3Q1FA

Ctx-m-9 s70g in complex with hydrolyzed piperacillin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title CTX-M-9 S70G mutant in complex with hydrolyzed piperacillin
rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 96
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q1fA00
1L0GA 1XXMA 5A93A 4QB8A 2Q9NA 3EQVA 1SDEA 1NJ4A 4UA7A 5F83A 4FCFA 2ZQAA 1MWTA 2HP6A 2ZQDA 3GR2A 1MPLA 5DF7A 3BM6A 2EX9A 3ZG9B 3Q82A 3VFHA 1KDSA 3UE1A 4GD8A 3FZCA 4MBFA 3G4PA 3HLFA 2JC7A 1MWRA 1W79A 3RJUA 3P09A 1WYCA 3UE0A 5GLBA 3IF6A 3OPHA 3ZNYA 1RP5A 1FCMA 1PIOA 4RA7A 4OP5A 3IXBA 1E25A 2DNSA 1U60A 1ZG4A 1FOFA 5FQJA 4EBPA 1WE4A 1K57A 2WAFA 3N8LA 1K4EA 3A3IA 3ZVWA 4OP8A 3WRTA 3A3EA 2HP5A 3C4PA 4X6TA 1ES5A 1SCWA 3SOIA 3A3FA 4EBNA 1WYBA 2Y55A 2Y59A 1PWDA 5E2FA 3WRZA 3MKEA 4OVDA 1VQQA 3BLSA 5A92A 1MXOA 1GHMA 2P9VA 5FAPA 1K55A 1I2SA 1YQSA 5CECA 3PBRA 2V1ZA 4S2KA 1GA9A 4UAAA 1PWCA 4OPRA 4S2IA 4P85A 3VFFA 5F82A 3PBQA 3PBTA 4MBHA 3VOYA 4WBGA 2EXBA 2EX8A 3O3VA 1XGIA 5GLDA 1W8YA 4KZ6A 5FAOA 5TR7A 3VP3A 4DDSA 2P9VB 3G31A 1YMSA 5CTMA 5GLAA 4GNUA 4F94A 4PMAA 3ZG5A 5A91A 2ZQ8A 1L0EA 2IWCA 3ITAA 4NETA 2EFXA 4Z9QA 1FR1A 4BJPA 3DTMA 4LV0A 4U0XA 4JXSA 3VSLA 3BRMA 1GHPA 1IYQA 4QY5A 4E3JA 1SHVA 3MKFA 1ES3A 5TFQA 3QHYA 2H0TA 2WKHA 3NBLA 3OCLA 1IELA 1M40A 5CEDA 2JBFA 3FWLA 5M1AA 4E3IA 2ZD8A 5DF9A 3PTEA 4E3KA 4C3QA 4WZ4A 2XD5A 4ZAMA 2Y2NA 4HBTA 3HUMA 4ID4A 2A3UA 4B88A 3C7VA 2ZJ9A 4WMCA 2XFTA 5KZHA 3Q81A 2WKEA 5M18A 4JF5A 1NRFA 4PM9A 1BSGA 1XPBA 1KVLA 1YLZA 1IKIA 3WS2A 2OSUA 1IYOA 1W5DA 3NDEA 2Z2MB 5FSRA 5GLCA 2ZQCA 3FKWA 1GCEA 3NY4A 4HESA 1FSWA 4KQQA 5E2HA 3VP4A 4DXCA 3VOZA 4HEFA 5E43A 1JWZA 3G2YA 1N4OA 2Y2PA 2EX2A 1RCJA 2JCHA 1KVMA 4LCLA 4RX3A 3W4PA 2JE5A 3IWIA 4BENA 5FI6A 1ESIA 4OKPA 4U0TA 1MKIA 4CJNA 4GDBA 5I94A 4R0QA 3IQAA 3AGEA 4N1HA 2C5WB 2I72A 4H8RA 2WADA 4OPZA 3VMAA 1BLHA 4LV2A 5HL1A 2H5SA 1SDNA 3AGDA 1ERQA 5M19A 4X68A 1RGZA 4E3OA 1LLBA 4Y0TA 4KQOA 3ZG7B 4YINA 1YLJA 4QHCA 5FA7A 1LHYA 3QNCA 3BEBA 4HBUA 3WS5A 2HDUA 3UDIA 1EWZA 5FQ9A 5JYOA 5KSHA 4QD4A 1Y54A 3IF6C 3BFGA 1TVFA 5EUAA 3W4QA 2PBYA 3IWQA 4IBRA 3S1YA 4A5RA 1CEFA 2HDRA 4IVIA 2RL3A 3P98A 3C5AA 5FQMA 4E3MA 1K57C 3ITBA 2WAEA 3OZHA 3EQUA 3M6HA 3ZG0A 3UDFA 4JF6A 5FAQA 3O86A 2BLSA 1HVBA 4WM9A 3FYZA 4KZBA 1XA7A 1FR6A 1Q2QA 1GHIA 5EVIA 3UPNA 4KZ7A 2J8YA 2WGWB 3GRJA 3WS4A 1KGGA 1K55C 3FKVA 4LV1A 4P6BA 2Y2GA 5E2GA 3IF5A 3VSKA 1YM1A 4DRTA 3SH9A 3V3RA 3ZCZA 2WKIA 2XLNA 2DRWA 1HZOA 1BLSA 4KZ9A 4WMCD 3G32A 5CHUA 5EVIB 2J9OA 2Z2LB 4LV3A 3UPOA 4Y7PA 1PW8A 4EBLA 3SH7A 1CI9A 2XK1A 4JPMA 1ESUA 3Q07A 1MWUA 4ZJ2A 4ZJ1A 1BUEA 5AQ7A 5TGFA 4OONA 4YFMA 4OQ0A 4S2OA 3CMZA 2H0YA 5CRFA 4JKTA 5CERA 5A90A 1HTZA 4EUZA 4FH4A 2P74A 4IEDA 4KZ3A 1KE4A 1K6RA 4GOGA 3IHAA 3BFEA 3MBZA 3IH8A 4UHUA 1BLCA 1L2SA 4OPQA 1Q2PA 2ZM8A 3O87A 4OOYA 2PU4A 4X55A 3S22A 1IKGA 5DTTA 3V50A 1H8YA 3PAGA 4QY6A 3MZEA 5JYPA 1L0FA 2Y2HA 3CZDA 4FSFA 3UNWA 1EROA 4E6WA 4BD0A 3MXSA 4O7DA 4GKUA 4S2MA 5CGXA 4CPKA 2HP9A 4RX2A 1LI9A 1AXBA 2Y2IA 1K54A 1HD8A 1C3BA 5BOHA 2ZM0A 1LL9A 3GTCA 4OQHA 1NYYA 3N4IA 4KQRA 2PU2A 1CK3A 3BECA 3C4OA 1NZOA 3UO9A 1YLPA 3WS0A 2Y2OA 3HBRA 5DF8A 4DE3A 4JF4A 4KENB 3GV9A 2QPNA 4OQGA 4B4XA 3GVBA 1GA0A 4JXVA 4DDYA 3MXRA 3HL9A 3W8KA 1ZC2A 1ZG6A 2XF3A 3G30A 3HLEA 3PBNA 1W7FA 4FD8A 5CXWA 5EVID 4C6YA 5KMWA 1QMFA 1PWGA 4N92A 1DJAA 5AQBA 2G2WA 1TDGA 3HLCA 3SS5A 1E3UA 1W8QA 2OLUA 1K25A 3GSGA 1NY0A 2XDMA 4N9KA 4R3BA 1ERMA 4S2NA 2EFUA 4MEZA 3ZDJA 2RCXA 3NDGA 3LY3A 3ZG8B 2FFFB 3IHBA 4N1XA 2C6WB 4WZ5A 2Y91A 4L0LA 5D3OA 5HFOA 4OLDA 1PI5A 4KG6A 2ZMAA 1ALQA 2R9WA 1NYMA 4MBKA 4PM7A 4MLLA 2BG1A 2WYXA 2ZQ7A 3IXGA 1K56A 1KE3A 3BLMA 3HLDA 2UWXA 2XR0A 2Y2KA 3CJMA 1KGEA 5CGSA 1G6AA 1RGYA 4R3JA 1FCOA 3S4XA 2J7VA 3M6BA 3TSGA 5FASA 4P87A 1PW1A 3HUOA 5EVIC 2ZC3B 4OOMA 4QU3A 4MNRA 4BL3A 4D2OA 1MY8A 1CEGA 1EI5A 4X69A 3JYIA 2ZC7A 4R4SA 5HW3A 4FH2A 5CEBA 2WGIA 2XH9A 3B3XA 3IXDA 1H5XA 1E4DA 3V5MA 4EV4A 3LCEA 3BYDA 2Y4AA 4XXRA 2WGWA 1TEMA 4XUZA 4ZTKA 5GHZA 4DE1A 3IH9A 5FQIA 2V2FF 4K0XA 2A49A 1CI8A 4UA6A 4OPYA 4OQIA 1DY6A 2OLVA 3Q7ZA 5FQKA 4BQMA 3NCKA 1YLTA 5AQAA 5GHYA 2HDQA 4KZAA 1NZUA 4JXGA 2WGVA 2XGNA 1S0WA 4LENA 1KGFA 3PBSA 2Y2QA 1BTLA 3SH8A 1MBLA 2ZLYA 3G2ZA 1O7EA 5DVAA 1BZAA 3I7JA 4BLMA 3SS3A 1E3UD 3TG9A 4R1GA 2QZ6A 1N9BA 4KZ5A 3FV7A 1K6SA 5FDHA 4R4RA 4JLFA 3LY4A 2WUQA 1ONGA 1VM1A 2XQZA 1JVJA 3ZNTA 3GQZA 2DCFA 3IT9A 4WEJA 5CTNA 4E3LA 2ZC6B 4OH0A 3SS4A 3ZHHA 1K54C 3AGFA 1YT4A 3HREA 3A3JA 5IHVA 1I5QA 1O07A 4DKIA 3HLWA 5CHMA 5G18A 5EOEA 3Q1FA 5EVLA 4JXWA 1YLWA 2B5RA 1K56D 1JTGA 4ZDXA 5HAPA 1PZOA 3IWOA 2Y2MA 5E2EA 3NIAA 1PI4A 5EPHA 5DTKA 2ZM2A 4K0WA 2ZQ9A 4KG5A 3BFDA 3QNBA 3RXXA 3IF6B 3O88A 4GB7A 4M3KA 3V3SA 3MZFA 3VP1A 4S2JA 3E2KA 4PM8A 2ZC4B 4IVKA 5HX9A 1Z6FA 4OOLA 4RYEA 5FI2A 1ZKJA 1YLYA 4XUXA 3OPRA 4S2NC 2OV5A 3CG5A 3OPPA 2X71A 3G34A 3M2KA 1QMEA 2Y2LA 3DWZA 4C75A 5CHJA 3BFCA 4WZ5C 3NC8A 1LI0A 1MWSA 4GDNA 2XFSA 1JTDA 3WWXA 2EX6A 4X56A 1JWPA 2X02A 1ES4A 5F1GA 2EXAA 3Q7VA 3LO7A 5EE8A 4DXBA 3NI9A 5FI7A 4EQIA 4Y0UA 4WEKA 2CC1A 4QJGA 5KSCA 1IEMA 4WELA 3UDXA 1XKZA 3UPPA 3VP0A 4BL2A 1K38A 2Y2JA 4UA9A 2ZC5B 4EWFA 1L0DA 1XX2A 2R9XA 3OCNA 3N8RA 1J9MA 3E2LA 1FQGA 2G2UA 3BFFA 3Q7VB 5HARA 1I2WA 2FFYA 3OPLA 5J8XA 3ZGAB 1YMXA 2IWDA 2VGJA 3D4FA 1K4FA 1OMEA 1PYYA 1XGJA 3M2JA 4R23A 3ZFZA 4Y0OA 3C7UA 3G35A 1H8ZA 3HVFA 5CGWA 5EOOA 3MZDA 5HAIA 4DE2A 4OLGA 4E3NA 1DJCA 4GN2A 5U47A 4BD1A 1ES2A 2HDSA 5GL9A 3VP2A 2WK0A 3W4OA 3A3DA 5DTSA 4S2LA 3OC2A 5EECA 4GD6A 3MFDA 5L2FA 2XD1A 1IYSA 3DW0A 3LEZA 5FATA 4B4ZA 1BT5A 4GZBA 2VGKA 1S6RA 2XEPA 3RXWA 1BULA 2E8IA 2HPBA 3PAEA 2QMIA 2IWBA 4ZJ3A 1FSYA 4K91A 4S2PA 5AQ9A 1TDLA 3HUNA 1LL5A 4NK3A 1KE0A 4WYYA 4PM6A 1JWVA 2J9PA 3DWKA 4PM5A 4KZ8A 2V20A 1IYPA 4X53A 3UE3A 1M6KA 2GDNA 3UY6A 1XA1A 4IBXA 4U3TA 1BLPA 1PZPA 4N9LA 5GHXA 3UN7A 1NXYA 5F1FA 4JBFA 4E6XA 4LCMA 4P0MA 2H10A 3N6IA 2WZZA 3ZVTA 1FCNA 5HAQA 2WZXA 2Q9MA 3IXHA 4KG2A 1DJBA 5FQQA 4ZBEA 3HLBA 4Q8IA 4RVAA 1SKFA 1G68A 3N8SA 3TOIA 4DF6A 1XP4A 3V39A 3ISGA 3N7WA 3PBOA 1KDWA 3HLGA 4PPRA 4DE0A 4KZ4A 1ONHA 3WS1A 3GMWA 2X01A
chains in the Genus database with same CATH superfamily
3BY8A 2Q9NA 4UEYA 2W3EA 2ZQDA 2EX9A 3Q82A 3VFHA 4WN5A 3RJUA 3UE0A 1WYCA 3L7HA 4QPRA 4GJ4A 1PIOA 4RA7A 3K2NA 4HY8A 1L3LA 1K4EA 2P7JA 4OP8A 1TF1A 3WRTA 2HP5A 4X6TA 1ES5A 1OTBA 3A3FA 4EBNA 3L9KA 1S4SA 4HH3A 3E4QA 2H28A 2WKQA 1VQQA 5A92A 1I2SA 2W3FA 4S2KA 1GA9A 4JGOA 1PWCA 3RH8B 4S2IA 5F82A 4WBGA 2EXBA 3V67A 3O3VA 5TR7A 4DDSA 3H9WA 1YMSA 4DJ3A 5GLAA 1VETB 4PMAA 3ZG5A 3ITAA 3CI6A 2FZ0A 4Z9QA 4IJGA 1IYQA 3MKFA 3QHYA 3NBLA 3FWLA 4E3IA 3F1OA 2ZD8A 5DF9A 3D3OA 4WZ4A 3HUMA 4MDZA 2JKFA 5KZHA 1BSGA 1KVLA 5EM1A 3WS2A 1OT6A 5FSRA 3NDEA 5GLCA 2V8CA 3NY4A 1FSWA 2V1AA 4E04A 1RCJA 5I94A 4N1HA 4OPZA 3VMAA 3HJKA 5HL1A 1FIKA 1SDNA 1ERQA 4E3OA 3ICYA 4Y0TA 1Y28A 1YLJA 3QNCA 3BEBA 3NECA 2HDUA 3E98A 1EWZA 5JYOA 1XJ4A 4JGQA 2O99A 1Y54A 5EUAA 2PBYA 4HH2A 3IWQA 3S1YA 1K57C 4NKPA 3EQUA 3CPTB 3O86A 4WM9A 1Q2QA 3MQQA 2M1CA 2OAQ1 3GRJA 3WS4A 1KGGA 3PYPA 5E2GA 4GHIA 3IF5A 2WKIA 2XLNA 2DRWA 4Y2FA 4FTXA 5HWWA 4KZ9A 4WMCD 4LV3A 1CI9A 4JPMA 3T1QB 3Q07A 4Q0IA 4ZJ2A 4ZJ1A 5AQ7A 4OQ0A 2H0YA 4HOIA 4X1MA 5I5LA 4EETB 2HGVA 4UHUA 1BLCA 1VETA 4OPQA 4K08A 2ZM8A 1IKGA 4R70A 1YSPA 3JPUA 5JYPA 1L0FA 2KDKA 3T4OA 4BD0A 2GJ3A 4BBVA 3GTCA 4OQHA 1NYYA 3FPVA 1CK3A 3C4OA 1NZOA 3S7PA 1VHMA 1YLPA 4JF4A 4KENB 5HWVA 2G7UA 3GVBA 4DDYA 3MXRA 3W8KA 2XROA 2XF3A 2V1BA 5EVID 1W7FA 5KMWA 3VOLA 1PWGA 5AQBA 1E3UA 3RFBA 4LRZE 4G3KA 1MKMA 1OPXA 1ERMA 2VLGA 2EFUA 2FFFB 1TD5A 3LGOA 4N1XA 5D3OA 4OLDA 1PI5A 2VV8A 1NYMA 3UMEA 4PM7A 1FILA 2WYXA 1K56A 3UB5P 2UWXA 1KGEA 3QP4A 4BBUA 3BQ8A 3TSGA 4P87A 1PW1A 2HF6A 1CEGA 3BQAA 1T1BA 5HW3A 5HDSA 5J3WA 4FH2A 1E4DA 1H5XA 4XXRA 1V9ZA 3F1PB 3IH9A 2A49A 4UA6A 1CQAA 2PR6A 4UQIM 1DY6A 5IS1A 1TS0A 2WGVA 3HJIA 3SH8A 2Y2QA 2AVXA 2J3WA 3KYQA 2KX6A 1IFQA 1S1ZA 2JN7A 4NG2A 4R4RA 3LY4A 4GLQA 3R4KA 3O5YA 3SS4A 3MF0A 4L9EA 4CLCC 4DKIA 1O07A 5CHMA 4G3VA 3Q1FA 4JXWA 3H7WB 1OTEA 1JTGA 1JNUA 2V0UA 3NOTC 5DTKA 4K0WA 2ZQ9A 1TS7A 3T1RA 5MC7A 2W1TB 3PXPA 3CITA 3IF6B 4S2JA 2ZC4B 1UWNX 3LUQA 4XUXA 3MQOA 3G34A 3M2KA 5CHJA 3BFCA 3E4PA 2L4RA 3LR3A 2EXAA 5L8MA 4DXBA 3NI9A 1UWPX 4WEKA 2ZBBA 4BL2A 5AVFA 1OJGA 2ACGA 2R9XA 3OCNA 4KUOA 3B47A 1FQGA 2W1RA 4MMNA 1TS6A 2FFYA 4YWZA 3UMDA 1XGJA 2V9AA 4R23A 1H8ZA 5G4ZA 3HVFA 5CGWA 4I5SA 4BD1A 4I3JA 4MCWA 3A3DA 5J7EA 3GDIA 1G28A 4EXOA 2DMWA 3MFDA 2XD1A 3DW0A 1D06A 3LEZA 5FATA 3F1PA 4ETXA 2VGKA 1S6RA 3B33A 3EGXC 1N9LA 3DBAA 4S2PA 1TDLA 3HUNA 1KE0A 3CHWP 3C38A 2V20A 4KQDA 3UY6A 4UQIS 1BYWA 4N9LA 5F1FA 4ETZA 4E6XA 4LCMA 2H10A 2WZZA 3ZVTA 1FCNA 2MJ6A 4KG2A 3C8CA 1SKFA 3TOIA 4PKYA 2JKTI 3WS1A 2X01A 1XXMA 5A93A 5F83A 1SDEA 2ZQAA 1F2KA 3H7WA 5DF7A 3BM6A 3ZG9B 4O8GA 3UE6A 4HI4A 3A0VA 3HLFA 4Q0JA 1MWRA 1W79A 3G6OA 3IF6A 3OPHA 1RP5A 1FCMA 1P9RA 4OP5A 1ZG4A 1FOFA 1PNEA 3FPWA 3MS6A 3A3IA 3ZVWA 3A3EA 3C4PA 2D02A 1SCWA 2QJ5A 5HL6A 3SOIA 3BLSA 1MXOA 2P9VA 2V1ZA 1LL8A 4EEUA 4NXGA 4EQ1A 2EX8A 1XGIA 5FAOA 3VP3A 2JKRI 3G31A 1L0EA 1OTAA 1FR1A 4E3JA 1ES3A 5TFQA 2H0TA 1IELA 4BMWA 2JBFA 3PTEA 3SZTA 2VGLM 4ZAMA 4HBTA 2A3UA 2VKSA 2PD8A 4WMCA 4L9FA 2WKEA 5M18A 4JF5A 4PM9A 1XPBA 1ZHHB 2OSUA 3F1OB 1IYOA 3UB6A 3FKWA 3QP2A 3VOZA 4HEFA 3IBRA 1JWZA 4RQ9A 1N4OA 2EX2A 3W4PA 5FEGA 3IWIA 4P6ZM 1ESIA 4OKPA 1SKOA 4U0TA 4H8RA 1BLHA 3BW6A 3AGDA 5M19A 1RGZA 3T1SA 4KQOA 3ZG7B 4QHCA 5FQ9A 5IT5A 1YSQA 3CUEA 4IBRA 4A5RA 2HDRA 3IS2A 2RL3A 3C5AA 5HPIA 2W27A 3ZG0A 3UDFA 2PYPA 2I9VA 2BLSA 1HVBA 4KZBA 5EFWA 1GHIA 5EVIA 1T19A 4KZ7A 2HV1A 1K55C 2KLIA 3QP1A 1YM1A 2GZAA 3EEAA 4EW7A 2L1MA 1BLSA 5CHUA 2INWA 4EBLA 1SZVA 1BUEA 4GHIB 4OONA 4BBTA 1W63M 3CMZA 4JKTA 5A90A 4EUZA 1ZTUA 2P74A 5EVEA 3IH8A 3LR4A 1L2SA 1Q2PA 2PU4A 1TS8A 3IBJA 1H8YA 3PAGA 2PAVP 3DTEA 4WLAA 2Y2HA 3VV4A 3CZDA 1EROA 4HQAA 5CGXA 4CPKA 4RX2A 1LI9A 1AXBA 2Y2IA 1K54A 4JGRA 3N4IA 4NXFA 3HBRA 3QP8A 2ZL1B 4B4XA 1S4RA 2VGLS 1ZG6A 3PBNA 4FD8A 2L0WA 3P01A 3HLCA 3SS5A 2PBDP 2OLUA 1K25A 2JKTM 4Q0HA 4S2NA 4MEZA 2BTFP 5HSQA 2RCXA 3LY3A 4LRYC 4P6ZS 2C6WB 4WZ5A 5HFOA 4FUWA 4KG6A 4EUVA 1ALQA 4MBKA 2BG1A 2B02A 2Y2KA 5CGSA 1NLZA 4IUHA 4R6LA 1G6AA 5F5YA 3S4XA 3M6BA 1NWZA 1H0MA 4MNRA 4D2OA 3T1XA 1EI5A 3LIBA 4X69A 1OJ5A 4EERA 2ZC7A 3IXDA 3B3XA 4CLCD 4DJ2A 4ZTKA 3IX8A 1MC0A 4OQIA 2OLVA 1LT0A 5DFXA 1YLTA 1XFNA 2JKRM 3PBSA 1MBLA 1LSWA 1O7EA 2A2LA 3SS3A 1H8MA 2QZ6A 1N9BA 3FV7A 5FDHA 3T4QA 1ODVA 1XJ2A 1OT9A 1ONGA 3ZNTA 3GQZA 2DCFA 4WEJA 5CTNA 4E3LA 4OH0A 3T4JA 1YT4A 5IHVA 1I5QA 3HLWA 4KUKA 5CX7A 4I3IA 3IWOA 3NIAA 5EPHA 1DP8A 4KG5A 3BFDA 4GB7A 3V3SA 3VP1A 3E2KA 2QYBA 2ZL1A 5HX9A 1H3QA 1S1YA 3KSIA 1ZKJA 2OV5A 1K0KA 2VK3A 1YPRA 1QMEA 1W63Q 3DWZA 5DJTA 3QP5A 5EV0A 3WWXA 2OWJA 2EX6A 3T4TA 2X02A 5F1GA 1ES4A 1DP6A 3Q7VA 3OLOA 4GW9A 3LO7A 4EESA 1IEMA 1K38A 1L0DA 3N8RA 3LI8A 3BFFA 5HARA 1I2WA 3ZGAB 1YMXA 2VGJA 3D4FA 3QP6A 1OMEA 1PYYA 4GCZA 3ZFZA 4Y0OA 3G35A 5EOOA 5HAIA 1DJCA 3H82B 3LFVA 3ZQ5A 3BY9A 4MN7A 4I39A 3LIEA 2K31A 4FOFA 3VE3A 4GD6A 5L2FA 1IYSA 4Y3IA 5EM0A 1P9WA 4B4ZA 1BT5A 4GZBA 2E8IA 4EEPA 3LIAA 4K91A 4HP4A 4R38A 4NK3A 4WYYA 3DWKA 4X53A 1IYPA 3KO6A 5J4EA 2EWWA 2GDNA 1XA1A 4IBXA 2XSSA 2B18A 2WZXA 3IXHA 3CWFA 1DJBA 5FL3A 3N8SA 3HCYA 2VV7A 1ONHA 5KSHA 3TG9A 4UA7A 3RTYA 4II7A 4FCFA 2IA2A 1MWTA 3TW8A 3GR2A 1MPLA 2D01A 3LR5A 1KDSA 3UE1A 3FZCA 2PR5A 3G4PA 2JC7A 3FC7A 3BWLA 3KYEA 5GLBA 3ZNYA 4WUJA 3IX3A 3S7QA 1E25A 2DNSA 1U60A 4EBPA 5HZHA 2WAFA 1K57A 3N8LA 1V9YA 2CMNA 3TRCA 4HP9A 1WYBA 2Y55A 2Y59A 5E2FA 2VZWA 4OVDA 4ME4A 3PBRA 4UAAA 4OPRA 4P85A 5GLDA 1W8YA 5FEFA 2P9VB 5C5KA 4GNUA 4F94A 5A91A 2OWHA 3DTIA 4U0XA 4DMZA 2VX8A 3VSLA 4PAUA 3BRMA 1GHPA 3H82A 4QY5A 3NOPC 2WKHA 3OCLA 4CLCB 5CEDA 5M1AA 2Q0OA 3IX4A 2XD5A 2Y2NA 4DN0A 4B88A 3T4LA 3Q81A 1YLZA 2ZQCA 3F1NA 1GCEA 3DAVA 5G4YA 5E2HA 2EA9A 3MQ0A 4F3LB 3G2YA 3T4SA 2JCHA 4LCLA 1KVMA 4RX3A 2JE5A 1UGUA 1MKIA 4CJNA 2WADA 1ACFA 5TBMB 4HJ3A 2Y79A 4YINA 1SKOB 1LHYA 5F69A 3WS5A 2OOLA 3LICA 5KIZA 2NUPC 4QD4A 3BFGA 1CEFA 4IVIA 5FQMA 3OZHA 3ITBA 2WAEA 1N9OA 5FAQA 4IUKA 1XA7A 1FR6A 3UPNA 5FDSA 3IS2B 4XT2A 1GSVA 5LBRA 4P6BA 2Y2GA 2E8JA 4DRTA 3SH9A 3V3RA 4MN6A 3MR0A 3G32A 5EVIB 2J9OA 4CLCE 4Y7PA 3TE8A 2XK1A 4S2OA 5CRFA 5CERA 1HTZA 1K6RA 3IHAA 3O87A 4I3AA 4OOYA 5L10A 3MZEA 3LR0A 4D60A 3UNWA 4L9GA 4E6WA 3MXSA 4O7DA 3EEHA 4G3WA 1HD8A 1C3BA 4NXEA 2ZM0A 5BOHA 4CLCA 4ESPA 4KQRA 3GECA 4HIAA 2PU2A 3BECA 4HJ4A 4LPZA 5DF8A 2QPNA 4OQGA 2JHEA 1GA0A 3HL9A 1ZC2A 3D72A 4Y13A 2P04A 4C6YA 3JVVA 2G2WA 1TDGA 4F3LA 1W8QA 1G5UA 2XDMA 4N9KA 4R3BA 1F9IA 4HHDA 3ZG8B 3IHBA 4NXBA 4L0LA 5TBMA 2JKGA 3DTKA 5HDDA 4MLLA 3IXGA 2ZMVA 2XR0A 3CJMA 2OAP1 1RGYA 4R3JA 1FCOA 4CQHA 2J7VA 5FASA 4YNRA 1AWIA 3HUOA 2ZC3B 4OOMA 4QU3A 2GNXA 4R4SA 3KSHA 5HD3A 2WGIA 2R78A 4EV4A 3LCEA 4Y15A 3BYDA 2Y4AA 3NHQA 1P97A 5FQIA 2PDRA 1CI8A 4OPYA 1NLYA 3NJAA 1HLUP 5FQKA 3W2ZA 4BQMA 2ZMFA 3NCKA 5AQAA 2HDQA 4KZAA 3LEQA 2XGNA 2P08A 3PHYA 3KYZA 2ZLYA 5L09A 4ARZA 1LSVA 1BZAA 3TJZC 1T1CA 2YKHA 4JLFA 2WUQA 3MJQA 1VM1A 3UB9A 2XQZA 4PHTA 4O01A 2ZC6B 3ULFA 3ZHHA 5TJJA 3AGFA 1XJ3A 3A3JA 1YKDA 5EOEA 3U4LP 1YLWA 1DP9A 2B5RA 4ZDXA 1PZOA 2Y2MA 5E2EA 3QNBA 3MSHA 3O88A 2Z6CA 3MZFA 3OOVA 2PRFA 4PM8A 1Z6FA 4OOLA 5FI2A 3A0RA 3CG5A 3OPPA 2X71A 2Y2LA 4C75A 4LFUA 1MWSA 1PRQA 2XFSA 4X56A 1VB6A 3LIDA 5EE8A 5FI7A 1Y4OA 4QJGA 2CC1A 4WELA 2J3TC 2Y2JA 4UA9A 2YKFA 1J9MA 3E2LA 5AJGA 2G2UA 3Q7VB 4R3AA 1A0KA 2BASA 4JGPA 3OPLA 5J8XA 1K4FA 2WKPA 3KSFA 4O0PA 2PD7A 2HDSA 5GL9A 3VP2A 2WK0A 5DTSA 3OC2A 3T4KA 2K2NA 4PKYG 2XEPA 3CAXA 1BULA 2HPBA 2QMIA 2VA0A 1OTDA 4MN5A 2J9PA 3S7OA 3UE3A 2ZOHA 2LB5A 2O9BA 1BLPA 1PZPA 3UN7A 1NXYA 4JBFA 4P0MA 3N6IA 5HWTA 2Q9MA 3EWKA 5K5BA 5FQQA 4Q8IA 3HLBA 4RVAA 1G68A 2NUTC 1T18A 3V39A 1G6OA 3PBOA 1KDWA 4PPRA 4NEED 4Y5FA 3GMWA 5F68A 1L0GA 4QB8A 3EQVA 1NJ4A 2XA7M 2HP6A 1XJ6A 2B95A 3T12B 4GD8A 4MBFA 3SW1A 4IHQA 1NRJA 3P09A 3B42A 3IXBA 5FQJA 4AFIA 4HJ6A 1WE4A 2O0YA 2XRNA 2FH5A 4LLOB 4LRXC 1PWDA 3WRZA 3MKEA 2VJWA 1GHMA 5FAPA 1K55A 2LB9A 1YQSA 5CECA 2QKPA 3VFFA 3VOYA 3PBQA 3PBTA 4MBHA 5IU1A 4KZ6A 5CTMA 1Z09A 3ZYTA 2ZQ8A 2Z6DA 2IWCA 4NETA 2UV0E 1VEUB 2EFXA 4BJPA 4HNBA 3DTMA 4LV0A 4JXSA 2GX5A 3MFXA 1SHVA 2W3HA 3E0YA 1DRMA 1M40A 3P7NA 2O9CA 4E3KA 4C3QA 4ID4A 3C7VA 5HPFA 3KSGA 2ZJ9A 3LI9A 2XFTA 5AVEA 1NRFA 1XFQA 1IKIA 4X25A 1W5DA 2Z2MB 4HESA 4KQQA 3VP4A 4DXCA 5E43A 3T50A 2Y2PA 3D9YA 4BENA 5FI6A 1S67L 1T1AA 1S66L 4GDBA 1J3WA 3CLOA 3IQAA 3AGEA 4R0QA 2C5WB 2I72A 3F1NB 4LV2A 2H5SA 4X68A 1LLBA 2HZ5A 1IOUA 3LYXA 5FA7A 4M4XA 4HBUA 3CPTA 3UDIA 1X0OA 3IF6C 1TVFA 3W4QA 3LIFA 4YOFA 2XA7S 4E3MA 3P98A 4GS9B 3M6HA 4JF6A 2W0NA 3FYZA 2J8YA 2WGWB 4LV1A 3FKVA 3VSKA 4LGWA 3ZCZA 1HZOA 2VEAA 2PYRA 2Z2LB 3UPOA 1PW8A 3SH7A 4XT2B 1ESUA 1MWUA 3UB8A 4H6JB 3EOIA 5TGFA 2HJEA 4YFMA 4I38A 5F6AA 4FH4A 4IEDA 4KZ3A 1KE4A 5DJUA 4GOGA 3BFEA 3MBZA 3JVUA 3K3DA 4X55A 3S22A 5DTTA 3V50A 4QY6A 1VEUA 4FSFA 4S2MA 4GKUA 3K3CA 2HP9A 2QHKA 1LL9A 1F98A 4QWOA 3UO9A 5A8BA 3WS0A 2Y2OA 4DE3A 3GV9A 2QWSA 2EWVA 4JXVA 1GSXA 1KOUA 3G30A 3HLEA 5CXWA 2K7SA 1QMFA 4N92A 1DJAA 5DKLA 4EU0A 3GSGA 1NY0A 3ZDJA 3NDGA 5HD5A 2Y91A 3BJNA 3VE4A 2ZMAA 2ZOIA 2R9WA 2ZQ7A 3HLDA 1KE3A 3BLMA 3CUEC 2W3GA 5EVIC 4GS9A 1MZUA 4BL3A 1MY8A 3JYIA 1D1JA 5CEBA 2XH9A 3V5MA 5HDCA 2W3DA 2WGWA 1TEMA 4XUZA 5GHZA 3U2AA 4DE1A 3R7WB 2V2FF 4K0XA 3NOUC 2A24B 3Q7ZA 5GHYA 3NULA 1CF0A 1NZUA 4JXGA 1S0WA 2V8FA 1KGFA 4LENA 1BTLA 3G2ZA 1N9NA 4H6JA 3A0SA 2PHYA 5DVAA 3I7JA 4BLMA 1E3UD 3OBFA 4R1GA 3C30A 2J80A 3S7NA 4KZ5A 1K6SA 1JVJA 3IT9A 4ARZB 1K54C 2W1TA 3HREA 4Y17A 2V0WA 5G18A 5EVLA 1K56D 5HAPA 1LSXA 2J3TD 1PI4A 2ZM2A 3RXXA 4B9OA 4M3KA 3PR6A 4WF0A 4IVKA 4RYEA 2VV6A 2O9AA 1YLYA 1D7EA 3OPRA 4S2NC 1CJFA 3C2WA 3E4OA 2PT7A 1PFLA 4WZ5C 3NC8A 1LI0A 1P0ZA 4GDNA 1JTDA 4ZRRA 4X1LA 1JWPA 4Z1WA 1YAXA 4EQIA 4Y0UA 5KSCA 3UDXA 1XKZA 3UPPA 3VP0A 2ZC5B 4EWFA 1XX2A 5DFYA 4BWIA 2IWDA 3KX0X 3M2JA 3C7UA 1EW0A 1OTIA 3FG8A 3MZDA 4DE2A 4E3NA 4OLGA 2Y8HA 4GN2A 5U47A 4WL9A 1ES2A 3MMHA 3W4OA 5L07A 2QJ7A 4S2LA 5EECA 2WKRA 3R7WA 3RXWA 2IWBA 3PAEA 4ZJ3A 1FSYA 2A24A 5AQ9A 1LL5A 4PM6A 1JWVA 4PM5A 4KZ8A 1M6KA 2HJ9C 2M7UA 2KOIA 4U3TA 5GHXA 1WA9A 5HAQA 3EGDC 3UB7A 3MXQA 2M7VA 4ZBEA 4DF6A 1STZA 1XP4A 4B93A 3ISGA 3N7WA 5DKKA 1F5MA 3HLGA 4DE0A 4KZ4A 1GSWA
chains in the Genus database with same CATH topology
1L0GA 1XXMA 5A93A 4QB8A 2Q9NA 3EQVA 1SDEA 1NJ4A 4UA7A 5F83A 4FCFA 2ZQAA 1MWTA 2HP6A 2ZQDA 3GR2A 1MPLA 5DF7A 3BM6A 2EX9A 3ZG9B 3Q82A 3VFHA 1KDSA 3UE1A 4GD8A 3FZCA 4MBFA 3G4PA 3HLFA 2JC7A 1MWRA 1W79A 3RJUA 3P09A 1WYCA 3UE0A 5GLBA 3IF6A 3OPHA 3ZNYA 1RP5A 1FCMA 1PIOA 4RA7A 4OP5A 3IXBA 1E25A 2DNSA 1U60A 1ZG4A 1FOFA 5FQJA 4EBPA 1WE4A 1K57A 2WAFA 3N8LA 1K4EA 3A3IA 3ZVWA 4OP8A 3WRTA 3A3EA 2HP5A 3C4PA 4X6TA 1ES5A 1SCWA 3SOIA 3A3FA 4EBNA 1WYBA 2Y55A 2Y59A 1PWDA 5E2FA 3WRZA 3MKEA 4OVDA 1VQQA 3BLSA 5A92A 1MXOA 1GHMA 2P9VA 5FAPA 1K55A 1I2SA 1YQSA 5CECA 3PBRA 2V1ZA 4S2KA 1GA9A 4UAAA 1PWCA 4OPRA 4S2IA 4P85A 3VFFA 5F82A 3PBQA 3PBTA 4MBHA 3VOYA 4WBGA 2EXBA 2EX8A 3O3VA 1XGIA 5GLDA 1W8YA 4KZ6A 5FAOA 5TR7A 3VP3A 4DDSA 2P9VB 3G31A 1YMSA 5CTMA 5GLAA 4GNUA 4F94A 4PMAA 3ZG5A 5A91A 2ZQ8A 1L0EA 2IWCA 3ITAA 4NETA 2EFXA 4Z9QA 1FR1A 4BJPA 3DTMA 4LV0A 4U0XA 4JXSA 3VSLA 3BRMA 1GHPA 1IYQA 4QY5A 4E3JA 1SHVA 3MKFA 1ES3A 5TFQA 3QHYA 2H0TA 2WKHA 3NBLA 3OCLA 1IELA 1M40A 5CEDA 2JBFA 3FWLA 5M1AA 4E3IA 2ZD8A 5DF9A 3PTEA 4E3KA 4C3QA 4WZ4A 2XD5A 4ZAMA 2Y2NA 4HBTA 3HUMA 4ID4A 2A3UA 4B88A 3C7VA 2ZJ9A 4WMCA 2XFTA 5KZHA 3Q81A 2WKEA 5M18A 4JF5A 1NRFA 4PM9A 1BSGA 1XPBA 1KVLA 1YLZA 1IKIA 3WS2A 2OSUA 1IYOA 1W5DA 3NDEA 2Z2MB 5FSRA 5GLCA 2ZQCA 3FKWA 1GCEA 3NY4A 4HESA 1FSWA 4KQQA 5E2HA 3VP4A 4DXCA 3VOZA 4HEFA 5E43A 1JWZA 3G2YA 1N4OA 2Y2PA 2EX2A 1RCJA 2JCHA 1KVMA 4LCLA 4RX3A 3W4PA 2JE5A 3IWIA 4BENA 5FI6A 1ESIA 4OKPA 4U0TA 1MKIA 4CJNA 4GDBA 5I94A 4R0QA 3IQAA 3AGEA 4N1HA 2C5WB 2I72A 4H8RA 2WADA 4OPZA 3VMAA 1BLHA 4LV2A 5HL1A 2H5SA 1SDNA 3AGDA 1ERQA 5M19A 4X68A 1RGZA 4E3OA 1LLBA 4Y0TA 4KQOA 3ZG7B 4YINA 1YLJA 4QHCA 5FA7A 1LHYA 3QNCA 3BEBA 4HBUA 3WS5A 2HDUA 3UDIA 1EWZA 5FQ9A 5JYOA 5KSHA 4QD4A 1Y54A 3IF6C 3BFGA 1TVFA 5EUAA 3W4QA 2PBYA 3IWQA 4IBRA 3S1YA 4A5RA 1CEFA 2HDRA 4IVIA 2RL3A 3P98A 3C5AA 5FQMA 4E3MA 1K57C 3ITBA 2WAEA 3OZHA 3EQUA 3M6HA 3ZG0A 3UDFA 4JF6A 5FAQA 3O86A 2BLSA 1HVBA 4WM9A 3FYZA 4KZBA 1XA7A 1FR6A 1Q2QA 1GHIA 5EVIA 3UPNA 4KZ7A 2J8YA 2WGWB 3GRJA 3WS4A 1KGGA 1K55C 3FKVA 4LV1A 4P6BA 2Y2GA 5E2GA 3IF5A 3VSKA 1YM1A 4DRTA 3SH9A 3V3RA 3ZCZA 2WKIA 2XLNA 2DRWA 1HZOA 1BLSA 4KZ9A 4WMCD 3G32A 5CHUA 5EVIB 2J9OA 2Z2LB 4LV3A 3UPOA 4Y7PA 1PW8A 4EBLA 3SH7A 1CI9A 2XK1A 4JPMA 1ESUA 3Q07A 1MWUA 4ZJ2A 4ZJ1A 1BUEA 5AQ7A 5TGFA 4OONA 4YFMA 4OQ0A 4S2OA 3CMZA 2H0YA 5CRFA 4JKTA 5CERA 5A90A 1HTZA 4EUZA 4FH4A 2P74A 4IEDA 4KZ3A 1KE4A 1K6RA 4GOGA 3IHAA 3BFEA 3MBZA 3IH8A 4UHUA 1BLCA 1L2SA 4OPQA 1Q2PA 2ZM8A 3O87A 4OOYA 2PU4A 4X55A 3S22A 1IKGA 5DTTA 3V50A 1H8YA 3PAGA 4QY6A 3MZEA 5JYPA 1L0FA 2Y2HA 3CZDA 4FSFA 3UNWA 1EROA 4E6WA 4BD0A 3MXSA 4O7DA 4GKUA 4S2MA 5CGXA 4CPKA 2HP9A 4RX2A 1LI9A 1AXBA 2Y2IA 1K54A 1HD8A 1C3BA 5BOHA 2ZM0A 1LL9A 3GTCA 4OQHA 1NYYA 3N4IA 4KQRA 2PU2A 1CK3A 3BECA 3C4OA 1NZOA 3UO9A 1YLPA 3WS0A 2Y2OA 3HBRA 5DF8A 4DE3A 4JF4A 4KENB 3GV9A 2QPNA 4OQGA 4B4XA 3GVBA 1GA0A 4JXVA 4DDYA 3MXRA 3HL9A 3W8KA 1ZC2A 1ZG6A 2XF3A 3G30A 3HLEA 3PBNA 1W7FA 4FD8A 5CXWA 5EVID 4C6YA 5KMWA 1QMFA 1PWGA 4N92A 1DJAA 5AQBA 2G2WA 1TDGA 3HLCA 3SS5A 1E3UA 1W8QA 2OLUA 1K25A 3GSGA 1NY0A 2XDMA 4N9KA 4R3BA 1ERMA 4S2NA 2EFUA 4MEZA 3ZDJA 2RCXA 3NDGA 3LY3A 3ZG8B 2FFFB 3IHBA 4N1XA 2C6WB 4WZ5A 2Y91A 4L0LA 5D3OA 5HFOA 4OLDA 1PI5A 4KG6A 2ZMAA 1ALQA 2R9WA 1NYMA 4MBKA 4PM7A 4MLLA 2BG1A 2WYXA 2ZQ7A 3IXGA 1K56A 1KE3A 3BLMA 3HLDA 2UWXA 2XR0A 2Y2KA 3CJMA 1KGEA 5CGSA 1G6AA 1RGYA 4R3JA 1FCOA 3S4XA 2J7VA 3M6BA 3TSGA 5FASA 4P87A 1PW1A 3HUOA 5EVIC 2ZC3B 4OOMA 4QU3A 4MNRA 4BL3A 4D2OA 1MY8A 1CEGA 1EI5A 4X69A 3JYIA 2ZC7A 4R4SA 5HW3A 4FH2A 5CEBA 2WGIA 2XH9A 3B3XA 3IXDA 1H5XA 1E4DA 3V5MA 4EV4A 3LCEA 3BYDA 2Y4AA 4XXRA 2WGWA 1TEMA 4XUZA 4ZTKA 5GHZA 4DE1A 3IH9A 5FQIA 2V2FF 4K0XA 2A49A 1CI8A 4UA6A 4OPYA 4OQIA 1DY6A 2OLVA 3Q7ZA 5FQKA 4BQMA 3NCKA 1YLTA 5AQAA 5GHYA 2HDQA 4KZAA 1NZUA 4JXGA 2WGVA 2XGNA 1S0WA 4LENA 1KGFA 3PBSA 2Y2QA 1BTLA 3SH8A 1MBLA 2ZLYA 3G2ZA 1O7EA 5DVAA 1BZAA 3I7JA 4BLMA 3SS3A 1E3UD 3TG9A 4R1GA 2QZ6A 1N9BA 4KZ5A 3FV7A 1K6SA 5FDHA 4R4RA 4JLFA 3LY4A 2WUQA 1ONGA 1VM1A 2XQZA 1JVJA 3ZNTA 3GQZA 2DCFA 3IT9A 4WEJA 5CTNA 4E3LA 2ZC6B 4OH0A 3SS4A 3ZHHA 1K54C 3AGFA 1YT4A 3HREA 3A3JA 5IHVA 1I5QA 1O07A 4DKIA 3HLWA 5CHMA 5G18A 5EOEA 3Q1FA 5EVLA 4JXWA 1YLWA 2B5RA 1K56D 1JTGA 4ZDXA 5HAPA 1PZOA 3IWOA 2Y2MA 5E2EA 3NIAA 1PI4A 5EPHA 5DTKA 2ZM2A 4K0WA 2ZQ9A 4KG5A 3BFDA 3QNBA 3RXXA 3IF6B 3O88A 4GB7A 4M3KA 3V3SA 3MZFA 3VP1A 4S2JA 3E2KA 4PM8A 2ZC4B 4IVKA 5HX9A 1Z6FA 4OOLA 4RYEA 5FI2A 1ZKJA 1YLYA 4XUXA 3OPRA 4S2NC 2OV5A 3CG5A 3OPPA 2X71A 3G34A 3M2KA 1QMEA 2Y2LA 3DWZA 4C75A 5CHJA 3BFCA 4WZ5C 3NC8A 1LI0A 1MWSA 4GDNA 2XFSA 1JTDA 3WWXA 2EX6A 4X56A 1JWPA 2X02A 1ES4A 5F1GA 2EXAA 3Q7VA 3LO7A 5EE8A 4DXBA 3NI9A 5FI7A 4EQIA 4Y0UA 4WEKA 2CC1A 4QJGA 5KSCA 1IEMA 4WELA 3UDXA 1XKZA 3UPPA 3VP0A 4BL2A 1K38A 2Y2JA 4UA9A 2ZC5B 4EWFA 1L0DA 1XX2A 2R9XA 3OCNA 3N8RA 1J9MA 3E2LA 1FQGA 2G2UA 3BFFA 3Q7VB 5HARA 1I2WA 2FFYA 3OPLA 5J8XA 3ZGAB 1YMXA 2IWDA 2VGJA 3D4FA 1K4FA 1OMEA 1PYYA 1XGJA 3M2JA 4R23A 3ZFZA 4Y0OA 3C7UA 3G35A 1H8ZA 3HVFA 5CGWA 5EOOA 3MZDA 5HAIA 4DE2A 4OLGA 4E3NA 1DJCA 4GN2A 5U47A 4BD1A 1ES2A 2HDSA 5GL9A 3VP2A 2WK0A 3W4OA 3A3DA 5DTSA 4S2LA 3OC2A 5EECA 4GD6A 3MFDA 5L2FA 2XD1A 1IYSA 3DW0A 3LEZA 5FATA 4B4ZA 1BT5A 4GZBA 2VGKA 1S6RA 2XEPA 3RXWA 1BULA 2E8IA 2HPBA 3PAEA 2QMIA 2IWBA 4ZJ3A 1FSYA 4K91A 4S2PA 5AQ9A 1TDLA 3HUNA 1LL5A 4NK3A 1KE0A 4WYYA 4PM6A 1JWVA 2J9PA 3DWKA 4PM5A 4KZ8A 2V20A 1IYPA 4X53A 3UE3A 1M6KA 2GDNA 3UY6A 1XA1A 4IBXA 4U3TA 1BLPA 1PZPA 4N9LA 5GHXA 3UN7A 1NXYA 5F1FA 4JBFA 4E6XA 4LCMA 4P0MA 2H10A 3N6IA 2WZZA 3ZVTA 1FCNA 5HAQA 2WZXA 2Q9MA 3IXHA 4KG2A 1DJBA 5FQQA 4ZBEA 3HLBA 4Q8IA 4RVAA 1SKFA 1G68A 3N8SA 3TOIA 4DF6A 1XP4A 3V39A 3ISGA 3N7WA 3PBOA 1KDWA 3HLGA 4PPRA 4DE0A 4KZ4A 1ONHA 3WS1A 3GMWA 2X01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0G A;  1XXM A;  5A93 A;  4QB8 A;  2Q9N A;  3EQV A;  1SDE A;  1NJ4 A;  4UA7 A;  5F83 A;  4FCF A;  2ZQA A;  1MWT A;  2HP6 A;  2ZQD A;  3GR2 A;  1MPL A;  5DF7 A;  3BM6 A;  2EX9 A;  3ZG9 B;  3Q82 A;  3VFH A;  1KDS A;  3UE1 A;  4GD8 A;  3FZC A;  4MBF A;  3G4P A;  3HLF A;  2JC7 A;  1MWR A;  1W79 A;  3RJU A;  3P09 A;  1WYC A;  3UE0 A;  5GLB A;  3IF6 A;  3OPH A;  3ZNY A;  1RP5 A;  1FCM A;  1PIO A;  4RA7 A;  4OP5 A;  3IXB A;  1E25 A;  2DNS A;  1U60 A;  1ZG4 A;  1FOF A;  5FQJ A;  4EBP A;  1WE4 A;  1K57 A;  2WAF A;  3N8L A;  1K4E A;  3A3I A;  3ZVW A;  4OP8 A;  3WRT A;  3A3E A;  2HP5 A;  3C4P A;  4X6T A;  1ES5 A;  1SCW A;  3SOI A;  3A3F A;  4EBN A;  1WYB A;  2Y55 A;  2Y59 A;  1PWD A;  5E2F A;  3WRZ A;  3MKE A;  4OVD A;  1VQQ A;  3BLS A;  5A92 A;  1MXO A;  1GHM A;  2P9V A;  5FAP A;  1K55 A;  1I2S A;  1YQS A;  5CEC A;  3PBR A;  2V1Z A;  4S2K A;  1GA9 A;  4UAA A;  1PWC A;  4OPR A;  4S2I A;  4P85 A;  3VFF A;  5F82 A;  3PBQ A;  3PBT A;  4MBH A;  3VOY A;  4WBG A;  2EXB A;  2EX8 A;  3O3V A;  1XGI A;  5GLD A;  1W8Y A;  4KZ6 A;  5FAO A;  5TR7 A;  3VP3 A;  4DDS A;  2P9V B;  3G31 A;  1YMS A;  5CTM A;  5GLA A;  4GNU A;  4F94 A;  4PMA A;  3ZG5 A;  5A91 A;  2ZQ8 A;  1L0E A;  2IWC A;  3ITA A;  4NET A;  2EFX A;  4Z9Q A;  1FR1 A;  4BJP A;  3DTM A;  4LV0 A;  4U0X A;  4JXS A;  3VSL A;  3BRM A;  1GHP A;  1IYQ A;  4QY5 A;  4E3J A;  1SHV A;  3MKF A;  1ES3 A;  5TFQ A;  3QHY A;  2H0T A;  2WKH A;  3NBL A;  3OCL A;  1IEL A;  1M40 A;  5CED A;  2JBF A;  3FWL A;  5M1A A;  4E3I A;  2ZD8 A;  5DF9 A;  3PTE A;  4E3K A;  4C3Q A;  4WZ4 A;  2XD5 A;  4ZAM A;  2Y2N A;  4HBT A;  3HUM A;  4ID4 A;  2A3U A;  4B88 A;  3C7V A;  2ZJ9 A;  4WMC A;  2XFT A;  5KZH A;  3Q81 A;  2WKE A;  5M18 A;  4JF5 A;  1NRF A;  4PM9 A;  1BSG A;  1XPB A;  1KVL A;  1YLZ A;  1IKI A;  3WS2 A;  2OSU A;  1IYO A;  1W5D A;  3NDE A;  2Z2M B;  5FSR A;  5GLC A;  2ZQC A;  3FKW A;  1GCE A;  3NY4 A;  4HES A;  1FSW A;  4KQQ A;  5E2H A;  3VP4 A;  4DXC A;  3VOZ A;  4HEF A;  5E43 A;  1JWZ A;  3G2Y A;  1N4O A;  2Y2P A;  2EX2 A;  1RCJ A;  2JCH A;  1KVM A;  4LCL A;  4RX3 A;  3W4P A;  2JE5 A;  3IWI A;  4BEN A;  5FI6 A;  1ESI A;  4OKP A;  4U0T A;  1MKI A;  4CJN A;  4GDB A;  5I94 A;  4R0Q A;  3IQA A;  3AGE A;  4N1H A;  2C5W B;  2I72 A;  4H8R A;  2WAD A;  4OPZ A;  3VMA A;  1BLH A;  4LV2 A;  5HL1 A;  2H5S A;  1SDN A;  3AGD A;  1ERQ A;  5M19 A;  4X68 A;  1RGZ A;  4E3O A;  1LLB A;  4Y0T A;  4KQO A;  3ZG7 B;  4YIN A;  1YLJ A;  4QHC A;  5FA7 A;  1LHY A;  3QNC A;  3BEB A;  4HBU A;  3WS5 A;  2HDU A;  3UDI A;  1EWZ A;  5FQ9 A;  5JYO A;  5KSH A;  4QD4 A;  1Y54 A;  3IF6 C;  3BFG A;  1TVF A;  5EUA A;  3W4Q A;  2PBY A;  3IWQ A;  4IBR A;  3S1Y A;  4A5R A;  1CEF A;  2HDR A;  4IVI A;  2RL3 A;  3P98 A;  3C5A A;  5FQM A;  4E3M A;  1K57 C;  3ITB A;  2WAE A;  3OZH A;  3EQU A;  3M6H A;  3ZG0 A;  3UDF A;  4JF6 A;  5FAQ A;  3O86 A;  2BLS A;  1HVB A;  4WM9 A;  3FYZ A;  4KZB A;  1XA7 A;  1FR6 A;  1Q2Q A;  1GHI A;  5EVI A;  3UPN A;  4KZ7 A;  2J8Y A;  2WGW B;  3GRJ A;  3WS4 A;  1KGG A;  1K55 C;  3FKV A;  4LV1 A;  4P6B A;  2Y2G A;  5E2G A;  3IF5 A;  3VSK A;  1YM1 A;  4DRT A;  3SH9 A;  3V3R A;  3ZCZ A;  2WKI A;  2XLN A;  2DRW A;  1HZO A;  1BLS A;  4KZ9 A;  4WMC D;  3G32 A;  5CHU A;  5EVI B;  2J9O A;  2Z2L B;  4LV3 A;  3UPO A;  4Y7P A;  1PW8 A;  4EBL A;  3SH7 A;  1CI9 A;  2XK1 A;  4JPM A;  1ESU A;  3Q07 A;  1MWU A;  4ZJ2 A;  4ZJ1 A;  1BUE A;  5AQ7 A;  5TGF A;  4OON A;  4YFM A;  4OQ0 A;  4S2O A;  3CMZ A;  2H0Y A;  5CRF A;  4JKT A;  5CER A;  5A90 A;  1HTZ A;  4EUZ A;  4FH4 A;  2P74 A;  4IED A;  4KZ3 A;  1KE4 A;  1K6R A;  4GOG A;  3IHA A;  3BFE A;  3MBZ A;  3IH8 A;  4UHU A;  1BLC A;  1L2S A;  4OPQ A;  1Q2P A;  2ZM8 A;  3O87 A;  4OOY A;  2PU4 A;  4X55 A;  3S22 A;  1IKG A;  5DTT A;  3V50 A;  1H8Y A;  3PAG A;  4QY6 A;  3MZE A;  5JYP A;  1L0F A;  2Y2H A;  3CZD A;  4FSF A;  3UNW A;  1ERO A;  4E6W A;  4BD0 A;  3MXS A;  4O7D A;  4GKU A;  4S2M A;  5CGX A;  4CPK A;  2HP9 A;  4RX2 A;  1LI9 A;  1AXB A;  2Y2I A;  1K54 A;  1HD8 A;  1C3B A;  5BOH A;  2ZM0 A;  1LL9 A;  3GTC A;  4OQH A;  1NYY A;  3N4I A;  4KQR A;  2PU2 A;  1CK3 A;  3BEC A;  3C4O A;  1NZO A;  3UO9 A;  1YLP A;  3WS0 A;  2Y2O A;  3HBR A;  5DF8 A;  4DE3 A;  4JF4 A;  4KEN B;  3GV9 A;  2QPN A;  4OQG A;  4B4X A;  3GVB A;  1GA0 A;  4JXV A;  4DDY A;  3MXR A;  3HL9 A;  3W8K A;  1ZC2 A;  1ZG6 A;  2XF3 A;  3G30 A;  3HLE A;  3PBN A;  1W7F A;  4FD8 A;  5CXW A;  5EVI D;  4C6Y A;  5KMW A;  1QMF A;  1PWG A;  4N92 A;  1DJA A;  5AQB A;  2G2W A;  1TDG A;  3HLC A;  3SS5 A;  1E3U A;  1W8Q A;  2OLU A;  1K25 A;  3GSG A;  1NY0 A;  2XDM A;  4N9K A;  4R3B A;  1ERM A;  4S2N A;  2EFU A;  4MEZ A;  3ZDJ A;  2RCX A;  3NDG A;  3LY3 A;  3ZG8 B;  2FFF B;  3IHB A;  4N1X A;  2C6W B;  4WZ5 A;  2Y91 A;  4L0L A;  5D3O A;  5HFO A;  4OLD A;  1PI5 A;  4KG6 A;  2ZMA A;  1ALQ A;  2R9W A;  1NYM A;  4MBK A;  4PM7 A;  4MLL A;  2BG1 A;  2WYX A;  2ZQ7 A;  3IXG A;  1K56 A;  1KE3 A;  3BLM A;  3HLD A;  2UWX A;  2XR0 A;  2Y2K A;  3CJM A;  1KGE A;  5CGS A;  1G6A A;  1RGY A;  4R3J A;  1FCO A;  3S4X A;  2J7V A;  3M6B A;  3TSG A;  5FAS A;  4P87 A;  1PW1 A;  3HUO A;  5EVI C;  2ZC3 B;  4OOM A;  4QU3 A;  4MNR A;  4BL3 A;  4D2O A;  1MY8 A;  1CEG A;  1EI5 A;  4X69 A;  3JYI A;  2ZC7 A;  4R4S A;  5HW3 A;  4FH2 A;  5CEB A;  2WGI A;  2XH9 A;  3B3X A;  3IXD A;  1H5X A;  1E4D A;  3V5M A;  4EV4 A;  3LCE A;  3BYD A;  2Y4A A;  4XXR A;  2WGW A;  1TEM A;  4XUZ A;  4ZTK A;  5GHZ A;  4DE1 A;  3IH9 A;  5FQI A;  2V2F F;  4K0X A;  2A49 A;  1CI8 A;  4UA6 A;  4OPY A;  4OQI A;  1DY6 A;  2OLV A;  3Q7Z A;  5FQK A;  4BQM A;  3NCK A;  1YLT A;  5AQA A;  5GHY A;  2HDQ A;  4KZA A;  1NZU A;  4JXG A;  2WGV A;  2XGN A;  1S0W A;  4LEN A;  1KGF A;  3PBS A;  2Y2Q A;  1BTL A;  3SH8 A;  1MBL A;  2ZLY A;  3G2Z A;  1O7E A;  5DVA A;  1BZA A;  3I7J A;  4BLM A;  3SS3 A;  1E3U D;  3TG9 A;  4R1G A;  2QZ6 A;  1N9B A;  4KZ5 A;  3FV7 A;  1K6S A;  5FDH A;  4R4R A;  4JLF A;  3LY4 A;  2WUQ A;  1ONG A;  1VM1 A;  2XQZ A;  1JVJ A;  3ZNT A;  3GQZ A;  2DCF A;  3IT9 A;  4WEJ A;  5CTN A;  4E3L A;  2ZC6 B;  4OH0 A;  3SS4 A;  3ZHH A;  1K54 C;  3AGF A;  1YT4 A;  3HRE A;  3A3J A;  5IHV A;  1I5Q A;  1O07 A;  4DKI A;  3HLW A;  5CHM A;  5G18 A;  5EOE A;  3Q1F A;  5EVL A;  4JXW A;  1YLW A;  2B5R A;  1K56 D;  1JTG A;  4ZDX A;  5HAP A;  1PZO A;  3IWO A;  2Y2M A;  5E2E A;  3NIA A;  1PI4 A;  5EPH A;  5DTK A;  2ZM2 A;  4K0W A;  2ZQ9 A;  4KG5 A;  3BFD A;  3QNB A;  3RXX A;  3IF6 B;  3O88 A;  4GB7 A;  4M3K A;  3V3S A;  3MZF A;  3VP1 A;  4S2J A;  3E2K A;  4PM8 A;  2ZC4 B;  4IVK A;  5HX9 A;  1Z6F A;  4OOL A;  4RYE A;  5FI2 A;  1ZKJ A;  1YLY A;  4XUX A;  3OPR A;  4S2N C;  2OV5 A;  3CG5 A;  3OPP A;  2X71 A;  3G34 A;  3M2K A;  1QME A;  2Y2L A;  3DWZ A;  4C75 A;  5CHJ A;  3BFC A;  4WZ5 C;  3NC8 A;  1LI0 A;  1MWS A;  4GDN A;  2XFS A;  1JTD A;  3WWX A;  2EX6 A;  4X56 A;  1JWP A;  2X02 A;  1ES4 A;  5F1G A;  2EXA A;  3Q7V A;  3LO7 A;  5EE8 A;  4DXB A;  3NI9 A;  5FI7 A;  4EQI A;  4Y0U A;  4WEK A;  2CC1 A;  4QJG A;  5KSC A;  1IEM A;  4WEL A;  3UDX A;  1XKZ A;  3UPP A;  3VP0 A;  4BL2 A;  1K38 A;  2Y2J A;  4UA9 A;  2ZC5 B;  4EWF A;  1L0D A;  1XX2 A;  2R9X A;  3OCN A;  3N8R A;  1J9M A;  3E2L A;  1FQG A;  2G2U A;  3BFF A;  3Q7V B;  5HAR A;  1I2W A;  2FFY A;  3OPL A;  5J8X A;  3ZGA B;  1YMX A;  2IWD A;  2VGJ A;  3D4F A;  1K4F A;  1OME A;  1PYY A;  1XGJ A;  3M2J A;  4R23 A;  3ZFZ A;  4Y0O A;  3C7U A;  3G35 A;  1H8Z A;  3HVF A;  5CGW A;  5EOO A;  3MZD A;  5HAI A;  4DE2 A;  4OLG A;  4E3N A;  1DJC A;  4GN2 A;  5U47 A;  4BD1 A;  1ES2 A;  2HDS A;  5GL9 A;  3VP2 A;  2WK0 A;  3W4O A;  3A3D A;  5DTS A;  4S2L A;  3OC2 A;  5EEC A;  4GD6 A;  3MFD A;  5L2F A;  2XD1 A;  1IYS A;  3DW0 A;  3LEZ A;  5FAT A;  4B4Z A;  1BT5 A;  4GZB A;  2VGK A;  1S6R A;  2XEP A;  3RXW A;  1BUL A;  2E8I A;  2HPB A;  3PAE A;  2QMI A;  2IWB A;  4ZJ3 A;  1FSY A;  4K91 A;  4S2P A;  5AQ9 A;  1TDL A;  3HUN A;  1LL5 A;  4NK3 A;  1KE0 A;  4WYY A;  4PM6 A;  1JWV A;  2J9P A;  3DWK A;  4PM5 A;  4KZ8 A;  2V20 A;  1IYP A;  4X53 A;  3UE3 A;  1M6K A;  2GDN A;  3UY6 A;  1XA1 A;  4IBX A;  4U3T A;  1BLP A;  1PZP A;  4N9L A;  5GHX A;  3UN7 A;  1NXY A;  5F1F A;  4JBF A;  4E6X A;  4LCM A;  4P0M A;  2H10 A;  3N6I A;  2WZZ A;  3ZVT A;  1FCN A;  5HAQ A;  2WZX A;  2Q9M A;  3IXH A;  4KG2 A;  1DJB A;  5FQQ A;  4ZBE A;  3HLB A;  4Q8I A;  4RVA A;  1SKF A;  1G68 A;  3N8S A;  3TOI A;  4DF6 A;  1XP4 A;  3V39 A;  3ISG A;  3N7W A;  3PBO A;  1KDW A;  3HLG A;  4PPR A;  4DE0 A;  4KZ4 A;  1ONH A;  3WS1 A;  3GMW A;  2X01 A; 
#chains in the Genus database with same CATH topology
 3BY8 A;  2Q9N A;  4UEY A;  2W3E A;  2ZQD A;  2EX9 A;  3Q82 A;  3VFH A;  4WN5 A;  3RJU A;  3UE0 A;  1WYC A;  3L7H A;  4QPR A;  4GJ4 A;  1PIO A;  4RA7 A;  3K2N A;  4HY8 A;  1L3L A;  1K4E A;  2P7J A;  4OP8 A;  1TF1 A;  3WRT A;  2HP5 A;  4X6T A;  1ES5 A;  1OTB A;  3A3F A;  4EBN A;  3L9K A;  1S4S A;  4HH3 A;  3E4Q A;  2H28 A;  2WKQ A;  1VQQ A;  5A92 A;  1I2S A;  2W3F A;  4S2K A;  1GA9 A;  4JGO A;  1PWC A;  3RH8 B;  4S2I A;  5F82 A;  4WBG A;  2EXB A;  3V67 A;  3O3V A;  5TR7 A;  4DDS A;  3H9W A;  1YMS A;  4DJ3 A;  5GLA A;  1VET B;  4PMA A;  3ZG5 A;  3ITA A;  3CI6 A;  2FZ0 A;  4Z9Q A;  4IJG A;  1IYQ A;  3MKF A;  3QHY A;  3NBL A;  3FWL A;  4E3I A;  3F1O A;  2ZD8 A;  5DF9 A;  3D3O A;  4WZ4 A;  3HUM A;  4MDZ A;  2JKF A;  5KZH A;  1BSG A;  1KVL A;  5EM1 A;  3WS2 A;  1OT6 A;  5FSR A;  3NDE A;  5GLC A;  2V8C A;  3NY4 A;  1FSW A;  2V1A A;  4E04 A;  1RCJ A;  5I94 A;  4N1H A;  4OPZ A;  3VMA A;  3HJK A;  5HL1 A;  1FIK A;  1SDN A;  1ERQ A;  4E3O A;  3ICY A;  4Y0T A;  1Y28 A;  1YLJ A;  3QNC A;  3BEB A;  3NEC A;  2HDU A;  3E98 A;  1EWZ A;  5JYO A;  1XJ4 A;  4JGQ A;  2O99 A;  1Y54 A;  5EUA A;  2PBY A;  4HH2 A;  3IWQ A;  3S1Y A;  1K57 C;  4NKP A;  3EQU A;  3CPT B;  3O86 A;  4WM9 A;  1Q2Q A;  3MQQ A;  2M1C A;  2OAQ 1;  3GRJ A;  3WS4 A;  1KGG A;  3PYP A;  5E2G A;  4GHI A;  3IF5 A;  2WKI A;  2XLN A;  2DRW A;  4Y2F A;  4FTX A;  5HWW A;  4KZ9 A;  4WMC D;  4LV3 A;  1CI9 A;  4JPM A;  3T1Q B;  3Q07 A;  4Q0I A;  4ZJ2 A;  4ZJ1 A;  5AQ7 A;  4OQ0 A;  2H0Y A;  4HOI A;  4X1M A;  5I5L A;  4EET B;  2HGV A;  4UHU A;  1BLC A;  1VET A;  4OPQ A;  4K08 A;  2ZM8 A;  1IKG A;  4R70 A;  1YSP A;  3JPU A;  5JYP A;  1L0F A;  2KDK A;  3T4O A;  4BD0 A;  2GJ3 A;  4BBV A;  3GTC A;  4OQH A;  1NYY A;  3FPV A;  1CK3 A;  3C4O A;  1NZO A;  3S7P A;  1VHM A;  1YLP A;  4JF4 A;  4KEN B;  5HWV A;  2G7U A;  3GVB A;  4DDY A;  3MXR A;  3W8K A;  2XRO A;  2XF3 A;  2V1B A;  5EVI D;  1W7F A;  5KMW A;  3VOL A;  1PWG A;  5AQB A;  1E3U A;  3RFB A;  4LRZ E;  4G3K A;  1MKM A;  1OPX A;  1ERM A;  2VLG A;  2EFU A;  2FFF B;  1TD5 A;  3LGO A;  4N1X A;  5D3O A;  4OLD A;  1PI5 A;  2VV8 A;  1NYM A;  3UME A;  4PM7 A;  1FIL A;  2WYX A;  1K56 A;  3UB5 P;  2UWX A;  1KGE A;  3QP4 A;  4BBU A;  3BQ8 A;  3TSG A;  4P87 A;  1PW1 A;  2HF6 A;  1CEG A;  3BQA A;  1T1B A;  5HW3 A;  5HDS A;  5J3W A;  4FH2 A;  1E4D A;  1H5X A;  4XXR A;  1V9Z A;  3F1P B;  3IH9 A;  2A49 A;  4UA6 A;  1CQA A;  2PR6 A;  4UQI M;  1DY6 A;  5IS1 A;  1TS0 A;  2WGV A;  3HJI A;  3SH8 A;  2Y2Q A;  2AVX A;  2J3W A;  3KYQ A;  2KX6 A;  1IFQ A;  1S1Z A;  2JN7 A;  4NG2 A;  4R4R A;  3LY4 A;  4GLQ A;  3R4K A;  3O5Y A;  3SS4 A;  3MF0 A;  4L9E A;  4CLC C;  4DKI A;  1O07 A;  5CHM A;  4G3V A;  3Q1F A;  4JXW A;  3H7W B;  1OTE A;  1JTG A;  1JNU A;  2V0U A;  3NOT C;  5DTK A;  4K0W A;  2ZQ9 A;  1TS7 A;  3T1R A;  5MC7 A;  2W1T B;  3PXP A;  3CIT A;  3IF6 B;  4S2J A;  2ZC4 B;  1UWN X;  3LUQ A;  4XUX A;  3MQO A;  3G34 A;  3M2K A;  5CHJ A;  3BFC A;  3E4P A;  2L4R A;  3LR3 A;  2EXA A;  5L8M A;  4DXB A;  3NI9 A;  1UWP X;  4WEK A;  2ZBB A;  4BL2 A;  5AVF A;  1OJG A;  2ACG A;  2R9X A;  3OCN A;  4KUO A;  3B47 A;  1FQG A;  2W1R A;  4MMN A;  1TS6 A;  2FFY A;  4YWZ A;  3UMD A;  1XGJ A;  2V9A A;  4R23 A;  1H8Z A;  5G4Z A;  3HVF A;  5CGW A;  4I5S A;  4BD1 A;  4I3J A;  4MCW A;  3A3D A;  5J7E A;  3GDI A;  1G28 A;  4EXO A;  2DMW A;  3MFD A;  2XD1 A;  3DW0 A;  1D06 A;  3LEZ A;  5FAT A;  3F1P A;  4ETX A;  2VGK A;  1S6R A;  3B33 A;  3EGX C;  1N9L A;  3DBA A;  4S2P A;  1TDL A;  3HUN A;  1KE0 A;  3CHW P;  3C38 A;  2V20 A;  4KQD A;  3UY6 A;  4UQI S;  1BYW A;  4N9L A;  5F1F A;  4ETZ A;  4E6X A;  4LCM A;  2H10 A;  2WZZ A;  3ZVT A;  1FCN A;  2MJ6 A;  4KG2 A;  3C8C A;  1SKF A;  3TOI A;  4PKY A;  2JKT I;  3WS1 A;  2X01 A;  1XXM A;  5A93 A;  5F83 A;  1SDE A;  2ZQA A;  1F2K A;  3H7W A;  5DF7 A;  3BM6 A;  3ZG9 B;  4O8G A;  3UE6 A;  4HI4 A;  3A0V A;  3HLF A;  4Q0J A;  1MWR A;  1W79 A;  3G6O A;  3IF6 A;  3OPH A;  1RP5 A;  1FCM A;  1P9R A;  4OP5 A;  1ZG4 A;  1FOF A;  1PNE A;  3FPW A;  3MS6 A;  3A3I A;  3ZVW A;  3A3E A;  3C4P A;  2D02 A;  1SCW A;  2QJ5 A;  5HL6 A;  3SOI A;  3BLS A;  1MXO A;  2P9V A;  2V1Z A;  1LL8 A;  4EEU A;  4NXG A;  4EQ1 A;  2EX8 A;  1XGI A;  5FAO A;  3VP3 A;  2JKR I;  3G31 A;  1L0E A;  1OTA A;  1FR1 A;  4E3J A;  1ES3 A;  5TFQ A;  2H0T A;  1IEL A;  4BMW A;  2JBF A;  3PTE A;  3SZT A;  2VGL M;  4ZAM A;  4HBT A;  2A3U A;  2VKS A;  2PD8 A;  4WMC A;  4L9F A;  2WKE A;  5M18 A;  4JF5 A;  4PM9 A;  1XPB A;  1ZHH B;  2OSU A;  3F1O B;  1IYO A;  3UB6 A;  3FKW A;  3QP2 A;  3VOZ A;  4HEF A;  3IBR A;  1JWZ A;  4RQ9 A;  1N4O A;  2EX2 A;  3W4P A;  5FEG A;  3IWI A;  4P6Z M;  1ESI A;  4OKP A;  1SKO A;  4U0T A;  4H8R A;  1BLH A;  3BW6 A;  3AGD A;  5M19 A;  1RGZ A;  3T1S A;  4KQO A;  3ZG7 B;  4QHC A;  5FQ9 A;  5IT5 A;  1YSQ A;  3CUE A;  4IBR A;  4A5R A;  2HDR A;  3IS2 A;  2RL3 A;  3C5A A;  5HPI A;  2W27 A;  3ZG0 A;  3UDF A;  2PYP A;  2I9V A;  2BLS A;  1HVB A;  4KZB A;  5EFW A;  1GHI A;  5EVI A;  1T19 A;  4KZ7 A;  2HV1 A;  1K55 C;  2KLI A;  3QP1 A;  1YM1 A;  2GZA A;  3EEA A;  4EW7 A;  2L1M A;  1BLS A;  5CHU A;  2INW A;  4EBL A;  1SZV A;  1BUE A;  4GHI B;  4OON A;  4BBT A;  1W63 M;  3CMZ A;  4JKT A;  5A90 A;  4EUZ A;  1ZTU A;  2P74 A;  5EVE A;  3IH8 A;  3LR4 A;  1L2S A;  1Q2P A;  2PU4 A;  1TS8 A;  3IBJ A;  1H8Y A;  3PAG A;  2PAV P;  3DTE A;  4WLA A;  2Y2H A;  3VV4 A;  3CZD A;  1ERO A;  4HQA A;  5CGX A;  4CPK A;  4RX2 A;  1LI9 A;  1AXB A;  2Y2I A;  1K54 A;  4JGR A;  3N4I A;  4NXF A;  3HBR A;  3QP8 A;  2ZL1 B;  4B4X A;  1S4R A;  2VGL S;  1ZG6 A;  3PBN A;  4FD8 A;  2L0W A;  3P01 A;  3HLC A;  3SS5 A;  2PBD P;  2OLU A;  1K25 A;  2JKT M;  4Q0H A;  4S2N A;  4MEZ A;  2BTF P;  5HSQ A;  2RCX A;  3LY3 A;  4LRY C;  4P6Z S;  2C6W B;  4WZ5 A;  5HFO A;  4FUW A;  4KG6 A;  4EUV A;  1ALQ A;  4MBK A;  2BG1 A;  2B02 A;  2Y2K A;  5CGS A;  1NLZ A;  4IUH A;  4R6L A;  1G6A A;  5F5Y A;  3S4X A;  3M6B A;  1NWZ A;  1H0M A;  4MNR A;  4D2O A;  3T1X A;  1EI5 A;  3LIB A;  4X69 A;  1OJ5 A;  4EER A;  2ZC7 A;  3IXD A;  3B3X A;  4CLC D;  4DJ2 A;  4ZTK A;  3IX8 A;  1MC0 A;  4OQI A;  2OLV A;  1LT0 A;  5DFX A;  1YLT A;  1XFN A;  2JKR M;  3PBS A;  1MBL A;  1LSW A;  1O7E A;  2A2L A;  3SS3 A;  1H8M A;  2QZ6 A;  1N9B A;  3FV7 A;  5FDH A;  3T4Q A;  1ODV A;  1XJ2 A;  1OT9 A;  1ONG A;  3ZNT A;  3GQZ A;  2DCF A;  4WEJ A;  5CTN A;  4E3L A;  4OH0 A;  3T4J A;  1YT4 A;  5IHV A;  1I5Q A;  3HLW A;  4KUK A;  5CX7 A;  4I3I A;  3IWO A;  3NIA A;  5EPH A;  1DP8 A;  4KG5 A;  3BFD A;  4GB7 A;  3V3S A;  3VP1 A;  3E2K A;  2QYB A;  2ZL1 A;  5HX9 A;  1H3Q A;  1S1Y A;  3KSI A;  1ZKJ A;  2OV5 A;  1K0K A;  2VK3 A;  1YPR A;  1QME A;  1W63 Q;  3DWZ A;  5DJT A;  3QP5 A;  5EV0 A;  3WWX A;  2OWJ A;  2EX6 A;  3T4T A;  2X02 A;  5F1G A;  1ES4 A;  1DP6 A;  3Q7V A;  3OLO A;  4GW9 A;  3LO7 A;  4EES A;  1IEM A;  1K38 A;  1L0D A;  3N8R A;  3LI8 A;  3BFF A;  5HAR A;  1I2W A;  3ZGA B;  1YMX A;  2VGJ A;  3D4F A;  3QP6 A;  1OME A;  1PYY A;  4GCZ A;  3ZFZ A;  4Y0O A;  3G35 A;  5EOO A;  5HAI A;  1DJC A;  3H82 B;  3LFV A;  3ZQ5 A;  3BY9 A;  4MN7 A;  4I39 A;  3LIE A;  2K31 A;  4FOF A;  3VE3 A;  4GD6 A;  5L2F A;  1IYS A;  4Y3I A;  5EM0 A;  1P9W A;  4B4Z A;  1BT5 A;  4GZB A;  2E8I A;  4EEP A;  3LIA A;  4K91 A;  4HP4 A;  4R38 A;  4NK3 A;  4WYY A;  3DWK A;  4X53 A;  1IYP A;  3KO6 A;  5J4E A;  2EWW A;  2GDN A;  1XA1 A;  4IBX A;  2XSS A;  2B18 A;  2WZX A;  3IXH A;  3CWF A;  1DJB A;  5FL3 A;  3N8S A;  3HCY A;  2VV7 A;  1ONH A;  5KSH A;  3TG9 A;  4UA7 A;  3RTY A;  4II7 A;  4FCF A;  2IA2 A;  1MWT A;  3TW8 A;  3GR2 A;  1MPL A;  2D01 A;  3LR5 A;  1KDS A;  3UE1 A;  3FZC A;  2PR5 A;  3G4P A;  2JC7 A;  3FC7 A;  3BWL A;  3KYE A;  5GLB A;  3ZNY A;  4WUJ A;  3IX3 A;  3S7Q A;  1E25 A;  2DNS A;  1U60 A;  4EBP A;  5HZH A;  2WAF A;  1K57 A;  3N8L A;  1V9Y A;  2CMN A;  3TRC A;  4HP9 A;  1WYB A;  2Y55 A;  2Y59 A;  5E2F A;  2VZW A;  4OVD A;  4ME4 A;  3PBR A;  4UAA A;  4OPR A;  4P85 A;  5GLD A;  1W8Y A;  5FEF A;  2P9V B;  5C5K A;  4GNU A;  4F94 A;  5A91 A;  2OWH A;  3DTI A;  4U0X A;  4DMZ A;  2VX8 A;  3VSL A;  4PAU A;  3BRM A;  1GHP A;  3H82 A;  4QY5 A;  3NOP C;  2WKH A;  3OCL A;  4CLC B;  5CED A;  5M1A A;  2Q0O A;  3IX4 A;  2XD5 A;  2Y2N A;  4DN0 A;  4B88 A;  3T4L A;  3Q81 A;  1YLZ A;  2ZQC A;  3F1N A;  1GCE A;  3DAV A;  5G4Y A;  5E2H A;  2EA9 A;  3MQ0 A;  4F3L B;  3G2Y A;  3T4S A;  2JCH A;  4LCL A;  1KVM A;  4RX3 A;  2JE5 A;  1UGU A;  1MKI A;  4CJN A;  2WAD A;  1ACF A;  5TBM B;  4HJ3 A;  2Y79 A;  4YIN A;  1SKO B;  1LHY A;  5F69 A;  3WS5 A;  2OOL A;  3LIC A;  5KIZ A;  2NUP C;  4QD4 A;  3BFG A;  1CEF A;  4IVI A;  5FQM A;  3OZH A;  3ITB A;  2WAE A;  1N9O A;  5FAQ A;  4IUK A;  1XA7 A;  1FR6 A;  3UPN A;  5FDS A;  3IS2 B;  4XT2 A;  1GSV A;  5LBR A;  4P6B A;  2Y2G A;  2E8J A;  4DRT A;  3SH9 A;  3V3R A;  4MN6 A;  3MR0 A;  3G32 A;  5EVI B;  2J9O A;  4CLC E;  4Y7P A;  3TE8 A;  2XK1 A;  4S2O A;  5CRF A;  5CER A;  1HTZ A;  1K6R A;  3IHA A;  3O87 A;  4I3A A;  4OOY A;  5L10 A;  3MZE A;  3LR0 A;  4D60 A;  3UNW A;  4L9G A;  4E6W A;  3MXS A;  4O7D A;  3EEH A;  4G3W A;  1HD8 A;  1C3B A;  4NXE A;  2ZM0 A;  5BOH A;  4CLC A;  4ESP A;  4KQR A;  3GEC A;  4HIA A;  2PU2 A;  3BEC A;  4HJ4 A;  4LPZ A;  5DF8 A;  2QPN A;  4OQG A;  2JHE A;  1GA0 A;  3HL9 A;  1ZC2 A;  3D72 A;  4Y13 A;  2P04 A;  4C6Y A;  3JVV A;  2G2W A;  1TDG A;  4F3L A;  1W8Q A;  1G5U A;  2XDM A;  4N9K A;  4R3B A;  1F9I A;  4HHD A;  3ZG8 B;  3IHB A;  4NXB A;  4L0L A;  5TBM A;  2JKG A;  3DTK A;  5HDD A;  4MLL A;  3IXG A;  2ZMV A;  2XR0 A;  3CJM A;  2OAP 1;  1RGY A;  4R3J A;  1FCO A;  4CQH A;  2J7V A;  5FAS A;  4YNR A;  1AWI A;  3HUO A;  2ZC3 B;  4OOM A;  4QU3 A;  2GNX A;  4R4S A;  3KSH A;  5HD3 A;  2WGI A;  2R78 A;  4EV4 A;  3LCE A;  4Y15 A;  3BYD A;  2Y4A A;  3NHQ A;  1P97 A;  5FQI A;  2PDR A;  1CI8 A;  4OPY A;  1NLY A;  3NJA A;  1HLU P;  5FQK A;  3W2Z A;  4BQM A;  2ZMF A;  3NCK A;  5AQA A;  2HDQ A;  4KZA A;  3LEQ A;  2XGN A;  2P08 A;  3PHY A;  3KYZ A;  2ZLY A;  5L09 A;  4ARZ A;  1LSV A;  1BZA A;  3TJZ C;  1T1C A;  2YKH A;  4JLF A;  2WUQ A;  3MJQ A;  1VM1 A;  3UB9 A;  2XQZ A;  4PHT A;  4O01 A;  2ZC6 B;  3ULF A;  3ZHH A;  5TJJ A;  3AGF A;  1XJ3 A;  3A3J A;  1YKD A;  5EOE A;  3U4L P;  1YLW A;  1DP9 A;  2B5R A;  4ZDX A;  1PZO A;  2Y2M A;  5E2E A;  3QNB A;  3MSH A;  3O88 A;  2Z6C A;  3MZF A;  3OOV A;  2PRF A;  4PM8 A;  1Z6F A;  4OOL A;  5FI2 A;  3A0R A;  3CG5 A;  3OPP A;  2X71 A;  2Y2L A;  4C75 A;  4LFU A;  1MWS A;  1PRQ A;  2XFS A;  4X56 A;  1VB6 A;  3LID A;  5EE8 A;  5FI7 A;  1Y4O A;  4QJG A;  2CC1 A;  4WEL A;  2J3T C;  2Y2J A;  4UA9 A;  2YKF A;  1J9M A;  3E2L A;  5AJG A;  2G2U A;  3Q7V B;  4R3A A;  1A0K A;  2BAS A;  4JGP A;  3OPL A;  5J8X A;  1K4F A;  2WKP A;  3KSF A;  4O0P A;  2PD7 A;  2HDS A;  5GL9 A;  3VP2 A;  2WK0 A;  5DTS A;  3OC2 A;  3T4K A;  2K2N A;  4PKY G;  2XEP A;  3CAX A;  1BUL A;  2HPB A;  2QMI A;  2VA0 A;  1OTD A;  4MN5 A;  2J9P A;  3S7O A;  3UE3 A;  2ZOH A;  2LB5 A;  2O9B A;  1BLP A;  1PZP A;  3UN7 A;  1NXY A;  4JBF A;  4P0M A;  3N6I A;  5HWT A;  2Q9M A;  3EWK A;  5K5B A;  5FQQ A;  4Q8I A;  3HLB A;  4RVA A;  1G68 A;  2NUT C;  1T18 A;  3V39 A;  1G6O A;  3PBO A;  1KDW A;  4PPR A;  4NEE D;  4Y5F A;  3GMW A;  5F68 A;  1L0G A;  4QB8 A;  3EQV A;  1NJ4 A;  2XA7 M;  2HP6 A;  1XJ6 A;  2B95 A;  3T12 B;  4GD8 A;  4MBF A;  3SW1 A;  4IHQ A;  1NRJ A;  3P09 A;  3B42 A;  3IXB A;  5FQJ A;  4AFI A;  4HJ6 A;  1WE4 A;  2O0Y A;  2XRN A;  2FH5 A;  4LLO B;  4LRX C;  1PWD A;  3WRZ A;  3MKE A;  2VJW A;  1GHM A;  5FAP A;  1K55 A;  2LB9 A;  1YQS A;  5CEC A;  2QKP A;  3VFF A;  3VOY A;  3PBQ A;  3PBT A;  4MBH A;  5IU1 A;  4KZ6 A;  5CTM A;  1Z09 A;  3ZYT A;  2ZQ8 A;  2Z6D A;  2IWC A;  4NET A;  2UV0 E;  1VEU B;  2EFX A;  4BJP A;  4HNB A;  3DTM A;  4LV0 A;  4JXS A;  2GX5 A;  3MFX A;  1SHV A;  2W3H A;  3E0Y A;  1DRM A;  1M40 A;  3P7N A;  2O9C A;  4E3K A;  4C3Q A;  4ID4 A;  3C7V A;  5HPF A;  3KSG A;  2ZJ9 A;  3LI9 A;  2XFT A;  5AVE A;  1NRF A;  1XFQ A;  1IKI A;  4X25 A;  1W5D A;  2Z2M B;  4HES A;  4KQQ A;  3VP4 A;  4DXC A;  5E43 A;  3T50 A;  2Y2P A;  3D9Y A;  4BEN A;  5FI6 A;  1S67 L;  1T1A A;  1S66 L;  4GDB A;  1J3W A;  3CLO A;  3IQA A;  3AGE A;  4R0Q A;  2C5W B;  2I72 A;  3F1N B;  4LV2 A;  2H5S A;  4X68 A;  1LLB A;  2HZ5 A;  1IOU A;  3LYX A;  5FA7 A;  4M4X A;  4HBU A;  3CPT A;  3UDI A;  1X0O A;  3IF6 C;  1TVF A;  3W4Q A;  3LIF A;  4YOF A;  2XA7 S;  4E3M A;  3P98 A;  4GS9 B;  3M6H A;  4JF6 A;  2W0N A;  3FYZ A;  2J8Y A;  2WGW B;  4LV1 A;  3FKV A;  3VSK A;  4LGW A;  3ZCZ A;  1HZO A;  2VEA A;  2PYR A;  2Z2L B;  3UPO A;  1PW8 A;  3SH7 A;  4XT2 B;  1ESU A;  1MWU A;  3UB8 A;  4H6J B;  3EOI A;  5TGF A;  2HJE A;  4YFM A;  4I38 A;  5F6A A;  4FH4 A;  4IED A;  4KZ3 A;  1KE4 A;  5DJU A;  4GOG A;  3BFE A;  3MBZ A;  3JVU A;  3K3D A;  4X55 A;  3S22 A;  5DTT A;  3V50 A;  4QY6 A;  1VEU A;  4FSF A;  4S2M A;  4GKU A;  3K3C A;  2HP9 A;  2QHK A;  1LL9 A;  1F98 A;  4QWO A;  3UO9 A;  5A8B A;  3WS0 A;  2Y2O A;  4DE3 A;  3GV9 A;  2QWS A;  2EWV A;  4JXV A;  1GSX A;  1KOU A;  3G30 A;  3HLE A;  5CXW A;  2K7S A;  1QMF A;  4N92 A;  1DJA A;  5DKL A;  4EU0 A;  3GSG A;  1NY0 A;  3ZDJ A;  3NDG A;  5HD5 A;  2Y91 A;  3BJN A;  3VE4 A;  2ZMA A;  2ZOI A;  2R9W A;  2ZQ7 A;  3HLD A;  1KE3 A;  3BLM A;  3CUE C;  2W3G A;  5EVI C;  4GS9 A;  1MZU A;  4BL3 A;  1MY8 A;  3JYI A;  1D1J A;  5CEB A;  2XH9 A;  3V5M A;  5HDC A;  2W3D A;  2WGW A;  1TEM A;  4XUZ A;  5GHZ A;  3U2A A;  4DE1 A;  3R7W B;  2V2F F;  4K0X A;  3NOU C;  2A24 B;  3Q7Z A;  5GHY A;  3NUL A;  1CF0 A;  1NZU A;  4JXG A;  1S0W A;  2V8F A;  1KGF A;  4LEN A;  1BTL A;  3G2Z A;  1N9N A;  4H6J A;  3A0S A;  2PHY A;  5DVA A;  3I7J A;  4BLM A;  1E3U D;  3OBF A;  4R1G A;  3C30 A;  2J80 A;  3S7N A;  4KZ5 A;  1K6S A;  1JVJ A;  3IT9 A;  4ARZ B;  1K54 C;  2W1T A;  3HRE A;  4Y17 A;  2V0W A;  5G18 A;  5EVL A;  1K56 D;  5HAP A;  1LSX A;  2J3T D;  1PI4 A;  2ZM2 A;  3RXX A;  4B9O A;  4M3K A;  3PR6 A;  4WF0 A;  4IVK A;  4RYE A;  2VV6 A;  2O9A A;  1YLY A;  1D7E A;  3OPR A;  4S2N C;  1CJF A;  3C2W A;  3E4O A;  2PT7 A;  1PFL A;  4WZ5 C;  3NC8 A;  1LI0 A;  1P0Z A;  4GDN A;  1JTD A;  4ZRR A;  4X1L A;  1JWP A;  4Z1W A;  1YAX A;  4EQI A;  4Y0U A;  5KSC A;  3UDX A;  1XKZ A;  3UPP A;  3VP0 A;  2ZC5 B;  4EWF A;  1XX2 A;  5DFY A;  4BWI A;  2IWD A;  3KX0 X;  3M2J A;  3C7U A;  1EW0 A;  1OTI A;  3FG8 A;  3MZD A;  4DE2 A;  4E3N A;  4OLG A;  2Y8H A;  4GN2 A;  5U47 A;  4WL9 A;  1ES2 A;  3MMH A;  3W4O A;  5L07 A;  2QJ7 A;  4S2L A;  5EEC A;  2WKR A;  3R7W A;  3RXW A;  2IWB A;  3PAE A;  4ZJ3 A;  1FSY A;  2A24 A;  5AQ9 A;  1LL5 A;  4PM6 A;  1JWV A;  4PM5 A;  4KZ8 A;  1M6K A;  2HJ9 C;  2M7U A;  2KOI A;  4U3T A;  5GHX A;  1WA9 A;  5HAQ A;  3EGD C;  3UB7 A;  3MXQ A;  2M7V A;  4ZBE A;  4DF6 A;  1STZ A;  1XP4 A;  4B93 A;  3ISG A;  3N7W A;  5DKK A;  1F5M A;  3HLG A;  4DE0 A;  4KZ4 A;  1GSW A; 
#chains in the Genus database with same CATH homology
 1L0G A;  1XXM A;  5A93 A;  4QB8 A;  2Q9N A;  3EQV A;  1SDE A;  1NJ4 A;  4UA7 A;  5F83 A;  4FCF A;  2ZQA A;  1MWT A;  2HP6 A;  2ZQD A;  3GR2 A;  1MPL A;  5DF7 A;  3BM6 A;  2EX9 A;  3ZG9 B;  3Q82 A;  3VFH A;  1KDS A;  3UE1 A;  4GD8 A;  3FZC A;  4MBF A;  3G4P A;  3HLF A;  2JC7 A;  1MWR A;  1W79 A;  3RJU A;  3P09 A;  1WYC A;  3UE0 A;  5GLB A;  3IF6 A;  3OPH A;  3ZNY A;  1RP5 A;  1FCM A;  1PIO A;  4RA7 A;  4OP5 A;  3IXB A;  1E25 A;  2DNS A;  1U60 A;  1ZG4 A;  1FOF A;  5FQJ A;  4EBP A;  1WE4 A;  1K57 A;  2WAF A;  3N8L A;  1K4E A;  3A3I A;  3ZVW A;  4OP8 A;  3WRT A;  3A3E A;  2HP5 A;  3C4P A;  4X6T A;  1ES5 A;  1SCW A;  3SOI A;  3A3F A;  4EBN A;  1WYB A;  2Y55 A;  2Y59 A;  1PWD A;  5E2F A;  3WRZ A;  3MKE A;  4OVD A;  1VQQ A;  3BLS A;  5A92 A;  1MXO A;  1GHM A;  2P9V A;  5FAP A;  1K55 A;  1I2S A;  1YQS A;  5CEC A;  3PBR A;  2V1Z A;  4S2K A;  1GA9 A;  4UAA A;  1PWC A;  4OPR A;  4S2I A;  4P85 A;  3VFF A;  5F82 A;  3PBQ A;  3PBT A;  4MBH A;  3VOY A;  4WBG A;  2EXB A;  2EX8 A;  3O3V A;  1XGI A;  5GLD A;  1W8Y A;  4KZ6 A;  5FAO A;  5TR7 A;  3VP3 A;  4DDS A;  2P9V B;  3G31 A;  1YMS A;  5CTM A;  5GLA A;  4GNU A;  4F94 A;  4PMA A;  3ZG5 A;  5A91 A;  2ZQ8 A;  1L0E A;  2IWC A;  3ITA A;  4NET A;  2EFX A;  4Z9Q A;  1FR1 A;  4BJP A;  3DTM A;  4LV0 A;  4U0X A;  4JXS A;  3VSL A;  3BRM A;  1GHP A;  1IYQ A;  4QY5 A;  4E3J A;  1SHV A;  3MKF A;  1ES3 A;  5TFQ A;  3QHY A;  2H0T A;  2WKH A;  3NBL A;  3OCL A;  1IEL A;  1M40 A;  5CED A;  2JBF A;  3FWL A;  5M1A A;  4E3I A;  2ZD8 A;  5DF9 A;  3PTE A;  4E3K A;  4C3Q A;  4WZ4 A;  2XD5 A;  4ZAM A;  2Y2N A;  4HBT A;  3HUM A;  4ID4 A;  2A3U A;  4B88 A;  3C7V A;  2ZJ9 A;  4WMC A;  2XFT A;  5KZH A;  3Q81 A;  2WKE A;  5M18 A;  4JF5 A;  1NRF A;  4PM9 A;  1BSG A;  1XPB A;  1KVL A;  1YLZ A;  1IKI A;  3WS2 A;  2OSU A;  1IYO A;  1W5D A;  3NDE A;  2Z2M B;  5FSR A;  5GLC A;  2ZQC A;  3FKW A;  1GCE A;  3NY4 A;  4HES A;  1FSW A;  4KQQ A;  5E2H A;  3VP4 A;  4DXC A;  3VOZ A;  4HEF A;  5E43 A;  1JWZ A;  3G2Y A;  1N4O A;  2Y2P A;  2EX2 A;  1RCJ A;  2JCH A;  1KVM A;  4LCL A;  4RX3 A;  3W4P A;  2JE5 A;  3IWI A;  4BEN A;  5FI6 A;  1ESI A;  4OKP A;  4U0T A;  1MKI A;  4CJN A;  4GDB A;  5I94 A;  4R0Q A;  3IQA A;  3AGE A;  4N1H A;  2C5W B;  2I72 A;  4H8R A;  2WAD A;  4OPZ A;  3VMA A;  1BLH A;  4LV2 A;  5HL1 A;  2H5S A;  1SDN A;  3AGD A;  1ERQ A;  5M19 A;  4X68 A;  1RGZ A;  4E3O A;  1LLB A;  4Y0T A;  4KQO A;  3ZG7 B;  4YIN A;  1YLJ A;  4QHC A;  5FA7 A;  1LHY A;  3QNC A;  3BEB A;  4HBU A;  3WS5 A;  2HDU A;  3UDI A;  1EWZ A;  5FQ9 A;  5JYO A;  5KSH A;  4QD4 A;  1Y54 A;  3IF6 C;  3BFG A;  1TVF A;  5EUA A;  3W4Q A;  2PBY A;  3IWQ A;  4IBR A;  3S1Y A;  4A5R A;  1CEF A;  2HDR A;  4IVI A;  2RL3 A;  3P98 A;  3C5A A;  5FQM A;  4E3M A;  1K57 C;  3ITB A;  2WAE A;  3OZH A;  3EQU A;  3M6H A;  3ZG0 A;  3UDF A;  4JF6 A;  5FAQ A;  3O86 A;  2BLS A;  1HVB A;  4WM9 A;  3FYZ A;  4KZB A;  1XA7 A;  1FR6 A;  1Q2Q A;  1GHI A;  5EVI A;  3UPN A;  4KZ7 A;  2J8Y A;  2WGW B;  3GRJ A;  3WS4 A;  1KGG A;  1K55 C;  3FKV A;  4LV1 A;  4P6B A;  2Y2G A;  5E2G A;  3IF5 A;  3VSK A;  1YM1 A;  4DRT A;  3SH9 A;  3V3R A;  3ZCZ A;  2WKI A;  2XLN A;  2DRW A;  1HZO A;  1BLS A;  4KZ9 A;  4WMC D;  3G32 A;  5CHU A;  5EVI B;  2J9O A;  2Z2L B;  4LV3 A;  3UPO A;  4Y7P A;  1PW8 A;  4EBL A;  3SH7 A;  1CI9 A;  2XK1 A;  4JPM A;  1ESU A;  3Q07 A;  1MWU A;  4ZJ2 A;  4ZJ1 A;  1BUE A;  5AQ7 A;  5TGF A;  4OON A;  4YFM A;  4OQ0 A;  4S2O A;  3CMZ A;  2H0Y A;  5CRF A;  4JKT A;  5CER A;  5A90 A;  1HTZ A;  4EUZ A;  4FH4 A;  2P74 A;  4IED A;  4KZ3 A;  1KE4 A;  1K6R A;  4GOG A;  3IHA A;  3BFE A;  3MBZ A;  3IH8 A;  4UHU A;  1BLC A;  1L2S A;  4OPQ A;  1Q2P A;  2ZM8 A;  3O87 A;  4OOY A;  2PU4 A;  4X55 A;  3S22 A;  1IKG A;  5DTT A;  3V50 A;  1H8Y A;  3PAG A;  4QY6 A;  3MZE A;  5JYP A;  1L0F A;  2Y2H A;  3CZD A;  4FSF A;  3UNW A;  1ERO A;  4E6W A;  4BD0 A;  3MXS A;  4O7D A;  4GKU A;  4S2M A;  5CGX A;  4CPK A;  2HP9 A;  4RX2 A;  1LI9 A;  1AXB A;  2Y2I A;  1K54 A;  1HD8 A;  1C3B A;  5BOH A;  2ZM0 A;  1LL9 A;  3GTC A;  4OQH A;  1NYY A;  3N4I A;  4KQR A;  2PU2 A;  1CK3 A;  3BEC A;  3C4O A;  1NZO A;  3UO9 A;  1YLP A;  3WS0 A;  2Y2O A;  3HBR A;  5DF8 A;  4DE3 A;  4JF4 A;  4KEN B;  3GV9 A;  2QPN A;  4OQG A;  4B4X A;  3GVB A;  1GA0 A;  4JXV A;  4DDY A;  3MXR A;  3HL9 A;  3W8K A;  1ZC2 A;  1ZG6 A;  2XF3 A;  3G30 A;  3HLE A;  3PBN A;  1W7F A;  4FD8 A;  5CXW A;  5EVI D;  4C6Y A;  5KMW A;  1QMF A;  1PWG A;  4N92 A;  1DJA A;  5AQB A;  2G2W A;  1TDG A;  3HLC A;  3SS5 A;  1E3U A;  1W8Q A;  2OLU A;  1K25 A;  3GSG A;  1NY0 A;  2XDM A;  4N9K A;  4R3B A;  1ERM A;  4S2N A;  2EFU A;  4MEZ A;  3ZDJ A;  2RCX A;  3NDG A;  3LY3 A;  3ZG8 B;  2FFF B;  3IHB A;  4N1X A;  2C6W B;  4WZ5 A;  2Y91 A;  4L0L A;  5D3O A;  5HFO A;  4OLD A;  1PI5 A;  4KG6 A;  2ZMA A;  1ALQ A;  2R9W A;  1NYM A;  4MBK A;  4PM7 A;  4MLL A;  2BG1 A;  2WYX A;  2ZQ7 A;  3IXG A;  1K56 A;  1KE3 A;  3BLM A;  3HLD A;  2UWX A;  2XR0 A;  2Y2K A;  3CJM A;  1KGE A;  5CGS A;  1G6A A;  1RGY A;  4R3J A;  1FCO A;  3S4X A;  2J7V A;  3M6B A;  3TSG A;  5FAS A;  4P87 A;  1PW1 A;  3HUO A;  5EVI C;  2ZC3 B;  4OOM A;  4QU3 A;  4MNR A;  4BL3 A;  4D2O A;  1MY8 A;  1CEG A;  1EI5 A;  4X69 A;  3JYI A;  2ZC7 A;  4R4S A;  5HW3 A;  4FH2 A;  5CEB A;  2WGI A;  2XH9 A;  3B3X A;  3IXD A;  1H5X A;  1E4D A;  3V5M A;  4EV4 A;  3LCE A;  3BYD A;  2Y4A A;  4XXR A;  2WGW A;  1TEM A;  4XUZ A;  4ZTK A;  5GHZ A;  4DE1 A;  3IH9 A;  5FQI A;  2V2F F;  4K0X A;  2A49 A;  1CI8 A;  4UA6 A;  4OPY A;  4OQI A;  1DY6 A;  2OLV A;  3Q7Z A;  5FQK A;  4BQM A;  3NCK A;  1YLT A;  5AQA A;  5GHY A;  2HDQ A;  4KZA A;  1NZU A;  4JXG A;  2WGV A;  2XGN A;  1S0W A;  4LEN A;  1KGF A;  3PBS A;  2Y2Q A;  1BTL A;  3SH8 A;  1MBL A;  2ZLY A;  3G2Z A;  1O7E A;  5DVA A;  1BZA A;  3I7J A;  4BLM A;  3SS3 A;  1E3U D;  3TG9 A;  4R1G A;  2QZ6 A;  1N9B A;  4KZ5 A;  3FV7 A;  1K6S A;  5FDH A;  4R4R A;  4JLF A;  3LY4 A;  2WUQ A;  1ONG A;  1VM1 A;  2XQZ A;  1JVJ A;  3ZNT A;  3GQZ A;  2DCF A;  3IT9 A;  4WEJ A;  5CTN A;  4E3L A;  2ZC6 B;  4OH0 A;  3SS4 A;  3ZHH A;  1K54 C;  3AGF A;  1YT4 A;  3HRE A;  3A3J A;  5IHV A;  1I5Q A;  1O07 A;  4DKI A;  3HLW A;  5CHM A;  5G18 A;  5EOE A;  3Q1F A;  5EVL A;  4JXW A;  1YLW A;  2B5R A;  1K56 D;  1JTG A;  4ZDX A;  5HAP A;  1PZO A;  3IWO A;  2Y2M A;  5E2E A;  3NIA A;  1PI4 A;  5EPH A;  5DTK A;  2ZM2 A;  4K0W A;  2ZQ9 A;  4KG5 A;  3BFD A;  3QNB A;  3RXX A;  3IF6 B;  3O88 A;  4GB7 A;  4M3K A;  3V3S A;  3MZF A;  3VP1 A;  4S2J A;  3E2K A;  4PM8 A;  2ZC4 B;  4IVK A;  5HX9 A;  1Z6F A;  4OOL A;  4RYE A;  5FI2 A;  1ZKJ A;  1YLY A;  4XUX A;  3OPR A;  4S2N C;  2OV5 A;  3CG5 A;  3OPP A;  2X71 A;  3G34 A;  3M2K A;  1QME A;  2Y2L A;  3DWZ A;  4C75 A;  5CHJ A;  3BFC A;  4WZ5 C;  3NC8 A;  1LI0 A;  1MWS A;  4GDN A;  2XFS A;  1JTD A;  3WWX A;  2EX6 A;  4X56 A;  1JWP A;  2X02 A;  1ES4 A;  5F1G A;  2EXA A;  3Q7V A;  3LO7 A;  5EE8 A;  4DXB A;  3NI9 A;  5FI7 A;  4EQI A;  4Y0U A;  4WEK A;  2CC1 A;  4QJG A;  5KSC A;  1IEM A;  4WEL A;  3UDX A;  1XKZ A;  3UPP A;  3VP0 A;  4BL2 A;  1K38 A;  2Y2J A;  4UA9 A;  2ZC5 B;  4EWF A;  1L0D A;  1XX2 A;  2R9X A;  3OCN A;  3N8R A;  1J9M A;  3E2L A;  1FQG A;  2G2U A;  3BFF A;  3Q7V B;  5HAR A;  1I2W A;  2FFY A;  3OPL A;  5J8X A;  3ZGA B;  1YMX A;  2IWD A;  2VGJ A;  3D4F A;  1K4F A;  1OME A;  1PYY A;  1XGJ A;  3M2J A;  4R23 A;  3ZFZ A;  4Y0O A;  3C7U A;  3G35 A;  1H8Z A;  3HVF A;  5CGW A;  5EOO A;  3MZD A;  5HAI A;  4DE2 A;  4OLG A;  4E3N A;  1DJC A;  4GN2 A;  5U47 A;  4BD1 A;  1ES2 A;  2HDS A;  5GL9 A;  3VP2 A;  2WK0 A;  3W4O A;  3A3D A;  5DTS A;  4S2L A;  3OC2 A;  5EEC A;  4GD6 A;  3MFD A;  5L2F A;  2XD1 A;  1IYS A;  3DW0 A;  3LEZ A;  5FAT A;  4B4Z A;  1BT5 A;  4GZB A;  2VGK A;  1S6R A;  2XEP A;  3RXW A;  1BUL A;  2E8I A;  2HPB A;  3PAE A;  2QMI A;  2IWB A;  4ZJ3 A;  1FSY A;  4K91 A;  4S2P A;  5AQ9 A;  1TDL A;  3HUN A;  1LL5 A;  4NK3 A;  1KE0 A;  4WYY A;  4PM6 A;  1JWV A;  2J9P A;  3DWK A;  4PM5 A;  4KZ8 A;  2V20 A;  1IYP A;  4X53 A;  3UE3 A;  1M6K A;  2GDN A;  3UY6 A;  1XA1 A;  4IBX A;  4U3T A;  1BLP A;  1PZP A;  4N9L A;  5GHX A;  3UN7 A;  1NXY A;  5F1F A;  4JBF A;  4E6X A;  4LCM A;  4P0M A;  2H10 A;  3N6I A;  2WZZ A;  3ZVT A;  1FCN A;  5HAQ A;  2WZX A;  2Q9M A;  3IXH A;  4KG2 A;  1DJB A;  5FQQ A;  4ZBE A;  3HLB A;  4Q8I A;  4RVA A;  1SKF A;  1G68 A;  3N8S A;  3TOI A;  4DF6 A;  1XP4 A;  3V39 A;  3ISG A;  3N7W A;  3PBO A;  1KDW A;  3HLG A;  4PPR A;  4DE0 A;  4KZ4 A;  1ONH A;  3WS1 A;  3GMW A;  2X01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...