3Q1FA

Ctx-m-9 s70g in complex with hydrolyzed piperacillin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
publication title CTX-M-9 S70G mutant in complex with hydrolyzed piperacillin
rcsb
source organism Escherichia coli
total genus 96
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q1fA00
3MKFA 2V20A 1YLTA 4Y7PA 2Q9NA 3A3IA 2Y2LA 4N1XA 3NC8A 3SS5A 3MZFA 1PYYA 2XGNA 2WGIA 4Y0UA 3M2KA 3UPPA 2HP5A 3VOYA 1KDSA 2X02A 4JF5A 4WEJA 5AQ7A 1HVBA 4KZ3A 5DTKA 5FASA 3GSGA 3HLWA 4O7DA 2EX9A 4IBXA 2DRWA 3M6BA 1MY8A 4S2OA 5JYOA 5DTSA 1Q2QA 3PBSA 4GD6A 1ZC2A 4ZJ2A 2Z2MB 2RCXA 4K0XA 4XUXA 3DWZA 4WELA 5FA7A 1NYYA 4E3NA 1DJCA 5GLDA 5M18A 3C4PA 3GQZA 3UY6A 4RVAA 4BD0A 4C75A 3UPNA 2J9OA 2OSUA 2WGWB 2XD5A 2ZM8A 3HVFA 3LO7A 1IYPA 3TSGA 1WE4A 1XX2A 1BTLA 4WMCD 1GHMA 5CTMA 2QZ6A 5HW3A 3I7JA 5GHZA 1W7FA 1DJAA 4OQIA 3E2LA 2Z2LB 5A93A 5FQQA 1BLCA 4GD8A 1ES5A 3ITAA 3WS5A 1SDNA 2E8IA 4R4RA 1SDEA 1M40A 2Y59A 1K54A 5EPHA 5E43A 3MKEA 4RX2A 3ZGAB 3IF6C 2ZQDA 3G34A 1ONHA 3G2YA 1RGYA 3MXSA 1I2WA 1SCWA 3BEBA 4KG2A 5CGWA 3Q7VB 3BM6A 5U47A 2DCFA 5FQIA 3CG5A 1KGFA 1ALQA 2IWCA 3C7UA 5KSHA 3NBLA 4GB7A 1GHPA 3IH8A 5A90A 1MWSA 4EV4A 5F82A 2RL3A 5F83A 4JXGA 3VMAA 1NZUA 1Q2PA 1YLJA 2ZM2A 2X01A 4ZJ3A 4WMCA 3WS0A 1MKIA 1CEGA 1K56D 1M6KA 4KENB 3UDIA 1JWZA 1DY6A 5M1AA 4R1GA 2EFUA 3PAGA 4JF6A 4XUZA 1N9BA 2Q9MA 5GL9A 5GHXA 3HBRA 2H10A 1WYBA 1PI5A 1FR6A 1K4FA 1PWCA 2JCHA 2Y2KA 2C5WB 2BG1A 3GVBA 3HLCA 1PZOA 3GRJA 1PZPA 3IXHA 3P09A 4IVKA 4N1HA 1JWVA 1RP5A 4P6BA 4R3JA 2OLVA 5KSCA 2Y91A 4X68A 3O88A 1QMEA 1IYQA 3ZNYA 4LV2A 4U0TA 5DTTA 4R0QA 4KZAA 5HL1A 4HESA 2J8YA 4KZ8A 2QMIA 3DWKA 3RJUA 3ZFZA 2C6WB 4B4ZA 3DW0A 3OPHA 4R3BA 5FSRA 1FCOA 3W4OA 1GHIA 3WS1A 5G18A 2HP6A 5DF8A 4ZAMA 1K55C 3UO9A 3A3JA 2ZQ8A 4S2JA 3HLBA 3N4IA 3Q7VA 4JLFA 1XA7A 1KVMA 1BULA 4DKIA 4EBNA 4OP5A 3HL9A 3Q07A 1K56A 3OPLA 2B5RA 2IWDA 4UAAA 3IHBA 1KDWA 3EQUA 5TR7A 5KMWA 2VGKA 4OPRA 4PPRA 1K4EA 3VP1A 4PM6A 3ZG0A 4KQOA 5CGSA 5FAPA 4GN2A 2Y4AA 4KG6A 3VP0A 4OOLA 4S2PA 2HDUA 5DVAA 3NY4A 1LHYA 1HTZA 4CPKA 4PM8A 5DF9A 4WZ4A 2HDSA 5GLBA 4MLLA 1GA9A 3SH8A 5CERA 3G30A 4ZJ1A 1YLYA 4LV1A 3S1YA 4KZ4A 1LL5A 4E3LA 3AGEA 5FATA 5AQAA 4E3MA 2HDRA 4JBFA 3CJMA 1VM1A 2XQZA 3WS4A 4HEFA 4QD4A 2ZC5B 4R4SA 4WEKA 1PWDA 1W79A 1ESIA 1RGZA 2WADA 5EVLA 4H8RA 3VSKA 2OV5A 3HLEA 3NDGA 5TGFA 1FQGA 4OPQA 3CZDA 3V3RA 1IELA 2GDNA 2P9VB 2Y55A 2ZM0A 2H5SA 2XK1A 5CTNA 2WZXA 2ZLYA 4FH2A 1CI8A 5L2FA 1XA1A 3GV9A 4BL2A 3WWXA 1KE4A 3UN7A 2Y2HA 1YLZA 1AXBA 2EX6A 3W4QA 2UWXA 3G2ZA 4B4XA 2V1ZA 5F1FA 3OPPA 1ERMA 1K6SA 3LY4A 4Z9QA 2EXAA 5FAQA 1JVJA 1TEMA 3ZDJA 2OLUA 4WBGA 4OPZA 4BQMA 2BLSA 2G2WA 2HPBA 2WKEA 3BFFA 4DE2A 1KE3A 1MXOA 1H8ZA 4F94A 4MEZA 1W5DA 1U60A 5GHYA 3V39A 5AQBA 4Q8IA 5HAQA 2XFSA 3BFCA 3ZG5A 4S2LA 3TOIA 3VFHA 2H0TA 4QY5A 2XDMA 5KZHA 4LV0A 4MBFA 5EVIB 4DXBA 1N4OA 3HREA 2I72A 5CHUA 1IEMA 4EBPA 1YQSA 4YINA 5CECA 3GMWA 4HBTA 5FI6A 3PBTA 5FDHA 3HUOA 2VGJA 1MWUA 3Q1FA 3B3XA 4X69A 3M6HA 5E2FA 2ZC4B 5EVID 1YT4A 3W4PA 3UPOA 1EWZA 4X6TA 3CMZA 3UNWA 1Y54A 5I94A 1EI5A 3BRMA 1NY0A 4LENA 4LCMA 1J9MA 2P9VA 1NRFA 1XKZA 3PBRA 5EE8A 1OMEA 1G68A 1YM1A 3ITBA 3O87A 1EROA 2Y2JA 5EOEA 3GTCA 3BFEA 4QY6A 3ZHHA 1LI0A 5J8XA 2XFTA 5EUAA 4FD8A 4FH4A 4PM5A 1TDGA 1H8YA 5M19A 5CXWA 3IXDA 4KZ7A 4DDYA 5HAIA 1FSWA 1S6RA 4QB8A 1FSYA 1H5XA 2FFFB 3RXWA 1ES3A 1PWGA 1ES4A 1XGJA 1K54C 3BLMA 1K57A 4OQHA 4S2KA 3UE0A 5FI2A 1ZG6A 3V3SA 3VSLA 4OH0A 4PMAA 4P0MA 3BFGA 2JE5A 3VFFA 3G31A 2Y2IA 4N92A 5EVIA 1L0EA 2WYXA 2ZC3B 1ZKJA 1YMXA 3LCEA 2PU2A 1JTDA 4WYYA 2Y2NA 3MFDA 1TVFA 4UA9A 5E2EA 2XD1A 4UA7A 1Z6FA 5AQ9A 1BLHA 4OLGA 4JPMA 3NCKA 1YLWA 3IT9A 3UE1A 4BL3A 4DE1A 1IKIA 1KGEA 1IYSA 1C3BA 2IWBA 1LI9A 4E3KA 3Q7ZA 5HARA 1PW8A 3SS3A 3ZVTA 4HBUA 4L0LA 4GOGA 4E3JA 4K91A 3HUNA 4JF4A 1KGGA 1BT5A 4KG5A 2WAFA 3FZCA 4E3IA 1JWPA 3VOZA 4OP8A 4N9KA 4OONA 3GR2A 4WZ5C 3DTMA 4KQRA 1NJ4A 2XR0A 3N7WA 5HX9A 3RXXA 4ZDXA 4ZBEA 2DNSA 3IF6B 1KE0A 4JXVA 3HLFA 1BLSA 4JKTA 2Y2GA 3VP3A 3C4OA 3FKVA 4EBLA 4IBRA 2R9XA 3PAEA 4P87A 4E3OA 1TDLA 3EQVA 3G35A 4WZ5A 3OC2A 4DE0A 4DXCA 1PW1A 2EXBA 3ZG8B 4ID4A 3SS4A 1GA0A 4LCLA 3C5AA 3A3FA 1CI9A 3WRTA 1DJBA 3PBOA 1FCMA 3V50A 3BECA 4B88A 1KVLA 1GCEA 1K38A 1PI4A 4GNUA 4KQQA 1E4DA 3BYDA 1MPLA 4MBKA 3D4FA 4XXRA 2WGVA 3UE3A 1K6RA 3A3DA 4RYEA 1RCJA 1BZAA 1ONGA 3PTEA 1SKFA 4S2NC 4RA7A 5CGXA 5GLCA 2ZJ9A 4FSFA 4KZ5A 5FQJA 4RX3A 4ZTKA 5FQKA 3MBZA 4BENA 5CEDA 1WYCA 3AGDA 3QHYA 3FKWA 3V5MA 2Y2OA 3IQAA 3TG9A 1HD8A 4JXWA 3FWLA 3LY3A 1IKGA 1LL9A 3ZCZA 3IHAA 3IF6A 4MBHA 4Y0TA 5A92A 1VQQA 2ZC6B 3OZHA 3QNCA 5FQMA 5A91A 3ZG9B 3ISGA 2ZQ7A 1E25A 3O3VA 5FQ9A 4D2OA 2WKHA 4K0WA 2X71A 3G32A 3HLGA 4OQ0A 1IYOA 4BD1A 1QMFA 2WKIA 4JXSA 4PM7A 3IF5A 4QHCA 3Q81A 4GZBA 3UDXA 2Y2QA 5BOHA 2EX8A 4U0XA 3PBQA 5FI7A 3SH9A 4OPYA 4YFMA 1CEFA 2ZQ9A 1ZG4A 5E2GA 3LEZA 4S2IA 3IWQA 5F1GA 2J9PA 3ZVWA 1ERQA 3IXGA 1HZOA 2ZD8A 1BUEA 1NZOA 4OOMA 3W8KA 2PU4A 4KZBA 3WS2A 2EFXA 5EOOA 3OCNA 3P98A 1L0DA 4KZ6A 2WAEA 1BSGA 3ZG7B 4WM9A 3JYIA 3IWOA 2R9WA 4C6YA 1O7EA 1XPBA 4UHUA 5CEBA 2PBYA 4KZ9A 4NETA 5FAOA 4EWFA 2ZQAA 4M3KA 2Y2PA 3QNBA 4OOYA 1ESUA 4OKPA 3WRZA 3BFDA 1XXMA 4A5RA 2XH9A 3Q82A 4GDNA 3G4PA 4IEDA 1K55A 3NIAA 3O86A 5CRFA 1E3UD 2HP9A 3A3EA 3NDEA 4PM9A 2ZMAA 1W8YA 1XP4A 3M2JA 4X53A 1BLPA 3MZDA 1ES2A 4GDBA 4MNRA 1CK3A 3UDFA 3VP4A 3FYZA 2XF3A 3BLSA 3AGFA 5D3OA 1LLBA 2J7VA 2JC7A 3NI9A 5HAPA 4E6XA 5GLAA 4IVIA 2HDQA 5CHMA 1G6AA 1O07A 2XLNA 2EX2A 3PBNA 2CC1A 4OVDA 4Y0OA 3N8SA 2WGWA 2FFYA 4LV3A 3FV7A 5DF7A 3N8LA 4CJNA 1XGIA 4GKUA 4DF6A 3SH7A 3MZEA 4N9LA 2A3UA 5HFOA 1S0WA 3HUMA 3ZNTA 3HLDA 2JBFA 1W8QA 1K25A 2Y2MA 1MWRA 4NK3A 4BJPA 3N6IA 4P85A 4DRTA 1FR1A 4C3QA 4EQIA 4DE3A 5TFQA 1I5QA 4X56A 4S2MA 1L0FA 1MBLA 2ZQCA 4R23A 1JTGA 2WUQA 3OPRA 2QPNA 5CHJA 1E3UA 2G2UA 4QU3A 5EECA 2P74A 2WZZA 3E2KA 5JYPA 3SOIA 4EUZA 1MWTA 3MXRA 5IHVA 1SHVA 3C7VA 3IWIA 1K57C 2WK0A 4BLMA 2XEPA 3VP2A 1PIOA 5E2HA 1NXYA 1FOFA 5EVIC 4QJGA 1YLPA 3N8RA 4S2NA 4OQGA 3IH9A 3OCLA 4UA6A 4DDSA 2V2FF 1FCNA 1YMSA 1I2SA 1L0GA 2A49A 3S22A 4E6WA 1NYMA 2H0YA 3IXBA 4X55A 4OLDA 1L2SA 4FCFA 4U3TA 2ZC7A 3S4XA
chains in the Genus database with same CATH superfamily
3B33A 4GLQA 4ARZA 3SS5A 3MZFA 2WGIA 3VOYA 1KDSA 4JF5A 1STZA 3GSGA 1UWPX 2DRWA 5F69A 1IOUA 4WLAA 3PXPA 4EUVA 4ZJ2A 1H0MA 4K0XA 4XUXA 1OTBA 2K7SA 2QJ5A 5FL3A 4E3NA 1LSVA 3T1QB 4KUKA 1Y28A 1H8MA 3UY6A 3ZQ5A 4Y17A 4Y15A 3UPNA 2VA0A 3TSGA 1BTLA 3OBFA 2QZ6A 5HW3A 3I7JA 1W7FA 1DJAA 3E2LA 3BWLA 1BLCA 4GD8A 3LR3A 2E8IA 5HPIA 2B02A 3LIAA 2AVXA 1M40A 3LICA 5E43A 3IS2B 3MKEA 3CLOA 3BJNA 3JVUA 3MXSA 3BEBA 4KG2A 1DRMA 3CG5A 3R4KA 1KGFA 3T12B 2VX8A 1YPRA 2RL3A 1YLJA 2X01A 3WS0A 4KENB 1IFQA 1DY6A 2EFUA 5GL9A 1N9BA 3HBRA 1PI5A 1FR6A 1PWCA 4LGWA 4R1GA 4GCZA 1JWVA 4LRZE 3EOIA 4P6BA 5KSCA 1DP6A 4DJ3A 5DTTA 4KZAA 2J8YA 2ZOHA 2KOIA 2QMIA 3DWKA 4KZ8A 3RJUA 2EA9A 1TS6A 3WS1A 3S7OA 5F6AA 5DF8A 3A3JA 4Y3IA 3Q7VA 1XA7A 4DKIA 2JKRM 2VK3A 4UAAA 3Q07A 3MQOA 1KDWA 3LFVA 4OPRA 1K4EA 3VP1A 4KQOA 5CGSA 4KG6A 5HWWA 4IUHA 3NY4A 4I3JA 5C5KA 4CPKA 5GLBA 3IBJA 1YLYA 2QJ7A 3HJIA 4E3MA 4YNRA 4QD4A 1YKDA 1MC0A 1ODVA 5AVEA 1FQGA 2I9VA 5IT5A 3EGXC 2GDNA 2P9VB 5L2FA 2ZLYA 3WWXA 1KE4A 4XT2B 1YLZA 1AXBA 1NRJA 2OLUA 4HP4A 4L9GA 2WKEA 2G2WA 2HPBA 3BFFA 5HDCA 1H8ZA 5MC7A 5AQBA 4Q8IA 5HAQA 2XFSA 3ZG5A 4S2LA 5EV0A 3VFHA 1TF1A 3KSIA 5KZHA 4LV0A 1J3WA 4MBFA 2JKRI 4EBPA 3PBTA 2PYRA 3B3XA 4X69A 1YT4A 3UB9A 3MFXA 4LRXC 1V9ZA 4X6TA 3CMZA 3UNWA 1Y54A 1EI5A 3W2ZA 2FZ0A 1OMEA 1YM1A 1EROA 1LI0A 5HDSA 3D72A 5EUAA 1NWZA 3FC7A 4KZ7A 1CQAA 3CHWP 3MS6A 5HAIA 4GS9B 4QB8A 1H5XA 4OQHA 3UE0A 3V3SA 4PMAA 3VFFA 3CUEC 2Y2IA 4N92A 1JNUA 2WYXA 2ZC3B 4UEYA 1JTDA 1TVFA 4UA7A 1XJ4A 1IKIA 1LI9A 1T18A 3ZVTA 4L0LA 4JF4A 3VOZA 3GR2A 4IJGA 4WZ5C 3DTMA 1NJ4A 2XR0A 3RXXA 4ZDXA 4ZBEA 1KE0A 4JXVA 5I5LA 3FPWA 4G3KA 4IBRA 3PAEA 4P87A 4WL9A 2O99A 3EQVA 3G35A 4R38A 2PR5A 3U2AA 2NUTC 3GDIA 4H6JA 4ID4A 3SS4A 3LIEA 1DJBA 2W1TB 4EQ1A 2GNXA 3IBRA 4B88A 4GNUA 1E4DA 5HZHA 2WGVA 4RA7A 3MJQA 4KZ5A 3V5MA 1UGUA 1CJFA 1VHMA 3IHAA 5A92A 3OZHA 5FQMA 3JVVA 1E25A 3R7WB 4D2OA 2X71A 4PHTA 3T50A 4E04A 2JKGA 2PT7A 2JKTM 3IF5A 4QHCA 4GZBA 5BOHA 4U0XA 3PBQA 3SH9A 4OPYA 3VE3A 3DTKA 4ESPA 3F1OB 2ZQ9A 3D9YA 3IWQA 1P9RA 3W8KA 4LRYC 4KZ6A 2JHEA 2WAEA 2QKPA 1BSGA 3ZG7B 4WM9A 1D7EA 2R9WA 1XPBA 4BWIA 2PBYA 4KZ9A 4NETA 5FAOA 4EWFA 4OOYA 1ESUA 4OKPA 3G4PA 2HP9A 1XP4A 1BLPA 4GDBA 3BLSA 1LLBA 5HAPA 4E6XA 5CHMA 2HZ5A 1G6AA 4OVDA 4R3AA 2CC1A 3HCYA 2FFYA 1XGIA 4HJ4A 3T1RA 3MZEA 2ACGA 2A3UA 5HFOA 1S0WA 3HLDA 1K25A 2Y2MA 3PHYA 4I3AA 4K08A 4GHIA 1I5QA 4Q0JA 4B9OA 2J80A 2ZQCA 3P01A 5CHJA 1SZVA 1F2KA 5EECA 5JYPA 3LI9A 3SOIA 2JKTI 4BBUA 3H82B 1WA9A 2HJ9C 2WK0A 3TRCA 3VP2A 1OTEA 5E2HA 5EVIC 4QJGA 1YLPA 3N8RA 2ZL1B 3E0YA 2OOLA 2OWHA 1S67L 1YMSA 3S22A 1L2SA 4FCFA 1GSVA 3NC8A 3C8CA 3UPPA 4LLOB 2HP5A 5AQ7A 5FASA 4HH2A 3VE4A 3HLWA 2EX9A 1NLYA 5JYOA 2FH5A 1Q2QA 1ZC2A 2RCXA 3DWZA 1P0ZA 3UB6A 1XFNA 4L9FA 5CX7A 4C75A 2OSUA 3NOPC 2ZM8A 4Q0IA 1GHMA 5CTMA 3LR0A 4OQIA 5A93A 4O8GA 4X1MA 1ES5A 1SDNA 1K54A 3T4QA 2ZQDA 1ONHA 1DP8A 1I2WA 4ME4A 4WN5A 5CGWA 3BM6A 1ALQA 3C7UA 3NBLA 3UE6A 1NZUA 2Z6CA 4I5SA 2ZM2A 3UB5P 1CEGA 2GZAA 1JWZA 5M1AA 3PAGA 4XUZA 4JF6A 3IT9A 5AQAA 5FDHA 2Y2KA 2C5WB 4CLCE 4I3IA 1G28A 1RP5A 3KYZA 2VV8A 3O88A 3DBAA 4R0QA 5HL1A 4HESA 5LBRA 1FCOA 1P9WA 3QP1A 4FTXA 1K55C 4S2JA 3HLBA 3N4IA 3NHQA 3K3DA 2ZOIA 4OP5A 4R70A 2IWDA 4LFUA 3EQUA 5TR7A 3MSHA 4NXEA 3ZYTA 3KYEA 1FILA 3CPTB 2VGKA 4PM6A 3ZG0A 4GN2A 2Y4AA 3VP0A 4S2PA 1LHYA 5DF9A 3KSHA 4WZ4A 2WKRA 4ZJ1A 2P08A 3VOLA 3DAVA 4KZ4A 1LL5A 4GS9A 2KX6A 2ZBBA 2V1AA 1VM1A 2XQZA 1GSWA 4F3LB 3VV4A 2ZC5B 4R4SA 3QP5A 5G4YA 1RGZA 2V8CA 3T4SA 3U4LP 3HLEA 5TGFA 1N9OA 4I39A 2ZM0A 2O9BA 3UN7A 2Y2HA 2B18A 4B4XA 2V1ZA 1ERMA 4JGOA 5FAQA 2NUPC 2EWWA 2OAP1 3H7WB 4CQHA 3BFCA 3TOIA 2H0TA 5EVIB 3HREA 4YINA 5CECA 2W1TA 4HBTA 3HUOA 3T4TA 3Q1FA 3M6HA 5E2FA 2ZC4B 2V9AA 5I94A 3V67A 3BRMA 1NY0A 4LENA 1NRFA 3PBRA 2OAQ1 3ITBA 3O87A 2Y2JA 5EOEA 3GTCA 4IUKA 4QY6A 1EW0A 3ZHHA 4HH3A 3G6OA 3LIBA 3DTEA 5L07A 2K2NA 4EERA 4FH4A 3S7NA 5M19A 2YKHA 5CXWA 4DDYA 5K5BA 2FFFB 3RXWA 1ES3A 1PWGA 3R7WA 1K57A 3OLOA 1ZG6A 5G4ZA 1SKOB 4OH0A 3LCEA 3MFDA 5E2EA 1T1AA 4FOFA 2BTFP 3NCKA 1YLWA 2HGVA 4DE1A 1KGEA 1IYSA 3Q7ZA 5HARA 3DTIA 1BT5A 2WAFA 4E3IA 1JWPA 1TS0A 4OP8A 4OONA 1AWIA 2W0NA 3UB7A 4KQRA 5J7EA 4NXGA 4QWOA 3HLFA 4JKTA 2Y2GA 3VP3A 4JGRA 3F1NB 2R9XA 4E3OA 1TDLA 3OC2A 1T1BA 3BECA 4DMZA 1PI4A 4XXRA 3UE3A 4PAUA 4RYEA 5KIZA 1RCJA 3BQ8A 3PTEA 4S2NC 5CGXA 5GLCA 2O0YA 3C30A 3NOUC 4RX3A 4ZTKA 5FQKA 1WYCA 3AGDA 3QHYA 3FKWA 4EEUA 1HD8A 4JXWA 1IKGA 4NKPA 3IF6A 4Y0TA 1VQQA 3QNCA 5DKKA 3D3OA 4HOIA 5FQ9A 4K0WA 5IS1A 4BD1A 1TS7A 1PNEA 3PR6A 2Y2QA 3C38A 3RH8B 2M7VA 3SW1A 1ZG4A 5E2GA 3ZVWA 1ERQA 2ZD8A 3GECA 1VEUB 4X1LA 1LT0A 5EOOA 1L0DA 2ZMVA 3JYIA 1O7EA 3A0SA 3CUEA 1LSWA 4A5RA 2XH9A 4GDNA 2Z6DA 5CRFA 2IWBA 3A3EA 3MXQA 4X53A 2ZMAA 3EGDC 1ES2A 1MKMA 3K3CA 3UDFA 1A0KA 2IA2A 2XLNA 3PBNA 3N8SA 3CWFA 4ARZB 4GKUA 4DF6A 4PKYG 3HUMA 3ZNTA 2JBFA 1W8QA 5HDDA 2VGLS 4BJPA 4P85A 3BQAA 3MQ0A 1L0FA 2QPNA 4QU3A 2WZZA 3MXRA 3IWIA 3JPUA 3EEHA 4BLMA 3UMEA 1PIOA 2A24A 3IH9A 3OCLA 4DDSA 1PRQA 1FCNA 2V2FF 1L0GA 4E6WA 2H0YA 4X55A 4OLDA 5DJUA 4U3TA 2VGLM 1YLTA 4Y7PA 2R78A 4N1XA 5F68A 1PYYA 3M2KA 4WEJA 4KZ3A 5TBMA 3PYPA 3M6BA 5FDSA 5DTSA 1OTIA 4GD6A 2Z2MB 4CLCC 1BYWA 5FA7A 2W3DA 5EFWA 2J3TC 2Y8HA 3C4PA 2KDKA 3GQZA 4RVAA 4BD0A 1L3LA 2J9OA 2WGWB 2XD5A 3HVFA 4AFIA 1IYPA 1WE4A 1XX2A 4WMCD 2VV7A 3MMHA 4NEED 3ITAA 3KX0X 3WS5A 4L9EA 4R4RA 5HSQA 4JGQA 4KUOA 1SDEA 4HIAA 4RX2A 3ZGAB 4F3LA 1RGYA 1SCWA 3Q7VB 3LEQA 2DCFA 5L10A 4GB7A 3IH8A 1MWSA 4EV4A 5F83A 3SZTA 4JXGA 1Q2PA 4ZJ3A 4WMCA 1OJ5A 1K56D 1M6KA 3UDIA 4NG2A 1F98A 4YOFA 5GHXA 5J4EA 1WYBA 1K4FA 2JCHA 5DFXA 3GVBA 4N1HA 1PZOA 1W63Q 3GRJA 3P09A 3NOTC 2OLVA 4BBTA 4HJ3A 4X68A 3ZNYA 2C6WB 3DW0A 3OPHA 3TE8A 3W4OA 1GHIA 3IS2A 4IHQA 3UO9A 3EEAA 1K56A 3OPLA 5KMWA 4MCWA 5DFYA 3B47A 5FAPA 2QYBA 4OOLA 2HDUA 3TJZC 5HPFA 4EEPA 2HJEA 1HTZA 4PM8A 2HDSA 4DN0A 4MLLA 3SH8A 5CERA 2JN7A 5FATA 4JBFA 1W63M 3CJMA 3WS4A 4HEFA 4DJ2A 4WEKA 1PWDA 3ICYA 1ESIA 4OPQA 2Y55A 2H5SA 2WZXA 4FH2A 1XA1A 2G7UA 2YKFA 1V9YA 2A2LA 4FUWA 2EX6A 3G2ZA 3B42A 2EXAA 1JVJA 1TEMA 5AJGA 3ZDJA 4OPZA 2BLSA 4DE2A 3LR5A 1KE3A 1MXOA 4F94A 1W5DA 1U60A 2XDMA 4DXBA 2I72A 1IEMA 1YQSA 3T1SA 1MZUA 3GMWA 2P04A 2VGJA 5L8MA 1MWUA 3UPOA 3TW8A 1J9MA 2P9VA 3T4JA 5EE8A 3BFEA 4O01A 4Y13A 4XT2A 3F1PB 4FD8A 4M4XA 2ZMFA 3IXDA 4EXOA 4CLCB 1FSWA 4G3VA 2L1MA 1FSYA 2GX5A 4H6JB 1ES4A 1XGJA 1K54C 5FI2A 4MN7A 1YMXA 3NECA 4WYYA 1OTDA 2Y2NA 2P7JA 1TD5A 4JPMA 4BL3A 5HL6A 4HBUA 1KGGA 4KG5A 3FZCA 4BBVA 5EM0A 4N9KA 2EWVA 2V8FA 5HX9A 5TJJA 2DNSA 1BLSA 2LB5A 3C4OA 4EBLA 1K0KA 4HY8A 1GA0A 3C5AA 3A3FA 3LIDA 3WRTA 3PBOA 1FCMA 3UB8A 1K38A 4KQQA 3BYDA 1S66L 3D4FA 2UV0E 1F9IA 1K6RA 3A3DA 3QP4A 3FG8A 3T1XA 4KQDA 5FQJA 3LIFA 1G6OA 2J3WA 2Y2OA 4Y5FA 3FWLA 3LY3A 1LL9A 3ZCZA 1G5UA 2ZC6B 4ETZA 3ISGA 2ZQ7A 2D01A 1IYOA 1QMFA 3RTYA 4O0PA 3UDXA 5FI7A 4Z1WA 1OT6A 3LYXA 4YFMA 1CEFA 5HD5A 3LEZA 3IXGA 1NZOA 4MMNA 2PU4A 4KZBA 4GHIB 3OCNA 3IX3A 2W3FA 1UWNX 1HLUP 3IWOA 4C6YA 4R6LA 4UHUA 2ZQAA 3HJKA 3NJAA 2Y2PA 3WRZA 1OJGA 4IEDA 2PRFA 3NIAA 3ZFZA 1E3UD 2W3GA 1W8YA 3MZDA 1CK3A 3VP4A 3AGFA 5D3OA 3NI9A 3L9KA 5GLAA 4IVIA 2HDQA 2XROA 4Y0OA 1O07A 3LR4A 2WGWA 5AVFA 4LV3A 5DF7A 3N8LA 4CJNA 3F1OA 3SH7A 1ZHHB 4WUJA 1MWRA 3N6IA 4DRTA 4EQIA 1F5MA 5TFQA 1VETB 4X56A 4R23A 5F5YA 4GW9A 4EETB 1JTGA 3OPRA 1E3UA 2HF6A 3H9WA 4EUZA 5IHVA 1SHVA 3C7VA 1K57C 3IX4A 1ZTUA 1NXYA 1FOFA 4S2NA 4OQGA 1H3QA 1NLZA 1I2SA 1OPXA 1NYMA 3IXBA 1BZAA 2ZC7A 3S4XA 3MKFA 2V20A 2Q9NA 3A3IA 2Y2LA 2XGNA 4Y0UA 2X02A 5HWTA 1HVBA 5DTKA 4O7DA 4IBXA 1MY8A 4HI4A 2V0UA 1XJ6A 4S2OA 2QWSA 3PBSA 3P7NA 2DMWA 4WELA 3H82A 1NYYA 1DJCA 5GLDA 5M18A 1YSQA 2ZL1A 4D60A 3LO7A 3EWKA 5A8BA 5GHZA 1YSPA 2Z2LB 4HQAA 5FQQA 2B95A 2KLIA 2Y59A 5EPHA 4EU0A 3K2NA 1X0OA 3IF6C 3G34A 3G2YA 2Q0OA 1YAXA 3S7PA 5U47A 4HJ6A 4ZRRA 5FQIA 2IWCA 5KSHA 1GHPA 1OT9A 5A90A 2E8JA 5F82A 2JKFA 3VMAA 1MKIA 1GSXA 5FEGA 3QP8A 2Q9MA 2H10A 4WZ5A 4LCLA 3IXHA 4IVKA 2BG1A 3HLCA 4NK3A 1FIKA 1PZPA 4GJ4A 1PFLA 4R3JA 2Y91A 1QMEA 1IYQA 4LV2A 4U0TA 3MR0A 4MDZA 3A0VA 4B4ZA 2HV1A 4CLCD 5FSRA 4R3BA 5G18A 1S1ZA 2HP6A 2J3TD 4ZAMA 2L0WA 2ZQ8A 4JLFA 1KVMA 1BULA 4EBNA 2V0WA 2PYPA 3HL9A 2B5RA 4P6ZS 3IHBA 2PBDP 4PPRA 1KOUA 3ULFA 4B93A 1LSXA 1T19A 2L4RA 4II7A 4UQIS 5DVAA 3F1PA 3IX8A 3NULA 1GA9A 3G30A 3S1YA 4LV1A 2V1BA 4CLCA 4E3LA 4G3WA 3AGEA 2HDRA 4PKYA 3S7QA 1N9LA 3BY9A 4QPRA 1W79A 2VV6A 2XRNA 4P6ZM 2WADA 5EVLA 3MQQA 4H8RA 3VSKA 2OV5A 3NDGA 3CZDA 3V3RA 1IELA 4MN6A 2XK1A 5CTNA 1CI8A 4UQIM 3FPVA 3GV9A 4BL2A 3CPTA 1ACFA 4YWZA 3W4QA 2UWXA 1S4RA 5F1FA 3OPPA 2VJWA 1K6SA 3LY4A 4Z9QA 4WBGA 4BQMA 3E4QA 2QHKA 1XJ2A 4MEZA 1VB6A 5GHYA 3V39A 5J3WA 2W3HA 4JGPA 4QY5A 3T4KA 1XFQA 1N4OA 1P97A 5CHUA 4NXBA 5FI6A 5EVID 3W4PA 2WKQA 1LL8A 1EWZA 3MF0A 2PAVP 4LCMA 3C2WA 1XKZA 3CAXA 1G68A 2W1RA 4EESA 4EW7A 5J8XA 2XFTA 4WF0A 4PM5A 1TDGA 1H8YA 4X25A 3KSFA 2XSSA 1S6RA 3H7WA 2W27A 3BLMA 4S2KA 3VSLA 4P0MA 3BFGA 2JE5A 2PD8A 3G31A 5EVIA 1L0EA 1ZKJA 2PU2A 4UA9A 2XD1A 1Z6FA 5AQ9A 1BLHA 2K31A 2WKPA 3A0RA 4OLGA 2M7UA 3KO6A 3UE1A 2M1CA 1C3BA 4E3KA 3SS3A 4NXFA 1PW8A 4GOGA 4E3JA 4K91A 4Q0HA 3HUNA 3E4OA 2PHYA 3T4OA 3N7WA 3IF6B 3FKVA 5FEFA 4DE0A 4DXCA 1PW1A 3E98A 2EXBA 2Y79A 3ZG8B 3LI8A 2PR6A 1SKOA 4HHDA 1CI9A 3V50A 3LUQA 1KVLA 1GCEA 3KYQA 1MPLA 4MBKA 1Y4OA 2PDRA 1TS8A 3QP6A 1ONGA 2BASA 2VKSA 1SKFA 2ZJ9A 4FSFA 1CF0A 3MBZA 4BENA 5CEDA 3OOVA 1XJ3A 3IQAA 3TG9A 1VETA 1DP9A 2O9AA 3CITA 2W3EA 3T4LA 4MBHA 2H28A 5A91A 3ZG9B 3F1NA 4LPZA 3O3VA 5EM1A 2WKHA 3HLGA 3G32A 4OQ0A 2WKIA 4JXSA 4PM7A 5EVEA 5HD3A 3Q81A 3QP2A 1T1CA 2EX8A 1OTAA 4I38A 2MJ6A 1D06A 4Y2FA 4S2IA 5F1GA 2J9PA 1HZOA 1BUEA 2PD7A 3L7HA 4OOMA 3O5YA 3WS2A 2EFXA 2XA7S 3P98A 5DKLA 2VZWA 4HP9A 3UMDA 5CEBA 2CMNA 4M3KA 2OWJA 3QNBA 4BMWA 3BFDA 1XXMA 3Q82A 1K55A 3O86A 3NDEA 5DJTA 4PM9A 3M2JA 4MNRA 3FYZA 2XF3A 2J7VA 2A24B 2JC7A 2GJ3A 1D1JA 2EX2A 3KSGA 3LGOA 3FV7A 2VEAA 2XA7M 1S1YA 4N9LA 2LB9A 3RFBA 1N9NA 4HNBA 4ETXA 1VEUA 5TBMB 2O9CA 1FR1A 4C3QA 4RQ9A 4DE3A 2D02A 2VLGA 4S2MA 1MBLA 2INWA 2WUQA 2G2UA 2P74A 3E2KA 1MWTA 5IU1A 1S4SA 2XEPA 3E4PA 3BY8A 5L09A 3CI6A 4UA6A 1Z09A 2A49A 5HWVA 3BW6A 4MN5A
chains in the Genus database with same CATH topology
3MKFA 2V20A 1YLTA 4Y7PA 2Q9NA 3A3IA 2Y2LA 4N1XA 3NC8A 3SS5A 3MZFA 1PYYA 2XGNA 2WGIA 4Y0UA 3M2KA 3UPPA 2HP5A 3VOYA 1KDSA 2X02A 4JF5A 4WEJA 5AQ7A 1HVBA 4KZ3A 5DTKA 5FASA 3GSGA 3HLWA 4O7DA 2EX9A 4IBXA 2DRWA 3M6BA 1MY8A 4S2OA 5JYOA 5DTSA 1Q2QA 3PBSA 4GD6A 1ZC2A 4ZJ2A 2Z2MB 2RCXA 4K0XA 4XUXA 3DWZA 4WELA 5FA7A 1NYYA 4E3NA 1DJCA 5GLDA 5M18A 3C4PA 3GQZA 3UY6A 4RVAA 4BD0A 4C75A 3UPNA 2J9OA 2OSUA 2WGWB 2XD5A 2ZM8A 3HVFA 3LO7A 1IYPA 3TSGA 1WE4A 1XX2A 1BTLA 4WMCD 1GHMA 5CTMA 2QZ6A 5HW3A 3I7JA 5GHZA 1W7FA 1DJAA 4OQIA 3E2LA 2Z2LB 5A93A 5FQQA 1BLCA 4GD8A 1ES5A 3ITAA 3WS5A 1SDNA 2E8IA 4R4RA 1SDEA 1M40A 2Y59A 1K54A 5EPHA 5E43A 3MKEA 4RX2A 3ZGAB 3IF6C 2ZQDA 3G34A 1ONHA 3G2YA 1RGYA 3MXSA 1I2WA 1SCWA 3BEBA 4KG2A 5CGWA 3Q7VB 3BM6A 5U47A 2DCFA 5FQIA 3CG5A 1KGFA 1ALQA 2IWCA 3C7UA 5KSHA 3NBLA 4GB7A 1GHPA 3IH8A 5A90A 1MWSA 4EV4A 5F82A 2RL3A 5F83A 4JXGA 3VMAA 1NZUA 1Q2PA 1YLJA 2ZM2A 2X01A 4ZJ3A 4WMCA 3WS0A 1MKIA 1CEGA 1K56D 1M6KA 4KENB 3UDIA 1JWZA 1DY6A 5M1AA 4R1GA 2EFUA 3PAGA 4JF6A 4XUZA 1N9BA 2Q9MA 5GL9A 5GHXA 3HBRA 2H10A 1WYBA 1PI5A 1FR6A 1K4FA 1PWCA 2JCHA 2Y2KA 2C5WB 2BG1A 3GVBA 3HLCA 1PZOA 3GRJA 1PZPA 3IXHA 3P09A 4IVKA 4N1HA 1JWVA 1RP5A 4P6BA 4R3JA 2OLVA 5KSCA 2Y91A 4X68A 3O88A 1QMEA 1IYQA 3ZNYA 4LV2A 4U0TA 5DTTA 4R0QA 4KZAA 5HL1A 4HESA 2J8YA 4KZ8A 2QMIA 3DWKA 3RJUA 3ZFZA 2C6WB 4B4ZA 3DW0A 3OPHA 4R3BA 5FSRA 1FCOA 3W4OA 1GHIA 3WS1A 5G18A 2HP6A 5DF8A 4ZAMA 1K55C 3UO9A 3A3JA 2ZQ8A 4S2JA 3HLBA 3N4IA 3Q7VA 4JLFA 1XA7A 1KVMA 1BULA 4DKIA 4EBNA 4OP5A 3HL9A 3Q07A 1K56A 3OPLA 2B5RA 2IWDA 4UAAA 3IHBA 1KDWA 3EQUA 5TR7A 5KMWA 2VGKA 4OPRA 4PPRA 1K4EA 3VP1A 4PM6A 3ZG0A 4KQOA 5CGSA 5FAPA 4GN2A 2Y4AA 4KG6A 3VP0A 4OOLA 4S2PA 2HDUA 5DVAA 3NY4A 1LHYA 1HTZA 4CPKA 4PM8A 5DF9A 4WZ4A 2HDSA 5GLBA 4MLLA 1GA9A 3SH8A 5CERA 3G30A 4ZJ1A 1YLYA 4LV1A 3S1YA 4KZ4A 1LL5A 4E3LA 3AGEA 5FATA 5AQAA 4E3MA 2HDRA 4JBFA 3CJMA 1VM1A 2XQZA 3WS4A 4HEFA 4QD4A 2ZC5B 4R4SA 4WEKA 1PWDA 1W79A 1ESIA 1RGZA 2WADA 5EVLA 4H8RA 3VSKA 2OV5A 3HLEA 3NDGA 5TGFA 1FQGA 4OPQA 3CZDA 3V3RA 1IELA 2GDNA 2P9VB 2Y55A 2ZM0A 2H5SA 2XK1A 5CTNA 2WZXA 2ZLYA 4FH2A 1CI8A 5L2FA 1XA1A 3GV9A 4BL2A 3WWXA 1KE4A 3UN7A 2Y2HA 1YLZA 1AXBA 2EX6A 3W4QA 2UWXA 3G2ZA 4B4XA 2V1ZA 5F1FA 3OPPA 1ERMA 1K6SA 3LY4A 4Z9QA 2EXAA 5FAQA 1JVJA 1TEMA 3ZDJA 2OLUA 4WBGA 4OPZA 4BQMA 2BLSA 2G2WA 2HPBA 2WKEA 3BFFA 4DE2A 1KE3A 1MXOA 1H8ZA 4F94A 4MEZA 1W5DA 1U60A 5GHYA 3V39A 5AQBA 4Q8IA 5HAQA 2XFSA 3BFCA 3ZG5A 4S2LA 3TOIA 3VFHA 2H0TA 4QY5A 2XDMA 5KZHA 4LV0A 4MBFA 5EVIB 4DXBA 1N4OA 3HREA 2I72A 5CHUA 1IEMA 4EBPA 1YQSA 4YINA 5CECA 3GMWA 4HBTA 5FI6A 3PBTA 5FDHA 3HUOA 2VGJA 1MWUA 3Q1FA 3B3XA 4X69A 3M6HA 5E2FA 2ZC4B 5EVID 1YT4A 3W4PA 3UPOA 1EWZA 4X6TA 3CMZA 3UNWA 1Y54A 5I94A 1EI5A 3BRMA 1NY0A 4LENA 4LCMA 1J9MA 2P9VA 1NRFA 1XKZA 3PBRA 5EE8A 1OMEA 1G68A 1YM1A 3ITBA 3O87A 1EROA 2Y2JA 5EOEA 3GTCA 3BFEA 4QY6A 3ZHHA 1LI0A 5J8XA 2XFTA 5EUAA 4FD8A 4FH4A 4PM5A 1TDGA 1H8YA 5M19A 5CXWA 3IXDA 4KZ7A 4DDYA 5HAIA 1FSWA 1S6RA 4QB8A 1FSYA 1H5XA 2FFFB 3RXWA 1ES3A 1PWGA 1ES4A 1XGJA 1K54C 3BLMA 1K57A 4OQHA 4S2KA 3UE0A 5FI2A 1ZG6A 3V3SA 3VSLA 4OH0A 4PMAA 4P0MA 3BFGA 2JE5A 3VFFA 3G31A 2Y2IA 4N92A 5EVIA 1L0EA 2WYXA 2ZC3B 1ZKJA 1YMXA 3LCEA 2PU2A 1JTDA 4WYYA 2Y2NA 3MFDA 1TVFA 4UA9A 5E2EA 2XD1A 4UA7A 1Z6FA 5AQ9A 1BLHA 4OLGA 4JPMA 3NCKA 1YLWA 3IT9A 3UE1A 4BL3A 4DE1A 1IKIA 1KGEA 1IYSA 1C3BA 2IWBA 1LI9A 4E3KA 3Q7ZA 5HARA 1PW8A 3SS3A 3ZVTA 4HBUA 4L0LA 4GOGA 4E3JA 4K91A 3HUNA 4JF4A 1KGGA 1BT5A 4KG5A 2WAFA 3FZCA 4E3IA 1JWPA 3VOZA 4OP8A 4N9KA 4OONA 3GR2A 4WZ5C 3DTMA 4KQRA 1NJ4A 2XR0A 3N7WA 5HX9A 3RXXA 4ZDXA 4ZBEA 2DNSA 3IF6B 1KE0A 4JXVA 3HLFA 1BLSA 4JKTA 2Y2GA 3VP3A 3C4OA 3FKVA 4EBLA 4IBRA 2R9XA 3PAEA 4P87A 4E3OA 1TDLA 3EQVA 3G35A 4WZ5A 3OC2A 4DE0A 4DXCA 1PW1A 2EXBA 3ZG8B 4ID4A 3SS4A 1GA0A 4LCLA 3C5AA 3A3FA 1CI9A 3WRTA 1DJBA 3PBOA 1FCMA 3V50A 3BECA 4B88A 1KVLA 1GCEA 1K38A 1PI4A 4GNUA 4KQQA 1E4DA 3BYDA 1MPLA 4MBKA 3D4FA 4XXRA 2WGVA 3UE3A 1K6RA 3A3DA 4RYEA 1RCJA 1BZAA 1ONGA 3PTEA 1SKFA 4S2NC 4RA7A 5CGXA 5GLCA 2ZJ9A 4FSFA 4KZ5A 5FQJA 4RX3A 4ZTKA 5FQKA 3MBZA 4BENA 5CEDA 1WYCA 3AGDA 3QHYA 3FKWA 3V5MA 2Y2OA 3IQAA 3TG9A 1HD8A 4JXWA 3FWLA 3LY3A 1IKGA 1LL9A 3ZCZA 3IHAA 3IF6A 4MBHA 4Y0TA 5A92A 1VQQA 2ZC6B 3OZHA 3QNCA 5FQMA 5A91A 3ZG9B 3ISGA 2ZQ7A 1E25A 3O3VA 5FQ9A 4D2OA 2WKHA 4K0WA 2X71A 3G32A 3HLGA 4OQ0A 1IYOA 4BD1A 1QMFA 2WKIA 4JXSA 4PM7A 3IF5A 4QHCA 3Q81A 4GZBA 3UDXA 2Y2QA 5BOHA 2EX8A 4U0XA 3PBQA 5FI7A 3SH9A 4OPYA 4YFMA 1CEFA 2ZQ9A 1ZG4A 5E2GA 3LEZA 4S2IA 3IWQA 5F1GA 2J9PA 3ZVWA 1ERQA 3IXGA 1HZOA 2ZD8A 1BUEA 1NZOA 4OOMA 3W8KA 2PU4A 4KZBA 3WS2A 2EFXA 5EOOA 3OCNA 3P98A 1L0DA 4KZ6A 2WAEA 1BSGA 3ZG7B 4WM9A 3JYIA 3IWOA 2R9WA 4C6YA 1O7EA 1XPBA 4UHUA 5CEBA 2PBYA 4KZ9A 4NETA 5FAOA 4EWFA 2ZQAA 4M3KA 2Y2PA 3QNBA 4OOYA 1ESUA 4OKPA 3WRZA 3BFDA 1XXMA 4A5RA 2XH9A 3Q82A 4GDNA 3G4PA 4IEDA 1K55A 3NIAA 3O86A 5CRFA 1E3UD 2HP9A 3A3EA 3NDEA 4PM9A 2ZMAA 1W8YA 1XP4A 3M2JA 4X53A 1BLPA 3MZDA 1ES2A 4GDBA 4MNRA 1CK3A 3UDFA 3VP4A 3FYZA 2XF3A 3BLSA 3AGFA 5D3OA 1LLBA 2J7VA 2JC7A 3NI9A 5HAPA 4E6XA 5GLAA 4IVIA 2HDQA 5CHMA 1G6AA 1O07A 2XLNA 2EX2A 3PBNA 2CC1A 4OVDA 4Y0OA 3N8SA 2WGWA 2FFYA 4LV3A 3FV7A 5DF7A 3N8LA 4CJNA 1XGIA 4GKUA 4DF6A 3SH7A 3MZEA 4N9LA 2A3UA 5HFOA 1S0WA 3HUMA 3ZNTA 3HLDA 2JBFA 1W8QA 1K25A 2Y2MA 1MWRA 4NK3A 4BJPA 3N6IA 4P85A 4DRTA 1FR1A 4C3QA 4EQIA 4DE3A 5TFQA 1I5QA 4X56A 4S2MA 1L0FA 1MBLA 2ZQCA 4R23A 1JTGA 2WUQA 3OPRA 2QPNA 5CHJA 1E3UA 2G2UA 4QU3A 5EECA 2P74A 2WZZA 3E2KA 5JYPA 3SOIA 4EUZA 1MWTA 3MXRA 5IHVA 1SHVA 3C7VA 3IWIA 1K57C 2WK0A 4BLMA 2XEPA 3VP2A 1PIOA 5E2HA 1NXYA 1FOFA 5EVIC 4QJGA 1YLPA 3N8RA 4S2NA 4OQGA 3IH9A 3OCLA 4UA6A 4DDSA 2V2FF 1FCNA 1YMSA 1I2SA 1L0GA 2A49A 3S22A 4E6WA 1NYMA 2H0YA 3IXBA 4X55A 4OLDA 1L2SA 4FCFA 4U3TA 2ZC7A 3S4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKF A;  2V20 A;  1YLT A;  4Y7P A;  2Q9N A;  3A3I A;  2Y2L A;  4N1X A;  3NC8 A;  3SS5 A;  3MZF A;  1PYY A;  2XGN A;  2WGI A;  4Y0U A;  3M2K A;  3UPP A;  2HP5 A;  3VOY A;  1KDS A;  2X02 A;  4JF5 A;  4WEJ A;  5AQ7 A;  1HVB A;  4KZ3 A;  5DTK A;  5FAS A;  3GSG A;  3HLW A;  4O7D A;  2EX9 A;  4IBX A;  2DRW A;  3M6B A;  1MY8 A;  4S2O A;  5JYO A;  5DTS A;  1Q2Q A;  3PBS A;  4GD6 A;  1ZC2 A;  4ZJ2 A;  2Z2M B;  2RCX A;  4K0X A;  4XUX A;  3DWZ A;  4WEL A;  5FA7 A;  1NYY A;  4E3N A;  1DJC A;  5GLD A;  5M18 A;  3C4P A;  3GQZ A;  3UY6 A;  4RVA A;  4BD0 A;  4C75 A;  3UPN A;  2J9O A;  2OSU A;  2WGW B;  2XD5 A;  2ZM8 A;  3HVF A;  3LO7 A;  1IYP A;  3TSG A;  1WE4 A;  1XX2 A;  1BTL A;  4WMC D;  1GHM A;  5CTM A;  2QZ6 A;  5HW3 A;  3I7J A;  5GHZ A;  1W7F A;  1DJA A;  4OQI A;  3E2L A;  2Z2L B;  5A93 A;  5FQQ A;  1BLC A;  4GD8 A;  1ES5 A;  3ITA A;  3WS5 A;  1SDN A;  2E8I A;  4R4R A;  1SDE A;  1M40 A;  2Y59 A;  1K54 A;  5EPH A;  5E43 A;  3MKE A;  4RX2 A;  3ZGA B;  3IF6 C;  2ZQD A;  3G34 A;  1ONH A;  3G2Y A;  1RGY A;  3MXS A;  1I2W A;  1SCW A;  3BEB A;  4KG2 A;  5CGW A;  3Q7V B;  3BM6 A;  5U47 A;  2DCF A;  5FQI A;  3CG5 A;  1KGF A;  1ALQ A;  2IWC A;  3C7U A;  5KSH A;  3NBL A;  4GB7 A;  1GHP A;  3IH8 A;  5A90 A;  1MWS A;  4EV4 A;  5F82 A;  2RL3 A;  5F83 A;  4JXG A;  3VMA A;  1NZU A;  1Q2P A;  1YLJ A;  2ZM2 A;  2X01 A;  4ZJ3 A;  4WMC A;  3WS0 A;  1MKI A;  1CEG A;  1K56 D;  1M6K A;  4KEN B;  3UDI A;  1JWZ A;  1DY6 A;  5M1A A;  4R1G A;  2EFU A;  3PAG A;  4JF6 A;  4XUZ A;  1N9B A;  2Q9M A;  5GL9 A;  5GHX A;  3HBR A;  2H10 A;  1WYB A;  1PI5 A;  1FR6 A;  1K4F A;  1PWC A;  2JCH A;  2Y2K A;  2C5W B;  2BG1 A;  3GVB A;  3HLC A;  1PZO A;  3GRJ A;  1PZP A;  3IXH A;  3P09 A;  4IVK A;  4N1H A;  1JWV A;  1RP5 A;  4P6B A;  4R3J A;  2OLV A;  5KSC A;  2Y91 A;  4X68 A;  3O88 A;  1QME A;  1IYQ A;  3ZNY A;  4LV2 A;  4U0T A;  5DTT A;  4R0Q A;  4KZA A;  5HL1 A;  4HES A;  2J8Y A;  4KZ8 A;  2QMI A;  3DWK A;  3RJU A;  3ZFZ A;  2C6W B;  4B4Z A;  3DW0 A;  3OPH A;  4R3B A;  5FSR A;  1FCO A;  3W4O A;  1GHI A;  3WS1 A;  5G18 A;  2HP6 A;  5DF8 A;  4ZAM A;  1K55 C;  3UO9 A;  3A3J A;  2ZQ8 A;  4S2J A;  3HLB A;  3N4I A;  3Q7V A;  4JLF A;  1XA7 A;  1KVM A;  1BUL A;  4DKI A;  4EBN A;  4OP5 A;  3HL9 A;  3Q07 A;  1K56 A;  3OPL A;  2B5R A;  2IWD A;  4UAA A;  3IHB A;  1KDW A;  3EQU A;  5TR7 A;  5KMW A;  2VGK A;  4OPR A;  4PPR A;  1K4E A;  3VP1 A;  4PM6 A;  3ZG0 A;  4KQO A;  5CGS A;  5FAP A;  4GN2 A;  2Y4A A;  4KG6 A;  3VP0 A;  4OOL A;  4S2P A;  2HDU A;  5DVA A;  3NY4 A;  1LHY A;  1HTZ A;  4CPK A;  4PM8 A;  5DF9 A;  4WZ4 A;  2HDS A;  5GLB A;  4MLL A;  1GA9 A;  3SH8 A;  5CER A;  3G30 A;  4ZJ1 A;  1YLY A;  4LV1 A;  3S1Y A;  4KZ4 A;  1LL5 A;  4E3L A;  3AGE A;  5FAT A;  5AQA A;  4E3M A;  2HDR A;  4JBF A;  3CJM A;  1VM1 A;  2XQZ A;  3WS4 A;  4HEF A;  4QD4 A;  2ZC5 B;  4R4S A;  4WEK A;  1PWD A;  1W79 A;  1ESI A;  1RGZ A;  2WAD A;  5EVL A;  4H8R A;  3VSK A;  2OV5 A;  3HLE A;  3NDG A;  5TGF A;  1FQG A;  4OPQ A;  3CZD A;  3V3R A;  1IEL A;  2GDN A;  2P9V B;  2Y55 A;  2ZM0 A;  2H5S A;  2XK1 A;  5CTN A;  2WZX A;  2ZLY A;  4FH2 A;  1CI8 A;  5L2F A;  1XA1 A;  3GV9 A;  4BL2 A;  3WWX A;  1KE4 A;  3UN7 A;  2Y2H A;  1YLZ A;  1AXB A;  2EX6 A;  3W4Q A;  2UWX A;  3G2Z A;  4B4X A;  2V1Z A;  5F1F A;  3OPP A;  1ERM A;  1K6S A;  3LY4 A;  4Z9Q A;  2EXA A;  5FAQ A;  1JVJ A;  1TEM A;  3ZDJ A;  2OLU A;  4WBG A;  4OPZ A;  4BQM A;  2BLS A;  2G2W A;  2HPB A;  2WKE A;  3BFF A;  4DE2 A;  1KE3 A;  1MXO A;  1H8Z A;  4F94 A;  4MEZ A;  1W5D A;  1U60 A;  5GHY A;  3V39 A;  5AQB A;  4Q8I A;  5HAQ A;  2XFS A;  3BFC A;  3ZG5 A;  4S2L A;  3TOI A;  3VFH A;  2H0T A;  4QY5 A;  2XDM A;  5KZH A;  4LV0 A;  4MBF A;  5EVI B;  4DXB A;  1N4O A;  3HRE A;  2I72 A;  5CHU A;  1IEM A;  4EBP A;  1YQS A;  4YIN A;  5CEC A;  3GMW A;  4HBT A;  5FI6 A;  3PBT A;  5FDH A;  3HUO A;  2VGJ A;  1MWU A;  3Q1F A;  3B3X A;  4X69 A;  3M6H A;  5E2F A;  2ZC4 B;  5EVI D;  1YT4 A;  3W4P A;  3UPO A;  1EWZ A;  4X6T A;  3CMZ A;  3UNW A;  1Y54 A;  5I94 A;  1EI5 A;  3BRM A;  1NY0 A;  4LEN A;  4LCM A;  1J9M A;  2P9V A;  1NRF A;  1XKZ A;  3PBR A;  5EE8 A;  1OME A;  1G68 A;  1YM1 A;  3ITB A;  3O87 A;  1ERO A;  2Y2J A;  5EOE A;  3GTC A;  3BFE A;  4QY6 A;  3ZHH A;  1LI0 A;  5J8X A;  2XFT A;  5EUA A;  4FD8 A;  4FH4 A;  4PM5 A;  1TDG A;  1H8Y A;  5M19 A;  5CXW A;  3IXD A;  4KZ7 A;  4DDY A;  5HAI A;  1FSW A;  1S6R A;  4QB8 A;  1FSY A;  1H5X A;  2FFF B;  3RXW A;  1ES3 A;  1PWG A;  1ES4 A;  1XGJ A;  1K54 C;  3BLM A;  1K57 A;  4OQH A;  4S2K A;  3UE0 A;  5FI2 A;  1ZG6 A;  3V3S A;  3VSL A;  4OH0 A;  4PMA A;  4P0M A;  3BFG A;  2JE5 A;  3VFF A;  3G31 A;  2Y2I A;  4N92 A;  5EVI A;  1L0E A;  2WYX A;  2ZC3 B;  1ZKJ A;  1YMX A;  3LCE A;  2PU2 A;  1JTD A;  4WYY A;  2Y2N A;  3MFD A;  1TVF A;  4UA9 A;  5E2E A;  2XD1 A;  4UA7 A;  1Z6F A;  5AQ9 A;  1BLH A;  4OLG A;  4JPM A;  3NCK A;  1YLW A;  3IT9 A;  3UE1 A;  4BL3 A;  4DE1 A;  1IKI A;  1KGE A;  1IYS A;  1C3B A;  2IWB A;  1LI9 A;  4E3K A;  3Q7Z A;  5HAR A;  1PW8 A;  3SS3 A;  3ZVT A;  4HBU A;  4L0L A;  4GOG A;  4E3J A;  4K91 A;  3HUN A;  4JF4 A;  1KGG A;  1BT5 A;  4KG5 A;  2WAF A;  3FZC A;  4E3I A;  1JWP A;  3VOZ A;  4OP8 A;  4N9K A;  4OON A;  3GR2 A;  4WZ5 C;  3DTM A;  4KQR A;  1NJ4 A;  2XR0 A;  3N7W A;  5HX9 A;  3RXX A;  4ZDX A;  4ZBE A;  2DNS A;  3IF6 B;  1KE0 A;  4JXV A;  3HLF A;  1BLS A;  4JKT A;  2Y2G A;  3VP3 A;  3C4O A;  3FKV A;  4EBL A;  4IBR A;  2R9X A;  3PAE A;  4P87 A;  4E3O A;  1TDL A;  3EQV A;  3G35 A;  4WZ5 A;  3OC2 A;  4DE0 A;  4DXC A;  1PW1 A;  2EXB A;  3ZG8 B;  4ID4 A;  3SS4 A;  1GA0 A;  4LCL A;  3C5A A;  3A3F A;  1CI9 A;  3WRT A;  1DJB A;  3PBO A;  1FCM A;  3V50 A;  3BEC A;  4B88 A;  1KVL A;  1GCE A;  1K38 A;  1PI4 A;  4GNU A;  4KQQ A;  1E4D A;  3BYD A;  1MPL A;  4MBK A;  3D4F A;  4XXR A;  2WGV A;  3UE3 A;  1K6R A;  3A3D A;  4RYE A;  1RCJ A;  1BZA A;  1ONG A;  3PTE A;  1SKF A;  4S2N C;  4RA7 A;  5CGX A;  5GLC A;  2ZJ9 A;  4FSF A;  4KZ5 A;  5FQJ A;  4RX3 A;  4ZTK A;  5FQK A;  3MBZ A;  4BEN A;  5CED A;  1WYC A;  3AGD A;  3QHY A;  3FKW A;  3V5M A;  2Y2O A;  3IQA A;  3TG9 A;  1HD8 A;  4JXW A;  3FWL A;  3LY3 A;  1IKG A;  1LL9 A;  3ZCZ A;  3IHA A;  3IF6 A;  4MBH A;  4Y0T A;  5A92 A;  1VQQ A;  2ZC6 B;  3OZH A;  3QNC A;  5FQM A;  5A91 A;  3ZG9 B;  3ISG A;  2ZQ7 A;  1E25 A;  3O3V A;  5FQ9 A;  4D2O A;  2WKH A;  4K0W A;  2X71 A;  3G32 A;  3HLG A;  4OQ0 A;  1IYO A;  4BD1 A;  1QMF A;  2WKI A;  4JXS A;  4PM7 A;  3IF5 A;  4QHC A;  3Q81 A;  4GZB A;  3UDX A;  2Y2Q A;  5BOH A;  2EX8 A;  4U0X A;  3PBQ A;  5FI7 A;  3SH9 A;  4OPY A;  4YFM A;  1CEF A;  2ZQ9 A;  1ZG4 A;  5E2G A;  3LEZ A;  4S2I A;  3IWQ A;  5F1G A;  2J9P A;  3ZVW A;  1ERQ A;  3IXG A;  1HZO A;  2ZD8 A;  1BUE A;  1NZO A;  4OOM A;  3W8K A;  2PU4 A;  4KZB A;  3WS2 A;  2EFX A;  5EOO A;  3OCN A;  3P98 A;  1L0D A;  4KZ6 A;  2WAE A;  1BSG A;  3ZG7 B;  4WM9 A;  3JYI A;  3IWO A;  2R9W A;  4C6Y A;  1O7E A;  1XPB A;  4UHU A;  5CEB A;  2PBY A;  4KZ9 A;  4NET A;  5FAO A;  4EWF A;  2ZQA A;  4M3K A;  2Y2P A;  3QNB A;  4OOY A;  1ESU A;  4OKP A;  3WRZ A;  3BFD A;  1XXM A;  4A5R A;  2XH9 A;  3Q82 A;  4GDN A;  3G4P A;  4IED A;  1K55 A;  3NIA A;  3O86 A;  5CRF A;  1E3U D;  2HP9 A;  3A3E A;  3NDE A;  4PM9 A;  2ZMA A;  1W8Y A;  1XP4 A;  3M2J A;  4X53 A;  1BLP A;  3MZD A;  1ES2 A;  4GDB A;  4MNR A;  1CK3 A;  3UDF A;  3VP4 A;  3FYZ A;  2XF3 A;  3BLS A;  3AGF A;  5D3O A;  1LLB A;  2J7V A;  2JC7 A;  3NI9 A;  5HAP A;  4E6X A;  5GLA A;  4IVI A;  2HDQ A;  5CHM A;  1G6A A;  1O07 A;  2XLN A;  2EX2 A;  3PBN A;  2CC1 A;  4OVD A;  4Y0O A;  3N8S A;  2WGW A;  2FFY A;  4LV3 A;  3FV7 A;  5DF7 A;  3N8L A;  4CJN A;  1XGI A;  4GKU A;  4DF6 A;  3SH7 A;  3MZE A;  4N9L A;  2A3U A;  5HFO A;  1S0W A;  3HUM A;  3ZNT A;  3HLD A;  2JBF A;  1W8Q A;  1K25 A;  2Y2M A;  1MWR A;  4NK3 A;  4BJP A;  3N6I A;  4P85 A;  4DRT A;  1FR1 A;  4C3Q A;  4EQI A;  4DE3 A;  5TFQ A;  1I5Q A;  4X56 A;  4S2M A;  1L0F A;  1MBL A;  2ZQC A;  4R23 A;  1JTG A;  2WUQ A;  3OPR A;  2QPN A;  5CHJ A;  1E3U A;  2G2U A;  4QU3 A;  5EEC A;  2P74 A;  2WZZ A;  3E2K A;  5JYP A;  3SOI A;  4EUZ A;  1MWT A;  3MXR A;  5IHV A;  1SHV A;  3C7V A;  3IWI A;  1K57 C;  2WK0 A;  4BLM A;  2XEP A;  3VP2 A;  1PIO A;  5E2H A;  1NXY A;  1FOF A;  5EVI C;  4QJG A;  1YLP A;  3N8R A;  4S2N A;  4OQG A;  3IH9 A;  3OCL A;  4UA6 A;  4DDS A;  2V2F F;  1FCN A;  1YMS A;  1I2S A;  1L0G A;  2A49 A;  3S22 A;  4E6W A;  1NYM A;  2H0Y A;  3IXB A;  4X55 A;  4OLD A;  1L2S A;  4FCF A;  4U3T A;  2ZC7 A;  3S4X A; 
#chains in the Genus database with same CATH topology
 3B33 A;  4GLQ A;  4ARZ A;  3SS5 A;  3MZF A;  2WGI A;  3VOY A;  1KDS A;  4JF5 A;  1STZ A;  3GSG A;  1UWP X;  2DRW A;  5F69 A;  1IOU A;  4WLA A;  3PXP A;  4EUV A;  4ZJ2 A;  1H0M A;  4K0X A;  4XUX A;  1OTB A;  2K7S A;  2QJ5 A;  5FL3 A;  4E3N A;  1LSV A;  3T1Q B;  4KUK A;  1Y28 A;  1H8M A;  3UY6 A;  3ZQ5 A;  4Y17 A;  4Y15 A;  3UPN A;  2VA0 A;  3TSG A;  1BTL A;  3OBF A;  2QZ6 A;  5HW3 A;  3I7J A;  1W7F A;  1DJA A;  3E2L A;  3BWL A;  1BLC A;  4GD8 A;  3LR3 A;  2E8I A;  5HPI A;  2B02 A;  3LIA A;  2AVX A;  1M40 A;  3LIC A;  5E43 A;  3IS2 B;  3MKE A;  3CLO A;  3BJN A;  3JVU A;  3MXS A;  3BEB A;  4KG2 A;  1DRM A;  3CG5 A;  3R4K A;  1KGF A;  3T12 B;  2VX8 A;  1YPR A;  2RL3 A;  1YLJ A;  2X01 A;  3WS0 A;  4KEN B;  1IFQ A;  1DY6 A;  2EFU A;  5GL9 A;  1N9B A;  3HBR A;  1PI5 A;  1FR6 A;  1PWC A;  4LGW A;  4R1G A;  4GCZ A;  1JWV A;  4LRZ E;  3EOI A;  4P6B A;  5KSC A;  1DP6 A;  4DJ3 A;  5DTT A;  4KZA A;  2J8Y A;  2ZOH A;  2KOI A;  2QMI A;  3DWK A;  4KZ8 A;  3RJU A;  2EA9 A;  1TS6 A;  3WS1 A;  3S7O A;  5F6A A;  5DF8 A;  3A3J A;  4Y3I A;  3Q7V A;  1XA7 A;  4DKI A;  2JKR M;  2VK3 A;  4UAA A;  3Q07 A;  3MQO A;  1KDW A;  3LFV A;  4OPR A;  1K4E A;  3VP1 A;  4KQO A;  5CGS A;  4KG6 A;  5HWW A;  4IUH A;  3NY4 A;  4I3J A;  5C5K A;  4CPK A;  5GLB A;  3IBJ A;  1YLY A;  2QJ7 A;  3HJI A;  4E3M A;  4YNR A;  4QD4 A;  1YKD A;  1MC0 A;  1ODV A;  5AVE A;  1FQG A;  2I9V A;  5IT5 A;  3EGX C;  2GDN A;  2P9V B;  5L2F A;  2ZLY A;  3WWX A;  1KE4 A;  4XT2 B;  1YLZ A;  1AXB A;  1NRJ A;  2OLU A;  4HP4 A;  4L9G A;  2WKE A;  2G2W A;  2HPB A;  3BFF A;  5HDC A;  1H8Z A;  5MC7 A;  5AQB A;  4Q8I A;  5HAQ A;  2XFS A;  3ZG5 A;  4S2L A;  5EV0 A;  3VFH A;  1TF1 A;  3KSI A;  5KZH A;  4LV0 A;  1J3W A;  4MBF A;  2JKR I;  4EBP A;  3PBT A;  2PYR A;  3B3X A;  4X69 A;  1YT4 A;  3UB9 A;  3MFX A;  4LRX C;  1V9Z A;  4X6T A;  3CMZ A;  3UNW A;  1Y54 A;  1EI5 A;  3W2Z A;  2FZ0 A;  1OME A;  1YM1 A;  1ERO A;  1LI0 A;  5HDS A;  3D72 A;  5EUA A;  1NWZ A;  3FC7 A;  4KZ7 A;  1CQA A;  3CHW P;  3MS6 A;  5HAI A;  4GS9 B;  4QB8 A;  1H5X A;  4OQH A;  3UE0 A;  3V3S A;  4PMA A;  3VFF A;  3CUE C;  2Y2I A;  4N92 A;  1JNU A;  2WYX A;  2ZC3 B;  4UEY A;  1JTD A;  1TVF A;  4UA7 A;  1XJ4 A;  1IKI A;  1LI9 A;  1T18 A;  3ZVT A;  4L0L A;  4JF4 A;  3VOZ A;  3GR2 A;  4IJG A;  4WZ5 C;  3DTM A;  1NJ4 A;  2XR0 A;  3RXX A;  4ZDX A;  4ZBE A;  1KE0 A;  4JXV A;  5I5L A;  3FPW A;  4G3K A;  4IBR A;  3PAE A;  4P87 A;  4WL9 A;  2O99 A;  3EQV A;  3G35 A;  4R38 A;  2PR5 A;  3U2A A;  2NUT C;  3GDI A;  4H6J A;  4ID4 A;  3SS4 A;  3LIE A;  1DJB A;  2W1T B;  4EQ1 A;  2GNX A;  3IBR A;  4B88 A;  4GNU A;  1E4D A;  5HZH A;  2WGV A;  4RA7 A;  3MJQ A;  4KZ5 A;  3V5M A;  1UGU A;  1CJF A;  1VHM A;  3IHA A;  5A92 A;  3OZH A;  5FQM A;  3JVV A;  1E25 A;  3R7W B;  4D2O A;  2X71 A;  4PHT A;  3T50 A;  4E04 A;  2JKG A;  2PT7 A;  2JKT M;  3IF5 A;  4QHC A;  4GZB A;  5BOH A;  4U0X A;  3PBQ A;  3SH9 A;  4OPY A;  3VE3 A;  3DTK A;  4ESP A;  3F1O B;  2ZQ9 A;  3D9Y A;  3IWQ A;  1P9R A;  3W8K A;  4LRY C;  4KZ6 A;  2JHE A;  2WAE A;  2QKP A;  1BSG A;  3ZG7 B;  4WM9 A;  1D7E A;  2R9W A;  1XPB A;  4BWI A;  2PBY A;  4KZ9 A;  4NET A;  5FAO A;  4EWF A;  4OOY A;  1ESU A;  4OKP A;  3G4P A;  2HP9 A;  1XP4 A;  1BLP A;  4GDB A;  3BLS A;  1LLB A;  5HAP A;  4E6X A;  5CHM A;  2HZ5 A;  1G6A A;  4OVD A;  4R3A A;  2CC1 A;  3HCY A;  2FFY A;  1XGI A;  4HJ4 A;  3T1R A;  3MZE A;  2ACG A;  2A3U A;  5HFO A;  1S0W A;  3HLD A;  1K25 A;  2Y2M A;  3PHY A;  4I3A A;  4K08 A;  4GHI A;  1I5Q A;  4Q0J A;  4B9O A;  2J80 A;  2ZQC A;  3P01 A;  5CHJ A;  1SZV A;  1F2K A;  5EEC A;  5JYP A;  3LI9 A;  3SOI A;  2JKT I;  4BBU A;  3H82 B;  1WA9 A;  2HJ9 C;  2WK0 A;  3TRC A;  3VP2 A;  1OTE A;  5E2H A;  5EVI C;  4QJG A;  1YLP A;  3N8R A;  2ZL1 B;  3E0Y A;  2OOL A;  2OWH A;  1S67 L;  1YMS A;  3S22 A;  1L2S A;  4FCF A;  1GSV A;  3NC8 A;  3C8C A;  3UPP A;  4LLO B;  2HP5 A;  5AQ7 A;  5FAS A;  4HH2 A;  3VE4 A;  3HLW A;  2EX9 A;  1NLY A;  5JYO A;  2FH5 A;  1Q2Q A;  1ZC2 A;  2RCX A;  3DWZ A;  1P0Z A;  3UB6 A;  1XFN A;  4L9F A;  5CX7 A;  4C75 A;  2OSU A;  3NOP C;  2ZM8 A;  4Q0I A;  1GHM A;  5CTM A;  3LR0 A;  4OQI A;  5A93 A;  4O8G A;  4X1M A;  1ES5 A;  1SDN A;  1K54 A;  3T4Q A;  2ZQD A;  1ONH A;  1DP8 A;  1I2W A;  4ME4 A;  4WN5 A;  5CGW A;  3BM6 A;  1ALQ A;  3C7U A;  3NBL A;  3UE6 A;  1NZU A;  2Z6C A;  4I5S A;  2ZM2 A;  3UB5 P;  1CEG A;  2GZA A;  1JWZ A;  5M1A A;  3PAG A;  4XUZ A;  4JF6 A;  3IT9 A;  5AQA A;  5FDH A;  2Y2K A;  2C5W B;  4CLC E;  4I3I A;  1G28 A;  1RP5 A;  3KYZ A;  2VV8 A;  3O88 A;  3DBA A;  4R0Q A;  5HL1 A;  4HES A;  5LBR A;  1FCO A;  1P9W A;  3QP1 A;  4FTX A;  1K55 C;  4S2J A;  3HLB A;  3N4I A;  3NHQ A;  3K3D A;  2ZOI A;  4OP5 A;  4R70 A;  2IWD A;  4LFU A;  3EQU A;  5TR7 A;  3MSH A;  4NXE A;  3ZYT A;  3KYE A;  1FIL A;  3CPT B;  2VGK A;  4PM6 A;  3ZG0 A;  4GN2 A;  2Y4A A;  3VP0 A;  4S2P A;  1LHY A;  5DF9 A;  3KSH A;  4WZ4 A;  2WKR A;  4ZJ1 A;  2P08 A;  3VOL A;  3DAV A;  4KZ4 A;  1LL5 A;  4GS9 A;  2KX6 A;  2ZBB A;  2V1A A;  1VM1 A;  2XQZ A;  1GSW A;  4F3L B;  3VV4 A;  2ZC5 B;  4R4S A;  3QP5 A;  5G4Y A;  1RGZ A;  2V8C A;  3T4S A;  3U4L P;  3HLE A;  5TGF A;  1N9O A;  4I39 A;  2ZM0 A;  2O9B A;  3UN7 A;  2Y2H A;  2B18 A;  4B4X A;  2V1Z A;  1ERM A;  4JGO A;  5FAQ A;  2NUP C;  2EWW A;  2OAP 1;  3H7W B;  4CQH A;  3BFC A;  3TOI A;  2H0T A;  5EVI B;  3HRE A;  4YIN A;  5CEC A;  2W1T A;  4HBT A;  3HUO A;  3T4T A;  3Q1F A;  3M6H A;  5E2F A;  2ZC4 B;  2V9A A;  5I94 A;  3V67 A;  3BRM A;  1NY0 A;  4LEN A;  1NRF A;  3PBR A;  2OAQ 1;  3ITB A;  3O87 A;  2Y2J A;  5EOE A;  3GTC A;  4IUK A;  4QY6 A;  1EW0 A;  3ZHH A;  4HH3 A;  3G6O A;  3LIB A;  3DTE A;  5L07 A;  2K2N A;  4EER A;  4FH4 A;  3S7N A;  5M19 A;  2YKH A;  5CXW A;  4DDY A;  5K5B A;  2FFF B;  3RXW A;  1ES3 A;  1PWG A;  3R7W A;  1K57 A;  3OLO A;  1ZG6 A;  5G4Z A;  1SKO B;  4OH0 A;  3LCE A;  3MFD A;  5E2E A;  1T1A A;  4FOF A;  2BTF P;  3NCK A;  1YLW A;  2HGV A;  4DE1 A;  1KGE A;  1IYS A;  3Q7Z A;  5HAR A;  3DTI A;  1BT5 A;  2WAF A;  4E3I A;  1JWP A;  1TS0 A;  4OP8 A;  4OON A;  1AWI A;  2W0N A;  3UB7 A;  4KQR A;  5J7E A;  4NXG A;  4QWO A;  3HLF A;  4JKT A;  2Y2G A;  3VP3 A;  4JGR A;  3F1N B;  2R9X A;  4E3O A;  1TDL A;  3OC2 A;  1T1B A;  3BEC A;  4DMZ A;  1PI4 A;  4XXR A;  3UE3 A;  4PAU A;  4RYE A;  5KIZ A;  1RCJ A;  3BQ8 A;  3PTE A;  4S2N C;  5CGX A;  5GLC A;  2O0Y A;  3C30 A;  3NOU C;  4RX3 A;  4ZTK A;  5FQK A;  1WYC A;  3AGD A;  3QHY A;  3FKW A;  4EEU A;  1HD8 A;  4JXW A;  1IKG A;  4NKP A;  3IF6 A;  4Y0T A;  1VQQ A;  3QNC A;  5DKK A;  3D3O A;  4HOI A;  5FQ9 A;  4K0W A;  5IS1 A;  4BD1 A;  1TS7 A;  1PNE A;  3PR6 A;  2Y2Q A;  3C38 A;  3RH8 B;  2M7V A;  3SW1 A;  1ZG4 A;  5E2G A;  3ZVW A;  1ERQ A;  2ZD8 A;  3GEC A;  1VEU B;  4X1L A;  1LT0 A;  5EOO A;  1L0D A;  2ZMV A;  3JYI A;  1O7E A;  3A0S A;  3CUE A;  1LSW A;  4A5R A;  2XH9 A;  4GDN A;  2Z6D A;  5CRF A;  2IWB A;  3A3E A;  3MXQ A;  4X53 A;  2ZMA A;  3EGD C;  1ES2 A;  1MKM A;  3K3C A;  3UDF A;  1A0K A;  2IA2 A;  2XLN A;  3PBN A;  3N8S A;  3CWF A;  4ARZ B;  4GKU A;  4DF6 A;  4PKY G;  3HUM A;  3ZNT A;  2JBF A;  1W8Q A;  5HDD A;  2VGL S;  4BJP A;  4P85 A;  3BQA A;  3MQ0 A;  1L0F A;  2QPN A;  4QU3 A;  2WZZ A;  3MXR A;  3IWI A;  3JPU A;  3EEH A;  4BLM A;  3UME A;  1PIO A;  2A24 A;  3IH9 A;  3OCL A;  4DDS A;  1PRQ A;  1FCN A;  2V2F F;  1L0G A;  4E6W A;  2H0Y A;  4X55 A;  4OLD A;  5DJU A;  4U3T A;  2VGL M;  1YLT A;  4Y7P A;  2R78 A;  4N1X A;  5F68 A;  1PYY A;  3M2K A;  4WEJ A;  4KZ3 A;  5TBM A;  3PYP A;  3M6B A;  5FDS A;  5DTS A;  1OTI A;  4GD6 A;  2Z2M B;  4CLC C;  1BYW A;  5FA7 A;  2W3D A;  5EFW A;  2J3T C;  2Y8H A;  3C4P A;  2KDK A;  3GQZ A;  4RVA A;  4BD0 A;  1L3L A;  2J9O A;  2WGW B;  2XD5 A;  3HVF A;  4AFI A;  1IYP A;  1WE4 A;  1XX2 A;  4WMC D;  2VV7 A;  3MMH A;  4NEE D;  3ITA A;  3KX0 X;  3WS5 A;  4L9E A;  4R4R A;  5HSQ A;  4JGQ A;  4KUO A;  1SDE A;  4HIA A;  4RX2 A;  3ZGA B;  4F3L A;  1RGY A;  1SCW A;  3Q7V B;  3LEQ A;  2DCF A;  5L10 A;  4GB7 A;  3IH8 A;  1MWS A;  4EV4 A;  5F83 A;  3SZT A;  4JXG A;  1Q2P A;  4ZJ3 A;  4WMC A;  1OJ5 A;  1K56 D;  1M6K A;  3UDI A;  4NG2 A;  1F98 A;  4YOF A;  5GHX A;  5J4E A;  1WYB A;  1K4F A;  2JCH A;  5DFX A;  3GVB A;  4N1H A;  1PZO A;  1W63 Q;  3GRJ A;  3P09 A;  3NOT C;  2OLV A;  4BBT A;  4HJ3 A;  4X68 A;  3ZNY A;  2C6W B;  3DW0 A;  3OPH A;  3TE8 A;  3W4O A;  1GHI A;  3IS2 A;  4IHQ A;  3UO9 A;  3EEA A;  1K56 A;  3OPL A;  5KMW A;  4MCW A;  5DFY A;  3B47 A;  5FAP A;  2QYB A;  4OOL A;  2HDU A;  3TJZ C;  5HPF A;  4EEP A;  2HJE A;  1HTZ A;  4PM8 A;  2HDS A;  4DN0 A;  4MLL A;  3SH8 A;  5CER A;  2JN7 A;  5FAT A;  4JBF A;  1W63 M;  3CJM A;  3WS4 A;  4HEF A;  4DJ2 A;  4WEK A;  1PWD A;  3ICY A;  1ESI A;  4OPQ A;  2Y55 A;  2H5S A;  2WZX A;  4FH2 A;  1XA1 A;  2G7U A;  2YKF A;  1V9Y A;  2A2L A;  4FUW A;  2EX6 A;  3G2Z A;  3B42 A;  2EXA A;  1JVJ A;  1TEM A;  5AJG A;  3ZDJ A;  4OPZ A;  2BLS A;  4DE2 A;  3LR5 A;  1KE3 A;  1MXO A;  4F94 A;  1W5D A;  1U60 A;  2XDM A;  4DXB A;  2I72 A;  1IEM A;  1YQS A;  3T1S A;  1MZU A;  3GMW A;  2P04 A;  2VGJ A;  5L8M A;  1MWU A;  3UPO A;  3TW8 A;  1J9M A;  2P9V A;  3T4J A;  5EE8 A;  3BFE A;  4O01 A;  4Y13 A;  4XT2 A;  3F1P B;  4FD8 A;  4M4X A;  2ZMF A;  3IXD A;  4EXO A;  4CLC B;  1FSW A;  4G3V A;  2L1M A;  1FSY A;  2GX5 A;  4H6J B;  1ES4 A;  1XGJ A;  1K54 C;  5FI2 A;  4MN7 A;  1YMX A;  3NEC A;  4WYY A;  1OTD A;  2Y2N A;  2P7J A;  1TD5 A;  4JPM A;  4BL3 A;  5HL6 A;  4HBU A;  1KGG A;  4KG5 A;  3FZC A;  4BBV A;  5EM0 A;  4N9K A;  2EWV A;  2V8F A;  5HX9 A;  5TJJ A;  2DNS A;  1BLS A;  2LB5 A;  3C4O A;  4EBL A;  1K0K A;  4HY8 A;  1GA0 A;  3C5A A;  3A3F A;  3LID A;  3WRT A;  3PBO A;  1FCM A;  3UB8 A;  1K38 A;  4KQQ A;  3BYD A;  1S66 L;  3D4F A;  2UV0 E;  1F9I A;  1K6R A;  3A3D A;  3QP4 A;  3FG8 A;  3T1X A;  4KQD A;  5FQJ A;  3LIF A;  1G6O A;  2J3W A;  2Y2O A;  4Y5F A;  3FWL A;  3LY3 A;  1LL9 A;  3ZCZ A;  1G5U A;  2ZC6 B;  4ETZ A;  3ISG A;  2ZQ7 A;  2D01 A;  1IYO A;  1QMF A;  3RTY A;  4O0P A;  3UDX A;  5FI7 A;  4Z1W A;  1OT6 A;  3LYX A;  4YFM A;  1CEF A;  5HD5 A;  3LEZ A;  3IXG A;  1NZO A;  4MMN A;  2PU4 A;  4KZB A;  4GHI B;  3OCN A;  3IX3 A;  2W3F A;  1UWN X;  1HLU P;  3IWO A;  4C6Y A;  4R6L A;  4UHU A;  2ZQA A;  3HJK A;  3NJA A;  2Y2P A;  3WRZ A;  1OJG A;  4IED A;  2PRF A;  3NIA A;  3ZFZ A;  1E3U D;  2W3G A;  1W8Y A;  3MZD A;  1CK3 A;  3VP4 A;  3AGF A;  5D3O A;  3NI9 A;  3L9K A;  5GLA A;  4IVI A;  2HDQ A;  2XRO A;  4Y0O A;  1O07 A;  3LR4 A;  2WGW A;  5AVF A;  4LV3 A;  5DF7 A;  3N8L A;  4CJN A;  3F1O A;  3SH7 A;  1ZHH B;  4WUJ A;  1MWR A;  3N6I A;  4DRT A;  4EQI A;  1F5M A;  5TFQ A;  1VET B;  4X56 A;  4R23 A;  5F5Y A;  4GW9 A;  4EET B;  1JTG A;  3OPR A;  1E3U A;  2HF6 A;  3H9W A;  4EUZ A;  5IHV A;  1SHV A;  3C7V A;  1K57 C;  3IX4 A;  1ZTU A;  1NXY A;  1FOF A;  4S2N A;  4OQG A;  1H3Q A;  1NLZ A;  1I2S A;  1OPX A;  1NYM A;  3IXB A;  1BZA A;  2ZC7 A;  3S4X A;  3MKF A;  2V20 A;  2Q9N A;  3A3I A;  2Y2L A;  2XGN A;  4Y0U A;  2X02 A;  5HWT A;  1HVB A;  5DTK A;  4O7D A;  4IBX A;  1MY8 A;  4HI4 A;  2V0U A;  1XJ6 A;  4S2O A;  2QWS A;  3PBS A;  3P7N A;  2DMW A;  4WEL A;  3H82 A;  1NYY A;  1DJC A;  5GLD A;  5M18 A;  1YSQ A;  2ZL1 A;  4D60 A;  3LO7 A;  3EWK A;  5A8B A;  5GHZ A;  1YSP A;  2Z2L B;  4HQA A;  5FQQ A;  2B95 A;  2KLI A;  2Y59 A;  5EPH A;  4EU0 A;  3K2N A;  1X0O A;  3IF6 C;  3G34 A;  3G2Y A;  2Q0O A;  1YAX A;  3S7P A;  5U47 A;  4HJ6 A;  4ZRR A;  5FQI A;  2IWC A;  5KSH A;  1GHP A;  1OT9 A;  5A90 A;  2E8J A;  5F82 A;  2JKF A;  3VMA A;  1MKI A;  1GSX A;  5FEG A;  3QP8 A;  2Q9M A;  2H10 A;  4WZ5 A;  4LCL A;  3IXH A;  4IVK A;  2BG1 A;  3HLC A;  4NK3 A;  1FIK A;  1PZP A;  4GJ4 A;  1PFL A;  4R3J A;  2Y91 A;  1QME A;  1IYQ A;  4LV2 A;  4U0T A;  3MR0 A;  4MDZ A;  3A0V A;  4B4Z A;  2HV1 A;  4CLC D;  5FSR A;  4R3B A;  5G18 A;  1S1Z A;  2HP6 A;  2J3T D;  4ZAM A;  2L0W A;  2ZQ8 A;  4JLF A;  1KVM A;  1BUL A;  4EBN A;  2V0W A;  2PYP A;  3HL9 A;  2B5R A;  4P6Z S;  3IHB A;  2PBD P;  4PPR A;  1KOU A;  3ULF A;  4B93 A;  1LSX A;  1T19 A;  2L4R A;  4II7 A;  4UQI S;  5DVA A;  3F1P A;  3IX8 A;  3NUL A;  1GA9 A;  3G30 A;  3S1Y A;  4LV1 A;  2V1B A;  4CLC A;  4E3L A;  4G3W A;  3AGE A;  2HDR A;  4PKY A;  3S7Q A;  1N9L A;  3BY9 A;  4QPR A;  1W79 A;  2VV6 A;  2XRN A;  4P6Z M;  2WAD A;  5EVL A;  3MQQ A;  4H8R A;  3VSK A;  2OV5 A;  3NDG A;  3CZD A;  3V3R A;  1IEL A;  4MN6 A;  2XK1 A;  5CTN A;  1CI8 A;  4UQI M;  3FPV A;  3GV9 A;  4BL2 A;  3CPT A;  1ACF A;  4YWZ A;  3W4Q A;  2UWX A;  1S4R A;  5F1F A;  3OPP A;  2VJW A;  1K6S A;  3LY4 A;  4Z9Q A;  4WBG A;  4BQM A;  3E4Q A;  2QHK A;  1XJ2 A;  4MEZ A;  1VB6 A;  5GHY A;  3V39 A;  5J3W A;  2W3H A;  4JGP A;  4QY5 A;  3T4K A;  1XFQ A;  1N4O A;  1P97 A;  5CHU A;  4NXB A;  5FI6 A;  5EVI D;  3W4P A;  2WKQ A;  1LL8 A;  1EWZ A;  3MF0 A;  2PAV P;  4LCM A;  3C2W A;  1XKZ A;  3CAX A;  1G68 A;  2W1R A;  4EES A;  4EW7 A;  5J8X A;  2XFT A;  4WF0 A;  4PM5 A;  1TDG A;  1H8Y A;  4X25 A;  3KSF A;  2XSS A;  1S6R A;  3H7W A;  2W27 A;  3BLM A;  4S2K A;  3VSL A;  4P0M A;  3BFG A;  2JE5 A;  2PD8 A;  3G31 A;  5EVI A;  1L0E A;  1ZKJ A;  2PU2 A;  4UA9 A;  2XD1 A;  1Z6F A;  5AQ9 A;  1BLH A;  2K31 A;  2WKP A;  3A0R A;  4OLG A;  2M7U A;  3KO6 A;  3UE1 A;  2M1C A;  1C3B A;  4E3K A;  3SS3 A;  4NXF A;  1PW8 A;  4GOG A;  4E3J A;  4K91 A;  4Q0H A;  3HUN A;  3E4O A;  2PHY A;  3T4O A;  3N7W A;  3IF6 B;  3FKV A;  5FEF A;  4DE0 A;  4DXC A;  1PW1 A;  3E98 A;  2EXB A;  2Y79 A;  3ZG8 B;  3LI8 A;  2PR6 A;  1SKO A;  4HHD A;  1CI9 A;  3V50 A;  3LUQ A;  1KVL A;  1GCE A;  3KYQ A;  1MPL A;  4MBK A;  1Y4O A;  2PDR A;  1TS8 A;  3QP6 A;  1ONG A;  2BAS A;  2VKS A;  1SKF A;  2ZJ9 A;  4FSF A;  1CF0 A;  3MBZ A;  4BEN A;  5CED A;  3OOV A;  1XJ3 A;  3IQA A;  3TG9 A;  1VET A;  1DP9 A;  2O9A A;  3CIT A;  2W3E A;  3T4L A;  4MBH A;  2H28 A;  5A91 A;  3ZG9 B;  3F1N A;  4LPZ A;  3O3V A;  5EM1 A;  2WKH A;  3HLG A;  3G32 A;  4OQ0 A;  2WKI A;  4JXS A;  4PM7 A;  5EVE A;  5HD3 A;  3Q81 A;  3QP2 A;  1T1C A;  2EX8 A;  1OTA A;  4I38 A;  2MJ6 A;  1D06 A;  4Y2F A;  4S2I A;  5F1G A;  2J9P A;  1HZO A;  1BUE A;  2PD7 A;  3L7H A;  4OOM A;  3O5Y A;  3WS2 A;  2EFX A;  2XA7 S;  3P98 A;  5DKL A;  2VZW A;  4HP9 A;  3UMD A;  5CEB A;  2CMN A;  4M3K A;  2OWJ A;  3QNB A;  4BMW A;  3BFD A;  1XXM A;  3Q82 A;  1K55 A;  3O86 A;  3NDE A;  5DJT A;  4PM9 A;  3M2J A;  4MNR A;  3FYZ A;  2XF3 A;  2J7V A;  2A24 B;  2JC7 A;  2GJ3 A;  1D1J A;  2EX2 A;  3KSG A;  3LGO A;  3FV7 A;  2VEA A;  2XA7 M;  1S1Y A;  4N9L A;  2LB9 A;  3RFB A;  1N9N A;  4HNB A;  4ETX A;  1VEU A;  5TBM B;  2O9C A;  1FR1 A;  4C3Q A;  4RQ9 A;  4DE3 A;  2D02 A;  2VLG A;  4S2M A;  1MBL A;  2INW A;  2WUQ A;  2G2U A;  2P74 A;  3E2K A;  1MWT A;  5IU1 A;  1S4S A;  2XEP A;  3E4P A;  3BY8 A;  5L09 A;  3CI6 A;  4UA6 A;  1Z09 A;  2A49 A;  5HWV A;  3BW6 A;  4MN5 A; 
#chains in the Genus database with same CATH homology
 3MKF A;  2V20 A;  1YLT A;  4Y7P A;  2Q9N A;  3A3I A;  2Y2L A;  4N1X A;  3NC8 A;  3SS5 A;  3MZF A;  1PYY A;  2XGN A;  2WGI A;  4Y0U A;  3M2K A;  3UPP A;  2HP5 A;  3VOY A;  1KDS A;  2X02 A;  4JF5 A;  4WEJ A;  5AQ7 A;  1HVB A;  4KZ3 A;  5DTK A;  5FAS A;  3GSG A;  3HLW A;  4O7D A;  2EX9 A;  4IBX A;  2DRW A;  3M6B A;  1MY8 A;  4S2O A;  5JYO A;  5DTS A;  1Q2Q A;  3PBS A;  4GD6 A;  1ZC2 A;  4ZJ2 A;  2Z2M B;  2RCX A;  4K0X A;  4XUX A;  3DWZ A;  4WEL A;  5FA7 A;  1NYY A;  4E3N A;  1DJC A;  5GLD A;  5M18 A;  3C4P A;  3GQZ A;  3UY6 A;  4RVA A;  4BD0 A;  4C75 A;  3UPN A;  2J9O A;  2OSU A;  2WGW B;  2XD5 A;  2ZM8 A;  3HVF A;  3LO7 A;  1IYP A;  3TSG A;  1WE4 A;  1XX2 A;  1BTL A;  4WMC D;  1GHM A;  5CTM A;  2QZ6 A;  5HW3 A;  3I7J A;  5GHZ A;  1W7F A;  1DJA A;  4OQI A;  3E2L A;  2Z2L B;  5A93 A;  5FQQ A;  1BLC A;  4GD8 A;  1ES5 A;  3ITA A;  3WS5 A;  1SDN A;  2E8I A;  4R4R A;  1SDE A;  1M40 A;  2Y59 A;  1K54 A;  5EPH A;  5E43 A;  3MKE A;  4RX2 A;  3ZGA B;  3IF6 C;  2ZQD A;  3G34 A;  1ONH A;  3G2Y A;  1RGY A;  3MXS A;  1I2W A;  1SCW A;  3BEB A;  4KG2 A;  5CGW A;  3Q7V B;  3BM6 A;  5U47 A;  2DCF A;  5FQI A;  3CG5 A;  1KGF A;  1ALQ A;  2IWC A;  3C7U A;  5KSH A;  3NBL A;  4GB7 A;  1GHP A;  3IH8 A;  5A90 A;  1MWS A;  4EV4 A;  5F82 A;  2RL3 A;  5F83 A;  4JXG A;  3VMA A;  1NZU A;  1Q2P A;  1YLJ A;  2ZM2 A;  2X01 A;  4ZJ3 A;  4WMC A;  3WS0 A;  1MKI A;  1CEG A;  1K56 D;  1M6K A;  4KEN B;  3UDI A;  1JWZ A;  1DY6 A;  5M1A A;  4R1G A;  2EFU A;  3PAG A;  4JF6 A;  4XUZ A;  1N9B A;  2Q9M A;  5GL9 A;  5GHX A;  3HBR A;  2H10 A;  1WYB A;  1PI5 A;  1FR6 A;  1K4F A;  1PWC A;  2JCH A;  2Y2K A;  2C5W B;  2BG1 A;  3GVB A;  3HLC A;  1PZO A;  3GRJ A;  1PZP A;  3IXH A;  3P09 A;  4IVK A;  4N1H A;  1JWV A;  1RP5 A;  4P6B A;  4R3J A;  2OLV A;  5KSC A;  2Y91 A;  4X68 A;  3O88 A;  1QME A;  1IYQ A;  3ZNY A;  4LV2 A;  4U0T A;  5DTT A;  4R0Q A;  4KZA A;  5HL1 A;  4HES A;  2J8Y A;  4KZ8 A;  2QMI A;  3DWK A;  3RJU A;  3ZFZ A;  2C6W B;  4B4Z A;  3DW0 A;  3OPH A;  4R3B A;  5FSR A;  1FCO A;  3W4O A;  1GHI A;  3WS1 A;  5G18 A;  2HP6 A;  5DF8 A;  4ZAM A;  1K55 C;  3UO9 A;  3A3J A;  2ZQ8 A;  4S2J A;  3HLB A;  3N4I A;  3Q7V A;  4JLF A;  1XA7 A;  1KVM A;  1BUL A;  4DKI A;  4EBN A;  4OP5 A;  3HL9 A;  3Q07 A;  1K56 A;  3OPL A;  2B5R A;  2IWD A;  4UAA A;  3IHB A;  1KDW A;  3EQU A;  5TR7 A;  5KMW A;  2VGK A;  4OPR A;  4PPR A;  1K4E A;  3VP1 A;  4PM6 A;  3ZG0 A;  4KQO A;  5CGS A;  5FAP A;  4GN2 A;  2Y4A A;  4KG6 A;  3VP0 A;  4OOL A;  4S2P A;  2HDU A;  5DVA A;  3NY4 A;  1LHY A;  1HTZ A;  4CPK A;  4PM8 A;  5DF9 A;  4WZ4 A;  2HDS A;  5GLB A;  4MLL A;  1GA9 A;  3SH8 A;  5CER A;  3G30 A;  4ZJ1 A;  1YLY A;  4LV1 A;  3S1Y A;  4KZ4 A;  1LL5 A;  4E3L A;  3AGE A;  5FAT A;  5AQA A;  4E3M A;  2HDR A;  4JBF A;  3CJM A;  1VM1 A;  2XQZ A;  3WS4 A;  4HEF A;  4QD4 A;  2ZC5 B;  4R4S A;  4WEK A;  1PWD A;  1W79 A;  1ESI A;  1RGZ A;  2WAD A;  5EVL A;  4H8R A;  3VSK A;  2OV5 A;  3HLE A;  3NDG A;  5TGF A;  1FQG A;  4OPQ A;  3CZD A;  3V3R A;  1IEL A;  2GDN A;  2P9V B;  2Y55 A;  2ZM0 A;  2H5S A;  2XK1 A;  5CTN A;  2WZX A;  2ZLY A;  4FH2 A;  1CI8 A;  5L2F A;  1XA1 A;  3GV9 A;  4BL2 A;  3WWX A;  1KE4 A;  3UN7 A;  2Y2H A;  1YLZ A;  1AXB A;  2EX6 A;  3W4Q A;  2UWX A;  3G2Z A;  4B4X A;  2V1Z A;  5F1F A;  3OPP A;  1ERM A;  1K6S A;  3LY4 A;  4Z9Q A;  2EXA A;  5FAQ A;  1JVJ A;  1TEM A;  3ZDJ A;  2OLU A;  4WBG A;  4OPZ A;  4BQM A;  2BLS A;  2G2W A;  2HPB A;  2WKE A;  3BFF A;  4DE2 A;  1KE3 A;  1MXO A;  1H8Z A;  4F94 A;  4MEZ A;  1W5D A;  1U60 A;  5GHY A;  3V39 A;  5AQB A;  4Q8I A;  5HAQ A;  2XFS A;  3BFC A;  3ZG5 A;  4S2L A;  3TOI A;  3VFH A;  2H0T A;  4QY5 A;  2XDM A;  5KZH A;  4LV0 A;  4MBF A;  5EVI B;  4DXB A;  1N4O A;  3HRE A;  2I72 A;  5CHU A;  1IEM A;  4EBP A;  1YQS A;  4YIN A;  5CEC A;  3GMW A;  4HBT A;  5FI6 A;  3PBT A;  5FDH A;  3HUO A;  2VGJ A;  1MWU A;  3Q1F A;  3B3X A;  4X69 A;  3M6H A;  5E2F A;  2ZC4 B;  5EVI D;  1YT4 A;  3W4P A;  3UPO A;  1EWZ A;  4X6T A;  3CMZ A;  3UNW A;  1Y54 A;  5I94 A;  1EI5 A;  3BRM A;  1NY0 A;  4LEN A;  4LCM A;  1J9M A;  2P9V A;  1NRF A;  1XKZ A;  3PBR A;  5EE8 A;  1OME A;  1G68 A;  1YM1 A;  3ITB A;  3O87 A;  1ERO A;  2Y2J A;  5EOE A;  3GTC A;  3BFE A;  4QY6 A;  3ZHH A;  1LI0 A;  5J8X A;  2XFT A;  5EUA A;  4FD8 A;  4FH4 A;  4PM5 A;  1TDG A;  1H8Y A;  5M19 A;  5CXW A;  3IXD A;  4KZ7 A;  4DDY A;  5HAI A;  1FSW A;  1S6R A;  4QB8 A;  1FSY A;  1H5X A;  2FFF B;  3RXW A;  1ES3 A;  1PWG A;  1ES4 A;  1XGJ A;  1K54 C;  3BLM A;  1K57 A;  4OQH A;  4S2K A;  3UE0 A;  5FI2 A;  1ZG6 A;  3V3S A;  3VSL A;  4OH0 A;  4PMA A;  4P0M A;  3BFG A;  2JE5 A;  3VFF A;  3G31 A;  2Y2I A;  4N92 A;  5EVI A;  1L0E A;  2WYX A;  2ZC3 B;  1ZKJ A;  1YMX A;  3LCE A;  2PU2 A;  1JTD A;  4WYY A;  2Y2N A;  3MFD A;  1TVF A;  4UA9 A;  5E2E A;  2XD1 A;  4UA7 A;  1Z6F A;  5AQ9 A;  1BLH A;  4OLG A;  4JPM A;  3NCK A;  1YLW A;  3IT9 A;  3UE1 A;  4BL3 A;  4DE1 A;  1IKI A;  1KGE A;  1IYS A;  1C3B A;  2IWB A;  1LI9 A;  4E3K A;  3Q7Z A;  5HAR A;  1PW8 A;  3SS3 A;  3ZVT A;  4HBU A;  4L0L A;  4GOG A;  4E3J A;  4K91 A;  3HUN A;  4JF4 A;  1KGG A;  1BT5 A;  4KG5 A;  2WAF A;  3FZC A;  4E3I A;  1JWP A;  3VOZ A;  4OP8 A;  4N9K A;  4OON A;  3GR2 A;  4WZ5 C;  3DTM A;  4KQR A;  1NJ4 A;  2XR0 A;  3N7W A;  5HX9 A;  3RXX A;  4ZDX A;  4ZBE A;  2DNS A;  3IF6 B;  1KE0 A;  4JXV A;  3HLF A;  1BLS A;  4JKT A;  2Y2G A;  3VP3 A;  3C4O A;  3FKV A;  4EBL A;  4IBR A;  2R9X A;  3PAE A;  4P87 A;  4E3O A;  1TDL A;  3EQV A;  3G35 A;  4WZ5 A;  3OC2 A;  4DE0 A;  4DXC A;  1PW1 A;  2EXB A;  3ZG8 B;  4ID4 A;  3SS4 A;  1GA0 A;  4LCL A;  3C5A A;  3A3F A;  1CI9 A;  3WRT A;  1DJB A;  3PBO A;  1FCM A;  3V50 A;  3BEC A;  4B88 A;  1KVL A;  1GCE A;  1K38 A;  1PI4 A;  4GNU A;  4KQQ A;  1E4D A;  3BYD A;  1MPL A;  4MBK A;  3D4F A;  4XXR A;  2WGV A;  3UE3 A;  1K6R A;  3A3D A;  4RYE A;  1RCJ A;  1BZA A;  1ONG A;  3PTE A;  1SKF A;  4S2N C;  4RA7 A;  5CGX A;  5GLC A;  2ZJ9 A;  4FSF A;  4KZ5 A;  5FQJ A;  4RX3 A;  4ZTK A;  5FQK A;  3MBZ A;  4BEN A;  5CED A;  1WYC A;  3AGD A;  3QHY A;  3FKW A;  3V5M A;  2Y2O A;  3IQA A;  3TG9 A;  1HD8 A;  4JXW A;  3FWL A;  3LY3 A;  1IKG A;  1LL9 A;  3ZCZ A;  3IHA A;  3IF6 A;  4MBH A;  4Y0T A;  5A92 A;  1VQQ A;  2ZC6 B;  3OZH A;  3QNC A;  5FQM A;  5A91 A;  3ZG9 B;  3ISG A;  2ZQ7 A;  1E25 A;  3O3V A;  5FQ9 A;  4D2O A;  2WKH A;  4K0W A;  2X71 A;  3G32 A;  3HLG A;  4OQ0 A;  1IYO A;  4BD1 A;  1QMF A;  2WKI A;  4JXS A;  4PM7 A;  3IF5 A;  4QHC A;  3Q81 A;  4GZB A;  3UDX A;  2Y2Q A;  5BOH A;  2EX8 A;  4U0X A;  3PBQ A;  5FI7 A;  3SH9 A;  4OPY A;  4YFM A;  1CEF A;  2ZQ9 A;  1ZG4 A;  5E2G A;  3LEZ A;  4S2I A;  3IWQ A;  5F1G A;  2J9P A;  3ZVW A;  1ERQ A;  3IXG A;  1HZO A;  2ZD8 A;  1BUE A;  1NZO A;  4OOM A;  3W8K A;  2PU4 A;  4KZB A;  3WS2 A;  2EFX A;  5EOO A;  3OCN A;  3P98 A;  1L0D A;  4KZ6 A;  2WAE A;  1BSG A;  3ZG7 B;  4WM9 A;  3JYI A;  3IWO A;  2R9W A;  4C6Y A;  1O7E A;  1XPB A;  4UHU A;  5CEB A;  2PBY A;  4KZ9 A;  4NET A;  5FAO A;  4EWF A;  2ZQA A;  4M3K A;  2Y2P A;  3QNB A;  4OOY A;  1ESU A;  4OKP A;  3WRZ A;  3BFD A;  1XXM A;  4A5R A;  2XH9 A;  3Q82 A;  4GDN A;  3G4P A;  4IED A;  1K55 A;  3NIA A;  3O86 A;  5CRF A;  1E3U D;  2HP9 A;  3A3E A;  3NDE A;  4PM9 A;  2ZMA A;  1W8Y A;  1XP4 A;  3M2J A;  4X53 A;  1BLP A;  3MZD A;  1ES2 A;  4GDB A;  4MNR A;  1CK3 A;  3UDF A;  3VP4 A;  3FYZ A;  2XF3 A;  3BLS A;  3AGF A;  5D3O A;  1LLB A;  2J7V A;  2JC7 A;  3NI9 A;  5HAP A;  4E6X A;  5GLA A;  4IVI A;  2HDQ A;  5CHM A;  1G6A A;  1O07 A;  2XLN A;  2EX2 A;  3PBN A;  2CC1 A;  4OVD A;  4Y0O A;  3N8S A;  2WGW A;  2FFY A;  4LV3 A;  3FV7 A;  5DF7 A;  3N8L A;  4CJN A;  1XGI A;  4GKU A;  4DF6 A;  3SH7 A;  3MZE A;  4N9L A;  2A3U A;  5HFO A;  1S0W A;  3HUM A;  3ZNT A;  3HLD A;  2JBF A;  1W8Q A;  1K25 A;  2Y2M A;  1MWR A;  4NK3 A;  4BJP A;  3N6I A;  4P85 A;  4DRT A;  1FR1 A;  4C3Q A;  4EQI A;  4DE3 A;  5TFQ A;  1I5Q A;  4X56 A;  4S2M A;  1L0F A;  1MBL A;  2ZQC A;  4R23 A;  1JTG A;  2WUQ A;  3OPR A;  2QPN A;  5CHJ A;  1E3U A;  2G2U A;  4QU3 A;  5EEC A;  2P74 A;  2WZZ A;  3E2K A;  5JYP A;  3SOI A;  4EUZ A;  1MWT A;  3MXR A;  5IHV A;  1SHV A;  3C7V A;  3IWI A;  1K57 C;  2WK0 A;  4BLM A;  2XEP A;  3VP2 A;  1PIO A;  5E2H A;  1NXY A;  1FOF A;  5EVI C;  4QJG A;  1YLP A;  3N8R A;  4S2N A;  4OQG A;  3IH9 A;  3OCL A;  4UA6 A;  4DDS A;  2V2F F;  1FCN A;  1YMS A;  1I2S A;  1L0G A;  2A49 A;  3S22 A;  4E6W A;  1NYM A;  2H0Y A;  3IXB A;  4X55 A;  4OLD A;  1L2S A;  4FCF A;  4U3T A;  2ZC7 A;  3S4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...