3Q1FA

Ctx-m-9 s70g in complex with hydrolyzed piperacillin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CTX-M-9 S70G mutant in complex with hydrolyzed piperacillin
rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
total genus 96
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q1fA00
5AQBA 2Y59A 3VSLA 4QU3A 3N7WA 2ZD8A 1K55A 4JXSA 5DF8A 3IF6B 2G2UA 4K0WA 4EQIA 2Q9NA 3AGEA 3HUOA 3HVFA 3MKEA 1KVLA 3VOZA 1ZKJA 2DNSA 3DW0A 4GB7A 3IWOA 1ERQA 3EQUA 5CGSA 5CERA 1LHYA 4JXGA 5FAOA 2ZMAA 5TR7A 3GSGA 3E2KA 3ZNTA 2JC7A 1BTLA 3VP2A 3BEBA 2QMIA 4ID4A 2VGJA 4KG6A 3N8SA 3FYZA 5F83A 3TG9A 4XUXA 4OLDA 2HDUA 4HBUA 5F82A 5EOEA 1FCNA 4QB8A 4IEDA 1NYYA 4X6TA 1JTDA 2J7VA 1VM1A 3V5MA 1ESUA 2XF3A 3MXRA 2WGVA 4KG2A 1KE0A 2VGKA 4WZ5C 3BFEA 1EI5A 3FZCA 5EVID 5FI7A 4P85A 3SS4A 3Q7VB 1PWGA 2EX2A 4EWFA 3O3VA 3UNWA 4C75A 1PI4A 1W8QA 3BFGA 2I72A 3UDIA 1JWZA 1MY8A 1YQSA 3BECA 2OLVA 3Q1FA 3MFDA 3OPHA 3WS5A 1ZG4A 4PM6A 4S2MA 4EUZA 4MBFA 4S2IA 3GV9A 3UDFA 3G34A 2OV5A 4RYEA 2HP6A 2Y2QA 1L0GA 2Y2IA 3M2JA 1JWPA 4OPRA 4KENB 4RA7A 1YM1A 2B5RA 4RX3A 4ZJ2A 5I94A 2V2FF 2XLNA 1PW1A 2EXBA 1K6RA 2FFFB 3G4PA 1K56A 4OQIA 4WZ5A 5GLAA 3ZG8B 2HDQA 2P9VA 1FCMA 5E2HA 1YMXA 2ZC6B 1MKIA 5U47A 3LY3A 3HLEA 3GTCA 4LV0A 3ZHHA 2H10A 3IH9A 4JBFA 2EFUA 1GCEA 2Y2GA 1W5DA 2JCHA 3EQVA 5CTNA 4D2OA 3IXHA 2X01A 1YLTA 1EWZA 1GHIA 3PBSA 5CECA 3Q7ZA 5HAIA 1ES5A 2WZXA 5FATA 1K4FA 2Y2OA 4P6BA 4DE1A 4FCFA 2Y55A 3W4OA 3VP0A 5HX9A 3G35A 4JLFA 2V20A 3FKWA 1E25A 4GZBA 4WMCD 2DCFA 4KZAA 4BD0A 5AQ7A 4R3JA 3MKFA 2ZQDA 1E3UA 3WRZA 3G2ZA 1DJBA 5DTTA 1IYSA 4DE0A 5DF9A 3IXBA 4OH0A 2Y2JA 3FV7A 5FSRA 4R4RA 3WS0A 4P0MA 4QD4A 3ZCZA 2XDMA 3LCEA 1MWSA 4JF4A 3MXSA 4WEKA 5JYPA 4Z9QA 5M18A 5EOOA 1ONHA 3HLFA 4LV2A 2OLUA 4E3NA 2WGWA 1Z6FA 1JTGA 2HP9A 1BULA 2Q9MA 3ZG7B 4Y0TA 1XX2A 4OP8A 4H8RA 5FDHA 1I2WA 2V1ZA 5FAQA 1GA0A 4HBTA 4QY5A 4WZ4A 5AQ9A 3ZFZA 2G2WA 1M6KA 3OC2A 3S1YA 4KZ4A 4DE2A 4KZ9A 1YLWA 1ALQA 4GD8A 5A93A 4OOYA 1LL9A 1L2SA 4ZAMA 1SCWA 2XFTA 3P09A 3PAEA 4MBKA 1N4OA 5CRFA 4LCLA 5DTSA 4GOGA 1XA7A 2PU2A 3WS1A 1FOFA 4KZ6A 4DE3A 4KQRA 1ONGA 1IEMA 1MWTA 1LI9A 2WGIA 4IVKA 1L0EA 4DDYA 4EBNA 1PW8A 3FWLA 3UE0A 1K54C 1CI9A 2DRWA 2ZQ9A 4GDNA 4JKTA 3S4XA 1KDWA 5CEBA 3VMAA 4E3LA 4Y0UA 4OVDA 4CJNA 4QY6A 5GHXA 4BL2A 5EVIC 5EPHA 3QNBA 4ZJ3A 3NDEA 4F94A 1W8YA 3HLCA 1E4DA 3A3DA 5CHUA 3GRJA 3NBLA 3MZFA 3SS5A 3W4QA 5EVIA 4S2NC 2JE5A 2X71A 3IWQA 1IYOA 4X56A 4WEJA 1YLJA 1KGFA 3Q07A 1K6SA 3O86A 3OCNA 1ES2A 3MBZA 1NJ4A 4KZ7A 4BLMA 3WRTA 1RGYA 3FKVA 4UA7A 3HUNA 3GMWA 2XD1A 1WYCA 4R23A 1H8ZA 3OCLA 5FA7A 4EBLA 3N8RA 1IKIA 4B4XA 5CHMA 1U60A 4L0LA 3NCKA 4DXCA 2IWCA 4YINA 2WADA 1K56D 5EE8A 4PM9A 1HTZA 4S2PA 2X02A 1YT4A 1HVBA 3RJUA 3NDGA 2ZC7A 4ZBEA 3ZVTA 3PBTA 4PPRA 1IYPA 1XP4A 2ZC5B 3PBQA 5KSHA 1K57C 1DJAA 2Y2KA 4KZ5A 2ZQ7A 3BFCA 3O88A 2HP5A 1FQGA 4JPMA 3ZNYA 4XXRA 4OPQA 5GLBA 4DDSA 3IF6A 5HARA 1XKZA 3HLBA 4R4SA 2Y2HA 4OONA 1RCJA 1XPBA 2WAEA 3LY4A 2QZ6A 3C7UA 4OLGA 4R1GA 1O07A 2XK1A 2P74A 3DWKA 2WUQA 1ERMA 2Y2MA 2Y2NA 3HLGA 4DKIA 4Y7PA 4GNUA 2WZZA 5GLDA 2HDSA 1PYYA 3N6IA 2J8YA 2ZQCA 4Y0OA 1BZAA 3V50A 1DJCA 2QPNA 5CTMA 3W4PA 1NYMA 3V3SA 3ZDJA 5F1GA 4ZJ1A 4U0XA 1QMEA 1TDLA 1FSYA 3HL9A 2BLSA 2XR0A 3IHBA 4WELA 3P98A 3UN7A 5M19A 4KQOA 1PWCA 4P87A 5FAPA 2RCXA 1QMFA 1S6RA 4WM9A 4Q8IA 4PM5A 5KMWA 3IF6C 1LI0A 3IXGA 1PZPA 5A91A 3BLSA 4QJGA 2HPBA 4PMAA 3AGDA 5F1FA 1NZUA 2PBYA 3JYIA 3SH8A 3VP3A 3GVBA 1NZOA 3IF5A 4PM8A 3V39A 3G2YA 3GQZA 1LL5A 3VP4A 1NY0A 2GDNA 4M3KA 3I7JA 3O87A 3G30A 4OOLA 5E2EA 5FI2A 3MZDA 3NY4A 3GR2A 3PTEA 4BL3A 1YLPA 1Q2PA 2Y4AA 4HEFA 4JF6A 4WYYA 5HAPA 1Q2QA 2UWXA 4FH4A 2EX6A 1TEMA 4GD6A 4X55A 3UO9A 3PBNA 4FH2A 2ZLYA 3DTMA 4EBPA 4E3JA 2IWBA 5FQJA 3BYDA 1E3UD 3MZEA 2CC1A 4DXBA 1PWDA 4K91A 4X68A 4C3QA 1IKGA 3A3FA 1SKFA 3WWXA 4B4ZA 3HBRA 5IHVA 3IQAA 1I5QA 3UE3A 3IWIA 4E6WA 3BFDA 3VFHA 3M2KA 4C6YA 4R3BA 2EX9A 1OMEA 1Y54A 2WK0A 4NETA 3SH9A 1SDEA 2ZC3B 2R9WA 1CEFA 2ZQ8A 2WKHA 4JXVA 5JYOA 4IVIA 3ZG5A 4KZ8A 4B88A 1JWVA 4N1HA 4BENA 5EUAA 1ZG6A 1KDSA 2A3UA 4FD8A 4KG5A 2JBFA 4QHCA 4JF5A 1GA9A 2ZQAA 2HDRA 3S22A 3WS4A 3UE1A 1MXOA 3C5AA 3VFFA 5KZHA 3AGFA 3ISGA 3NI9A 4NK3A 1VQQA 3CG5A 5HW3A 4MLLA 3LEZA 1XXMA 1XA1A 4GN2A 1ZC2A 4S2NA 1HZOA 2WKEA 5FQIA 1MBLA 4U3TA 4UA9A 1I2SA 3RXXA 3HUMA 4LCMA 2J9PA 2XFSA 3SS3A 1IELA 3RXWA 3ZVWA 1L0DA 1H5XA 1KE4A 1MWUA 1NRFA 4LV3A 2A49A 3IHAA 2XGNA 3PBRA 4N9LA 3Q81A 4MEZA 3N8LA 1MPLA 5CGXA 4S2KA 1YMSA 4BD1A 4HESA 4X69A 3WS2A 3IH8A 1ES3A 1NXYA 1PZOA 1GHMA 2XQZA 3M6HA 3UPOA 1CI8A 1G6AA 1TVFA 3IXDA 4U0TA 5EECA 2EFXA 4BQMA 3C4OA 5EVIB 3BRMA 3NIAA 4OPZA 1KVMA 5TGFA 4IBRA 3Q7VA 4WMCA 1ESIA 1L0FA 1XGJA 5AQAA 3M6BA 4KZ3A 4EV4A 3C4PA 4K0XA 3BLMA 4KQQA 3V3RA 3Q82A 4LV1A 2H5SA 4DF6A 1WE4A 4MBHA 5G18A 1BLHA 2H0TA 3IT9A 5FQKA 4O7DA 3ZG0A 5FI6A 3SOIA 2ZM8A 4S2JA 4UAAA 2Z2LB 2Y2PA 4S2LA 3UPNA 3A3JA 5FASA 4OQ0A 1BUEA 2ZM2A 3BFFA 3HREA 4FSFA 3W8KA 5E2GA 1CEGA 4RVAA 4E6XA 1FCOA 1RP5A 1O7EA 3QHYA 4LENA 3HLWA 3QNCA 5GL9A 2Y2LA 3NC8A 2J9OA 5DTKA 3CZDA 3PBOA 3VSKA 5DVAA 2WGWB 1KGGA 5GHYA 4DRTA 1M40A 5A92A 1K4EA 3BM6A 3SH7A 3UPPA 1LLBA 4GDBA 4X53A 1BLPA 5BOHA 2XH9A 5TFQA 3A3EA 3VOYA 1N9BA 1RGZA 1K57A 1WYBA 3UDXA 1BLCA 2BG1A 1AXBA 2XEPA 1BT5A 4UA6A 2RL3A 4YFMA 1K54A 5CXWA 4N1XA 4A5RA 2FFYA 1G68A 2R9XA 3D4FA 4OOMA 1KE3A 4R0QA 5FQQA 3VP1A 1HD8A 1TDGA 3OZHA 1GHPA 4E3MA 5D3OA 4ZDXA 2WYXA 1JVJA 1FR6A 4OKPA 1W7FA 2WAFA 3ITAA 3TOIA 5A90A 4MNRA 2IWDA 2H0YA 5FQMA 1CK3A 1PIOA 3E2LA 1FSWA 5CGWA 4OPYA 5FQ9A 1K38A 4JXWA 1K55C 5L2FA 2E8IA 3N4IA 4ZTKA 2WKIA 3OPRA 2EXAA 3PAGA 4OQHA 3A3IA 1MWRA 3CJMA 3ZGAB 1XGIA 5CEDA 5HAQA 5KSCA 3G32A 4IBXA 4E3OA 1DY6A 5CHJA 4UHUA 2P9VB 5E2FA 1S0WA 1J9MA 1H8YA 4XUZA 5HL1A 1ES4A 1K25A 4E3KA 2C6WB 3DWZA 4KZBA 3UY6A 3TSGA 3G31A 5GLCA 1KGEA 1YLZA 2C5WB 2XD5A 3CMZA 4OQGA 4WBGA 5M1AA 1BSGA 5E43A 4CPKA 2ZM0A 3OPPA 4S2OA 3HLDA 1EROA 4GKUA 4E3IA 1FR1A 5HFOA 1IYQA 2ZJ9A 1SDNA 2EX8A 1PI5A 4BJPA 3ITBA 5GHZA 5DF7A 4N92A 1C3BA 2OSUA 1W79A 2PU4A 1SHVA 3LO7A 4PM7A 5EVLA 3OPLA 2ZC4B 1BLSA 3C7VA 4RX2A 5J8XA 3B3XA 4OP5A 2Y91A 4N9KA 2Z2MB 3ZG9B 1YLYA
chains in the Genus database with same CATH superfamily
3VSLA 2NUTC 4QU3A 2ZD8A 4JXSA 4EQIA 2B18A 1YPRA 3HVFA 3MKEA 4GB7A 3CITA 1LHYA 4JXGA 2JC7A 1BTLA 3VP2A 4KG6A 3FYZA 2QKPA 3TG9A 1PFLA 4HJ4A 3IS2A 1VM1A 2KOIA 4KG2A 4WZ5C 2VGKA 1EI5A 3F1NA 4ME4A 3BFGA 3BECA 5KIZA 1T19A 3EOIA 2PHYA 3G34A 2HP6A 2Y2QA 1H0MA 2B5RA 4AFIA 4RX3A 2W3HA 4YWZA 4ZJ2A 5I94A 1PW1A 2EXBA 5GLAA 1AWIA 2ZC6B 1MKIA 4JBFA 3CAXA 2EFUA 1GCEA 4MCWA 3IXHA 1EWZA 1GHIA 1ES5A 1K4FA 2Y55A 3W4OA 5HX9A 3G35A 4HP4A 4Y3IA 2V20A 4GZBA 4WMCD 1TS6A 1T1BA 3EGXC 5DTTA 1OTDA 4OH0A 2Y2JA 3FC7A 2VGLM 4QWOA 4JGQA 3ZCZA 4Z9QA 2XROA 5EOOA 2QJ7A 4HH3A 3ZG7B 1FILA 4H8RA 5FAQA 3L9KA 2W1TB 5K5BA 2V0UA 3OC2A 3S1YA 5CX7A 4KZ4A 5HSQA 4GD8A 5EV0A 3P09A 1FOFA 4KZ6A 3FWLA 2HJ9C 3K3DA 5HL6A 5GHXA 1F5MA 2M1CA 3QNBA 4ZJ3A 4F94A 2AVXA 5FL3A 4HJ6A 3A3DA 1W63Q 5HPFA 3Q07A 3O86A 3OCNA 2PR6A 2J3TD 3V67A 3WRTA 1RGYA 5TJJA 3GMWA 1U60A 4L0LA 4DXCA 3QP5A 1K56D 1P9WA 4ESPA 5EE8A 2X02A 3OBFA 1YT4A 2OAP1 2ZC7A 1DJAA 3QP1A 4R6LA 4LFUA 3BFCA 4JPMA 3HJIA 4XXRA 5GLBA 3HLBA 4R4SA 5IU1A 1GSVA 2Y2HA 2W3DA 3LICA 4LPZA 1RCJA 1VHMA 1XPBA 3LY4A 1W63M 1LL8A 4R1GA 3EWKA 2WUQA 3LYXA 1SKOA 2ZQCA 1BZAA 3NOTC 3ZDJA 1FSYA 2XR0A 3IHBA 3RTYA 3BWLA 1PWCA 4Q8IA 3VE4A 1F98A 5F1FA 2PBYA 4JGRA 1OT6A 3A0RA 2D01A 3IX3A 3T4KA 1LL5A 3H9WA 3UB8A 1NY0A 4OOLA 4PKYA 1G5UA 3GR2A 1YLPA 5L07A 2UWXA 2PT7A 1TEMA 4L9EA 3IBRA 2ZLYA 5DJUA 5FQJA 3BYDA 2PRFA 1OTEA 4X68A 3HBRA 2O0YA 3M2KA 3VV4A 4R3BA 1Y54A 2PYRA 5L09A 3C30A 4HY8A 4JXVA 1JWVA 3CPTB 4BENA 3KSGA 4FD8A 2JBFA 2O9CA 5L10A 4BBUA 2ZQAA 3T1QB 2HDRA 2VGLS 4Q0HA 3S22A 5KZHA 3TE8A 1XA1A 4GN2A 3D3OA 1MBLA 1I2SA 3SS3A 3MXQA 4B9OA 1KE4A 1MWUA 4JGOA 4O01A 2A49A 3IHAA 4N9LA 4MEZA 3N8LA 3BW6A 3NHQA 4S2KA 4BD1A 4HESA 3WS2A 1ES3A 1GHMA 2XQZA 4EESA 3CLOA 5EECA 3P7NA 4ZRRA 4BQMA 5TBMA 3C4OA 5EVIB 3BRMA 3NIAA 3Q7VA 3UB5P 5A8BA 4I5SA 3M6BA 4EV4A 3C4PA 4MN6A 4DF6A 5G18A 4HIAA 3E98A 3ZG0A 3SW1A 2Y2PA 3MFXA 1BUEA 3BFFA 1CEGA 1FCOA 3MQOA 3HLWA 4EERA 1NLYA 2J3WA 4DRTA 1M40A 1K4EA 3BM6A 3F1NB 2OWJA 3UPPA 3LR5A 4X53A 5TFQA 1RGZA 2QYBA 3UDXA 1BLCA 3U2AA 1K54A 4R0QA 1G68A 5FQQA 3VP1A 1TDGA 3EEHA 3OZHA 1GHPA 2WYXA 1JVJA 2VV7A 4OKPA 1WA9A 1K38A 2WKQA 4JXWA 3S7QA 2E8IA 3A3IA 3CJMA 3ZGAB 5HAQA 5J3WA 3G32A 1DY6A 1YAXA 4XUZA 1ES4A 2C5WB 2XD5A 3L7HA 4II7A 1BSGA 3OPPA 1STZA 4GKUA 2W3EA 1SDNA 4GCZA 1D1JA 1C3BA 4O0PA 5G4ZA 4GLQA 2PU4A 1SHVA 1BLSA 4RX2A 2Y91A 4N9KA 2Z2MB 3KO6A 3JVVA 3N7WA 1K55A 5DF8A 4K0WA 2V1AA 2EWWA 3AGEA 3A0VA 1Y28A 2DNSA 3E4QA 1ERQA 3ZNTA 1UWPX 3T1XA 1Y4OA 3H7WA 4X25A 3CPTA 3GECA 5F83A 4F3LB 1FCNA 2XSSA 1ESUA 4IHQA 2XF3A 1KE0A 3DBAA 3BFEA 3FZCA 3SS4A 1TS8A 2EX2A 1YQSA 1MY8A 1N9LA 3OPHA 4MBFA 4S2IA 3UDFA 3CWFA 2OV5A 3T12B 3PXPA 1L0GA 1TD5A 1JWPA 4KENB 4RA7A 3G4PA 4EQ1A 4OQIA 3ZHHA 2H10A 3IH9A 1W5DA 2JCHA 1YLTA 4PAUA 2VEAA 3DAVA 4KQDA 3T4JA 4RQ9A 4JLFA 3F1OB 3KYQA 2E8JA 2DCFA 3OLOA 3WRZA 1DJBA 1F9IA 4G3VA 5DF9A 3IXBA 4HI4A 2OWHA 4Y13A 3WS0A 4P0MA 4JF4A 3MXSA 1N9OA 3HLFA 4LV2A 2OLUA 4E3NA 2WGWA 1Z6FA 5C5KA 1XX2A 5EM1A 2VJWA 1G6OA 4OP8A 2V1ZA 4HBTA 4R38A 3ZFZA 2KLIA 4DE2A 2V0WA 4KZ9A 3LI9A 1YLWA 3NJAA 5A93A 3HJKA 2OOLA 4G3WA 4MBKA 1N4OA 5CRFA 4CLCD 4LCLA 1S67L 2PU2A 2ZL1A 4DJ3A 1IEMA 4WN5A 1LSVA 1MWTA 1LI9A 5DFYA 2DRWA 2ZQ9A 4JKTA 5CEBA 4NXGA 4QY6A 4BL2A 5EVIC 2V1BA 2PD7A 4CQHA 1UWNX 3NDEA 1ZHHB 3QP4A 5CHUA 3GDIA 3NBLA 3MZFA 4CLCB 1YLJA 1XJ6A 1NJ4A 2PR5A 3KSIA 3S7PA 5MC7A 3HUNA 4YOFA 3KYEA 4R23A 5FA7A 1H8ZA 4EBLA 3LIDA 3N8RA 5CHMA 2HV1A 4YINA 2WADA 2W0NA 4PM9A 1HTZA 4S2PA 1HVBA 3PBQA 2Y2KA 3K3CA 4KZ5A 2ZQ7A 4KUOA 2P04A 1YSQA 1FQGA 1GSWA 4OPQA 3FG8A 3IF6A 5HARA 1XKZA 4OONA 2I9VA 2INWA 2WAEA 3C7UA 1P97A 3NOPC 4OLGA 1O07A 2Y2MA 3HLGA 1NWZA 5L8MA 2HDSA 1PYYA 3N6IA 2J8YA 4LLOB 3V50A 2QPNA 4ZJ1A 1SZVA 1QMEA 1TDLA 2BLSA 3P98A 5M19A 1VEUA 1S6RA 1PZPA 4QJGA 2HPBA 4PMAA 4BMWA 1NZUA 1OTAA 3JYIA 3IF5A 1YSPA 4I3JA 2Z6DA 3GQZA 2JKGA 3UB9A 3VP4A 1OJ5A 4MMNA 3O87A 2W3GA 3G30A 3MZDA 3NY4A 4BL3A 4JF6A 2VA0A 1DRMA 4BWIA 4GD6A 4X55A 4R70A 4FH2A 1G28A 2IWBA 3MZEA 2CC1A 4ARZB 2WKPA 3A3FA 3WWXA 3IQAA 1I5QA 2LB9A 3KYZA 4C6YA 3IX4A 1Z09A 1VEUB 3SH9A 1SDEA 2Q0OA 1A0KA 5HWVA 4B93A 4F3LA 4IVIA 4EXOA 4B88A 4KG5A 1GA9A 1MXOA 3VFFA 3ISGA 3W2ZA 3NI9A 1VQQA 4MLLA 3LEZA 1ZC2A 2M7UA 5FQIA 4LCMA 2D02A 2MJ6A 1IELA 3T4SA 1L0DA 4UQIS 4LV3A 2W27A 4MN5A 3PBRA 3Q81A 1CF0A 4Z1WA 4HOIA 1PZOA 2V9AA 3LR3A 3UPOA 1G6AA 1CI8A 4Y5FA 3T1RA 3IX8A 4OPZA 1LT0A 1ESIA 1L0FA 1XGJA 3T4QA 2VLGA 1VETB 2V8FA 4K0XA 2JKRI 4KQQA 3V3RA 4LV1A 4Q0JA 5AJGA 3IT9A 5FQKA 4O7DA 1T18A 2PBDP 5FASA 4YNRA 3B42A 1VETA 3PR6A 4FSFA 2KDKA 3MQ0A 3QNCA 3DTIA 5GL9A 2Y2LA 2V8CA 3S7NA 3NC8A 2J9OA 5DTKA 2WGWB 5GHYA 3SH7A 4GDBA 2XH9A 4GHIB 3BY9A 1BT5A 4UA6A 2RL3A 4NKPA 4OOMA 5HDCA 1HD8A 4E3MA 1OJGA 3F1OA 5HPIA 3ITAA 3TOIA 2JKTI 1FSWA 1TF1A 1NLZA 4NXFA 4WLAA 5L2FA 4P6ZS 3OPRA 5FDSA 5KSCA 2FZ0A 4IBXA 4E3OA 5EFWA 5CHJA 4DJ2A 1VB6A 5HZHA 3UY6A 3BQAA 1YLZA 1IOUA 3CMZA 4OQGA 5M1AA 4CPKA 3HLDA 4HHDA 4E3IA 1FR1A 5HFOA 4BJPA 3ITBA 5GHZA 5LBRA 5F68A 4N92A 3LO7A 4IJGA 2ZC4B 4H6JB 3C7VA 5J8XA 3B3XA 2VX8A 3ZG9B 1YLYA 2Y59A 3R7WA 2KX6A 2Q9NA 4PKYG 3HUOA 4FOFA 1KVLA 3DW0A 1S4SA 3IWOA 1BYWA 3EQUA 5CGSA 5TR7A 3GSGA 3LIFA 3BEBA 2QMIA 3R7WB 4XUXA 2W3FA 2LB5A 1S1YA 5F82A 1ODVA 4QB8A 2VZWA 1NYYA 3ICYA 4X6TA 1JTDA 2GZAA 3MXRA 3UE6A 1V9YA 5EVID 5FI7A 3LIEA 4EU0A 2B95A 3O3VA 3UNWA 3T50A 4C75A 3Q1FA 2PD8A 3MFDA 4S2MA 3O5YA 5HD3A 5DFXA 3KX0X 4RYEA 2A24B 4GW9A 4OPRA 4LRXC 3T4TA 4WZ5A 1K56A 3ZG8B 1FCMA 1F2KA 3C2WA 5E2HA 5U47A 3HLEA 4LV0A 4D2OA 4IUHA 3EQVA 3TW8A 3PBSA 4BBTA 2Y2OA 3NECA 3A0SA 4FCFA 5J4EA 4HH2A 3MSHA 2HJEA 5F69A 1DP9A 3FKWA 1E25A 2JHEA 4KZAA 3T1SA 5AQ7A 2O9BA 1LSWA 1E3UA 1IYSA 2O99A 3FV7A 4KUKA 1SKOB 4WEKA 5JYPA 1BULA 3VE3A 5FDHA 1I2WA 2Y8HA 4E04A 4QY5A 4WZ4A 4G3KA 3ZQ5A 2G2WA 4EUVA 3QP6A 1P9RA 4OOYA 1L2SA 4ZAMA 1SCWA 1XA7A 4DE3A 4KQRA 1ONGA 4EBNA 4GS9A 3UE0A 1K54C 3VMAA 4E3LA 4Y0UA 2VV8A 4HQAA 1P0ZA 1W8YA 5J7EA 3HLCA 1E4DA 5TBMB 2B02A 1OT9A 4CLCA 2JE5A 2X71A 4X56A 1IYOA 4WEJA 2J3TC 4O8GA 2P7JA 4ARZA 1K6SA 1ES2A 4KZ7A 4UA7A 2XD1A 4I38A 3TRCA 4B4XA 2IWCA 2UV0E 2XRNA 3NDGA 3ZVTA 1IYPA 1MC0A 2ZC5B 5KSHA 1K57C 4D60A 1ACFA 1V9ZA 3O88A 3ZNYA 2A24A 2L0WA 4Y15A 2QZ6A 2XK1A 2P74A 3DWKA 3NOUC 4DKIA 4GNUA 4X1LA 5CTMA 4L9GA 3W4PA 1NYMA 2VKSA 3HL9A 3CUEC 2JKFA 4WELA 3UN7A 4ETZA 4KQOA 2HF6A 4P87A 4PM5A 4WM9A 3IF6C 1LI0A 1XFQA 3IXGA 5A91A 3BLSA 2NUPC 4I3AA 3SH8A 3GVBA 4PM8A 1UGUA 2YKHA 1T1AA 3HCYA 5EM0A 5AVFA 4CLCC 4M3KA 1DP8A 1Q2PA 1DP6A 2Y4AA 1XJ2A 1Q2QA 2ZL1B 1XJ4A 2GJ3A 3DTMA 4EBPA 4E3JA 4DN0A 4DXBA 1K0KA 4C3QA 2PDRA 1IKGA 1SKFA 4B4ZA 3IWIA 3BFDA 2WK0A 2ZC3B 2GX5A 2R9WA 2WKHA 3VOLA 4KZ8A 4N1HA 4Y17A 3P01A 1ZG6A 3D72A 3LEQA 4JF5A 3H7WB 3WS4A 4GJ4A 3C5AA 4I3IA 3UE1A 3AGFA 4NK3A 3LIAA 4HP9A 4U3TA 4UA9A 3RXXA 3HUMA 2XFSA 1MZUA 3LR4A 3RXWA 2K7SA 2XGNA 5AVEA 5EVEA 5CGXA 1YMSA 5FEFA 1OTIA 2Z6CA 3C38A 1TVFA 2IA2A 4U0TA 1N9NA 2EFXA 5IS1A 1GSXA 4KZ3A 2BTFP 1LSXA 3Q82A 2H5SA 3PYPA 1WE4A 1BLHA 1NRJA 4S2JA 4UAAA 2Z2LB 3SZTA 3UPNA 4OQ0A 2ZM2A 1FIKA 3W8KA 2WKRA 5E2GA 2PAVP 4RVAA 1RP5A 1O7EA 4LENA 2QWSA 3E0YA 2OAQ1 4CLCE 4LGWA 3CZDA 3PBOA 5DVAA 3MQQA 1KGGA 5A92A 5BOHA 1BLPA 4WF0A 4NEED 2FH5A 3JVUA 1N9BA 3KSFA 1CJFA 2BG1A 1TS0A 4IUKA 5CXWA 4N1XA 2R9XA 1KE3A 1L3LA 3QP2A 1FR6A 2WAFA 4MNRA 1PIOA 4UQIM 5CGWA 5FQ9A 4OPYA 5DKKA 1K55C 3UMEA 3N4IA 2WKIA 3E4OA 3PAGA 4OQHA 1EW0A 1XGIA 2VV6A 5CEDA 3B47A 3MJQA 1S4RA 2PYPA 4UHUA 1IFQA 1K25A 4E3KA 1CQAA 4Q0IA 3DWZA 4KZBA 5DKLA 4WBGA 2ZM0A 4S2OA 1EROA 2HGVA 2ZJ9A 3CUEA 5DF7A 3MF0A 3BY8A 2OSUA 1PNEA 1T1CA 4PM7A 3IBJA 4OP5A 2R78A 3RFBA 1XJ3A 5AQBA 3IF6B 2G2UA 4WL9A 4WUJA 3VOZA 1ZKJA 5CERA 5FAOA 2ZMAA 3PHYA 3E2KA 3LI8A 4ID4A 2VGJA 1H3QA 3N8SA 1PRQA 4OLDA 2HDUA 4HBUA 5EOEA 4IEDA 2ZMFA 1KOUA 2J7VA 3H82A 3V5MA 2WGVA 2K31A 4NXEA 5FEGA 4P85A 3Q7VB 1PWGA 2BASA 4EWFA 4FTXA 2JN7A 1PI4A 1W8QA 2I72A 3UDIA 1JWZA 4EEPA 2OLVA 1D06A 3D9YA 3WS5A 1ZG4A 4PM6A 4EUZA 3GV9A 4QPRA 3MMHA 2Y2IA 3M2JA 1YM1A 2CMNA 2V2FF 2W1RA 2XLNA 2FFFB 1K6RA 4L9FA 3T4OA 3ZYTA 2HDQA 2HZ5A 2P9VA 1YMXA 3LY3A 3GTCA 5CTNA 2Y2GA 2X01A 5CECA 3Q7ZA 5HAIA 2WZXA 5FATA 4P6BA 4DE1A 1D7EA 3VP0A 3F1PA 4BD0A 4R3JA 3MKFA 4UEYA 2ZQDA 3G2ZA 4DE0A 4LRZE 5FSRA 4R4RA 3LGOA 4EW7A 4QD4A 3FPVA 2XDMA 3LCEA 1MWSA 1MKMA 5M18A 1ONHA 1JTGA 2HP9A 2Q9MA 4Y0TA 4XT2A 4Y2FA 4JGPA 1GA0A 3E4PA 4GS9B 5AQ9A 3EGDC 1M6KA 3EEAA 1ALQA 1LL9A 2H28A 2XFTA 3PAEA 2G7UA 5DTSA 4GOGA 3WS1A 2WGIA 4DDYA 4IVKA 1L0EA 1PW8A 1CI9A 4GDNA 3S4XA 1KDWA 4OVDA 4CJNA 5EPHA 2JKRM 3GRJA 3W4QA 3LUQA 3SS5A 5EVIA 2XA7S 4S2NC 3IWQA 1KGFA 1ZTUA 3MBZA 4BLMA 3FKVA 1WYCA 3OCLA 3UB7A 1IKIA 3NCKA 4K08A 2ACGA 5HWTA 3RJUA 3DTEA 3MS6A 4ZBEA 3PBTA 4PPRA 1XP4A 1H8MA 2HP5A 1TS7A 4DDSA 5IT5A 3CHWP 4EETB 2QJ5A 2ZMVA 5HDSA 4LRYC 1S66L 1ERMA 2W1TA 2L1MA 2Y2NA 4Y7PA 4H6JA 2WZZA 4EEUA 5GLDA 4Y0OA 4NXBA 1DJCA 2ZBBA 3MR0A 2DMWA 3V3SA 5F1GA 4U0XA 3FPWA 5FAPA 5KMWA 2RCXA 1QMFA 4HNBA 1J3WA 2ZOIA 3LR0A 3AGDA 3VP3A 1HLUP 1NZOA 3LIBA 3UB6A 3V39A 3G2YA 2GDNA 3I7JA 3DTKA 5E2EA 5FI2A 3PTEA 5HAPA 4WYYA 4HEFA 4BBVA 4FH4A 2EX6A 4MDZA 3UO9A 3PBNA 1E3UD 1PWDA 4K91A 5IHVA 3UE3A 4E6WA 3VFHA 2EX9A 1OMEA 3B33A 4NETA 4XT2B 3K2NA 1CEFA 2ZQ8A 5DJTA 5JYOA 5HWWA 3ZG5A 5EUAA 2XA7M 4R3AA 1KDSA 2A3UA 4QHCA 5F6AA 3IS2B 2EA9A 2Y79A 1S1ZA 4DMZA 3RH8B 1YKDA 3CG5A 5HW3A 1XXMA 2GNXA 4S2NA 1HZOA 2WKEA 3TJZC 4X1MA 4FUWA 2J9PA 3ULFA 3ZVWA 1H5XA 3CI6A 1NRFA 2ZOHA 3U4LP 4P6ZM 5I5LA 2EWVA 1MPLA 4X69A 4PHTA 3IH8A 1NXYA 3T4LA 3M6HA 3BJNA 3IXDA 1KVMA 3F1PB 5TGFA 2L4RA 4IBRA 4WMCA 5AQAA 3LFVA 3BLMA 3OOVA 4M4XA 4MBHA 2H0TA 5FI6A 3SOIA 2ZM8A 1XFNA 4S2LA 3A3JA 2P08A 3HREA 4E6XA 3QHYA 3R4KA 4NG2A 2YKFA 3VSKA 4ETXA 4I39A 5G4YA 2A2LA 1LLBA 3A3EA 3VOYA 1OTBA 1K57A 1WYBA 1AXBA 2XEPA 3BQ8A 2VK3A 4YFMA 3H82B 4A5RA 2FFYA 1OPXA 3D4FA 5HD5A 4ZDXA 5D3OA 1JNUA 2M7VA 3G6OA 1W7FA 2JKTM 3UMDA 5A90A 3NULA 2IWDA 2H0YA 5FQMA 5F5YA 1CK3A 1X0OA 3E2LA 5HDDA 2J80A 2QHKA 3QP8A 4ZTKA 2EXAA 1MWRA 2K2NA 2P9VB 5E2FA 1S0WA 4HJ3A 1J9MA 1H8YA 5HL1A 2C6WB 3JPUA 3TSGA 3G31A 5GLCA 1KGEA 5E43A 1IYQA 2EX8A 4MN7A 1PI5A 3C8CA 3KSHA 2O9AA 3S7OA 1W79A 4GHIA 5EVLA 3OPLA
chains in the Genus database with same CATH topology
5AQBA 2Y59A 3VSLA 4QU3A 3N7WA 2ZD8A 1K55A 4JXSA 5DF8A 3IF6B 2G2UA 4K0WA 4EQIA 2Q9NA 3AGEA 3HUOA 3HVFA 3MKEA 1KVLA 3VOZA 1ZKJA 2DNSA 3DW0A 4GB7A 3IWOA 1ERQA 3EQUA 5CGSA 5CERA 1LHYA 4JXGA 5FAOA 2ZMAA 5TR7A 3GSGA 3E2KA 3ZNTA 2JC7A 1BTLA 3VP2A 3BEBA 2QMIA 4ID4A 2VGJA 4KG6A 3N8SA 3FYZA 5F83A 3TG9A 4XUXA 4OLDA 2HDUA 4HBUA 5F82A 5EOEA 1FCNA 4QB8A 4IEDA 1NYYA 4X6TA 1JTDA 2J7VA 1VM1A 3V5MA 1ESUA 2XF3A 3MXRA 2WGVA 4KG2A 1KE0A 2VGKA 4WZ5C 3BFEA 1EI5A 3FZCA 5EVID 5FI7A 4P85A 3SS4A 3Q7VB 1PWGA 2EX2A 4EWFA 3O3VA 3UNWA 4C75A 1PI4A 1W8QA 3BFGA 2I72A 3UDIA 1JWZA 1MY8A 1YQSA 3BECA 2OLVA 3Q1FA 3MFDA 3OPHA 3WS5A 1ZG4A 4PM6A 4S2MA 4EUZA 4MBFA 4S2IA 3GV9A 3UDFA 3G34A 2OV5A 4RYEA 2HP6A 2Y2QA 1L0GA 2Y2IA 3M2JA 1JWPA 4OPRA 4KENB 4RA7A 1YM1A 2B5RA 4RX3A 4ZJ2A 5I94A 2V2FF 2XLNA 1PW1A 2EXBA 1K6RA 2FFFB 3G4PA 1K56A 4OQIA 4WZ5A 5GLAA 3ZG8B 2HDQA 2P9VA 1FCMA 5E2HA 1YMXA 2ZC6B 1MKIA 5U47A 3LY3A 3HLEA 3GTCA 4LV0A 3ZHHA 2H10A 3IH9A 4JBFA 2EFUA 1GCEA 2Y2GA 1W5DA 2JCHA 3EQVA 5CTNA 4D2OA 3IXHA 2X01A 1YLTA 1EWZA 1GHIA 3PBSA 5CECA 3Q7ZA 5HAIA 1ES5A 2WZXA 5FATA 1K4FA 2Y2OA 4P6BA 4DE1A 4FCFA 2Y55A 3W4OA 3VP0A 5HX9A 3G35A 4JLFA 2V20A 3FKWA 1E25A 4GZBA 4WMCD 2DCFA 4KZAA 4BD0A 5AQ7A 4R3JA 3MKFA 2ZQDA 1E3UA 3WRZA 3G2ZA 1DJBA 5DTTA 1IYSA 4DE0A 5DF9A 3IXBA 4OH0A 2Y2JA 3FV7A 5FSRA 4R4RA 3WS0A 4P0MA 4QD4A 3ZCZA 2XDMA 3LCEA 1MWSA 4JF4A 3MXSA 4WEKA 5JYPA 4Z9QA 5M18A 5EOOA 1ONHA 3HLFA 4LV2A 2OLUA 4E3NA 2WGWA 1Z6FA 1JTGA 2HP9A 1BULA 2Q9MA 3ZG7B 4Y0TA 1XX2A 4OP8A 4H8RA 5FDHA 1I2WA 2V1ZA 5FAQA 1GA0A 4HBTA 4QY5A 4WZ4A 5AQ9A 3ZFZA 2G2WA 1M6KA 3OC2A 3S1YA 4KZ4A 4DE2A 4KZ9A 1YLWA 1ALQA 4GD8A 5A93A 4OOYA 1LL9A 1L2SA 4ZAMA 1SCWA 2XFTA 3P09A 3PAEA 4MBKA 1N4OA 5CRFA 4LCLA 5DTSA 4GOGA 1XA7A 2PU2A 3WS1A 1FOFA 4KZ6A 4DE3A 4KQRA 1ONGA 1IEMA 1MWTA 1LI9A 2WGIA 4IVKA 1L0EA 4DDYA 4EBNA 1PW8A 3FWLA 3UE0A 1K54C 1CI9A 2DRWA 2ZQ9A 4GDNA 4JKTA 3S4XA 1KDWA 5CEBA 3VMAA 4E3LA 4Y0UA 4OVDA 4CJNA 4QY6A 5GHXA 4BL2A 5EVIC 5EPHA 3QNBA 4ZJ3A 3NDEA 4F94A 1W8YA 3HLCA 1E4DA 3A3DA 5CHUA 3GRJA 3NBLA 3MZFA 3SS5A 3W4QA 5EVIA 4S2NC 2JE5A 2X71A 3IWQA 1IYOA 4X56A 4WEJA 1YLJA 1KGFA 3Q07A 1K6SA 3O86A 3OCNA 1ES2A 3MBZA 1NJ4A 4KZ7A 4BLMA 3WRTA 1RGYA 3FKVA 4UA7A 3HUNA 3GMWA 2XD1A 1WYCA 4R23A 1H8ZA 3OCLA 5FA7A 4EBLA 3N8RA 1IKIA 4B4XA 5CHMA 1U60A 4L0LA 3NCKA 4DXCA 2IWCA 4YINA 2WADA 1K56D 5EE8A 4PM9A 1HTZA 4S2PA 2X02A 1YT4A 1HVBA 3RJUA 3NDGA 2ZC7A 4ZBEA 3ZVTA 3PBTA 4PPRA 1IYPA 1XP4A 2ZC5B 3PBQA 5KSHA 1K57C 1DJAA 2Y2KA 4KZ5A 2ZQ7A 3BFCA 3O88A 2HP5A 1FQGA 4JPMA 3ZNYA 4XXRA 4OPQA 5GLBA 4DDSA 3IF6A 5HARA 1XKZA 3HLBA 4R4SA 2Y2HA 4OONA 1RCJA 1XPBA 2WAEA 3LY4A 2QZ6A 3C7UA 4OLGA 4R1GA 1O07A 2XK1A 2P74A 3DWKA 2WUQA 1ERMA 2Y2MA 2Y2NA 3HLGA 4DKIA 4Y7PA 4GNUA 2WZZA 5GLDA 2HDSA 1PYYA 3N6IA 2J8YA 2ZQCA 4Y0OA 1BZAA 3V50A 1DJCA 2QPNA 5CTMA 3W4PA 1NYMA 3V3SA 3ZDJA 5F1GA 4ZJ1A 4U0XA 1QMEA 1TDLA 1FSYA 3HL9A 2BLSA 2XR0A 3IHBA 4WELA 3P98A 3UN7A 5M19A 4KQOA 1PWCA 4P87A 5FAPA 2RCXA 1QMFA 1S6RA 4WM9A 4Q8IA 4PM5A 5KMWA 3IF6C 1LI0A 3IXGA 1PZPA 5A91A 3BLSA 4QJGA 2HPBA 4PMAA 3AGDA 5F1FA 1NZUA 2PBYA 3JYIA 3SH8A 3VP3A 3GVBA 1NZOA 3IF5A 4PM8A 3V39A 3G2YA 3GQZA 1LL5A 3VP4A 1NY0A 2GDNA 4M3KA 3I7JA 3O87A 3G30A 4OOLA 5E2EA 5FI2A 3MZDA 3NY4A 3GR2A 3PTEA 4BL3A 1YLPA 1Q2PA 2Y4AA 4HEFA 4JF6A 4WYYA 5HAPA 1Q2QA 2UWXA 4FH4A 2EX6A 1TEMA 4GD6A 4X55A 3UO9A 3PBNA 4FH2A 2ZLYA 3DTMA 4EBPA 4E3JA 2IWBA 5FQJA 3BYDA 1E3UD 3MZEA 2CC1A 4DXBA 1PWDA 4K91A 4X68A 4C3QA 1IKGA 3A3FA 1SKFA 3WWXA 4B4ZA 3HBRA 5IHVA 3IQAA 1I5QA 3UE3A 3IWIA 4E6WA 3BFDA 3VFHA 3M2KA 4C6YA 4R3BA 2EX9A 1OMEA 1Y54A 2WK0A 4NETA 3SH9A 1SDEA 2ZC3B 2R9WA 1CEFA 2ZQ8A 2WKHA 4JXVA 5JYOA 4IVIA 3ZG5A 4KZ8A 4B88A 1JWVA 4N1HA 4BENA 5EUAA 1ZG6A 1KDSA 2A3UA 4FD8A 4KG5A 2JBFA 4QHCA 4JF5A 1GA9A 2ZQAA 2HDRA 3S22A 3WS4A 3UE1A 1MXOA 3C5AA 3VFFA 5KZHA 3AGFA 3ISGA 3NI9A 4NK3A 1VQQA 3CG5A 5HW3A 4MLLA 3LEZA 1XXMA 1XA1A 4GN2A 1ZC2A 4S2NA 1HZOA 2WKEA 5FQIA 1MBLA 4U3TA 4UA9A 1I2SA 3RXXA 3HUMA 4LCMA 2J9PA 2XFSA 3SS3A 1IELA 3RXWA 3ZVWA 1L0DA 1H5XA 1KE4A 1MWUA 1NRFA 4LV3A 2A49A 3IHAA 2XGNA 3PBRA 4N9LA 3Q81A 4MEZA 3N8LA 1MPLA 5CGXA 4S2KA 1YMSA 4BD1A 4HESA 4X69A 3WS2A 3IH8A 1ES3A 1NXYA 1PZOA 1GHMA 2XQZA 3M6HA 3UPOA 1CI8A 1G6AA 1TVFA 3IXDA 4U0TA 5EECA 2EFXA 4BQMA 3C4OA 5EVIB 3BRMA 3NIAA 4OPZA 1KVMA 5TGFA 4IBRA 3Q7VA 4WMCA 1ESIA 1L0FA 1XGJA 5AQAA 3M6BA 4KZ3A 4EV4A 3C4PA 4K0XA 3BLMA 4KQQA 3V3RA 3Q82A 4LV1A 2H5SA 4DF6A 1WE4A 4MBHA 5G18A 1BLHA 2H0TA 3IT9A 5FQKA 4O7DA 3ZG0A 5FI6A 3SOIA 2ZM8A 4S2JA 4UAAA 2Z2LB 2Y2PA 4S2LA 3UPNA 3A3JA 5FASA 4OQ0A 1BUEA 2ZM2A 3BFFA 3HREA 4FSFA 3W8KA 5E2GA 1CEGA 4RVAA 4E6XA 1FCOA 1RP5A 1O7EA 3QHYA 4LENA 3HLWA 3QNCA 5GL9A 2Y2LA 3NC8A 2J9OA 5DTKA 3CZDA 3PBOA 3VSKA 5DVAA 2WGWB 1KGGA 5GHYA 4DRTA 1M40A 5A92A 1K4EA 3BM6A 3SH7A 3UPPA 1LLBA 4GDBA 4X53A 1BLPA 5BOHA 2XH9A 5TFQA 3A3EA 3VOYA 1N9BA 1RGZA 1K57A 1WYBA 3UDXA 1BLCA 2BG1A 1AXBA 2XEPA 1BT5A 4UA6A 2RL3A 4YFMA 1K54A 5CXWA 4N1XA 4A5RA 2FFYA 1G68A 2R9XA 3D4FA 4OOMA 1KE3A 4R0QA 5FQQA 3VP1A 1HD8A 1TDGA 3OZHA 1GHPA 4E3MA 5D3OA 4ZDXA 2WYXA 1JVJA 1FR6A 4OKPA 1W7FA 2WAFA 3ITAA 3TOIA 5A90A 4MNRA 2IWDA 2H0YA 5FQMA 1CK3A 1PIOA 3E2LA 1FSWA 5CGWA 4OPYA 5FQ9A 1K38A 4JXWA 1K55C 5L2FA 2E8IA 3N4IA 4ZTKA 2WKIA 3OPRA 2EXAA 3PAGA 4OQHA 3A3IA 1MWRA 3CJMA 3ZGAB 1XGIA 5CEDA 5HAQA 5KSCA 3G32A 4IBXA 4E3OA 1DY6A 5CHJA 4UHUA 2P9VB 5E2FA 1S0WA 1J9MA 1H8YA 4XUZA 5HL1A 1ES4A 1K25A 4E3KA 2C6WB 3DWZA 4KZBA 3UY6A 3TSGA 3G31A 5GLCA 1KGEA 1YLZA 2C5WB 2XD5A 3CMZA 4OQGA 4WBGA 5M1AA 1BSGA 5E43A 4CPKA 2ZM0A 3OPPA 4S2OA 3HLDA 1EROA 4GKUA 4E3IA 1FR1A 5HFOA 1IYQA 2ZJ9A 1SDNA 2EX8A 1PI5A 4BJPA 3ITBA 5GHZA 5DF7A 4N92A 1C3BA 2OSUA 1W79A 2PU4A 1SHVA 3LO7A 4PM7A 5EVLA 3OPLA 2ZC4B 1BLSA 3C7VA 4RX2A 5J8XA 3B3XA 4OP5A 2Y91A 4N9KA 2Z2MB 3ZG9B 1YLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQB A;  2Y59 A;  3VSL A;  4QU3 A;  3N7W A;  2ZD8 A;  1K55 A;  4JXS A;  5DF8 A;  3IF6 B;  2G2U A;  4K0W A;  4EQI A;  2Q9N A;  3AGE A;  3HUO A;  3HVF A;  3MKE A;  1KVL A;  3VOZ A;  1ZKJ A;  2DNS A;  3DW0 A;  4GB7 A;  3IWO A;  1ERQ A;  3EQU A;  5CGS A;  5CER A;  1LHY A;  4JXG A;  5FAO A;  2ZMA A;  5TR7 A;  3GSG A;  3E2K A;  3ZNT A;  2JC7 A;  1BTL A;  3VP2 A;  3BEB A;  2QMI A;  4ID4 A;  2VGJ A;  4KG6 A;  3N8S A;  3FYZ A;  5F83 A;  3TG9 A;  4XUX A;  4OLD A;  2HDU A;  4HBU A;  5F82 A;  5EOE A;  1FCN A;  4QB8 A;  4IED A;  1NYY A;  4X6T A;  1JTD A;  2J7V A;  1VM1 A;  3V5M A;  1ESU A;  2XF3 A;  3MXR A;  2WGV A;  4KG2 A;  1KE0 A;  2VGK A;  4WZ5 C;  3BFE A;  1EI5 A;  3FZC A;  5EVI D;  5FI7 A;  4P85 A;  3SS4 A;  3Q7V B;  1PWG A;  2EX2 A;  4EWF A;  3O3V A;  3UNW A;  4C75 A;  1PI4 A;  1W8Q A;  3BFG A;  2I72 A;  3UDI A;  1JWZ A;  1MY8 A;  1YQS A;  3BEC A;  2OLV A;  3Q1F A;  3MFD A;  3OPH A;  3WS5 A;  1ZG4 A;  4PM6 A;  4S2M A;  4EUZ A;  4MBF A;  4S2I A;  3GV9 A;  3UDF A;  3G34 A;  2OV5 A;  4RYE A;  2HP6 A;  2Y2Q A;  1L0G A;  2Y2I A;  3M2J A;  1JWP A;  4OPR A;  4KEN B;  4RA7 A;  1YM1 A;  2B5R A;  4RX3 A;  4ZJ2 A;  5I94 A;  2V2F F;  2XLN A;  1PW1 A;  2EXB A;  1K6R A;  2FFF B;  3G4P A;  1K56 A;  4OQI A;  4WZ5 A;  5GLA A;  3ZG8 B;  2HDQ A;  2P9V A;  1FCM A;  5E2H A;  1YMX A;  2ZC6 B;  1MKI A;  5U47 A;  3LY3 A;  3HLE A;  3GTC A;  4LV0 A;  3ZHH A;  2H10 A;  3IH9 A;  4JBF A;  2EFU A;  1GCE A;  2Y2G A;  1W5D A;  2JCH A;  3EQV A;  5CTN A;  4D2O A;  3IXH A;  2X01 A;  1YLT A;  1EWZ A;  1GHI A;  3PBS A;  5CEC A;  3Q7Z A;  5HAI A;  1ES5 A;  2WZX A;  5FAT A;  1K4F A;  2Y2O A;  4P6B A;  4DE1 A;  4FCF A;  2Y55 A;  3W4O A;  3VP0 A;  5HX9 A;  3G35 A;  4JLF A;  2V20 A;  3FKW A;  1E25 A;  4GZB A;  4WMC D;  2DCF A;  4KZA A;  4BD0 A;  5AQ7 A;  4R3J A;  3MKF A;  2ZQD A;  1E3U A;  3WRZ A;  3G2Z A;  1DJB A;  5DTT A;  1IYS A;  4DE0 A;  5DF9 A;  3IXB A;  4OH0 A;  2Y2J A;  3FV7 A;  5FSR A;  4R4R A;  3WS0 A;  4P0M A;  4QD4 A;  3ZCZ A;  2XDM A;  3LCE A;  1MWS A;  4JF4 A;  3MXS A;  4WEK A;  5JYP A;  4Z9Q A;  5M18 A;  5EOO A;  1ONH A;  3HLF A;  4LV2 A;  2OLU A;  4E3N A;  2WGW A;  1Z6F A;  1JTG A;  2HP9 A;  1BUL A;  2Q9M A;  3ZG7 B;  4Y0T A;  1XX2 A;  4OP8 A;  4H8R A;  5FDH A;  1I2W A;  2V1Z A;  5FAQ A;  1GA0 A;  4HBT A;  4QY5 A;  4WZ4 A;  5AQ9 A;  3ZFZ A;  2G2W A;  1M6K A;  3OC2 A;  3S1Y A;  4KZ4 A;  4DE2 A;  4KZ9 A;  1YLW A;  1ALQ A;  4GD8 A;  5A93 A;  4OOY A;  1LL9 A;  1L2S A;  4ZAM A;  1SCW A;  2XFT A;  3P09 A;  3PAE A;  4MBK A;  1N4O A;  5CRF A;  4LCL A;  5DTS A;  4GOG A;  1XA7 A;  2PU2 A;  3WS1 A;  1FOF A;  4KZ6 A;  4DE3 A;  4KQR A;  1ONG A;  1IEM A;  1MWT A;  1LI9 A;  2WGI A;  4IVK A;  1L0E A;  4DDY A;  4EBN A;  1PW8 A;  3FWL A;  3UE0 A;  1K54 C;  1CI9 A;  2DRW A;  2ZQ9 A;  4GDN A;  4JKT A;  3S4X A;  1KDW A;  5CEB A;  3VMA A;  4E3L A;  4Y0U A;  4OVD A;  4CJN A;  4QY6 A;  5GHX A;  4BL2 A;  5EVI C;  5EPH A;  3QNB A;  4ZJ3 A;  3NDE A;  4F94 A;  1W8Y A;  3HLC A;  1E4D A;  3A3D A;  5CHU A;  3GRJ A;  3NBL A;  3MZF A;  3SS5 A;  3W4Q A;  5EVI A;  4S2N C;  2JE5 A;  2X71 A;  3IWQ A;  1IYO A;  4X56 A;  4WEJ A;  1YLJ A;  1KGF A;  3Q07 A;  1K6S A;  3O86 A;  3OCN A;  1ES2 A;  3MBZ A;  1NJ4 A;  4KZ7 A;  4BLM A;  3WRT A;  1RGY A;  3FKV A;  4UA7 A;  3HUN A;  3GMW A;  2XD1 A;  1WYC A;  4R23 A;  1H8Z A;  3OCL A;  5FA7 A;  4EBL A;  3N8R A;  1IKI A;  4B4X A;  5CHM A;  1U60 A;  4L0L A;  3NCK A;  4DXC A;  2IWC A;  4YIN A;  2WAD A;  1K56 D;  5EE8 A;  4PM9 A;  1HTZ A;  4S2P A;  2X02 A;  1YT4 A;  1HVB A;  3RJU A;  3NDG A;  2ZC7 A;  4ZBE A;  3ZVT A;  3PBT A;  4PPR A;  1IYP A;  1XP4 A;  2ZC5 B;  3PBQ A;  5KSH A;  1K57 C;  1DJA A;  2Y2K A;  4KZ5 A;  2ZQ7 A;  3BFC A;  3O88 A;  2HP5 A;  1FQG A;  4JPM A;  3ZNY A;  4XXR A;  4OPQ A;  5GLB A;  4DDS A;  3IF6 A;  5HAR A;  1XKZ A;  3HLB A;  4R4S A;  2Y2H A;  4OON A;  1RCJ A;  1XPB A;  2WAE A;  3LY4 A;  2QZ6 A;  3C7U A;  4OLG A;  4R1G A;  1O07 A;  2XK1 A;  2P74 A;  3DWK A;  2WUQ A;  1ERM A;  2Y2M A;  2Y2N A;  3HLG A;  4DKI A;  4Y7P A;  4GNU A;  2WZZ A;  5GLD A;  2HDS A;  1PYY A;  3N6I A;  2J8Y A;  2ZQC A;  4Y0O A;  1BZA A;  3V50 A;  1DJC A;  2QPN A;  5CTM A;  3W4P A;  1NYM A;  3V3S A;  3ZDJ A;  5F1G A;  4ZJ1 A;  4U0X A;  1QME A;  1TDL A;  1FSY A;  3HL9 A;  2BLS A;  2XR0 A;  3IHB A;  4WEL A;  3P98 A;  3UN7 A;  5M19 A;  4KQO A;  1PWC A;  4P87 A;  5FAP A;  2RCX A;  1QMF A;  1S6R A;  4WM9 A;  4Q8I A;  4PM5 A;  5KMW A;  3IF6 C;  1LI0 A;  3IXG A;  1PZP A;  5A91 A;  3BLS A;  4QJG A;  2HPB A;  4PMA A;  3AGD A;  5F1F A;  1NZU A;  2PBY A;  3JYI A;  3SH8 A;  3VP3 A;  3GVB A;  1NZO A;  3IF5 A;  4PM8 A;  3V39 A;  3G2Y A;  3GQZ A;  1LL5 A;  3VP4 A;  1NY0 A;  2GDN A;  4M3K A;  3I7J A;  3O87 A;  3G30 A;  4OOL A;  5E2E A;  5FI2 A;  3MZD A;  3NY4 A;  3GR2 A;  3PTE A;  4BL3 A;  1YLP A;  1Q2P A;  2Y4A A;  4HEF A;  4JF6 A;  4WYY A;  5HAP A;  1Q2Q A;  2UWX A;  4FH4 A;  2EX6 A;  1TEM A;  4GD6 A;  4X55 A;  3UO9 A;  3PBN A;  4FH2 A;  2ZLY A;  3DTM A;  4EBP A;  4E3J A;  2IWB A;  5FQJ A;  3BYD A;  1E3U D;  3MZE A;  2CC1 A;  4DXB A;  1PWD A;  4K91 A;  4X68 A;  4C3Q A;  1IKG A;  3A3F A;  1SKF A;  3WWX A;  4B4Z A;  3HBR A;  5IHV A;  3IQA A;  1I5Q A;  3UE3 A;  3IWI A;  4E6W A;  3BFD A;  3VFH A;  3M2K A;  4C6Y A;  4R3B A;  2EX9 A;  1OME A;  1Y54 A;  2WK0 A;  4NET A;  3SH9 A;  1SDE A;  2ZC3 B;  2R9W A;  1CEF A;  2ZQ8 A;  2WKH A;  4JXV A;  5JYO A;  4IVI A;  3ZG5 A;  4KZ8 A;  4B88 A;  1JWV A;  4N1H A;  4BEN A;  5EUA A;  1ZG6 A;  1KDS A;  2A3U A;  4FD8 A;  4KG5 A;  2JBF A;  4QHC A;  4JF5 A;  1GA9 A;  2ZQA A;  2HDR A;  3S22 A;  3WS4 A;  3UE1 A;  1MXO A;  3C5A A;  3VFF A;  5KZH A;  3AGF A;  3ISG A;  3NI9 A;  4NK3 A;  1VQQ A;  3CG5 A;  5HW3 A;  4MLL A;  3LEZ A;  1XXM A;  1XA1 A;  4GN2 A;  1ZC2 A;  4S2N A;  1HZO A;  2WKE A;  5FQI A;  1MBL A;  4U3T A;  4UA9 A;  1I2S A;  3RXX A;  3HUM A;  4LCM A;  2J9P A;  2XFS A;  3SS3 A;  1IEL A;  3RXW A;  3ZVW A;  1L0D A;  1H5X A;  1KE4 A;  1MWU A;  1NRF A;  4LV3 A;  2A49 A;  3IHA A;  2XGN A;  3PBR A;  4N9L A;  3Q81 A;  4MEZ A;  3N8L A;  1MPL A;  5CGX A;  4S2K A;  1YMS A;  4BD1 A;  4HES A;  4X69 A;  3WS2 A;  3IH8 A;  1ES3 A;  1NXY A;  1PZO A;  1GHM A;  2XQZ A;  3M6H A;  3UPO A;  1CI8 A;  1G6A A;  1TVF A;  3IXD A;  4U0T A;  5EEC A;  2EFX A;  4BQM A;  3C4O A;  5EVI B;  3BRM A;  3NIA A;  4OPZ A;  1KVM A;  5TGF A;  4IBR A;  3Q7V A;  4WMC A;  1ESI A;  1L0F A;  1XGJ A;  5AQA A;  3M6B A;  4KZ3 A;  4EV4 A;  3C4P A;  4K0X A;  3BLM A;  4KQQ A;  3V3R A;  3Q82 A;  4LV1 A;  2H5S A;  4DF6 A;  1WE4 A;  4MBH A;  5G18 A;  1BLH A;  2H0T A;  3IT9 A;  5FQK A;  4O7D A;  3ZG0 A;  5FI6 A;  3SOI A;  2ZM8 A;  4S2J A;  4UAA A;  2Z2L B;  2Y2P A;  4S2L A;  3UPN A;  3A3J A;  5FAS A;  4OQ0 A;  1BUE A;  2ZM2 A;  3BFF A;  3HRE A;  4FSF A;  3W8K A;  5E2G A;  1CEG A;  4RVA A;  4E6X A;  1FCO A;  1RP5 A;  1O7E A;  3QHY A;  4LEN A;  3HLW A;  3QNC A;  5GL9 A;  2Y2L A;  3NC8 A;  2J9O A;  5DTK A;  3CZD A;  3PBO A;  3VSK A;  5DVA A;  2WGW B;  1KGG A;  5GHY A;  4DRT A;  1M40 A;  5A92 A;  1K4E A;  3BM6 A;  3SH7 A;  3UPP A;  1LLB A;  4GDB A;  4X53 A;  1BLP A;  5BOH A;  2XH9 A;  5TFQ A;  3A3E A;  3VOY A;  1N9B A;  1RGZ A;  1K57 A;  1WYB A;  3UDX A;  1BLC A;  2BG1 A;  1AXB A;  2XEP A;  1BT5 A;  4UA6 A;  2RL3 A;  4YFM A;  1K54 A;  5CXW A;  4N1X A;  4A5R A;  2FFY A;  1G68 A;  2R9X A;  3D4F A;  4OOM A;  1KE3 A;  4R0Q A;  5FQQ A;  3VP1 A;  1HD8 A;  1TDG A;  3OZH A;  1GHP A;  4E3M A;  5D3O A;  4ZDX A;  2WYX A;  1JVJ A;  1FR6 A;  4OKP A;  1W7F A;  2WAF A;  3ITA A;  3TOI A;  5A90 A;  4MNR A;  2IWD A;  2H0Y A;  5FQM A;  1CK3 A;  1PIO A;  3E2L A;  1FSW A;  5CGW A;  4OPY A;  5FQ9 A;  1K38 A;  4JXW A;  1K55 C;  5L2F A;  2E8I A;  3N4I A;  4ZTK A;  2WKI A;  3OPR A;  2EXA A;  3PAG A;  4OQH A;  3A3I A;  1MWR A;  3CJM A;  3ZGA B;  1XGI A;  5CED A;  5HAQ A;  5KSC A;  3G32 A;  4IBX A;  4E3O A;  1DY6 A;  5CHJ A;  4UHU A;  2P9V B;  5E2F A;  1S0W A;  1J9M A;  1H8Y A;  4XUZ A;  5HL1 A;  1ES4 A;  1K25 A;  4E3K A;  2C6W B;  3DWZ A;  4KZB A;  3UY6 A;  3TSG A;  3G31 A;  5GLC A;  1KGE A;  1YLZ A;  2C5W B;  2XD5 A;  3CMZ A;  4OQG A;  4WBG A;  5M1A A;  1BSG A;  5E43 A;  4CPK A;  2ZM0 A;  3OPP A;  4S2O A;  3HLD A;  1ERO A;  4GKU A;  4E3I A;  1FR1 A;  5HFO A;  1IYQ A;  2ZJ9 A;  1SDN A;  2EX8 A;  1PI5 A;  4BJP A;  3ITB A;  5GHZ A;  5DF7 A;  4N92 A;  1C3B A;  2OSU A;  1W79 A;  2PU4 A;  1SHV A;  3LO7 A;  4PM7 A;  5EVL A;  3OPL A;  2ZC4 B;  1BLS A;  3C7V A;  4RX2 A;  5J8X A;  3B3X A;  4OP5 A;  2Y91 A;  4N9K A;  2Z2M B;  3ZG9 B;  1YLY A; 
#chains in the Genus database with same CATH topology
 3VSL A;  2NUT C;  4QU3 A;  2ZD8 A;  4JXS A;  4EQI A;  2B18 A;  1YPR A;  3HVF A;  3MKE A;  4GB7 A;  3CIT A;  1LHY A;  4JXG A;  2JC7 A;  1BTL A;  3VP2 A;  4KG6 A;  3FYZ A;  2QKP A;  3TG9 A;  1PFL A;  4HJ4 A;  3IS2 A;  1VM1 A;  2KOI A;  4KG2 A;  4WZ5 C;  2VGK A;  1EI5 A;  3F1N A;  4ME4 A;  3BFG A;  3BEC A;  5KIZ A;  1T19 A;  3EOI A;  2PHY A;  3G34 A;  2HP6 A;  2Y2Q A;  1H0M A;  2B5R A;  4AFI A;  4RX3 A;  2W3H A;  4YWZ A;  4ZJ2 A;  5I94 A;  1PW1 A;  2EXB A;  5GLA A;  1AWI A;  2ZC6 B;  1MKI A;  4JBF A;  3CAX A;  2EFU A;  1GCE A;  4MCW A;  3IXH A;  1EWZ A;  1GHI A;  1ES5 A;  1K4F A;  2Y55 A;  3W4O A;  5HX9 A;  3G35 A;  4HP4 A;  4Y3I A;  2V20 A;  4GZB A;  4WMC D;  1TS6 A;  1T1B A;  3EGX C;  5DTT A;  1OTD A;  4OH0 A;  2Y2J A;  3FC7 A;  2VGL M;  4QWO A;  4JGQ A;  3ZCZ A;  4Z9Q A;  2XRO A;  5EOO A;  2QJ7 A;  4HH3 A;  3ZG7 B;  1FIL A;  4H8R A;  5FAQ A;  3L9K A;  2W1T B;  5K5B A;  2V0U A;  3OC2 A;  3S1Y A;  5CX7 A;  4KZ4 A;  5HSQ A;  4GD8 A;  5EV0 A;  3P09 A;  1FOF A;  4KZ6 A;  3FWL A;  2HJ9 C;  3K3D A;  5HL6 A;  5GHX A;  1F5M A;  2M1C A;  3QNB A;  4ZJ3 A;  4F94 A;  2AVX A;  5FL3 A;  4HJ6 A;  3A3D A;  1W63 Q;  5HPF A;  3Q07 A;  3O86 A;  3OCN A;  2PR6 A;  2J3T D;  3V67 A;  3WRT A;  1RGY A;  5TJJ A;  3GMW A;  1U60 A;  4L0L A;  4DXC A;  3QP5 A;  1K56 D;  1P9W A;  4ESP A;  5EE8 A;  2X02 A;  3OBF A;  1YT4 A;  2OAP 1;  2ZC7 A;  1DJA A;  3QP1 A;  4R6L A;  4LFU A;  3BFC A;  4JPM A;  3HJI A;  4XXR A;  5GLB A;  3HLB A;  4R4S A;  5IU1 A;  1GSV A;  2Y2H A;  2W3D A;  3LIC A;  4LPZ A;  1RCJ A;  1VHM A;  1XPB A;  3LY4 A;  1W63 M;  1LL8 A;  4R1G A;  3EWK A;  2WUQ A;  3LYX A;  1SKO A;  2ZQC A;  1BZA A;  3NOT C;  3ZDJ A;  1FSY A;  2XR0 A;  3IHB A;  3RTY A;  3BWL A;  1PWC A;  4Q8I A;  3VE4 A;  1F98 A;  5F1F A;  2PBY A;  4JGR A;  1OT6 A;  3A0R A;  2D01 A;  3IX3 A;  3T4K A;  1LL5 A;  3H9W A;  3UB8 A;  1NY0 A;  4OOL A;  4PKY A;  1G5U A;  3GR2 A;  1YLP A;  5L07 A;  2UWX A;  2PT7 A;  1TEM A;  4L9E A;  3IBR A;  2ZLY A;  5DJU A;  5FQJ A;  3BYD A;  2PRF A;  1OTE A;  4X68 A;  3HBR A;  2O0Y A;  3M2K A;  3VV4 A;  4R3B A;  1Y54 A;  2PYR A;  5L09 A;  3C30 A;  4HY8 A;  4JXV A;  1JWV A;  3CPT B;  4BEN A;  3KSG A;  4FD8 A;  2JBF A;  2O9C A;  5L10 A;  4BBU A;  2ZQA A;  3T1Q B;  2HDR A;  2VGL S;  4Q0H A;  3S22 A;  5KZH A;  3TE8 A;  1XA1 A;  4GN2 A;  3D3O A;  1MBL A;  1I2S A;  3SS3 A;  3MXQ A;  4B9O A;  1KE4 A;  1MWU A;  4JGO A;  4O01 A;  2A49 A;  3IHA A;  4N9L A;  4MEZ A;  3N8L A;  3BW6 A;  3NHQ A;  4S2K A;  4BD1 A;  4HES A;  3WS2 A;  1ES3 A;  1GHM A;  2XQZ A;  4EES A;  3CLO A;  5EEC A;  3P7N A;  4ZRR A;  4BQM A;  5TBM A;  3C4O A;  5EVI B;  3BRM A;  3NIA A;  3Q7V A;  3UB5 P;  5A8B A;  4I5S A;  3M6B A;  4EV4 A;  3C4P A;  4MN6 A;  4DF6 A;  5G18 A;  4HIA A;  3E98 A;  3ZG0 A;  3SW1 A;  2Y2P A;  3MFX A;  1BUE A;  3BFF A;  1CEG A;  1FCO A;  3MQO A;  3HLW A;  4EER A;  1NLY A;  2J3W A;  4DRT A;  1M40 A;  1K4E A;  3BM6 A;  3F1N B;  2OWJ A;  3UPP A;  3LR5 A;  4X53 A;  5TFQ A;  1RGZ A;  2QYB A;  3UDX A;  1BLC A;  3U2A A;  1K54 A;  4R0Q A;  1G68 A;  5FQQ A;  3VP1 A;  1TDG A;  3EEH A;  3OZH A;  1GHP A;  2WYX A;  1JVJ A;  2VV7 A;  4OKP A;  1WA9 A;  1K38 A;  2WKQ A;  4JXW A;  3S7Q A;  2E8I A;  3A3I A;  3CJM A;  3ZGA B;  5HAQ A;  5J3W A;  3G32 A;  1DY6 A;  1YAX A;  4XUZ A;  1ES4 A;  2C5W B;  2XD5 A;  3L7H A;  4II7 A;  1BSG A;  3OPP A;  1STZ A;  4GKU A;  2W3E A;  1SDN A;  4GCZ A;  1D1J A;  1C3B A;  4O0P A;  5G4Z A;  4GLQ A;  2PU4 A;  1SHV A;  1BLS A;  4RX2 A;  2Y91 A;  4N9K A;  2Z2M B;  3KO6 A;  3JVV A;  3N7W A;  1K55 A;  5DF8 A;  4K0W A;  2V1A A;  2EWW A;  3AGE A;  3A0V A;  1Y28 A;  2DNS A;  3E4Q A;  1ERQ A;  3ZNT A;  1UWP X;  3T1X A;  1Y4O A;  3H7W A;  4X25 A;  3CPT A;  3GEC A;  5F83 A;  4F3L B;  1FCN A;  2XSS A;  1ESU A;  4IHQ A;  2XF3 A;  1KE0 A;  3DBA A;  3BFE A;  3FZC A;  3SS4 A;  1TS8 A;  2EX2 A;  1YQS A;  1MY8 A;  1N9L A;  3OPH A;  4MBF A;  4S2I A;  3UDF A;  3CWF A;  2OV5 A;  3T12 B;  3PXP A;  1L0G A;  1TD5 A;  1JWP A;  4KEN B;  4RA7 A;  3G4P A;  4EQ1 A;  4OQI A;  3ZHH A;  2H10 A;  3IH9 A;  1W5D A;  2JCH A;  1YLT A;  4PAU A;  2VEA A;  3DAV A;  4KQD A;  3T4J A;  4RQ9 A;  4JLF A;  3F1O B;  3KYQ A;  2E8J A;  2DCF A;  3OLO A;  3WRZ A;  1DJB A;  1F9I A;  4G3V A;  5DF9 A;  3IXB A;  4HI4 A;  2OWH A;  4Y13 A;  3WS0 A;  4P0M A;  4JF4 A;  3MXS A;  1N9O A;  3HLF A;  4LV2 A;  2OLU A;  4E3N A;  2WGW A;  1Z6F A;  5C5K A;  1XX2 A;  5EM1 A;  2VJW A;  1G6O A;  4OP8 A;  2V1Z A;  4HBT A;  4R38 A;  3ZFZ A;  2KLI A;  4DE2 A;  2V0W A;  4KZ9 A;  3LI9 A;  1YLW A;  3NJA A;  5A93 A;  3HJK A;  2OOL A;  4G3W A;  4MBK A;  1N4O A;  5CRF A;  4CLC D;  4LCL A;  1S67 L;  2PU2 A;  2ZL1 A;  4DJ3 A;  1IEM A;  4WN5 A;  1LSV A;  1MWT A;  1LI9 A;  5DFY A;  2DRW A;  2ZQ9 A;  4JKT A;  5CEB A;  4NXG A;  4QY6 A;  4BL2 A;  5EVI C;  2V1B A;  2PD7 A;  4CQH A;  1UWN X;  3NDE A;  1ZHH B;  3QP4 A;  5CHU A;  3GDI A;  3NBL A;  3MZF A;  4CLC B;  1YLJ A;  1XJ6 A;  1NJ4 A;  2PR5 A;  3KSI A;  3S7P A;  5MC7 A;  3HUN A;  4YOF A;  3KYE A;  4R23 A;  5FA7 A;  1H8Z A;  4EBL A;  3LID A;  3N8R A;  5CHM A;  2HV1 A;  4YIN A;  2WAD A;  2W0N A;  4PM9 A;  1HTZ A;  4S2P A;  1HVB A;  3PBQ A;  2Y2K A;  3K3C A;  4KZ5 A;  2ZQ7 A;  4KUO A;  2P04 A;  1YSQ A;  1FQG A;  1GSW A;  4OPQ A;  3FG8 A;  3IF6 A;  5HAR A;  1XKZ A;  4OON A;  2I9V A;  2INW A;  2WAE A;  3C7U A;  1P97 A;  3NOP C;  4OLG A;  1O07 A;  2Y2M A;  3HLG A;  1NWZ A;  5L8M A;  2HDS A;  1PYY A;  3N6I A;  2J8Y A;  4LLO B;  3V50 A;  2QPN A;  4ZJ1 A;  1SZV A;  1QME A;  1TDL A;  2BLS A;  3P98 A;  5M19 A;  1VEU A;  1S6R A;  1PZP A;  4QJG A;  2HPB A;  4PMA A;  4BMW A;  1NZU A;  1OTA A;  3JYI A;  3IF5 A;  1YSP A;  4I3J A;  2Z6D A;  3GQZ A;  2JKG A;  3UB9 A;  3VP4 A;  1OJ5 A;  4MMN A;  3O87 A;  2W3G A;  3G30 A;  3MZD A;  3NY4 A;  4BL3 A;  4JF6 A;  2VA0 A;  1DRM A;  4BWI A;  4GD6 A;  4X55 A;  4R70 A;  4FH2 A;  1G28 A;  2IWB A;  3MZE A;  2CC1 A;  4ARZ B;  2WKP A;  3A3F A;  3WWX A;  3IQA A;  1I5Q A;  2LB9 A;  3KYZ A;  4C6Y A;  3IX4 A;  1Z09 A;  1VEU B;  3SH9 A;  1SDE A;  2Q0O A;  1A0K A;  5HWV A;  4B93 A;  4F3L A;  4IVI A;  4EXO A;  4B88 A;  4KG5 A;  1GA9 A;  1MXO A;  3VFF A;  3ISG A;  3W2Z A;  3NI9 A;  1VQQ A;  4MLL A;  3LEZ A;  1ZC2 A;  2M7U A;  5FQI A;  4LCM A;  2D02 A;  2MJ6 A;  1IEL A;  3T4S A;  1L0D A;  4UQI S;  4LV3 A;  2W27 A;  4MN5 A;  3PBR A;  3Q81 A;  1CF0 A;  4Z1W A;  4HOI A;  1PZO A;  2V9A A;  3LR3 A;  3UPO A;  1G6A A;  1CI8 A;  4Y5F A;  3T1R A;  3IX8 A;  4OPZ A;  1LT0 A;  1ESI A;  1L0F A;  1XGJ A;  3T4Q A;  2VLG A;  1VET B;  2V8F A;  4K0X A;  2JKR I;  4KQQ A;  3V3R A;  4LV1 A;  4Q0J A;  5AJG A;  3IT9 A;  5FQK A;  4O7D A;  1T18 A;  2PBD P;  5FAS A;  4YNR A;  3B42 A;  1VET A;  3PR6 A;  4FSF A;  2KDK A;  3MQ0 A;  3QNC A;  3DTI A;  5GL9 A;  2Y2L A;  2V8C A;  3S7N A;  3NC8 A;  2J9O A;  5DTK A;  2WGW B;  5GHY A;  3SH7 A;  4GDB A;  2XH9 A;  4GHI B;  3BY9 A;  1BT5 A;  4UA6 A;  2RL3 A;  4NKP A;  4OOM A;  5HDC A;  1HD8 A;  4E3M A;  1OJG A;  3F1O A;  5HPI A;  3ITA A;  3TOI A;  2JKT I;  1FSW A;  1TF1 A;  1NLZ A;  4NXF A;  4WLA A;  5L2F A;  4P6Z S;  3OPR A;  5FDS A;  5KSC A;  2FZ0 A;  4IBX A;  4E3O A;  5EFW A;  5CHJ A;  4DJ2 A;  1VB6 A;  5HZH A;  3UY6 A;  3BQA A;  1YLZ A;  1IOU A;  3CMZ A;  4OQG A;  5M1A A;  4CPK A;  3HLD A;  4HHD A;  4E3I A;  1FR1 A;  5HFO A;  4BJP A;  3ITB A;  5GHZ A;  5LBR A;  5F68 A;  4N92 A;  3LO7 A;  4IJG A;  2ZC4 B;  4H6J B;  3C7V A;  5J8X A;  3B3X A;  2VX8 A;  3ZG9 B;  1YLY A;  2Y59 A;  3R7W A;  2KX6 A;  2Q9N A;  4PKY G;  3HUO A;  4FOF A;  1KVL A;  3DW0 A;  1S4S A;  3IWO A;  1BYW A;  3EQU A;  5CGS A;  5TR7 A;  3GSG A;  3LIF A;  3BEB A;  2QMI A;  3R7W B;  4XUX A;  2W3F A;  2LB5 A;  1S1Y A;  5F82 A;  1ODV A;  4QB8 A;  2VZW A;  1NYY A;  3ICY A;  4X6T A;  1JTD A;  2GZA A;  3MXR A;  3UE6 A;  1V9Y A;  5EVI D;  5FI7 A;  3LIE A;  4EU0 A;  2B95 A;  3O3V A;  3UNW A;  3T50 A;  4C75 A;  3Q1F A;  2PD8 A;  3MFD A;  4S2M A;  3O5Y A;  5HD3 A;  5DFX A;  3KX0 X;  4RYE A;  2A24 B;  4GW9 A;  4OPR A;  4LRX C;  3T4T A;  4WZ5 A;  1K56 A;  3ZG8 B;  1FCM A;  1F2K A;  3C2W A;  5E2H A;  5U47 A;  3HLE A;  4LV0 A;  4D2O A;  4IUH A;  3EQV A;  3TW8 A;  3PBS A;  4BBT A;  2Y2O A;  3NEC A;  3A0S A;  4FCF A;  5J4E A;  4HH2 A;  3MSH A;  2HJE A;  5F69 A;  1DP9 A;  3FKW A;  1E25 A;  2JHE A;  4KZA A;  3T1S A;  5AQ7 A;  2O9B A;  1LSW A;  1E3U A;  1IYS A;  2O99 A;  3FV7 A;  4KUK A;  1SKO B;  4WEK A;  5JYP A;  1BUL A;  3VE3 A;  5FDH A;  1I2W A;  2Y8H A;  4E04 A;  4QY5 A;  4WZ4 A;  4G3K A;  3ZQ5 A;  2G2W A;  4EUV A;  3QP6 A;  1P9R A;  4OOY A;  1L2S A;  4ZAM A;  1SCW A;  1XA7 A;  4DE3 A;  4KQR A;  1ONG A;  4EBN A;  4GS9 A;  3UE0 A;  1K54 C;  3VMA A;  4E3L A;  4Y0U A;  2VV8 A;  4HQA A;  1P0Z A;  1W8Y A;  5J7E A;  3HLC A;  1E4D A;  5TBM B;  2B02 A;  1OT9 A;  4CLC A;  2JE5 A;  2X71 A;  4X56 A;  1IYO A;  4WEJ A;  2J3T C;  4O8G A;  2P7J A;  4ARZ A;  1K6S A;  1ES2 A;  4KZ7 A;  4UA7 A;  2XD1 A;  4I38 A;  3TRC A;  4B4X A;  2IWC A;  2UV0 E;  2XRN A;  3NDG A;  3ZVT A;  1IYP A;  1MC0 A;  2ZC5 B;  5KSH A;  1K57 C;  4D60 A;  1ACF A;  1V9Z A;  3O88 A;  3ZNY A;  2A24 A;  2L0W A;  4Y15 A;  2QZ6 A;  2XK1 A;  2P74 A;  3DWK A;  3NOU C;  4DKI A;  4GNU A;  4X1L A;  5CTM A;  4L9G A;  3W4P A;  1NYM A;  2VKS A;  3HL9 A;  3CUE C;  2JKF A;  4WEL A;  3UN7 A;  4ETZ A;  4KQO A;  2HF6 A;  4P87 A;  4PM5 A;  4WM9 A;  3IF6 C;  1LI0 A;  1XFQ A;  3IXG A;  5A91 A;  3BLS A;  2NUP C;  4I3A A;  3SH8 A;  3GVB A;  4PM8 A;  1UGU A;  2YKH A;  1T1A A;  3HCY A;  5EM0 A;  5AVF A;  4CLC C;  4M3K A;  1DP8 A;  1Q2P A;  1DP6 A;  2Y4A A;  1XJ2 A;  1Q2Q A;  2ZL1 B;  1XJ4 A;  2GJ3 A;  3DTM A;  4EBP A;  4E3J A;  4DN0 A;  4DXB A;  1K0K A;  4C3Q A;  2PDR A;  1IKG A;  1SKF A;  4B4Z A;  3IWI A;  3BFD A;  2WK0 A;  2ZC3 B;  2GX5 A;  2R9W A;  2WKH A;  3VOL A;  4KZ8 A;  4N1H A;  4Y17 A;  3P01 A;  1ZG6 A;  3D72 A;  3LEQ A;  4JF5 A;  3H7W B;  3WS4 A;  4GJ4 A;  3C5A A;  4I3I A;  3UE1 A;  3AGF A;  4NK3 A;  3LIA A;  4HP9 A;  4U3T A;  4UA9 A;  3RXX A;  3HUM A;  2XFS A;  1MZU A;  3LR4 A;  3RXW A;  2K7S A;  2XGN A;  5AVE A;  5EVE A;  5CGX A;  1YMS A;  5FEF A;  1OTI A;  2Z6C A;  3C38 A;  1TVF A;  2IA2 A;  4U0T A;  1N9N A;  2EFX A;  5IS1 A;  1GSX A;  4KZ3 A;  2BTF P;  1LSX A;  3Q82 A;  2H5S A;  3PYP A;  1WE4 A;  1BLH A;  1NRJ A;  4S2J A;  4UAA A;  2Z2L B;  3SZT A;  3UPN A;  4OQ0 A;  2ZM2 A;  1FIK A;  3W8K A;  2WKR A;  5E2G A;  2PAV P;  4RVA A;  1RP5 A;  1O7E A;  4LEN A;  2QWS A;  3E0Y A;  2OAQ 1;  4CLC E;  4LGW A;  3CZD A;  3PBO A;  5DVA A;  3MQQ A;  1KGG A;  5A92 A;  5BOH A;  1BLP A;  4WF0 A;  4NEE D;  2FH5 A;  3JVU A;  1N9B A;  3KSF A;  1CJF A;  2BG1 A;  1TS0 A;  4IUK A;  5CXW A;  4N1X A;  2R9X A;  1KE3 A;  1L3L A;  3QP2 A;  1FR6 A;  2WAF A;  4MNR A;  1PIO A;  4UQI M;  5CGW A;  5FQ9 A;  4OPY A;  5DKK A;  1K55 C;  3UME A;  3N4I A;  2WKI A;  3E4O A;  3PAG A;  4OQH A;  1EW0 A;  1XGI A;  2VV6 A;  5CED A;  3B47 A;  3MJQ A;  1S4R A;  2PYP A;  4UHU A;  1IFQ A;  1K25 A;  4E3K A;  1CQA A;  4Q0I A;  3DWZ A;  4KZB A;  5DKL A;  4WBG A;  2ZM0 A;  4S2O A;  1ERO A;  2HGV A;  2ZJ9 A;  3CUE A;  5DF7 A;  3MF0 A;  3BY8 A;  2OSU A;  1PNE A;  1T1C A;  4PM7 A;  3IBJ A;  4OP5 A;  2R78 A;  3RFB A;  1XJ3 A;  5AQB A;  3IF6 B;  2G2U A;  4WL9 A;  4WUJ A;  3VOZ A;  1ZKJ A;  5CER A;  5FAO A;  2ZMA A;  3PHY A;  3E2K A;  3LI8 A;  4ID4 A;  2VGJ A;  1H3Q A;  3N8S A;  1PRQ A;  4OLD A;  2HDU A;  4HBU A;  5EOE A;  4IED A;  2ZMF A;  1KOU A;  2J7V A;  3H82 A;  3V5M A;  2WGV A;  2K31 A;  4NXE A;  5FEG A;  4P85 A;  3Q7V B;  1PWG A;  2BAS A;  4EWF A;  4FTX A;  2JN7 A;  1PI4 A;  1W8Q A;  2I72 A;  3UDI A;  1JWZ A;  4EEP A;  2OLV A;  1D06 A;  3D9Y A;  3WS5 A;  1ZG4 A;  4PM6 A;  4EUZ A;  3GV9 A;  4QPR A;  3MMH A;  2Y2I A;  3M2J A;  1YM1 A;  2CMN A;  2V2F F;  2W1R A;  2XLN A;  2FFF B;  1K6R A;  4L9F A;  3T4O A;  3ZYT A;  2HDQ A;  2HZ5 A;  2P9V A;  1YMX A;  3LY3 A;  3GTC A;  5CTN A;  2Y2G A;  2X01 A;  5CEC A;  3Q7Z A;  5HAI A;  2WZX A;  5FAT A;  4P6B A;  4DE1 A;  1D7E A;  3VP0 A;  3F1P A;  4BD0 A;  4R3J A;  3MKF A;  4UEY A;  2ZQD A;  3G2Z A;  4DE0 A;  4LRZ E;  5FSR A;  4R4R A;  3LGO A;  4EW7 A;  4QD4 A;  3FPV A;  2XDM A;  3LCE A;  1MWS A;  1MKM A;  5M18 A;  1ONH A;  1JTG A;  2HP9 A;  2Q9M A;  4Y0T A;  4XT2 A;  4Y2F A;  4JGP A;  1GA0 A;  3E4P A;  4GS9 B;  5AQ9 A;  3EGD C;  1M6K A;  3EEA A;  1ALQ A;  1LL9 A;  2H28 A;  2XFT A;  3PAE A;  2G7U A;  5DTS A;  4GOG A;  3WS1 A;  2WGI A;  4DDY A;  4IVK A;  1L0E A;  1PW8 A;  1CI9 A;  4GDN A;  3S4X A;  1KDW A;  4OVD A;  4CJN A;  5EPH A;  2JKR M;  3GRJ A;  3W4Q A;  3LUQ A;  3SS5 A;  5EVI A;  2XA7 S;  4S2N C;  3IWQ A;  1KGF A;  1ZTU A;  3MBZ A;  4BLM A;  3FKV A;  1WYC A;  3OCL A;  3UB7 A;  1IKI A;  3NCK A;  4K08 A;  2ACG A;  5HWT A;  3RJU A;  3DTE A;  3MS6 A;  4ZBE A;  3PBT A;  4PPR A;  1XP4 A;  1H8M A;  2HP5 A;  1TS7 A;  4DDS A;  5IT5 A;  3CHW P;  4EET B;  2QJ5 A;  2ZMV A;  5HDS A;  4LRY C;  1S66 L;  1ERM A;  2W1T A;  2L1M A;  2Y2N A;  4Y7P A;  4H6J A;  2WZZ A;  4EEU A;  5GLD A;  4Y0O A;  4NXB A;  1DJC A;  2ZBB A;  3MR0 A;  2DMW A;  3V3S A;  5F1G A;  4U0X A;  3FPW A;  5FAP A;  5KMW A;  2RCX A;  1QMF A;  4HNB A;  1J3W A;  2ZOI A;  3LR0 A;  3AGD A;  3VP3 A;  1HLU P;  1NZO A;  3LIB A;  3UB6 A;  3V39 A;  3G2Y A;  2GDN A;  3I7J A;  3DTK A;  5E2E A;  5FI2 A;  3PTE A;  5HAP A;  4WYY A;  4HEF A;  4BBV A;  4FH4 A;  2EX6 A;  4MDZ A;  3UO9 A;  3PBN A;  1E3U D;  1PWD A;  4K91 A;  5IHV A;  3UE3 A;  4E6W A;  3VFH A;  2EX9 A;  1OME A;  3B33 A;  4NET A;  4XT2 B;  3K2N A;  1CEF A;  2ZQ8 A;  5DJT A;  5JYO A;  5HWW A;  3ZG5 A;  5EUA A;  2XA7 M;  4R3A A;  1KDS A;  2A3U A;  4QHC A;  5F6A A;  3IS2 B;  2EA9 A;  2Y79 A;  1S1Z A;  4DMZ A;  3RH8 B;  1YKD A;  3CG5 A;  5HW3 A;  1XXM A;  2GNX A;  4S2N A;  1HZO A;  2WKE A;  3TJZ C;  4X1M A;  4FUW A;  2J9P A;  3ULF A;  3ZVW A;  1H5X A;  3CI6 A;  1NRF A;  2ZOH A;  3U4L P;  4P6Z M;  5I5L A;  2EWV A;  1MPL A;  4X69 A;  4PHT A;  3IH8 A;  1NXY A;  3T4L A;  3M6H A;  3BJN A;  3IXD A;  1KVM A;  3F1P B;  5TGF A;  2L4R A;  4IBR A;  4WMC A;  5AQA A;  3LFV A;  3BLM A;  3OOV A;  4M4X A;  4MBH A;  2H0T A;  5FI6 A;  3SOI A;  2ZM8 A;  1XFN A;  4S2L A;  3A3J A;  2P08 A;  3HRE A;  4E6X A;  3QHY A;  3R4K A;  4NG2 A;  2YKF A;  3VSK A;  4ETX A;  4I39 A;  5G4Y A;  2A2L A;  1LLB A;  3A3E A;  3VOY A;  1OTB A;  1K57 A;  1WYB A;  1AXB A;  2XEP A;  3BQ8 A;  2VK3 A;  4YFM A;  3H82 B;  4A5R A;  2FFY A;  1OPX A;  3D4F A;  5HD5 A;  4ZDX A;  5D3O A;  1JNU A;  2M7V A;  3G6O A;  1W7F A;  2JKT M;  3UMD A;  5A90 A;  3NUL A;  2IWD A;  2H0Y A;  5FQM A;  5F5Y A;  1CK3 A;  1X0O A;  3E2L A;  5HDD A;  2J80 A;  2QHK A;  3QP8 A;  4ZTK A;  2EXA A;  1MWR A;  2K2N A;  2P9V B;  5E2F A;  1S0W A;  4HJ3 A;  1J9M A;  1H8Y A;  5HL1 A;  2C6W B;  3JPU A;  3TSG A;  3G31 A;  5GLC A;  1KGE A;  5E43 A;  1IYQ A;  2EX8 A;  4MN7 A;  1PI5 A;  3C8C A;  3KSH A;  2O9A A;  3S7O A;  1W79 A;  4GHI A;  5EVL A;  3OPL A; 
#chains in the Genus database with same CATH homology
 5AQB A;  2Y59 A;  3VSL A;  4QU3 A;  3N7W A;  2ZD8 A;  1K55 A;  4JXS A;  5DF8 A;  3IF6 B;  2G2U A;  4K0W A;  4EQI A;  2Q9N A;  3AGE A;  3HUO A;  3HVF A;  3MKE A;  1KVL A;  3VOZ A;  1ZKJ A;  2DNS A;  3DW0 A;  4GB7 A;  3IWO A;  1ERQ A;  3EQU A;  5CGS A;  5CER A;  1LHY A;  4JXG A;  5FAO A;  2ZMA A;  5TR7 A;  3GSG A;  3E2K A;  3ZNT A;  2JC7 A;  1BTL A;  3VP2 A;  3BEB A;  2QMI A;  4ID4 A;  2VGJ A;  4KG6 A;  3N8S A;  3FYZ A;  5F83 A;  3TG9 A;  4XUX A;  4OLD A;  2HDU A;  4HBU A;  5F82 A;  5EOE A;  1FCN A;  4QB8 A;  4IED A;  1NYY A;  4X6T A;  1JTD A;  2J7V A;  1VM1 A;  3V5M A;  1ESU A;  2XF3 A;  3MXR A;  2WGV A;  4KG2 A;  1KE0 A;  2VGK A;  4WZ5 C;  3BFE A;  1EI5 A;  3FZC A;  5EVI D;  5FI7 A;  4P85 A;  3SS4 A;  3Q7V B;  1PWG A;  2EX2 A;  4EWF A;  3O3V A;  3UNW A;  4C75 A;  1PI4 A;  1W8Q A;  3BFG A;  2I72 A;  3UDI A;  1JWZ A;  1MY8 A;  1YQS A;  3BEC A;  2OLV A;  3Q1F A;  3MFD A;  3OPH A;  3WS5 A;  1ZG4 A;  4PM6 A;  4S2M A;  4EUZ A;  4MBF A;  4S2I A;  3GV9 A;  3UDF A;  3G34 A;  2OV5 A;  4RYE A;  2HP6 A;  2Y2Q A;  1L0G A;  2Y2I A;  3M2J A;  1JWP A;  4OPR A;  4KEN B;  4RA7 A;  1YM1 A;  2B5R A;  4RX3 A;  4ZJ2 A;  5I94 A;  2V2F F;  2XLN A;  1PW1 A;  2EXB A;  1K6R A;  2FFF B;  3G4P A;  1K56 A;  4OQI A;  4WZ5 A;  5GLA A;  3ZG8 B;  2HDQ A;  2P9V A;  1FCM A;  5E2H A;  1YMX A;  2ZC6 B;  1MKI A;  5U47 A;  3LY3 A;  3HLE A;  3GTC A;  4LV0 A;  3ZHH A;  2H10 A;  3IH9 A;  4JBF A;  2EFU A;  1GCE A;  2Y2G A;  1W5D A;  2JCH A;  3EQV A;  5CTN A;  4D2O A;  3IXH A;  2X01 A;  1YLT A;  1EWZ A;  1GHI A;  3PBS A;  5CEC A;  3Q7Z A;  5HAI A;  1ES5 A;  2WZX A;  5FAT A;  1K4F A;  2Y2O A;  4P6B A;  4DE1 A;  4FCF A;  2Y55 A;  3W4O A;  3VP0 A;  5HX9 A;  3G35 A;  4JLF A;  2V20 A;  3FKW A;  1E25 A;  4GZB A;  4WMC D;  2DCF A;  4KZA A;  4BD0 A;  5AQ7 A;  4R3J A;  3MKF A;  2ZQD A;  1E3U A;  3WRZ A;  3G2Z A;  1DJB A;  5DTT A;  1IYS A;  4DE0 A;  5DF9 A;  3IXB A;  4OH0 A;  2Y2J A;  3FV7 A;  5FSR A;  4R4R A;  3WS0 A;  4P0M A;  4QD4 A;  3ZCZ A;  2XDM A;  3LCE A;  1MWS A;  4JF4 A;  3MXS A;  4WEK A;  5JYP A;  4Z9Q A;  5M18 A;  5EOO A;  1ONH A;  3HLF A;  4LV2 A;  2OLU A;  4E3N A;  2WGW A;  1Z6F A;  1JTG A;  2HP9 A;  1BUL A;  2Q9M A;  3ZG7 B;  4Y0T A;  1XX2 A;  4OP8 A;  4H8R A;  5FDH A;  1I2W A;  2V1Z A;  5FAQ A;  1GA0 A;  4HBT A;  4QY5 A;  4WZ4 A;  5AQ9 A;  3ZFZ A;  2G2W A;  1M6K A;  3OC2 A;  3S1Y A;  4KZ4 A;  4DE2 A;  4KZ9 A;  1YLW A;  1ALQ A;  4GD8 A;  5A93 A;  4OOY A;  1LL9 A;  1L2S A;  4ZAM A;  1SCW A;  2XFT A;  3P09 A;  3PAE A;  4MBK A;  1N4O A;  5CRF A;  4LCL A;  5DTS A;  4GOG A;  1XA7 A;  2PU2 A;  3WS1 A;  1FOF A;  4KZ6 A;  4DE3 A;  4KQR A;  1ONG A;  1IEM A;  1MWT A;  1LI9 A;  2WGI A;  4IVK A;  1L0E A;  4DDY A;  4EBN A;  1PW8 A;  3FWL A;  3UE0 A;  1K54 C;  1CI9 A;  2DRW A;  2ZQ9 A;  4GDN A;  4JKT A;  3S4X A;  1KDW A;  5CEB A;  3VMA A;  4E3L A;  4Y0U A;  4OVD A;  4CJN A;  4QY6 A;  5GHX A;  4BL2 A;  5EVI C;  5EPH A;  3QNB A;  4ZJ3 A;  3NDE A;  4F94 A;  1W8Y A;  3HLC A;  1E4D A;  3A3D A;  5CHU A;  3GRJ A;  3NBL A;  3MZF A;  3SS5 A;  3W4Q A;  5EVI A;  4S2N C;  2JE5 A;  2X71 A;  3IWQ A;  1IYO A;  4X56 A;  4WEJ A;  1YLJ A;  1KGF A;  3Q07 A;  1K6S A;  3O86 A;  3OCN A;  1ES2 A;  3MBZ A;  1NJ4 A;  4KZ7 A;  4BLM A;  3WRT A;  1RGY A;  3FKV A;  4UA7 A;  3HUN A;  3GMW A;  2XD1 A;  1WYC A;  4R23 A;  1H8Z A;  3OCL A;  5FA7 A;  4EBL A;  3N8R A;  1IKI A;  4B4X A;  5CHM A;  1U60 A;  4L0L A;  3NCK A;  4DXC A;  2IWC A;  4YIN A;  2WAD A;  1K56 D;  5EE8 A;  4PM9 A;  1HTZ A;  4S2P A;  2X02 A;  1YT4 A;  1HVB A;  3RJU A;  3NDG A;  2ZC7 A;  4ZBE A;  3ZVT A;  3PBT A;  4PPR A;  1IYP A;  1XP4 A;  2ZC5 B;  3PBQ A;  5KSH A;  1K57 C;  1DJA A;  2Y2K A;  4KZ5 A;  2ZQ7 A;  3BFC A;  3O88 A;  2HP5 A;  1FQG A;  4JPM A;  3ZNY A;  4XXR A;  4OPQ A;  5GLB A;  4DDS A;  3IF6 A;  5HAR A;  1XKZ A;  3HLB A;  4R4S A;  2Y2H A;  4OON A;  1RCJ A;  1XPB A;  2WAE A;  3LY4 A;  2QZ6 A;  3C7U A;  4OLG A;  4R1G A;  1O07 A;  2XK1 A;  2P74 A;  3DWK A;  2WUQ A;  1ERM A;  2Y2M A;  2Y2N A;  3HLG A;  4DKI A;  4Y7P A;  4GNU A;  2WZZ A;  5GLD A;  2HDS A;  1PYY A;  3N6I A;  2J8Y A;  2ZQC A;  4Y0O A;  1BZA A;  3V50 A;  1DJC A;  2QPN A;  5CTM A;  3W4P A;  1NYM A;  3V3S A;  3ZDJ A;  5F1G A;  4ZJ1 A;  4U0X A;  1QME A;  1TDL A;  1FSY A;  3HL9 A;  2BLS A;  2XR0 A;  3IHB A;  4WEL A;  3P98 A;  3UN7 A;  5M19 A;  4KQO A;  1PWC A;  4P87 A;  5FAP A;  2RCX A;  1QMF A;  1S6R A;  4WM9 A;  4Q8I A;  4PM5 A;  5KMW A;  3IF6 C;  1LI0 A;  3IXG A;  1PZP A;  5A91 A;  3BLS A;  4QJG A;  2HPB A;  4PMA A;  3AGD A;  5F1F A;  1NZU A;  2PBY A;  3JYI A;  3SH8 A;  3VP3 A;  3GVB A;  1NZO A;  3IF5 A;  4PM8 A;  3V39 A;  3G2Y A;  3GQZ A;  1LL5 A;  3VP4 A;  1NY0 A;  2GDN A;  4M3K A;  3I7J A;  3O87 A;  3G30 A;  4OOL A;  5E2E A;  5FI2 A;  3MZD A;  3NY4 A;  3GR2 A;  3PTE A;  4BL3 A;  1YLP A;  1Q2P A;  2Y4A A;  4HEF A;  4JF6 A;  4WYY A;  5HAP A;  1Q2Q A;  2UWX A;  4FH4 A;  2EX6 A;  1TEM A;  4GD6 A;  4X55 A;  3UO9 A;  3PBN A;  4FH2 A;  2ZLY A;  3DTM A;  4EBP A;  4E3J A;  2IWB A;  5FQJ A;  3BYD A;  1E3U D;  3MZE A;  2CC1 A;  4DXB A;  1PWD A;  4K91 A;  4X68 A;  4C3Q A;  1IKG A;  3A3F A;  1SKF A;  3WWX A;  4B4Z A;  3HBR A;  5IHV A;  3IQA A;  1I5Q A;  3UE3 A;  3IWI A;  4E6W A;  3BFD A;  3VFH A;  3M2K A;  4C6Y A;  4R3B A;  2EX9 A;  1OME A;  1Y54 A;  2WK0 A;  4NET A;  3SH9 A;  1SDE A;  2ZC3 B;  2R9W A;  1CEF A;  2ZQ8 A;  2WKH A;  4JXV A;  5JYO A;  4IVI A;  3ZG5 A;  4KZ8 A;  4B88 A;  1JWV A;  4N1H A;  4BEN A;  5EUA A;  1ZG6 A;  1KDS A;  2A3U A;  4FD8 A;  4KG5 A;  2JBF A;  4QHC A;  4JF5 A;  1GA9 A;  2ZQA A;  2HDR A;  3S22 A;  3WS4 A;  3UE1 A;  1MXO A;  3C5A A;  3VFF A;  5KZH A;  3AGF A;  3ISG A;  3NI9 A;  4NK3 A;  1VQQ A;  3CG5 A;  5HW3 A;  4MLL A;  3LEZ A;  1XXM A;  1XA1 A;  4GN2 A;  1ZC2 A;  4S2N A;  1HZO A;  2WKE A;  5FQI A;  1MBL A;  4U3T A;  4UA9 A;  1I2S A;  3RXX A;  3HUM A;  4LCM A;  2J9P A;  2XFS A;  3SS3 A;  1IEL A;  3RXW A;  3ZVW A;  1L0D A;  1H5X A;  1KE4 A;  1MWU A;  1NRF A;  4LV3 A;  2A49 A;  3IHA A;  2XGN A;  3PBR A;  4N9L A;  3Q81 A;  4MEZ A;  3N8L A;  1MPL A;  5CGX A;  4S2K A;  1YMS A;  4BD1 A;  4HES A;  4X69 A;  3WS2 A;  3IH8 A;  1ES3 A;  1NXY A;  1PZO A;  1GHM A;  2XQZ A;  3M6H A;  3UPO A;  1CI8 A;  1G6A A;  1TVF A;  3IXD A;  4U0T A;  5EEC A;  2EFX A;  4BQM A;  3C4O A;  5EVI B;  3BRM A;  3NIA A;  4OPZ A;  1KVM A;  5TGF A;  4IBR A;  3Q7V A;  4WMC A;  1ESI A;  1L0F A;  1XGJ A;  5AQA A;  3M6B A;  4KZ3 A;  4EV4 A;  3C4P A;  4K0X A;  3BLM A;  4KQQ A;  3V3R A;  3Q82 A;  4LV1 A;  2H5S A;  4DF6 A;  1WE4 A;  4MBH A;  5G18 A;  1BLH A;  2H0T A;  3IT9 A;  5FQK A;  4O7D A;  3ZG0 A;  5FI6 A;  3SOI A;  2ZM8 A;  4S2J A;  4UAA A;  2Z2L B;  2Y2P A;  4S2L A;  3UPN A;  3A3J A;  5FAS A;  4OQ0 A;  1BUE A;  2ZM2 A;  3BFF A;  3HRE A;  4FSF A;  3W8K A;  5E2G A;  1CEG A;  4RVA A;  4E6X A;  1FCO A;  1RP5 A;  1O7E A;  3QHY A;  4LEN A;  3HLW A;  3QNC A;  5GL9 A;  2Y2L A;  3NC8 A;  2J9O A;  5DTK A;  3CZD A;  3PBO A;  3VSK A;  5DVA A;  2WGW B;  1KGG A;  5GHY A;  4DRT A;  1M40 A;  5A92 A;  1K4E A;  3BM6 A;  3SH7 A;  3UPP A;  1LLB A;  4GDB A;  4X53 A;  1BLP A;  5BOH A;  2XH9 A;  5TFQ A;  3A3E A;  3VOY A;  1N9B A;  1RGZ A;  1K57 A;  1WYB A;  3UDX A;  1BLC A;  2BG1 A;  1AXB A;  2XEP A;  1BT5 A;  4UA6 A;  2RL3 A;  4YFM A;  1K54 A;  5CXW A;  4N1X A;  4A5R A;  2FFY A;  1G68 A;  2R9X A;  3D4F A;  4OOM A;  1KE3 A;  4R0Q A;  5FQQ A;  3VP1 A;  1HD8 A;  1TDG A;  3OZH A;  1GHP A;  4E3M A;  5D3O A;  4ZDX A;  2WYX A;  1JVJ A;  1FR6 A;  4OKP A;  1W7F A;  2WAF A;  3ITA A;  3TOI A;  5A90 A;  4MNR A;  2IWD A;  2H0Y A;  5FQM A;  1CK3 A;  1PIO A;  3E2L A;  1FSW A;  5CGW A;  4OPY A;  5FQ9 A;  1K38 A;  4JXW A;  1K55 C;  5L2F A;  2E8I A;  3N4I A;  4ZTK A;  2WKI A;  3OPR A;  2EXA A;  3PAG A;  4OQH A;  3A3I A;  1MWR A;  3CJM A;  3ZGA B;  1XGI A;  5CED A;  5HAQ A;  5KSC A;  3G32 A;  4IBX A;  4E3O A;  1DY6 A;  5CHJ A;  4UHU A;  2P9V B;  5E2F A;  1S0W A;  1J9M A;  1H8Y A;  4XUZ A;  5HL1 A;  1ES4 A;  1K25 A;  4E3K A;  2C6W B;  3DWZ A;  4KZB A;  3UY6 A;  3TSG A;  3G31 A;  5GLC A;  1KGE A;  1YLZ A;  2C5W B;  2XD5 A;  3CMZ A;  4OQG A;  4WBG A;  5M1A A;  1BSG A;  5E43 A;  4CPK A;  2ZM0 A;  3OPP A;  4S2O A;  3HLD A;  1ERO A;  4GKU A;  4E3I A;  1FR1 A;  5HFO A;  1IYQ A;  2ZJ9 A;  1SDN A;  2EX8 A;  1PI5 A;  4BJP A;  3ITB A;  5GHZ A;  5DF7 A;  4N92 A;  1C3B A;  2OSU A;  1W79 A;  2PU4 A;  1SHV A;  3LO7 A;  4PM7 A;  5EVL A;  3OPL A;  2ZC4 B;  1BLS A;  3C7V A;  4RX2 A;  5J8X A;  3B3X A;  4OP5 A;  2Y91 A;  4N9K A;  2Z2M B;  3ZG9 B;  1YLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...