5TBMA

Crystal structure of pt2385 bound to hif2a-b*:arnt-b* complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
106
Chain Sequence
LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Small-Molecule Antagonist of HIF2 alpha Is Efficacious in Preclinical Models of Renal Cell Carcinoma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 29
structure length 106
sequence length 110
ec nomenclature
pdb deposition date 2016-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5tbmA00
2QJ5A 4KUOA 5F68A 5F69A 1GSVA 2J80A 3H9WA 3MFXA 2VEAA 1WA9A 4HJ6A 5HD5A 2VLGA 4EERA 3LIDA 5IU1A 3OLOA 3IS2B 5HD3A 1VB6A 2V1BA 1LSWA 1OJGA 3G6OA 2PD8A 3LIBA 2ZOHA 1S4SA 3F1NA 3MXQA 4JGPA 4GHIA 4PKYA 5HDSA 3VE3A 4LRXC 5HSQA 4I5SA 3T50A 4NXEA 3HJKA 2HV1A 3C2WA 3PYPA 2QHKA 4I38A 4HH3A 3B33A 4I3JA 4R6LA 3FG8A 1LSXA 1N9LA 3H82A 1ODVA 1V9ZA 4HY8A 1S4RA 1EW0A 4EW7A 2V0WA 3A0SA 3A0RA 1S67L 2A24B 4HNBA 3NOUC 2WKRA 3C8CA 3MQQA 3LIFA 4R70A 2JN7A 1S1YA 4B9OA 1NWZA 5HZHA 1Y28A 1LT0A 4L9GA 2Z6CA 3UMEA 3D72A 1TS7A 4HQAA 5F6AA 1V9YA 1XJ4A 5HDDA 2VV6A 4H6JB 4NXGA 4MN5A 3P7NA 1TS0A 2D02A 2PR6A 3BY9A 5J3WA 3VOLA 2M1CA 2PDRA 5HWVA 4HP9A 1DP8A 1OJ5A 3MR0A 4WF0A 3EEHA 1F98A 3KX0X 4PKYG 4JGRA 2CMNA 3MJQA 3NJAA 1UWNX 1T1CA 4R3AA 3F1NB 1OTDA 4I39A 4GHIB 5DJUA 1GSWA 3PHYA 5G4ZA 3H82B 3E4OA 4NXFA 3UB9A 1T1AA 5TBMB 4DJ2A 1XJ6A 4GCZA 2GJ3A 1N9OA 1P0ZA 2K7SA 3GDIA 3CAXA 3LUQA 5G4YA 3UMDA 2INWA 1TS6A 3LI8A 4HI4A 5EFWA 2VV8A 1N9NA 4WLAA 5DKLA 5AVEA 1T1BA 2BASA 2QJ7A 3LI9A 3RTYA 3LYXA 3NHQA 3GECA 4L9EA 2L1MA 3UE6A 3H7WB 5DKKA 4EETB 2WKPA 3LIAA 4HJ3A 2I9VA 5A8BA 3CWFA 2JHEA 4XT2A 4NXBA 1OT6A 4YWZA 5J7EA 5DJTA 1OTIA 3EWKA 4LPZA 2ZOIA 3LICA 2OOLA 3F1PA 4H6JA 5F5YA 3VE4A 4DJ3A 1T19A 3FC7A 4EQ1A 4F3LA 1X0OA 4WUJA 3A0VA 2ZBBA 4KQDA 2Z6DA 3UB6A 4BBUA 1P97A 4KUKA 4HH2A 1GSXA 1OTAA 1OTEA 1OTBA 2VV7A 4HOIA 5J4EA 4JGQA 1LSVA 3RH8B 2H28A 5KIZA 3UB7A 4BBTA 1D7EA 1OT9A 2B02A 3F1OB 1UGUA 3F1OA 3MQOA 2V1AA 4EEPA 1D06A 2L4RA 4EESA 1DP6A 3NOTC 2QKPA 2PD7A 4HIAA 5HWTA 1XJ2A 1S1ZA 2YKHA 1BYWA 4RQ9A 5IS1A 1T18A 2EA9A 3H7WA 3NOPC 4HJ4A 2A24A 1XFQA 4E04A 1XJ3A 4F3LB 1LL8A 4K08A 5HDCA 3IBRA 2P7JA 1TS8A 2PYPA 4GW9A 2OWHA 1XFNA 2L0WA 3K3CA 2PR5A 4R38A 3F1PB 4MN6A 4GS9B 4LRZE 3ULFA 4GS9A 3ICYA 1MZUA 2PYRA 2V0UA 5I5LA 2V9AA 5TBMA 2KDKA 2PHYA 2WKQA 3SW1A 4L9FA 5AVFA 4JGOA 5HWWA 1F9IA 1S66L 3LIEA 4M4XA 2YKFA 2R78A 2OWJA 1UWPX 3BWLA 3IS2A 4LRYC 1DP9A 3E4QA 1G28A 3UB8A 4WN5A 1KOUA 4HHDA 4LLOB 3HJIA 2D01A 3K3DA 4EEUA 4I3IA 4I3AA 1JNUA 3E4PA 4XT2B 2W0NA 3CLOA 1DRMA 2KX6A 2QWSA 4HP4A 4BBVA 4WL9A 4EXOA 3ZQ5A 3BY8A 2W27A
chains in the Genus database with same CATH superfamily
4Y0TA 3IX4A 1BZAA 3UB5P 4BMWA 1IKGA 3LIDA 5EVLA 2ZOHA 3VE3A 4P6ZM 1GHPA 5A93A 2QHKA 3C4PA 1MKMA 2FZ0A 3FG8A 3QP8A 1MKIA 2OSUA 4JLFA 2V0WA 3A0SA 1YLYA 1ALQA 4E3IA 2JN7A 1W5DA 1PYYA 1Y4OA 2Z6CA 3MXSA 3IHBA 2ZMFA 1V9YA 4GNUA 4KZ4A 3V3SA 2X71A 2Y59A 3CMZA 3T4SA 2HDRA 4X56A 2XFTA 1PZOA 5EM1A 3Q7ZA 3T4QA 2Y79A 3UMDA 1N9NA 2HDUA 1O7EA 3FYZA 3RTYA 4FD8A 3LYXA 4PM5A 2L1MA 3TSGA 3HCYA 3HLGA 2B5RA 3N7WA 4DE3A 4H6JA 1ZKJA 1P9WA 1NLYA 4OONA 4F3LA 1ESIA 4WUJA 2XSSA 4QPRA 2DMWA 2EXBA 5CHJA 1NYMA 2ZL1B 4GLQA 4X25A 1DP6A 4MBFA 5EECA 2BG1A 1W79A 3JYIA 4ETXA 4YWZA 2M7UA 3HLEA 1NZUA 3NECA 5FQJA 3VP2A 4Y15A 2ZM8A 2OWJA 3UE0A 3Q7VB 4GJ4A 1M40A 1ZC2A 2KX6A 3PXPA 3LR0A 5A90A 2Y2OA 3NI9A 3BFCA 5AQAA 1KE4A 1STZA 5GLDA 1EROA 2XEPA 1VETB 3MZFA 5GLCA 4H8RA 2ZM2A 3LIBA 4JGPA 5HSQA 4KQRA 3GQZA 4C75A 2W3GA 3OZHA 4R6LA 1Q2QA 4E6XA 3T4TA 4EW7A 2JC7A 4N9KA 2Y91A 1HTZA 2WGWA 3T12B 3FZCA 2D02A 4FSFA 4UQIS 3C30A 2P9VA 3ITBA 4R3AA 3U2AA 2Y2JA 3Q1FA 4LV1A 2O9CA 4ZDXA 3KO6A 4ESPA 2BASA 3HVFA 4XUXA 3SH8A 4P87A 1KGEA 5AQ9A 5FEGA 2I9VA 5J7EA 4DE0A 1K54C 1S0WA 1ZTUA 3IWIA 1N9BA 4KQDA 4EBNA 5FEFA 3VOZA 3V5MA 4EEPA 5CGXA 1ZHHB 5FAQA 3RXWA 3AGFA 1ONGA 1SKOB 5FDSA 4HJ4A 1K56A 4NXBA 4JPMA 3V3RA 2L0WA 4LRZE 2LB9A 2HDSA 1IYPA 4KZ7A 2HJ9C 4WN5A 4BL3A 3TW8A 4E3OA 3EQUA 3OPLA 2H5SA 3CLOA 4WL9A 1K25A 2XDMA 4OPRA 4BL2A 3H9WA 5FA7A 2VK3A 3CITA 4MN7A 4HBUA 4GHIA 4DF6A 3HJKA 1K0KA 2J3TD 1LSXA 1BLHA 3T1RA 4ETZA 5HAPA 2X02A 1K55A 5F6AA 5KMWA 2ZC6B 4ME4A 1ES3A 2BTFP 4FH4A 3JPUA 1P9RA 5EVEA 3UDFA 3O86A 4K0XA 3UPPA 2DRWA 3S4XA 3E98A 4I39A 3ZNTA 1NRFA 4ZBEA 3VOYA 4LCMA 1CF0A 4GCZA 3T4KA 2GJ3A 3CAXA 4ZTKA 5U47A 3HLCA 3O5YA 3O3VA 3LR5A 3BW6A 2QJ7A 3LI9A 4WBGA 5HL6A 4Z9QA 4EETB 1JTGA 4NK3A 3E2LA 4S2JA 4JF4A 2JBFA 2WKHA 2UV0E 3P01A 4KZAA 3UB6A 5EVIB 1JWVA 1OTAA 3O87A 2V8FA 3RH8B 5KIZA 3UB7A 3CUEC 4U3TA 2W3DA 3F1OA 5GHZA 3Q7VA 3PR6A 1G68A 3NOTC 5IS1A 1IYSA 3TOIA 1IELA 1K57A 2BLSA 3BQAA 4F3LB 1S6RA 4K91A 3DTEA 2V2FF 5I5LA 5FAPA 1KGGA 4KZ5A 1J9MA 3L9KA 3C4OA 2H10A 5M19A 4P6ZS 2VJWA 3ZHHA 4XT2B 1XKZA 3LR4A 1GSVA 3LFVA 3HUMA 2ZMAA 4WM9A 1G6OA 3ZG8B 3OLOA 3ZCZA 1SZVA 4LENA 1S4SA 3F1NA 3IBJA 1WYBA 3ZGAB 4QY5A 1S4RA 1PZPA 1S67L 4WELA 3C8CA 5L8MA 3WS4A 5IHVA 1LT0A 4DXCA 3ZYTA 4E3JA 4PM7A 2KOIA 1UWNX 2O9BA 3PHYA 3H82B 3E4OA 3M2KA 4S2NA 1XJ6A 5G4YA 2P74A 4O01A 3BJNA 1TS6A 2XLNA 3LI8A 1TD5A 3B3XA 4L9EA 1K54A 3NDEA 2XK1A 4BWIA 1DJCA 1OTIA 2WYXA 2OOLA 5F5YA 4OQHA 3VE4A 3QNCA 3ZVWA 4X1LA 2WK0A 4EBLA 1W8QA 2CC1A 1RGZA 4JGQA 4UQIM 4QHCA 2B02A 3MQOA 3NIAA 2XH9A 1BSGA 1BYWA 2EA9A 4KZ8A 4OLDA 3EQVA 3ZNYA 1XJ3A 4K08A 1TS8A 5FATA 2QPNA 4EQIA 5KZHA 2V0UA 4KENB 4R1GA 1XA1A 4II7A 4M4XA 4CLCE 3QNBA 3DW0A 5EE8A 3HL9A 5M1AA 1YSPA 1DRMA 1FCMA 3SS3A 1XA7A 1YT4A 2QJ5A 5F68A 1KE3A 3G32A 4ZJ3A 1VETA 1ES2A 4DXBA 1LSWA 2PD8A 3WS2A 5DTKA 5M18A 3M2JA 2J9OA 4HH3A 2FFYA 1G6AA 1NYYA 3UPOA 3LO7A 2K2NA 1ZG4A 3IWOA 3G4PA 5FDHA 4MBHA 4H6JB 3VSLA 3P09A 4X68A 2VX8A 2PDRA 2WUQA 5EVIA 4P0MA 1MPLA 1U60A 1N9OA 1P0ZA 4IEDA 2JKTM 2Q9NA 3UE3A 4OP8A 1MWSA 4Y17A 1H8MA 4MEZA 1GA0A 5A8BA 1VEUB 2JE5A 4IUKA 1RP5A 3LCEA 4EUZA 3ISGA 1GSXA 3OPHA 2H28A 3LEZA 4OPZA 1UGUA 3NULA 4CLCD 3Q07A 4IVKA 2QKPA 1XJ2A 5KSCA 3QP6A 3UE1A 2DNSA 1YMXA 2PR5A 2ZQ7A 3E2KA 4GS9B 4MDZA 1RGYA 5TBMA 5HWWA 3IS2A 2Y55A 4OLGA 3IWQA 3S22A 2FFFB 4YOFA 1OMEA 3S1YA 2K31A 4X6TA 1Z09A 3UN7A 4R3BA 4HP4A 5HARA 3I7JA 3BFDA 5F1FA 1YLPA 5J8XA 5TJJA 1I2WA 4PMAA 2XD1A 5CHUA 3EOIA 1NXYA 1GHIA 4NXEA 3WS0A 5CX7A 1K56D 2WZXA 2H0YA 3SS4A 5DTTA 2GZAA 2HZ5A 3TE8A 2DCFA 5EPHA 3R7WA 1S1YA 1K6RA 4U0TA 3B47A 4HQAA 3OPRA 2VV6A 3P7NA 2HJEA 2XA7S 3KX0X 5FSRA 4ARZA 3MQ0A 2C6WB 1YLJA 5E2GA 5AVEA 4WLAA 4Q0IA 1ESUA 3VP1A 4HJ3A 4ZJ2A 2GDNA 3F1PA 1HVBA 4ZRRA 2Q0OA 3UNWA 3ZG7B 3A0VA 2ZBBA 5E2FA 2P9VB 1YPRA 4KUKA 2Y4AA 3GVBA 3SH7A 1MWRA 1PWCA 4HOIA 5TR7A 3IXBA 2WGIA 1L0FA 4KZ3A 3ZG9B 4FUWA 3ITAA 5GHXA 2OV5A 1LL8A 1NJ4A 3VFHA 3VP3A 1E4DA 3B42A 1MZUA 1H3QA 4DDSA 1TVFA 1LLBA 1HD8A 3VMAA 5CTNA 3VSKA 1UWPX 5I94A 5DF7A 4C3QA 1FCOA 3HJIA 2D01A 1TDGA 4OPYA 2WGWB 2XD5A 5D3OA 2J80A 4DMZA 2VEAA 1CQAA 3HLFA 3MKFA 4GD8A 2JKRM 3HLWA 4GZBA 1JVJA 2HPBA 3WRZA 2VGJA 1N9LA 4WEKA 4P6BA 5HX9A 3IX8A 3W4OA 3BFEA 4KG2A 1AXBA 2NUPC 2Y2PA 3N8LA 3UMEA 4Y13A 1XX2A 4WF0A 4JXWA 1FSWA 2V1ZA 3V50A 3DBAA 2K7SA 4NEED 5AQBA 4HESA 4HI4A 2HP6A 2IWCA 1PI5A 3MF0A 5EVIC 1KDSA 1L3LA 3GV9A 3S7NA 1K38A 1OTEA 4XUZA 5LBRA 3FPVA 1SHVA 4G3KA 4WMCA 4O8GA 4S2PA 1D06A 5F83A 4CQHA 1I2SA 4E6WA 1E3UD 4JBFA 1SKOA 1S1ZA 3QP4A 1T18A 5GLBA 4E04A 2E8IA 4CLCC 3IBRA 5AQ7A 3PAGA 4RX2A 3IF6A 3W4PA 2Y2QA 5L2FA 1BT5A 2QYBA 3OPPA 1S66L 3LIEA 1L0GA 5L09A 1DJBA 4DN0A 2HGVA 4R23A 1EWZA 1BLSA 4E3KA 2W0NA 2PU2A 4E3NA 4BLMA 4QY6A 1QMFA 3HUOA 2IWDA 1GCEA 1K6SA 4NETA 4S2MA 3PAEA 2NUTC 1H0MA 3C2WA 2EWVA 3NCKA 1YMSA 3GMWA 3DWZA 3A0RA 3E0YA 3EGDC 3OC2A 2OLUA 2ZC3B 5L07A 4R70A 3MXRA 4HBTA 2ZC4B 1IKIA 4CLCB 4MN5A 4OQGA 1DP8A 4WEJA 1MY8A 3WS5A 3LY4A 1W8YA 2AVXA 1K4FA 4R4SA 3UY6A 1KE0A 4GN2A 2JKGA 1PRQA 3GRJA 1ERQA 3CWFA 3MSHA 3IXGA 4DE2A 1GA9A 3CPTB 3UO9A 3VP0A 1X0OA 2J3WA 3D3OA 3HREA 4HH2A 2Y2MA 4IBRA 1KVLA 1LSVA 4D2OA 1IFQA 3IF6C 2YKHA 1FILA 3FWLA 1YLWA 4WZ5A 5FQMA 1YLTA 2XF3A 2OWHA 1XFNA 1ZG6A 5CERA 4MN6A 1PW1A 2Y8HA 2PHYA 2WKIA 1J3WA 1TDLA 4Y2FA 5HPFA 4X69A 1DP9A 1G28A 1MC0A 3A3DA 2B95A 4EEUA 4I3IA 1IYOA 1ES4A 2ZC7A 1BLPA 2E8JA 2W27A 2VA0A 3S7PA 4KUOA 3CG5A 4UAAA 2XR0A 3MFXA 3NC8A 1WA9A 5E43A 4ID4A 4JXSA 4N1XA 5HD3A 4M3KA 4O0PA 4KG6A 5HDSA 4ZJ1A 1ERMA 4IVIA 4MLLA 2Y2GA 3PBRA 1ODVA 5HL1A 3D72A 1LHYA 4CJNA 1HZOA 4NXGA 3ZG5A 3VOLA 2JKFA 1E25A 2Y2NA 2Z2LB 2OAP1 1F98A 3MJQA 5DJUA 4G3VA 3LUQA 1MXOA 2VV8A 3PTEA 1OPXA 2WZZA 2W1TB 4D60A 5DJTA 3LICA 1FR1A 4YNRA 1KVMA 5KSHA 5TFQA 4LV2A 2Z2MB 4YINA 1D1JA 1XGJA 3T4OA 5E2HA 2V1AA 3RFBA 4Y3IA 2Y2KA 1FIKA 2ZQDA 5AJGA 5HDCA 5HWTA 4R38A 4N1HA 3AGEA 3F1PB 1IYQA 3OCLA 2H0TA 5MC7A 2OLVA 5AVFA 4KG5A 3DTMA 3ZVTA 3BWLA 2OAQ1 2G2WA 2W1TA 2I72A 3AGDA 4EBPA 1CJFA 4MBKA 3KSGA 4QJGA 3MFDA 5G18A 5CGWA 2MJ6A 4IBXA 4CPKA 1WE4A 1NZOA 1OJGA 2ZM0A 4Y0OA 1H8YA 4XXRA 4OH0A 4RX3A 3IX3A 3A3JA 3B33A 3H82A 3FKVA 3T4JA 1EW0A 4X1MA 2A24B 5HZHA 5JYPA 5CTMA 4GD6A 5HDDA 2M1CA 3MR0A 1NLZA 3G30A 3IF6B 1YAXA 1T1AA 2X01A 4X53A 1PIOA 3IH8A 2EX2A 4B88A 2VGKA 3DAVA 1JWPA 2WKPA 3LIAA 2EFXA 3W2ZA 3EEAA 3T1XA 2ZOIA 4OVDA 2GX5A 2QZ6A 4Q8IA 4LV0A 3BM6A 5CXWA 4S2LA 1OTBA 3FPWA 4FOFA 3PBSA 4FH2A 4BBTA 5HPIA 1MWTA 3G2YA 4F94A 3NOPC 2A24A 3BLSA 1XGIA 2V9AA 4L9FA 3RJUA 1PNEA 4WYYA 2WAFA 5EUAA 1TF1A 3BQ8A 3G2ZA 3O88A 3BECA 2J9PA 2R9XA 3C5AA 4E3LA 1CI9A 1G5UA 3BFGA 3MBZA 4Z1WA 5FQQA 2JKRI 4L0LA 4UA9A 1IEMA 2O9AA 5IT5A 5HAIA 3KYZA 2Y2HA 4A5RA 4X55A 1BLCA 5HW3A 1Y28A 4AFIA 2PU4A 3A3IA 4P85A 4MNRA 1O07A 3BY9A 1HLUP 4HP9A 4JF5A 5DF9A 3IF5A 4JGRA 2CMNA 4OP5A 1OTDA 1CEGA 1GSWA 2RL3A 4NXFA 2J8YA 3TRCA 4JF6A 5EFWA 1E3UA 1OT6A 4IHQA 1PI4A 1Q2PA 3N8RA 3T1SA 4PM9A 2VV7A 2C5WB 2EX8A 1CI8A 4OQIA 1D7EA 3F1OB 4ZAMA 4OOLA 2ZLYA 2ACGA 2W3FA 2V20A 4Y7PA 1XFQA 5K5BA 5HWVA 3BRMA 4GW9A 3K3CA 3CPTA 4NG2A 3DTKA 2PYRA 4RA7A 3BLMA 3HLDA 3KYQA 3W8KA 4LRYC 4B4XA 3E4QA 1CEFA 4PM6A 4EXOA 3ZQ5A 3SZTA 5EM0A 5F69A 3U4LP 1Y54A 5FQIA 2VLGA 3M6HA 5FQ9A 1TEMA 3OCNA 5TGFA 4PKYA 1K57C 4LRXC 3V39A 4C6YA 2HV1A 5GLAA 4Q0HA 3CHWP 3HBRA 3MQQA 1C3BA 4G3WA 3MZDA 2WAEA 5GHYA 3T4LA 1VM1A 4LFUA 5EVID 3HUNA 1WYCA 4HEFA 3G31A 3NJAA 4EV4A 3CJMA 3MZEA 4PAUA 2PAVP 1SDEA 2XQZA 4BD1A 3IXHA 5TBMB 3ZG0A 4OPQA 4DJ2A 4NKPA 4BQMA 3UDIA 3T1QB 3R4KA 3UE6A 3H7WB 5DKKA 2PBYA 4FTXA 2EX9A 3BFFA 1YQSA 1YKDA 2HF6A 2O99A 4JXVA 1XXMA 3EWKA 4BENA 3SS5A 4UA7A 4EQ1A 1N4OA 2ZQAA 5A92A 3FV7A 3IXDA 1H5XA 4WZ4A 1NRJA 2A49A 1P97A 5EOEA 4DKIA 4B4ZA 4MMNA 1RCJA 3IT9A 5HFOA 3MKEA 4HIAA 4RQ9A 4JKTA 2JKTI 1QMEA 2GNXA 2P7JA 3BEBA 3PBOA 3ICYA 2LB5A 1JWZA 5CGSA 3SW1A 2R78A 2ZJ9A 3CI6A 1KOUA 4LLOB 3C7UA 1JNUA 5CECA 2B18A 2QWSA 3Q82A 1BULA 4WZ5C 1KGFA 5DTSA 1ES5A 2JCHA 3LGOA 3S7OA 3QP5A 4E3MA 4EU0A 3G6OA 5EOOA 3PYPA 4UEYA 3PBTA 1EI5A 1V9ZA 5CHMA 2R9WA 3SH9A 3R7WB 4QD4A 2Y2IA 4L9GA 1H8ZA 1LL9A 1TS7A 5FI2A 2PR6A 4S2OA 2Q9MA 4JXGA 4UA6A 4GKUA 3WS1A 1GHMA 1DY6A 2M7VA 3LR3A 1T1BA 2Y2LA 3NBLA 3JVUA 4K0WA 4LPZA 1T19A 2PRFA 5FASA 3A3EA 2VGLM 3TG9A 5JYOA 4B93A 3HLBA 4R4RA 2ZC5B 1OT9A 3S7QA 1L0DA 3V67A 2PD7A 1VQQA 1F2KA 3H7WA 2QMIA 2W1RA 3EGXC 4LV3A 2PYPA 2ZQ9A 3ULFA 2HP5A 1MBLA 3C7VA 2KDKA 1I5QA 2J7VA 5DF8A 2HP9A 1A0KA 5DFXA 3GTCA 4MCWA 3K2NA 2XA7M 4LGWA 3NY4A 3ZFZA 5FI7A 3MMHA 5E2EA 5HD5A 2ZQCA 4Y0UA 3WWXA 3JVVA 1KDWA 1VEUA 4I5SA 2P04A 4GDBA 3NDGA 4I38A 4YFMA 2ZQ8A 4KZ6A 3W4QA 3NOUC 1Z6FA 5CEBA 3LIFA 5A91A 1M6KA 5GL9A 2WGVA 1YM1A 1F5MA 5DFYA 4OQ0A 2VGLS 1L0EA 1VHMA 5FL3A 4WMCD 4OOYA 4KZ9A 3RXXA 3C38A 2VKSA 3UPNA 5F82A 2JHEA 3OBFA 1K55C 4CLCA 4DJ3A 4RYEA 4Y5FA 4BBUA 3KSHA 1BUEA 4ARZB 3KYEA 3UDXA 2G7UA 1MWUA 5J4EA 2ZL1A 4EUVA 2J3TC 4OKPA 4QU3A 4EESA 1W63M 1AWIA 2PT7A 3SOIA 1FCNA 2ZMVA 4QB8A 1F9IA 2YKFA 4DDYA 3KSIA 1SDNA 4LCLA 1FSYA 2A3UA 3VFFA 2P08A 1YLZA 3E4PA 1FOFA 2RCXA 4S2KA 1L2SA 3TJZC 3BY8A 4R3JA 4EERA 5IU1A 3IS2B 2XROA 2V1BA 1FR6A 5DVAA 5F1GA 5CRFA 1CK3A 4HY8A 2G2UA 3QHYA 4B9OA 1NWZA 4IJGA 3BYDA 3VP4A 3L7HA 3IH9A 4PKYG 4GB7A 3LEQA 3F1NB 4GHIB 4OOMA 1ACFA 4KZBA 3N4IA 3QP2A 3GDIA 3P98A 3WRTA 2INWA 4BD0A 3GECA 4FCFA 4KQOA 2XRNA 5EV0A 4XT2A 2EFUA 3FC7A 1NY0A 2Z6DA 4Q0JA 3FKWA 1YSQA 2O0YA 4UHUA 3CUEA 3QP1A 1FQGA 1PW8A 5HAQA 3D9YA 2L4RA 5FQKA 3D4FA 3GSGA 3IHAA 1K4EA 1IOUA 1XP4A 3LY3A 4GS9A 4KQQA 1JTDA 1PWGA 2WKQA 4JGOA 3DTIA 2IWBA 1SKFA 3UB8A 3UB9A 4N9LA 2HDQA 4RVAA 4HJ6A 3GR2A 2EWWA 4U0XA 2WADA 1VB6A 3MXQA 2EXAA 3G35A 2KLIA 3T50A 4I3JA 3N8SA 4QWOA 5FI6A 4HNBA 2WKRA 1PWDA 4DRTA 4N92A 3M6BA 4R0QA 1XJ4A 4PM8A 1TS0A 3OOVA 5J3WA 5CEDA 2A2LA 1OJ5A 3EEHA 1T1CA 5G4ZA 5L10A 3ZDJA 4S2NC 5FAOA 3MS6A 3G34A 1ONHA 5DKLA 3NHQA 2XGNA 4EWFA 5C5KA 4PPRA 3VV4A 2FH5A 3DWKA 2VZWA 1LI0A 2WKEA 2UWXA 2XFSA 4S2IA 1W63Q 1XPBA 2ZD8A 4O7DA 2PBDP 1PFLA 2W3EA 1W7FA 3KSFA 3Q81A 2EX6A 1LL5A 4DE1A 4IUHA 2V8CA 1BTLA 1DJAA 3N6IA 5BOHA 3PBNA 1LI9A 2IA2A 3A3FA 4GOGA 3CZDA 1SCWA 4PHTA 4HHDA 4GDNA 3K3DA 2W3HA 4I3AA 3PBQA 4BBVA 3IQAA 4BJPA
chains in the Genus database with same CATH topology
2QJ5A 4KUOA 5F68A 3MFXA 4BMWA 1WA9A 3S7OA 3LIDA 5HD3A 4O0PA 1LSWA 4EU0A 3G6OA 2PD8A 5HDSA 2ZOHA 3VE3A 4P6ZM 3PYPA 3PBRA 2QHKA 4UEYA 4HH3A 1MKMA 3PBTA 2FZ0A 3FG8A 1ODVA 1V9ZA 2K2NA 2V0WA 3A0SA 2JN7A 3R7WB 4L9GA 2Z6CA 3D72A 1TS7A 2ZMFA 1V9YA 4H6JB 4NXGA 3T4SA 2PR6A 3VOLA 2VX8A 2PDRA 2OAP1 1F98A 3MJQA 5DJUA 3T4QA 4G3VA 1N9OA 1P0ZA 2Y79A 3LUQA 3UMDA 2M7VA 2JKTM 2VV8A 1N9NA 3LR3A 1T1BA 3UE3A 3RTYA 1OPXA 3LYXA 2L1MA 1H8MA 5A8BA 3JVUA 2W1TB 3HCYA 5DJTA 4LPZA 3LICA 4H6JA 1T19A 1P9WA 1NLYA 4F3LA 4WUJA 4YNRA 2XSSA 2VGLM 4QPRA 2DMWA 4IUKA 5KSHA 1GSXA 4B93A 2H28A 1OT9A 4GLQA 1UGUA 3T4OA 2V1AA 4CLCD 3S7QA 3V67A 1DP6A 2QKPA 2PD7A 1XJ2A 3RFBA 3H7WA 4Y3IA 2W1RA 3EGXC 5AJGA 5HDCA 5HWTA 4R38A 2PYPA 4YWZA 2M7UA 4ETXA 3ULFA 2PR5A 3F1PB 4GS9B 3OCLA 4MDZA 5TBMA 2KDKA 5MC7A 5AVFA 5HWWA 2OWJA 3BWLA 3IS2A 4GJ4A 4YOFA 2OAQ1 5DFXA 2K31A 2W1TA 2KX6A 4HP4A 4MCWA 3K2NA 2XA7M 3PXPA 3LR0A 3KSGA 3MMHA 5HD5A 5TJJA 1STZA 2MJ6A 1OJGA 3LIBA 3JVVA 4JGPA 5HSQA 3EOIA 4I5SA 2P04A 4NXEA 2W3GA 5CX7A 4I38A 3B33A 4R6LA 3H82A 2GZAA 3T4TA 3T4JA 1EW0A 4EW7A 2A24B 3NOUC 3TE8A 3LIFA 3R7WA 1S1YA 5HZHA 3B47A 4HQAA 5HDDA 2VV6A 3P7NA 2D02A 2HJEA 2M1CA 4FSFA 2XA7S 4UQIS 1F5MA 3C30A 3MR0A 1NLZA 3KX0X 4ARZA 4R3AA 3MQ0A 5DFYA 3U2AA 1YAXA 1T1AA 2VGLS 1VHMA 5FL3A 2O9CA 3KO6A 5AVEA 4WLAA 2BASA 3C38A 4Q0IA 2VKSA 2WKPA 3LIAA 4HJ3A 2I9VA 5J7EA 2JHEA 3W2ZA 3EEAA 3OBFA 1ZTUA 2ZOIA 4CLCA 3F1PA 4DJ3A 2GX5A 4ZRRA 3A0VA 4Y5FA 2ZBBA 4KQDA 4BBUA 3KSHA 4ARZB 4KUKA 1OTBA 2G7UA 3FPWA 4HOIA 5J4EA 4FOFA 3PBSA 4BBTA 4EUVA 2J3TC 4EEPA 5HPIA 1ZHHB 4EESA 3NOPC 4HJ4A 2A24A 1LL8A 1W63M 4NXBA 2PT7A 2L0WA 4LRZE 2LB9A 3B42A 2ZMVA 1MZUA 1H3QA 2V9AA 4L9FA 1F9IA 2YKFA 1UWPX 3KSIA 1TF1A 3BQ8A 2HJ9C 4WN5A 3HJIA 2D01A 3TW8A 2P08A 3EQUA 3E4PA 3CLOA 3TJZC 4WL9A 3BY8A 2J80A 3H9WA 4DMZA 4Z1WA 2VEAA 2JKRI 4L0LA 4EERA 5IU1A 3CITA 2JKRM 3IS2B 2XROA 2V1BA 4MN7A 2O9AA 4GHIA 5IT5A 3KYZA 3HJKA 2J3TD 1LSXA 1N9LA 4HY8A 4ETZA 4WEKA 4B9OA 1NWZA 1Y28A 4IJGA 2NUPC 3UMEA 4AFIA 5F6AA 4ME4A 3BY9A 1P9RA 4HP9A 5DF9A 4WF0A 4PKYG 4JGRA 2CMNA 3E98A 3F1NB 1OTDA 4I39A 4GHIB 1GSWA 4NXFA 4OOMA 4GCZA 3T4KA 2GJ3A 2K7SA 3DBAA 3GDIA 4NEED 3CAXA 3TRCA 2INWA 5EFWA 4HI4A 3O5YA 3LR5A 3BW6A 2QJ7A 3LI9A 4BJPA 5HL6A 3GECA 4EETB 4KQOA 2XRNA 4XT2A 3MF0A 1OT6A 4IHQA 3FC7A 3P01A 2Z6DA 4Q0JA 3S7NA 3UB6A 1YSQA 1OTAA 1OTEA 2VV7A 5LBRA 2O0YA 3CUEA 3FPVA 3RH8B 5KIZA 3UB7A 3CUEC 1D7EA 2W3DA 3F1OB 4G3KA 3F1OA 4O8GA 1D06A 4OOLA 4CQHA 2L4RA 3PR6A 3NOTC 2W3FA 1S1ZA 5IS1A 1T18A 4E04A 1XFQA 3BQAA 4F3LB 4CLCC 5K5BA 1IOUA 3IBRA 5HWVA 4GW9A 3K3CA 4GS9A 2PYRA 5I5LA 2WKQA 2QYBA 4JGOA 1S66L 3LIEA 3KYQA 4DN0A 4LRYC 3E4QA 3UB8A 2HGVA 4P6ZS 2VJWA 4XT2B 2W0NA 3UB9A 4EXOA 3ZQ5A 5F69A 3LR4A 1GSVA 3LFVA 4HJ6A 2VLGA 2EWWA 1G6OA 3OLOA 1VB6A 3OCNA 3MXQA 1S4SA 3F1NA 4PKYA 3IBJA 4LRXC 2NUTC 2KLIA 3T50A 2HV1A 2EWVA 3C2WA 4I3JA 4Q0HA 1S4RA 3A0RA 3E0YA 3EGDC 1S67L 3OC2A 4HNBA 2WKRA 4WELA 3C8CA 3MQQA 5L8MA 4R70A 4G3WA 1LT0A 1XJ4A 3ZYTA 4CLCB 4MN5A 3T4LA 1TS0A 3OOVA 2KOIA 5J3WA 2A2LA 1DP8A 1OJ5A 4WEJA 3EEHA 3NJAA 1UWNX 1T1CA 5G4ZA 4PAUA 2O9BA 3PHYA 3H82B 3E4OA 5TBMB 4DJ2A 1XJ6A 5G4YA 4NKPA 4O01A 3BJNA 1TS6A 3LI8A 1TD5A 5DKLA 3NHQA 3R4KA 4L9EA 3UE6A 3H7WB 5DKKA 5C5KA 3CWFA 3VV4A 1YKDA 2FH5A 2HF6A 4BWIA 2O99A 1OTIA 3EWKA 2VZWA 2OOLA 5F5YA 3VE4A 4EQ1A 1X0OA 2J3WA 3D3OA 1NRJA 1P97A 4HH2A 4JGQA 1LSVA 1W63Q 4UQIM 1IFQA 2B02A 3MQOA 4MMNA 4HIAA 2W3EA 2YKHA 1BYWA 4RQ9A 2EA9A 2JKTI 3KSFA 3EQVA 1XJ3A 2GNXA 4IUHA 4K08A 2P7JA 1TS8A 2OWHA 1XFNA 4MN6A 3PBOA 3ICYA 2V0UA 2LB5A 2Y8HA 3PBNA 2PHYA 3SW1A 4II7A 4M4XA 2IA2A 4CLCE 2R78A 4Y2FA 5HPFA 1DP9A 1G28A 1MC0A 4PHTA 3CI6A 1KOUA 4HHDA 4LLOB 3K3DA 4EEUA 2W3HA 4I3IA 4I3AA 1YSPA 1JNUA 3PBQA 2B18A 1DRMA 2QWSA 4BBVA 2W27A 2VA0A 3S7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ5 A;  4KUO A;  5F68 A;  5F69 A;  1GSV A;  2J80 A;  3H9W A;  3MFX A;  2VEA A;  1WA9 A;  4HJ6 A;  5HD5 A;  2VLG A;  4EER A;  3LID A;  5IU1 A;  3OLO A;  3IS2 B;  5HD3 A;  1VB6 A;  2V1B A;  1LSW A;  1OJG A;  3G6O A;  2PD8 A;  3LIB A;  2ZOH A;  1S4S A;  3F1N A;  3MXQ A;  4JGP A;  4GHI A;  4PKY A;  5HDS A;  3VE3 A;  4LRX C;  5HSQ A;  4I5S A;  3T50 A;  4NXE A;  3HJK A;  2HV1 A;  3C2W A;  3PYP A;  2QHK A;  4I38 A;  4HH3 A;  3B33 A;  4I3J A;  4R6L A;  3FG8 A;  1LSX A;  1N9L A;  3H82 A;  1ODV A;  1V9Z A;  4HY8 A;  1S4R A;  1EW0 A;  4EW7 A;  2V0W A;  3A0S A;  3A0R A;  1S67 L;  2A24 B;  4HNB A;  3NOU C;  2WKR A;  3C8C A;  3MQQ A;  3LIF A;  4R70 A;  2JN7 A;  1S1Y A;  4B9O A;  1NWZ A;  5HZH A;  1Y28 A;  1LT0 A;  4L9G A;  2Z6C A;  3UME A;  3D72 A;  1TS7 A;  4HQA A;  5F6A A;  1V9Y A;  1XJ4 A;  5HDD A;  2VV6 A;  4H6J B;  4NXG A;  4MN5 A;  3P7N A;  1TS0 A;  2D02 A;  2PR6 A;  3BY9 A;  5J3W A;  3VOL A;  2M1C A;  2PDR A;  5HWV A;  4HP9 A;  1DP8 A;  1OJ5 A;  3MR0 A;  4WF0 A;  3EEH A;  1F98 A;  3KX0 X;  4PKY G;  4JGR A;  2CMN A;  3MJQ A;  3NJA A;  1UWN X;  1T1C A;  4R3A A;  3F1N B;  1OTD A;  4I39 A;  4GHI B;  5DJU A;  1GSW A;  3PHY A;  5G4Z A;  3H82 B;  3E4O A;  4NXF A;  3UB9 A;  1T1A A;  5TBM B;  4DJ2 A;  1XJ6 A;  4GCZ A;  2GJ3 A;  1N9O A;  1P0Z A;  2K7S A;  3GDI A;  3CAX A;  3LUQ A;  5G4Y A;  3UMD A;  2INW A;  1TS6 A;  3LI8 A;  4HI4 A;  5EFW A;  2VV8 A;  1N9N A;  4WLA A;  5DKL A;  5AVE A;  1T1B A;  2BAS A;  2QJ7 A;  3LI9 A;  3RTY A;  3LYX A;  3NHQ A;  3GEC A;  4L9E A;  2L1M A;  3UE6 A;  3H7W B;  5DKK A;  4EET B;  2WKP A;  3LIA A;  4HJ3 A;  2I9V A;  5A8B A;  3CWF A;  2JHE A;  4XT2 A;  4NXB A;  1OT6 A;  4YWZ A;  5J7E A;  5DJT A;  1OTI A;  3EWK A;  4LPZ A;  2ZOI A;  3LIC A;  2OOL A;  3F1P A;  4H6J A;  5F5Y A;  3VE4 A;  4DJ3 A;  1T19 A;  3FC7 A;  4EQ1 A;  4F3L A;  1X0O A;  4WUJ A;  3A0V A;  2ZBB A;  4KQD A;  2Z6D A;  3UB6 A;  4BBU A;  1P97 A;  4KUK A;  4HH2 A;  1GSX A;  1OTA A;  1OTE A;  1OTB A;  2VV7 A;  4HOI A;  5J4E A;  4JGQ A;  1LSV A;  3RH8 B;  2H28 A;  5KIZ A;  3UB7 A;  4BBT A;  1D7E A;  1OT9 A;  2B02 A;  3F1O B;  1UGU A;  3F1O A;  3MQO A;  2V1A A;  4EEP A;  1D06 A;  2L4R A;  4EES A;  1DP6 A;  3NOT C;  2QKP A;  2PD7 A;  4HIA A;  5HWT A;  1XJ2 A;  1S1Z A;  2YKH A;  1BYW A;  4RQ9 A;  5IS1 A;  1T18 A;  2EA9 A;  3H7W A;  3NOP C;  4HJ4 A;  2A24 A;  1XFQ A;  4E04 A;  1XJ3 A;  4F3L B;  1LL8 A;  4K08 A;  5HDC A;  3IBR A;  2P7J A;  1TS8 A;  2PYP A;  4GW9 A;  2OWH A;  1XFN A;  2L0W A;  3K3C A;  2PR5 A;  4R38 A;  3F1P B;  4MN6 A;  4GS9 B;  4LRZ E;  3ULF A;  4GS9 A;  3ICY A;  1MZU A;  2PYR A;  2V0U A;  5I5L A;  2V9A A;  5TBM A;  2KDK A;  2PHY A;  2WKQ A;  3SW1 A;  4L9F A;  5AVF A;  4JGO A;  5HWW A;  1F9I A;  1S66 L;  3LIE A;  4M4X A;  2YKF A;  2R78 A;  2OWJ A;  1UWP X;  3BWL A;  3IS2 A;  4LRY C;  1DP9 A;  3E4Q A;  1G28 A;  3UB8 A;  4WN5 A;  1KOU A;  4HHD A;  4LLO B;  3HJI A;  2D01 A;  3K3D A;  4EEU A;  4I3I A;  4I3A A;  1JNU A;  3E4P A;  4XT2 B;  2W0N A;  3CLO A;  1DRM A;  2KX6 A;  2QWS A;  4HP4 A;  4BBV A;  4WL9 A;  4EXO A;  3ZQ5 A;  3BY8 A;  2W27 A; 
#chains in the Genus database with same CATH topology
 4Y0T A;  3IX4 A;  1BZA A;  3UB5 P;  4BMW A;  1IKG A;  3LID A;  5EVL A;  2ZOH A;  3VE3 A;  4P6Z M;  1GHP A;  5A93 A;  2QHK A;  3C4P A;  1MKM A;  2FZ0 A;  3FG8 A;  3QP8 A;  1MKI A;  2OSU A;  4JLF A;  2V0W A;  3A0S A;  1YLY A;  1ALQ A;  4E3I A;  2JN7 A;  1W5D A;  1PYY A;  1Y4O A;  2Z6C A;  3MXS A;  3IHB A;  2ZMF A;  1V9Y A;  4GNU A;  4KZ4 A;  3V3S A;  2X71 A;  2Y59 A;  3CMZ A;  3T4S A;  2HDR A;  4X56 A;  2XFT A;  1PZO A;  5EM1 A;  3Q7Z A;  3T4Q A;  2Y79 A;  3UMD A;  1N9N A;  2HDU A;  1O7E A;  3FYZ A;  3RTY A;  4FD8 A;  3LYX A;  4PM5 A;  2L1M A;  3TSG A;  3HCY A;  3HLG A;  2B5R A;  3N7W A;  4DE3 A;  4H6J A;  1ZKJ A;  1P9W A;  1NLY A;  4OON A;  4F3L A;  1ESI A;  4WUJ A;  2XSS A;  4QPR A;  2DMW A;  2EXB A;  5CHJ A;  1NYM A;  2ZL1 B;  4GLQ A;  4X25 A;  1DP6 A;  4MBF A;  5EEC A;  2BG1 A;  1W79 A;  3JYI A;  4ETX A;  4YWZ A;  2M7U A;  3HLE A;  1NZU A;  3NEC A;  5FQJ A;  3VP2 A;  4Y15 A;  2ZM8 A;  2OWJ A;  3UE0 A;  3Q7V B;  4GJ4 A;  1M40 A;  1ZC2 A;  2KX6 A;  3PXP A;  3LR0 A;  5A90 A;  2Y2O A;  3NI9 A;  3BFC A;  5AQA A;  1KE4 A;  1STZ A;  5GLD A;  1ERO A;  2XEP A;  1VET B;  3MZF A;  5GLC A;  4H8R A;  2ZM2 A;  3LIB A;  4JGP A;  5HSQ A;  4KQR A;  3GQZ A;  4C75 A;  2W3G A;  3OZH A;  4R6L A;  1Q2Q A;  4E6X A;  3T4T A;  4EW7 A;  2JC7 A;  4N9K A;  2Y91 A;  1HTZ A;  2WGW A;  3T12 B;  3FZC A;  2D02 A;  4FSF A;  4UQI S;  3C30 A;  2P9V A;  3ITB A;  4R3A A;  3U2A A;  2Y2J A;  3Q1F A;  4LV1 A;  2O9C A;  4ZDX A;  3KO6 A;  4ESP A;  2BAS A;  3HVF A;  4XUX A;  3SH8 A;  4P87 A;  1KGE A;  5AQ9 A;  5FEG A;  2I9V A;  5J7E A;  4DE0 A;  1K54 C;  1S0W A;  1ZTU A;  3IWI A;  1N9B A;  4KQD A;  4EBN A;  5FEF A;  3VOZ A;  3V5M A;  4EEP A;  5CGX A;  1ZHH B;  5FAQ A;  3RXW A;  3AGF A;  1ONG A;  1SKO B;  5FDS A;  4HJ4 A;  1K56 A;  4NXB A;  4JPM A;  3V3R A;  2L0W A;  4LRZ E;  2LB9 A;  2HDS A;  1IYP A;  4KZ7 A;  2HJ9 C;  4WN5 A;  4BL3 A;  3TW8 A;  4E3O A;  3EQU A;  3OPL A;  2H5S A;  3CLO A;  4WL9 A;  1K25 A;  2XDM A;  4OPR A;  4BL2 A;  3H9W A;  5FA7 A;  2VK3 A;  3CIT A;  4MN7 A;  4HBU A;  4GHI A;  4DF6 A;  3HJK A;  1K0K A;  2J3T D;  1LSX A;  1BLH A;  3T1R A;  4ETZ A;  5HAP A;  2X02 A;  1K55 A;  5F6A A;  5KMW A;  2ZC6 B;  4ME4 A;  1ES3 A;  2BTF P;  4FH4 A;  3JPU A;  1P9R A;  5EVE A;  3UDF A;  3O86 A;  4K0X A;  3UPP A;  2DRW A;  3S4X A;  3E98 A;  4I39 A;  3ZNT A;  1NRF A;  4ZBE A;  3VOY A;  4LCM A;  1CF0 A;  4GCZ A;  3T4K A;  2GJ3 A;  3CAX A;  4ZTK A;  5U47 A;  3HLC A;  3O5Y A;  3O3V A;  3LR5 A;  3BW6 A;  2QJ7 A;  3LI9 A;  4WBG A;  5HL6 A;  4Z9Q A;  4EET B;  1JTG A;  4NK3 A;  3E2L A;  4S2J A;  4JF4 A;  2JBF A;  2WKH A;  2UV0 E;  3P01 A;  4KZA A;  3UB6 A;  5EVI B;  1JWV A;  1OTA A;  3O87 A;  2V8F A;  3RH8 B;  5KIZ A;  3UB7 A;  3CUE C;  4U3T A;  2W3D A;  3F1O A;  5GHZ A;  3Q7V A;  3PR6 A;  1G68 A;  3NOT C;  5IS1 A;  1IYS A;  3TOI A;  1IEL A;  1K57 A;  2BLS A;  3BQA A;  4F3L B;  1S6R A;  4K91 A;  3DTE A;  2V2F F;  5I5L A;  5FAP A;  1KGG A;  4KZ5 A;  1J9M A;  3L9K A;  3C4O A;  2H10 A;  5M19 A;  4P6Z S;  2VJW A;  3ZHH A;  4XT2 B;  1XKZ A;  3LR4 A;  1GSV A;  3LFV A;  3HUM A;  2ZMA A;  4WM9 A;  1G6O A;  3ZG8 B;  3OLO A;  3ZCZ A;  1SZV A;  4LEN A;  1S4S A;  3F1N A;  3IBJ A;  1WYB A;  3ZGA B;  4QY5 A;  1S4R A;  1PZP A;  1S67 L;  4WEL A;  3C8C A;  5L8M A;  3WS4 A;  5IHV A;  1LT0 A;  4DXC A;  3ZYT A;  4E3J A;  4PM7 A;  2KOI A;  1UWN X;  2O9B A;  3PHY A;  3H82 B;  3E4O A;  3M2K A;  4S2N A;  1XJ6 A;  5G4Y A;  2P74 A;  4O01 A;  3BJN A;  1TS6 A;  2XLN A;  3LI8 A;  1TD5 A;  3B3X A;  4L9E A;  1K54 A;  3NDE A;  2XK1 A;  4BWI A;  1DJC A;  1OTI A;  2WYX A;  2OOL A;  5F5Y A;  4OQH A;  3VE4 A;  3QNC A;  3ZVW A;  4X1L A;  2WK0 A;  4EBL A;  1W8Q A;  2CC1 A;  1RGZ A;  4JGQ A;  4UQI M;  4QHC A;  2B02 A;  3MQO A;  3NIA A;  2XH9 A;  1BSG A;  1BYW A;  2EA9 A;  4KZ8 A;  4OLD A;  3EQV A;  3ZNY A;  1XJ3 A;  4K08 A;  1TS8 A;  5FAT A;  2QPN A;  4EQI A;  5KZH A;  2V0U A;  4KEN B;  4R1G A;  1XA1 A;  4II7 A;  4M4X A;  4CLC E;  3QNB A;  3DW0 A;  5EE8 A;  3HL9 A;  5M1A A;  1YSP A;  1DRM A;  1FCM A;  3SS3 A;  1XA7 A;  1YT4 A;  2QJ5 A;  5F68 A;  1KE3 A;  3G32 A;  4ZJ3 A;  1VET A;  1ES2 A;  4DXB A;  1LSW A;  2PD8 A;  3WS2 A;  5DTK A;  5M18 A;  3M2J A;  2J9O A;  4HH3 A;  2FFY A;  1G6A A;  1NYY A;  3UPO A;  3LO7 A;  2K2N A;  1ZG4 A;  3IWO A;  3G4P A;  5FDH A;  4MBH A;  4H6J B;  3VSL A;  3P09 A;  4X68 A;  2VX8 A;  2PDR A;  2WUQ A;  5EVI A;  4P0M A;  1MPL A;  1U60 A;  1N9O A;  1P0Z A;  4IED A;  2JKT M;  2Q9N A;  3UE3 A;  4OP8 A;  1MWS A;  4Y17 A;  1H8M A;  4MEZ A;  1GA0 A;  5A8B A;  1VEU B;  2JE5 A;  4IUK A;  1RP5 A;  3LCE A;  4EUZ A;  3ISG A;  1GSX A;  3OPH A;  2H28 A;  3LEZ A;  4OPZ A;  1UGU A;  3NUL A;  4CLC D;  3Q07 A;  4IVK A;  2QKP A;  1XJ2 A;  5KSC A;  3QP6 A;  3UE1 A;  2DNS A;  1YMX A;  2PR5 A;  2ZQ7 A;  3E2K A;  4GS9 B;  4MDZ A;  1RGY A;  5TBM A;  5HWW A;  3IS2 A;  2Y55 A;  4OLG A;  3IWQ A;  3S22 A;  2FFF B;  4YOF A;  1OME A;  3S1Y A;  2K31 A;  4X6T A;  1Z09 A;  3UN7 A;  4R3B A;  4HP4 A;  5HAR A;  3I7J A;  3BFD A;  5F1F A;  1YLP A;  5J8X A;  5TJJ A;  1I2W A;  4PMA A;  2XD1 A;  5CHU A;  3EOI A;  1NXY A;  1GHI A;  4NXE A;  3WS0 A;  5CX7 A;  1K56 D;  2WZX A;  2H0Y A;  3SS4 A;  5DTT A;  2GZA A;  2HZ5 A;  3TE8 A;  2DCF A;  5EPH A;  3R7W A;  1S1Y A;  1K6R A;  4U0T A;  3B47 A;  4HQA A;  3OPR A;  2VV6 A;  3P7N A;  2HJE A;  2XA7 S;  3KX0 X;  5FSR A;  4ARZ A;  3MQ0 A;  2C6W B;  1YLJ A;  5E2G A;  5AVE A;  4WLA A;  4Q0I A;  1ESU A;  3VP1 A;  4HJ3 A;  4ZJ2 A;  2GDN A;  3F1P A;  1HVB A;  4ZRR A;  2Q0O A;  3UNW A;  3ZG7 B;  3A0V A;  2ZBB A;  5E2F A;  2P9V B;  1YPR A;  4KUK A;  2Y4A A;  3GVB A;  3SH7 A;  1MWR A;  1PWC A;  4HOI A;  5TR7 A;  3IXB A;  2WGI A;  1L0F A;  4KZ3 A;  3ZG9 B;  4FUW A;  3ITA A;  5GHX A;  2OV5 A;  1LL8 A;  1NJ4 A;  3VFH A;  3VP3 A;  1E4D A;  3B42 A;  1MZU A;  1H3Q A;  4DDS A;  1TVF A;  1LLB A;  1HD8 A;  3VMA A;  5CTN A;  3VSK A;  1UWP X;  5I94 A;  5DF7 A;  4C3Q A;  1FCO A;  3HJI A;  2D01 A;  1TDG A;  4OPY A;  2WGW B;  2XD5 A;  5D3O A;  2J80 A;  4DMZ A;  2VEA A;  1CQA A;  3HLF A;  3MKF A;  4GD8 A;  2JKR M;  3HLW A;  4GZB A;  1JVJ A;  2HPB A;  3WRZ A;  2VGJ A;  1N9L A;  4WEK A;  4P6B A;  5HX9 A;  3IX8 A;  3W4O A;  3BFE A;  4KG2 A;  1AXB A;  2NUP C;  2Y2P A;  3N8L A;  3UME A;  4Y13 A;  1XX2 A;  4WF0 A;  4JXW A;  1FSW A;  2V1Z A;  3V50 A;  3DBA A;  2K7S A;  4NEE D;  5AQB A;  4HES A;  4HI4 A;  2HP6 A;  2IWC A;  1PI5 A;  3MF0 A;  5EVI C;  1KDS A;  1L3L A;  3GV9 A;  3S7N A;  1K38 A;  1OTE A;  4XUZ A;  5LBR A;  3FPV A;  1SHV A;  4G3K A;  4WMC A;  4O8G A;  4S2P A;  1D06 A;  5F83 A;  4CQH A;  1I2S A;  4E6W A;  1E3U D;  4JBF A;  1SKO A;  1S1Z A;  3QP4 A;  1T18 A;  5GLB A;  4E04 A;  2E8I A;  4CLC C;  3IBR A;  5AQ7 A;  3PAG A;  4RX2 A;  3IF6 A;  3W4P A;  2Y2Q A;  5L2F A;  1BT5 A;  2QYB A;  3OPP A;  1S66 L;  3LIE A;  1L0G A;  5L09 A;  1DJB A;  4DN0 A;  2HGV A;  4R23 A;  1EWZ A;  1BLS A;  4E3K A;  2W0N A;  2PU2 A;  4E3N A;  4BLM A;  4QY6 A;  1QMF A;  3HUO A;  2IWD A;  1GCE A;  1K6S A;  4NET A;  4S2M A;  3PAE A;  2NUT C;  1H0M A;  3C2W A;  2EWV A;  3NCK A;  1YMS A;  3GMW A;  3DWZ A;  3A0R A;  3E0Y A;  3EGD C;  3OC2 A;  2OLU A;  2ZC3 B;  5L07 A;  4R70 A;  3MXR A;  4HBT A;  2ZC4 B;  1IKI A;  4CLC B;  4MN5 A;  4OQG A;  1DP8 A;  4WEJ A;  1MY8 A;  3WS5 A;  3LY4 A;  1W8Y A;  2AVX A;  1K4F A;  4R4S A;  3UY6 A;  1KE0 A;  4GN2 A;  2JKG A;  1PRQ A;  3GRJ A;  1ERQ A;  3CWF A;  3MSH A;  3IXG A;  4DE2 A;  1GA9 A;  3CPT B;  3UO9 A;  3VP0 A;  1X0O A;  2J3W A;  3D3O A;  3HRE A;  4HH2 A;  2Y2M A;  4IBR A;  1KVL A;  1LSV A;  4D2O A;  1IFQ A;  3IF6 C;  2YKH A;  1FIL A;  3FWL A;  1YLW A;  4WZ5 A;  5FQM A;  1YLT A;  2XF3 A;  2OWH A;  1XFN A;  1ZG6 A;  5CER A;  4MN6 A;  1PW1 A;  2Y8H A;  2PHY A;  2WKI A;  1J3W A;  1TDL A;  4Y2F A;  5HPF A;  4X69 A;  1DP9 A;  1G28 A;  1MC0 A;  3A3D A;  2B95 A;  4EEU A;  4I3I A;  1IYO A;  1ES4 A;  2ZC7 A;  1BLP A;  2E8J A;  2W27 A;  2VA0 A;  3S7P A;  4KUO A;  3CG5 A;  4UAA A;  2XR0 A;  3MFX A;  3NC8 A;  1WA9 A;  5E43 A;  4ID4 A;  4JXS A;  4N1X A;  5HD3 A;  4M3K A;  4O0P A;  4KG6 A;  5HDS A;  4ZJ1 A;  1ERM A;  4IVI A;  4MLL A;  2Y2G A;  3PBR A;  1ODV A;  5HL1 A;  3D72 A;  1LHY A;  4CJN A;  1HZO A;  4NXG A;  3ZG5 A;  3VOL A;  2JKF A;  1E25 A;  2Y2N A;  2Z2L B;  2OAP 1;  1F98 A;  3MJQ A;  5DJU A;  4G3V A;  3LUQ A;  1MXO A;  2VV8 A;  3PTE A;  1OPX A;  2WZZ A;  2W1T B;  4D60 A;  5DJT A;  3LIC A;  1FR1 A;  4YNR A;  1KVM A;  5KSH A;  5TFQ A;  4LV2 A;  2Z2M B;  4YIN A;  1D1J A;  1XGJ A;  3T4O A;  5E2H A;  2V1A A;  3RFB A;  4Y3I A;  2Y2K A;  1FIK A;  2ZQD A;  5AJG A;  5HDC A;  5HWT A;  4R38 A;  4N1H A;  3AGE A;  3F1P B;  1IYQ A;  3OCL A;  2H0T A;  5MC7 A;  2OLV A;  5AVF A;  4KG5 A;  3DTM A;  3ZVT A;  3BWL A;  2OAQ 1;  2G2W A;  2W1T A;  2I72 A;  3AGD A;  4EBP A;  1CJF A;  4MBK A;  3KSG A;  4QJG A;  3MFD A;  5G18 A;  5CGW A;  2MJ6 A;  4IBX A;  4CPK A;  1WE4 A;  1NZO A;  1OJG A;  2ZM0 A;  4Y0O A;  1H8Y A;  4XXR A;  4OH0 A;  4RX3 A;  3IX3 A;  3A3J A;  3B33 A;  3H82 A;  3FKV A;  3T4J A;  1EW0 A;  4X1M A;  2A24 B;  5HZH A;  5JYP A;  5CTM A;  4GD6 A;  5HDD A;  2M1C A;  3MR0 A;  1NLZ A;  3G30 A;  3IF6 B;  1YAX A;  1T1A A;  2X01 A;  4X53 A;  1PIO A;  3IH8 A;  2EX2 A;  4B88 A;  2VGK A;  3DAV A;  1JWP A;  2WKP A;  3LIA A;  2EFX A;  3W2Z A;  3EEA A;  3T1X A;  2ZOI A;  4OVD A;  2GX5 A;  2QZ6 A;  4Q8I A;  4LV0 A;  3BM6 A;  5CXW A;  4S2L A;  1OTB A;  3FPW A;  4FOF A;  3PBS A;  4FH2 A;  4BBT A;  5HPI A;  1MWT A;  3G2Y A;  4F94 A;  3NOP C;  2A24 A;  3BLS A;  1XGI A;  2V9A A;  4L9F A;  3RJU A;  1PNE A;  4WYY A;  2WAF A;  5EUA A;  1TF1 A;  3BQ8 A;  3G2Z A;  3O88 A;  3BEC A;  2J9P A;  2R9X A;  3C5A A;  4E3L A;  1CI9 A;  1G5U A;  3BFG A;  3MBZ A;  4Z1W A;  5FQQ A;  2JKR I;  4L0L A;  4UA9 A;  1IEM A;  2O9A A;  5IT5 A;  5HAI A;  3KYZ A;  2Y2H A;  4A5R A;  4X55 A;  1BLC A;  5HW3 A;  1Y28 A;  4AFI A;  2PU4 A;  3A3I A;  4P85 A;  4MNR A;  1O07 A;  3BY9 A;  1HLU P;  4HP9 A;  4JF5 A;  5DF9 A;  3IF5 A;  4JGR A;  2CMN A;  4OP5 A;  1OTD A;  1CEG A;  1GSW A;  2RL3 A;  4NXF A;  2J8Y A;  3TRC A;  4JF6 A;  5EFW A;  1E3U A;  1OT6 A;  4IHQ A;  1PI4 A;  1Q2P A;  3N8R A;  3T1S A;  4PM9 A;  2VV7 A;  2C5W B;  2EX8 A;  1CI8 A;  4OQI A;  1D7E A;  3F1O B;  4ZAM A;  4OOL A;  2ZLY A;  2ACG A;  2W3F A;  2V20 A;  4Y7P A;  1XFQ A;  5K5B A;  5HWV A;  3BRM A;  4GW9 A;  3K3C A;  3CPT A;  4NG2 A;  3DTK A;  2PYR A;  4RA7 A;  3BLM A;  3HLD A;  3KYQ A;  3W8K A;  4LRY C;  4B4X A;  3E4Q A;  1CEF A;  4PM6 A;  4EXO A;  3ZQ5 A;  3SZT A;  5EM0 A;  5F69 A;  3U4L P;  1Y54 A;  5FQI A;  2VLG A;  3M6H A;  5FQ9 A;  1TEM A;  3OCN A;  5TGF A;  4PKY A;  1K57 C;  4LRX C;  3V39 A;  4C6Y A;  2HV1 A;  5GLA A;  4Q0H A;  3CHW P;  3HBR A;  3MQQ A;  1C3B A;  4G3W A;  3MZD A;  2WAE A;  5GHY A;  3T4L A;  1VM1 A;  4LFU A;  5EVI D;  3HUN A;  1WYC A;  4HEF A;  3G31 A;  3NJA A;  4EV4 A;  3CJM A;  3MZE A;  4PAU A;  2PAV P;  1SDE A;  2XQZ A;  4BD1 A;  3IXH A;  5TBM B;  3ZG0 A;  4OPQ A;  4DJ2 A;  4NKP A;  4BQM A;  3UDI A;  3T1Q B;  3R4K A;  3UE6 A;  3H7W B;  5DKK A;  2PBY A;  4FTX A;  2EX9 A;  3BFF A;  1YQS A;  1YKD A;  2HF6 A;  2O99 A;  4JXV A;  1XXM A;  3EWK A;  4BEN A;  3SS5 A;  4UA7 A;  4EQ1 A;  1N4O A;  2ZQA A;  5A92 A;  3FV7 A;  3IXD A;  1H5X A;  4WZ4 A;  1NRJ A;  2A49 A;  1P97 A;  5EOE A;  4DKI A;  4B4Z A;  4MMN A;  1RCJ A;  3IT9 A;  5HFO A;  3MKE A;  4HIA A;  4RQ9 A;  4JKT A;  2JKT I;  1QME A;  2GNX A;  2P7J A;  3BEB A;  3PBO A;  3ICY A;  2LB5 A;  1JWZ A;  5CGS A;  3SW1 A;  2R78 A;  2ZJ9 A;  3CI6 A;  1KOU A;  4LLO B;  3C7U A;  1JNU A;  5CEC A;  2B18 A;  2QWS A;  3Q82 A;  1BUL A;  4WZ5 C;  1KGF A;  5DTS A;  1ES5 A;  2JCH A;  3LGO A;  3S7O A;  3QP5 A;  4E3M A;  4EU0 A;  3G6O A;  5EOO A;  3PYP A;  4UEY A;  3PBT A;  1EI5 A;  1V9Z A;  5CHM A;  2R9W A;  3SH9 A;  3R7W B;  4QD4 A;  2Y2I A;  4L9G A;  1H8Z A;  1LL9 A;  1TS7 A;  5FI2 A;  2PR6 A;  4S2O A;  2Q9M A;  4JXG A;  4UA6 A;  4GKU A;  3WS1 A;  1GHM A;  1DY6 A;  2M7V A;  3LR3 A;  1T1B A;  2Y2L A;  3NBL A;  3JVU A;  4K0W A;  4LPZ A;  1T19 A;  2PRF A;  5FAS A;  3A3E A;  2VGL M;  3TG9 A;  5JYO A;  4B93 A;  3HLB A;  4R4R A;  2ZC5 B;  1OT9 A;  3S7Q A;  1L0D A;  3V67 A;  2PD7 A;  1VQQ A;  1F2K A;  3H7W A;  2QMI A;  2W1R A;  3EGX C;  4LV3 A;  2PYP A;  2ZQ9 A;  3ULF A;  2HP5 A;  1MBL A;  3C7V A;  2KDK A;  1I5Q A;  2J7V A;  5DF8 A;  2HP9 A;  1A0K A;  5DFX A;  3GTC A;  4MCW A;  3K2N A;  2XA7 M;  4LGW A;  3NY4 A;  3ZFZ A;  5FI7 A;  3MMH A;  5E2E A;  5HD5 A;  2ZQC A;  4Y0U A;  3WWX A;  3JVV A;  1KDW A;  1VEU A;  4I5S A;  2P04 A;  4GDB A;  3NDG A;  4I38 A;  4YFM A;  2ZQ8 A;  4KZ6 A;  3W4Q A;  3NOU C;  1Z6F A;  5CEB A;  3LIF A;  5A91 A;  1M6K A;  5GL9 A;  2WGV A;  1YM1 A;  1F5M A;  5DFY A;  4OQ0 A;  2VGL S;  1L0E A;  1VHM A;  5FL3 A;  4WMC D;  4OOY A;  4KZ9 A;  3RXX A;  3C38 A;  2VKS A;  3UPN A;  5F82 A;  2JHE A;  3OBF A;  1K55 C;  4CLC A;  4DJ3 A;  4RYE A;  4Y5F A;  4BBU A;  3KSH A;  1BUE A;  4ARZ B;  3KYE A;  3UDX A;  2G7U A;  1MWU A;  5J4E A;  2ZL1 A;  4EUV A;  2J3T C;  4OKP A;  4QU3 A;  4EES A;  1W63 M;  1AWI A;  2PT7 A;  3SOI A;  1FCN A;  2ZMV A;  4QB8 A;  1F9I A;  2YKF A;  4DDY A;  3KSI A;  1SDN A;  4LCL A;  1FSY A;  2A3U A;  3VFF A;  2P08 A;  1YLZ A;  3E4P A;  1FOF A;  2RCX A;  4S2K A;  1L2S A;  3TJZ C;  3BY8 A;  4R3J A;  4EER A;  5IU1 A;  3IS2 B;  2XRO A;  2V1B A;  1FR6 A;  5DVA A;  5F1G A;  5CRF A;  1CK3 A;  4HY8 A;  2G2U A;  3QHY A;  4B9O A;  1NWZ A;  4IJG A;  3BYD A;  3VP4 A;  3L7H A;  3IH9 A;  4PKY G;  4GB7 A;  3LEQ A;  3F1N B;  4GHI B;  4OOM A;  1ACF A;  4KZB A;  3N4I A;  3QP2 A;  3GDI A;  3P98 A;  3WRT A;  2INW A;  4BD0 A;  3GEC A;  4FCF A;  4KQO A;  2XRN A;  5EV0 A;  4XT2 A;  2EFU A;  3FC7 A;  1NY0 A;  2Z6D A;  4Q0J A;  3FKW A;  1YSQ A;  2O0Y A;  4UHU A;  3CUE A;  3QP1 A;  1FQG A;  1PW8 A;  5HAQ A;  3D9Y A;  2L4R A;  5FQK A;  3D4F A;  3GSG A;  3IHA A;  1K4E A;  1IOU A;  1XP4 A;  3LY3 A;  4GS9 A;  4KQQ A;  1JTD A;  1PWG A;  2WKQ A;  4JGO A;  3DTI A;  2IWB A;  1SKF A;  3UB8 A;  3UB9 A;  4N9L A;  2HDQ A;  4RVA A;  4HJ6 A;  3GR2 A;  2EWW A;  4U0X A;  2WAD A;  1VB6 A;  3MXQ A;  2EXA A;  3G35 A;  2KLI A;  3T50 A;  4I3J A;  3N8S A;  4QWO A;  5FI6 A;  4HNB A;  2WKR A;  1PWD A;  4DRT A;  4N92 A;  3M6B A;  4R0Q A;  1XJ4 A;  4PM8 A;  1TS0 A;  3OOV A;  5J3W A;  5CED A;  2A2L A;  1OJ5 A;  3EEH A;  1T1C A;  5G4Z A;  5L10 A;  3ZDJ A;  4S2N C;  5FAO A;  3MS6 A;  3G34 A;  1ONH A;  5DKL A;  3NHQ A;  2XGN A;  4EWF A;  5C5K A;  4PPR A;  3VV4 A;  2FH5 A;  3DWK A;  2VZW A;  1LI0 A;  2WKE A;  2UWX A;  2XFS A;  4S2I A;  1W63 Q;  1XPB A;  2ZD8 A;  4O7D A;  2PBD P;  1PFL A;  2W3E A;  1W7F A;  3KSF A;  3Q81 A;  2EX6 A;  1LL5 A;  4DE1 A;  4IUH A;  2V8C A;  1BTL A;  1DJA A;  3N6I A;  5BOH A;  3PBN A;  1LI9 A;  2IA2 A;  3A3F A;  4GOG A;  3CZD A;  1SCW A;  4PHT A;  4HHD A;  4GDN A;  3K3D A;  2W3H A;  4I3A A;  3PBQ A;  4BBV A;  3IQA A;  4BJP A; 
#chains in the Genus database with same CATH homology
 2QJ5 A;  4KUO A;  5F68 A;  3MFX A;  4BMW A;  1WA9 A;  3S7O A;  3LID A;  5HD3 A;  4O0P A;  1LSW A;  4EU0 A;  3G6O A;  2PD8 A;  5HDS A;  2ZOH A;  3VE3 A;  4P6Z M;  3PYP A;  3PBR A;  2QHK A;  4UEY A;  4HH3 A;  1MKM A;  3PBT A;  2FZ0 A;  3FG8 A;  1ODV A;  1V9Z A;  2K2N A;  2V0W A;  3A0S A;  2JN7 A;  3R7W B;  4L9G A;  2Z6C A;  3D72 A;  1TS7 A;  2ZMF A;  1V9Y A;  4H6J B;  4NXG A;  3T4S A;  2PR6 A;  3VOL A;  2VX8 A;  2PDR A;  2OAP 1;  1F98 A;  3MJQ A;  5DJU A;  3T4Q A;  4G3V A;  1N9O A;  1P0Z A;  2Y79 A;  3LUQ A;  3UMD A;  2M7V A;  2JKT M;  2VV8 A;  1N9N A;  3LR3 A;  1T1B A;  3UE3 A;  3RTY A;  1OPX A;  3LYX A;  2L1M A;  1H8M A;  5A8B A;  3JVU A;  2W1T B;  3HCY A;  5DJT A;  4LPZ A;  3LIC A;  4H6J A;  1T19 A;  1P9W A;  1NLY A;  4F3L A;  4WUJ A;  4YNR A;  2XSS A;  2VGL M;  4QPR A;  2DMW A;  4IUK A;  5KSH A;  1GSX A;  4B93 A;  2H28 A;  1OT9 A;  4GLQ A;  1UGU A;  3T4O A;  2V1A A;  4CLC D;  3S7Q A;  3V67 A;  1DP6 A;  2QKP A;  2PD7 A;  1XJ2 A;  3RFB A;  3H7W A;  4Y3I A;  2W1R A;  3EGX C;  5AJG A;  5HDC A;  5HWT A;  4R38 A;  2PYP A;  4YWZ A;  2M7U A;  4ETX A;  3ULF A;  2PR5 A;  3F1P B;  4GS9 B;  3OCL A;  4MDZ A;  5TBM A;  2KDK A;  5MC7 A;  5AVF A;  5HWW A;  2OWJ A;  3BWL A;  3IS2 A;  4GJ4 A;  4YOF A;  2OAQ 1;  5DFX A;  2K31 A;  2W1T A;  2KX6 A;  4HP4 A;  4MCW A;  3K2N A;  2XA7 M;  3PXP A;  3LR0 A;  3KSG A;  3MMH A;  5HD5 A;  5TJJ A;  1STZ A;  2MJ6 A;  1OJG A;  3LIB A;  3JVV A;  4JGP A;  5HSQ A;  3EOI A;  4I5S A;  2P04 A;  4NXE A;  2W3G A;  5CX7 A;  4I38 A;  3B33 A;  4R6L A;  3H82 A;  2GZA A;  3T4T A;  3T4J A;  1EW0 A;  4EW7 A;  2A24 B;  3NOU C;  3TE8 A;  3LIF A;  3R7W A;  1S1Y A;  5HZH A;  3B47 A;  4HQA A;  5HDD A;  2VV6 A;  3P7N A;  2D02 A;  2HJE A;  2M1C A;  4FSF A;  2XA7 S;  4UQI S;  1F5M A;  3C30 A;  3MR0 A;  1NLZ A;  3KX0 X;  4ARZ A;  4R3A A;  3MQ0 A;  5DFY A;  3U2A A;  1YAX A;  1T1A A;  2VGL S;  1VHM A;  5FL3 A;  2O9C A;  3KO6 A;  5AVE A;  4WLA A;  2BAS A;  3C38 A;  4Q0I A;  2VKS A;  2WKP A;  3LIA A;  4HJ3 A;  2I9V A;  5J7E A;  2JHE A;  3W2Z A;  3EEA A;  3OBF A;  1ZTU A;  2ZOI A;  4CLC A;  3F1P A;  4DJ3 A;  2GX5 A;  4ZRR A;  3A0V A;  4Y5F A;  2ZBB A;  4KQD A;  4BBU A;  3KSH A;  4ARZ B;  4KUK A;  1OTB A;  2G7U A;  3FPW A;  4HOI A;  5J4E A;  4FOF A;  3PBS A;  4BBT A;  4EUV A;  2J3T C;  4EEP A;  5HPI A;  1ZHH B;  4EES A;  3NOP C;  4HJ4 A;  2A24 A;  1LL8 A;  1W63 M;  4NXB A;  2PT7 A;  2L0W A;  4LRZ E;  2LB9 A;  3B42 A;  2ZMV A;  1MZU A;  1H3Q A;  2V9A A;  4L9F A;  1F9I A;  2YKF A;  1UWP X;  3KSI A;  1TF1 A;  3BQ8 A;  2HJ9 C;  4WN5 A;  3HJI A;  2D01 A;  3TW8 A;  2P08 A;  3EQU A;  3E4P A;  3CLO A;  3TJZ C;  4WL9 A;  3BY8 A;  2J80 A;  3H9W A;  4DMZ A;  4Z1W A;  2VEA A;  2JKR I;  4L0L A;  4EER A;  5IU1 A;  3CIT A;  2JKR M;  3IS2 B;  2XRO A;  2V1B A;  4MN7 A;  2O9A A;  4GHI A;  5IT5 A;  3KYZ A;  3HJK A;  2J3T D;  1LSX A;  1N9L A;  4HY8 A;  4ETZ A;  4WEK A;  4B9O A;  1NWZ A;  1Y28 A;  4IJG A;  2NUP C;  3UME A;  4AFI A;  5F6A A;  4ME4 A;  3BY9 A;  1P9R A;  4HP9 A;  5DF9 A;  4WF0 A;  4PKY G;  4JGR A;  2CMN A;  3E98 A;  3F1N B;  1OTD A;  4I39 A;  4GHI B;  1GSW A;  4NXF A;  4OOM A;  4GCZ A;  3T4K A;  2GJ3 A;  2K7S A;  3DBA A;  3GDI A;  4NEE D;  3CAX A;  3TRC A;  2INW A;  5EFW A;  4HI4 A;  3O5Y A;  3LR5 A;  3BW6 A;  2QJ7 A;  3LI9 A;  4BJP A;  5HL6 A;  3GEC A;  4EET B;  4KQO A;  2XRN A;  4XT2 A;  3MF0 A;  1OT6 A;  4IHQ A;  3FC7 A;  3P01 A;  2Z6D A;  4Q0J A;  3S7N A;  3UB6 A;  1YSQ A;  1OTA A;  1OTE A;  2VV7 A;  5LBR A;  2O0Y A;  3CUE A;  3FPV A;  3RH8 B;  5KIZ A;  3UB7 A;  3CUE C;  1D7E A;  2W3D A;  3F1O B;  4G3K A;  3F1O A;  4O8G A;  1D06 A;  4OOL A;  4CQH A;  2L4R A;  3PR6 A;  3NOT C;  2W3F A;  1S1Z A;  5IS1 A;  1T18 A;  4E04 A;  1XFQ A;  3BQA A;  4F3L B;  4CLC C;  5K5B A;  1IOU A;  3IBR A;  5HWV A;  4GW9 A;  3K3C A;  4GS9 A;  2PYR A;  5I5L A;  2WKQ A;  2QYB A;  4JGO A;  1S66 L;  3LIE A;  3KYQ A;  4DN0 A;  4LRY C;  3E4Q A;  3UB8 A;  2HGV A;  4P6Z S;  2VJW A;  4XT2 B;  2W0N A;  3UB9 A;  4EXO A;  3ZQ5 A;  5F69 A;  3LR4 A;  1GSV A;  3LFV A;  4HJ6 A;  2VLG A;  2EWW A;  1G6O A;  3OLO A;  1VB6 A;  3OCN A;  3MXQ A;  1S4S A;  3F1N A;  4PKY A;  3IBJ A;  4LRX C;  2NUT C;  2KLI A;  3T50 A;  2HV1 A;  2EWV A;  3C2W A;  4I3J A;  4Q0H A;  1S4R A;  3A0R A;  3E0Y A;  3EGD C;  1S67 L;  3OC2 A;  4HNB A;  2WKR A;  4WEL A;  3C8C A;  3MQQ A;  5L8M A;  4R70 A;  4G3W A;  1LT0 A;  1XJ4 A;  3ZYT A;  4CLC B;  4MN5 A;  3T4L A;  1TS0 A;  3OOV A;  2KOI A;  5J3W A;  2A2L A;  1DP8 A;  1OJ5 A;  4WEJ A;  3EEH A;  3NJA A;  1UWN X;  1T1C A;  5G4Z A;  4PAU A;  2O9B A;  3PHY A;  3H82 B;  3E4O A;  5TBM B;  4DJ2 A;  1XJ6 A;  5G4Y A;  4NKP A;  4O01 A;  3BJN A;  1TS6 A;  3LI8 A;  1TD5 A;  5DKL A;  3NHQ A;  3R4K A;  4L9E A;  3UE6 A;  3H7W B;  5DKK A;  5C5K A;  3CWF A;  3VV4 A;  1YKD A;  2FH5 A;  2HF6 A;  4BWI A;  2O99 A;  1OTI A;  3EWK A;  2VZW A;  2OOL A;  5F5Y A;  3VE4 A;  4EQ1 A;  1X0O A;  2J3W A;  3D3O A;  1NRJ A;  1P97 A;  4HH2 A;  4JGQ A;  1LSV A;  1W63 Q;  4UQI M;  1IFQ A;  2B02 A;  3MQO A;  4MMN A;  4HIA A;  2W3E A;  2YKH A;  1BYW A;  4RQ9 A;  2EA9 A;  2JKT I;  3KSF A;  3EQV A;  1XJ3 A;  2GNX A;  4IUH A;  4K08 A;  2P7J A;  1TS8 A;  2OWH A;  1XFN A;  4MN6 A;  3PBO A;  3ICY A;  2V0U A;  2LB5 A;  2Y8H A;  3PBN A;  2PHY A;  3SW1 A;  4II7 A;  4M4X A;  2IA2 A;  4CLC E;  2R78 A;  4Y2F A;  5HPF A;  1DP9 A;  1G28 A;  1MC0 A;  4PHT A;  3CI6 A;  1KOU A;  4HHD A;  4LLO B;  3K3D A;  4EEU A;  2W3H A;  4I3I A;  4I3A A;  1YSP A;  1JNU A;  3PBQ A;  2B18 A;  1DRM A;  2QWS A;  4BBV A;  2W27 A;  2VA0 A;  3S7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...