5FQMA

Last common ancestor of gram negative bacteria (gnca) class a beta- lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADWRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA BETA LACTAMASE
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqmA00
1S0WA 4N9LA 1I2WA 3ZGAB 4F94A 1YQSA 2HP6A 4C75A 1ESUA 1K38A 3NI9A 4KG5A 1RP5A 4S2NA 4X55A 5CHMA 1FR1A 4N1HA 3BFGA 4WZ4A 4GDNA 3HLDA 5AQBA 3V3RA 4C6YA 3DTMA 3HUMA 4JPMA 5M18A 5FQQA 5E2EA 4S2OA 4EV4A 1G6AA 2X02A 4OPQA 4BL3A 2Y2PA 3C4PA 2ZC5B 1MWSA 4FH4A 1BT5A 1XA7A 5KSHA 3ISGA 3HVFA 3G30A 3MXSA 4P85A 1XA1A 2J9OA 1YMXA 2V2FF 1MWRA 4UAAA 2XH9A 4S2KA 3NDEA 4R1GA 1L0FA 3M2JA 3W4OA 3FKVA 4KQRA 3UE3A 2HDUA 3OZHA 5FASA 3QNCA 5L2FA 2WKHA 2XFSA 2XFTA 3ZG7B 5CGXA 4ZDXA 4Y7PA 3FV7A 5HL1A 1NZOA 4GB7A 1K55C 1BULA 1N4OA 2WKEA 1MBLA 4L0LA 5CERA 3ZHHA 3VP1A 5F82A 1IELA 1YT4A 4OPZA 3A3EA 1ES3A 2DNSA 3WRZA 2V20A 1NXYA 1TDLA 2DRWA 2Y4AA 3IHBA 3UE0A 1YLZA 2R9WA 2XDMA 2HDQA 3IF6B 5U47A 3LCEA 4ZBEA 5JYOA 5A93A 1C3BA 1K55A 4B4ZA 4R0QA 4RA7A 5HARA 1ALQA 1PZOA 1TVFA 2EX2A 4U0TA 2Z2LB 1BLHA 1FSWA 5EVID 3A3FA 5DF9A 3FWLA 2P9VB 4ZAMA 5FAQA 3NBLA 3W4QA 2ZC7A 4ZJ1A 2FFYA 1CK3A 3PBQA 4RX3A 5DTKA 4KQOA 2GDNA 5CGSA 3UPNA 1KVLA 1XKZA 2XGNA 4BENA 4S2IA 2HP5A 2WGVA 2Y2QA 5DVAA 4ZJ3A 5DTSA 5HW3A 1LHYA 4E3JA 4EBPA 4IVKA 4OPRA 3CMZA 4LCMA 4DE1A 4DXBA 3WRTA 5E2HA 4OOMA 3UDFA 2C6WB 4OQIA 4LV3A 1SKFA 4JXGA 4PM7A 1O7EA 1KDWA 2H0YA 4JF6A 1GCEA 4NK3A 2ZD8A 2WGWB 5EVIB 2IWCA 1FSYA 3Q7VA 2OV5A 1FQGA 4JF4A 3DWZA 3G4PA 4FCFA 2BG1A 1WYCA 1K4FA 3RXWA 3WS0A 1W7FA 3C4OA 1PWGA 4X68A 1NY0A 3TOIA 1HD8A 3WS4A 3C7VA 3VP3A 3FZCA 3G35A 3IXDA 4QHCA 4DE3A 3C7UA 2Z2MB 5HAPA 3MZDA 2EX6A 4XUXA 4B88A 3AGDA 1RCJA 1M40A 2XR0A 1MWUA 4RYEA 3SH8A 4GDBA 3ZG0A 3A3DA 2ZQAA 3OPRA 4KZ4A 1SHVA 4HEFA 3BFFA 5HFOA 4GKUA 4RX2A 1IKIA 4E6WA 4X53A 5GHZA 2Y2JA 2WK0A 3PBSA 5F1GA 2JCHA 4BL2A 3BFCA 3OCNA 1K6RA 5TGFA 5CTNA 2VGKA 1VM1A 1JWZA 4DDYA 4CJNA 3Q82A 3G34A 2Y59A 4JXVA 4QD4A 5JYPA 4PPRA 4P0MA 1YLWA 3IXBA 2P9VA 3V50A 4WM9A 1ZKJA 1FCMA 3MBZA 3A3IA 2DCFA 5CRFA 1H8ZA 2EFXA 3HLBA 1WYBA 1YLPA 4R3BA 1NJ4A 1W8YA 4E3IA 5KSCA 4MBFA 2HPBA 4E3OA 2Y2GA 3RJUA 4WMCD 4JBFA 1K6SA 2JBFA 4U0XA 5G18A 2C5WB 3P09A 4GD8A 2RCXA 5F83A 4BQMA 1IKGA 4KZ7A 4EUZA 3PTEA 3SH9A 1OMEA 2A3UA 4FH2A 4IEDA 2ZM8A 2WGIA 4DF6A 1SCWA 3GQZA 1CI9A 1H8YA 2G2WA 2QMIA 3PBOA 5FSRA 5DF8A 3VOZA 3MZFA 5FDHA 3ITAA 4KZ9A 3DWKA 2WGWA 1RGZA 4CPKA 3D4FA 1NYMA 3OPHA 5M19A 1YM1A 2P74A 3CJMA 3NCKA 1PWCA 1K56A 2JC7A 3P98A 4P87A 2EXBA 1JWPA 4OOYA 4QB8A 2J9PA 4OH0A 2X01A 3DW0A 4ZTKA 2XLNA 4U3TA 3ZNYA 4LENA 1HTZA 4MBHA 1BLCA 1GA9A 3VP4A 1KE0A 4HBTA 3O88A 3ZG5A 4GZBA 1U60A 4N1XA 3HUOA 4MEZA 1YLYA 3VSKA 3I7JA 5F1FA 3HLGA 2PBYA 1KVMA 1MWTA 4QU3A 4OP5A 3MXRA 3LEZA 3ZCZA 1XGIA 4KENB 4OQGA 5FI7A 2ZQ8A 3OC2A 4S2LA 3SS5A 3NC8A 4IVIA 1NZUA 3V39A 1TEMA 1ZG6A 3S22A 3VFFA 1DJBA 2PU2A 3N8LA 2CC1A 4X6TA 5CGWA 1E3UA 5EE8A 5FQJA 1HVBA 3GRJA 4KZ8A 3ZNTA 2XEPA 4FD8A 3N4IA 3UE1A 4YFMA 1KE4A 4MLLA 3HUNA 2JE5A 1MPLA 4DRTA 3HLFA 2XD5A 4NETA 1G68A 4XUZA 1KGFA 5M1AA 4DXCA 4QJGA 4OQ0A 5CEDA 1ESIA 1XGJA 1QMEA 3O86A 4D2OA 4N9KA 5CECA 3VP2A 3HLEA 1Q2QA 1FOFA 2EFUA 2ZM2A 3ZG9B 1KE3A 4JXSA 5EECA 3UDIA 3ZVWA 3SH7A 4R23A 4WZ5A 4R4SA 1H5XA 1EI5A 3BYDA 1JTGA 3UY6A 5AQ9A 3S1YA 5CHUA 1JVJA 4PMAA 4BJPA 3Q1FA 4Y0UA 1FR6A 1K57A 5FA7A 2HP9A 3ITBA 5DF7A 3W8KA 1LL9A 1Z6FA 3NY4A 4IBRA 2ZM0A 4OOLA 4S2JA 5CTMA 4E3MA 4DE0A 4JXWA 2ZJ9A 5HAIA 2VGJA 5EOEA 5D3OA 2XF3A 1LL5A 2OSUA 4E3KA 5FATA 1DJCA 1FCNA 2ZQDA 4K0XA 4UA7A 3AGFA 4A5RA 1ES2A 4EBNA 3N7WA 1BSGA 3Q07A 1M6KA 3BEBA 5E2FA 1WE4A 3IF6C 4ID4A 2ZLYA 3EQUA 1IYPA 1BUEA 3O87A 5A90A 3RXXA 1RGYA 2V1ZA 5GL9A 1L0EA 1NYYA 2QZ6A 3WWXA 5KZHA 3BM6A 3TG9A 3LO7A 3Q81A 4KG2A 3HL9A 2H5SA 2J7VA 2BLSA 4PM6A 5FI6A 3V3SA 3VOYA 1BLSA 4Y0OA 2XQZA 2ZQCA 2OLVA 2PU4A 1IEMA 4PM8A 3MFDA 3IF6A 4H8RA 4OKPA 1E25A 3G2YA 5FAOA 3UPOA 2Y2OA 5IHVA 3PAGA 4E3NA 5A92A 4P6BA 4K91A 1PZPA 3WS1A 5CXWA 1K4EA 4GD6A 4S2PA 3GSGA 3IF5A 3NIAA 2Q9MA 2OLUA 4B4XA 4PM5A 2WZXA 1L0DA 1PWDA 1DJAA 3MKEA 4RVAA 5GHXA 5GLDA 3SOIA 3TSGA 3OPPA 4DKIA 4GNUA 1AXBA 1MKIA 4JKTA 1S6RA 3BFDA 3VMAA 4WYYA 4OP8A 3SS3A 4OLGA 1ZC2A 3BLMA 5EVIC 3BFEA 3VFHA 4E3LA 1BZAA 3GVBA 4QY5A 4YINA 5TFQA 3B3XA 5E2GA 3PAEA 3SS4A 1SDEA 3CG5A 2UWXA 4Q8IA 2B5RA 2WAEA 3GR2A 5DTTA 1YLJA 3CZDA 2EX8A 2ZQ9A 5EOOA 2X71A 4KQQA 3E2KA 5EVIA 1VQQA 3HLCA 4BD0A 4BLMA 3ZG8B 3GV9A 1NRFA 1JWVA 2WUQA 3FYZA 3UDXA 3UO9A 4OONA 2Y2LA 1KGGA 5HX9A 1CEFA 5CHJA 3M2KA 3Q7VB 1W8QA 4N92A 3W4PA 5GHYA 4PM9A 5FI2A 4OLDA 3LY4A 4GOGA 3BRMA 4WEKA 3V5MA 2WAFA 2ZC6B 1JTDA 2G2UA 1XXMA 4BD1A 1FCOA 2EX9A 4LV2A 2I72A 2H10A 4S2MA 1IYQA 4OQHA 3ZFZA 1SDNA 1TDGA 3HBRA 4MBKA 4UA6A 4R4RA 3VP0A 2J8YA 1L2SA 3IXGA 2HDRA 2RL3A 5FQ9A 4JLFA 1LLBA 5EVLA 3C5AA 4MNRA 1GHMA 5CEBA 3HLWA 1PI5A 1E4DA 4HESA 4X69A 1YMSA 1EWZA 1KGEA 3QNBA 1BLPA 2ZMAA 2XK1A 1PYYA 1XP4A 4E6XA 5TR7A 3IWIA 4WZ5C 3NDGA 2QPNA 3ZVTA 3OCLA 2Y2NA 5AQ7A 5EUAA 5FQIA 4X56A 1LI9A 3A3JA 4GN2A 5E43A 1K57C 1GHIA 5FAPA 3N8RA 2A49A 4K0WA 4LV0A 1ERQA 3PBNA 3M6BA 2H0TA 3IWOA 5GLCA 4KZBA 4KZ6A 5GLAA 2HDSA 3UPPA 5HAQA 5FQMA 2ZC3B 5FQKA 1K56D 4EWFA 3ZDJA 3IWQA 2WYXA 3IH9A 3JYIA 3N6IA 3BLSA 2ZC4B 4QY6A 4KZAA 5KMWA 3IHAA 4XXRA 1O07A 3BECA 1Q2PA 3N8SA 2WZZA 1DY6A 3M6HA 2R9XA 4ZJ2A 2ZQ7A 2WKIA 5I94A 1GA0A 1MXOA 4OVDA 3S4XA 4UHUA 4EQIA 3IT9A 4DE2A 3MZEA 3IH8A 1ES5A 4WELA 4Y0TA 4LV1A 1I5QA 4C3QA 5A91A 1PW1A 2Y2MA 5AQAA 4Z9QA 1K54C 5J8XA 1PW8A 1KDSA 4DDSA 1HZOA 1ZG4A 2IWDA 1ONHA 4KG6A 3LY3A 3UNWA 4WMCA 3E2LA 3AGEA 3PBTA 2Y2HA 1L0GA 2Q9NA 4KZ3A 1CI8A 4OPYA 3GMWA 2FFFB 1E3UD 3QHYA 2WADA 3Q7ZA 4M3KA 1PIOA 2Y55A 3WS5A 3G32A 1K54A 1XPBA 1Y54A 2XD1A 4R3JA 3VSLA 4EBLA 1BTLA 2EXAA 2IWBA 1GHPA 3PBRA 1EROA 5EPHA 1IYOA 3OPLA 1ERMA 1W5DA 3GTCA 1CEGA 3G2ZA 1N9BA 1ONGA 1YLTA 4HBUA 3HREA 3UN7A 2Y2IA 3O3VA 3IQAA 2Y91A 3G31A 4WBGA 4UA9A 4FSFA 1J9MA 1PI4A 3FKWA 1MY8A 4WEJA 3MKFA 3EQVA 4S2NC 3IXHA 3WS2A 1I2SA 1ES4A 4JF5A 4KZ5A 1QMFA 4IBXA 1K25A 4O7DA 2Y2KA 5GLBA 1XX2A 2E8IA 5BOHA 1IYSA 1W79A 1LI0A 4LCLA
chains in the Genus database with same CATH superfamily
4G3VA 1I2WA 2HP6A 1ESUA 5CHMA 1RP5A 3S7OA 4C6YA 3HLDA 3V3RA 3CUEC 1OTBA 3HUMA 5M18A 4EQ1A 1KOUA 2ZC5B 5KSHA 1XA7A 1YSQA 4H6JA 3G30A 3T1XA 4R70A 1XA1A 4R1GA 3OZHA 5L2FA 2XFSA 3KSIA 1K55C 5CERA 4HH2A 2V20A 1NXYA 3IHBA 3UE0A 2XDMA 3MJQA 5HDSA 2ZMFA 3OBFA 4WN5A 3RTYA 5A93A 1C3BA 4R0QA 4MDZA 5EVID 3A3FA 1A0KA 3SW1A 4HJ3A 2ZL1A 5DTKA 3T50A 2J80A 2XGNA 5DVAA 4ZJ3A 5DTSA 1LHYA 3H82A 3WRTA 2HF6A 5IU1A 1OPXA 2ZD8A 1L3LA 3DWZA 2JKRI 2BG1A 1WYCA 3WS0A 1PWGA 4X68A 3TOIA 3LR4A 3VP3A 3FZCA 4DE3A 4QHCA 4B88A 5TBMA 3EGDC 4DN0A 1MWUA 2FH5A 4RYEA 3SH8A 2V0WA 3ZG0A 3MXQA 5FEGA 3TW8A 2WK0A 3PBSA 4X1MA 2JCHA 3BFCA 4GLQA 1YSPA 3Q82A 4I38A 1YLWA 2P9VA 4WM9A 1FCMA 3A3IA 4E04A 2EFXA 2HJ9C 3MQ0A 3S7PA 4WMCD 1FIKA 1K6SA 2JBFA 4JBFA 2C5WB 4GD8A 3T4KA 4FH2A 2ZBBA 4DF6A 3D72A 1CI9A 2G2WA 5FSRA 5FDHA 2W1RA 3ITAA 5FDSA 3DWKA 2WGWA 5L8MA 1NYMA 1PRQA 5M19A 1PWCA 2JC7A 4P87A 3E4QA 3QP5A 2X01A 4UQIM 4U3TA 3ZNYA 2VKSA 2QJ5A 3ZG5A 4YNRA 4II7A 4R3AA 5G4YA 5F1FA 1F98A 2PBYA 3LEZA 1F9IA 3ZCZA 1XGIA 4KENB 5AVFA 4IUKA 4S2LA 1NZUA 3PHYA 1TEMA 1ZG6A 3S22A 1DJBA 2CC1A 4KZ8A 4FD8A 3N4IA 3UE1A 3LR3A 4DRTA 2IA2A 1F2KA 4DXCA 1XFNA 4QJGA 3O86A 3NJAA 4N9KA 5CECA 3HLEA 3ZVWA 2ZM2A 5HDCA 1KE3A 3SH7A 4HOIA 4R4SA 4WZ5A 1EI5A 4F3LB 5AQ9A 5CHUA 1JVJA 3LIAA 2QYBA 3C30A 2OAQ1 1K57A 5FA7A 4E3MA 2ZM0A 5LBRA 5J7EA 5FATA 3E4OA 2ZQDA 4EBNA 1WE4A 3LIFA 2ZLYA 3O87A 1IYPA 1BUEA 1LT0A 2V1ZA 5GL9A 3WWXA 2ZOHA 3P7NA 5KZHA 3BM6A 3TG9A 2J7VA 2BLSA 1WA9A 4MN7A 4PM8A 3MFDA 5FAOA 3BY9A 2LB5A 3LR5A 4K91A 3GSGA 4ETZA 2JKTM 3T1SA 3NIAA 2Q9MA 4PM5A 2A24A 3SOIA 5GLDA 3OPPA 4I3IA 1MKIA 3BFDA 4GJ4A 4WYYA 1MZUA 1Y28A 3SS4A 3V67A 2UWXA 4Q8IA 3GR2A 3F1PB 3KSFA 4IUHA 3CZDA 2ZQ9A 2W1TA 2M1CA 2VZWA 3E2KA 3HLCA 1YAXA 1N9LA 2W0NA 2Y2LA 1CEFA 5CHJA 3Q7VB 3EWKA 4N92A 5GHYA 4OLDA 4GOGA 4WEKA 3V5MA 4BD1A 4S2MA 4OQHA 2J3TC 2O99A 1SDNA 1TDGA 4UA6A 2J8YA 1GHMA 4Y2FA 1E4DA 1GSWA 2VV8A 1P9WA 2ZMAA 1TS7A 1PYYA 1XP4A 3OCLA 2Y2NA 5AQ7A 3HJKA 3A3JA 3N8RA 3IWOA 1XJ6A 3UPPA 5FQMA 1K56D 3ZDJA 3IH9A 1N9OA 3UB6A 4XXRA 3R4KA 5EVEA 2L0WA 3S4XA 1ES5A 1T1AA 4LV1A 4H6JB 5F68A 5A91A 4Z9QA 1KDSA 1ZG4A 2IWDA 1ONHA 2WKRA 3UNWA 2Q9NA 4KZ3A 3QHYA 4NXEA 3Q7ZA 1PIOA 3WS5A 2YKHA 1K54A 1XPBA 4ME4A 3VSLA 2VJWA 1BTLA 3PBRA 1IYOA 1W5DA 3IS2A 3G2ZA 3B42A 3IQAA 3ULFA 3G31A 3UE6A 3UB9A 1MY8A 4S2NC 3BW6A 2Y2KA 1IYSA 2VEAA 3TJZC 3H82B 1S0WA 5F6AA 3ZGAB 4F94A 1YQSA 4B93A 4C75A 4F3LA 1MC0A 4IJGA 3T4SA 2I9VA 4KG5A 4X55A 4N1HA 4WZ4A 4GDNA 1DP9A 1UWPX 4JPMA 5FQQA 1G6AA 1OTDA 2Y8HA 2Y2PA 2EA9A 1J3WA 3HVFA 1YMXA 2V2FF 2XH9A 4S2KA 3W4OA 2J3WA 2HDUA 5TBMB 2K2NA 2WKHA 5CGXA 4GB7A 4G3KA 1N4OA 4L0LA 3WRZA 1T19A 2Y4AA 2V8CA 5C5KA 3LCEA 3R7WA 4HJ6A 4RA7A 1TVFA 1OT6A 2DMWA 2Z2LB 2PD8A 3FWLA 2P9VB 4P6ZM 5FAQA 5F5YA 4ZJ1A 3L7HA 2FFYA 3PBQA 4O8GA 2GDNA 5CGSA 3UPNA 1XKZA 4AFIA 2HP5A 2WGVA 4Y13A 3F1OB 4LCMA 3F1PA 2BASA 4DXBA 5E2HA 4OOMA 1SKFA 5IT5A 4PM7A 1K0KA 4JF6A 2WGWB 5EVIB 1FSYA 3Q7VA 3NOTC 2OV5A 2K31A 1FQGA 4ARZB 3G4PA 4FCFA 1K4FA 4Q0JA 3RXWA 3C4OA 2J3TD 5DJUA 1HD8A 4YWZA 3WS4A 3C7VA 3KYEA 3MZDA 4JGOA 4XUXA 3AGDA 1M40A 2XR0A 2ZQAA 1SHVA 2W27A 5HFOA 3BFFA 4E6WA 4LPZA 5GHZA 3OLOA 5DJTA 3OCNA 5CTNA 2VGKA 1CJFA 4CJNA 3CLOA 4BBVA 4JXVA 4QD4A 5JYPA 4PPRA 3T4OA 4L9FA 3MR0A 4P0MA 2LB9A 2HV1A 2PRFA 3HLBA 1WYBA 3PXPA 4R3BA 1NJ4A 4MBFA 2HPBA 3FPWA 3P09A 4BQMA 5F83A 1IKGA 2QKPA 3SH9A 2JN7A 2WGIA 2VV6A 1ZTUA 2W3FA 1H8YA 5HSQA 3VOZA 5J4EA 3CPTB 4KZ9A 3IBRA 3D4FA 4PKYA 1YM1A 3CJMA 3NCKA 4EU0A 2EXBA 3D9YA 1JWPA 3T1QB 4OOYA 2J9PA 4ZTKA 1SKOB 1HTZA 4MBHA 4HBTA 1OJGA 4BMWA 4N1XA 4I3AA 4MEZA 2D01A 3I7JA 4EUVA 4QU3A 1MWTA 3MXRA 1NLZA 5DKKA 3DAVA 2B02A 3SS5A 2A24B 1F5MA 1CF0A 4X6TA 1E3UA 3K3DA 3ZNTA 4MCWA 4MN5A 3VE3A 4YFMA 5A8BA 4K08A 4NETA 3HLFA 5CEDA 5K5BA 1QMEA 4D2OA 3C8CA 5I5LA 2D02A 3UDIA 2W1TB 4R23A 3BYDA 3UY6A 3S1YA 3LI8A 4O0PA 2HP9A 4DJ3A 5DF7A 1S1ZA 2P7JA 1Z6FA 4OOLA 4R38A 4HP4A 4KUOA 5HAIA 2XF3A 2OSUA 1DJCA 4UA7A 4A5RA 1BSGA 5E2FA 3BEBA 4ID4A 3IF6C 1RGYA 3LO7A 3JVUA 4CLCC 4Y0OA 3RFBA 2PU4A 1IEMA 3UPOA 2Y2OA 3PAGA 1PZPA 3WS1A 1K4EA 4WUJA 1OTIA 5G4ZA 2OLUA 2WZXA 2Y79A 1DJAA 4DKIA 3TSGA 3VMAA 1XJ4A 1OTAA 3SS3A 4E3LA 3VFHA 3F1OA 2XA7S 3GVBA 4QY5A 4YINA 4LLOB 3B3XA 5E2GA 4B9OA 4KUKA 1UWNX 1YLJA 2KX6A 5EVIA 3JPUA 3GV9A 1NRFA 4ARZA 5HL6A 3UMEA 1ACFA 1KGGA 2PR6A 5FI2A 1XXMA 1TS8A 2EX9A 3ZFZA 1IYQA 3DTIA 2HDRA 3IX3A 3C5AA 2V1AA 3HLWA 4EEUA 1PI5A 3IS2B 3O5YA 1EWZA 1BLPA 4CQHA 2W3GA 2XK1A 3LFVA 2QPNA 4NKPA 5EUAA 5FQIA 2V1BA 4X56A 5E43A 5FAPA 1GHIA 3EGXC 4HNBA 3M6BA 2H0TA 5GLCA 5GLAA 3TRCA 4BBUA 5L07A 5HAQA 2ZC3B 2O9AA 4EWFA 3K2NA 3IWQA 5KMWA 4QY6A 3BLSA 3IHAA 3BECA 3N8SA 2WZZA 5KIZA 1DY6A 4YOFA 4P6ZS 1AWIA 5HWTA 5I94A 1GA0A 1MXOA 1VEUB 4OVDA 4EEPA 3K3CA 4EQIA 3CPTA 1G6OA 4C3QA 2EWWA 5AQAA 4D60A 3MS6A 4WMCA 1SKOA 1LSXA 1ZHHB 3PBTA 3S7NA 2Y2HA 1L0GA 3NOUC 4BBTA 1CI8A 5L09A 3EOIA 2Y55A 3G32A 1Y54A 2XD1A 1GHPA 5EV0A 3R7WB 1ERMA 1ONGA 3QP1A 3O3VA 3MQOA 4WBGA 2V9AA 3H9WA 4UA9A 4FSFA 2HGVA 1IFQA 3WS2A 3IXHA 4JF5A 1QMFA 2FZ0A 1K25A 2E8IA 1W79A 2JKFA 1LL8A 2YKFA 3PAEA 1LI0A 1YKDA 2PBDP 1LSVA 2M7UA 3MFXA 3NI9A 5AQBA 3BFGA 5E2EA 4EV4A 3BQ8A 4OPQA 4BL3A 5HDDA 2XROA 3KYQA 3C4PA 1BT5A 3W2ZA 3ISGA 2JKRM 3MMHA 5DKLA 2B95A 2J9OA 3P01A 1MWRA 4UAAA 3CUEA 2ZOIA 1L0FA 1XJ3A 3M2JA 3UE3A 3QNCA 4R6LA 4CLCD 1STZA 4Y7PA 5HL1A 1NZOA 1BULA 4RQ9A 3MSHA 4JGRA 1ES3A 2DNSA 4FUWA 3JVVA 3VE4A 2R9WA 4GHIA 2HDQA 4ZBEA 5JYOA 1T18A 1K55A 5HARA 1ALQA 1PZOA 4Q0HA 4U0TA 1BLHA 5DF9A 3LUQA 4ZAMA 3ZYTA 3NBLA 2ZC7A 1NWZA 4RX3A 1CK3A 2M7VA 4KQOA 5FEFA 4BENA 4S2IA 2Y2QA 4PAUA 5HD5A 4EBPA 1ODVA 4OPRA 4DE1A 2A2LA 3UDFA 5L10A 1O7EA 1S67L 2IWCA 1VETA 4NXFA 3OOVA 5MC7A 3G35A 3C7UA 2Z2MB 5HAPA 2EX6A 1RCJA 2KOIA 4FTXA 3OPRA 4LRXC 2Q0OA 4NG2A 1IKIA 4RX2A 1OT9A 2GJ3A 2PT7A 5F1GA 2INWA 5TGFA 1K6RA 1VM1A 1JWZA 3CI6A 3A0VA 4CLCA 3V50A 1ZKJA 1V9YA 2DCFA 3IX8A 3T4QA 5KSCA 4E3OA 3RJUA 5G18A 4KZ7A 3E4PA 1W63Q 1OMEA 1VEUA 3GDIA 4IEDA 2ZM8A 5DFXA 5HPFA 1SCWA 3GQZA 2Z6CA 5DF8A 4HI4A 3OPHA 3BY8A 3U4LP 1K56A 3P98A 3LIEA 4OH0A 2XLNA 1BLCA 1GA9A 5J3WA 1KE0A 3O88A 4GZBA 1UGUA 2VV7A 3HLGA 4OP5A 4UQIS 3LIDA 4I39A 4OQGA 2VLGA 4LGWA 1LSWA 4M4XA 5FI7A 2V8FA 3V39A 3BWLA 3ICYA 2PU2A 5CGWA 5EE8A 2XEPA 3FPVA 1KE4A 3HUNA 4FOFA 1MPLA 1H3QA 1G68A 1H8MA 2OWHA 1XGJA 4HIAA 4BWIA 3MF0A 4HY8A 3ZG9B 4JXSA 4XT2A 1H5XA 4PMAA 4Y0UA 3ITBA 3W8KA 3NY4A 4S2JA 3LYXA 3H7WA 5D3OA 4E3KA 4MN6A 1FCNA 3IBJA 3AGFA 3FC7A 3N7WA 3Q07A 3F1NA 2XSSA 3G6OA 4JGQA 3RXXA 1NYYA 2QZ6A 4Y5FA 3Q81A 3HL9A 2H5SA 3VOYA 3V3SA 5FL3A 4L9GA 2ZQCA 1D06A 2OLVA 1XFQA 4H8RA 4OKPA 3VV4A 1E25A 3T12B 4EERA 1DRMA 4E3NA 5A92A 3U2AA 5CXWA 1D1JA 4B4XA 1L0DA 3MKEA 1EW0A 5GHXA 4Q0IA 4GNUA 1AXBA 4JKTA 1S6RA 2JHEA 2MJ6A 4OP8A 1ZC2A 3DTKA 5TFQA 2BTFP 1SDEA 2GZAA 2B5RA 2WAEA 5DTTA 2XRNA 3T1RA 3LR0A 4KQQA 4BD0A 3L9KA 1JWVA 2WUQA 3FYZA 3UDXA 4OONA 2NUPC 3E98A 1W8QA 5HWWA 3D3OA 4PM9A 1VHMA 3LY4A 3LICA 2WAFA 2ZC6B 1JTDA 1PNEA 3DBAA 3HBRA 3LI9A 3VP0A 1L2SA 5FQ9A 1DP6A 2RL3A 1LLBA 2VGLM 4MNRA 4HH3A 5CEBA 2L4RA 4HESA 1VB6A 2NUTC 4PKYG 1KGEA 3QNBA 5TR7A 3NDGA 2JKTI 5F69A 5EFWA 1LI9A 1X0OA 4K0WA 1ERQA 3C2WA 3PBNA 4KZBA 4KZ6A 2HDSA 2CMNA 5IS1A 5FQKA 3JYIA 3N6IA 4KZAA 1O07A 4WF0A 3M6HA 2R9XA 2ZQ7A 2PD7A 4UHUA 1TD5A 2QHKA 4DE2A 3MZEA 2VK3A 2Y2MA 1XJ2A 4DMZA 1K54C 5J8XA 1PW8A 4DDSA 1HZOA 4KG6A 3E2LA 3AGEA 1OJ5A 3QP2A 2O9BA 3GMWA 2B18A 2WADA 4GS9B 4M3KA 4R3JA 3B47A 5AVEA 4GHIB 3NULA 5EPHA 3BQAA 3OPLA 3GTCA 3NOPC 5HPIA 4HQAA 5HD3A 3HREA 4ZRRA 3UN7A 1NRJA 3FKWA 3MKFA 2PHYA 2PAVP 1JNUA 4O7DA 3EEAA 5GLBA 1XX2A 1Z09A 3KSGA 3C38A 4LCLA 1HLUP 4N9LA 1D7EA 5EM1A 1K38A 3KYZA 4S2NA 4L9EA 1FR1A 3DTMA 3HCYA 1P9RA 4S2OA 4Z1WA 2X02A 1VETB 4KQDA 1MWSA 4FH4A 3QP6A 1TS0A 2WKQA 3MXSA 4P85A 3NDEA 3EEHA 3FKVA 4KQRA 5FASA 3ZG7B 4ZDXA 2XFTA 2W3HA 4LRZE 3FV7A 2KLIA 3LGOA 2WKEA 1G5UA 1MBLA 2L1MA 3ZHHA 3VP1A 5F82A 1IELA 1YT4A 4OPZA 3A3EA 2DRWA 1TDLA 1YLZA 3IF6B 4HHDA 5U47A 3VOLA 3MQQA 4B4ZA 2EX2A 1FSWA 4CLCB 3PR6A 4MMNA 3W4QA 2OOLA 2W3DA 4EETB 1KVLA 5HW3A 4E3JA 4IVKA 3CMZA 2P04A 2OAP1 4HP9A 2C6WB 4X25A 1IOUA 4OQIA 4LV3A 3QP4A 4JXGA 3CWFA 1KDWA 2H0YA 1GCEA 4NK3A 4NXBA 1T1BA 2Z6DA 4JF4A 3KO6A 1W7FA 1NY0A 1BYWA 3IXDA 1YPRA 1W63M 4NEED 3NECA 4LRYC 4GDBA 2HZ5A 3A3DA 2PYRA 3A0RA 4KZ4A 5TJJA 1GSXA 4HEFA 4GKUA 4I5SA 3KX0X 4NXGA 4X53A 2Y2JA 5EM0A 3PYPA 4BL2A 3DTEA 4DDYA 3G34A 2Y59A 3B33A 3IXBA 3CHWP 4EESA 3MBZA 5CRFA 1H8ZA 4X1LA 1YLPA 1W8YA 4E3IA 2Y2GA 4U0XA 2JKGA 4XT2B 2RCXA 4JGPA 4EUZA 3PTEA 3T4LA 3TE8A 2A3UA 2EWVA 4HJ4A 3BJNA 3RH8B 3UB5P 2QMIA 3PBOA 1V9ZA 3H7WB 3MZFA 2GNXA 2O0YA 1RGZA 4CPKA 4ETXA 2P74A 3F1NB 4QB8A 4EXOA 3DW0A 4GS9A 4LENA 1SZVA 4Y15A 3VP4A 4WLAA 1U60A 3HUOA 1YLYA 3VSKA 1KVMA 3A0SA 3IX4A 1PFLA 2PDRA 2ZQ8A 3OC2A 3NC8A 4IVIA 3VFFA 5FQJA 3N8LA 2VX8A 2VGLS 5CX7A 1HVBA 3GRJA 4O01A 4MLLA 2JE5A 2PYPA 2XD5A 5M1AA 4XUZA 1KGFA 2K7SA 4OQ0A 1ESIA 1OTEA 1TF1A 3VP2A 1N9NA 1FOFA 1Q2QA 2EFUA 2R78A 5EECA 4Y17A 2QJ7A 2PR5A 2VA0A 1JTGA 1S4RA 4BJPA 3Q1FA 1FR6A 4EW7A 1LL9A 3GECA 4IBRA 5CTMA 4DE0A 4JXWA 2ZJ9A 2VGJA 5EOEA 1LL5A 3HJIA 4K0XA 1ES2A 4PHTA 1M6KA 2QWSA 1Y4OA 3EQUA 5HWVA 2G7UA 3UB8A 5A90A 1DP8A 1L0EA 2W3EA 1FILA 4DJ2A 4LFUA 4KG2A 3KSHA 5FI6A 4PM6A 1BLSA 3LEQA 2XQZA 1H0MA 3IF6A 3G2YA 5IHVA 1MKMA 4P6BA 4GD6A 4S2PA 3IF5A 3UMDA 2XA7M 4WL9A 5HZHA 4RVAA 4GW9A 1PWDA 1P97A 3LIBA 4G3WA 4OLGA 5EVIC 3BLMA 3BFEA 1BZAA 2ZL1B 2ACGA 3S7QA 3CG5A 1S1YA 2EX8A 5EOOA 2WKPA 2X71A 3ZQ5A 1VQQA 5DFYA 4BLMA 3ZG8B 4CLCE 2P08A 3UO9A 2E8JA 5HX9A 3M2KA 3W4PA 3T4JA 3BRMA 2G2UA 1FCOA 4LV2A 2I72A 2H10A 2UV0E 4MBKA 3T4TA 4R4RA 3IXGA 4JLFA 5EVLA 2OWJA 2KDKA 4X69A 1YMSA 4ESPA 2ZMVA 4E6XA 4QWOA 3IWIA 4WZ5C 3ZVTA 1GSVA 1NLYA 4GN2A 1K57C 4UEYA 2A49A 2AVXA 4LV0A 3QP8A 2V0UA 1CQAA 3SZTA 2WYXA 2ZC4B 1Q2PA 2GX5A 4ZJ2A 2WKIA 3IT9A 3IH8A 4Y0TA 4WELA 4IHQA 1I5QA 1PW1A 1G28A 3NHQA 3LY3A 4GCZA 1T1CA 4OPYA 2FFFB 1E3UD 1P0ZA 3CITA 4EBLA 3E0YA 2EXAA 2O9CA 2HJEA 2IWBA 1S66L 1EROA 2H28A 4I3JA 1CEGA 1N9BA 1YLTA 4HBUA 3CAXA 4QPRA 1S4SA 2Y2IA 3FG8A 2Y91A 5AJGA 1J9MA 1PI4A 4WEJA 3EQVA 1TS6A 3UB7A 1I2SA 4Y3IA 1ES4A 4KZ5A 4IBXA 5BOHA
chains in the Genus database with same CATH topology
1S0WA 4N9LA 1I2WA 3ZGAB 4F94A 1YQSA 2HP6A 4C75A 1ESUA 1K38A 3NI9A 4KG5A 1RP5A 4S2NA 4X55A 5CHMA 1FR1A 4N1HA 3BFGA 4WZ4A 4GDNA 3HLDA 5AQBA 3V3RA 4C6YA 3DTMA 3HUMA 4JPMA 5M18A 5FQQA 5E2EA 4S2OA 4EV4A 1G6AA 2X02A 4OPQA 4BL3A 2Y2PA 3C4PA 2ZC5B 1MWSA 4FH4A 1BT5A 1XA7A 5KSHA 3ISGA 3HVFA 3G30A 3MXSA 4P85A 1XA1A 2J9OA 1YMXA 2V2FF 1MWRA 4UAAA 2XH9A 4S2KA 3NDEA 4R1GA 1L0FA 3M2JA 3W4OA 3FKVA 4KQRA 3UE3A 2HDUA 3OZHA 5FASA 3QNCA 5L2FA 2WKHA 2XFSA 2XFTA 3ZG7B 5CGXA 4ZDXA 4Y7PA 3FV7A 5HL1A 1NZOA 4GB7A 1K55C 1BULA 1N4OA 2WKEA 1MBLA 4L0LA 5CERA 3ZHHA 3VP1A 5F82A 1IELA 1YT4A 4OPZA 3A3EA 1ES3A 2DNSA 3WRZA 2V20A 1NXYA 1TDLA 2DRWA 2Y4AA 3IHBA 3UE0A 1YLZA 2R9WA 2XDMA 2HDQA 3IF6B 5U47A 3LCEA 4ZBEA 5JYOA 5A93A 1C3BA 1K55A 4B4ZA 4R0QA 4RA7A 5HARA 1ALQA 1PZOA 1TVFA 2EX2A 4U0TA 2Z2LB 1BLHA 1FSWA 5EVID 3A3FA 5DF9A 3FWLA 2P9VB 4ZAMA 5FAQA 3NBLA 3W4QA 2ZC7A 4ZJ1A 2FFYA 1CK3A 3PBQA 4RX3A 5DTKA 4KQOA 2GDNA 5CGSA 3UPNA 1KVLA 1XKZA 2XGNA 4BENA 4S2IA 2HP5A 2WGVA 2Y2QA 5DVAA 4ZJ3A 5DTSA 5HW3A 1LHYA 4E3JA 4EBPA 4IVKA 4OPRA 3CMZA 4LCMA 4DE1A 4DXBA 3WRTA 5E2HA 4OOMA 3UDFA 2C6WB 4OQIA 4LV3A 1SKFA 4JXGA 4PM7A 1O7EA 1KDWA 2H0YA 4JF6A 1GCEA 4NK3A 2ZD8A 2WGWB 5EVIB 2IWCA 1FSYA 3Q7VA 2OV5A 1FQGA 4JF4A 3DWZA 3G4PA 4FCFA 2BG1A 1WYCA 1K4FA 3RXWA 3WS0A 1W7FA 3C4OA 1PWGA 4X68A 1NY0A 3TOIA 1HD8A 3WS4A 3C7VA 3VP3A 3FZCA 3G35A 3IXDA 4QHCA 4DE3A 3C7UA 2Z2MB 5HAPA 3MZDA 2EX6A 4XUXA 4B88A 3AGDA 1RCJA 1M40A 2XR0A 1MWUA 4RYEA 3SH8A 4GDBA 3ZG0A 3A3DA 2ZQAA 3OPRA 4KZ4A 1SHVA 4HEFA 3BFFA 5HFOA 4GKUA 4RX2A 1IKIA 4E6WA 4X53A 5GHZA 2Y2JA 2WK0A 3PBSA 5F1GA 2JCHA 4BL2A 3BFCA 3OCNA 1K6RA 5TGFA 5CTNA 2VGKA 1VM1A 1JWZA 4DDYA 4CJNA 3Q82A 3G34A 2Y59A 4JXVA 4QD4A 5JYPA 4PPRA 4P0MA 1YLWA 3IXBA 2P9VA 3V50A 4WM9A 1ZKJA 1FCMA 3MBZA 3A3IA 2DCFA 5CRFA 1H8ZA 2EFXA 3HLBA 1WYBA 1YLPA 4R3BA 1NJ4A 1W8YA 4E3IA 5KSCA 4MBFA 2HPBA 4E3OA 2Y2GA 3RJUA 4WMCD 4JBFA 1K6SA 2JBFA 4U0XA 5G18A 2C5WB 3P09A 4GD8A 2RCXA 5F83A 4BQMA 1IKGA 4KZ7A 4EUZA 3PTEA 3SH9A 1OMEA 2A3UA 4FH2A 4IEDA 2ZM8A 2WGIA 4DF6A 1SCWA 3GQZA 1CI9A 1H8YA 2G2WA 2QMIA 3PBOA 5FSRA 5DF8A 3VOZA 3MZFA 5FDHA 3ITAA 4KZ9A 3DWKA 2WGWA 1RGZA 4CPKA 3D4FA 1NYMA 3OPHA 5M19A 1YM1A 2P74A 3CJMA 3NCKA 1PWCA 1K56A 2JC7A 3P98A 4P87A 2EXBA 1JWPA 4OOYA 4QB8A 2J9PA 4OH0A 2X01A 3DW0A 4ZTKA 2XLNA 4U3TA 3ZNYA 4LENA 1HTZA 4MBHA 1BLCA 1GA9A 3VP4A 1KE0A 4HBTA 3O88A 3ZG5A 4GZBA 1U60A 4N1XA 3HUOA 4MEZA 1YLYA 3VSKA 3I7JA 5F1FA 3HLGA 2PBYA 1KVMA 1MWTA 4QU3A 4OP5A 3MXRA 3LEZA 3ZCZA 1XGIA 4KENB 4OQGA 5FI7A 2ZQ8A 3OC2A 4S2LA 3SS5A 3NC8A 4IVIA 1NZUA 3V39A 1TEMA 1ZG6A 3S22A 3VFFA 1DJBA 2PU2A 3N8LA 2CC1A 4X6TA 5CGWA 1E3UA 5EE8A 5FQJA 1HVBA 3GRJA 4KZ8A 3ZNTA 2XEPA 4FD8A 3N4IA 3UE1A 4YFMA 1KE4A 4MLLA 3HUNA 2JE5A 1MPLA 4DRTA 3HLFA 2XD5A 4NETA 1G68A 4XUZA 1KGFA 5M1AA 4DXCA 4QJGA 4OQ0A 5CEDA 1ESIA 1XGJA 1QMEA 3O86A 4D2OA 4N9KA 5CECA 3VP2A 3HLEA 1Q2QA 1FOFA 2EFUA 2ZM2A 3ZG9B 1KE3A 4JXSA 5EECA 3UDIA 3ZVWA 3SH7A 4R23A 4WZ5A 4R4SA 1H5XA 1EI5A 3BYDA 1JTGA 3UY6A 5AQ9A 3S1YA 5CHUA 1JVJA 4PMAA 4BJPA 3Q1FA 4Y0UA 1FR6A 1K57A 5FA7A 2HP9A 3ITBA 5DF7A 3W8KA 1LL9A 1Z6FA 3NY4A 4IBRA 2ZM0A 4OOLA 4S2JA 5CTMA 4E3MA 4DE0A 4JXWA 2ZJ9A 5HAIA 2VGJA 5EOEA 5D3OA 2XF3A 1LL5A 2OSUA 4E3KA 5FATA 1DJCA 1FCNA 2ZQDA 4K0XA 4UA7A 3AGFA 4A5RA 1ES2A 4EBNA 3N7WA 1BSGA 3Q07A 1M6KA 3BEBA 5E2FA 1WE4A 3IF6C 4ID4A 2ZLYA 3EQUA 1IYPA 1BUEA 3O87A 5A90A 3RXXA 1RGYA 2V1ZA 5GL9A 1L0EA 1NYYA 2QZ6A 3WWXA 5KZHA 3BM6A 3TG9A 3LO7A 3Q81A 4KG2A 3HL9A 2H5SA 2J7VA 2BLSA 4PM6A 5FI6A 3V3SA 3VOYA 1BLSA 4Y0OA 2XQZA 2ZQCA 2OLVA 2PU4A 1IEMA 4PM8A 3MFDA 3IF6A 4H8RA 4OKPA 1E25A 3G2YA 5FAOA 3UPOA 2Y2OA 5IHVA 3PAGA 4E3NA 5A92A 4P6BA 4K91A 1PZPA 3WS1A 5CXWA 1K4EA 4GD6A 4S2PA 3GSGA 3IF5A 3NIAA 2Q9MA 2OLUA 4B4XA 4PM5A 2WZXA 1L0DA 1PWDA 1DJAA 3MKEA 4RVAA 5GHXA 5GLDA 3SOIA 3TSGA 3OPPA 4DKIA 4GNUA 1AXBA 1MKIA 4JKTA 1S6RA 3BFDA 3VMAA 4WYYA 4OP8A 3SS3A 4OLGA 1ZC2A 3BLMA 5EVIC 3BFEA 3VFHA 4E3LA 1BZAA 3GVBA 4QY5A 4YINA 5TFQA 3B3XA 5E2GA 3PAEA 3SS4A 1SDEA 3CG5A 2UWXA 4Q8IA 2B5RA 2WAEA 3GR2A 5DTTA 1YLJA 3CZDA 2EX8A 2ZQ9A 5EOOA 2X71A 4KQQA 3E2KA 5EVIA 1VQQA 3HLCA 4BD0A 4BLMA 3ZG8B 3GV9A 1NRFA 1JWVA 2WUQA 3FYZA 3UDXA 3UO9A 4OONA 2Y2LA 1KGGA 5HX9A 1CEFA 5CHJA 3M2KA 3Q7VB 1W8QA 4N92A 3W4PA 5GHYA 4PM9A 5FI2A 4OLDA 3LY4A 4GOGA 3BRMA 4WEKA 3V5MA 2WAFA 2ZC6B 1JTDA 2G2UA 1XXMA 4BD1A 1FCOA 2EX9A 4LV2A 2I72A 2H10A 4S2MA 1IYQA 4OQHA 3ZFZA 1SDNA 1TDGA 3HBRA 4MBKA 4UA6A 4R4RA 3VP0A 2J8YA 1L2SA 3IXGA 2HDRA 2RL3A 5FQ9A 4JLFA 1LLBA 5EVLA 3C5AA 4MNRA 1GHMA 5CEBA 3HLWA 1PI5A 1E4DA 4HESA 4X69A 1YMSA 1EWZA 1KGEA 3QNBA 1BLPA 2ZMAA 2XK1A 1PYYA 1XP4A 4E6XA 5TR7A 3IWIA 4WZ5C 3NDGA 2QPNA 3ZVTA 3OCLA 2Y2NA 5AQ7A 5EUAA 5FQIA 4X56A 1LI9A 3A3JA 4GN2A 5E43A 1K57C 1GHIA 5FAPA 3N8RA 2A49A 4K0WA 4LV0A 1ERQA 3PBNA 3M6BA 2H0TA 3IWOA 5GLCA 4KZBA 4KZ6A 5GLAA 2HDSA 3UPPA 5HAQA 5FQMA 2ZC3B 5FQKA 1K56D 4EWFA 3ZDJA 3IWQA 2WYXA 3IH9A 3JYIA 3N6IA 3BLSA 2ZC4B 4QY6A 4KZAA 5KMWA 3IHAA 4XXRA 1O07A 3BECA 1Q2PA 3N8SA 2WZZA 1DY6A 3M6HA 2R9XA 4ZJ2A 2ZQ7A 2WKIA 5I94A 1GA0A 1MXOA 4OVDA 3S4XA 4UHUA 4EQIA 3IT9A 4DE2A 3MZEA 3IH8A 1ES5A 4WELA 4Y0TA 4LV1A 1I5QA 4C3QA 5A91A 1PW1A 2Y2MA 5AQAA 4Z9QA 1K54C 5J8XA 1PW8A 1KDSA 4DDSA 1HZOA 1ZG4A 2IWDA 1ONHA 4KG6A 3LY3A 3UNWA 4WMCA 3E2LA 3AGEA 3PBTA 2Y2HA 1L0GA 2Q9NA 4KZ3A 1CI8A 4OPYA 3GMWA 2FFFB 1E3UD 3QHYA 2WADA 3Q7ZA 4M3KA 1PIOA 2Y55A 3WS5A 3G32A 1K54A 1XPBA 1Y54A 2XD1A 4R3JA 3VSLA 4EBLA 1BTLA 2EXAA 2IWBA 1GHPA 3PBRA 1EROA 5EPHA 1IYOA 3OPLA 1ERMA 1W5DA 3GTCA 1CEGA 3G2ZA 1N9BA 1ONGA 1YLTA 4HBUA 3HREA 3UN7A 2Y2IA 3O3VA 3IQAA 2Y91A 3G31A 4WBGA 4UA9A 4FSFA 1J9MA 1PI4A 3FKWA 1MY8A 4WEJA 3MKFA 3EQVA 4S2NC 3IXHA 3WS2A 1I2SA 1ES4A 4JF5A 4KZ5A 1QMFA 4IBXA 1K25A 4O7DA 2Y2KA 5GLBA 1XX2A 2E8IA 5BOHA 1IYSA 1W79A 1LI0A 4LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0W A;  4N9L A;  1I2W A;  3ZGA B;  4F94 A;  1YQS A;  2HP6 A;  4C75 A;  1ESU A;  1K38 A;  3NI9 A;  4KG5 A;  1RP5 A;  4S2N A;  4X55 A;  5CHM A;  1FR1 A;  4N1H A;  3BFG A;  4WZ4 A;  4GDN A;  3HLD A;  5AQB A;  3V3R A;  4C6Y A;  3DTM A;  3HUM A;  4JPM A;  5M18 A;  5FQQ A;  5E2E A;  4S2O A;  4EV4 A;  1G6A A;  2X02 A;  4OPQ A;  4BL3 A;  2Y2P A;  3C4P A;  2ZC5 B;  1MWS A;  4FH4 A;  1BT5 A;  1XA7 A;  5KSH A;  3ISG A;  3HVF A;  3G30 A;  3MXS A;  4P85 A;  1XA1 A;  2J9O A;  1YMX A;  2V2F F;  1MWR A;  4UAA A;  2XH9 A;  4S2K A;  3NDE A;  4R1G A;  1L0F A;  3M2J A;  3W4O A;  3FKV A;  4KQR A;  3UE3 A;  2HDU A;  3OZH A;  5FAS A;  3QNC A;  5L2F A;  2WKH A;  2XFS A;  2XFT A;  3ZG7 B;  5CGX A;  4ZDX A;  4Y7P A;  3FV7 A;  5HL1 A;  1NZO A;  4GB7 A;  1K55 C;  1BUL A;  1N4O A;  2WKE A;  1MBL A;  4L0L A;  5CER A;  3ZHH A;  3VP1 A;  5F82 A;  1IEL A;  1YT4 A;  4OPZ A;  3A3E A;  1ES3 A;  2DNS A;  3WRZ A;  2V20 A;  1NXY A;  1TDL A;  2DRW A;  2Y4A A;  3IHB A;  3UE0 A;  1YLZ A;  2R9W A;  2XDM A;  2HDQ A;  3IF6 B;  5U47 A;  3LCE A;  4ZBE A;  5JYO A;  5A93 A;  1C3B A;  1K55 A;  4B4Z A;  4R0Q A;  4RA7 A;  5HAR A;  1ALQ A;  1PZO A;  1TVF A;  2EX2 A;  4U0T A;  2Z2L B;  1BLH A;  1FSW A;  5EVI D;  3A3F A;  5DF9 A;  3FWL A;  2P9V B;  4ZAM A;  5FAQ A;  3NBL A;  3W4Q A;  2ZC7 A;  4ZJ1 A;  2FFY A;  1CK3 A;  3PBQ A;  4RX3 A;  5DTK A;  4KQO A;  2GDN A;  5CGS A;  3UPN A;  1KVL A;  1XKZ A;  2XGN A;  4BEN A;  4S2I A;  2HP5 A;  2WGV A;  2Y2Q A;  5DVA A;  4ZJ3 A;  5DTS A;  5HW3 A;  1LHY A;  4E3J A;  4EBP A;  4IVK A;  4OPR A;  3CMZ A;  4LCM A;  4DE1 A;  4DXB A;  3WRT A;  5E2H A;  4OOM A;  3UDF A;  2C6W B;  4OQI A;  4LV3 A;  1SKF A;  4JXG A;  4PM7 A;  1O7E A;  1KDW A;  2H0Y A;  4JF6 A;  1GCE A;  4NK3 A;  2ZD8 A;  2WGW B;  5EVI B;  2IWC A;  1FSY A;  3Q7V A;  2OV5 A;  1FQG A;  4JF4 A;  3DWZ A;  3G4P A;  4FCF A;  2BG1 A;  1WYC A;  1K4F A;  3RXW A;  3WS0 A;  1W7F A;  3C4O A;  1PWG A;  4X68 A;  1NY0 A;  3TOI A;  1HD8 A;  3WS4 A;  3C7V A;  3VP3 A;  3FZC A;  3G35 A;  3IXD A;  4QHC A;  4DE3 A;  3C7U A;  2Z2M B;  5HAP A;  3MZD A;  2EX6 A;  4XUX A;  4B88 A;  3AGD A;  1RCJ A;  1M40 A;  2XR0 A;  1MWU A;  4RYE A;  3SH8 A;  4GDB A;  3ZG0 A;  3A3D A;  2ZQA A;  3OPR A;  4KZ4 A;  1SHV A;  4HEF A;  3BFF A;  5HFO A;  4GKU A;  4RX2 A;  1IKI A;  4E6W A;  4X53 A;  5GHZ A;  2Y2J A;  2WK0 A;  3PBS A;  5F1G A;  2JCH A;  4BL2 A;  3BFC A;  3OCN A;  1K6R A;  5TGF A;  5CTN A;  2VGK A;  1VM1 A;  1JWZ A;  4DDY A;  4CJN A;  3Q82 A;  3G34 A;  2Y59 A;  4JXV A;  4QD4 A;  5JYP A;  4PPR A;  4P0M A;  1YLW A;  3IXB A;  2P9V A;  3V50 A;  4WM9 A;  1ZKJ A;  1FCM A;  3MBZ A;  3A3I A;  2DCF A;  5CRF A;  1H8Z A;  2EFX A;  3HLB A;  1WYB A;  1YLP A;  4R3B A;  1NJ4 A;  1W8Y A;  4E3I A;  5KSC A;  4MBF A;  2HPB A;  4E3O A;  2Y2G A;  3RJU A;  4WMC D;  4JBF A;  1K6S A;  2JBF A;  4U0X A;  5G18 A;  2C5W B;  3P09 A;  4GD8 A;  2RCX A;  5F83 A;  4BQM A;  1IKG A;  4KZ7 A;  4EUZ A;  3PTE A;  3SH9 A;  1OME A;  2A3U A;  4FH2 A;  4IED A;  2ZM8 A;  2WGI A;  4DF6 A;  1SCW A;  3GQZ A;  1CI9 A;  1H8Y A;  2G2W A;  2QMI A;  3PBO A;  5FSR A;  5DF8 A;  3VOZ A;  3MZF A;  5FDH A;  3ITA A;  4KZ9 A;  3DWK A;  2WGW A;  1RGZ A;  4CPK A;  3D4F A;  1NYM A;  3OPH A;  5M19 A;  1YM1 A;  2P74 A;  3CJM A;  3NCK A;  1PWC A;  1K56 A;  2JC7 A;  3P98 A;  4P87 A;  2EXB A;  1JWP A;  4OOY A;  4QB8 A;  2J9P A;  4OH0 A;  2X01 A;  3DW0 A;  4ZTK A;  2XLN A;  4U3T A;  3ZNY A;  4LEN A;  1HTZ A;  4MBH A;  1BLC A;  1GA9 A;  3VP4 A;  1KE0 A;  4HBT A;  3O88 A;  3ZG5 A;  4GZB A;  1U60 A;  4N1X A;  3HUO A;  4MEZ A;  1YLY A;  3VSK A;  3I7J A;  5F1F A;  3HLG A;  2PBY A;  1KVM A;  1MWT A;  4QU3 A;  4OP5 A;  3MXR A;  3LEZ A;  3ZCZ A;  1XGI A;  4KEN B;  4OQG A;  5FI7 A;  2ZQ8 A;  3OC2 A;  4S2L A;  3SS5 A;  3NC8 A;  4IVI A;  1NZU A;  3V39 A;  1TEM A;  1ZG6 A;  3S22 A;  3VFF A;  1DJB A;  2PU2 A;  3N8L A;  2CC1 A;  4X6T A;  5CGW A;  1E3U A;  5EE8 A;  5FQJ A;  1HVB A;  3GRJ A;  4KZ8 A;  3ZNT A;  2XEP A;  4FD8 A;  3N4I A;  3UE1 A;  4YFM A;  1KE4 A;  4MLL A;  3HUN A;  2JE5 A;  1MPL A;  4DRT A;  3HLF A;  2XD5 A;  4NET A;  1G68 A;  4XUZ A;  1KGF A;  5M1A A;  4DXC A;  4QJG A;  4OQ0 A;  5CED A;  1ESI A;  1XGJ A;  1QME A;  3O86 A;  4D2O A;  4N9K A;  5CEC A;  3VP2 A;  3HLE A;  1Q2Q A;  1FOF A;  2EFU A;  2ZM2 A;  3ZG9 B;  1KE3 A;  4JXS A;  5EEC A;  3UDI A;  3ZVW A;  3SH7 A;  4R23 A;  4WZ5 A;  4R4S A;  1H5X A;  1EI5 A;  3BYD A;  1JTG A;  3UY6 A;  5AQ9 A;  3S1Y A;  5CHU A;  1JVJ A;  4PMA A;  4BJP A;  3Q1F A;  4Y0U A;  1FR6 A;  1K57 A;  5FA7 A;  2HP9 A;  3ITB A;  5DF7 A;  3W8K A;  1LL9 A;  1Z6F A;  3NY4 A;  4IBR A;  2ZM0 A;  4OOL A;  4S2J A;  5CTM A;  4E3M A;  4DE0 A;  4JXW A;  2ZJ9 A;  5HAI A;  2VGJ A;  5EOE A;  5D3O A;  2XF3 A;  1LL5 A;  2OSU A;  4E3K A;  5FAT A;  1DJC A;  1FCN A;  2ZQD A;  4K0X A;  4UA7 A;  3AGF A;  4A5R A;  1ES2 A;  4EBN A;  3N7W A;  1BSG A;  3Q07 A;  1M6K A;  3BEB A;  5E2F A;  1WE4 A;  3IF6 C;  4ID4 A;  2ZLY A;  3EQU A;  1IYP A;  1BUE A;  3O87 A;  5A90 A;  3RXX A;  1RGY A;  2V1Z A;  5GL9 A;  1L0E A;  1NYY A;  2QZ6 A;  3WWX A;  5KZH A;  3BM6 A;  3TG9 A;  3LO7 A;  3Q81 A;  4KG2 A;  3HL9 A;  2H5S A;  2J7V A;  2BLS A;  4PM6 A;  5FI6 A;  3V3S A;  3VOY A;  1BLS A;  4Y0O A;  2XQZ A;  2ZQC A;  2OLV A;  2PU4 A;  1IEM A;  4PM8 A;  3MFD A;  3IF6 A;  4H8R A;  4OKP A;  1E25 A;  3G2Y A;  5FAO A;  3UPO A;  2Y2O A;  5IHV A;  3PAG A;  4E3N A;  5A92 A;  4P6B A;  4K91 A;  1PZP A;  3WS1 A;  5CXW A;  1K4E A;  4GD6 A;  4S2P A;  3GSG A;  3IF5 A;  3NIA A;  2Q9M A;  2OLU A;  4B4X A;  4PM5 A;  2WZX A;  1L0D A;  1PWD A;  1DJA A;  3MKE A;  4RVA A;  5GHX A;  5GLD A;  3SOI A;  3TSG A;  3OPP A;  4DKI A;  4GNU A;  1AXB A;  1MKI A;  4JKT A;  1S6R A;  3BFD A;  3VMA A;  4WYY A;  4OP8 A;  3SS3 A;  4OLG A;  1ZC2 A;  3BLM A;  5EVI C;  3BFE A;  3VFH A;  4E3L A;  1BZA A;  3GVB A;  4QY5 A;  4YIN A;  5TFQ A;  3B3X A;  5E2G A;  3PAE A;  3SS4 A;  1SDE A;  3CG5 A;  2UWX A;  4Q8I A;  2B5R A;  2WAE A;  3GR2 A;  5DTT A;  1YLJ A;  3CZD A;  2EX8 A;  2ZQ9 A;  5EOO A;  2X71 A;  4KQQ A;  3E2K A;  5EVI A;  1VQQ A;  3HLC A;  4BD0 A;  4BLM A;  3ZG8 B;  3GV9 A;  1NRF A;  1JWV A;  2WUQ A;  3FYZ A;  3UDX A;  3UO9 A;  4OON A;  2Y2L A;  1KGG A;  5HX9 A;  1CEF A;  5CHJ A;  3M2K A;  3Q7V B;  1W8Q A;  4N92 A;  3W4P A;  5GHY A;  4PM9 A;  5FI2 A;  4OLD A;  3LY4 A;  4GOG A;  3BRM A;  4WEK A;  3V5M A;  2WAF A;  2ZC6 B;  1JTD A;  2G2U A;  1XXM A;  4BD1 A;  1FCO A;  2EX9 A;  4LV2 A;  2I72 A;  2H10 A;  4S2M A;  1IYQ A;  4OQH A;  3ZFZ A;  1SDN A;  1TDG A;  3HBR A;  4MBK A;  4UA6 A;  4R4R A;  3VP0 A;  2J8Y A;  1L2S A;  3IXG A;  2HDR A;  2RL3 A;  5FQ9 A;  4JLF A;  1LLB A;  5EVL A;  3C5A A;  4MNR A;  1GHM A;  5CEB A;  3HLW A;  1PI5 A;  1E4D A;  4HES A;  4X69 A;  1YMS A;  1EWZ A;  1KGE A;  3QNB A;  1BLP A;  2ZMA A;  2XK1 A;  1PYY A;  1XP4 A;  4E6X A;  5TR7 A;  3IWI A;  4WZ5 C;  3NDG A;  2QPN A;  3ZVT A;  3OCL A;  2Y2N A;  5AQ7 A;  5EUA A;  5FQI A;  4X56 A;  1LI9 A;  3A3J A;  4GN2 A;  5E43 A;  1K57 C;  1GHI A;  5FAP A;  3N8R A;  2A49 A;  4K0W A;  4LV0 A;  1ERQ A;  3PBN A;  3M6B A;  2H0T A;  3IWO A;  5GLC A;  4KZB A;  4KZ6 A;  5GLA A;  2HDS A;  3UPP A;  5HAQ A;  5FQM A;  2ZC3 B;  5FQK A;  1K56 D;  4EWF A;  3ZDJ A;  3IWQ A;  2WYX A;  3IH9 A;  3JYI A;  3N6I A;  3BLS A;  2ZC4 B;  4QY6 A;  4KZA A;  5KMW A;  3IHA A;  4XXR A;  1O07 A;  3BEC A;  1Q2P A;  3N8S A;  2WZZ A;  1DY6 A;  3M6H A;  2R9X A;  4ZJ2 A;  2ZQ7 A;  2WKI A;  5I94 A;  1GA0 A;  1MXO A;  4OVD A;  3S4X A;  4UHU A;  4EQI A;  3IT9 A;  4DE2 A;  3MZE A;  3IH8 A;  1ES5 A;  4WEL A;  4Y0T A;  4LV1 A;  1I5Q A;  4C3Q A;  5A91 A;  1PW1 A;  2Y2M A;  5AQA A;  4Z9Q A;  1K54 C;  5J8X A;  1PW8 A;  1KDS A;  4DDS A;  1HZO A;  1ZG4 A;  2IWD A;  1ONH A;  4KG6 A;  3LY3 A;  3UNW A;  4WMC A;  3E2L A;  3AGE A;  3PBT A;  2Y2H A;  1L0G A;  2Q9N A;  4KZ3 A;  1CI8 A;  4OPY A;  3GMW A;  2FFF B;  1E3U D;  3QHY A;  2WAD A;  3Q7Z A;  4M3K A;  1PIO A;  2Y55 A;  3WS5 A;  3G32 A;  1K54 A;  1XPB A;  1Y54 A;  2XD1 A;  4R3J A;  3VSL A;  4EBL A;  1BTL A;  2EXA A;  2IWB A;  1GHP A;  3PBR A;  1ERO A;  5EPH A;  1IYO A;  3OPL A;  1ERM A;  1W5D A;  3GTC A;  1CEG A;  3G2Z A;  1N9B A;  1ONG A;  1YLT A;  4HBU A;  3HRE A;  3UN7 A;  2Y2I A;  3O3V A;  3IQA A;  2Y91 A;  3G31 A;  4WBG A;  4UA9 A;  4FSF A;  1J9M A;  1PI4 A;  3FKW A;  1MY8 A;  4WEJ A;  3MKF A;  3EQV A;  4S2N C;  3IXH A;  3WS2 A;  1I2S A;  1ES4 A;  4JF5 A;  4KZ5 A;  1QMF A;  4IBX A;  1K25 A;  4O7D A;  2Y2K A;  5GLB A;  1XX2 A;  2E8I A;  5BOH A;  1IYS A;  1W79 A;  1LI0 A;  4LCL A; 
#chains in the Genus database with same CATH topology
 4G3V A;  1I2W A;  2HP6 A;  1ESU A;  5CHM A;  1RP5 A;  3S7O A;  4C6Y A;  3HLD A;  3V3R A;  3CUE C;  1OTB A;  3HUM A;  5M18 A;  4EQ1 A;  1KOU A;  2ZC5 B;  5KSH A;  1XA7 A;  1YSQ A;  4H6J A;  3G30 A;  3T1X A;  4R70 A;  1XA1 A;  4R1G A;  3OZH A;  5L2F A;  2XFS A;  3KSI A;  1K55 C;  5CER A;  4HH2 A;  2V20 A;  1NXY A;  3IHB A;  3UE0 A;  2XDM A;  3MJQ A;  5HDS A;  2ZMF A;  3OBF A;  4WN5 A;  3RTY A;  5A93 A;  1C3B A;  4R0Q A;  4MDZ A;  5EVI D;  3A3F A;  1A0K A;  3SW1 A;  4HJ3 A;  2ZL1 A;  5DTK A;  3T50 A;  2J80 A;  2XGN A;  5DVA A;  4ZJ3 A;  5DTS A;  1LHY A;  3H82 A;  3WRT A;  2HF6 A;  5IU1 A;  1OPX A;  2ZD8 A;  1L3L A;  3DWZ A;  2JKR I;  2BG1 A;  1WYC A;  3WS0 A;  1PWG A;  4X68 A;  3TOI A;  3LR4 A;  3VP3 A;  3FZC A;  4DE3 A;  4QHC A;  4B88 A;  5TBM A;  3EGD C;  4DN0 A;  1MWU A;  2FH5 A;  4RYE A;  3SH8 A;  2V0W A;  3ZG0 A;  3MXQ A;  5FEG A;  3TW8 A;  2WK0 A;  3PBS A;  4X1M A;  2JCH A;  3BFC A;  4GLQ A;  1YSP A;  3Q82 A;  4I38 A;  1YLW A;  2P9V A;  4WM9 A;  1FCM A;  3A3I A;  4E04 A;  2EFX A;  2HJ9 C;  3MQ0 A;  3S7P A;  4WMC D;  1FIK A;  1K6S A;  2JBF A;  4JBF A;  2C5W B;  4GD8 A;  3T4K A;  4FH2 A;  2ZBB A;  4DF6 A;  3D72 A;  1CI9 A;  2G2W A;  5FSR A;  5FDH A;  2W1R A;  3ITA A;  5FDS A;  3DWK A;  2WGW A;  5L8M A;  1NYM A;  1PRQ A;  5M19 A;  1PWC A;  2JC7 A;  4P87 A;  3E4Q A;  3QP5 A;  2X01 A;  4UQI M;  4U3T A;  3ZNY A;  2VKS A;  2QJ5 A;  3ZG5 A;  4YNR A;  4II7 A;  4R3A A;  5G4Y A;  5F1F A;  1F98 A;  2PBY A;  3LEZ A;  1F9I A;  3ZCZ A;  1XGI A;  4KEN B;  5AVF A;  4IUK A;  4S2L A;  1NZU A;  3PHY A;  1TEM A;  1ZG6 A;  3S22 A;  1DJB A;  2CC1 A;  4KZ8 A;  4FD8 A;  3N4I A;  3UE1 A;  3LR3 A;  4DRT A;  2IA2 A;  1F2K A;  4DXC A;  1XFN A;  4QJG A;  3O86 A;  3NJA A;  4N9K A;  5CEC A;  3HLE A;  3ZVW A;  2ZM2 A;  5HDC A;  1KE3 A;  3SH7 A;  4HOI A;  4R4S A;  4WZ5 A;  1EI5 A;  4F3L B;  5AQ9 A;  5CHU A;  1JVJ A;  3LIA A;  2QYB A;  3C30 A;  2OAQ 1;  1K57 A;  5FA7 A;  4E3M A;  2ZM0 A;  5LBR A;  5J7E A;  5FAT A;  3E4O A;  2ZQD A;  4EBN A;  1WE4 A;  3LIF A;  2ZLY A;  3O87 A;  1IYP A;  1BUE A;  1LT0 A;  2V1Z A;  5GL9 A;  3WWX A;  2ZOH A;  3P7N A;  5KZH A;  3BM6 A;  3TG9 A;  2J7V A;  2BLS A;  1WA9 A;  4MN7 A;  4PM8 A;  3MFD A;  5FAO A;  3BY9 A;  2LB5 A;  3LR5 A;  4K91 A;  3GSG A;  4ETZ A;  2JKT M;  3T1S A;  3NIA A;  2Q9M A;  4PM5 A;  2A24 A;  3SOI A;  5GLD A;  3OPP A;  4I3I A;  1MKI A;  3BFD A;  4GJ4 A;  4WYY A;  1MZU A;  1Y28 A;  3SS4 A;  3V67 A;  2UWX A;  4Q8I A;  3GR2 A;  3F1P B;  3KSF A;  4IUH A;  3CZD A;  2ZQ9 A;  2W1T A;  2M1C A;  2VZW A;  3E2K A;  3HLC A;  1YAX A;  1N9L A;  2W0N A;  2Y2L A;  1CEF A;  5CHJ A;  3Q7V B;  3EWK A;  4N92 A;  5GHY A;  4OLD A;  4GOG A;  4WEK A;  3V5M A;  4BD1 A;  4S2M A;  4OQH A;  2J3T C;  2O99 A;  1SDN A;  1TDG A;  4UA6 A;  2J8Y A;  1GHM A;  4Y2F A;  1E4D A;  1GSW A;  2VV8 A;  1P9W A;  2ZMA A;  1TS7 A;  1PYY A;  1XP4 A;  3OCL A;  2Y2N A;  5AQ7 A;  3HJK A;  3A3J A;  3N8R A;  3IWO A;  1XJ6 A;  3UPP A;  5FQM A;  1K56 D;  3ZDJ A;  3IH9 A;  1N9O A;  3UB6 A;  4XXR A;  3R4K A;  5EVE A;  2L0W A;  3S4X A;  1ES5 A;  1T1A A;  4LV1 A;  4H6J B;  5F68 A;  5A91 A;  4Z9Q A;  1KDS A;  1ZG4 A;  2IWD A;  1ONH A;  2WKR A;  3UNW A;  2Q9N A;  4KZ3 A;  3QHY A;  4NXE A;  3Q7Z A;  1PIO A;  3WS5 A;  2YKH A;  1K54 A;  1XPB A;  4ME4 A;  3VSL A;  2VJW A;  1BTL A;  3PBR A;  1IYO A;  1W5D A;  3IS2 A;  3G2Z A;  3B42 A;  3IQA A;  3ULF A;  3G31 A;  3UE6 A;  3UB9 A;  1MY8 A;  4S2N C;  3BW6 A;  2Y2K A;  1IYS A;  2VEA A;  3TJZ C;  3H82 B;  1S0W A;  5F6A A;  3ZGA B;  4F94 A;  1YQS A;  4B93 A;  4C75 A;  4F3L A;  1MC0 A;  4IJG A;  3T4S A;  2I9V A;  4KG5 A;  4X55 A;  4N1H A;  4WZ4 A;  4GDN A;  1DP9 A;  1UWP X;  4JPM A;  5FQQ A;  1G6A A;  1OTD A;  2Y8H A;  2Y2P A;  2EA9 A;  1J3W A;  3HVF A;  1YMX A;  2V2F F;  2XH9 A;  4S2K A;  3W4O A;  2J3W A;  2HDU A;  5TBM B;  2K2N A;  2WKH A;  5CGX A;  4GB7 A;  4G3K A;  1N4O A;  4L0L A;  3WRZ A;  1T19 A;  2Y4A A;  2V8C A;  5C5K A;  3LCE A;  3R7W A;  4HJ6 A;  4RA7 A;  1TVF A;  1OT6 A;  2DMW A;  2Z2L B;  2PD8 A;  3FWL A;  2P9V B;  4P6Z M;  5FAQ A;  5F5Y A;  4ZJ1 A;  3L7H A;  2FFY A;  3PBQ A;  4O8G A;  2GDN A;  5CGS A;  3UPN A;  1XKZ A;  4AFI A;  2HP5 A;  2WGV A;  4Y13 A;  3F1O B;  4LCM A;  3F1P A;  2BAS A;  4DXB A;  5E2H A;  4OOM A;  1SKF A;  5IT5 A;  4PM7 A;  1K0K A;  4JF6 A;  2WGW B;  5EVI B;  1FSY A;  3Q7V A;  3NOT C;  2OV5 A;  2K31 A;  1FQG A;  4ARZ B;  3G4P A;  4FCF A;  1K4F A;  4Q0J A;  3RXW A;  3C4O A;  2J3T D;  5DJU A;  1HD8 A;  4YWZ A;  3WS4 A;  3C7V A;  3KYE A;  3MZD A;  4JGO A;  4XUX A;  3AGD A;  1M40 A;  2XR0 A;  2ZQA A;  1SHV A;  2W27 A;  5HFO A;  3BFF A;  4E6W A;  4LPZ A;  5GHZ A;  3OLO A;  5DJT A;  3OCN A;  5CTN A;  2VGK A;  1CJF A;  4CJN A;  3CLO A;  4BBV A;  4JXV A;  4QD4 A;  5JYP A;  4PPR A;  3T4O A;  4L9F A;  3MR0 A;  4P0M A;  2LB9 A;  2HV1 A;  2PRF A;  3HLB A;  1WYB A;  3PXP A;  4R3B A;  1NJ4 A;  4MBF A;  2HPB A;  3FPW A;  3P09 A;  4BQM A;  5F83 A;  1IKG A;  2QKP A;  3SH9 A;  2JN7 A;  2WGI A;  2VV6 A;  1ZTU A;  2W3F A;  1H8Y A;  5HSQ A;  3VOZ A;  5J4E A;  3CPT B;  4KZ9 A;  3IBR A;  3D4F A;  4PKY A;  1YM1 A;  3CJM A;  3NCK A;  4EU0 A;  2EXB A;  3D9Y A;  1JWP A;  3T1Q B;  4OOY A;  2J9P A;  4ZTK A;  1SKO B;  1HTZ A;  4MBH A;  4HBT A;  1OJG A;  4BMW A;  4N1X A;  4I3A A;  4MEZ A;  2D01 A;  3I7J A;  4EUV A;  4QU3 A;  1MWT A;  3MXR A;  1NLZ A;  5DKK A;  3DAV A;  2B02 A;  3SS5 A;  2A24 B;  1F5M A;  1CF0 A;  4X6T A;  1E3U A;  3K3D A;  3ZNT A;  4MCW A;  4MN5 A;  3VE3 A;  4YFM A;  5A8B A;  4K08 A;  4NET A;  3HLF A;  5CED A;  5K5B A;  1QME A;  4D2O A;  3C8C A;  5I5L A;  2D02 A;  3UDI A;  2W1T B;  4R23 A;  3BYD A;  3UY6 A;  3S1Y A;  3LI8 A;  4O0P A;  2HP9 A;  4DJ3 A;  5DF7 A;  1S1Z A;  2P7J A;  1Z6F A;  4OOL A;  4R38 A;  4HP4 A;  4KUO A;  5HAI A;  2XF3 A;  2OSU A;  1DJC A;  4UA7 A;  4A5R A;  1BSG A;  5E2F A;  3BEB A;  4ID4 A;  3IF6 C;  1RGY A;  3LO7 A;  3JVU A;  4CLC C;  4Y0O A;  3RFB A;  2PU4 A;  1IEM A;  3UPO A;  2Y2O A;  3PAG A;  1PZP A;  3WS1 A;  1K4E A;  4WUJ A;  1OTI A;  5G4Z A;  2OLU A;  2WZX A;  2Y79 A;  1DJA A;  4DKI A;  3TSG A;  3VMA A;  1XJ4 A;  1OTA A;  3SS3 A;  4E3L A;  3VFH A;  3F1O A;  2XA7 S;  3GVB A;  4QY5 A;  4YIN A;  4LLO B;  3B3X A;  5E2G A;  4B9O A;  4KUK A;  1UWN X;  1YLJ A;  2KX6 A;  5EVI A;  3JPU A;  3GV9 A;  1NRF A;  4ARZ A;  5HL6 A;  3UME A;  1ACF A;  1KGG A;  2PR6 A;  5FI2 A;  1XXM A;  1TS8 A;  2EX9 A;  3ZFZ A;  1IYQ A;  3DTI A;  2HDR A;  3IX3 A;  3C5A A;  2V1A A;  3HLW A;  4EEU A;  1PI5 A;  3IS2 B;  3O5Y A;  1EWZ A;  1BLP A;  4CQH A;  2W3G A;  2XK1 A;  3LFV A;  2QPN A;  4NKP A;  5EUA A;  5FQI A;  2V1B A;  4X56 A;  5E43 A;  5FAP A;  1GHI A;  3EGX C;  4HNB A;  3M6B A;  2H0T A;  5GLC A;  5GLA A;  3TRC A;  4BBU A;  5L07 A;  5HAQ A;  2ZC3 B;  2O9A A;  4EWF A;  3K2N A;  3IWQ A;  5KMW A;  4QY6 A;  3BLS A;  3IHA A;  3BEC A;  3N8S A;  2WZZ A;  5KIZ A;  1DY6 A;  4YOF A;  4P6Z S;  1AWI A;  5HWT A;  5I94 A;  1GA0 A;  1MXO A;  1VEU B;  4OVD A;  4EEP A;  3K3C A;  4EQI A;  3CPT A;  1G6O A;  4C3Q A;  2EWW A;  5AQA A;  4D60 A;  3MS6 A;  4WMC A;  1SKO A;  1LSX A;  1ZHH B;  3PBT A;  3S7N A;  2Y2H A;  1L0G A;  3NOU C;  4BBT A;  1CI8 A;  5L09 A;  3EOI A;  2Y55 A;  3G32 A;  1Y54 A;  2XD1 A;  1GHP A;  5EV0 A;  3R7W B;  1ERM A;  1ONG A;  3QP1 A;  3O3V A;  3MQO A;  4WBG A;  2V9A A;  3H9W A;  4UA9 A;  4FSF A;  2HGV A;  1IFQ A;  3WS2 A;  3IXH A;  4JF5 A;  1QMF A;  2FZ0 A;  1K25 A;  2E8I A;  1W79 A;  2JKF A;  1LL8 A;  2YKF A;  3PAE A;  1LI0 A;  1YKD A;  2PBD P;  1LSV A;  2M7U A;  3MFX A;  3NI9 A;  5AQB A;  3BFG A;  5E2E A;  4EV4 A;  3BQ8 A;  4OPQ A;  4BL3 A;  5HDD A;  2XRO A;  3KYQ A;  3C4P A;  1BT5 A;  3W2Z A;  3ISG A;  2JKR M;  3MMH A;  5DKL A;  2B95 A;  2J9O A;  3P01 A;  1MWR A;  4UAA A;  3CUE A;  2ZOI A;  1L0F A;  1XJ3 A;  3M2J A;  3UE3 A;  3QNC A;  4R6L A;  4CLC D;  1STZ A;  4Y7P A;  5HL1 A;  1NZO A;  1BUL A;  4RQ9 A;  3MSH A;  4JGR A;  1ES3 A;  2DNS A;  4FUW A;  3JVV A;  3VE4 A;  2R9W A;  4GHI A;  2HDQ A;  4ZBE A;  5JYO A;  1T18 A;  1K55 A;  5HAR A;  1ALQ A;  1PZO A;  4Q0H A;  4U0T A;  1BLH A;  5DF9 A;  3LUQ A;  4ZAM A;  3ZYT A;  3NBL A;  2ZC7 A;  1NWZ A;  4RX3 A;  1CK3 A;  2M7V A;  4KQO A;  5FEF A;  4BEN A;  4S2I A;  2Y2Q A;  4PAU A;  5HD5 A;  4EBP A;  1ODV A;  4OPR A;  4DE1 A;  2A2L A;  3UDF A;  5L10 A;  1O7E A;  1S67 L;  2IWC A;  1VET A;  4NXF A;  3OOV A;  5MC7 A;  3G35 A;  3C7U A;  2Z2M B;  5HAP A;  2EX6 A;  1RCJ A;  2KOI A;  4FTX A;  3OPR A;  4LRX C;  2Q0O A;  4NG2 A;  1IKI A;  4RX2 A;  1OT9 A;  2GJ3 A;  2PT7 A;  5F1G A;  2INW A;  5TGF A;  1K6R A;  1VM1 A;  1JWZ A;  3CI6 A;  3A0V A;  4CLC A;  3V50 A;  1ZKJ A;  1V9Y A;  2DCF A;  3IX8 A;  3T4Q A;  5KSC A;  4E3O A;  3RJU A;  5G18 A;  4KZ7 A;  3E4P A;  1W63 Q;  1OME A;  1VEU A;  3GDI A;  4IED A;  2ZM8 A;  5DFX A;  5HPF A;  1SCW A;  3GQZ A;  2Z6C A;  5DF8 A;  4HI4 A;  3OPH A;  3BY8 A;  3U4L P;  1K56 A;  3P98 A;  3LIE A;  4OH0 A;  2XLN A;  1BLC A;  1GA9 A;  5J3W A;  1KE0 A;  3O88 A;  4GZB A;  1UGU A;  2VV7 A;  3HLG A;  4OP5 A;  4UQI S;  3LID A;  4I39 A;  4OQG A;  2VLG A;  4LGW A;  1LSW A;  4M4X A;  5FI7 A;  2V8F A;  3V39 A;  3BWL A;  3ICY A;  2PU2 A;  5CGW A;  5EE8 A;  2XEP A;  3FPV A;  1KE4 A;  3HUN A;  4FOF A;  1MPL A;  1H3Q A;  1G68 A;  1H8M A;  2OWH A;  1XGJ A;  4HIA A;  4BWI A;  3MF0 A;  4HY8 A;  3ZG9 B;  4JXS A;  4XT2 A;  1H5X A;  4PMA A;  4Y0U A;  3ITB A;  3W8K A;  3NY4 A;  4S2J A;  3LYX A;  3H7W A;  5D3O A;  4E3K A;  4MN6 A;  1FCN A;  3IBJ A;  3AGF A;  3FC7 A;  3N7W A;  3Q07 A;  3F1N A;  2XSS A;  3G6O A;  4JGQ A;  3RXX A;  1NYY A;  2QZ6 A;  4Y5F A;  3Q81 A;  3HL9 A;  2H5S A;  3VOY A;  3V3S A;  5FL3 A;  4L9G A;  2ZQC A;  1D06 A;  2OLV A;  1XFQ A;  4H8R A;  4OKP A;  3VV4 A;  1E25 A;  3T12 B;  4EER A;  1DRM A;  4E3N A;  5A92 A;  3U2A A;  5CXW A;  1D1J A;  4B4X A;  1L0D A;  3MKE A;  1EW0 A;  5GHX A;  4Q0I A;  4GNU A;  1AXB A;  4JKT A;  1S6R A;  2JHE A;  2MJ6 A;  4OP8 A;  1ZC2 A;  3DTK A;  5TFQ A;  2BTF P;  1SDE A;  2GZA A;  2B5R A;  2WAE A;  5DTT A;  2XRN A;  3T1R A;  3LR0 A;  4KQQ A;  4BD0 A;  3L9K A;  1JWV A;  2WUQ A;  3FYZ A;  3UDX A;  4OON A;  2NUP C;  3E98 A;  1W8Q A;  5HWW A;  3D3O A;  4PM9 A;  1VHM A;  3LY4 A;  3LIC A;  2WAF A;  2ZC6 B;  1JTD A;  1PNE A;  3DBA A;  3HBR A;  3LI9 A;  3VP0 A;  1L2S A;  5FQ9 A;  1DP6 A;  2RL3 A;  1LLB A;  2VGL M;  4MNR A;  4HH3 A;  5CEB A;  2L4R A;  4HES A;  1VB6 A;  2NUT C;  4PKY G;  1KGE A;  3QNB A;  5TR7 A;  3NDG A;  2JKT I;  5F69 A;  5EFW A;  1LI9 A;  1X0O A;  4K0W A;  1ERQ A;  3C2W A;  3PBN A;  4KZB A;  4KZ6 A;  2HDS A;  2CMN A;  5IS1 A;  5FQK A;  3JYI A;  3N6I A;  4KZA A;  1O07 A;  4WF0 A;  3M6H A;  2R9X A;  2ZQ7 A;  2PD7 A;  4UHU A;  1TD5 A;  2QHK A;  4DE2 A;  3MZE A;  2VK3 A;  2Y2M A;  1XJ2 A;  4DMZ A;  1K54 C;  5J8X A;  1PW8 A;  4DDS A;  1HZO A;  4KG6 A;  3E2L A;  3AGE A;  1OJ5 A;  3QP2 A;  2O9B A;  3GMW A;  2B18 A;  2WAD A;  4GS9 B;  4M3K A;  4R3J A;  3B47 A;  5AVE A;  4GHI B;  3NUL A;  5EPH A;  3BQA A;  3OPL A;  3GTC A;  3NOP C;  5HPI A;  4HQA A;  5HD3 A;  3HRE A;  4ZRR A;  3UN7 A;  1NRJ A;  3FKW A;  3MKF A;  2PHY A;  2PAV P;  1JNU A;  4O7D A;  3EEA A;  5GLB A;  1XX2 A;  1Z09 A;  3KSG A;  3C38 A;  4LCL A;  1HLU P;  4N9L A;  1D7E A;  5EM1 A;  1K38 A;  3KYZ A;  4S2N A;  4L9E A;  1FR1 A;  3DTM A;  3HCY A;  1P9R A;  4S2O A;  4Z1W A;  2X02 A;  1VET B;  4KQD A;  1MWS A;  4FH4 A;  3QP6 A;  1TS0 A;  2WKQ A;  3MXS A;  4P85 A;  3NDE A;  3EEH A;  3FKV A;  4KQR A;  5FAS A;  3ZG7 B;  4ZDX A;  2XFT A;  2W3H A;  4LRZ E;  3FV7 A;  2KLI A;  3LGO A;  2WKE A;  1G5U A;  1MBL A;  2L1M A;  3ZHH A;  3VP1 A;  5F82 A;  1IEL A;  1YT4 A;  4OPZ A;  3A3E A;  2DRW A;  1TDL A;  1YLZ A;  3IF6 B;  4HHD A;  5U47 A;  3VOL A;  3MQQ A;  4B4Z A;  2EX2 A;  1FSW A;  4CLC B;  3PR6 A;  4MMN A;  3W4Q A;  2OOL A;  2W3D A;  4EET B;  1KVL A;  5HW3 A;  4E3J A;  4IVK A;  3CMZ A;  2P04 A;  2OAP 1;  4HP9 A;  2C6W B;  4X25 A;  1IOU A;  4OQI A;  4LV3 A;  3QP4 A;  4JXG A;  3CWF A;  1KDW A;  2H0Y A;  1GCE A;  4NK3 A;  4NXB A;  1T1B A;  2Z6D A;  4JF4 A;  3KO6 A;  1W7F A;  1NY0 A;  1BYW A;  3IXD A;  1YPR A;  1W63 M;  4NEE D;  3NEC A;  4LRY C;  4GDB A;  2HZ5 A;  3A3D A;  2PYR A;  3A0R A;  4KZ4 A;  5TJJ A;  1GSX A;  4HEF A;  4GKU A;  4I5S A;  3KX0 X;  4NXG A;  4X53 A;  2Y2J A;  5EM0 A;  3PYP A;  4BL2 A;  3DTE A;  4DDY A;  3G34 A;  2Y59 A;  3B33 A;  3IXB A;  3CHW P;  4EES A;  3MBZ A;  5CRF A;  1H8Z A;  4X1L A;  1YLP A;  1W8Y A;  4E3I A;  2Y2G A;  4U0X A;  2JKG A;  4XT2 B;  2RCX A;  4JGP A;  4EUZ A;  3PTE A;  3T4L A;  3TE8 A;  2A3U A;  2EWV A;  4HJ4 A;  3BJN A;  3RH8 B;  3UB5 P;  2QMI A;  3PBO A;  1V9Z A;  3H7W B;  3MZF A;  2GNX A;  2O0Y A;  1RGZ A;  4CPK A;  4ETX A;  2P74 A;  3F1N B;  4QB8 A;  4EXO A;  3DW0 A;  4GS9 A;  4LEN A;  1SZV A;  4Y15 A;  3VP4 A;  4WLA A;  1U60 A;  3HUO A;  1YLY A;  3VSK A;  1KVM A;  3A0S A;  3IX4 A;  1PFL A;  2PDR A;  2ZQ8 A;  3OC2 A;  3NC8 A;  4IVI A;  3VFF A;  5FQJ A;  3N8L A;  2VX8 A;  2VGL S;  5CX7 A;  1HVB A;  3GRJ A;  4O01 A;  4MLL A;  2JE5 A;  2PYP A;  2XD5 A;  5M1A A;  4XUZ A;  1KGF A;  2K7S A;  4OQ0 A;  1ESI A;  1OTE A;  1TF1 A;  3VP2 A;  1N9N A;  1FOF A;  1Q2Q A;  2EFU A;  2R78 A;  5EEC A;  4Y17 A;  2QJ7 A;  2PR5 A;  2VA0 A;  1JTG A;  1S4R A;  4BJP A;  3Q1F A;  1FR6 A;  4EW7 A;  1LL9 A;  3GEC A;  4IBR A;  5CTM A;  4DE0 A;  4JXW A;  2ZJ9 A;  2VGJ A;  5EOE A;  1LL5 A;  3HJI A;  4K0X A;  1ES2 A;  4PHT A;  1M6K A;  2QWS A;  1Y4O A;  3EQU A;  5HWV A;  2G7U A;  3UB8 A;  5A90 A;  1DP8 A;  1L0E A;  2W3E A;  1FIL A;  4DJ2 A;  4LFU A;  4KG2 A;  3KSH A;  5FI6 A;  4PM6 A;  1BLS A;  3LEQ A;  2XQZ A;  1H0M A;  3IF6 A;  3G2Y A;  5IHV A;  1MKM A;  4P6B A;  4GD6 A;  4S2P A;  3IF5 A;  3UMD A;  2XA7 M;  4WL9 A;  5HZH A;  4RVA A;  4GW9 A;  1PWD A;  1P97 A;  3LIB A;  4G3W A;  4OLG A;  5EVI C;  3BLM A;  3BFE A;  1BZA A;  2ZL1 B;  2ACG A;  3S7Q A;  3CG5 A;  1S1Y A;  2EX8 A;  5EOO A;  2WKP A;  2X71 A;  3ZQ5 A;  1VQQ A;  5DFY A;  4BLM A;  3ZG8 B;  4CLC E;  2P08 A;  3UO9 A;  2E8J A;  5HX9 A;  3M2K A;  3W4P A;  3T4J A;  3BRM A;  2G2U A;  1FCO A;  4LV2 A;  2I72 A;  2H10 A;  2UV0 E;  4MBK A;  3T4T A;  4R4R A;  3IXG A;  4JLF A;  5EVL A;  2OWJ A;  2KDK A;  4X69 A;  1YMS A;  4ESP A;  2ZMV A;  4E6X A;  4QWO A;  3IWI A;  4WZ5 C;  3ZVT A;  1GSV A;  1NLY A;  4GN2 A;  1K57 C;  4UEY A;  2A49 A;  2AVX A;  4LV0 A;  3QP8 A;  2V0U A;  1CQA A;  3SZT A;  2WYX A;  2ZC4 B;  1Q2P A;  2GX5 A;  4ZJ2 A;  2WKI A;  3IT9 A;  3IH8 A;  4Y0T A;  4WEL A;  4IHQ A;  1I5Q A;  1PW1 A;  1G28 A;  3NHQ A;  3LY3 A;  4GCZ A;  1T1C A;  4OPY A;  2FFF B;  1E3U D;  1P0Z A;  3CIT A;  4EBL A;  3E0Y A;  2EXA A;  2O9C A;  2HJE A;  2IWB A;  1S66 L;  1ERO A;  2H28 A;  4I3J A;  1CEG A;  1N9B A;  1YLT A;  4HBU A;  3CAX A;  4QPR A;  1S4S A;  2Y2I A;  3FG8 A;  2Y91 A;  5AJG A;  1J9M A;  1PI4 A;  4WEJ A;  3EQV A;  1TS6 A;  3UB7 A;  1I2S A;  4Y3I A;  1ES4 A;  4KZ5 A;  4IBX A;  5BOH A; 
#chains in the Genus database with same CATH homology
 1S0W A;  4N9L A;  1I2W A;  3ZGA B;  4F94 A;  1YQS A;  2HP6 A;  4C75 A;  1ESU A;  1K38 A;  3NI9 A;  4KG5 A;  1RP5 A;  4S2N A;  4X55 A;  5CHM A;  1FR1 A;  4N1H A;  3BFG A;  4WZ4 A;  4GDN A;  3HLD A;  5AQB A;  3V3R A;  4C6Y A;  3DTM A;  3HUM A;  4JPM A;  5M18 A;  5FQQ A;  5E2E A;  4S2O A;  4EV4 A;  1G6A A;  2X02 A;  4OPQ A;  4BL3 A;  2Y2P A;  3C4P A;  2ZC5 B;  1MWS A;  4FH4 A;  1BT5 A;  1XA7 A;  5KSH A;  3ISG A;  3HVF A;  3G30 A;  3MXS A;  4P85 A;  1XA1 A;  2J9O A;  1YMX A;  2V2F F;  1MWR A;  4UAA A;  2XH9 A;  4S2K A;  3NDE A;  4R1G A;  1L0F A;  3M2J A;  3W4O A;  3FKV A;  4KQR A;  3UE3 A;  2HDU A;  3OZH A;  5FAS A;  3QNC A;  5L2F A;  2WKH A;  2XFS A;  2XFT A;  3ZG7 B;  5CGX A;  4ZDX A;  4Y7P A;  3FV7 A;  5HL1 A;  1NZO A;  4GB7 A;  1K55 C;  1BUL A;  1N4O A;  2WKE A;  1MBL A;  4L0L A;  5CER A;  3ZHH A;  3VP1 A;  5F82 A;  1IEL A;  1YT4 A;  4OPZ A;  3A3E A;  1ES3 A;  2DNS A;  3WRZ A;  2V20 A;  1NXY A;  1TDL A;  2DRW A;  2Y4A A;  3IHB A;  3UE0 A;  1YLZ A;  2R9W A;  2XDM A;  2HDQ A;  3IF6 B;  5U47 A;  3LCE A;  4ZBE A;  5JYO A;  5A93 A;  1C3B A;  1K55 A;  4B4Z A;  4R0Q A;  4RA7 A;  5HAR A;  1ALQ A;  1PZO A;  1TVF A;  2EX2 A;  4U0T A;  2Z2L B;  1BLH A;  1FSW A;  5EVI D;  3A3F A;  5DF9 A;  3FWL A;  2P9V B;  4ZAM A;  5FAQ A;  3NBL A;  3W4Q A;  2ZC7 A;  4ZJ1 A;  2FFY A;  1CK3 A;  3PBQ A;  4RX3 A;  5DTK A;  4KQO A;  2GDN A;  5CGS A;  3UPN A;  1KVL A;  1XKZ A;  2XGN A;  4BEN A;  4S2I A;  2HP5 A;  2WGV A;  2Y2Q A;  5DVA A;  4ZJ3 A;  5DTS A;  5HW3 A;  1LHY A;  4E3J A;  4EBP A;  4IVK A;  4OPR A;  3CMZ A;  4LCM A;  4DE1 A;  4DXB A;  3WRT A;  5E2H A;  4OOM A;  3UDF A;  2C6W B;  4OQI A;  4LV3 A;  1SKF A;  4JXG A;  4PM7 A;  1O7E A;  1KDW A;  2H0Y A;  4JF6 A;  1GCE A;  4NK3 A;  2ZD8 A;  2WGW B;  5EVI B;  2IWC A;  1FSY A;  3Q7V A;  2OV5 A;  1FQG A;  4JF4 A;  3DWZ A;  3G4P A;  4FCF A;  2BG1 A;  1WYC A;  1K4F A;  3RXW A;  3WS0 A;  1W7F A;  3C4O A;  1PWG A;  4X68 A;  1NY0 A;  3TOI A;  1HD8 A;  3WS4 A;  3C7V A;  3VP3 A;  3FZC A;  3G35 A;  3IXD A;  4QHC A;  4DE3 A;  3C7U A;  2Z2M B;  5HAP A;  3MZD A;  2EX6 A;  4XUX A;  4B88 A;  3AGD A;  1RCJ A;  1M40 A;  2XR0 A;  1MWU A;  4RYE A;  3SH8 A;  4GDB A;  3ZG0 A;  3A3D A;  2ZQA A;  3OPR A;  4KZ4 A;  1SHV A;  4HEF A;  3BFF A;  5HFO A;  4GKU A;  4RX2 A;  1IKI A;  4E6W A;  4X53 A;  5GHZ A;  2Y2J A;  2WK0 A;  3PBS A;  5F1G A;  2JCH A;  4BL2 A;  3BFC A;  3OCN A;  1K6R A;  5TGF A;  5CTN A;  2VGK A;  1VM1 A;  1JWZ A;  4DDY A;  4CJN A;  3Q82 A;  3G34 A;  2Y59 A;  4JXV A;  4QD4 A;  5JYP A;  4PPR A;  4P0M A;  1YLW A;  3IXB A;  2P9V A;  3V50 A;  4WM9 A;  1ZKJ A;  1FCM A;  3MBZ A;  3A3I A;  2DCF A;  5CRF A;  1H8Z A;  2EFX A;  3HLB A;  1WYB A;  1YLP A;  4R3B A;  1NJ4 A;  1W8Y A;  4E3I A;  5KSC A;  4MBF A;  2HPB A;  4E3O A;  2Y2G A;  3RJU A;  4WMC D;  4JBF A;  1K6S A;  2JBF A;  4U0X A;  5G18 A;  2C5W B;  3P09 A;  4GD8 A;  2RCX A;  5F83 A;  4BQM A;  1IKG A;  4KZ7 A;  4EUZ A;  3PTE A;  3SH9 A;  1OME A;  2A3U A;  4FH2 A;  4IED A;  2ZM8 A;  2WGI A;  4DF6 A;  1SCW A;  3GQZ A;  1CI9 A;  1H8Y A;  2G2W A;  2QMI A;  3PBO A;  5FSR A;  5DF8 A;  3VOZ A;  3MZF A;  5FDH A;  3ITA A;  4KZ9 A;  3DWK A;  2WGW A;  1RGZ A;  4CPK A;  3D4F A;  1NYM A;  3OPH A;  5M19 A;  1YM1 A;  2P74 A;  3CJM A;  3NCK A;  1PWC A;  1K56 A;  2JC7 A;  3P98 A;  4P87 A;  2EXB A;  1JWP A;  4OOY A;  4QB8 A;  2J9P A;  4OH0 A;  2X01 A;  3DW0 A;  4ZTK A;  2XLN A;  4U3T A;  3ZNY A;  4LEN A;  1HTZ A;  4MBH A;  1BLC A;  1GA9 A;  3VP4 A;  1KE0 A;  4HBT A;  3O88 A;  3ZG5 A;  4GZB A;  1U60 A;  4N1X A;  3HUO A;  4MEZ A;  1YLY A;  3VSK A;  3I7J A;  5F1F A;  3HLG A;  2PBY A;  1KVM A;  1MWT A;  4QU3 A;  4OP5 A;  3MXR A;  3LEZ A;  3ZCZ A;  1XGI A;  4KEN B;  4OQG A;  5FI7 A;  2ZQ8 A;  3OC2 A;  4S2L A;  3SS5 A;  3NC8 A;  4IVI A;  1NZU A;  3V39 A;  1TEM A;  1ZG6 A;  3S22 A;  3VFF A;  1DJB A;  2PU2 A;  3N8L A;  2CC1 A;  4X6T A;  5CGW A;  1E3U A;  5EE8 A;  5FQJ A;  1HVB A;  3GRJ A;  4KZ8 A;  3ZNT A;  2XEP A;  4FD8 A;  3N4I A;  3UE1 A;  4YFM A;  1KE4 A;  4MLL A;  3HUN A;  2JE5 A;  1MPL A;  4DRT A;  3HLF A;  2XD5 A;  4NET A;  1G68 A;  4XUZ A;  1KGF A;  5M1A A;  4DXC A;  4QJG A;  4OQ0 A;  5CED A;  1ESI A;  1XGJ A;  1QME A;  3O86 A;  4D2O A;  4N9K A;  5CEC A;  3VP2 A;  3HLE A;  1Q2Q A;  1FOF A;  2EFU A;  2ZM2 A;  3ZG9 B;  1KE3 A;  4JXS A;  5EEC A;  3UDI A;  3ZVW A;  3SH7 A;  4R23 A;  4WZ5 A;  4R4S A;  1H5X A;  1EI5 A;  3BYD A;  1JTG A;  3UY6 A;  5AQ9 A;  3S1Y A;  5CHU A;  1JVJ A;  4PMA A;  4BJP A;  3Q1F A;  4Y0U A;  1FR6 A;  1K57 A;  5FA7 A;  2HP9 A;  3ITB A;  5DF7 A;  3W8K A;  1LL9 A;  1Z6F A;  3NY4 A;  4IBR A;  2ZM0 A;  4OOL A;  4S2J A;  5CTM A;  4E3M A;  4DE0 A;  4JXW A;  2ZJ9 A;  5HAI A;  2VGJ A;  5EOE A;  5D3O A;  2XF3 A;  1LL5 A;  2OSU A;  4E3K A;  5FAT A;  1DJC A;  1FCN A;  2ZQD A;  4K0X A;  4UA7 A;  3AGF A;  4A5R A;  1ES2 A;  4EBN A;  3N7W A;  1BSG A;  3Q07 A;  1M6K A;  3BEB A;  5E2F A;  1WE4 A;  3IF6 C;  4ID4 A;  2ZLY A;  3EQU A;  1IYP A;  1BUE A;  3O87 A;  5A90 A;  3RXX A;  1RGY A;  2V1Z A;  5GL9 A;  1L0E A;  1NYY A;  2QZ6 A;  3WWX A;  5KZH A;  3BM6 A;  3TG9 A;  3LO7 A;  3Q81 A;  4KG2 A;  3HL9 A;  2H5S A;  2J7V A;  2BLS A;  4PM6 A;  5FI6 A;  3V3S A;  3VOY A;  1BLS A;  4Y0O A;  2XQZ A;  2ZQC A;  2OLV A;  2PU4 A;  1IEM A;  4PM8 A;  3MFD A;  3IF6 A;  4H8R A;  4OKP A;  1E25 A;  3G2Y A;  5FAO A;  3UPO A;  2Y2O A;  5IHV A;  3PAG A;  4E3N A;  5A92 A;  4P6B A;  4K91 A;  1PZP A;  3WS1 A;  5CXW A;  1K4E A;  4GD6 A;  4S2P A;  3GSG A;  3IF5 A;  3NIA A;  2Q9M A;  2OLU A;  4B4X A;  4PM5 A;  2WZX A;  1L0D A;  1PWD A;  1DJA A;  3MKE A;  4RVA A;  5GHX A;  5GLD A;  3SOI A;  3TSG A;  3OPP A;  4DKI A;  4GNU A;  1AXB A;  1MKI A;  4JKT A;  1S6R A;  3BFD A;  3VMA A;  4WYY A;  4OP8 A;  3SS3 A;  4OLG A;  1ZC2 A;  3BLM A;  5EVI C;  3BFE A;  3VFH A;  4E3L A;  1BZA A;  3GVB A;  4QY5 A;  4YIN A;  5TFQ A;  3B3X A;  5E2G A;  3PAE A;  3SS4 A;  1SDE A;  3CG5 A;  2UWX A;  4Q8I A;  2B5R A;  2WAE A;  3GR2 A;  5DTT A;  1YLJ A;  3CZD A;  2EX8 A;  2ZQ9 A;  5EOO A;  2X71 A;  4KQQ A;  3E2K A;  5EVI A;  1VQQ A;  3HLC A;  4BD0 A;  4BLM A;  3ZG8 B;  3GV9 A;  1NRF A;  1JWV A;  2WUQ A;  3FYZ A;  3UDX A;  3UO9 A;  4OON A;  2Y2L A;  1KGG A;  5HX9 A;  1CEF A;  5CHJ A;  3M2K A;  3Q7V B;  1W8Q A;  4N92 A;  3W4P A;  5GHY A;  4PM9 A;  5FI2 A;  4OLD A;  3LY4 A;  4GOG A;  3BRM A;  4WEK A;  3V5M A;  2WAF A;  2ZC6 B;  1JTD A;  2G2U A;  1XXM A;  4BD1 A;  1FCO A;  2EX9 A;  4LV2 A;  2I72 A;  2H10 A;  4S2M A;  1IYQ A;  4OQH A;  3ZFZ A;  1SDN A;  1TDG A;  3HBR A;  4MBK A;  4UA6 A;  4R4R A;  3VP0 A;  2J8Y A;  1L2S A;  3IXG A;  2HDR A;  2RL3 A;  5FQ9 A;  4JLF A;  1LLB A;  5EVL A;  3C5A A;  4MNR A;  1GHM A;  5CEB A;  3HLW A;  1PI5 A;  1E4D A;  4HES A;  4X69 A;  1YMS A;  1EWZ A;  1KGE A;  3QNB A;  1BLP A;  2ZMA A;  2XK1 A;  1PYY A;  1XP4 A;  4E6X A;  5TR7 A;  3IWI A;  4WZ5 C;  3NDG A;  2QPN A;  3ZVT A;  3OCL A;  2Y2N A;  5AQ7 A;  5EUA A;  5FQI A;  4X56 A;  1LI9 A;  3A3J A;  4GN2 A;  5E43 A;  1K57 C;  1GHI A;  5FAP A;  3N8R A;  2A49 A;  4K0W A;  4LV0 A;  1ERQ A;  3PBN A;  3M6B A;  2H0T A;  3IWO A;  5GLC A;  4KZB A;  4KZ6 A;  5GLA A;  2HDS A;  3UPP A;  5HAQ A;  5FQM A;  2ZC3 B;  5FQK A;  1K56 D;  4EWF A;  3ZDJ A;  3IWQ A;  2WYX A;  3IH9 A;  3JYI A;  3N6I A;  3BLS A;  2ZC4 B;  4QY6 A;  4KZA A;  5KMW A;  3IHA A;  4XXR A;  1O07 A;  3BEC A;  1Q2P A;  3N8S A;  2WZZ A;  1DY6 A;  3M6H A;  2R9X A;  4ZJ2 A;  2ZQ7 A;  2WKI A;  5I94 A;  1GA0 A;  1MXO A;  4OVD A;  3S4X A;  4UHU A;  4EQI A;  3IT9 A;  4DE2 A;  3MZE A;  3IH8 A;  1ES5 A;  4WEL A;  4Y0T A;  4LV1 A;  1I5Q A;  4C3Q A;  5A91 A;  1PW1 A;  2Y2M A;  5AQA A;  4Z9Q A;  1K54 C;  5J8X A;  1PW8 A;  1KDS A;  4DDS A;  1HZO A;  1ZG4 A;  2IWD A;  1ONH A;  4KG6 A;  3LY3 A;  3UNW A;  4WMC A;  3E2L A;  3AGE A;  3PBT A;  2Y2H A;  1L0G A;  2Q9N A;  4KZ3 A;  1CI8 A;  4OPY A;  3GMW A;  2FFF B;  1E3U D;  3QHY A;  2WAD A;  3Q7Z A;  4M3K A;  1PIO A;  2Y55 A;  3WS5 A;  3G32 A;  1K54 A;  1XPB A;  1Y54 A;  2XD1 A;  4R3J A;  3VSL A;  4EBL A;  1BTL A;  2EXA A;  2IWB A;  1GHP A;  3PBR A;  1ERO A;  5EPH A;  1IYO A;  3OPL A;  1ERM A;  1W5D A;  3GTC A;  1CEG A;  3G2Z A;  1N9B A;  1ONG A;  1YLT A;  4HBU A;  3HRE A;  3UN7 A;  2Y2I A;  3O3V A;  3IQA A;  2Y91 A;  3G31 A;  4WBG A;  4UA9 A;  4FSF A;  1J9M A;  1PI4 A;  3FKW A;  1MY8 A;  4WEJ A;  3MKF A;  3EQV A;  4S2N C;  3IXH A;  3WS2 A;  1I2S A;  1ES4 A;  4JF5 A;  4KZ5 A;  1QMF A;  4IBX A;  1K25 A;  4O7D A;  2Y2K A;  5GLB A;  1XX2 A;  2E8I A;  5BOH A;  1IYS A;  1W79 A;  1LI0 A;  4LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...