KSC A;  1VB6 A;  5HDS A;  4NEE D;  1S67 L;  4R0Q A;  5FQQ A;  5HDD A;  4ID4 A;  2MJ6 A;  4OKP A;  1BLH A;  1CF0 A;  2ZM0 A;  2DCF A;  3IXH A;  3N8R A;  4EU0 A;  1FSY A;  3TSG A;  4R4R A;  3IH8 A;  5EV0 A;  1YPR A;  3S7O A;  3G30 A;  2ZJ9 A;  2OSU A;  4EBP A;  1GCE A;  4YFM A;  1VM1 A;  5CXW A;  5TBM B;  3NOU C;  5G4Y A;  2J8Y A;  5IT5 A;  3BEC A;  4HP4 A;  4E3O A;  3IBJ A;  3MKE A;  3IWO A;  2OAP 1;  2XRO A;  4R6L A;  1OTA A;  3A3I A;  3V39 A;  1GSV A;  3B33 A;  2OWH A;  3HBR A;  4BQM A;  3UE3 A;  2WYX A;  5C5K A;  3HLD A;  4IUK A;  1S4R A;  1MWT A;  1S66 L;  3WS5 A;  4WF0 A;  3BQ8 A;  4H6J B;  1XX2 A;  2XR0 A;  3I7J A;  3P98 A;  5F6A A;  4DRT A;  1Y28 A;  4PHT A;  2A3U A;  4MNR A;  2VJW A;  3F1P A;  3LGO A;  4GDN A;  3ZVW A;  4GHI A;  1K55 A;  4L9F A;  5A90 A;  3VP4 A;  5AQA A;  4WMC D;  2K2N A;  2WGI A;  4ZJ2 A;  5FEG A;  1EW0 A;  4I5S A;  5A93 A;  2HDU A;  1SDN A;  2W27 A;  3H9W A;  3T4J A;  3SH9 A;  3VP3 A;  3ZHH A;  4WMC A;  5HZH A;  4FD8 A;  1J3W A;  2Y79 A;  3IF6 A;  2WKI A;  4A5R A;  4DN0 A;  2DNS A;  3BFD A;  4EEP A;  3DTK A;  1LL5 A;  3BFE A;  4RVA A;  3MR0 A;  1DY6 A;  3HL9 A;  5EM1 A;  1ZTU A;  5E2E A;  4EXO A;  3IS2 B;  3C7V A;  5CRF A;  5FI2 A;  5DVA A;  5F82 A;  1XKZ A;  4ZTK A;  2XFT A;  3D3O A;  5G4Z A;  3HLC A;  3Q82 A;  4P85 A;  4OPY A;  5M19 A;  1TS0 A;  1OJG A;  3LIC A;  3AGD A;  2V8C A;  2ZBB A;  5F1G A;  4OON A;  1MZU A;  4N1X A;  1TDL A;  1F98 A;  1G68 A;  1EWZ A;  3W4Q A;  1MKM A;  3FC7 A;  3ICY A;  4PKY G;  3NI9 A;  4Z1W A;  5FL3 A;  3M2K A;  3ZG0 A;  4G3V A;  5GL9 A;  1PI4 A;  5TBM A;  1ESU A;  1K54 C;  5DKK A;  4EET B;  3HLG A;  3T1Q B;  4JGO A;  3IT9 A;  3EEH A;  3HUO A;  4HNB A;  4PKY A;  4FOF A;  5A91 A;  4GJ4 A;  5AQB A;  1MC0 A;  3SS5 A;  3T12 B;  3UB6 A;  2H0Y A;  5GHY A;  1C3B A;  3MS6 A;  4H6J A;  5CHU A;  1S0W A;  4KQO A;  3WS2 A;  1XA7 A;  4BD1 A;  2C5W B;  4HJ4 A;  4X53 A;  3FKW A;  2L1M A;  1CEG A;  2PU2 A;  2HF6 A;  2KOI A;  4CLC E;  5HWW A;  2PR5 A;  1FCN A;  3ZYT A;  1TS8 A;  1CI8 A;  4PM7 A;  4E6W A;  3NHQ A;  4Y0T A;  4N9K A;  3O88 A;  4ETX A;  5CGW A;  4XT2 B;  1KE4 A;  4U0X A;  3SS3 A;  4MCW A;  4X68 A;  3BLS A;  2Y2P A;  3VP0 A;  3OPL A;  4K0W A;  4CLC C;  3EEA A;  4X55 A;  4P0M A;  4LLO B;  3TOI A;  3LR3 A;  4KZ3 A;  1K55 C;  5DF8 A;  5E2F A;  2CC1 A;  2KX6 A;  4Y13 A;  1N4O A;  4BBT A;  4Y0U A;  1DP9 A;  2HP9 A;  4Y7P A;  1OTI A;  1CJF A;  2VGL M;  1OTD A;  3S7P A;  2BTF P;  4KEN B;  5L8M A;  5DF7 A;  2M7U A;  1GHP A;  3IF6 C;  5G18 A;  3ZG5 A;  2M1C A;  2EX6 A;  3TRC A;  4ZBE A;  5HAI A;  1IKI A;  4WM9 A;  4D2O A;  1HLU P;  3QP1 A;  4UQI M;  4EEU A;  4BL2 A;  4R38 A;  4X69 A;  5E43 A;  3TG9 A;  1GA9 A;  4RX3 A;  1QMF A;  1KGG A;  3IX3 A;  2WKR A;  3L7H A;  3IX8 A;  4GZB A;  2O0Y A;  4OOL A;  4DMZ A;  5KZH A;  4IED A;  3DW0 A;  2WKP A;  3MBZ A;  4L0L A;  1O7E A;  4HH3 A;  1GSW A;  1OT9 A;  4EBL A;  1MXO A;  3MMH A;  3BFC A;  1TDG A;  3KYQ A;  5CX7 A;  3QP4 A;  4MBH A;  1RP5 A;  3PR6 A;  2WKH A;  1LSV A;  1UGU A;  3VP1 A;  2PT7 A;  4WZ5 A;  4DKI A;  2I9V A;  3T1R A;  3T4L A;  1KGE A;  3PTE A;  3FPV A;  4BBU A;  5EEC A;  4OQG A;  2HDR A;  5EVI B;  4Y2F A;  3ZNT A;  1W8Y A;  2V0W A;  3A0R A;  3IF5 A;  3PHY A;  3P01 A;  2Z6D A;  1YLZ A;  4Q0I A;  3NDE A;  2QMI A;  3IWQ A;  1AXB A;  3BEB A;  1YLY A;  2DMW A;  4KUK A;  4XT2 A;  1K4F A;  3MZD A;  5AJG A;  4KZ9 A;  4BMW A;  2ZQ8 A;  4I3A A;  1XFQ A;  1PWG A;  4EV4 A;  4PMA A;  3PBR A;  5IS1 A;  3CUE A;  4BEN A;  2Y2G A;  3DBA A;  2HJ9 C;  4UA9 A;  1SZV A;  2GDN A;  2Y2O A;  3Q81 A;  1W63 M;  2EX8 A;  4G3W A;  1TD5 A;  4GB7 A;  2INW A;  1PZO A;  3JVV A;  1OPX A;  2IWC A;  2XDM A;  1LSX A;  2Y2J A;  3UMD A;  2Y55 A;  1XPB A;  4KZ8 A;  4O01 A;  4GN2 A;  4LV2 A;  5AVE A;  4RA7 A;  1RGZ A;  3MZF A;  4NXB A;  1QME A;  4FH2 A;  3BQA A;  5EM0 A;  4II7 A;  4LEN A;  4BWI A;  4LGW A;  1SKO B;  4U0T A;  4FUW A;  4FSF A;  4KZ7 A;  5HW3 A;  3K2N A;  1MPL A;  1S4S A;  1W63 Q;  3BJN A;  2OLV A;  1NZU A;  4MN7 A;  5GLB A;  3HVF A;  3O3V A;  3KSG A;  3GRJ A;  5L2F A;  2P04 A;  4Y3I A;  3OCN A;  4E04 A;  5HAQ A;  3M2J A;  1JNU A;  2VX8 A;  3DAV A;  1XGI A;  1S1Y A;  2EFX A;  1IKG A;  3HJK A;  1T19 A;  2EX9 A;  3O5Y A;  5CER A;  3BLM A;  4I39 A;  3T4O A;  1GHI A;  2V1A A;  3LY3 A;  4LFU A;  2JKF A;  3UPN A;  4S2I A;  3HUM A;  1IFQ A;  1MWR A;  2RCX A;  4DE0 A;  3BY9 A;  3G6O A;  3CLO A;  3B47 A;  3HRE A;  1W79 A;  3NCK A;  2W0N A;  5M18 A;  1KVM A;  1FR6 A;  2VV7 A;  2DRW A;  4XUZ A;  4HH2 A;  4C3Q A;  2H5S A;  5EVI A;  3ZG8 B;  1K56 A;  3Q1F A;  3NC8 A;  4IBR A;  2OWJ A;  1CI9 A;  1TF1 A;  1YM1 A;  2XQZ A;  1L0D A;  1SKF A;  3PBQ A;  3FZC A;  4KZA A;  4OLD A;  3UPO A;  5HD3 A;  1TVF A;  4WZ5 C;  1VEU B;  2W3F A;  1H3Q A;  4MBK A;  3PAE A;  4WN5 A;  3M6H A;  4I3J A;  3Q7V A;  1Q2P A;  4YWZ A;  3BW6 A;  1IYS A;  3JYI A;  4IBX A;  2IWB A;  1XA1 A;  3U4L P;  4UHU A;  1H8Y A;  5FEF A;  2HV1 A;  4B93 A;  2B18 A;  2JE5 A;  4DDS A;  2UV0 E;  1PI5 A;  2VK3 A;  5AQ9 A;  3ULF A;  5F83 A;  3ZG7 B;  3BWL A;  2WZX A;  5A8B A;  4EQ1 A;  3CJM A;  2W3D A;  1M40 A;  3E2L A;  3GR2 A;  2WAD A;  2J3T C;  2FH5 A;  1PZP A;  1JTD A;  1SKO A;  3C5A A;  4R3A A;  4QWO A;  3HCY A;  2X01 A;  1ONG A;  4WLA A;  3MFD A;  4JGP A;  2O9C A;  4LV3 A;  4GLQ A;  1BTL A;  1KGF A;  1I2S A;  3G35 A;  5IU1 A;  3PBO A;  4JXV A;  3D72 A;  3EGD C;  4QY6 A;  4DDY A;  1G6A A;  2VKS A;  2AVX A;  3KYE A;  3ZVT A;  4BJP A;  4HBU A;  2P74 A;  4HBT A;  2QHK A;  2YKF A;  3HUN A;  1XJ6 A;  3MKF A;  5DF9 A;  4OQ0 A;  4JGR A;  3FV7 A;  4PM5 A;  1DRM A;  3LY4 A;  4YOF A;  3EWK A;  1CEF A;  5EOE A;  1ZG6 A;  3OPH A;  4ZAM A;  2Y2K A;  3LFV A;  4NK3 A;  2ZC6 B;  3W2Z A;  5CEC A;  4CPK A;  5CTM A;  4I3I A;  4EW7 A;  3FPW A;  3ZQ5 A;  1D06 A;  2VV8 A;  2J7V A;  2QZ6 A;  3G31 A;  3R7W B;  3UNW A;  4S2J A;  2GNX A;  2VGJ A;  3IWI A;  2PBY A;  4JF5 A;  3WWX A;  2WZZ A;  3VSL A;  2IWD A;  1OME A;  1XJ4 A;  1VEU A;  1HZO A;  1P9R A;  1KE3 A;  1Q2Q A;  1L0F A;  3G32 A;  3LIF A;  5EVI C;  3DTM A;  5DKL A;  3N6I A;  2V1Z A;  2ZQ7 A;  3PYP A;  3V50 A;  4DXC A;  4FTX A;  3QP2 A;  4JXS A;  5DTS A;  3QNC A;  1XFN A;  3SH7 A;  2Q0O A;  2Y59 A;  5FI7 A;  4K0X A;  3KSI A;  4KZB A;  4R3J A;  3VV4 A;  5FAO A;  5CTN A;  2E8J A;  5L07 A;  3K3C A;  3RXX A;  2Y2H A;  4OOY A;  2PAV P;  5M1A A;  2HDQ A;  4PPR A;  4HEF A;  4P6Z M;  3MXR A;  3W8K A;  2ZQD A;  1ACF A;  2O9B A;  2B5R A;  4Y17 A;  3LR0 A;  2B95 A;  4JF6 A;  4Q0J A;  3N8S A;  4UEY A;  4ZJ3 A;  2VZW A;  1SDE A;  5E2G A;  5JYP A;  3A3D A;  3WS0 A;  1BZA A;  5HFO A;  4Z9Q A;  4NXF A;  4B88 A;  4KQD A;  2J9P A;  5CEB A;  3N8L A;  1ES5 A;  2WUQ A;  1YAX A;  3KSF A;  3T1S A;  3W4O A;  4R1G A;  1BT5 A;  1K25 A;  2VLG A;  4ZRR A;  1NLZ A;  4LCM A;  1J9M A;  4BBV A;  1A0K A;  5FQ9 A;  2ZQ9 A;  3VSK A;  3T50 A;  1H8M A;  3T1X A;  2P08 A;  2QWS A;  4GDB A;  2OOL A;  3NJA A;  3BFG A;  1HD8 A;  2EWW A;  2HZ5 A;  1SHV A;  3PAG A;  3A3F A;  4K91 A;  1XJ2 A;  1YLW A;  1TEM A;  3R7W A;  4X1L A;  5TGF A;  3LEZ A;  1NXY A;  3EOI A;  2Z2M B;  3G2Z A;  1XXM A;  1D7E A;  2ZQC A;  3DTE A;  1G5U A;  2HGV A;  5DJT A;  3SH8 A;  1IYO A;  3NOT C;  3NBL A;  3IBR A;  1D1J A;  4DJ2 A;  3IX4 A;  3MFX A;  2BAS A;  5AVF A;  4QB8 A;  1MWU A;  3T4K A;  3UDI A;  3M6B A;  4RQ9 A;  2Q9N A;  4KG5 A;  4ESP A;  3GV9 A;  3BRM A;  1LT0 A;  4KUO A;  4NET A;  1JWZ A;  3F1N A;  2HDS A;  1BLC A;  1FQG A;  4JXW A;  1N9O A;  3IHB A;  5HWT A;  3BYD A;  4L9G A;  2V2F F;  5HAP A;  3PXP A;  4IUH A;  1MWS A;  4S2L A;  5FQM A;  2IA2 A;  1H5X A;  3Q7Z A;  4JKT A;  3C30 A;  5L10 A;  3GQZ A;  1SCW A;  4N9L A;  1KOU A;  3OZH A;  3KYZ A;  3LI8 A;  4HOI A;  2KDK A;  2Z6C A;  4H8R A;  2ZC7 A;  2FFY A;  1F9I A;  5FAS A;  4HHD A;  5E2H A;  1KVL A;  1TS6 A;  3VE3 A;  2PDR A;  1K6R A;  2XA7 M;  1KE0 A;  3IXD A;  1PWD A;  5GLD A;  2H28 A;  3OLO A;  5U47 A;  2L0W A;  1DP6 A;  5FI6 A;  3E4P A;  3CG5 A;  3LIE A;  4EUV A;  3OBF A;  3UB7 A;  2Y8H A;  4WEL A;  2P9V B;  4UA7 A;  5HAR A;  4X6T A;  3CI6 A;  2ZD8 A;  1IEL A;  4GD6 A;  4PM6 A;  3MQ0 A;  5FAP A;  2VGL S;  4QJG A;  3QP5 A;  4XUX A;  1NLY A;  1ES3 A;  2XF3 A;  2HPB A;  2H10 A;  4WEK A;  4E3M A;  1CK3 A;  2XK1 A;  3Q7V B;  2R78 A;  3T4Q A;  2Y2M A;  1F5M A;  1ONH A;  1P9W A;  2Y91 A;  4ZDX A;  1L3L A;  4OQH A;  1ES2 A;  3S7Q A;  1MKI A;  3A3E A;  3NIA A;  4UQI S;  3IXG A;  2ZM2 A;  1HTZ A;  3P7N A;  1K57 A;  1YSQ A;  2Z2L B;  1CQA A;  1T18 A;  4HI4 A;  3VOL A;  2Q9M A;  2WAF A;  2QKP A;  3MXS A;  5GHX A;  1LSW A;  5K5B A;  2NUT C;  4KQQ A;  2W3H A;  3UB5 P;  1BUE A;  3T4T A;  5BOH A;  3LYX A;  1YMS A;  3PBN A;  1JWV A;  4X56 A;  5EFW A;  1MBL A;  3OPR A;  3FKV A;  3ITA A;  5AQ7 A;  3WS4 A;  3LI9 A;  3A3J A;  3OC2 A;  5HWV A;  2J3W A;  1I2W A;  4D60 A;  1PNE A;  3DWZ A;  2W1R A;  3CIT A;  2QYB A;  3NY4 A;  4L9E A;  3VP2 A;  1ESI A;  5EE8 A;  5LBR A;  2WKQ A;  3H7W A;  4S2M A;  3VE4 A;  4E3L A;  3QHY A;  4B4Z A;  2XD5 A;  3E98 A;  5EPH A;  3KO6 A;  2EFU A;  1NRJ A;  1RGY A;  3AGE A;  5EOO A;  3HLE A;  3WRZ A;  1NZO A;  4MN6 A;  4N1H A;  3UY6 A;  5HD5 A;  3LID A;  3UB8 A;  2P9V A;  2PBD P;  2Y2Q A;  4F94 A;  2O9A A;  2XH9 A;  4MDZ A;  5TFQ A;  2ZC3 B;  2ZMF A;  1LI0 A;  5DJU A;  1S6R A;  5FQJ A;  3JVU A;  1L0G A;  3ZDJ A;  4DE3 A;  3K3D A;  1YSP A;  5DFX A;  4M3K A;  4QHC A;  5L09 A;  3CMZ A;  3NEC A;  3TW8 A;  5CHJ A;  4ZJ1 A;  1G28 A;  4BLM A;  4GKU A;  4E3N A;  1YKD A;  3IQA A;  3A0V A;  1ODV A;  1OTE A;  1Z09 A;  5CGX A;  5FAQ A;  5EVL A;  3LUQ A;  4ETZ A;  4R4S A;  5DTT A;  3PBT A;  3F1O A;  1RCJ A;  1YQS A;  3OOV A;  3FWL A;  3W4P A;  2ZL1 B;  4OPZ A;  2V1B A;  2K31 A;  3CHW P;  4IVK A;  1K0K A;  1LLB A;  3H82 B;  2EXB A;  1PW1 A;  2PYP A;  1XP4 A;  1L0E A;  2V20 A;  3MF0 A;  3CUE C;  4OOM A;  4DXB A;  4P6B A;  2X71 A;  1LL9 A;  4RYE A;  2OAQ 1;  1K54 A;  2ZMA A;  2NUP C;  1JWP A;  4X25 A;  1ERQ A;  1N9B A;  4YNR A;  3KSH A;  4C75 A;  2A24 B;  3CPT A;  4LRZ E;  4EBN A;  1K57 C;  1FCO A;  1ZHH B;  1VQQ A;  3LIA A;  1KDS A;  3MQQ A;  2XEP A;  3NDG A;  5FAT A;  4R70 A;  3N7W A;  2EX2 A;  4X1M A;  4PM8 A;  4O7D A;  4EQI A;  4K08 A;  1BSG A;  4IVI A;  3S4X A;  4S2O A;  4EES A;  1NY0 A;  3ZFZ A;  4LV1 A;  4OP8 A;  3GEC A;  5HL6 A;  1JTG A;  3RXW A;  1WYC A;  5F1F A;  1Y4O A;  4DE2 A;  1P0Z A;  1IOU A;  3ZNY A;  4EWF A;  2V8F A;  3T4S A;  4N92 A;  4CLC D;  1OTB A;  1NYY A;  2ZMV A;  4HY8 A;  4HJ3 A;  3UE6 A;  2EXA A;  3U2A A;  4HES A;  2M7V A;  3SS4 A;  1ZC2 A;  5FQI A;  2LB9 A;  2W1T B;  3A0S A;  2WKE A;  5GLC A;  2HP6 A;  1MY8 A;  4CLC A;  3FG8 A;  2EWV A;  5A92 A;  3N4I A;  1IYQ A;  1L2S A;  4JGQ A;  2BLS A;  3ZGA B;  2PD7 A;  1OJ5 A;  1W7F A;  1XGJ A;  4CJN A;  5J7E A;  2L4R A;  4AFI A;  2R9W A;  3HJI A;  4Y5F A;  3OCL A;  3BFF A;  5I94 A;  4F3L B;  2BG1 A;  5HSQ A;  1EI5 A;  2Y4A A;  1PWC A;  1PYY A;  2G2W A;  2P7J A;  2ZQA A;  1LHY A;  4WL9 A;  1NRF A;  4E6X A;  4O0P A;  3O86 A;  4B4X A;  3UO9 A;  2W3G A;  1IYP A;  2JKG A;  5F69 A;  1ZG4 A;  3B3X A;  1W5D A;  4OPR A;  4GCZ A;  4Y15 A;  2D01 A;  5GHZ A;  2ZL1 A;  2VV6 A;  3F1N B;  3C4O A;  3H82 A;  1GHM A;  1XJ3 A;  3RH8 B;  2VEA A;  4M4X A;  2LB5 A;  2R9X A;  1DJC A;  3LR5 A;  4RX2 A;  1K6S A;  3SW1 A;  1KDW A;  4U3T A;  1BUL A;  5F68 A;  3V67 A;  4E3J A;  4S2N A;  2GJ3 A;  3BM6 A;  2A24 A;  2FZ0 A;  4KZ6 A;  4JXG A;  2OLU A;  3S22 A;  2O99 A;  4QPR A;  1S1Z A;  2HP5 A;  3GTC A;  4DE1 A;  4HJ6 A;  2I72 A;  3LIB A;  4GOG A;  4HIA A;  4UAA A;  1ZKJ A;  1Z6F A;  1GSX A;  3QP8 A;  2OV5 A;  3B42 A;  2X02 A;  4JLF A;  2PD8 A;  3MJQ A;  1YMX A;  1NYM A;  2JBF A;  1JVJ A;  4R3B A;  4JBF A;  3SZT A;  3GVB A;  3UE1 A;  3LR4 A;  2XD1 A;  3E4O A;  1IEM A;  1E25 A;  3ZCZ A;  2Y2L A;  3S1Y A;  2W1T A;  2CMN A;  1NWZ A;  1UWN X;  3IH9 A;  5FA7 A;  3LO7 A;  1YLJ A;  2ZOH A;  4GW9 A;  2XFS A;  5GLA A;  1FIK A;  1WYB A;  5J8X A;  2ZM8 A;  4QU3 A;  1ERM A;  1FOF A;  3DWK A;  3G2Y A;  3G4P A;  4P6Z S;  4OH0 A;  1STZ A;  3R4K A;  3VMA A;  4F3L A;  3P09 A;  3BY8 A;  4BD0 A;  4KG6 A;  3SOI A;  2JCH A;  5F5Y A;  3RJU A;  5HX9 A;  4OPQ A;  2JN7 A;  3Q07 A;  4LV0 A;  1N9N A;  1E3U D;  4NKP A;  1VET B;  2J80 A;  1N9L A;  2XRN A;  3UB9 A;  4FH4 A;  3E2K A;  3WS1 A;  3IS2 A;  4IHQ A;  1G6O A;  2JKR M;  1TS7 A;  2WAE A;  5FQK A;  1K38 A;  2GZA A;  3GDI A;  1E3U A;  1YT4 A;  4KZ4 A;  3FYZ A;  4ME4 A;  3RTY A;  3L9K A;  4QY5 A;  2KLI A;  4WEJ A;  3GSG A;  2QJ7 A;  1V9Y A;  2VGK A;  3H7W B;  4G3K A;  5FDS A;  1O07 A;  4LCL A;  1BLP A;  4MLL A;  1GA0 A;  4GS9 B;  1VHM A;  3C4P A;  2A2L A;  1UWP X;  4KQR A;  1PIO A;  4ARZ B;  3UDX A;  2ZC4 B;  4QD4 A;  5I5L A;  1M6K A;  2W3E A;  3UDF A;  5HPI A;  2PHY A;  2Y2I A;  3IHA A;  4NXE A;  3UME A;  3JPU A; 
#chains in the Genus database with same CATH homology
 3ZVT A;  4BJP A;  4HBU A;  2P74 A;  1RGY A;  2WGW B;  3AGE A;  4HBT A;  4S2N C;  5EOO A;  3HLE A;  1DJA A;  5AQB A;  3SS5 A;  3WRZ A;  1NZO A;  1WE4 A;  4N1H A;  3PBS A;  2C6W B;  3HUN A;  2H0Y A;  3UY6 A;  4E3K A;  5GHY A;  1C3B A;  3MKF A;  3CZD A;  5DF9 A;  4OQ0 A;  5CHU A;  3FV7 A;  1S0W A;  4PM5 A;  4KQO A;  3WS2 A;  3EQV A;  4C6Y A;  1XA7 A;  5D3O A;  4BD1 A;  2C5W B;  4X53 A;  4BL3 A;  2P9V A;  3LY4 A;  1CEF A;  3FKW A;  2Y2Q A;  5EOE A;  4EQI A;  4F94 A;  1ZG6 A;  3OPH A;  1CEG A;  2PU2 A;  5IHV A;  4ZAM A;  2Y2K A;  2XH9 A;  4NK3 A;  2ZC6 B;  5CEC A;  4YIN A;  3ITB A;  4DF6 A;  1FR1 A;  1FCN A;  4CPK A;  2A49 A;  5TFQ A;  2ZC3 B;  5CTM A;  1LI0 A;  1S6R A;  5FQJ A;  1L0G A;  3ZDJ A;  4DE3 A;  1CI8 A;  5HL1 A;  4PM7 A;  4E6W A;  1HVB A;  2J7V A;  3HLF A;  4M3K A;  4MEZ A;  4GNU A;  4QHC A;  2QZ6 A;  4N9K A;  4Y0T A;  3G31 A;  4S2K A;  3O88 A;  3UNW A;  2UWX A;  5CGW A;  3CMZ A;  4S2J A;  1YLP A;  3O87 A;  1KE4 A;  1NJ4 A;  3HLW A;  5CHJ A;  2VGJ A;  4ZJ1 A;  4PM9 A;  3IWI A;  4U0X A;  3SS3 A;  4X68 A;  2PBY A;  4BLM A;  4GKU A;  4JF5 A;  4KZ5 A;  4E3N A;  2ZC5 B;  3WWX A;  3IQA A;  3BLS A;  2WZZ A;  2Y2P A;  3VSL A;  3VP0 A;  3OPL A;  2IWD A;  1OME A;  2PU4 A;  4K0W A;  4X55 A;  5CGX A;  4P0M A;  3TOI A;  5FAQ A;  1HZO A;  5CGS A;  1KE3 A;  4KZ3 A;  1K55 C;  5DF8 A;  5E2F A;  5EVL A;  1Q2Q A;  5FSR A;  2CC1 A;  3V3R A;  1FCM A;  1L0F A;  3G32 A;  5EVI C;  3DTM A;  1N4O A;  3N6I A;  2V1Z A;  4KG2 A;  2ZQ7 A;  4R4S A;  4WYY A;  5DTT A;  3V50 A;  3PBT A;  5KMW A;  4DXC A;  4JXS A;  5DTS A;  4E3I A;  4Y0U A;  3QNC A;  3VFF A;  1RCJ A;  1YQS A;  2Y2N A;  3FWL A;  3G34 A;  1ERO A;  4JF4 A;  2HP9 A;  4Y7P A;  3SH7 A;  3W4P A;  2Y59 A;  4OPZ A;  4IVK A;  1LLB A;  2H0T A;  5FI7 A;  2EXB A;  1PW1 A;  4K0X A;  4KEN B;  4OLG A;  2XGN A;  4KZB A;  3MZE A;  1XP4 A;  1L0E A;  2V20 A;  4OOM A;  5DF7 A;  4DXB A;  3VOZ A;  4P6B A;  4R3J A;  1GHP A;  2X71 A;  5FAO A;  1LL9 A;  4RYE A;  3IF6 C;  5CTN A;  5G18 A;  5CHM A;  3V3S A;  1K54 A;  3ZG5 A;  2EX6 A;  2ZMA A;  4WZ4 A;  1Y54 A;  1JWP A;  3RXX A;  2JC7 A;  2Y2H A;  4OOY A;  4ZBE A;  1ERQ A;  1N9B A;  5M1A A;  2HDQ A;  4C75 A;  5HAI A;  4PPR A;  4HEF A;  1IKI A;  4WM9 A;  1DJB A;  3UPP A;  4D2O A;  3HLB A;  1ALQ A;  4EBN A;  2E8I A;  4BL2 A;  1K57 C;  3MXR A;  1FCO A;  1VQQ A;  1KDS A;  4X69 A;  5E43 A;  3W8K A;  3TG9 A;  1GA9 A;  2XEP A;  2ZQD A;  3NDG A;  4RX3 A;  1FSW A;  1QMF A;  3QNB A;  5FAT A;  2B5R A;  1KGG A;  1W8Q A;  3N7W A;  3ISG A;  4GZB A;  4JF6 A;  1I5Q A;  4OOL A;  2EX2 A;  3V5M A;  5KZH A;  1BLS A;  4IED A;  3DW0 A;  3N8S A;  4O7D A;  3MBZ A;  4PM8 A;  1BSG A;  4IVI A;  4L0L A;  4ZJ3 A;  2J9O A;  4S2O A;  3S4X A;  4EUZ A;  3D4F A;  4MBF A;  1O7E A;  1E4D A;  1NY0 A;  2QPN A;  2ZLY A;  4R23 A;  4EBL A;  3ZFZ A;  1SDE A;  4LV1 A;  5E2G A;  3VFH A;  5JYP A;  4OP8 A;  1MXO A;  3GMW A;  3A3D A;  4P87 A;  5DTK A;  3WS0 A;  1BZA A;  1JTG A;  3BFC A;  3RXW A;  1TDG A;  1PW8 A;  5KSH A;  1WYC A;  5HFO A;  5F1F A;  4Z9Q A;  3EQU A;  2XLN A;  4B88 A;  4MBH A;  4XXR A;  2FFF B;  2G2U A;  4WBG A;  4DE2 A;  2RL3 A;  3IXB A;  2J9P A;  3ZG9 B;  5CEB A;  3N8L A;  3ZNY A;  4EWF A;  1ES5 A;  1RP5 A;  2WUQ A;  2WKH A;  2WGW A;  3VP1 A;  4WZ5 A;  4N92 A;  4DKI A;  1NYY A;  3W4O A;  4R1G A;  1BT5 A;  2WGV A;  1KGE A;  1K25 A;  2EXA A;  3PTE A;  4HES A;  3SS4 A;  1ZC2 A;  4UA6 A;  5EVI D;  5FQI A;  1K56 D;  5EEC A;  4LCM A;  1J9M A;  4OQG A;  2HDR A;  4OP5 A;  5EVI B;  3ZNT A;  4GD8 A;  2WKE A;  5GLC A;  5FQ9 A;  2HP6 A;  2ZQ9 A;  1MY8 A;  1W8Y A;  3VSK A;  3IF5 A;  3VOY A;  4OQI A;  1YLZ A;  4GDB A;  5A92 A;  3N4I A;  5EUA A;  1H8Z A;  1K4E A;  3BFG A;  1IYQ A;  3WRT A;  1L2S A;  3NDE A;  2BLS A;  3ZGA B;  2QMI A;  1HD8 A;  4FCF A;  1W7F A;  3IWQ A;  1U60 A;  3C7U A;  1AXB A;  3BEB A;  1SHV A;  3PAG A;  5JYO A;  1YLY A;  1XGJ A;  1LI9 A;  3A3F A;  4K91 A;  3IF6 B;  1YLW A;  3UN7 A;  1TEM A;  4CJN A;  5FDH A;  3AGF A;  1K4F A;  3MZD A;  4JPM A;  4KZ9 A;  2R9W A;  5TGF A;  3LEZ A;  4S2P A;  1NXY A;  2ZQ8 A;  5CED A;  2Z2M B;  3G2Z A;  1PWG A;  1XXM A;  4EV4 A;  3OCL A;  4PMA A;  3PBR A;  4Q8I A;  3BFF A;  5I94 A;  2BG1 A;  1EI5 A;  2Y4A A;  2ZQC A;  4BEN A;  1PWC A;  2Y2G A;  4UA9 A;  2GDN A;  1PYY A;  2G2W A;  2Y2O A;  2ZQA A;  1LHY A;  3Q81 A;  1NRF A;  3OPP A;  2EX8 A;  3SH8 A;  4GB7 A;  4E6X A;  1IYO A;  1PZO A;  3O86 A;  2IWC A;  4B4X A;  3UO9 A;  3NBL A;  2XDM A;  4OVD A;  2Y2J A;  1IYP A;  2Y55 A;  3LCE A;  3UE0 A;  1ZG4 A;  3B3X A;  1XPB A;  1YLT A;  1ES4 A;  1W5D A;  4KZ8 A;  4OPR A;  4GN2 A;  4LV2 A;  5TR7 A;  4QB8 A;  4Y0O A;  2WK0 A;  4RA7 A;  1MWU A;  5GHZ A;  1RGZ A;  3MZF A;  5KSC A;  3C4O A;  1GHM A;  3UDI A;  1QME A;  4FH2 A;  4R0Q A;  5FQQ A;  3M6B A;  4ID4 A;  2R9X A;  2Q9N A;  4KG5 A;  1DJC A;  3GV9 A;  3BRM A;  4LEN A;  4OKP A;  4RX2 A;  1K6S A;  1BLH A;  2ZM0 A;  2DCF A;  1KDW A;  4NET A;  1JWZ A;  4U3T A;  2HDS A;  3IXH A;  1BLC A;  1BUL A;  3N8R A;  1FQG A;  4JXW A;  1FSY A;  3IHB A;  3TSG A;  3BYD A;  4R4R A;  4E3J A;  4U0T A;  2V2F F;  4S2N A;  3IH8 A;  5HAP A;  1MWS A;  3BM6 A;  4S2L A;  5FQM A;  3G30 A;  2ZJ9 A;  2OSU A;  4EBP A;  1H5X A;  4FSF A;  1GCE A;  3Q7Z A;  4JKT A;  4KZ6 A;  4KZ7 A;  4YFM A;  4JXG A;  5HW3 A;  1MPL A;  3GQZ A;  1SCW A;  2OLU A;  3S22 A;  1VM1 A;  2OLV A;  1NZU A;  4N9L A;  5CXW A;  5GLB A;  3HVF A;  3OZH A;  3O3V A;  2J8Y A;  3GRJ A;  3BEC A;  5L2F A;  2HP5 A;  4E3O A;  3GTC A;  4DE1 A;  3OCN A;  3MKE A;  5HAQ A;  2I72 A;  4H8R A;  3IWO A;  3M2J A;  2ZC7 A;  4GOG A;  2FFY A;  1XGI A;  5FAS A;  5E2H A;  1KVL A;  1IKG A;  2EFX A;  3A3I A;  3V39 A;  1K6R A;  1KE0 A;  4UAA A;  1ZKJ A;  1Z6F A;  1PWD A;  3HBR A;  3IXD A;  4BQM A;  5GLD A;  2OV5 A;  3UE3 A;  2EX9 A;  5CER A;  3BLM A;  2WYX A;  5U47 A;  3HLD A;  2X02 A;  1MWT A;  4JLF A;  1GHI A;  3WS5 A;  3LY3 A;  5FI6 A;  1XX2 A;  2XR0 A;  3CG5 A;  3UPN A;  1YMX A;  3I7J A;  4S2I A;  1NYM A;  3HUM A;  2JBF A;  1MWR A;  2RCX A;  3P98 A;  4DE0 A;  4DRT A;  4WEL A;  1JVJ A;  2P9V B;  4R3B A;  4UA7 A;  3HRE A;  5HAR A;  2A3U A;  4JBF A;  3UE1 A;  3GVB A;  4X6T A;  2ZD8 A;  4MNR A;  2XD1 A;  1W79 A;  3NCK A;  1IEL A;  5M18 A;  4GD6 A;  4PM6 A;  1IEM A;  4GDN A;  3ZVW A;  1E25 A;  1KVM A;  1K55 A;  1FR6 A;  3ZCZ A;  2Y2L A;  5FAP A;  2DRW A;  4XUZ A;  3S1Y A;  3VP4 A;  5A90 A;  4C3Q A;  2H5S A;  5AQA A;  4WMC D;  5EVI A;  3ZG8 B;  2WGI A;  4ZJ2 A;  1K56 A;  3Q1F A;  3IH9 A;  4QJG A;  3NC8 A;  4IBR A;  5FA7 A;  3LO7 A;  4XUX A;  5A93 A;  1YLJ A;  2HDU A;  1ES3 A;  2XF3 A;  2HPB A;  2H10 A;  4WEK A;  4E3M A;  1CI9 A;  1CK3 A;  1SDN A;  1YM1 A;  2XFS A;  2XQZ A;  2XK1 A;  3Q7V B;  1L0D A;  1SKF A;  3PBQ A;  3FZC A;  4KZA A;  4OLD A;  5GLA A;  3SH9 A;  3UPO A;  3VP3 A;  3ZHH A;  1WYB A;  4WMC A;  2Y2M A;  1TVF A;  4WZ5 C;  4FD8 A;  5J8X A;  1ONH A;  2ZM8 A;  4QU3 A;  2Y91 A;  4ZDX A;  4MBK A;  4OQH A;  1ES2 A;  3IF6 A;  1ERM A;  1MKI A;  3PAE A;  3A3E A;  3M6H A;  2WKI A;  3Q7V A;  4A5R A;  1FOF A;  2DNS A;  3DWK A;  3BFD A;  3NIA A;  1Q2P A;  3G2Y A;  3G4P A;  2ZM2 A;  3IXG A;  4OH0 A;  1HTZ A;  1IYS A;  1LL5 A;  3JYI A;  4IBX A;  2IWB A;  1XA1 A;  3BFE A;  3VMA A;  4RVA A;  3P09 A;  4UHU A;  4BD0 A;  1H8Y A;  4KG6 A;  1K57 A;  1DY6 A;  2Z2L B;  3HL9 A;  3SOI A;  2JCH A;  5E2E A;  3RJU A;  5HX9 A;  4OPQ A;  3C7V A;  5CRF A;  3Q07 A;  2JE5 A;  4LV0 A;  4DDS A;  5FI2 A;  2Q9M A;  5DVA A;  2WAF A;  5F82 A;  1XKZ A;  1E3U D;  4ZTK A;  2XFT A;  1PI5 A;  3MXS A;  5GHX A;  4FH4 A;  3E2K A;  3HLC A;  3Q82 A;  5AQ9 A;  4KQQ A;  4P85 A;  4OPY A;  5M19 A;  5F83 A;  3ZG7 B;  1BUE A;  3WS1 A;  5BOH A;  3AGD A;  1YMS A;  2WZX A;  3PBN A;  3CJM A;  1JWV A;  4X56 A;  5F1G A;  2WAE A;  1M40 A;  5FQK A;  1MBL A;  3OPR A;  3FKV A;  1K38 A;  3ITA A;  4OON A;  5AQ7 A;  3E2L A;  3GR2 A;  3WS4 A;  4N1X A;  1E3U A;  1YT4 A;  2WAD A;  4KZ4 A;  1TDL A;  3FYZ A;  3A3J A;  3OC2 A;  4QY5 A;  1G68 A;  4WEJ A;  1PZP A;  1JTD A;  3GSG A;  1EWZ A;  2VGK A;  3C5A A;  3W4Q A;  1I2W A;  1O07 A;  2X01 A;  3DWZ A;  1ONG A;  1BLP A;  4LCL A;  3MFD A;  4MLL A;  1GA0 A;  4LV3 A;  3C4P A;  3NY4 A;  3VP2 A;  1ESI A;  5EE8 A;  3NI9 A;  1BTL A;  1KGF A;  3M2K A;  3ZG0 A;  4S2M A;  1I2S A;  4KQR A;  5GL9 A;  1PI4 A;  1ESU A;  1PIO A;  3G35 A;  1K54 C;  2ZC4 B;  3PBO A;  4JXV A;  3UDX A;  4E3L A;  4QD4 A;  3QHY A;  4B4Z A;  3HLG A;  1M6K A;  4QY6 A;  3IT9 A;  4DDY A;  3UDF A;  3HUO A;  1G6A A;  2Y2I A;  3IHA A;  2XD5 A;  5A91 A;  5EPH A;  2EFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...