5FQMA

Last common ancestor of gram negative bacteria (gnca) class a beta- lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADWRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GNCA BETA LACTAMASE
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
total genus 99
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2015-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5fqmA00
3N8LA 4KZ9A 1DJCA 1JWZA 3HLDA 3LO7A 4OP5A 4WZ5A 2ZQDA 3C7UA 1Q2PA 1ERMA 4KQQA 4U0TA 3ZHHA 3W4QA 3EQVA 4MEZA 2DNSA 3N6IA 3CMZA 3IWIA 4UA6A 3ZG5A 3IWQA 1SCWA 3A3IA 3MXSA 1RP5A 5FDHA 2Y91A 1L2SA 3C4PA 1MKIA 1E3UA 5CHUA 2VGKA 1IKGA 3BLSA 4PPRA 4PM5A 5AQ7A 1JTGA 5HW3A 1FCNA 4Y0OA 3DWZA 2Y2QA 4GKUA 1BLHA 3A3DA 3BFFA 4OQHA 4OLGA 4R0QA 3TSGA 5FQQA 1PI5A 4BENA 3G4PA 4E3NA 4KG6A 1JVJA 2XR0A 3LY4A 4MBKA 4X69A 4C6YA 1BULA 3M6HA 2X01A 1QMEA 2J7VA 4LV0A 3Q7ZA 1XX2A 1PW8A 1LLBA 4JBFA 1FQGA 4S2LA 3BFCA 2EX9A 5HAIA 1LHYA 3AGFA 4KENB 2WGIA 1PZPA 2PBYA 3UO9A 1C3BA 1K38A 2WGWA 4OOMA 2DRWA 3LCEA 4RA7A 3V5MA 4OOLA 2XH9A 4JPMA 1IYQA 1CI9A 3HUOA 1CEFA 4S2JA 1CEGA 1AXBA 4BLMA 1LL5A 3RJUA 4PM6A 3HLWA 4CJNA 1BTLA 5HARA 3NY4A 2Y2HA 3G35A 2IWDA 4M3KA 1FR1A 3CZDA 4WM9A 5FQ9A 5GHZA 4UAAA 5TGFA 3UE3A 2VGJA 1HZOA 4FSFA 2X71A 1W8QA 4MBFA 4UA9A 2GDNA 1OMEA 2Y2MA 1S6RA 3IXBA 4FH2A 3ZDJA 1Y54A 4ZDXA 5CTMA 5M18A 1GHIA 3NDGA 3UY6A 4OPRA 1BLSA 4P87A 2WADA 3IQAA 2Z2MB 1MY8A 2WK0A 4IBRA 4LCMA 4KZ4A 1KDWA 5CXWA 4LENA 3OCLA 1PYYA 2Z2LB 5CGSA 2UWXA 1ES2A 4GDNA 2ZC6B 4BL2A 4Y0TA 1K57C 1VM1A 3OCNA 4ZBEA 4X55A 1W8YA 2FFYA 3Q7VA 2HDUA 1GA0A 2Y2JA 2QMIA 3NI9A 5CGXA 3OPHA 5KSHA 4ZJ3A 4JF4A 1K57A 3NCKA 2X02A 4OQ0A 4S2MA 5M19A 3ITBA 1YMXA 3UE0A 1H8YA 3SS3A 1WYBA 4PM7A 1TDLA 1YM1A 4X53A 3ZG8B 2PU2A 3B3XA 1BLPA 4OPZA 3G31A 2ZD8A 2P74A 5A92A 2ZQ8A 4IBXA 2HP9A 1NXYA 4N9KA 4S2PA 3GTCA 2C5WB 4R23A 3ZVTA 1PZOA 2JE5A 2ZQ7A 4B4XA 5KMWA 3HVFA 3NIAA 3GSGA 4WMCA 1SDEA 3UDXA 2IWCA 2WAEA 5M1AA 3SH8A 1DY6A 4E3KA 1FCMA 4PM8A 2PU4A 1L0DA 1XGJA 3OPPA 3BFEA 4WELA 1K56D 2HDSA 3CJMA 5DTSA 1SKFA 5JYPA 2EX8A 2WGWB 2WYXA 3FYZA 3PBRA 3WS0A 1H5XA 3V3RA 2XD5A 5EVIC 4DF6A 4KZ3A 3UNWA 4BD0A 3A3FA 1ZG6A 3HUMA 3I7JA 5E2EA 2Y55A 3C5AA 4RX2A 4DE1A 1PIOA 2P9VA 4K0WA 3MKFA 4U0XA 4LCLA 4WZ5C 5EPHA 4LV2A 2CC1A 3UPPA 3VFFA 3LY3A 4BQMA 2Y2KA 5EVIA 4RYEA 5JYOA 1K6SA 1HD8A 3AGDA 5HX9A 1NYMA 5HAQA 4Y7PA 3S4XA 2H0YA 1HVBA 5AQ9A 1TEMA 4JF6A 1KE4A 2C6WB 4IVIA 4GZBA 3Q82A 3HLCA 1NRFA 3WWXA 4OQGA 5E2HA 1KVLA 1I5QA 1K4EA 4EWFA 1PWDA 2ZC4B 2EXAA 1YLPA 3PTEA 4QHCA 4E6XA 3VOYA 1K54C 4X6TA 1QMFA 4XUXA 3Q7VB 1BSGA 4KQRA 2JBFA 2HP5A 3W8KA 3UN7A 3FWLA 3O86A 3PBSA 3V50A 2BG1A 1K54A 5CEDA 3N8RA 3MFDA 1GHMA 3WS1A 4EUZA 3IXGA 3MBZA 4JXVA 1NZOA 3QHYA 2ZQCA 1L0GA 4FH4A 4R4RA 4E3MA 1XXMA 5FAPA 1E4DA 4DKIA 5DVAA 2H10A 3OZHA 1FR6A 5E2GA 3W4OA 2XDMA 2OV5A 1YQSA 2ZJ9A 1EROA 2EX2A 5CTNA 4GN2A 3G30A 5CERA 4OPYA 3VFHA 1K55C 4ZAMA 2EXBA 3O87A 5DTTA 4Y0UA 4YINA 3ZCZA 1RCJA 1PWCA 2Y59A 4DE3A 1SDNA 1DJBA 4S2KA 5FQMA 2HDQA 3IH9A 2XF3A 3DW0A 1CI8A 3Q81A 3UDIA 1K55A 4KZ5A 3IHAA 5EOOA 5FAOA 4RX3A 1FSYA 3E2KA 4DXCA 4OP8A 1ZKJA 4E3JA 1S0WA 2I72A 4HBUA 3ZNYA 5EE8A 4HEFA 4OQIA 4FCFA 1Q2QA 3BECA 1YLTA 1SHVA 5A91A 3VP1A 1TVFA 2V20A 4JLFA 1GA9A 2P9VB 3ISGA 3ZG0A 4XUZA 1XGIA 2WKIA 5FQIA 2XK1A 1W79A 5EVIB 1YMSA 4R4SA 3BFGA 3GVBA 3SS4A 2Y4AA 4DXBA 4EQIA 2WZXA 1KGEA 2H5SA 5CGWA 3HLGA 4ZJ2A 3QNCA 2Q9MA 3P09A 3WS2A 1U60A 2ZLYA 1ESIA 2DCFA 2E8IA 5GLBA 1FOFA 2ZC5B 4BJPA 2WKHA 3PAEA 4WEKA 1GHPA 5HL1A 1YLWA 1IELA 1G68A 2H0TA 3HBRA 5GL9A 4UHUA 1N4OA 5G18A 5EUAA 5F1FA 3ZNTA 4R3JA 1NYYA 1I2SA 1TDGA 2BLSA 5FQKA 4EV4A 1MWRA 4F94A 1NZUA 1ERQA 2XGNA 3HLEA 4A5RA 1N9BA 5A93A 4BL3A 4DDSA 1XP4A 3SS5A 1W5DA 4QY5A 3WS5A 3A3JA 1M6KA 3FZCA 1BT5A 1KVMA 3VOZA 5KZHA 1GCEA 2XLNA 1O07A 3D4FA 3S1YA 3A3EA 1ONHA 4N1HA 2JC7A 1J9MA 3G32A 2Y2PA 4OVDA 1XA1A 3UDFA 3JYIA 5FQJA 3ZG9B 4UA7A 3NDEA 3IHBA 3GQZA 3PBQA 4QD4A 4KZ6A 3NC8A 1HTZA 4R3BA 1PW1A 2HPBA 3FKWA 1FCOA 4LV1A 1BUEA 1WE4A 5CHMA 4Z9QA 5F83A 2R9WA 5U47A 1K56A 3C4OA 4QU3A 4QJGA 3UPOA 3BLMA 4YFMA 1ALQA 2XQZA 3MZFA 4EBLA 4N9LA 1LI0A 4IEDA 3IF5A 5EECA 2V1ZA 3HLBA 4S2IA 1BZAA 4CPKA 3VP2A 3WRZA 5IHVA 2ZQAA 4JKTA 1EI5A 2IWBA 3HREA 1H8ZA 3O3VA 4WZ4A 1L0FA 1MWSA 1BLCA 3GR2A 3ZVWA 4KZBA 5BOHA 1KE0A 4KZ8A 2XFTA 3BFDA 3HLFA 3E2LA 4JXGA 4L0LA 2G2UA 1E3UD 4GB7A 5KSCA 1MBLA 5CHJA 1EWZA 1VQQA 1KGGA 3IXDA 1L0EA 2G2WA 4KZ7A 4B4ZA 3MZDA 1NY0A 4WBGA 3UPNA 3HUNA 3VSLA 4OLDA 3BEBA 4MBHA 2Y2GA 3N7WA 1ESUA 1I2WA 1MWUA 3ZGAB 1Z6FA 3IF6C 3VP0A 2R9XA 4DRTA 1IKIA 1IYPA 5FATA 3M2KA 4GD8A 4KQOA 1JTDA 1RGZA 3RXWA 2B5RA 3NBLA 3PBNA 4S2NC 5FI2A 4B88A 1YT4A 3IF6A 1W7FA 2WKEA 3IT9A 3DTMA 3IH8A 4P85A 1XA7A 3ZFZA 3DWKA 2J9PA 4FD8A 2QPNA 2ZQ9A 3G34A 3HL9A 4S2OA 5F1GA 1DJAA 5AQBA 4HBTA 1MPLA 4S2NA 3BRMA 4X56A 3PBTA 5GLCA 3ITAA 1LL9A 4JXWA 5TR7A 4E3LA 4GDBA 4ZTKA 3V39A 3TOIA 1M40A 4EBNA 4GNUA 5D3OA 1FSWA 3VMAA 2ZMAA 3M2JA 5E2FA 4WEJA 3VSKA 4OPQA 3LEZA 2QZ6A 4PMAA 3Q1FA 3IXHA 4IVKA 1ES5A 2FFFB 3AGEA 1K25A 2RCXA 1ES3A 2V2FF 4DDYA 1K6RA 2OSUA 2ZM2A 3ZG7B 4RVAA 1IYSA 2WZZA 3Q07A 4K91A 3G2ZA 1G6AA 2ZM0A 5DTKA 3W4PA 4WYYA 3OPRA 4BD1A 5FA7A 2XD1A 4ZJ1A 1XKZA 4E3OA 4JF5A 3P98A 5EOEA 2J8YA 3C7VA 3N8SA 4D2OA 3BYDA 3M6BA 1ES4A 1O7EA 3TG9A 1YLJA 5J8XA 1ZG4A 5DF7A 5I94A 4KG2A 2ZM8A 1YLZA 4Q8IA 4H8RA 4MLLA 1ONGA 1YLYA 4N92A 4QY6A 5TFQA 4OOYA 4HESA 3WS4A 3IWOA 3MXRA 2Y2IA 3O88A 4DE2A 5HAPA 5GHXA 1KE3A 4KZAA 1LI9A 3RXXA 2ZC3B 4KG5A 5FAQA 5AQAA 4GOGA 5HFOA 5F82A 2A3UA 5FSRA 1RGYA 4NK3A 3OC2A 2XFSA 1JWPA 3QNBA 3VP3A 2HP6A 3SOIA 4WMCD 3GV9A 3BM6A 5EVLA 2EX6A 3GMWA 5DF9A 1MWTA 3EQUA 4JXSA 2WGVA 4P0MA 5GHYA 1NJ4A 4XXRA 4O7DA 2Q9NA 1KGFA 4N1XA 3OPLA 5L2FA 2Y2OA 3PAGA 3IF6B 2WAFA 1WYCA 1E25A 3S22A 5CRFA 4EBPA 4K0XA 2Y2LA 4P6BA 4PM9A 5DF8A 3V3SA 4OH0A 3WRTA 2WUQA 1IEMA 2Y2NA 1MXOA 4DE0A 4C75A 5GLDA 5CECA 5GLAA 3N4IA 2RL3A 2EFXA 2ZC7A 3CG5A 4NETA 3SH9A 4E3IA 3FV7A 5EVID 3FKVA 1IYOA 2HDRA 3PBOA 3UE1A 2OLUA 1K4FA 1ZC2A 4E6WA 1CK3A 3VP4A 4QB8A 2J9OA 5E43A 4LV3A 2OLVA 1PI4A 4R1GA 4OONA 3G2YA 4MNRA 5FI7A 2EFUA 2A49A 5A90A 2XEPA 1JWVA 1KDSA 4U3TA 5FI6A 4OKPA 3MZEA 1XPBA 3MKEA 3GRJA 4GD6A 2JCHA 5FASA 3SH7A 5CEBA 1PWGA 4X68A 4C3QA 4ID4A
chains in the Genus database with same CATH superfamily
3MMHA 4KZ9A 3LO7A 4WZ5A 2ZQDA 3C7UA 3RFBA 1Q2PA 1ERMA 4U0TA 4ARZA 1SZVA 1SCWA 1NLZA 2P08A 1RP5A 2Y91A 4I3AA 4Y0OA 3DWZA 1XFNA 2OOLA 3TSGA 4E3NA 2A24A 1QMEA 4MDZA 1LLBA 4JBFA 1T19A 3K2NA 1IYQA 1CI9A 1OTDA 4BLMA 1TF1A 4Y15A 3C38A 3HLWA 2Y2HA 5FQ9A 4UAAA 3KSIA 1HZOA 4FSFA 2X71A 1W8QA 2GDNA 1OMEA 2PD8A 4FH2A 5HPIA 3UY6A 4B9OA 3OCLA 2UWXA 4GDNA 4Y0TA 2FFYA 2HDUA 3S7QA 3OPHA 1K0KA 5M19A 4OQ0A 1YMXA 3UE0A 1H8YA 4ARZB 3TW8A 1TDLA 5HDCA 5HDDA 2JKGA 3C8CA 5EV0A 2ZQ8A 1Y4OA 4N9KA 2KOIA 2ZQ7A 5IU1A 2IWCA 4CLCE 3SH8A 2A24B 4E3KA 1FCMA 1L0DA 1XGJA 3BFEA 2WKQA 4EETB 3CJMA 4EXOA 5JYPA 1VEUA 3PBRA 5EVIC 1ZG6A 3C5AA 4RX2A 4DE1A 4LCLA 2CC1A 5EVIA 2HV1A 1YSQA 4AFIA 3AGDA 5HX9A 1HVBA 1KE4A 1K4EA 3T4OA 1YLPA 4KQRA 2JBFA 4DJ3A 3O86A 2YKHA 3PBSA 2VKSA 3MFDA 1GHMA 2W27A 5FAPA 2D01A 3CUEC 5F5YA 5DVAA 4DJ2A 3OZHA 1FR6A 2XDMA 1EROA 1NRJA 1NLYA 2H28A 5CERA 3QP5A 3T4JA 3VFHA 1P0ZA 1DP9A 3CUEA 4HQAA 4PAUA 1PWCA 4DE3A 5FQMA 5LBRA 2XF3A 4ETZA 2B95A 3CLOA 1CI8A 3MF0A 5FAOA 4RX3A 1VEUB 4KUOA 2KDKA 3ZNYA 4LLOB 1Q2QA 1YLTA 5A91A 3UB9A 1GSWA 2V20A 3FPWA 3T4KA 5EVIB 1YMSA 3GVBA 5EM0A 4EQIA 2WZXA 3LYXA 2PHYA 3QP6A 4EERA 4Q0IA 2ZC5B 2WKHA 2VLGA 1ODVA 3DTEA 3IX3A 2A2LA 3HBRA 1N4OA 5G18A 5F1FA 4R3JA 2BLSA 5FQKA 3L9KA 1CF0A 1D06A 2XRNA 2I9VA 1ONHA 2JC7A 3G32A 2VGLM 4OVDA 1XA1A 4DMZA 5FQJA 4UA7A 3NDEA 3GQZA 1P97A 1HTZA 1SKOA 3LIEA 1FIKA 4HNBA 1BUEA 4GHIA 4Z9QA 3UPOA 4QJGA 1FILA 2VGLS 3T1SA 1ALQA 2V0WA 4IEDA 5EECA 1BZAA 5IHVA 4JKTA 1EI5A 4EU0A 4I39A 1L0FA 4KZBA 4KZ8A 2CMNA 3VE4A 3UMEA 3E2LA 2ZL1A 4JXGA 4ETXA 1E3UD 1W63M 1KGGA 2FH5A 4MBHA 3N7WA 2QWSA 2HF6A 5EVEA 3VP0A 2R9XA 4EUVA 3IX4A 4KQOA 2QJ7A 2B5RA 1OT6A 1W7FA 1F98A 4P85A 3DWKA 3R7WA 3FPVA 3HL9A 4Q0JA 3OBFA 4S2OA 5F1GA 5AQBA 5TR7A 4E3LA 3ITAA 5D3OA 5E2FA 2QZ6A 4PMAA 2FFFB 2RCXA 4X1MA 4HI4A 2OSUA 3JPUA 1IYSA 1SKOB 4BD1A 5IT5A 3D9YA 3E98A 4HJ3A 2ZOIA 4E3OA 4JF5A 4EESA 3NECA 3M6BA 1O7EA 3TG9A 1YLJA 2VEAA 2NUPC 4KG2A 3O5YA 4H8RA 4MLLA 4L9GA 1T1AA 3T4SA 5K5BA 4OOYA 3ULFA 3WS4A 3T12B 3O88A 5HAPA 2ZL1B 1KE3A 4O0PA 2V8FA 4HJ4A 5HFOA 3A0RA 4GOGA 1RGYA 4NK3A 2M7VA 3E0YA 1NJ4A 3K3DA 2Y2OA 3PAGA 4NKPA 1E25A 3R7WB 1PNEA 2Y2LA 2JHEA 4PM9A 1W63Q 3WRTA 2WUQA 2Y2NA 1MXOA 2YKFA 2AVXA 4Z1WA 4C75A 1EW0A 2RL3A 2EFXA 4WUJA 4E3IA 2HDRA 2VJWA 2OLUA 3BW6A 3MQOA 4OONA 3D72A 2BTFP 2XEPA 4MCWA 4OKPA 4BBVA 2JKRM 5I5LA 3MKEA 3B42A 1PWGA 4MMNA 1DJCA 1LSVA 3HLDA 4OP5A 1OJ5A 2P04A 4HP4A 4MEZA 3FC7A 5CHUA 4MN7A 1IKGA 4PM5A 1JTGA 1FCNA 2EWVA 2OAQ1 2Y2QA 4GKUA 4R0QA 5FQQA 1PI5A 1S4SA 4BENA 1VB6A 1JVJA 2XR0A 3LY4A 4QPRA 4X69A 1BULA 3M6HA 3T1XA 5DJTA 1PW8A 3E4QA 2JKTM 5HAIA 3NOUC 1LHYA 2WGIA 1PZPA 4LFUA 4RA7A 3LCEA 4OOLA 4JPMA 1CEFA 4S2JA 4BMWA 4CJNA 3IBJA 2GZAA 1L3LA 2IWDA 3MFXA 3CZDA 5L09A 4DN0A 3IXBA 5M18A 3ZDJA 4G3KA 4PHTA 1PRQA 3IQAA 4LCMA 4KZ4A 1KDWA 4LENA 1PYYA 2JKFA 4X55A 1W8YA 5J3WA 2QMIA 3NI9A 3E4OA 5KSHA 4ZJ3A 4S2MA 4PKYA 3BWLA 1YM1A 3UE6A 4OPZA 3G31A 2ZD8A 5A92A 1D7EA 3UB6A 3ZVTA 4B4XA 5KMWA 3HVFA 3GSGA 4WMCA 1SDEA 5C5KA 2WAEA 4YNRA 3T1RA 4JGPA 2R78A 2B18A 3LGOA 4WELA 4L9EA 3FYZA 3WS0A 1H5XA 2W0NA 1UGUA 2W3FA 4KZ3A 3UNWA 5E2EA 1PIOA 2P9VA 4K0WA 4U0XA 4WZ5C 4E04A 3VFFA 3LY3A 2Y2KA 4WF0A 3JVUA 1HD8A 5HZHA 2V0UA 2EWWA 2H0YA 2B02A 2VV8A 2HGVA 3MSHA 2HJ9C 1T18A 1G6OA 4EW7A 3VV4A 4IUHA 4E6XA 3HCYA 1K54C 4XUXA 2KLIA 1K54A 3WS1A 1YKDA 3QHYA 3RH8B 4E3MA 4R4RA 2Y79A 2H10A 2OV5A 2L0WA 4OPYA 4ZAMA 2EXBA 3O87A 5DTTA 3OOVA 1SDNA 4S2KA 1OPXA 4WN5A 3H9WA 4R6LA 3UDIA 4YWZA 5EOOA 2PD7A 1FSYA 5HDSA 2UV0E 1ZKJA 4E3JA 1OTIA 4R3AA 1S0WA 3GECA 5EE8A 1SHVA 1TVFA 3UB7A 2P9VB 2XK1A 5FEFA 3SS4A 2Y4AA 3IBRA 5DFXA 1CQAA 3PR6A 1DRMA 3K3CA 4GCZA 2Q9MA 3P09A 1U60A 2E8IA 4CQHA 4WEKA 2GX5A 5HL1A 3PHYA 5FL3A 4RQ9A 1NYYA 1I2SA 1S1YA 3LEQA 2M7UA 1NZUA 2XGNA 3HLEA 1H8MA 5A93A 4DDSA 3SS5A 1M6KA 3A3EA 5L8MA 2J3TC 3F1NA 3P01A 3IHBA 4QD4A 2ZOHA 1TS0A 4R3BA 3FKWA 2INWA 4LV1A 5CHMA 1WE4A 2R9WA 1K56A 2PT7A 3C4OA 3PXPA 4QU3A 2E8JA 3BLMA 4YFMA 3P7NA 1Z09A 3MZFA 3HLBA 2ZQAA 3HREA 3O3VA 4I3JA 3GR2A 3F1OA 2XROA 2EA9A 5CHJA 5HWTA 1DP6A 2VX8A 3MZDA 1NY0A 2W1TA 3H7WA 1I2WA 3ZGAB 1Z6FA 5FATA 2V8CA 3MQQA 1RGZA 2PAVP 1TS6A 4B88A 1YT4A 3IH8A 2OWHA 2ZQ9A 1DJAA 1XJ3A 4HBTA 4X56A 5GLCA 4NXGA 4JXWA 5F69A 1M40A 1FSWA 2L1MA 2FZ0A 2M1CA 4OPQA 4Y5FA 2WZZA 3Q07A 2XD1A 4ZJ1A 1XKZA 5EOEA 2J8YA 3N8SA 3U4LP 1ES4A 3SW1A 3KO6A 4HIAA 1YLZA 1YLYA 3OLOA 2Y2IA 3F1OB 4DE2A 4KZAA 1LI9A 2ZC3B 4KG5A 5FAQA 5AQAA 2A3UA 3OC2A 2W1TB 3QNBA 3VP3A 3RTYA 2HP6A 3H7WB 5EVLA 5DF9A 4Y13A 3T1QB 4P0MA 1DP8A 3KX0X 4WL9A 3TE8A 4O7DA 4FOFA 1KGFA 4N1XA 5L2FA 2ACGA 5EM1A 1UWPX 4CLCC 2WAFA 3ZYTA 3S22A 3LR4A 4K0XA 4OH0A 2PYRA 4CLCA 4EEPA 2J3TD 4NETA 5DKLA 1LSXA 3FV7A 5EVID 1OTAA 1K4FA 1CK3A 3C30A 3VP4A 4LV3A 4KQDA 3KSGA 4MNRA 1H0MA 2A49A 3LIBA 5FI6A 3LIFA 3GRJA 5FASA 4X68A 4C3QA 4ID4A 3N8LA 4II7A 1IOUA 3T50A 3EQVA 2DNSA 3H82A 3IWIA 3MXSA 5FDHA 3C4PA 1MKIA 3BLSA 4PPRA 5AQ7A 5HW3A 1BLHA 1XJ4A 2W3GA 1Y28A 3G4PA 4MBKA 4C6YA 4HP9A 2P7JA 1J3WA 4LV0A 3Q7ZA 4UQIM 3BFCA 3AGFA 2WGWA 3V5MA 1YSPA 2DRWA 1N9NA 2XH9A 3HUOA 1CEGA 2W1RA 3RJUA 4CLCB 3G35A 4GHIB 4M3KA 4UQIS 5GHZA 4WM9A 3UE3A 1BYWA 4MBFA 2Y2MA 1S6RA 1Y54A 5CTMA 3NDGA 3CPTA 4OPRA 1BLSA 4IBRA 2WK0A 4GJ4A 5CGSA 1GSVA 2W3DA 1ES2A 2O9CA 4ZBEA 2Y2JA 2PDRA 5IS1A 2D02A 3NCKA 3ITBA 1OTEA 3SS3A 3H82B 4PM7A 3ZG8B 2PU2A 4NXFA 3B3XA 1BLPA 1ACFA 1NXYA 4S2PA 3GTCA 1PZOA 4BWIA 4PM8A 2MJ6A 3BJNA 2WKPA 2HDSA 1SKFA 2EX8A 2WGWB 2WYXA 3HJKA 3MR0A 3V3RA 2XD5A 4DF6A 3A3FA 3I7JA 3MKFA 5EPHA 3NJAA 4RYEA 5JYOA 3LR5A 2LB5A 1TEMA 4JF6A 3CPTB 4IVIA 4GZBA 1NRFA 3WWXA 4OQGA 1KVLA 1S66L 1I5QA 4EWFA 1PWDA 2ZC4B 2EXAA 4I5SA 4X6TA 1ZHHB 3UN7A 3NULA 3FWLA 2XSSA 2OWJA 3CAXA 4GS9A 4F3LA 5CEDA 3LFVA 4QWOA 3IXGA 3MBZA 1NZOA 1F5MA 2ZQCA 3MS6A 4BBUA 1L0GA 4FH4A 4FTXA 1E4DA 4DKIA 5AVEA 5E2GA 3W4OA 1YQSA 2EX2A 3ZCZA 1RCJA 2HJEA 1DJBA 3DW0A 4LPZA 3G6OA 1MZUA 3Q81A 4KZ5A 3IHAA 3KYZA 3CITA 4FUWA 3MXQA 3E2KA 4DXCA 5HPFA 2J80A 2I72A 4FCFA 4H6JA 3ZG0A 4LRZE 1XGIA 4NXEA 1ZTUA 1N9LA 1S1ZA 5F6AA 2H5SA 5CGWA 3HLGA 1P9WA 3LI8A 3QNCA 3BQ8A 2ZLYA 2DCFA 5DJUA 5GLBA 1FOFA 2QJ5A 1G68A 2H0TA 4UHUA 4XT2A 5EUAA 1TDGA 4GS9B 1MWRA 4F94A 4BL3A 4K08A 1W5DA 3FZCA 5G4YA 2NUTC 3U2AA 1KVMA 5KZHA 2XLNA 1O07A 3D4FA 3S1YA 3EGDC 3GDIA 4L9FA 3ZG9B 5G4ZA 3PBQA 4KZ6A 3NC8A 5MC7A 2PR6A 1PW1A 1XJ6A 2HPBA 2L4RA 1FCOA 5U47A 5F83A 4ESPA 3KYEA 5HSQA 2XA7M 2XQZA 1AWIA 4EBLA 4N9LA 3UB5P 3VP2A 3WRZA 3MQ0A 1H8ZA 2K2NA 1BLCA 4MN6A 3ZVWA 5BOHA 1KE0A 4H6JB 2XFTA 1LT0A 3HLFA 4L0LA 4X1LA 4GB7A 5KSCA 2XA7S 2BASA 1EWZA 2V9AA 4B4ZA 2O9BA 4WBGA 3TRCA 4OLDA 4JGOA 3IF6C 1S4RA 3M2KA 4GD8A 1JTDA 2PR5A 3EGXC 1WA9A 3NBLA 3PBNA 4XT2B 3IF6A 5HD5A 3DTMA 1XA7A 2ZMFA 3G34A 3BRMA 3PBTA 4NG2A 1LL9A 4PKYG 4GDBA 4ZTKA 3TOIA 3VE3A 4EBNA 3VMAA 2ZMAA 3M2JA 3CHWP 3LEZA 3NOTC 3Q1FA 3IXHA 1ES5A 3UMDA 3AGEA 3SZTA 1K25A 2V2FF 1K6RA 3ZG7B 4R70A 4RVAA 2K7SA 4K91A 1G6AA 4UEYA 3W4PA 2VV7A 4WYYA 5DKKA 5FA7A 1JNUA 3ICYA 3P98A 3C7VA 3BYDA 5J8XA 1ZG4A 5DF7A 4QY6A 4N92A 2QKPA 1MC0A 3MXRA 4JGQA 1TS7A 1HLUP 3KSHA 3RXXA 5F82A 5FSRA 3MJQA 1T1BA 4D60A 2XFSA 1JWPA 3DBAA 3SOIA 4WMCD 3GV9A 3BM6A 3ZQ5A 2EX6A 3GMWA 1MWTA 4JXSA 2WGVA 5GHYA 4XXRA 4GW9A 3OPLA 3IF6B 5DFYA 1WYCA 1TD5A 5CRFA 4ME4A 1IEMA 4DE0A 5FEGA 3JVVA 5GLDA 5CECA 5GLAA 3N4IA 3CG5A 2Y8HA 4R38A 1XJ2A 3PBOA 2GNXA 3UE1A 3DAVA 3S7OA 3FG8A 1ZC2A 3DTKA 4QB8A 3EOIA 2J9OA 1PI4A 3G2YA 2EFUA 4U3TA 3MZEA 1XPBA 4GD6A 2JCHA 3SH7A 5CEBA 4NXBA 1JWZA 4I38A 4KQQA 4ZRRA 3ZHHA 3W4QA 3N6IA 3CMZA 3ZG5A 4UA6A 3IWQA 3A3IA 1L2SA 3UB8A 3CWFA 1E3UA 2VGKA 4Y17A 5F68A 2O99A 2Q0OA 4IJGA 3A3DA 3BFFA 4OQHA 4OLGA 4WLAA 1CJFA 5L10A 3QP4A 2V1BA 5AJGA 4KG6A 1NWZA 2X01A 4HY8A 2J7VA 1XX2A 2VV6A 1FQGA 4S2LA 4G3VA 2EX9A 1STZA 4KENB 3UO9A 2PBYA 5EFWA 1C3BA 1K38A 1OT9A 4OOMA 3F1NB 1YPRA 1AXBA 1H3QA 1LL5A 4PM6A 4O01A 1BTLA 5HARA 3NY4A 2ZMVA 1FR1A 2QHKA 5TGFA 2VGJA 4UA9A 4HH3A 4ZDXA 2LB9A 3BY8A 1GHIA 5HD3A 4P87A 2WADA 5CXWA 2Z2MB 1MY8A 1VHMA 4G3WA 4IUKA 4Y3IA 2Z2LB 1G5UA 4HHDA 2DMWA 2ZC6B 4BL2A 3KSFA 1P9RA 1K57C 1VM1A 3OCNA 4Y2FA 1S67L 3Q7VA 1GA0A 2HZ5A 5CGXA 2WKRA 4JF4A 1K57A 2X02A 1WYBA 3D3OA 4X53A 2P74A 4IBXA 2HP9A 1TS8A 2KX6A 2C5WB 4R23A 2JE5A 3NIAA 3UDXA 5M1AA 1DY6A 4LRYC 2PU4A 3OPPA 3PYPA 1K56D 1UWNX 5DTSA 3TJZC 4EEUA 3VOLA 1MKMA 3QP8A 4BD0A 3HUMA 2Y55A 4BQMA 4LV2A 3UPPA 1K6SA 3LUQA 3F1PA 1F9IA 1NYMA 5HAQA 4M4XA 4Y7PA 5AQ9A 3S4XA 3IS2A 2C6WB 5J7EA 3Q82A 3HLCA 5E2HA 2J3WA 3PTEA 4QHCA 3VOYA 1QMFA 3EWKA 3Q7VB 1BSGA 2HP5A 5HL6A 3W8KA 3V50A 2QYBA 3T4LA 2BG1A 3N8RA 4BBTA 2Z6CA 4EUZA 4JXVA 5J4EA 1XXMA 5FDSA 2ZJ9A 5CTNA 4GN2A 3G30A 3HJIA 1K55C 2V1AA 4Y0UA 4YINA 2Y59A 2HDQA 3IH9A 1X0OA 1XFQA 2OAP1 1K55A 4JGRA 1VETA 4GLQA 2Z6DA 4OP8A 4HBUA 5HWWA 3T4QA 4B93A 1A0KA 4HEFA 4OQIA 3BECA 2K31A 3VP1A 4JLFA 1GA9A 3ISGA 4XUZA 2WKIA 5FQIA 1W79A 4R4SA 3BFGA 4DXBA 3LR0A 3F1PB 2ZBBA 4LGWA 2PBDP 4Q0HA 1KGEA 3IS2B 1LL8A 4ZJ2A 3WS2A 2PYPA 1ESIA 4BJPA 3NHQA 3PAEA 5HWVA 1GHPA 4O8GA 3LIAA 1YLWA 1IELA 4KUKA 5GL9A 1V9YA 5CX7A 3ZNTA 3V67A 1GSXA 4EV4A 1ERQA 4A5RA 1N9BA 1PFLA 1XP4A 2IA2A 4QY5A 3WS5A 4I3IA 3A3JA 4CLCD 1BT5A 3VOZA 1G28A 1GCEA 2VZWA 4N1HA 2O9AA 1OTBA 1J9MA 2Y2PA 3UDFA 4HJ6A 4LRXC 3JYIA 3L7HA 4MN5A 2JKRI 4HOIA 3A0VA 1LI0A 1VETB 3E4PA 3IF5A 2V1ZA 4S2IA 4CPKA 2IWBA 2JN7A 4WZ4A 1MWSA 1V9ZA 3BFDA 5KIZA 2G2UA 1MBLA 1VQQA 3IXDA 1L0EA 2G2WA 4KZ7A 2VA0A 3UPNA 3HUNA 3VSLA 3BEBA 2Y2GA 2O0YA 1ESUA 1MWUA 2W3EA 5AVFA 3LIDA 4DRTA 1IKIA 1IYPA 3RXWA 3IX8A 2JKTI 4S2NC 5FI2A 1OJGA 2WKEA 3IT9A 5TJJA 3ZFZA 2J9PA 4FD8A 3S7NA 2QPNA 3LI9A 4YOFA 4S2NA 1MPLA 5TBMA 3V39A 3DTIA 4GNUA 4X25A 4WEJA 3EEAA 3VSKA 4IVKA 2GJ3A 2PRFA 1ES3A 4DDYA 2ZM2A 1IFQA 3LICA 3G2ZA 2W3HA 2ZM0A 5DTKA 3BQAA 3OPRA 4D2OA 3C2WA 2VK3A 5I94A 1D1JA 2ZM8A 4Q8IA 1ONGA 3EEHA 5TFQA 4HESA 1N9OA 3A0SA 3IWOA 4P6ZM 5GHXA 3T4TA 3QP1A 4F3LB 1T1CA 3LR3A 3EQUA 4P6ZS 3QP2A 2Q9NA 1KOUA 5L07A 1LSWA 4EQ1A 1YAXA 4EBPA 5DF8A 4P6BA 3V3SA 3W2ZA 5TBMB 1F2KA 2ZC7A 3CI6A 3B47A 4NEED 3SH9A 3KYQA 3FKVA 3BY9A 1IYOA 4IHQA 2G7UA 4E6WA 4HH2A 5E43A 4R1GA 2OLVA 3B33A 5A8BA 5FI7A 5A90A 1JWVA 1KDSA 3NOPC 3R4KA 3S7PA
chains in the Genus database with same CATH topology
3N8LA 4KZ9A 1DJCA 1JWZA 3HLDA 3LO7A 4OP5A 4WZ5A 2ZQDA 3C7UA 1Q2PA 1ERMA 4KQQA 4U0TA 3ZHHA 3W4QA 3EQVA 4MEZA 2DNSA 3N6IA 3CMZA 3IWIA 4UA6A 3ZG5A 3IWQA 1SCWA 3A3IA 3MXSA 1RP5A 5FDHA 2Y91A 1L2SA 3C4PA 1MKIA 1E3UA 5CHUA 2VGKA 1IKGA 3BLSA 4PPRA 4PM5A 5AQ7A 1JTGA 5HW3A 1FCNA 4Y0OA 3DWZA 2Y2QA 4GKUA 1BLHA 3A3DA 3BFFA 4OQHA 4OLGA 4R0QA 3TSGA 5FQQA 1PI5A 4BENA 3G4PA 4E3NA 4KG6A 1JVJA 2XR0A 3LY4A 4MBKA 4X69A 4C6YA 1BULA 3M6HA 2X01A 1QMEA 2J7VA 4LV0A 3Q7ZA 1XX2A 1PW8A 1LLBA 4JBFA 1FQGA 4S2LA 3BFCA 2EX9A 5HAIA 1LHYA 3AGFA 4KENB 2WGIA 1PZPA 2PBYA 3UO9A 1C3BA 1K38A 2WGWA 4OOMA 2DRWA 3LCEA 4RA7A 3V5MA 4OOLA 2XH9A 4JPMA 1IYQA 1CI9A 3HUOA 1CEFA 4S2JA 1CEGA 1AXBA 4BLMA 1LL5A 3RJUA 4PM6A 3HLWA 4CJNA 1BTLA 5HARA 3NY4A 2Y2HA 3G35A 2IWDA 4M3KA 1FR1A 3CZDA 4WM9A 5FQ9A 5GHZA 4UAAA 5TGFA 3UE3A 2VGJA 1HZOA 4FSFA 2X71A 1W8QA 4MBFA 4UA9A 2GDNA 1OMEA 2Y2MA 1S6RA 3IXBA 4FH2A 3ZDJA 1Y54A 4ZDXA 5CTMA 5M18A 1GHIA 3NDGA 3UY6A 4OPRA 1BLSA 4P87A 2WADA 3IQAA 2Z2MB 1MY8A 2WK0A 4IBRA 4LCMA 4KZ4A 1KDWA 5CXWA 4LENA 3OCLA 1PYYA 2Z2LB 5CGSA 2UWXA 1ES2A 4GDNA 2ZC6B 4BL2A 4Y0TA 1K57C 1VM1A 3OCNA 4ZBEA 4X55A 1W8YA 2FFYA 3Q7VA 2HDUA 1GA0A 2Y2JA 2QMIA 3NI9A 5CGXA 3OPHA 5KSHA 4ZJ3A 4JF4A 1K57A 3NCKA 2X02A 4OQ0A 4S2MA 5M19A 3ITBA 1YMXA 3UE0A 1H8YA 3SS3A 1WYBA 4PM7A 1TDLA 1YM1A 4X53A 3ZG8B 2PU2A 3B3XA 1BLPA 4OPZA 3G31A 2ZD8A 2P74A 5A92A 2ZQ8A 4IBXA 2HP9A 1NXYA 4N9KA 4S2PA 3GTCA 2C5WB 4R23A 3ZVTA 1PZOA 2JE5A 2ZQ7A 4B4XA 5KMWA 3HVFA 3NIAA 3GSGA 4WMCA 1SDEA 3UDXA 2IWCA 2WAEA 5M1AA 3SH8A 1DY6A 4E3KA 1FCMA 4PM8A 2PU4A 1L0DA 1XGJA 3OPPA 3BFEA 4WELA 1K56D 2HDSA 3CJMA 5DTSA 1SKFA 5JYPA 2EX8A 2WGWB 2WYXA 3FYZA 3PBRA 3WS0A 1H5XA 3V3RA 2XD5A 5EVIC 4DF6A 4KZ3A 3UNWA 4BD0A 3A3FA 1ZG6A 3HUMA 3I7JA 5E2EA 2Y55A 3C5AA 4RX2A 4DE1A 1PIOA 2P9VA 4K0WA 3MKFA 4U0XA 4LCLA 4WZ5C 5EPHA 4LV2A 2CC1A 3UPPA 3VFFA 3LY3A 4BQMA 2Y2KA 5EVIA 4RYEA 5JYOA 1K6SA 1HD8A 3AGDA 5HX9A 1NYMA 5HAQA 4Y7PA 3S4XA 2H0YA 1HVBA 5AQ9A 1TEMA 4JF6A 1KE4A 2C6WB 4IVIA 4GZBA 3Q82A 3HLCA 1NRFA 3WWXA 4OQGA 5E2HA 1KVLA 1I5QA 1K4EA 4EWFA 1PWDA 2ZC4B 2EXAA 1YLPA 3PTEA 4QHCA 4E6XA 3VOYA 1K54C 4X6TA 1QMFA 4XUXA 3Q7VB 1BSGA 4KQRA 2JBFA 2HP5A 3W8KA 3UN7A 3FWLA 3O86A 3PBSA 3V50A 2BG1A 1K54A 5CEDA 3N8RA 3MFDA 1GHMA 3WS1A 4EUZA 3IXGA 3MBZA 4JXVA 1NZOA 3QHYA 2ZQCA 1L0GA 4FH4A 4R4RA 4E3MA 1XXMA 5FAPA 1E4DA 4DKIA 5DVAA 2H10A 3OZHA 1FR6A 5E2GA 3W4OA 2XDMA 2OV5A 1YQSA 2ZJ9A 1EROA 2EX2A 5CTNA 4GN2A 3G30A 5CERA 4OPYA 3VFHA 1K55C 4ZAMA 2EXBA 3O87A 5DTTA 4Y0UA 4YINA 3ZCZA 1RCJA 1PWCA 2Y59A 4DE3A 1SDNA 1DJBA 4S2KA 5FQMA 2HDQA 3IH9A 2XF3A 3DW0A 1CI8A 3Q81A 3UDIA 1K55A 4KZ5A 3IHAA 5EOOA 5FAOA 4RX3A 1FSYA 3E2KA 4DXCA 4OP8A 1ZKJA 4E3JA 1S0WA 2I72A 4HBUA 3ZNYA 5EE8A 4HEFA 4OQIA 4FCFA 1Q2QA 3BECA 1YLTA 1SHVA 5A91A 3VP1A 1TVFA 2V20A 4JLFA 1GA9A 2P9VB 3ISGA 3ZG0A 4XUZA 1XGIA 2WKIA 5FQIA 2XK1A 1W79A 5EVIB 1YMSA 4R4SA 3BFGA 3GVBA 3SS4A 2Y4AA 4DXBA 4EQIA 2WZXA 1KGEA 2H5SA 5CGWA 3HLGA 4ZJ2A 3QNCA 2Q9MA 3P09A 3WS2A 1U60A 2ZLYA 1ESIA 2DCFA 2E8IA 5GLBA 1FOFA 2ZC5B 4BJPA 2WKHA 3PAEA 4WEKA 1GHPA 5HL1A 1YLWA 1IELA 1G68A 2H0TA 3HBRA 5GL9A 4UHUA 1N4OA 5G18A 5EUAA 5F1FA 3ZNTA 4R3JA 1NYYA 1I2SA 1TDGA 2BLSA 5FQKA 4EV4A 1MWRA 4F94A 1NZUA 1ERQA 2XGNA 3HLEA 4A5RA 1N9BA 5A93A 4BL3A 4DDSA 1XP4A 3SS5A 1W5DA 4QY5A 3WS5A 3A3JA 1M6KA 3FZCA 1BT5A 1KVMA 3VOZA 5KZHA 1GCEA 2XLNA 1O07A 3D4FA 3S1YA 3A3EA 1ONHA 4N1HA 2JC7A 1J9MA 3G32A 2Y2PA 4OVDA 1XA1A 3UDFA 3JYIA 5FQJA 3ZG9B 4UA7A 3NDEA 3IHBA 3GQZA 3PBQA 4QD4A 4KZ6A 3NC8A 1HTZA 4R3BA 1PW1A 2HPBA 3FKWA 1FCOA 4LV1A 1BUEA 1WE4A 5CHMA 4Z9QA 5F83A 2R9WA 5U47A 1K56A 3C4OA 4QU3A 4QJGA 3UPOA 3BLMA 4YFMA 1ALQA 2XQZA 3MZFA 4EBLA 4N9LA 1LI0A 4IEDA 3IF5A 5EECA 2V1ZA 3HLBA 4S2IA 1BZAA 4CPKA 3VP2A 3WRZA 5IHVA 2ZQAA 4JKTA 1EI5A 2IWBA 3HREA 1H8ZA 3O3VA 4WZ4A 1L0FA 1MWSA 1BLCA 3GR2A 3ZVWA 4KZBA 5BOHA 1KE0A 4KZ8A 2XFTA 3BFDA 3HLFA 3E2LA 4JXGA 4L0LA 2G2UA 1E3UD 4GB7A 5KSCA 1MBLA 5CHJA 1EWZA 1VQQA 1KGGA 3IXDA 1L0EA 2G2WA 4KZ7A 4B4ZA 3MZDA 1NY0A 4WBGA 3UPNA 3HUNA 3VSLA 4OLDA 3BEBA 4MBHA 2Y2GA 3N7WA 1ESUA 1I2WA 1MWUA 3ZGAB 1Z6FA 3IF6C 3VP0A 2R9XA 4DRTA 1IKIA 1IYPA 5FATA 3M2KA 4GD8A 4KQOA 1JTDA 1RGZA 3RXWA 2B5RA 3NBLA 3PBNA 4S2NC 5FI2A 4B88A 1YT4A 3IF6A 1W7FA 2WKEA 3IT9A 3DTMA 3IH8A 4P85A 1XA7A 3ZFZA 3DWKA 2J9PA 4FD8A 2QPNA 2ZQ9A 3G34A 3HL9A 4S2OA 5F1GA 1DJAA 5AQBA 4HBTA 1MPLA 4S2NA 3BRMA 4X56A 3PBTA 5GLCA 3ITAA 1LL9A 4JXWA 5TR7A 4E3LA 4GDBA 4ZTKA 3V39A 3TOIA 1M40A 4EBNA 4GNUA 5D3OA 1FSWA 3VMAA 2ZMAA 3M2JA 5E2FA 4WEJA 3VSKA 4OPQA 3LEZA 2QZ6A 4PMAA 3Q1FA 3IXHA 4IVKA 1ES5A 2FFFB 3AGEA 1K25A 2RCXA 1ES3A 2V2FF 4DDYA 1K6RA 2OSUA 2ZM2A 3ZG7B 4RVAA 1IYSA 2WZZA 3Q07A 4K91A 3G2ZA 1G6AA 2ZM0A 5DTKA 3W4PA 4WYYA 3OPRA 4BD1A 5FA7A 2XD1A 4ZJ1A 1XKZA 4E3OA 4JF5A 3P98A 5EOEA 2J8YA 3C7VA 3N8SA 4D2OA 3BYDA 3M6BA 1ES4A 1O7EA 3TG9A 1YLJA 5J8XA 1ZG4A 5DF7A 5I94A 4KG2A 2ZM8A 1YLZA 4Q8IA 4H8RA 4MLLA 1ONGA 1YLYA 4N92A 4QY6A 5TFQA 4OOYA 4HESA 3WS4A 3IWOA 3MXRA 2Y2IA 3O88A 4DE2A 5HAPA 5GHXA 1KE3A 4KZAA 1LI9A 3RXXA 2ZC3B 4KG5A 5FAQA 5AQAA 4GOGA 5HFOA 5F82A 2A3UA 5FSRA 1RGYA 4NK3A 3OC2A 2XFSA 1JWPA 3QNBA 3VP3A 2HP6A 3SOIA 4WMCD 3GV9A 3BM6A 5EVLA 2EX6A 3GMWA 5DF9A 1MWTA 3EQUA 4JXSA 2WGVA 4P0MA 5GHYA 1NJ4A 4XXRA 4O7DA 2Q9NA 1KGFA 4N1XA 3OPLA 5L2FA 2Y2OA 3PAGA 3IF6B 2WAFA 1WYCA 1E25A 3S22A 5CRFA 4EBPA 4K0XA 2Y2LA 4P6BA 4PM9A 5DF8A 3V3SA 4OH0A 3WRTA 2WUQA 1IEMA 2Y2NA 1MXOA 4DE0A 4C75A 5GLDA 5CECA 5GLAA 3N4IA 2RL3A 2EFXA 2ZC7A 3CG5A 4NETA 3SH9A 4E3IA 3FV7A 5EVID 3FKVA 1IYOA 2HDRA 3PBOA 3UE1A 2OLUA 1K4FA 1ZC2A 4E6WA 1CK3A 3VP4A 4QB8A 2J9OA 5E43A 4LV3A 2OLVA 1PI4A 4R1GA 4OONA 3G2YA 4MNRA 5FI7A 2EFUA 2A49A 5A90A 2XEPA 1JWVA 1KDSA 4U3TA 5FI6A 4OKPA 3MZEA 1XPBA 3MKEA 3GRJA 4GD6A 2JCHA 5FASA 3SH7A 5CEBA 1PWGA 4X68A 4C3QA 4ID4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8L A;  4KZ9 A;  1DJC A;  1JWZ A;  3HLD A;  3LO7 A;  4OP5 A;  4WZ5 A;  2ZQD A;  3C7U A;  1Q2P A;  1ERM A;  4KQQ A;  4U0T A;  3ZHH A;  3W4Q A;  3EQV A;  4MEZ A;  2DNS A;  3N6I A;  3CMZ A;  3IWI A;  4UA6 A;  3ZG5 A;  3IWQ A;  1SCW A;  3A3I A;  3MXS A;  1RP5 A;  5FDH A;  2Y91 A;  1L2S A;  3C4P A;  1MKI A;  1E3U A;  5CHU A;  2VGK A;  1IKG A;  3BLS A;  4PPR A;  4PM5 A;  5AQ7 A;  1JTG A;  5HW3 A;  1FCN A;  4Y0O A;  3DWZ A;  2Y2Q A;  4GKU A;  1BLH A;  3A3D A;  3BFF A;  4OQH A;  4OLG A;  4R0Q A;  3TSG A;  5FQQ A;  1PI5 A;  4BEN A;  3G4P A;  4E3N A;  4KG6 A;  1JVJ A;  2XR0 A;  3LY4 A;  4MBK A;  4X69 A;  4C6Y A;  1BUL A;  3M6H A;  2X01 A;  1QME A;  2J7V A;  4LV0 A;  3Q7Z A;  1XX2 A;  1PW8 A;  1LLB A;  4JBF A;  1FQG A;  4S2L A;  3BFC A;  2EX9 A;  5HAI A;  1LHY A;  3AGF A;  4KEN B;  2WGI A;  1PZP A;  2PBY A;  3UO9 A;  1C3B A;  1K38 A;  2WGW A;  4OOM A;  2DRW A;  3LCE A;  4RA7 A;  3V5M A;  4OOL A;  2XH9 A;  4JPM A;  1IYQ A;  1CI9 A;  3HUO A;  1CEF A;  4S2J A;  1CEG A;  1AXB A;  4BLM A;  1LL5 A;  3RJU A;  4PM6 A;  3HLW A;  4CJN A;  1BTL A;  5HAR A;  3NY4 A;  2Y2H A;  3G35 A;  2IWD A;  4M3K A;  1FR1 A;  3CZD A;  4WM9 A;  5FQ9 A;  5GHZ A;  4UAA A;  5TGF A;  3UE3 A;  2VGJ A;  1HZO A;  4FSF A;  2X71 A;  1W8Q A;  4MBF A;  4UA9 A;  2GDN A;  1OME A;  2Y2M A;  1S6R A;  3IXB A;  4FH2 A;  3ZDJ A;  1Y54 A;  4ZDX A;  5CTM A;  5M18 A;  1GHI A;  3NDG A;  3UY6 A;  4OPR A;  1BLS A;  4P87 A;  2WAD A;  3IQA A;  2Z2M B;  1MY8 A;  2WK0 A;  4IBR A;  4LCM A;  4KZ4 A;  1KDW A;  5CXW A;  4LEN A;  3OCL A;  1PYY A;  2Z2L B;  5CGS A;  2UWX A;  1ES2 A;  4GDN A;  2ZC6 B;  4BL2 A;  4Y0T A;  1K57 C;  1VM1 A;  3OCN A;  4ZBE A;  4X55 A;  1W8Y A;  2FFY A;  3Q7V A;  2HDU A;  1GA0 A;  2Y2J A;  2QMI A;  3NI9 A;  5CGX A;  3OPH A;  5KSH A;  4ZJ3 A;  4JF4 A;  1K57 A;  3NCK A;  2X02 A;  4OQ0 A;  4S2M A;  5M19 A;  3ITB A;  1YMX A;  3UE0 A;  1H8Y A;  3SS3 A;  1WYB A;  4PM7 A;  1TDL A;  1YM1 A;  4X53 A;  3ZG8 B;  2PU2 A;  3B3X A;  1BLP A;  4OPZ A;  3G31 A;  2ZD8 A;  2P74 A;  5A92 A;  2ZQ8 A;  4IBX A;  2HP9 A;  1NXY A;  4N9K A;  4S2P A;  3GTC A;  2C5W B;  4R23 A;  3ZVT A;  1PZO A;  2JE5 A;  2ZQ7 A;  4B4X A;  5KMW A;  3HVF A;  3NIA A;  3GSG A;  4WMC A;  1SDE A;  3UDX A;  2IWC A;  2WAE A;  5M1A A;  3SH8 A;  1DY6 A;  4E3K A;  1FCM A;  4PM8 A;  2PU4 A;  1L0D A;  1XGJ A;  3OPP A;  3BFE A;  4WEL A;  1K56 D;  2HDS A;  3CJM A;  5DTS A;  1SKF A;  5JYP A;  2EX8 A;  2WGW B;  2WYX A;  3FYZ A;  3PBR A;  3WS0 A;  1H5X A;  3V3R A;  2XD5 A;  5EVI C;  4DF6 A;  4KZ3 A;  3UNW A;  4BD0 A;  3A3F A;  1ZG6 A;  3HUM A;  3I7J A;  5E2E A;  2Y55 A;  3C5A A;  4RX2 A;  4DE1 A;  1PIO A;  2P9V A;  4K0W A;  3MKF A;  4U0X A;  4LCL A;  4WZ5 C;  5EPH A;  4LV2 A;  2CC1 A;  3UPP A;  3VFF A;  3LY3 A;  4BQM A;  2Y2K A;  5EVI A;  4RYE A;  5JYO A;  1K6S A;  1HD8 A;  3AGD A;  5HX9 A;  1NYM A;  5HAQ A;  4Y7P A;  3S4X A;  2H0Y A;  1HVB A;  5AQ9 A;  1TEM A;  4JF6 A;  1KE4 A;  2C6W B;  4IVI A;  4GZB A;  3Q82 A;  3HLC A;  1NRF A;  3WWX A;  4OQG A;  5E2H A;  1KVL A;  1I5Q A;  1K4E A;  4EWF A;  1PWD A;  2ZC4 B;  2EXA A;  1YLP A;  3PTE A;  4QHC A;  4E6X A;  3VOY A;  1K54 C;  4X6T A;  1QMF A;  4XUX A;  3Q7V B;  1BSG A;  4KQR A;  2JBF A;  2HP5 A;  3W8K A;  3UN7 A;  3FWL A;  3O86 A;  3PBS A;  3V50 A;  2BG1 A;  1K54 A;  5CED A;  3N8R A;  3MFD A;  1GHM A;  3WS1 A;  4EUZ A;  3IXG A;  3MBZ A;  4JXV A;  1NZO A;  3QHY A;  2ZQC A;  1L0G A;  4FH4 A;  4R4R A;  4E3M A;  1XXM A;  5FAP A;  1E4D A;  4DKI A;  5DVA A;  2H10 A;  3OZH A;  1FR6 A;  5E2G A;  3W4O A;  2XDM A;  2OV5 A;  1YQS A;  2ZJ9 A;  1ERO A;  2EX2 A;  5CTN A;  4GN2 A;  3G30 A;  5CER A;  4OPY A;  3VFH A;  1K55 C;  4ZAM A;  2EXB A;  3O87 A;  5DTT A;  4Y0U A;  4YIN A;  3ZCZ A;  1RCJ A;  1PWC A;  2Y59 A;  4DE3 A;  1SDN A;  1DJB A;  4S2K A;  5FQM A;  2HDQ A;  3IH9 A;  2XF3 A;  3DW0 A;  1CI8 A;  3Q81 A;  3UDI A;  1K55 A;  4KZ5 A;  3IHA A;  5EOO A;  5FAO A;  4RX3 A;  1FSY A;  3E2K A;  4DXC A;  4OP8 A;  1ZKJ A;  4E3J A;  1S0W A;  2I72 A;  4HBU A;  3ZNY A;  5EE8 A;  4HEF A;  4OQI A;  4FCF A;  1Q2Q A;  3BEC A;  1YLT A;  1SHV A;  5A91 A;  3VP1 A;  1TVF A;  2V20 A;  4JLF A;  1GA9 A;  2P9V B;  3ISG A;  3ZG0 A;  4XUZ A;  1XGI A;  2WKI A;  5FQI A;  2XK1 A;  1W79 A;  5EVI B;  1YMS A;  4R4S A;  3BFG A;  3GVB A;  3SS4 A;  2Y4A A;  4DXB A;  4EQI A;  2WZX A;  1KGE A;  2H5S A;  5CGW A;  3HLG A;  4ZJ2 A;  3QNC A;  2Q9M A;  3P09 A;  3WS2 A;  1U60 A;  2ZLY A;  1ESI A;  2DCF A;  2E8I A;  5GLB A;  1FOF A;  2ZC5 B;  4BJP A;  2WKH A;  3PAE A;  4WEK A;  1GHP A;  5HL1 A;  1YLW A;  1IEL A;  1G68 A;  2H0T A;  3HBR A;  5GL9 A;  4UHU A;  1N4O A;  5G18 A;  5EUA A;  5F1F A;  3ZNT A;  4R3J A;  1NYY A;  1I2S A;  1TDG A;  2BLS A;  5FQK A;  4EV4 A;  1MWR A;  4F94 A;  1NZU A;  1ERQ A;  2XGN A;  3HLE A;  4A5R A;  1N9B A;  5A93 A;  4BL3 A;  4DDS A;  1XP4 A;  3SS5 A;  1W5D A;  4QY5 A;  3WS5 A;  3A3J A;  1M6K A;  3FZC A;  1BT5 A;  1KVM A;  3VOZ A;  5KZH A;  1GCE A;  2XLN A;  1O07 A;  3D4F A;  3S1Y A;  3A3E A;  1ONH A;  4N1H A;  2JC7 A;  1J9M A;  3G32 A;  2Y2P A;  4OVD A;  1XA1 A;  3UDF A;  3JYI A;  5FQJ A;  3ZG9 B;  4UA7 A;  3NDE A;  3IHB A;  3GQZ A;  3PBQ A;  4QD4 A;  4KZ6 A;  3NC8 A;  1HTZ A;  4R3B A;  1PW1 A;  2HPB A;  3FKW A;  1FCO A;  4LV1 A;  1BUE A;  1WE4 A;  5CHM A;  4Z9Q A;  5F83 A;  2R9W A;  5U47 A;  1K56 A;  3C4O A;  4QU3 A;  4QJG A;  3UPO A;  3BLM A;  4YFM A;  1ALQ A;  2XQZ A;  3MZF A;  4EBL A;  4N9L A;  1LI0 A;  4IED A;  3IF5 A;  5EEC A;  2V1Z A;  3HLB A;  4S2I A;  1BZA A;  4CPK A;  3VP2 A;  3WRZ A;  5IHV A;  2ZQA A;  4JKT A;  1EI5 A;  2IWB A;  3HRE A;  1H8Z A;  3O3V A;  4WZ4 A;  1L0F A;  1MWS A;  1BLC A;  3GR2 A;  3ZVW A;  4KZB A;  5BOH A;  1KE0 A;  4KZ8 A;  2XFT A;  3BFD A;  3HLF A;  3E2L A;  4JXG A;  4L0L A;  2G2U A;  1E3U D;  4GB7 A;  5KSC A;  1MBL A;  5CHJ A;  1EWZ A;  1VQQ A;  1KGG A;  3IXD A;  1L0E A;  2G2W A;  4KZ7 A;  4B4Z A;  3MZD A;  1NY0 A;  4WBG A;  3UPN A;  3HUN A;  3VSL A;  4OLD A;  3BEB A;  4MBH A;  2Y2G A;  3N7W A;  1ESU A;  1I2W A;  1MWU A;  3ZGA B;  1Z6F A;  3IF6 C;  3VP0 A;  2R9X A;  4DRT A;  1IKI A;  1IYP A;  5FAT A;  3M2K A;  4GD8 A;  4KQO A;  1JTD A;  1RGZ A;  3RXW A;  2B5R A;  3NBL A;  3PBN A;  4S2N C;  5FI2 A;  4B88 A;  1YT4 A;  3IF6 A;  1W7F A;  2WKE A;  3IT9 A;  3DTM A;  3IH8 A;  4P85 A;  1XA7 A;  3ZFZ A;  3DWK A;  2J9P A;  4FD8 A;  2QPN A;  2ZQ9 A;  3G34 A;  3HL9 A;  4S2O A;  5F1G A;  1DJA A;  5AQB A;  4HBT A;  1MPL A;  4S2N A;  3BRM A;  4X56 A;  3PBT A;  5GLC A;  3ITA A;  1LL9 A;  4JXW A;  5TR7 A;  4E3L A;  4GDB A;  4ZTK A;  3V39 A;  3TOI A;  1M40 A;  4EBN A;  4GNU A;  5D3O A;  1FSW A;  3VMA A;  2ZMA A;  3M2J A;  5E2F A;  4WEJ A;  3VSK A;  4OPQ A;  3LEZ A;  2QZ6 A;  4PMA A;  3Q1F A;  3IXH A;  4IVK A;  1ES5 A;  2FFF B;  3AGE A;  1K25 A;  2RCX A;  1ES3 A;  2V2F F;  4DDY A;  1K6R A;  2OSU A;  2ZM2 A;  3ZG7 B;  4RVA A;  1IYS A;  2WZZ A;  3Q07 A;  4K91 A;  3G2Z A;  1G6A A;  2ZM0 A;  5DTK A;  3W4P A;  4WYY A;  3OPR A;  4BD1 A;  5FA7 A;  2XD1 A;  4ZJ1 A;  1XKZ A;  4E3O A;  4JF5 A;  3P98 A;  5EOE A;  2J8Y A;  3C7V A;  3N8S A;  4D2O A;  3BYD A;  3M6B A;  1ES4 A;  1O7E A;  3TG9 A;  1YLJ A;  5J8X A;  1ZG4 A;  5DF7 A;  5I94 A;  4KG2 A;  2ZM8 A;  1YLZ A;  4Q8I A;  4H8R A;  4MLL A;  1ONG A;  1YLY A;  4N92 A;  4QY6 A;  5TFQ A;  4OOY A;  4HES A;  3WS4 A;  3IWO A;  3MXR A;  2Y2I A;  3O88 A;  4DE2 A;  5HAP A;  5GHX A;  1KE3 A;  4KZA A;  1LI9 A;  3RXX A;  2ZC3 B;  4KG5 A;  5FAQ A;  5AQA A;  4GOG A;  5HFO A;  5F82 A;  2A3U A;  5FSR A;  1RGY A;  4NK3 A;  3OC2 A;  2XFS A;  1JWP A;  3QNB A;  3VP3 A;  2HP6 A;  3SOI A;  4WMC D;  3GV9 A;  3BM6 A;  5EVL A;  2EX6 A;  3GMW A;  5DF9 A;  1MWT A;  3EQU A;  4JXS A;  2WGV A;  4P0M A;  5GHY A;  1NJ4 A;  4XXR A;  4O7D A;  2Q9N A;  1KGF A;  4N1X A;  3OPL A;  5L2F A;  2Y2O A;  3PAG A;  3IF6 B;  2WAF A;  1WYC A;  1E25 A;  3S22 A;  5CRF A;  4EBP A;  4K0X A;  2Y2L A;  4P6B A;  4PM9 A;  5DF8 A;  3V3S A;  4OH0 A;  3WRT A;  2WUQ A;  1IEM A;  2Y2N A;  1MXO A;  4DE0 A;  4C75 A;  5GLD A;  5CEC A;  5GLA A;  3N4I A;  2RL3 A;  2EFX A;  2ZC7 A;  3CG5 A;  4NET A;  3SH9 A;  4E3I A;  3FV7 A;  5EVI D;  3FKV A;  1IYO A;  2HDR A;  3PBO A;  3UE1 A;  2OLU A;  1K4F A;  1ZC2 A;  4E6W A;  1CK3 A;  3VP4 A;  4QB8 A;  2J9O A;  5E43 A;  4LV3 A;  2OLV A;  1PI4 A;  4R1G A;  4OON A;  3G2Y A;  4MNR A;  5FI7 A;  2EFU A;  2A49 A;  5A90 A;  2XEP A;  1JWV A;  1KDS A;  4U3T A;  5FI6 A;  4OKP A;  3MZE A;  1XPB A;  3MKE A;  3GRJ A;  4GD6 A;  2JCH A;  5FAS A;  3SH7 A;  5CEB A;  1PWG A;  4X68 A;  4C3Q A;  4ID4 A; 
#chains in the Genus database with same CATH topology
 3MMH A;  4KZ9 A;  3LO7 A;  4WZ5 A;  2ZQD A;  3C7U A;  3RFB A;  1Q2P A;  1ERM A;  4U0T A;  4ARZ A;  1SZV A;  1SCW A;  1NLZ A;  2P08 A;  1RP5 A;  2Y91 A;  4I3A A;  4Y0O A;  3DWZ A;  1XFN A;  2OOL A;  3TSG A;  4E3N A;  2A24 A;  1QME A;  4MDZ A;  1LLB A;  4JBF A;  1T19 A;  3K2N A;  1IYQ A;  1CI9 A;  1OTD A;  4BLM A;  1TF1 A;  4Y15 A;  3C38 A;  3HLW A;  2Y2H A;  5FQ9 A;  4UAA A;  3KSI A;  1HZO A;  4FSF A;  2X71 A;  1W8Q A;  2GDN A;  1OME A;  2PD8 A;  4FH2 A;  5HPI A;  3UY6 A;  4B9O A;  3OCL A;  2UWX A;  4GDN A;  4Y0T A;  2FFY A;  2HDU A;  3S7Q A;  3OPH A;  1K0K A;  5M19 A;  4OQ0 A;  1YMX A;  3UE0 A;  1H8Y A;  4ARZ B;  3TW8 A;  1TDL A;  5HDC A;  5HDD A;  2JKG A;  3C8C A;  5EV0 A;  2ZQ8 A;  1Y4O A;  4N9K A;  2KOI A;  2ZQ7 A;  5IU1 A;  2IWC A;  4CLC E;  3SH8 A;  2A24 B;  4E3K A;  1FCM A;  1L0D A;  1XGJ A;  3BFE A;  2WKQ A;  4EET B;  3CJM A;  4EXO A;  5JYP A;  1VEU A;  3PBR A;  5EVI C;  1ZG6 A;  3C5A A;  4RX2 A;  4DE1 A;  4LCL A;  2CC1 A;  5EVI A;  2HV1 A;  1YSQ A;  4AFI A;  3AGD A;  5HX9 A;  1HVB A;  1KE4 A;  1K4E A;  3T4O A;  1YLP A;  4KQR A;  2JBF A;  4DJ3 A;  3O86 A;  2YKH A;  3PBS A;  2VKS A;  3MFD A;  1GHM A;  2W27 A;  5FAP A;  2D01 A;  3CUE C;  5F5Y A;  5DVA A;  4DJ2 A;  3OZH A;  1FR6 A;  2XDM A;  1ERO A;  1NRJ A;  1NLY A;  2H28 A;  5CER A;  3QP5 A;  3T4J A;  3VFH A;  1P0Z A;  1DP9 A;  3CUE A;  4HQA A;  4PAU A;  1PWC A;  4DE3 A;  5FQM A;  5LBR A;  2XF3 A;  4ETZ A;  2B95 A;  3CLO A;  1CI8 A;  3MF0 A;  5FAO A;  4RX3 A;  1VEU B;  4KUO A;  2KDK A;  3ZNY A;  4LLO B;  1Q2Q A;  1YLT A;  5A91 A;  3UB9 A;  1GSW A;  2V20 A;  3FPW A;  3T4K A;  5EVI B;  1YMS A;  3GVB A;  5EM0 A;  4EQI A;  2WZX A;  3LYX A;  2PHY A;  3QP6 A;  4EER A;  4Q0I A;  2ZC5 B;  2WKH A;  2VLG A;  1ODV A;  3DTE A;  3IX3 A;  2A2L A;  3HBR A;  1N4O A;  5G18 A;  5F1F A;  4R3J A;  2BLS A;  5FQK A;  3L9K A;  1CF0 A;  1D06 A;  2XRN A;  2I9V A;  1ONH A;  2JC7 A;  3G32 A;  2VGL M;  4OVD A;  1XA1 A;  4DMZ A;  5FQJ A;  4UA7 A;  3NDE A;  3GQZ A;  1P97 A;  1HTZ A;  1SKO A;  3LIE A;  1FIK A;  4HNB A;  1BUE A;  4GHI A;  4Z9Q A;  3UPO A;  4QJG A;  1FIL A;  2VGL S;  3T1S A;  1ALQ A;  2V0W A;  4IED A;  5EEC A;  1BZA A;  5IHV A;  4JKT A;  1EI5 A;  4EU0 A;  4I39 A;  1L0F A;  4KZB A;  4KZ8 A;  2CMN A;  3VE4 A;  3UME A;  3E2L A;  2ZL1 A;  4JXG A;  4ETX A;  1E3U D;  1W63 M;  1KGG A;  2FH5 A;  4MBH A;  3N7W A;  2QWS A;  2HF6 A;  5EVE A;  3VP0 A;  2R9X A;  4EUV A;  3IX4 A;  4KQO A;  2QJ7 A;  2B5R A;  1OT6 A;  1W7F A;  1F98 A;  4P85 A;  3DWK A;  3R7W A;  3FPV A;  3HL9 A;  4Q0J A;  3OBF A;  4S2O A;  5F1G A;  5AQB A;  5TR7 A;  4E3L A;  3ITA A;  5D3O A;  5E2F A;  2QZ6 A;  4PMA A;  2FFF B;  2RCX A;  4X1M A;  4HI4 A;  2OSU A;  3JPU A;  1IYS A;  1SKO B;  4BD1 A;  5IT5 A;  3D9Y A;  3E98 A;  4HJ3 A;  2ZOI A;  4E3O A;  4JF5 A;  4EES A;  3NEC A;  3M6B A;  1O7E A;  3TG9 A;  1YLJ A;  2VEA A;  2NUP C;  4KG2 A;  3O5Y A;  4H8R A;  4MLL A;  4L9G A;  1T1A A;  3T4S A;  5K5B A;  4OOY A;  3ULF A;  3WS4 A;  3T12 B;  3O88 A;  5HAP A;  2ZL1 B;  1KE3 A;  4O0P A;  2V8F A;  4HJ4 A;  5HFO A;  3A0R A;  4GOG A;  1RGY A;  4NK3 A;  2M7V A;  3E0Y A;  1NJ4 A;  3K3D A;  2Y2O A;  3PAG A;  4NKP A;  1E25 A;  3R7W B;  1PNE A;  2Y2L A;  2JHE A;  4PM9 A;  1W63 Q;  3WRT A;  2WUQ A;  2Y2N A;  1MXO A;  2YKF A;  2AVX A;  4Z1W A;  4C75 A;  1EW0 A;  2RL3 A;  2EFX A;  4WUJ A;  4E3I A;  2HDR A;  2VJW A;  2OLU A;  3BW6 A;  3MQO A;  4OON A;  3D72 A;  2BTF P;  2XEP A;  4MCW A;  4OKP A;  4BBV A;  2JKR M;  5I5L A;  3MKE A;  3B42 A;  1PWG A;  4MMN A;  1DJC A;  1LSV A;  3HLD A;  4OP5 A;  1OJ5 A;  2P04 A;  4HP4 A;  4MEZ A;  3FC7 A;  5CHU A;  4MN7 A;  1IKG A;  4PM5 A;  1JTG A;  1FCN A;  2EWV A;  2OAQ 1;  2Y2Q A;  4GKU A;  4R0Q A;  5FQQ A;  1PI5 A;  1S4S A;  4BEN A;  1VB6 A;  1JVJ A;  2XR0 A;  3LY4 A;  4QPR A;  4X69 A;  1BUL A;  3M6H A;  3T1X A;  5DJT A;  1PW8 A;  3E4Q A;  2JKT M;  5HAI A;  3NOU C;  1LHY A;  2WGI A;  1PZP A;  4LFU A;  4RA7 A;  3LCE A;  4OOL A;  4JPM A;  1CEF A;  4S2J A;  4BMW A;  4CJN A;  3IBJ A;  2GZA A;  1L3L A;  2IWD A;  3MFX A;  3CZD A;  5L09 A;  4DN0 A;  3IXB A;  5M18 A;  3ZDJ A;  4G3K A;  4PHT A;  1PRQ A;  3IQA A;  4LCM A;  4KZ4 A;  1KDW A;  4LEN A;  1PYY A;  2JKF A;  4X55 A;  1W8Y A;  5J3W A;  2QMI A;  3NI9 A;  3E4O A;  5KSH A;  4ZJ3 A;  4S2M A;  4PKY A;  3BWL A;  1YM1 A;  3UE6 A;  4OPZ A;  3G31 A;  2ZD8 A;  5A92 A;  1D7E A;  3UB6 A;  3ZVT A;  4B4X A;  5KMW A;  3HVF A;  3GSG A;  4WMC A;  1SDE A;  5C5K A;  2WAE A;  4YNR A;  3T1R A;  4JGP A;  2R78 A;  2B18 A;  3LGO A;  4WEL A;  4L9E A;  3FYZ A;  3WS0 A;  1H5X A;  2W0N A;  1UGU A;  2W3F A;  4KZ3 A;  3UNW A;  5E2E A;  1PIO A;  2P9V A;  4K0W A;  4U0X A;  4WZ5 C;  4E04 A;  3VFF A;  3LY3 A;  2Y2K A;  4WF0 A;  3JVU A;  1HD8 A;  5HZH A;  2V0U A;  2EWW A;  2H0Y A;  2B02 A;  2VV8 A;  2HGV A;  3MSH A;  2HJ9 C;  1T18 A;  1G6O A;  4EW7 A;  3VV4 A;  4IUH A;  4E6X A;  3HCY A;  1K54 C;  4XUX A;  2KLI A;  1K54 A;  3WS1 A;  1YKD A;  3QHY A;  3RH8 B;  4E3M A;  4R4R A;  2Y79 A;  2H10 A;  2OV5 A;  2L0W A;  4OPY A;  4ZAM A;  2EXB A;  3O87 A;  5DTT A;  3OOV A;  1SDN A;  4S2K A;  1OPX A;  4WN5 A;  3H9W A;  4R6L A;  3UDI A;  4YWZ A;  5EOO A;  2PD7 A;  1FSY A;  5HDS A;  2UV0 E;  1ZKJ A;  4E3J A;  1OTI A;  4R3A A;  1S0W A;  3GEC A;  5EE8 A;  1SHV A;  1TVF A;  3UB7 A;  2P9V B;  2XK1 A;  5FEF A;  3SS4 A;  2Y4A A;  3IBR A;  5DFX A;  1CQA A;  3PR6 A;  1DRM A;  3K3C A;  4GCZ A;  2Q9M A;  3P09 A;  1U60 A;  2E8I A;  4CQH A;  4WEK A;  2GX5 A;  5HL1 A;  3PHY A;  5FL3 A;  4RQ9 A;  1NYY A;  1I2S A;  1S1Y A;  3LEQ A;  2M7U A;  1NZU A;  2XGN A;  3HLE A;  1H8M A;  5A93 A;  4DDS A;  3SS5 A;  1M6K A;  3A3E A;  5L8M A;  2J3T C;  3F1N A;  3P01 A;  3IHB A;  4QD4 A;  2ZOH A;  1TS0 A;  4R3B A;  3FKW A;  2INW A;  4LV1 A;  5CHM A;  1WE4 A;  2R9W A;  1K56 A;  2PT7 A;  3C4O A;  3PXP A;  4QU3 A;  2E8J A;  3BLM A;  4YFM A;  3P7N A;  1Z09 A;  3MZF A;  3HLB A;  2ZQA A;  3HRE A;  3O3V A;  4I3J A;  3GR2 A;  3F1O A;  2XRO A;  2EA9 A;  5CHJ A;  5HWT A;  1DP6 A;  2VX8 A;  3MZD A;  1NY0 A;  2W1T A;  3H7W A;  1I2W A;  3ZGA B;  1Z6F A;  5FAT A;  2V8C A;  3MQQ A;  1RGZ A;  2PAV P;  1TS6 A;  4B88 A;  1YT4 A;  3IH8 A;  2OWH A;  2ZQ9 A;  1DJA A;  1XJ3 A;  4HBT A;  4X56 A;  5GLC A;  4NXG A;  4JXW A;  5F69 A;  1M40 A;  1FSW A;  2L1M A;  2FZ0 A;  2M1C A;  4OPQ A;  4Y5F A;  2WZZ A;  3Q07 A;  2XD1 A;  4ZJ1 A;  1XKZ A;  5EOE A;  2J8Y A;  3N8S A;  3U4L P;  1ES4 A;  3SW1 A;  3KO6 A;  4HIA A;  1YLZ A;  1YLY A;  3OLO A;  2Y2I A;  3F1O B;  4DE2 A;  4KZA A;  1LI9 A;  2ZC3 B;  4KG5 A;  5FAQ A;  5AQA A;  2A3U A;  3OC2 A;  2W1T B;  3QNB A;  3VP3 A;  3RTY A;  2HP6 A;  3H7W B;  5EVL A;  5DF9 A;  4Y13 A;  3T1Q B;  4P0M A;  1DP8 A;  3KX0 X;  4WL9 A;  3TE8 A;  4O7D A;  4FOF A;  1KGF A;  4N1X A;  5L2F A;  2ACG A;  5EM1 A;  1UWP X;  4CLC C;  2WAF A;  3ZYT A;  3S22 A;  3LR4 A;  4K0X A;  4OH0 A;  2PYR A;  4CLC A;  4EEP A;  2J3T D;  4NET A;  5DKL A;  1LSX A;  3FV7 A;  5EVI D;  1OTA A;  1K4F A;  1CK3 A;  3C30 A;  3VP4 A;  4LV3 A;  4KQD A;  3KSG A;  4MNR A;  1H0M A;  2A49 A;  3LIB A;  5FI6 A;  3LIF A;  3GRJ A;  5FAS A;  4X68 A;  4C3Q A;  4ID4 A;  3N8L A;  4II7 A;  1IOU A;  3T50 A;  3EQV A;  2DNS A;  3H82 A;  3IWI A;  3MXS A;  5FDH A;  3C4P A;  1MKI A;  3BLS A;  4PPR A;  5AQ7 A;  5HW3 A;  1BLH A;  1XJ4 A;  2W3G A;  1Y28 A;  3G4P A;  4MBK A;  4C6Y A;  4HP9 A;  2P7J A;  1J3W A;  4LV0 A;  3Q7Z A;  4UQI M;  3BFC A;  3AGF A;  2WGW A;  3V5M A;  1YSP A;  2DRW A;  1N9N A;  2XH9 A;  3HUO A;  1CEG A;  2W1R A;  3RJU A;  4CLC B;  3G35 A;  4GHI B;  4M3K A;  4UQI S;  5GHZ A;  4WM9 A;  3UE3 A;  1BYW A;  4MBF A;  2Y2M A;  1S6R A;  1Y54 A;  5CTM A;  3NDG A;  3CPT A;  4OPR A;  1BLS A;  4IBR A;  2WK0 A;  4GJ4 A;  5CGS A;  1GSV A;  2W3D A;  1ES2 A;  2O9C A;  4ZBE A;  2Y2J A;  2PDR A;  5IS1 A;  2D02 A;  3NCK A;  3ITB A;  1OTE A;  3SS3 A;  3H82 B;  4PM7 A;  3ZG8 B;  2PU2 A;  4NXF A;  3B3X A;  1BLP A;  1ACF A;  1NXY A;  4S2P A;  3GTC A;  1PZO A;  4BWI A;  4PM8 A;  2MJ6 A;  3BJN A;  2WKP A;  2HDS A;  1SKF A;  2EX8 A;  2WGW B;  2WYX A;  3HJK A;  3MR0 A;  3V3R A;  2XD5 A;  4DF6 A;  3A3F A;  3I7J A;  3MKF A;  5EPH A;  3NJA A;  4RYE A;  5JYO A;  3LR5 A;  2LB5 A;  1TEM A;  4JF6 A;  3CPT B;  4IVI A;  4GZB A;  1NRF A;  3WWX A;  4OQG A;  1KVL A;  1S66 L;  1I5Q A;  4EWF A;  1PWD A;  2ZC4 B;  2EXA A;  4I5S A;  4X6T A;  1ZHH B;  3UN7 A;  3NUL A;  3FWL A;  2XSS A;  2OWJ A;  3CAX A;  4GS9 A;  4F3L A;  5CED A;  3LFV A;  4QWO A;  3IXG A;  3MBZ A;  1NZO A;  1F5M A;  2ZQC A;  3MS6 A;  4BBU A;  1L0G A;  4FH4 A;  4FTX A;  1E4D A;  4DKI A;  5AVE A;  5E2G A;  3W4O A;  1YQS A;  2EX2 A;  3ZCZ A;  1RCJ A;  2HJE A;  1DJB A;  3DW0 A;  4LPZ A;  3G6O A;  1MZU A;  3Q81 A;  4KZ5 A;  3IHA A;  3KYZ A;  3CIT A;  4FUW A;  3MXQ A;  3E2K A;  4DXC A;  5HPF A;  2J80 A;  2I72 A;  4FCF A;  4H6J A;  3ZG0 A;  4LRZ E;  1XGI A;  4NXE A;  1ZTU A;  1N9L A;  1S1Z A;  5F6A A;  2H5S A;  5CGW A;  3HLG A;  1P9W A;  3LI8 A;  3QNC A;  3BQ8 A;  2ZLY A;  2DCF A;  5DJU A;  5GLB A;  1FOF A;  2QJ5 A;  1G68 A;  2H0T A;  4UHU A;  4XT2 A;  5EUA A;  1TDG A;  4GS9 B;  1MWR A;  4F94 A;  4BL3 A;  4K08 A;  1W5D A;  3FZC A;  5G4Y A;  2NUT C;  3U2A A;  1KVM A;  5KZH A;  2XLN A;  1O07 A;  3D4F A;  3S1Y A;  3EGD C;  3GDI A;  4L9F A;  3ZG9 B;  5G4Z A;  3PBQ A;  4KZ6 A;  3NC8 A;  5MC7 A;  2PR6 A;  1PW1 A;  1XJ6 A;  2HPB A;  2L4R A;  1FCO A;  5U47 A;  5F83 A;  4ESP A;  3KYE A;  5HSQ A;  2XA7 M;  2XQZ A;  1AWI A;  4EBL A;  4N9L A;  3UB5 P;  3VP2 A;  3WRZ A;  3MQ0 A;  1H8Z A;  2K2N A;  1BLC A;  4MN6 A;  3ZVW A;  5BOH A;  1KE0 A;  4H6J B;  2XFT A;  1LT0 A;  3HLF A;  4L0L A;  4X1L A;  4GB7 A;  5KSC A;  2XA7 S;  2BAS A;  1EWZ A;  2V9A A;  4B4Z A;  2O9B A;  4WBG A;  3TRC A;  4OLD A;  4JGO A;  3IF6 C;  1S4R A;  3M2K A;  4GD8 A;  1JTD A;  2PR5 A;  3EGX C;  1WA9 A;  3NBL A;  3PBN A;  4XT2 B;  3IF6 A;  5HD5 A;  3DTM A;  1XA7 A;  2ZMF A;  3G34 A;  3BRM A;  3PBT A;  4NG2 A;  1LL9 A;  4PKY G;  4GDB A;  4ZTK A;  3TOI A;  3VE3 A;  4EBN A;  3VMA A;  2ZMA A;  3M2J A;  3CHW P;  3LEZ A;  3NOT C;  3Q1F A;  3IXH A;  1ES5 A;  3UMD A;  3AGE A;  3SZT A;  1K25 A;  2V2F F;  1K6R A;  3ZG7 B;  4R70 A;  4RVA A;  2K7S A;  4K91 A;  1G6A A;  4UEY A;  3W4P A;  2VV7 A;  4WYY A;  5DKK A;  5FA7 A;  1JNU A;  3ICY A;  3P98 A;  3C7V A;  3BYD A;  5J8X A;  1ZG4 A;  5DF7 A;  4QY6 A;  4N92 A;  2QKP A;  1MC0 A;  3MXR A;  4JGQ A;  1TS7 A;  1HLU P;  3KSH A;  3RXX A;  5F82 A;  5FSR A;  3MJQ A;  1T1B A;  4D60 A;  2XFS A;  1JWP A;  3DBA A;  3SOI A;  4WMC D;  3GV9 A;  3BM6 A;  3ZQ5 A;  2EX6 A;  3GMW A;  1MWT A;  4JXS A;  2WGV A;  5GHY A;  4XXR A;  4GW9 A;  3OPL A;  3IF6 B;  5DFY A;  1WYC A;  1TD5 A;  5CRF A;  4ME4 A;  1IEM A;  4DE0 A;  5FEG A;  3JVV A;  5GLD A;  5CEC A;  5GLA A;  3N4I A;  3CG5 A;  2Y8H A;  4R38 A;  1XJ2 A;  3PBO A;  2GNX A;  3UE1 A;  3DAV A;  3S7O A;  3FG8 A;  1ZC2 A;  3DTK A;  4QB8 A;  3EOI A;  2J9O A;  1PI4 A;  3G2Y A;  2EFU A;  4U3T A;  3MZE A;  1XPB A;  4GD6 A;  2JCH A;  3SH7 A;  5CEB A;  4NXB A;  1JWZ A;  4I38 A;  4KQQ A;  4ZRR A;  3ZHH A;  3W4Q A;  3N6I A;  3CMZ A;  3ZG5 A;  4UA6 A;  3IWQ A;  3A3I A;  1L2S A;  3UB8 A;  3CWF A;  1E3U A;  2VGK A;  4Y17 A;  5F68 A;  2O99 A;  2Q0O A;  4IJG A;  3A3D A;  3BFF A;  4OQH A;  4OLG A;  4WLA A;  1CJF A;  5L10 A;  3QP4 A;  2V1B A;  5AJG A;  4KG6 A;  1NWZ A;  2X01 A;  4HY8 A;  2J7V A;  1XX2 A;  2VV6 A;  1FQG A;  4S2L A;  4G3V A;  2EX9 A;  1STZ A;  4KEN B;  3UO9 A;  2PBY A;  5EFW A;  1C3B A;  1K38 A;  1OT9 A;  4OOM A;  3F1N B;  1YPR A;  1AXB A;  1H3Q A;  1LL5 A;  4PM6 A;  4O01 A;  1BTL A;  5HAR A;  3NY4 A;  2ZMV A;  1FR1 A;  2QHK A;  5TGF A;  2VGJ A;  4UA9 A;  4HH3 A;  4ZDX A;  2LB9 A;  3BY8 A;  1GHI A;  5HD3 A;  4P87 A;  2WAD A;  5CXW A;  2Z2M B;  1MY8 A;  1VHM A;  4G3W A;  4IUK A;  4Y3I A;  2Z2L B;  1G5U A;  4HHD A;  2DMW A;  2ZC6 B;  4BL2 A;  3KSF A;  1P9R A;  1K57 C;  1VM1 A;  3OCN A;  4Y2F A;  1S67 L;  3Q7V A;  1GA0 A;  2HZ5 A;  5CGX A;  2WKR A;  4JF4 A;  1K57 A;  2X02 A;  1WYB A;  3D3O A;  4X53 A;  2P74 A;  4IBX A;  2HP9 A;  1TS8 A;  2KX6 A;  2C5W B;  4R23 A;  2JE5 A;  3NIA A;  3UDX A;  5M1A A;  1DY6 A;  4LRY C;  2PU4 A;  3OPP A;  3PYP A;  1K56 D;  1UWN X;  5DTS A;  3TJZ C;  4EEU A;  3VOL A;  1MKM A;  3QP8 A;  4BD0 A;  3HUM A;  2Y55 A;  4BQM A;  4LV2 A;  3UPP A;  1K6S A;  3LUQ A;  3F1P A;  1F9I A;  1NYM A;  5HAQ A;  4M4X A;  4Y7P A;  5AQ9 A;  3S4X A;  3IS2 A;  2C6W B;  5J7E A;  3Q82 A;  3HLC A;  5E2H A;  2J3W A;  3PTE A;  4QHC A;  3VOY A;  1QMF A;  3EWK A;  3Q7V B;  1BSG A;  2HP5 A;  5HL6 A;  3W8K A;  3V50 A;  2QYB A;  3T4L A;  2BG1 A;  3N8R A;  4BBT A;  2Z6C A;  4EUZ A;  4JXV A;  5J4E A;  1XXM A;  5FDS A;  2ZJ9 A;  5CTN A;  4GN2 A;  3G30 A;  3HJI A;  1K55 C;  2V1A A;  4Y0U A;  4YIN A;  2Y59 A;  2HDQ A;  3IH9 A;  1X0O A;  1XFQ A;  2OAP 1;  1K55 A;  4JGR A;  1VET A;  4GLQ A;  2Z6D A;  4OP8 A;  4HBU A;  5HWW A;  3T4Q A;  4B93 A;  1A0K A;  4HEF A;  4OQI A;  3BEC A;  2K31 A;  3VP1 A;  4JLF A;  1GA9 A;  3ISG A;  4XUZ A;  2WKI A;  5FQI A;  1W79 A;  4R4S A;  3BFG A;  4DXB A;  3LR0 A;  3F1P B;  2ZBB A;  4LGW A;  2PBD P;  4Q0H A;  1KGE A;  3IS2 B;  1LL8 A;  4ZJ2 A;  3WS2 A;  2PYP A;  1ESI A;  4BJP A;  3NHQ A;  3PAE A;  5HWV A;  1GHP A;  4O8G A;  3LIA A;  1YLW A;  1IEL A;  4KUK A;  5GL9 A;  1V9Y A;  5CX7 A;  3ZNT A;  3V67 A;  1GSX A;  4EV4 A;  1ERQ A;  4A5R A;  1N9B A;  1PFL A;  1XP4 A;  2IA2 A;  4QY5 A;  3WS5 A;  4I3I A;  3A3J A;  4CLC D;  1BT5 A;  3VOZ A;  1G28 A;  1GCE A;  2VZW A;  4N1H A;  2O9A A;  1OTB A;  1J9M A;  2Y2P A;  3UDF A;  4HJ6 A;  4LRX C;  3JYI A;  3L7H A;  4MN5 A;  2JKR I;  4HOI A;  3A0V A;  1LI0 A;  1VET B;  3E4P A;  3IF5 A;  2V1Z A;  4S2I A;  4CPK A;  2IWB A;  2JN7 A;  4WZ4 A;  1MWS A;  1V9Z A;  3BFD A;  5KIZ A;  2G2U A;  1MBL A;  1VQQ A;  3IXD A;  1L0E A;  2G2W A;  4KZ7 A;  2VA0 A;  3UPN A;  3HUN A;  3VSL A;  3BEB A;  2Y2G A;  2O0Y A;  1ESU A;  1MWU A;  2W3E A;  5AVF A;  3LID A;  4DRT A;  1IKI A;  1IYP A;  3RXW A;  3IX8 A;  2JKT I;  4S2N C;  5FI2 A;  1OJG A;  2WKE A;  3IT9 A;  5TJJ A;  3ZFZ A;  2J9P A;  4FD8 A;  3S7N A;  2QPN A;  3LI9 A;  4YOF A;  4S2N A;  1MPL A;  5TBM A;  3V39 A;  3DTI A;  4GNU A;  4X25 A;  4WEJ A;  3EEA A;  3VSK A;  4IVK A;  2GJ3 A;  2PRF A;  1ES3 A;  4DDY A;  2ZM2 A;  1IFQ A;  3LIC A;  3G2Z A;  2W3H A;  2ZM0 A;  5DTK A;  3BQA A;  3OPR A;  4D2O A;  3C2W A;  2VK3 A;  5I94 A;  1D1J A;  2ZM8 A;  4Q8I A;  1ONG A;  3EEH A;  5TFQ A;  4HES A;  1N9O A;  3A0S A;  3IWO A;  4P6Z M;  5GHX A;  3T4T A;  3QP1 A;  4F3L B;  1T1C A;  3LR3 A;  3EQU A;  4P6Z S;  3QP2 A;  2Q9N A;  1KOU A;  5L07 A;  1LSW A;  4EQ1 A;  1YAX A;  4EBP A;  5DF8 A;  4P6B A;  3V3S A;  3W2Z A;  5TBM B;  1F2K A;  2ZC7 A;  3CI6 A;  3B47 A;  4NEE D;  3SH9 A;  3KYQ A;  3FKV A;  3BY9 A;  1IYO A;  4IHQ A;  2G7U A;  4E6W A;  4HH2 A;  5E43 A;  4R1G A;  2OLV A;  3B33 A;  5A8B A;  5FI7 A;  5A90 A;  1JWV A;  1KDS A;  3NOP C;  3R4K A;  3S7P A; 
#chains in the Genus database with same CATH homology
 3N8L A;  4KZ9 A;  1DJC A;  1JWZ A;  3HLD A;  3LO7 A;  4OP5 A;  4WZ5 A;  2ZQD A;  3C7U A;  1Q2P A;  1ERM A;  4KQQ A;  4U0T A;  3ZHH A;  3W4Q A;  3EQV A;  4MEZ A;  2DNS A;  3N6I A;  3CMZ A;  3IWI A;  4UA6 A;  3ZG5 A;  3IWQ A;  1SCW A;  3A3I A;  3MXS A;  1RP5 A;  5FDH A;  2Y91 A;  1L2S A;  3C4P A;  1MKI A;  1E3U A;  5CHU A;  2VGK A;  1IKG A;  3BLS A;  4PPR A;  4PM5 A;  5AQ7 A;  1JTG A;  5HW3 A;  1FCN A;  4Y0O A;  3DWZ A;  2Y2Q A;  4GKU A;  1BLH A;  3A3D A;  3BFF A;  4OQH A;  4OLG A;  4R0Q A;  3TSG A;  5FQQ A;  1PI5 A;  4BEN A;  3G4P A;  4E3N A;  4KG6 A;  1JVJ A;  2XR0 A;  3LY4 A;  4MBK A;  4X69 A;  4C6Y A;  1BUL A;  3M6H A;  2X01 A;  1QME A;  2J7V A;  4LV0 A;  3Q7Z A;  1XX2 A;  1PW8 A;  1LLB A;  4JBF A;  1FQG A;  4S2L A;  3BFC A;  2EX9 A;  5HAI A;  1LHY A;  3AGF A;  4KEN B;  2WGI A;  1PZP A;  2PBY A;  3UO9 A;  1C3B A;  1K38 A;  2WGW A;  4OOM A;  2DRW A;  3LCE A;  4RA7 A;  3V5M A;  4OOL A;  2XH9 A;  4JPM A;  1IYQ A;  1CI9 A;  3HUO A;  1CEF A;  4S2J A;  1CEG A;  1AXB A;  4BLM A;  1LL5 A;  3RJU A;  4PM6 A;  3HLW A;  4CJN A;  1BTL A;  5HAR A;  3NY4 A;  2Y2H A;  3G35 A;  2IWD A;  4M3K A;  1FR1 A;  3CZD A;  4WM9 A;  5FQ9 A;  5GHZ A;  4UAA A;  5TGF A;  3UE3 A;  2VGJ A;  1HZO A;  4FSF A;  2X71 A;  1W8Q A;  4MBF A;  4UA9 A;  2GDN A;  1OME A;  2Y2M A;  1S6R A;  3IXB A;  4FH2 A;  3ZDJ A;  1Y54 A;  4ZDX A;  5CTM A;  5M18 A;  1GHI A;  3NDG A;  3UY6 A;  4OPR A;  1BLS A;  4P87 A;  2WAD A;  3IQA A;  2Z2M B;  1MY8 A;  2WK0 A;  4IBR A;  4LCM A;  4KZ4 A;  1KDW A;  5CXW A;  4LEN A;  3OCL A;  1PYY A;  2Z2L B;  5CGS A;  2UWX A;  1ES2 A;  4GDN A;  2ZC6 B;  4BL2 A;  4Y0T A;  1K57 C;  1VM1 A;  3OCN A;  4ZBE A;  4X55 A;  1W8Y A;  2FFY A;  3Q7V A;  2HDU A;  1GA0 A;  2Y2J A;  2QMI A;  3NI9 A;  5CGX A;  3OPH A;  5KSH A;  4ZJ3 A;  4JF4 A;  1K57 A;  3NCK A;  2X02 A;  4OQ0 A;  4S2M A;  5M19 A;  3ITB A;  1YMX A;  3UE0 A;  1H8Y A;  3SS3 A;  1WYB A;  4PM7 A;  1TDL A;  1YM1 A;  4X53 A;  3ZG8 B;  2PU2 A;  3B3X A;  1BLP A;  4OPZ A;  3G31 A;  2ZD8 A;  2P74 A;  5A92 A;  2ZQ8 A;  4IBX A;  2HP9 A;  1NXY A;  4N9K A;  4S2P A;  3GTC A;  2C5W B;  4R23 A;  3ZVT A;  1PZO A;  2JE5 A;  2ZQ7 A;  4B4X A;  5KMW A;  3HVF A;  3NIA A;  3GSG A;  4WMC A;  1SDE A;  3UDX A;  2IWC A;  2WAE A;  5M1A A;  3SH8 A;  1DY6 A;  4E3K A;  1FCM A;  4PM8 A;  2PU4 A;  1L0D A;  1XGJ A;  3OPP A;  3BFE A;  4WEL A;  1K56 D;  2HDS A;  3CJM A;  5DTS A;  1SKF A;  5JYP A;  2EX8 A;  2WGW B;  2WYX A;  3FYZ A;  3PBR A;  3WS0 A;  1H5X A;  3V3R A;  2XD5 A;  5EVI C;  4DF6 A;  4KZ3 A;  3UNW A;  4BD0 A;  3A3F A;  1ZG6 A;  3HUM A;  3I7J A;  5E2E A;  2Y55 A;  3C5A A;  4RX2 A;  4DE1 A;  1PIO A;  2P9V A;  4K0W A;  3MKF A;  4U0X A;  4LCL A;  4WZ5 C;  5EPH A;  4LV2 A;  2CC1 A;  3UPP A;  3VFF A;  3LY3 A;  4BQM A;  2Y2K A;  5EVI A;  4RYE A;  5JYO A;  1K6S A;  1HD8 A;  3AGD A;  5HX9 A;  1NYM A;  5HAQ A;  4Y7P A;  3S4X A;  2H0Y A;  1HVB A;  5AQ9 A;  1TEM A;  4JF6 A;  1KE4 A;  2C6W B;  4IVI A;  4GZB A;  3Q82 A;  3HLC A;  1NRF A;  3WWX A;  4OQG A;  5E2H A;  1KVL A;  1I5Q A;  1K4E A;  4EWF A;  1PWD A;  2ZC4 B;  2EXA A;  1YLP A;  3PTE A;  4QHC A;  4E6X A;  3VOY A;  1K54 C;  4X6T A;  1QMF A;  4XUX A;  3Q7V B;  1BSG A;  4KQR A;  2JBF A;  2HP5 A;  3W8K A;  3UN7 A;  3FWL A;  3O86 A;  3PBS A;  3V50 A;  2BG1 A;  1K54 A;  5CED A;  3N8R A;  3MFD A;  1GHM A;  3WS1 A;  4EUZ A;  3IXG A;  3MBZ A;  4JXV A;  1NZO A;  3QHY A;  2ZQC A;  1L0G A;  4FH4 A;  4R4R A;  4E3M A;  1XXM A;  5FAP A;  1E4D A;  4DKI A;  5DVA A;  2H10 A;  3OZH A;  1FR6 A;  5E2G A;  3W4O A;  2XDM A;  2OV5 A;  1YQS A;  2ZJ9 A;  1ERO A;  2EX2 A;  5CTN A;  4GN2 A;  3G30 A;  5CER A;  4OPY A;  3VFH A;  1K55 C;  4ZAM A;  2EXB A;  3O87 A;  5DTT A;  4Y0U A;  4YIN A;  3ZCZ A;  1RCJ A;  1PWC A;  2Y59 A;  4DE3 A;  1SDN A;  1DJB A;  4S2K A;  5FQM A;  2HDQ A;  3IH9 A;  2XF3 A;  3DW0 A;  1CI8 A;  3Q81 A;  3UDI A;  1K55 A;  4KZ5 A;  3IHA A;  5EOO A;  5FAO A;  4RX3 A;  1FSY A;  3E2K A;  4DXC A;  4OP8 A;  1ZKJ A;  4E3J A;  1S0W A;  2I72 A;  4HBU A;  3ZNY A;  5EE8 A;  4HEF A;  4OQI A;  4FCF A;  1Q2Q A;  3BEC A;  1YLT A;  1SHV A;  5A91 A;  3VP1 A;  1TVF A;  2V20 A;  4JLF A;  1GA9 A;  2P9V B;  3ISG A;  3ZG0 A;  4XUZ A;  1XGI A;  2WKI A;  5FQI A;  2XK1 A;  1W79 A;  5EVI B;  1YMS A;  4R4S A;  3BFG A;  3GVB A;  3SS4 A;  2Y4A A;  4DXB A;  4EQI A;  2WZX A;  1KGE A;  2H5S A;  5CGW A;  3HLG A;  4ZJ2 A;  3QNC A;  2Q9M A;  3P09 A;  3WS2 A;  1U60 A;  2ZLY A;  1ESI A;  2DCF A;  2E8I A;  5GLB A;  1FOF A;  2ZC5 B;  4BJP A;  2WKH A;  3PAE A;  4WEK A;  1GHP A;  5HL1 A;  1YLW A;  1IEL A;  1G68 A;  2H0T A;  3HBR A;  5GL9 A;  4UHU A;  1N4O A;  5G18 A;  5EUA A;  5F1F A;  3ZNT A;  4R3J A;  1NYY A;  1I2S A;  1TDG A;  2BLS A;  5FQK A;  4EV4 A;  1MWR A;  4F94 A;  1NZU A;  1ERQ A;  2XGN A;  3HLE A;  4A5R A;  1N9B A;  5A93 A;  4BL3 A;  4DDS A;  1XP4 A;  3SS5 A;  1W5D A;  4QY5 A;  3WS5 A;  3A3J A;  1M6K A;  3FZC A;  1BT5 A;  1KVM A;  3VOZ A;  5KZH A;  1GCE A;  2XLN A;  1O07 A;  3D4F A;  3S1Y A;  3A3E A;  1ONH A;  4N1H A;  2JC7 A;  1J9M A;  3G32 A;  2Y2P A;  4OVD A;  1XA1 A;  3UDF A;  3JYI A;  5FQJ A;  3ZG9 B;  4UA7 A;  3NDE A;  3IHB A;  3GQZ A;  3PBQ A;  4QD4 A;  4KZ6 A;  3NC8 A;  1HTZ A;  4R3B A;  1PW1 A;  2HPB A;  3FKW A;  1FCO A;  4LV1 A;  1BUE A;  1WE4 A;  5CHM A;  4Z9Q A;  5F83 A;  2R9W A;  5U47 A;  1K56 A;  3C4O A;  4QU3 A;  4QJG A;  3UPO A;  3BLM A;  4YFM A;  1ALQ A;  2XQZ A;  3MZF A;  4EBL A;  4N9L A;  1LI0 A;  4IED A;  3IF5 A;  5EEC A;  2V1Z A;  3HLB A;  4S2I A;  1BZA A;  4CPK A;  3VP2 A;  3WRZ A;  5IHV A;  2ZQA A;  4JKT A;  1EI5 A;  2IWB A;  3HRE A;  1H8Z A;  3O3V A;  4WZ4 A;  1L0F A;  1MWS A;  1BLC A;  3GR2 A;  3ZVW A;  4KZB A;  5BOH A;  1KE0 A;  4KZ8 A;  2XFT A;  3BFD A;  3HLF A;  3E2L A;  4JXG A;  4L0L A;  2G2U A;  1E3U D;  4GB7 A;  5KSC A;  1MBL A;  5CHJ A;  1EWZ A;  1VQQ A;  1KGG A;  3IXD A;  1L0E A;  2G2W A;  4KZ7 A;  4B4Z A;  3MZD A;  1NY0 A;  4WBG A;  3UPN A;  3HUN A;  3VSL A;  4OLD A;  3BEB A;  4MBH A;  2Y2G A;  3N7W A;  1ESU A;  1I2W A;  1MWU A;  3ZGA B;  1Z6F A;  3IF6 C;  3VP0 A;  2R9X A;  4DRT A;  1IKI A;  1IYP A;  5FAT A;  3M2K A;  4GD8 A;  4KQO A;  1JTD A;  1RGZ A;  3RXW A;  2B5R A;  3NBL A;  3PBN A;  4S2N C;  5FI2 A;  4B88 A;  1YT4 A;  3IF6 A;  1W7F A;  2WKE A;  3IT9 A;  3DTM A;  3IH8 A;  4P85 A;  1XA7 A;  3ZFZ A;  3DWK A;  2J9P A;  4FD8 A;  2QPN A;  2ZQ9 A;  3G34 A;  3HL9 A;  4S2O A;  5F1G A;  1DJA A;  5AQB A;  4HBT A;  1MPL A;  4S2N A;  3BRM A;  4X56 A;  3PBT A;  5GLC A;  3ITA A;  1LL9 A;  4JXW A;  5TR7 A;  4E3L A;  4GDB A;  4ZTK A;  3V39 A;  3TOI A;  1M40 A;  4EBN A;  4GNU A;  5D3O A;  1FSW A;  3VMA A;  2ZMA A;  3M2J A;  5E2F A;  4WEJ A;  3VSK A;  4OPQ A;  3LEZ A;  2QZ6 A;  4PMA A;  3Q1F A;  3IXH A;  4IVK A;  1ES5 A;  2FFF B;  3AGE A;  1K25 A;  2RCX A;  1ES3 A;  2V2F F;  4DDY A;  1K6R A;  2OSU A;  2ZM2 A;  3ZG7 B;  4RVA A;  1IYS A;  2WZZ A;  3Q07 A;  4K91 A;  3G2Z A;  1G6A A;  2ZM0 A;  5DTK A;  3W4P A;  4WYY A;  3OPR A;  4BD1 A;  5FA7 A;  2XD1 A;  4ZJ1 A;  1XKZ A;  4E3O A;  4JF5 A;  3P98 A;  5EOE A;  2J8Y A;  3C7V A;  3N8S A;  4D2O A;  3BYD A;  3M6B A;  1ES4 A;  1O7E A;  3TG9 A;  1YLJ A;  5J8X A;  1ZG4 A;  5DF7 A;  5I94 A;  4KG2 A;  2ZM8 A;  1YLZ A;  4Q8I A;  4H8R A;  4MLL A;  1ONG A;  1YLY A;  4N92 A;  4QY6 A;  5TFQ A;  4OOY A;  4HES A;  3WS4 A;  3IWO A;  3MXR A;  2Y2I A;  3O88 A;  4DE2 A;  5HAP A;  5GHX A;  1KE3 A;  4KZA A;  1LI9 A;  3RXX A;  2ZC3 B;  4KG5 A;  5FAQ A;  5AQA A;  4GOG A;  5HFO A;  5F82 A;  2A3U A;  5FSR A;  1RGY A;  4NK3 A;  3OC2 A;  2XFS A;  1JWP A;  3QNB A;  3VP3 A;  2HP6 A;  3SOI A;  4WMC D;  3GV9 A;  3BM6 A;  5EVL A;  2EX6 A;  3GMW A;  5DF9 A;  1MWT A;  3EQU A;  4JXS A;  2WGV A;  4P0M A;  5GHY A;  1NJ4 A;  4XXR A;  4O7D A;  2Q9N A;  1KGF A;  4N1X A;  3OPL A;  5L2F A;  2Y2O A;  3PAG A;  3IF6 B;  2WAF A;  1WYC A;  1E25 A;  3S22 A;  5CRF A;  4EBP A;  4K0X A;  2Y2L A;  4P6B A;  4PM9 A;  5DF8 A;  3V3S A;  4OH0 A;  3WRT A;  2WUQ A;  1IEM A;  2Y2N A;  1MXO A;  4DE0 A;  4C75 A;  5GLD A;  5CEC A;  5GLA A;  3N4I A;  2RL3 A;  2EFX A;  2ZC7 A;  3CG5 A;  4NET A;  3SH9 A;  4E3I A;  3FV7 A;  5EVI D;  3FKV A;  1IYO A;  2HDR A;  3PBO A;  3UE1 A;  2OLU A;  1K4F A;  1ZC2 A;  4E6W A;  1CK3 A;  3VP4 A;  4QB8 A;  2J9O A;  5E43 A;  4LV3 A;  2OLV A;  1PI4 A;  4R1G A;  4OON A;  3G2Y A;  4MNR A;  5FI7 A;  2EFU A;  2A49 A;  5A90 A;  2XEP A;  1JWV A;  1KDS A;  4U3T A;  5FI6 A;  4OKP A;  3MZE A;  1XPB A;  3MKE A;  3GRJ A;  4GD6 A;  2JCH A;  5FAS A;  3SH7 A;  5CEB A;  1PWG A;  4X68 A;  4C3Q A;  4ID4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...