5TBMA

Crystal structure of pt2385 bound to hif2a-b*:arnt-b* complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
106
Chain Sequence
LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title A Small-Molecule Antagonist of HIF2 alpha Is Efficacious in Preclinical Models of Renal Cell Carcinoma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 106
sequence length 110
ec nomenclature
pdb deposition date 2016-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5tbmA00
1NWZA 4PKYA 3E4QA 3K3CA 2K7SA 1OTBA 2OOLA 4B9OA 4NXFA 4I5SA 4GHIA 3MQQA 3ICYA 4L9EA 5J3WA 4MN5A 2YKFA 4R3AA 4HQAA 1S67L 2YKHA 2M1CA 3UB9A 3VE3A 4WUJA 3F1NA 2CMNA 4EERA 3LUQA 4EW7A 3NOTC 4DJ3A 1F98A 1Y28A 5HZHA 2D01A 3LIDA 2PYRA 2PD7A 3RH8B 2VLGA 1DRMA 4KUKA 3ZQ5A 4BBVA 1OTDA 3A0RA 4HH2A 4HOIA 1TS8A 3D72A 2PR5A 3B33A 4I3AA 3LI9A 1S4SA 2ZOIA 2W27A 5HDSA 2EA9A 3BY9A 1G28A 3MQOA 3MJQA 2R78A 3H9WA 2V0UA 1UGUA 3IBRA 1XFNA 3IS2B 4HH3A 4R6LA 4GCZA 5F68A 3K3DA 4EETB 4R38A 1TS6A 4EEUA 1N9OA 1XJ6A 4L9FA 4WLAA 3BWLA 3IS2A 4DJ2A 1XFQA 3LYXA 3CLOA 2L4RA 2PYPA 3FG8A 4R70A 1S4RA 1LSXA 4GW9A 1OJ5A 3ULFA 1X0OA 2J80A 1T1AA 1V9YA 1JNUA 4H6JA 2L0WA 4I38A 1DP6A 1WA9A 1XJ2A 4M4XA 1OT6A 3NOUC 4PKYG 2W0NA 1VB6A 5HDCA 3PYPA 1S66L 2QHKA 1V9ZA 2D02A 3H82B 4K08A 1T1CA 3CAXA 4JGOA 4HI4A 2L1MA 2QJ7A 3OLOA 5IU1A 1MZUA 1GSXA 1OT9A 3GDIA 1XJ4A 3UE6A 5IS1A 3A0VA 3NJAA 4RQ9A 4XT2B 4KQDA 3H82A 4HJ6A 1T18A 2PR6A 2VV8A 5J4EA 4HP4A 3VOLA 3MFXA 3UB8A 4I39A 2VV7A 4WN5A 4LRYC 1P0ZA 4XT2A 2PDRA 3MR0A 4LLOB 2JHEA 2P7JA 3LICA 4KUOA 3C8CA 4GS9B 5HWWA 4HJ3A 3KX0X 3CWFA 2OWJA 3NHQA 1XJ3A 1S1YA 2VV6A 3EWKA 1LSVA 1TS0A 2WKRA 4EXOA 5DKLA 3LI8A 1D06A 5G4YA 3E4PA 5HD5A 2PD8A 2V0WA 1T1BA 1F9IA 1OJGA 1OTAA 4GS9A 2INWA 3SW1A 3FC7A 2QJ5A 3F1PB 1OTEA 2QWSA 4LRXC 1UWNX 3C2WA 3HJIA 2H28A 4MN6A 4JGPA 5F6AA 5HWTA 4GHIB 2WKQA 5HD3A 2ZBBA 4LRZE 1N9LA 2BASA 4WF0A 3F1PA 5HDDA 1EW0A 1OTIA 3HJKA 3F1NB 4YWZA 5KIZA 4EESA 2OWHA 3PHYA 1KOUA 2HV1A 5J7EA 1P97A 5F69A 2A24B 3GECA 4I3JA 3H7WB 4JGRA 3E4OA 4WL9A 4JGQA 3EEHA 4HY8A 5AVEA 3VE4A 4L9GA 5A8BA 4EQ1A 4F3LB 2B02A 2A24A 2GJ3A 1BYWA 3H7WA 3UB6A 2Z6DA 5EFWA 4LPZA 3UB7A 2V1AA 2Z6CA 4HNBA 4BBTA 5AVFA 3T50A 1UWPX 4F3LA 4HIAA 5G4ZA 2QKPA 5HSQA 1GSWA 2V9AA 2ZOHA 3P7NA 3F1OB 2V1BA 4BBUA 2I9VA 3UMDA 2KDKA 4HHDA 1D7EA 1GSVA 1T19A 2KX6A 1S1ZA 5TBMB 2JN7A 1LT0A 3LIBA 1LSWA 2PHYA 4I3IA 3RTYA 1TS7A 5F5YA 1ODVA 2WKPA 3LIAA 3BY8A 1N9NA 4E04A 3F1OA 3UMEA 3A0SA 1LL8A 5DJTA 5I5LA 4NXBA 5DJUA 4EEPA 4H6JB 5TBMA 4HJ4A 4HP9A 3LIFA 3NOPC 1DP8A 1DP9A 2VEAA 4NXEA 5DKKA 4NXGA 3MXQA 5HWVA 3LIEA 3G6OA
chains in the Genus database with same CATH superfamily
1SKOA 5CEDA 1NWZA 4G3KA 5J8XA 4XUZA 3MXSA 2HP5A 1WYBA 1MPLA 3GQZA 3OCLA 1OTBA 4JXWA 3N8RA 4BD1A 4S2MA 4GHIA 5EUAA 1YLYA 1KDSA 3ICYA 4L9EA 5J3WA 4A5RA 3U2AA 4EWFA 1G6OA 2XF3A 2PRFA 1OPXA 3HUOA 3LUQA 4EERA 4EW7A 1NYMA 3MS6A 2OAQ1 3S7QA 3WS0A 3DTKA 3UO9A 4K0XA 2PYRA 3C5AA 1KE0A 1BUEA 1FSWA 4YNRA 3CG5A 1FR6A 2VLGA 4JXGA 1OTDA 4IVIA 1WE4A 3A3JA 5EV0A 5C5KA 4DRTA 3KSIA 3IBJA 1TS8A 4C75A 3W4OA 3OPPA 4PM8A 3UDXA 2M7UA 1S4SA 2Y2IA 5HDSA 2EA9A 4GN2A 4JXVA 2V8FA 1VETB 2XFTA 3BY9A 1SKFA 1TDGA 4LV2A 1XGJA 3FPVA 2HJEA 2R78A 3H9WA 1PWGA 1IYOA 4HBUA 2V0UA 1SDEA 2WGIA 1H5XA 4CLCA 3DWKA 1XFNA 3IS2B 3N4IA 1ERMA 4DXCA 4HH3A 3ZVTA 4OP8A 2J3WA 4Q8IA 1HVBA 4R4RA 1GHMA 1ES3A 4ESPA 1TS6A 2EX6A 4ZJ2A 2ZL1B 4B88A 3BWLA 3CPTA 4S2NC 3UDIA 3BQ8A 4Y0TA 4OPZA 1H8YA 4GD6A 3Q82A 3B3XA 3CLOA 3G2ZA 5AQ9A 3OC2A 3VSLA 2IWDA 3IWQA 2LB5A 2EFXA 1LSXA 3M6HA 4GW9A 4LV3A 1T1AA 1V9YA 1W79A 3T4OA 4DF6A 3O3VA 1TF1A 2X02A 1SHVA 3MSHA 3D9YA 2FFYA 3E2LA 3IHBA 4OQIA 1XKZA 2HP6A 3VP2A 4OPRA 3PYPA 2Y2NA 3DWZA 4JGOA 1H3QA 4RX3A 3PBRA 1IYPA 4RYEA 1MZUA 1GSXA 3T4SA 2NUTC 4RVAA 3Q1FA 3GDIA 3HLGA 1BLSA 3PXPA 3N8LA 3PAEA 2VA0A 1T18A 4ARZA 1ZG6A 1YT4A 2VV8A 1N4OA 4PM7A 2ZC3B 4S2KA 1KGEA 4HP4A 5CRFA 4O7DA 2XGNA 2J3TD 3S22A 1ALQA 4OP5A 4NG2A 3LO7A 1CEFA 4FOFA 1Y54A 4B4ZA 1YSPA 4XT2A 1KDWA 2BTFP 2GDNA 2PDRA 3MR0A 3C38A 4KENB 3DBAA 4DE3A 5HPIA 3HLFA 4BD0A 3QP6A 1BTLA 4HJ3A 3KX0X 5FI7A 4PPRA 2Y2OA 2EX2A 3NIAA 4PM9A 4KG5A 4N1HA 4EBNA 5LBRA 3Q7ZA 2BLSA 5D3OA 3LI8A 4E3KA 1HLUP 5G4YA 5HD5A 3QNCA 3WS2A 3QP8A 4C3QA 1BSGA 1OJGA 4JF5A 3HBRA 1OTAA 2Y2LA 2XFSA 2Y2GA 4GS9A 3SW1A 1O7EA 3WRTA 3O86A 4R1GA 5EOOA 5JYPA 1KVMA 1SKOB 2P9VB 2QWSA 3SH9A 4GD8A 3C2WA 1GA9A 5KSHA 5TJJA 4X68A 4R4SA 5K5BA 4C6YA 3G2YA 4ZJ1A 3FKVA 3V3SA 4D60A 5EVEA 4GHIB 2OSUA 2ZBBA 4LRZE 2BASA 4WF0A 5HDDA 1CF0A 3HL9A 5GLBA 5FI2A 1XGIA 4CLCD 1N9BA 1E4DA 4JXSA 1TVFA 1PI5A 3UNWA 1ZC2A 2EWWA 4FH2A 4PAUA 1KOUA 1YMSA 3HLWA 3HLCA 2XRNA 3E0YA 4ETXA 4GDBA 3G35A 4OLGA 3ZNYA 2ZMAA 4GKUA 2A24B 3GECA 5FQKA 2QZ6A 3Q7VA 1TDLA 2XD1A 2ZMFA 1MC0A 2JKRM 1MKIA 4F94A 4JGQA 1KVLA 4B93A 3C7UA 5AVEA 3VE4A 4U3TA 5EM1A 3JVUA 3EQVA 1XPBA 3ZFZA 1HD8A 3ZG8B 5AQBA 2E8JA 2Y2MA 3H7WA 1PNEA 1MWTA 1FCNA 2KLIA 4N1XA 3SH8A 3MBZA 2V1AA 4BBTA 1PRQA 5GL9A 4ZJ3A 1CQAA 2WZXA 3T50A 3OPRA 3CUEC 1PZOA 1PYYA 2ZD8A 3BM6A 4HIAA 2QKPA 2JKGA 2EXBA 2UWXA 1GSWA 2ZOHA 1K6SA 4WYYA 4EU0A 1YLJA 3F1OB 2V1BA 1L2SA 4BBUA 1YPRA 5CGXA 1BZAA 4HHDA 1VQQA 1XX2A 5HL6A 1LT0A 3ZDJA 4PHTA 4QY6A 2IWBA 3G4PA 1PW8A 2PHYA 1W63Q 3HUMA 3BY8A 4UEYA 4BL2A 1DJCA 5FEGA 4QY5A 4RA7A 1LL8A 3VP0A 5DJTA 4EBLA 1J9MA 4NKPA 2B18A 4EEPA 2ZM0A 5TBMA 3BLMA 3HVFA 2HPBA 3LIFA 3NOPC 1DP9A 2VEAA 4GB7A 3MXQA 3MKEA 4D2OA 1EROA 1RGZA 4UAAA 1GHPA 2Q9MA 2O99A 5GHYA 5EVIC 1FSYA 5DTTA 2HZ5A 5FQ9A 3UE0A 3K3CA 4P6BA 2ZQ9A 3CITA 1E3UD 3NC8A 1MY8A 2Y59A 3LCEA 1YLPA 1W63M 2R9WA 3FZCA 2PBYA 5I94A 3VE3A 2M1CA 4WMCA 1FQGA 3R7WB 3V5MA 2GNXA 3KSHA 3O88A 1K55C 3NOTC 3BYDA 2JBFA 3T4QA 3HCYA 2P74A 3PBOA 5GHXA 1Y28A 1IYQA 1NZUA 2D01A 4LV0A 3G30A 3RH8B 1DRMA 4IBXA 4KUKA 3ZQ5A 3E98A 2HF6A 2QPNA 4NK3A 4HOIA 1MKMA 4OPYA 2FZ0A 3G31A 4UA9A 3PAGA 4QD4A 4IVKA 4KZ5A 2ZOIA 3MJQA 1JWZA 4O8GA 3PBSA 5KMWA 1MWUA 2ZLYA 4X53A 3EGDC 2W1RA 1I2WA 3M2KA 5DF7A 3T4JA 4KG6A 5FATA 4OH0A 1OMEA 4S2NA 3IXGA 4R6LA 4GCZA 1JTDA 3K3DA 3LEQA 3OPHA 2QYBA 5CERA 1I5QA 4EEUA 1RP5A 1XJ6A 1PW1A 4AFIA 3UB5P 3D4FA 3L9KA 2EWVA 5FEFA 4DN0A 1CI9A 1EWZA 3W4PA 4DJ2A 3HLBA 3KYZA 1YQSA 2L4RA 4M3KA 2PYPA 1ES4A 1ESUA 2WAEA 3VP4A 1M6KA 4KZ9A 5HAPA 3ULFA 4MBFA 1X0OA 1JNUA 1PFLA 3FWLA 1LL9A 3AGEA 4HBTA 4I38A 1WA9A 1XJ2A 2W1TA 3BFDA 4PKYG 1VM1A 2C6WB 3L7HA 1IYSA 3I7JA 1S66L 1V9ZA 3TG9A 3CAXA 4HI4A 5FASA 4X56A 2L1MA 3DTIA 4YOFA 2QJ7A 1K0KA 4UA6A 5IU1A 4O01A 5TGFA 2RL3A 1XXMA 3NDGA 3V50A 3BEBA 4QB8A 2J9OA 3IQAA 3UE6A 1P9RA 3JVVA 2K31A 2XDMA 1TEMA 3H82A 2JKFA 1K56D 2LB9A 2VZWA 2WGVA 5EOEA 5A91A 2PR6A 1Q2QA 1IKIA 2Y79A 4U0TA 3IWIA 4MBKA 2HJ9C 4MN7A 4KQRA 3BQAA 3CMZA 5HPFA 3RFBA 2J9PA 5TR7A 4N9LA 2JHEA 1L3LA 4IJGA 2P7JA 1TD5A 4K0WA 1FOFA 2A49A 3IXDA 4WMCD 4BWIA 3C8CA 3A3IA 1ZHHB 3CWFA 2OWJA 3MFDA 3GTCA 3NHQA 5TFQA 5CEBA 4DKIA 1S1YA 1JTGA 1LSVA 1KGFA 2JCHA 1PZPA 4S2LA 4UA7A 4EXOA 4S2OA 2ZC6B 1L0EA 4UQIM 2ZC4B 2ZC5B 1F9IA 1DJBA 4WZ5A 2R9XA 3N6IA 1IELA 1LI0A 4JBFA 1DY6A 5EVLA 1KE3A 2EX8A 1MWRA 3P01A 3F1PB 1OTEA 2W3DA 3WS1A 5FQJA 2ZJ9A 3QHYA 2Y55A 3M2JA 5M18A 2G2UA 3KSFA 3IXHA 5HD3A 1N9LA 3G34A 1FIKA 4P6ZS 3S4XA 3E2KA 2H5SA 1G68A 4BENA 3T4KA 2OWHA 4CPKA 2HV1A 3N7WA 3SS3A 1P97A 3LR3A 3TOIA 4JF6A 4O0PA 3UPPA 1GA0A 2EFUA 5DF8A 1VEUA 1IEMA 5HX9A 4I3JA 3LY4A 3E4OA 5DFXA 1YLZA 5IT5A 1JWPA 4Z9QA 1U60A 5AQAA 2OLVA 5A8BA 4UQIS 4EQ1A 4EUZA 3BFFA 2B02A 5HL1A 1ACFA 5BOHA 5HAQA 3CUEA 1BYWA 3OBFA 4X1LA 2Z6CA 4OQHA 4IEDA 4X25A 1YLWA 4F3LA 2DCFA 3OOVA 2VX8A 3JYIA 4R3BA 3MF0A 5HSQA 2V9AA 3HLEA 4X55A 4QJGA 1BT5A 5FQMA 3IWOA 1F2KA 2NUPC 2I9VA 2WGWA 4OOLA 2KDKA 1D7EA 3BRMA 1ZKJA 3VMAA 2KX6A 1S1ZA 5FDSA 4QHCA 2WKEA 2V2FF 1ODVA 1FCMA 3IXBA 2XA7S 2VKSA 1C3BA 1N9NA 4LV1A 5EVIA 4JKTA 5I5LA 3BW6A 4WZ5C 2XR0A 4II7A 4HP9A 1IFQA 4NXEA 4MCWA 4NXGA 5HWVA 2Q0OA 3LIEA 4CQHA 4MLLA 3DW0A 1NJ4A 2C5WB 5FQIA 3W4QA 3IF6A 3E4QA 3WS5A 1S6RA 4NXFA 1K55A 5KSCA 2Y91A 4QPRA 3UY6A 4MN5A 5AQ7A 2XK1A 4R3AA 3U4LP 2Q9NA 3B42A 3F1NA 3SOIA 5KZHA 4X1MA 2J7VA 4DJ3A 3HUNA 2HDSA 3ZNTA 3PBQA 4E3OA 4E3JA 2O9BA 3KYQA 4JF4A 3T1SA 1FCOA 2HDRA 1HTZA 3PR6A 2Y2JA 4EQIA 1L0DA 1BLCA 5FAQA 4BBVA 3A0RA 4NEED 1Z09A 1YMXA 3P09A 2ZQ7A 3D72A 2PR5A 4Y5FA 3B33A 4P85A 3C7VA 2WKIA 1YKDA 3VP1A 5EM0A 3LI9A 4CLCB 5MC7A 4Q0JA 5F82A 2P08A 3LR5A 5L09A 3OZHA 3CHWP 1W5DA 3SS4A 4ID4A 1L0GA 3MQOA 3GMWA 2A3UA 3S7PA 3WWXA 2ZM8A 4ZBEA 5EECA 2ZM2A 2RCXA 4BLMA 5CGWA 3A3FA 5E2EA 2B5RA 5A93A 4E3MA 5G18A 3CPTB 3MKFA 4ME4A 4OQ0A 2ZC7A 5F1GA 4S2PA 5E2HA 3O5YA 4OONA 5F68A 3OPLA 3GRJA 4EETB 1GCEA 5E2GA 5FAOA 5HAIA 1F5MA 1NYYA 1HZOA 1VHMA 1NRJA 1CJFA 4L9FA 4WLAA 2H0TA 1NRFA 1ERQA 1O07A 3IS2A 3N8SA 3MZFA 3PBTA 1XFQA 3LYXA 4P0MA 1QMFA 3FG8A 4PM6A 4B4XA 2K2NA 2Y2PA 3VOZA 4H6JA 3LR0A 5DF9A 5AJGA 5FDHA 4DE0A 1DP6A 4ZDXA 4M4XA 3NOUC 4EV4A 2W0NA 1VB6A 5HDCA 3IF6C 3C30A 2D02A 4BMWA 2XQZA 1T1CA 3T12B 4ARZB 2O9CA 4OQGA 3RXWA 4E6WA 5A92A 1FILA 2E8IA 5EVID 1AXBA 4JPMA 4CJNA 1XJ4A 4XT2B 3PTEA 3ZG0A 4S2JA 4KQQA 4E3LA 4KQDA 2XROA 2J8YA 4OPQA 2M7VA 3SH7A 4DE2A 2ZQDA 3T1XA 4KZ6A 1BULA 1K25A 1YAXA 3GR2A 3MFXA 3UB8A 3FYZA 4I39A 2XH9A 3ZG5A 5DVAA 1P0ZA 4FH4A 4LLOB 5GLCA 4FSFA 3TRCA 2UV0E 4LENA 2BG1A 3LGOA 4MMNA 1MWSA 3C4OA 4KUOA 4GDNA 4GS9B 2Y8HA 5DFYA 3LR4A 3EWKA 4WM9A 2WKRA 3TE8A 5E43A 1D06A 3NDEA 4JLFA 5EVIB 3IH9A 2HGVA 2XSSA 2W3HA 4KZ8A 3V3RA 2Z2LB 2DRWA 4Y17A 1T1BA 4K91A 5HARA 1PIOA 3C4PA 4WZ4A 4IUKA 3KO6A 4N92A 4GOGA 1E25A 4MNRA 3NY4A 1BLPA 4DDYA 4OVDA 2QJ5A 4LRXC 5DTSA 4EBPA 4BL3A 3HJIA 2H28A 3S1YA 4Y0UA 2PBDP 5FI6A 3DTEA 2WKQA 1K57A 4U0XA 5U47A 3LFVA 4EUVA 2ACGA 2P9VA 5CHUA 1EW0A 4NETA 3HJKA 3Q7VB 3F1NB 3JPUA 1LL5A 5J7EA 3P98A 5F69A 3IX4A 3NCKA 3CI6A 3T4LA 3H7WB 2EX9A 4JGRA 4XUXA 5F1FA 3B47A 5FQQA 3LEZA 3EEHA 3MQ0A 4HY8A 2WUQA 4Q0IA 1ONGA 1K6RA 4P6ZM 2GZAA 2A24A 3VFHA 3VOYA 4QWOA 5HW3A 4YINA 1S0WA 1YM1A 2Z6DA 4R0QA 2JKTM 2XEPA 4ZAMA 4L0LA 5GLAA 3UB7A 1CEGA 4HNBA 4Z1WA 1SCWA 2JC7A 3OCNA 3ZHHA 1K4EA 3KYEA 3UE1A 5L2FA 4Y2FA 4P87A 5FSRA 1YLTA 4GZBA 3MZDA 1NZOA 1IOUA 4WELA 4R3JA 3IT9A 3UMDA 3VFFA 1JWVA 3R4KA 3BECA 3K2NA 5TBMB 2VJWA 5L8MA 2JN7A 4Y3IA 2DMWA 3LIBA 1K38A 1LSWA 1FR1A 4I3IA 1TS7A 5F5YA 3EOIA 4Y7PA 3QP5A 1K4FA 4E04A 2HP9A 3F1OA 3UMEA 1J3WA 2PAVP 3ZGAB 2X01A 5DJUA 5A90A 4OOYA 4H6JB 4HJ4A 3FKWA 1DP8A 5GHZA 5DKKA 1A0KA 4S2IA 3BLSA 5DTKA 4IBRA 4PKYA 4LFUA 1KGGA 3GV9A 2K7SA 2OOLA 3Q81A 4B9OA 1K57C 3D3OA 3TSGA 4I5SA 1ZG4A 2ZMVA 1ES5A 4FUWA 3MQQA 1CK3A 2XA7M 2WAFA 3T1QB 2YKFA 2JKTI 1QMEA 4HQAA 1S67L 2YKHA 3UB9A 4WUJA 2J3TC 2O9AA 2CMNA 2KOIA 1XA7A 2X71A 4H8RA 3IF5A 2WADA 4GNUA 3DTMA 4OOMA 3W2ZA 1F98A 3NECA 4FD8A 1I2SA 5HZHA 1RCJA 1PI4A 3WS4A 5FAPA 3LIDA 3QP4A 1ES2A 3IH8A 3IX3A 2PD7A 4HH2A 3A3DA 3R7WA 3M6BA 4LCLA 4YFMA 1ONHA 1NLZA 2OAP1 3O87A 4I3AA 2V1ZA 2W27A 4WEKA 1NY0A 2MJ6A 4FTXA 3AGDA 4DXBA 1G28A 4FCFA 2XD5A 1K54A 1ZTUA 4KZ3A 2WZZA 5EPHA 1W8QA 3G32A 2PU2A 1IKGA 4LGWA 1KE4A 5HFOA 1UGUA 3IBRA 5M1AA 2IA2A 3GSGA 3UE3A 2QMIA 1G6AA 1E3UA 2Y2KA 4R38A 2O0YA 4IUHA 1N9OA 1G5UA 3ZCZA 4R23A 4CLCC 3IX8A 1PWDA 5GLDA 5M19A 2A2LA 5E2FA 1DJAA 1AWIA 3ITBA 2W1TB 3QP1A 4BQMA 5CECA 4ZTKA 3SS5A 3WRZA 4ZRRA 5FL3A 4R70A 3NBLA 1S4RA 5L10A 4E3IA 1OJ5A 3V39A 4KZAA 3AGFA 2J80A 1H0MA 2V8CA 2OLUA 2L0WA 2WYXA 4KQOA 2Z2MB 1OT6A 2HDUA 4XXRA 2FH5A 2H10A 2QHKA 3HLDA 3H82B 4K08A 3OLOA 4Y15A 4KZBA 4E3NA 3TJZC 1OT9A 4QU3A 1LI9A 5IS1A 3A0VA 3NJAA 4RQ9A 4RX2A 5CHMA 3ITAA 2DNSA 4HJ6A 3RJUA 4HESA 1Q2PA 5J4EA 3FPWA 4HEFA 2ZQCA 1BLHA 3VOLA 4E6XA 2VV7A 3ZVWA 3UPOA 1M40A 4WN5A 4PM5A 4LRYC 2OV5A 1ESIA 1XP4A 5IHVA 4KZ4A 3LICA 4MEZA 2JE5A 1STZA 3ZG7B 3ZYTA 3MZEA 4N9KA 5HWWA 4CLCE 1XJ3A 2VV6A 2H0YA 4X6TA 1K54C 1TS0A 4GLQA 1VETA 4ETZA 1H8MA 5DKLA 2B95A 3E4PA 2PD8A 1WYCA 1YSQA 2WKHA 3BJNA 2V0WA 4BJPA 3PBNA 2INWA 2Y4AA 2W3FA 2VK3A 2VGKA 1MXOA 1Y4OA 1GHIA 1NXYA 3FC7A 2WK0A 3CJMA 4Y13A 3LY3A 4DE1A 1UWNX 3VP3A 5F83A 2VGJA 4DMZA 2XLNA 4MDZA 3DAVA 2G7UA 4MN6A 3BFGA 4JGPA 2CC1A 1EI5A 2ZL1A 3EEAA 5F6AA 5HWTA 3UDFA 1PWCA 3MMHA 4DDSA 1RGYA 4UHUA 1K56A 1VEUB 3F1PA 4OLDA 3KSGA 4PMAA 1OTIA 4OKPA 2JKRI 3T4TA 2HDQA 3FV7A 4YWZA 5KIZA 4EESA 1SDNA 3PHYA 4G3VA 2ZQ8A 3S7OA 3A3EA 1L0FA 3RXXA 2ZQAA 2VGLM 1P9WA 4KZ7A 2I72A 3Q07A 5CHJA 1LHYA 4G3WA 3TW8A 2PT7A 2Y2QA 4WL9A 3T1RA 2FFFB 3CZDA 4L9GA 4GJ4A 5CGSA 4F3LB 3QP2A 4Y0OA 2GJ3A 3NULA 1H8ZA 3SZTA 3UB6A 2W3EA 5EFWA 5L07A 2G2WA 4LPZA 3UPNA 3GVBA 3V67A 1LLBA 2AVXA 2WGWB 5AVFA 4MBHA 5CTMA 1D1JA 1SZVA 1UWPX 5CXWA 5G4ZA 1MBLA 5FA7A 5JYOA 2GX5A 4KG2A 3BFEA 2Y2HA 3P7NA 4Q0HA 2V20A 3UN7A 1NLYA 5EE8A 3EQUA 1W7FA 3VSKA 2EXAA 4X69A 1GSVA 1T19A 3BFCA 3MXRA 3HREA 1JVJA 2IWCA 5CTNA 2P04A 3S7NA 4WEJA 3ISGA 3RTYA 2WKPA 3LIAA 1CI8A 2PU4A 4IHQA 3ZG9B 3A0SA 2VGLS 3IHAA 3IF6B 5CX7A 4WBGA 3W8KA 1Z6FA 4LCMA 4NXBA 3EGXC 3QNBA 1XA1A 2W3GA 1W8YA 3VV4A 3NI9A 3G6OA
chains in the Genus database with same CATH topology
4CQHA 2O99A 1NWZA 4G3KA 4PKYA 3E4QA 3K3CA 3OCLA 2K7SA 1OTBA 2OOLA 4B9OA 3CITA 3D3OA 4NXFA 4I5SA 4GHIA 2ZMVA 3MQQA 3ICYA 4QPRA 4L9EA 2XA7M 5J3WA 1W63M 4MN5A 3U2AA 2YKFA 4R3AA 2JKTI 1G6OA 4HQAA 1S67L 2YKHA 2M1CA 3UB9A 3VE3A 4WUJA 1OPXA 2J3TC 2O9AA 3B42A 3F1NA 3R7WB 2CMNA 2KOIA 2GNXA 4EERA 3LUQA 4EW7A 3KSHA 2OAQ1 3S7QA 3NOTC 3T4QA 4DJ3A 3HCYA 4OOMA 3PBOA 3W2ZA 1F98A 1Y28A 3PBQA 5HZHA 2D01A 3LIDA 2PYRA 2O9BA 3KYQA 4YNRA 2PD7A 3RH8B 2VLGA 3PR6A 1DRMA 4KUKA 3ZQ5A 4BBVA 1OTDA 3E98A 2HF6A 3A0RA 4HH2A 3R7WA 4NEED 5C5KA 4HOIA 1MKMA 3KSIA 3IBJA 1TS8A 2FZ0A 3D72A 1NLZA 2OAP1 2PR5A 4Y5FA 3B33A 4I3AA 1YKDA 2M7UA 4CLCB 3LI9A 5MC7A 1S4SA 2ZOIA 2W27A 4Q0JA 4WEKA 2P08A 3LR5A 5HDSA 2MJ6A 2EA9A 3BY9A 1G28A 3MQOA 3MJQA 4O8GA 3FPVA 1ZTUA 3S7PA 2HJEA 2R78A 3H9WA 3PBSA 2V0UA 3EGDC 2W1RA 1UGUA 3IBRA 3T4JA 4CLCA 4ME4A 1XFNA 2IA2A 3UE3A 3IS2B 4HH3A 4R6LA 4GCZA 3O5YA 5F68A 3K3DA 2J3WA 4EETB 2QYBA 4R38A 2O0YA 1TS6A 1F5MA 4EEUA 4IUHA 1N9OA 1VHMA 1XJ6A 1NRJA 4AFIA 4CLCC 4L9FA 4WLAA 3BWLA 3BQ8A 2A2LA 2EWVA 4DN0A 3IS2A 4DJ2A 3PBTA 2W1TB 1XFQA 3LYXA 3CLOA 3OC2A 3KYZA 2L4RA 2PYPA 3FG8A 4ZRRA 5FL3A 4R70A 2LB5A 1S4RA 1LSXA 4GW9A 1OJ5A 3ULFA 1X0OA 2J80A 1T1AA 2K2NA 1V9YA 1JNUA 4H6JA 3LR0A 3T4OA 5DF9A 5AJGA 2L0WA 1TF1A 4KQOA 4I38A 1DP6A 1WA9A 1XJ2A 4M4XA 1OT6A 2FH5A 2W1TA 3NOUC 4PKYG 2W0NA 1VB6A 5HDCA 3PYPA 1S66L 2QHKA 3C30A 1V9ZA 2D02A 4BMWA 3H82B 4K08A 1T1CA 4ARZB 2O9CA 1H3QA 3CAXA 4HI4A 4JGOA 2L1MA 4YOFA 2QJ7A 3PBRA 3OLOA 5IU1A 4O01A 1MZUA 1GSXA 3T4SA 2NUTC 3TJZC 1OT9A 3GDIA 1XJ4A 3UE6A 5IS1A 3A0VA 3NJAA 4RQ9A 4XT2B 1P9RA 3JVVA 2K31A 3PXPA 4KQDA 3H82A 4HJ6A 2VA0A 1T18A 2LB9A 2VZWA 4ARZA 2XROA 2M7VA 2PR6A 2VV8A 2Y79A 5J4EA 3FPWA 1YAXA 4HP4A 3VOLA 3MFXA 3UB8A 2HJ9C 4MN7A 2J3TD 4I39A 2VV7A 3BQAA 4WN5A 5HPFA 3RFBA 4FOFA 4LRYC 1P0ZA 1YSPA 4XT2A 2PDRA 3MR0A 3C38A 4LLOB 3DBAA 2JHEA 5HPIA 4FSFA 3TRCA 4IJGA 2P7JA 3LICA 1TD5A 4MMNA 1STZA 4KUOA 3ZYTA 4BWIA 3C8CA 4GS9B 5HWWA 2Y8HA 4HJ3A 3KX0X 1ZHHB 4CLCE 3CWFA 2OWJA 3NHQA 5DFYA 1XJ3A 3LR4A 1S1YA 2VV6A 3EWKA 1LSVA 1TS0A 4GLQA 5LBRA 4ETZA 2WKRA 1H8MA 4EXOA 5DKLA 3LI8A 3TE8A 1D06A 5G4YA 3E4PA 2HGVA 2XSSA 5HD5A 2PD8A 2W3HA 4UQIM 1YSQA 3BJNA 2V0WA 1T1BA 1F9IA 1OJGA 1OTAA 4BJPA 4IUKA 3PBNA 4GS9A 3KO6A 2INWA 3SW1A 2W3FA 3FC7A 3P01A 2QJ5A 3F1PB 1OTEA 2W3DA 2QWSA 4LRXC 1UWNX 5KSHA 3C2WA 3HJIA 5TJJA 2H28A 4DMZA 4MDZA 5K5BA 2G7UA 4MN6A 4JGPA 3EEAA 5F6AA 5HWTA 4GHIB 2WKQA 3MMHA 3KSFA 5HD3A 2ZBBA 4LRZE 1N9LA 2BASA 3LFVA 4WF0A 4EUVA 4P6ZS 3F1PA 5HDDA 3KSGA 1EW0A 1OTIA 3HJKA 2JKRI 3T4TA 4CLCD 3F1NB 3T4KA 4YWZA 5KIZA 4EESA 2EWWA 2OWHA 4PAUA 3PHYA 1KOUA 2HV1A 5J7EA 2XRNA 3E0YA 4ETXA 1P97A 3LR3A 4G3VA 3S7OA 5F69A 2A24B 4O0PA 3GECA 3CI6A 4I3JA 2VGLM 3T4LA 1P9WA 3H7WB 4JGRA 3E4OA 5DFXA 2ZMFA 1MC0A 3B47A 5IT5A 4G3WA 3TW8A 2JKRM 2PT7A 4WL9A 4JGQA 3EEHA 3MQ0A 4B93A 4HY8A 4Q0IA 5AVEA 3VE4A 3JVUA 4GJ4A 4L9GA 4P6ZM 5A8BA 4UQIS 2GZAA 4EQ1A 4F3LB 2B02A 2A24A 3EQVA 2GJ3A 3CUEA 1BYWA 3H7WA 3UB6A 2W3EA 2Z6DA 5EFWA 2KLIA 2JKTM 4LPZA 4L0LA 3OBFA 3V67A 3UB7A 2V1AA 2Z6CA 4HNBA 4Z1WA 4BBTA 5AVFA 3OCNA 3T50A 1UWPX 3CUEC 4F3LA 4Y2FA 4HIAA 5G4ZA 3OOVA 2QKPA 2VX8A 3MF0A 2GX5A 5HSQA 1GSWA 2V9AA 2ZOHA 4EU0A 1IOUA 3P7NA 3F1OB 4WELA 4Q0HA 2V1BA 4BBUA 2NUPC 2I9VA 1NLYA 3EQUA 3UMDA 4OOLA 2KDKA 4HHDA 1D7EA 1GSVA 3R4KA 1T19A 2KX6A 5HL6A 1S1ZA 3K2NA 5TBMB 2VJWA 5L8MA 2JN7A 4Y3IA 1LT0A 4PHTA 2DMWA 2P04A 3LIBA 1LSWA 3S7NA 2PHYA 4WEJA 4I3IA 1TS7A 5F5YA 3RTYA 1ODVA 3EOIA 2WKPA 1W63Q 2XA7S 3LIAA 3BY8A 2VKSA 4IHQA 4UEYA 1N9NA 4E04A 3F1OA 3UMEA 3A0SA 2VGLS 1LL8A 5DJTA 5CX7A 5I5LA 3BW6A 4NKPA 2B18A 4NXBA 5DJUA 4EEPA 3EGXC 4H6JB 5TBMA 4HJ4A 4HP9A 4II7A 3LIFA 3NOPC 1DP8A 1DP9A 1IFQA 2VEAA 2W3GA 4NXEA 5DKKA 3VV4A 4MCWA 3MXQA 4NXGA 5HWVA 3LIEA 3G6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWZ A;  4PKY A;  3E4Q A;  3K3C A;  2K7S A;  1OTB A;  2OOL A;  4B9O A;  4NXF A;  4I5S A;  4GHI A;  3MQQ A;  3ICY A;  4L9E A;  5J3W A;  4MN5 A;  2YKF A;  4R3A A;  4HQA A;  1S67 L;  2YKH A;  2M1C A;  3UB9 A;  3VE3 A;  4WUJ A;  3F1N A;  2CMN A;  4EER A;  3LUQ A;  4EW7 A;  3NOT C;  4DJ3 A;  1F98 A;  1Y28 A;  5HZH A;  2D01 A;  3LID A;  2PYR A;  2PD7 A;  3RH8 B;  2VLG A;  1DRM A;  4KUK A;  3ZQ5 A;  4BBV A;  1OTD A;  3A0R A;  4HH2 A;  4HOI A;  1TS8 A;  3D72 A;  2PR5 A;  3B33 A;  4I3A A;  3LI9 A;  1S4S A;  2ZOI A;  2W27 A;  5HDS A;  2EA9 A;  3BY9 A;  1G28 A;  3MQO A;  3MJQ A;  2R78 A;  3H9W A;  2V0U A;  1UGU A;  3IBR A;  1XFN A;  3IS2 B;  4HH3 A;  4R6L A;  4GCZ A;  5F68 A;  3K3D A;  4EET B;  4R38 A;  1TS6 A;  4EEU A;  1N9O A;  1XJ6 A;  4L9F A;  4WLA A;  3BWL A;  3IS2 A;  4DJ2 A;  1XFQ A;  3LYX A;  3CLO A;  2L4R A;  2PYP A;  3FG8 A;  4R70 A;  1S4R A;  1LSX A;  4GW9 A;  1OJ5 A;  3ULF A;  1X0O A;  2J80 A;  1T1A A;  1V9Y A;  1JNU A;  4H6J A;  2L0W A;  4I38 A;  1DP6 A;  1WA9 A;  1XJ2 A;  4M4X A;  1OT6 A;  3NOU C;  4PKY G;  2W0N A;  1VB6 A;  5HDC A;  3PYP A;  1S66 L;  2QHK A;  1V9Z A;  2D02 A;  3H82 B;  4K08 A;  1T1C A;  3CAX A;  4JGO A;  4HI4 A;  2L1M A;  2QJ7 A;  3OLO A;  5IU1 A;  1MZU A;  1GSX A;  1OT9 A;  3GDI A;  1XJ4 A;  3UE6 A;  5IS1 A;  3A0V A;  3NJA A;  4RQ9 A;  4XT2 B;  4KQD A;  3H82 A;  4HJ6 A;  1T18 A;  2PR6 A;  2VV8 A;  5J4E A;  4HP4 A;  3VOL A;  3MFX A;  3UB8 A;  4I39 A;  2VV7 A;  4WN5 A;  4LRY C;  1P0Z A;  4XT2 A;  2PDR A;  3MR0 A;  4LLO B;  2JHE A;  2P7J A;  3LIC A;  4KUO A;  3C8C A;  4GS9 B;  5HWW A;  4HJ3 A;  3KX0 X;  3CWF A;  2OWJ A;  3NHQ A;  1XJ3 A;  1S1Y A;  2VV6 A;  3EWK A;  1LSV A;  1TS0 A;  2WKR A;  4EXO A;  5DKL A;  3LI8 A;  1D06 A;  5G4Y A;  3E4P A;  5HD5 A;  2PD8 A;  2V0W A;  1T1B A;  1F9I A;  1OJG A;  1OTA A;  4GS9 A;  2INW A;  3SW1 A;  3FC7 A;  2QJ5 A;  3F1P B;  1OTE A;  2QWS A;  4LRX C;  1UWN X;  3C2W A;  3HJI A;  2H28 A;  4MN6 A;  4JGP A;  5F6A A;  5HWT A;  4GHI B;  2WKQ A;  5HD3 A;  2ZBB A;  4LRZ E;  1N9L A;  2BAS A;  4WF0 A;  3F1P A;  5HDD A;  1EW0 A;  1OTI A;  3HJK A;  3F1N B;  4YWZ A;  5KIZ A;  4EES A;  2OWH A;  3PHY A;  1KOU A;  2HV1 A;  5J7E A;  1P97 A;  5F69 A;  2A24 B;  3GEC A;  4I3J A;  3H7W B;  4JGR A;  3E4O A;  4WL9 A;  4JGQ A;  3EEH A;  4HY8 A;  5AVE A;  3VE4 A;  4L9G A;  5A8B A;  4EQ1 A;  4F3L B;  2B02 A;  2A24 A;  2GJ3 A;  1BYW A;  3H7W A;  3UB6 A;  2Z6D A;  5EFW A;  4LPZ A;  3UB7 A;  2V1A A;  2Z6C A;  4HNB A;  4BBT A;  5AVF A;  3T50 A;  1UWP X;  4F3L A;  4HIA A;  5G4Z A;  2QKP A;  5HSQ A;  1GSW A;  2V9A A;  2ZOH A;  3P7N A;  3F1O B;  2V1B A;  4BBU A;  2I9V A;  3UMD A;  2KDK A;  4HHD A;  1D7E A;  1GSV A;  1T19 A;  2KX6 A;  1S1Z A;  5TBM B;  2JN7 A;  1LT0 A;  3LIB A;  1LSW A;  2PHY A;  4I3I A;  3RTY A;  1TS7 A;  5F5Y A;  1ODV A;  2WKP A;  3LIA A;  3BY8 A;  1N9N A;  4E04 A;  3F1O A;  3UME A;  3A0S A;  1LL8 A;  5DJT A;  5I5L A;  4NXB A;  5DJU A;  4EEP A;  4H6J B;  5TBM A;  4HJ4 A;  4HP9 A;  3LIF A;  3NOP C;  1DP8 A;  1DP9 A;  2VEA A;  4NXE A;  5DKK A;  4NXG A;  3MXQ A;  5HWV A;  3LIE A;  3G6O A; 
#chains in the Genus database with same CATH topology
 1SKO A;  5CED A;  1NWZ A;  4G3K A;  5J8X A;  4XUZ A;  3MXS A;  2HP5 A;  1WYB A;  1MPL A;  3GQZ A;  3OCL A;  1OTB A;  4JXW A;  3N8R A;  4BD1 A;  4S2M A;  4GHI A;  5EUA A;  1YLY A;  1KDS A;  3ICY A;  4L9E A;  5J3W A;  4A5R A;  3U2A A;  4EWF A;  1G6O A;  2XF3 A;  2PRF A;  1OPX A;  3HUO A;  3LUQ A;  4EER A;  4EW7 A;  1NYM A;  3MS6 A;  2OAQ 1;  3S7Q A;  3WS0 A;  3DTK A;  3UO9 A;  4K0X A;  2PYR A;  3C5A A;  1KE0 A;  1BUE A;  1FSW A;  4YNR A;  3CG5 A;  1FR6 A;  2VLG A;  4JXG A;  1OTD A;  4IVI A;  1WE4 A;  3A3J A;  5EV0 A;  5C5K A;  4DRT A;  3KSI A;  3IBJ A;  1TS8 A;  4C75 A;  3W4O A;  3OPP A;  4PM8 A;  3UDX A;  2M7U A;  1S4S A;  2Y2I A;  5HDS A;  2EA9 A;  4GN2 A;  4JXV A;  2V8F A;  1VET B;  2XFT A;  3BY9 A;  1SKF A;  1TDG A;  4LV2 A;  1XGJ A;  3FPV A;  2HJE A;  2R78 A;  3H9W A;  1PWG A;  1IYO A;  4HBU A;  2V0U A;  1SDE A;  2WGI A;  1H5X A;  4CLC A;  3DWK A;  1XFN A;  3IS2 B;  3N4I A;  1ERM A;  4DXC A;  4HH3 A;  3ZVT A;  4OP8 A;  2J3W A;  4Q8I A;  1HVB A;  4R4R A;  1GHM A;  1ES3 A;  4ESP A;  1TS6 A;  2EX6 A;  4ZJ2 A;  2ZL1 B;  4B88 A;  3BWL A;  3CPT A;  4S2N C;  3UDI A;  3BQ8 A;  4Y0T A;  4OPZ A;  1H8Y A;  4GD6 A;  3Q82 A;  3B3X A;  3CLO A;  3G2Z A;  5AQ9 A;  3OC2 A;  3VSL A;  2IWD A;  3IWQ A;  2LB5 A;  2EFX A;  1LSX A;  3M6H A;  4GW9 A;  4LV3 A;  1T1A A;  1V9Y A;  1W79 A;  3T4O A;  4DF6 A;  3O3V A;  1TF1 A;  2X02 A;  1SHV A;  3MSH A;  3D9Y A;  2FFY A;  3E2L A;  3IHB A;  4OQI A;  1XKZ A;  2HP6 A;  3VP2 A;  4OPR A;  3PYP A;  2Y2N A;  3DWZ A;  4JGO A;  1H3Q A;  4RX3 A;  3PBR A;  1IYP A;  4RYE A;  1MZU A;  1GSX A;  3T4S A;  2NUT C;  4RVA A;  3Q1F A;  3GDI A;  3HLG A;  1BLS A;  3PXP A;  3N8L A;  3PAE A;  2VA0 A;  1T18 A;  4ARZ A;  1ZG6 A;  1YT4 A;  2VV8 A;  1N4O A;  4PM7 A;  2ZC3 B;  4S2K A;  1KGE A;  4HP4 A;  5CRF A;  4O7D A;  2XGN A;  2J3T D;  3S22 A;  1ALQ A;  4OP5 A;  4NG2 A;  3LO7 A;  1CEF A;  4FOF A;  1Y54 A;  4B4Z A;  1YSP A;  4XT2 A;  1KDW A;  2BTF P;  2GDN A;  2PDR A;  3MR0 A;  3C38 A;  4KEN B;  3DBA A;  4DE3 A;  5HPI A;  3HLF A;  4BD0 A;  3QP6 A;  1BTL A;  4HJ3 A;  3KX0 X;  5FI7 A;  4PPR A;  2Y2O A;  2EX2 A;  3NIA A;  4PM9 A;  4KG5 A;  4N1H A;  4EBN A;  5LBR A;  3Q7Z A;  2BLS A;  5D3O A;  3LI8 A;  4E3K A;  1HLU P;  5G4Y A;  5HD5 A;  3QNC A;  3WS2 A;  3QP8 A;  4C3Q A;  1BSG A;  1OJG A;  4JF5 A;  3HBR A;  1OTA A;  2Y2L A;  2XFS A;  2Y2G A;  4GS9 A;  3SW1 A;  1O7E A;  3WRT A;  3O86 A;  4R1G A;  5EOO A;  5JYP A;  1KVM A;  1SKO B;  2P9V B;  2QWS A;  3SH9 A;  4GD8 A;  3C2W A;  1GA9 A;  5KSH A;  5TJJ A;  4X68 A;  4R4S A;  5K5B A;  4C6Y A;  3G2Y A;  4ZJ1 A;  3FKV A;  3V3S A;  4D60 A;  5EVE A;  4GHI B;  2OSU A;  2ZBB A;  4LRZ E;  2BAS A;  4WF0 A;  5HDD A;  1CF0 A;  3HL9 A;  5GLB A;  5FI2 A;  1XGI A;  4CLC D;  1N9B A;  1E4D A;  4JXS A;  1TVF A;  1PI5 A;  3UNW A;  1ZC2 A;  2EWW A;  4FH2 A;  4PAU A;  1KOU A;  1YMS A;  3HLW A;  3HLC A;  2XRN A;  3E0Y A;  4ETX A;  4GDB A;  3G35 A;  4OLG A;  3ZNY A;  2ZMA A;  4GKU A;  2A24 B;  3GEC A;  5FQK A;  2QZ6 A;  3Q7V A;  1TDL A;  2XD1 A;  2ZMF A;  1MC0 A;  2JKR M;  1MKI A;  4F94 A;  4JGQ A;  1KVL A;  4B93 A;  3C7U A;  5AVE A;  3VE4 A;  4U3T A;  5EM1 A;  3JVU A;  3EQV A;  1XPB A;  3ZFZ A;  1HD8 A;  3ZG8 B;  5AQB A;  2E8J A;  2Y2M A;  3H7W A;  1PNE A;  1MWT A;  1FCN A;  2KLI A;  4N1X A;  3SH8 A;  3MBZ A;  2V1A A;  4BBT A;  1PRQ A;  5GL9 A;  4ZJ3 A;  1CQA A;  2WZX A;  3T50 A;  3OPR A;  3CUE C;  1PZO A;  1PYY A;  2ZD8 A;  3BM6 A;  4HIA A;  2QKP A;  2JKG A;  2EXB A;  2UWX A;  1GSW A;  2ZOH A;  1K6S A;  4WYY A;  4EU0 A;  1YLJ A;  3F1O B;  2V1B A;  1L2S A;  4BBU A;  1YPR A;  5CGX A;  1BZA A;  4HHD A;  1VQQ A;  1XX2 A;  5HL6 A;  1LT0 A;  3ZDJ A;  4PHT A;  4QY6 A;  2IWB A;  3G4P A;  1PW8 A;  2PHY A;  1W63 Q;  3HUM A;  3BY8 A;  4UEY A;  4BL2 A;  1DJC A;  5FEG A;  4QY5 A;  4RA7 A;  1LL8 A;  3VP0 A;  5DJT A;  4EBL A;  1J9M A;  4NKP A;  2B18 A;  4EEP A;  2ZM0 A;  5TBM A;  3BLM A;  3HVF A;  2HPB A;  3LIF A;  3NOP C;  1DP9 A;  2VEA A;  4GB7 A;  3MXQ A;  3MKE A;  4D2O A;  1ERO A;  1RGZ A;  4UAA A;  1GHP A;  2Q9M A;  2O99 A;  5GHY A;  5EVI C;  1FSY A;  5DTT A;  2HZ5 A;  5FQ9 A;  3UE0 A;  3K3C A;  4P6B A;  2ZQ9 A;  3CIT A;  1E3U D;  3NC8 A;  1MY8 A;  2Y59 A;  3LCE A;  1YLP A;  1W63 M;  2R9W A;  3FZC A;  2PBY A;  5I94 A;  3VE3 A;  2M1C A;  4WMC A;  1FQG A;  3R7W B;  3V5M A;  2GNX A;  3KSH A;  3O88 A;  1K55 C;  3NOT C;  3BYD A;  2JBF A;  3T4Q A;  3HCY A;  2P74 A;  3PBO A;  5GHX A;  1Y28 A;  1IYQ A;  1NZU A;  2D01 A;  4LV0 A;  3G30 A;  3RH8 B;  1DRM A;  4IBX A;  4KUK A;  3ZQ5 A;  3E98 A;  2HF6 A;  2QPN A;  4NK3 A;  4HOI A;  1MKM A;  4OPY A;  2FZ0 A;  3G31 A;  4UA9 A;  3PAG A;  4QD4 A;  4IVK A;  4KZ5 A;  2ZOI A;  3MJQ A;  1JWZ A;  4O8G A;  3PBS A;  5KMW A;  1MWU A;  2ZLY A;  4X53 A;  3EGD C;  2W1R A;  1I2W A;  3M2K A;  5DF7 A;  3T4J A;  4KG6 A;  5FAT A;  4OH0 A;  1OME A;  4S2N A;  3IXG A;  4R6L A;  4GCZ A;  1JTD A;  3K3D A;  3LEQ A;  3OPH A;  2QYB A;  5CER A;  1I5Q A;  4EEU A;  1RP5 A;  1XJ6 A;  1PW1 A;  4AFI A;  3UB5 P;  3D4F A;  3L9K A;  2EWV A;  5FEF A;  4DN0 A;  1CI9 A;  1EWZ A;  3W4P A;  4DJ2 A;  3HLB A;  3KYZ A;  1YQS A;  2L4R A;  4M3K A;  2PYP A;  1ES4 A;  1ESU A;  2WAE A;  3VP4 A;  1M6K A;  4KZ9 A;  5HAP A;  3ULF A;  4MBF A;  1X0O A;  1JNU A;  1PFL A;  3FWL A;  1LL9 A;  3AGE A;  4HBT A;  4I38 A;  1WA9 A;  1XJ2 A;  2W1T A;  3BFD A;  4PKY G;  1VM1 A;  2C6W B;  3L7H A;  1IYS A;  3I7J A;  1S66 L;  1V9Z A;  3TG9 A;  3CAX A;  4HI4 A;  5FAS A;  4X56 A;  2L1M A;  3DTI A;  4YOF A;  2QJ7 A;  1K0K A;  4UA6 A;  5IU1 A;  4O01 A;  5TGF A;  2RL3 A;  1XXM A;  3NDG A;  3V50 A;  3BEB A;  4QB8 A;  2J9O A;  3IQA A;  3UE6 A;  1P9R A;  3JVV A;  2K31 A;  2XDM A;  1TEM A;  3H82 A;  2JKF A;  1K56 D;  2LB9 A;  2VZW A;  2WGV A;  5EOE A;  5A91 A;  2PR6 A;  1Q2Q A;  1IKI A;  2Y79 A;  4U0T A;  3IWI A;  4MBK A;  2HJ9 C;  4MN7 A;  4KQR A;  3BQA A;  3CMZ A;  5HPF A;  3RFB A;  2J9P A;  5TR7 A;  4N9L A;  2JHE A;  1L3L A;  4IJG A;  2P7J A;  1TD5 A;  4K0W A;  1FOF A;  2A49 A;  3IXD A;  4WMC D;  4BWI A;  3C8C A;  3A3I A;  1ZHH B;  3CWF A;  2OWJ A;  3MFD A;  3GTC A;  3NHQ A;  5TFQ A;  5CEB A;  4DKI A;  1S1Y A;  1JTG A;  1LSV A;  1KGF A;  2JCH A;  1PZP A;  4S2L A;  4UA7 A;  4EXO A;  4S2O A;  2ZC6 B;  1L0E A;  4UQI M;  2ZC4 B;  2ZC5 B;  1F9I A;  1DJB A;  4WZ5 A;  2R9X A;  3N6I A;  1IEL A;  1LI0 A;  4JBF A;  1DY6 A;  5EVL A;  1KE3 A;  2EX8 A;  1MWR A;  3P01 A;  3F1P B;  1OTE A;  2W3D A;  3WS1 A;  5FQJ A;  2ZJ9 A;  3QHY A;  2Y55 A;  3M2J A;  5M18 A;  2G2U A;  3KSF A;  3IXH A;  5HD3 A;  1N9L A;  3G34 A;  1FIK A;  4P6Z S;  3S4X A;  3E2K A;  2H5S A;  1G68 A;  4BEN A;  3T4K A;  2OWH A;  4CPK A;  2HV1 A;  3N7W A;  3SS3 A;  1P97 A;  3LR3 A;  3TOI A;  4JF6 A;  4O0P A;  3UPP A;  1GA0 A;  2EFU A;  5DF8 A;  1VEU A;  1IEM A;  5HX9 A;  4I3J A;  3LY4 A;  3E4O A;  5DFX A;  1YLZ A;  5IT5 A;  1JWP A;  4Z9Q A;  1U60 A;  5AQA A;  2OLV A;  5A8B A;  4UQI S;  4EQ1 A;  4EUZ A;  3BFF A;  2B02 A;  5HL1 A;  1ACF A;  5BOH A;  5HAQ A;  3CUE A;  1BYW A;  3OBF A;  4X1L A;  2Z6C A;  4OQH A;  4IED A;  4X25 A;  1YLW A;  4F3L A;  2DCF A;  3OOV A;  2VX8 A;  3JYI A;  4R3B A;  3MF0 A;  5HSQ A;  2V9A A;  3HLE A;  4X55 A;  4QJG A;  1BT5 A;  5FQM A;  3IWO A;  1F2K A;  2NUP C;  2I9V A;  2WGW A;  4OOL A;  2KDK A;  1D7E A;  3BRM A;  1ZKJ A;  3VMA A;  2KX6 A;  1S1Z A;  5FDS A;  4QHC A;  2WKE A;  2V2F F;  1ODV A;  1FCM A;  3IXB A;  2XA7 S;  2VKS A;  1C3B A;  1N9N A;  4LV1 A;  5EVI A;  4JKT A;  5I5L A;  3BW6 A;  4WZ5 C;  2XR0 A;  4II7 A;  4HP9 A;  1IFQ A;  4NXE A;  4MCW A;  4NXG A;  5HWV A;  2Q0O A;  3LIE A;  4CQH A;  4MLL A;  3DW0 A;  1NJ4 A;  2C5W B;  5FQI A;  3W4Q A;  3IF6 A;  3E4Q A;  3WS5 A;  1S6R A;  4NXF A;  1K55 A;  5KSC A;  2Y91 A;  4QPR A;  3UY6 A;  4MN5 A;  5AQ7 A;  2XK1 A;  4R3A A;  3U4L P;  2Q9N A;  3B42 A;  3F1N A;  3SOI A;  5KZH A;  4X1M A;  2J7V A;  4DJ3 A;  3HUN A;  2HDS A;  3ZNT A;  3PBQ A;  4E3O A;  4E3J A;  2O9B A;  3KYQ A;  4JF4 A;  3T1S A;  1FCO A;  2HDR A;  1HTZ A;  3PR6 A;  2Y2J A;  4EQI A;  1L0D A;  1BLC A;  5FAQ A;  4BBV A;  3A0R A;  4NEE D;  1Z09 A;  1YMX A;  3P09 A;  2ZQ7 A;  3D72 A;  2PR5 A;  4Y5F A;  3B33 A;  4P85 A;  3C7V A;  2WKI A;  1YKD A;  3VP1 A;  5EM0 A;  3LI9 A;  4CLC B;  5MC7 A;  4Q0J A;  5F82 A;  2P08 A;  3LR5 A;  5L09 A;  3OZH A;  3CHW P;  1W5D A;  3SS4 A;  4ID4 A;  1L0G A;  3MQO A;  3GMW A;  2A3U A;  3S7P A;  3WWX A;  2ZM8 A;  4ZBE A;  5EEC A;  2ZM2 A;  2RCX A;  4BLM A;  5CGW A;  3A3F A;  5E2E A;  2B5R A;  5A93 A;  4E3M A;  5G18 A;  3CPT B;  3MKF A;  4ME4 A;  4OQ0 A;  2ZC7 A;  5F1G A;  4S2P A;  5E2H A;  3O5Y A;  4OON A;  5F68 A;  3OPL A;  3GRJ A;  4EET B;  1GCE A;  5E2G A;  5FAO A;  5HAI A;  1F5M A;  1NYY A;  1HZO A;  1VHM A;  1NRJ A;  1CJF A;  4L9F A;  4WLA A;  2H0T A;  1NRF A;  1ERQ A;  1O07 A;  3IS2 A;  3N8S A;  3MZF A;  3PBT A;  1XFQ A;  3LYX A;  4P0M A;  1QMF A;  3FG8 A;  4PM6 A;  4B4X A;  2K2N A;  2Y2P A;  3VOZ A;  4H6J A;  3LR0 A;  5DF9 A;  5AJG A;  5FDH A;  4DE0 A;  1DP6 A;  4ZDX A;  4M4X A;  3NOU C;  4EV4 A;  2W0N A;  1VB6 A;  5HDC A;  3IF6 C;  3C30 A;  2D02 A;  4BMW A;  2XQZ A;  1T1C A;  3T12 B;  4ARZ B;  2O9C A;  4OQG A;  3RXW A;  4E6W A;  5A92 A;  1FIL A;  2E8I A;  5EVI D;  1AXB A;  4JPM A;  4CJN A;  1XJ4 A;  4XT2 B;  3PTE A;  3ZG0 A;  4S2J A;  4KQQ A;  4E3L A;  4KQD A;  2XRO A;  2J8Y A;  4OPQ A;  2M7V A;  3SH7 A;  4DE2 A;  2ZQD A;  3T1X A;  4KZ6 A;  1BUL A;  1K25 A;  1YAX A;  3GR2 A;  3MFX A;  3UB8 A;  3FYZ A;  4I39 A;  2XH9 A;  3ZG5 A;  5DVA A;  1P0Z A;  4FH4 A;  4LLO B;  5GLC A;  4FSF A;  3TRC A;  2UV0 E;  4LEN A;  2BG1 A;  3LGO A;  4MMN A;  1MWS A;  3C4O A;  4KUO A;  4GDN A;  4GS9 B;  2Y8H A;  5DFY A;  3LR4 A;  3EWK A;  4WM9 A;  2WKR A;  3TE8 A;  5E43 A;  1D06 A;  3NDE A;  4JLF A;  5EVI B;  3IH9 A;  2HGV A;  2XSS A;  2W3H A;  4KZ8 A;  3V3R A;  2Z2L B;  2DRW A;  4Y17 A;  1T1B A;  4K91 A;  5HAR A;  1PIO A;  3C4P A;  4WZ4 A;  4IUK A;  3KO6 A;  4N92 A;  4GOG A;  1E25 A;  4MNR A;  3NY4 A;  1BLP A;  4DDY A;  4OVD A;  2QJ5 A;  4LRX C;  5DTS A;  4EBP A;  4BL3 A;  3HJI A;  2H28 A;  3S1Y A;  4Y0U A;  2PBD P;  5FI6 A;  3DTE A;  2WKQ A;  1K57 A;  4U0X A;  5U47 A;  3LFV A;  4EUV A;  2ACG A;  2P9V A;  5CHU A;  1EW0 A;  4NET A;  3HJK A;  3Q7V B;  3F1N B;  3JPU A;  1LL5 A;  5J7E A;  3P98 A;  5F69 A;  3IX4 A;  3NCK A;  3CI6 A;  3T4L A;  3H7W B;  2EX9 A;  4JGR A;  4XUX A;  5F1F A;  3B47 A;  5FQQ A;  3LEZ A;  3EEH A;  3MQ0 A;  4HY8 A;  2WUQ A;  4Q0I A;  1ONG A;  1K6R A;  4P6Z M;  2GZA A;  2A24 A;  3VFH A;  3VOY A;  4QWO A;  5HW3 A;  4YIN A;  1S0W A;  1YM1 A;  2Z6D A;  4R0Q A;  2JKT M;  2XEP A;  4ZAM A;  4L0L A;  5GLA A;  3UB7 A;  1CEG A;  4HNB A;  4Z1W A;  1SCW A;  2JC7 A;  3OCN A;  3ZHH A;  1K4E A;  3KYE A;  3UE1 A;  5L2F A;  4Y2F A;  4P87 A;  5FSR A;  1YLT A;  4GZB A;  3MZD A;  1NZO A;  1IOU A;  4WEL A;  4R3J A;  3IT9 A;  3UMD A;  3VFF A;  1JWV A;  3R4K A;  3BEC A;  3K2N A;  5TBM B;  2VJW A;  5L8M A;  2JN7 A;  4Y3I A;  2DMW A;  3LIB A;  1K38 A;  1LSW A;  1FR1 A;  4I3I A;  1TS7 A;  5F5Y A;  3EOI A;  4Y7P A;  3QP5 A;  1K4F A;  4E04 A;  2HP9 A;  3F1O A;  3UME A;  1J3W A;  2PAV P;  3ZGA B;  2X01 A;  5DJU A;  5A90 A;  4OOY A;  4H6J B;  4HJ4 A;  3FKW A;  1DP8 A;  5GHZ A;  5DKK A;  1A0K A;  4S2I A;  3BLS A;  5DTK A;  4IBR A;  4PKY A;  4LFU A;  1KGG A;  3GV9 A;  2K7S A;  2OOL A;  3Q81 A;  4B9O A;  1K57 C;  3D3O A;  3TSG A;  4I5S A;  1ZG4 A;  2ZMV A;  1ES5 A;  4FUW A;  3MQQ A;  1CK3 A;  2XA7 M;  2WAF A;  3T1Q B;  2YKF A;  2JKT I;  1QME A;  4HQA A;  1S67 L;  2YKH A;  3UB9 A;  4WUJ A;  2J3T C;  2O9A A;  2CMN A;  2KOI A;  1XA7 A;  2X71 A;  4H8R A;  3IF5 A;  2WAD A;  4GNU A;  3DTM A;  4OOM A;  3W2Z A;  1F98 A;  3NEC A;  4FD8 A;  1I2S A;  5HZH A;  1RCJ A;  1PI4 A;  3WS4 A;  5FAP A;  3LID A;  3QP4 A;  1ES2 A;  3IH8 A;  3IX3 A;  2PD7 A;  4HH2 A;  3A3D A;  3R7W A;  3M6B A;  4LCL A;  4YFM A;  1ONH A;  1NLZ A;  2OAP 1;  3O87 A;  4I3A A;  2V1Z A;  2W27 A;  4WEK A;  1NY0 A;  2MJ6 A;  4FTX A;  3AGD A;  4DXB A;  1G28 A;  4FCF A;  2XD5 A;  1K54 A;  1ZTU A;  4KZ3 A;  2WZZ A;  5EPH A;  1W8Q A;  3G32 A;  2PU2 A;  1IKG A;  4LGW A;  1KE4 A;  5HFO A;  1UGU A;  3IBR A;  5M1A A;  2IA2 A;  3GSG A;  3UE3 A;  2QMI A;  1G6A A;  1E3U A;  2Y2K A;  4R38 A;  2O0Y A;  4IUH A;  1N9O A;  1G5U A;  3ZCZ A;  4R23 A;  4CLC C;  3IX8 A;  1PWD A;  5GLD A;  5M19 A;  2A2L A;  5E2F A;  1DJA A;  1AWI A;  3ITB A;  2W1T B;  3QP1 A;  4BQM A;  5CEC A;  4ZTK A;  3SS5 A;  3WRZ A;  4ZRR A;  5FL3 A;  4R70 A;  3NBL A;  1S4R A;  5L10 A;  4E3I A;  1OJ5 A;  3V39 A;  4KZA A;  3AGF A;  2J80 A;  1H0M A;  2V8C A;  2OLU A;  2L0W A;  2WYX A;  4KQO A;  2Z2M B;  1OT6 A;  2HDU A;  4XXR A;  2FH5 A;  2H10 A;  2QHK A;  3HLD A;  3H82 B;  4K08 A;  3OLO A;  4Y15 A;  4KZB A;  4E3N A;  3TJZ C;  1OT9 A;  4QU3 A;  1LI9 A;  5IS1 A;  3A0V A;  3NJA A;  4RQ9 A;  4RX2 A;  5CHM A;  3ITA A;  2DNS A;  4HJ6 A;  3RJU A;  4HES A;  1Q2P A;  5J4E A;  3FPW A;  4HEF A;  2ZQC A;  1BLH A;  3VOL A;  4E6X A;  2VV7 A;  3ZVW A;  3UPO A;  1M40 A;  4WN5 A;  4PM5 A;  4LRY C;  2OV5 A;  1ESI A;  1XP4 A;  5IHV A;  4KZ4 A;  3LIC A;  4MEZ A;  2JE5 A;  1STZ A;  3ZG7 B;  3ZYT A;  3MZE A;  4N9K A;  5HWW A;  4CLC E;  1XJ3 A;  2VV6 A;  2H0Y A;  4X6T A;  1K54 C;  1TS0 A;  4GLQ A;  1VET A;  4ETZ A;  1H8M A;  5DKL A;  2B95 A;  3E4P A;  2PD8 A;  1WYC A;  1YSQ A;  2WKH A;  3BJN A;  2V0W A;  4BJP A;  3PBN A;  2INW A;  2Y4A A;  2W3F A;  2VK3 A;  2VGK A;  1MXO A;  1Y4O A;  1GHI A;  1NXY A;  3FC7 A;  2WK0 A;  3CJM A;  4Y13 A;  3LY3 A;  4DE1 A;  1UWN X;  3VP3 A;  5F83 A;  2VGJ A;  4DMZ A;  2XLN A;  4MDZ A;  3DAV A;  2G7U A;  4MN6 A;  3BFG A;  4JGP A;  2CC1 A;  1EI5 A;  2ZL1 A;  3EEA A;  5F6A A;  5HWT A;  3UDF A;  1PWC A;  3MMH A;  4DDS A;  1RGY A;  4UHU A;  1K56 A;  1VEU B;  3F1P A;  4OLD A;  3KSG A;  4PMA A;  1OTI A;  4OKP A;  2JKR I;  3T4T A;  2HDQ A;  3FV7 A;  4YWZ A;  5KIZ A;  4EES A;  1SDN A;  3PHY A;  4G3V A;  2ZQ8 A;  3S7O A;  3A3E A;  1L0F A;  3RXX A;  2ZQA A;  2VGL M;  1P9W A;  4KZ7 A;  2I72 A;  3Q07 A;  5CHJ A;  1LHY A;  4G3W A;  3TW8 A;  2PT7 A;  2Y2Q A;  4WL9 A;  3T1R A;  2FFF B;  3CZD A;  4L9G A;  4GJ4 A;  5CGS A;  4F3L B;  3QP2 A;  4Y0O A;  2GJ3 A;  3NUL A;  1H8Z A;  3SZT A;  3UB6 A;  2W3E A;  5EFW A;  5L07 A;  2G2W A;  4LPZ A;  3UPN A;  3GVB A;  3V67 A;  1LLB A;  2AVX A;  2WGW B;  5AVF A;  4MBH A;  5CTM A;  1D1J A;  1SZV A;  1UWP X;  5CXW A;  5G4Z A;  1MBL A;  5FA7 A;  5JYO A;  2GX5 A;  4KG2 A;  3BFE A;  2Y2H A;  3P7N A;  4Q0H A;  2V20 A;  3UN7 A;  1NLY A;  5EE8 A;  3EQU A;  1W7F A;  3VSK A;  2EXA A;  4X69 A;  1GSV A;  1T19 A;  3BFC A;  3MXR A;  3HRE A;  1JVJ A;  2IWC A;  5CTN A;  2P04 A;  3S7N A;  4WEJ A;  3ISG A;  3RTY A;  2WKP A;  3LIA A;  1CI8 A;  2PU4 A;  4IHQ A;  3ZG9 B;  3A0S A;  2VGL S;  3IHA A;  3IF6 B;  5CX7 A;  4WBG A;  3W8K A;  1Z6F A;  4LCM A;  4NXB A;  3EGX C;  3QNB A;  1XA1 A;  2W3G A;  1W8Y A;  3VV4 A;  3NI9 A;  3G6O A; 
#chains in the Genus database with same CATH homology
 4CQH A;  2O99 A;  1NWZ A;  4G3K A;  4PKY A;  3E4Q A;  3K3C A;  3OCL A;  2K7S A;  1OTB A;  2OOL A;  4B9O A;  3CIT A;  3D3O A;  4NXF A;  4I5S A;  4GHI A;  2ZMV A;  3MQQ A;  3ICY A;  4QPR A;  4L9E A;  2XA7 M;  5J3W A;  1W63 M;  4MN5 A;  3U2A A;  2YKF A;  4R3A A;  2JKT I;  1G6O A;  4HQA A;  1S67 L;  2YKH A;  2M1C A;  3UB9 A;  3VE3 A;  4WUJ A;  1OPX A;  2J3T C;  2O9A A;  3B42 A;  3F1N A;  3R7W B;  2CMN A;  2KOI A;  2GNX A;  4EER A;  3LUQ A;  4EW7 A;  3KSH A;  2OAQ 1;  3S7Q A;  3NOT C;  3T4Q A;  4DJ3 A;  3HCY A;  4OOM A;  3PBO A;  3W2Z A;  1F98 A;  1Y28 A;  3PBQ A;  5HZH A;  2D01 A;  3LID A;  2PYR A;  2O9B A;  3KYQ A;  4YNR A;  2PD7 A;  3RH8 B;  2VLG A;  3PR6 A;  1DRM A;  4KUK A;  3ZQ5 A;  4BBV A;  1OTD A;  3E98 A;  2HF6 A;  3A0R A;  4HH2 A;  3R7W A;  4NEE D;  5C5K A;  4HOI A;  1MKM A;  3KSI A;  3IBJ A;  1TS8 A;  2FZ0 A;  3D72 A;  1NLZ A;  2OAP 1;  2PR5 A;  4Y5F A;  3B33 A;  4I3A A;  1YKD A;  2M7U A;  4CLC B;  3LI9 A;  5MC7 A;  1S4S A;  2ZOI A;  2W27 A;  4Q0J A;  4WEK A;  2P08 A;  3LR5 A;  5HDS A;  2MJ6 A;  2EA9 A;  3BY9 A;  1G28 A;  3MQO A;  3MJQ A;  4O8G A;  3FPV A;  1ZTU A;  3S7P A;  2HJE A;  2R78 A;  3H9W A;  3PBS A;  2V0U A;  3EGD C;  2W1R A;  1UGU A;  3IBR A;  3T4J A;  4CLC A;  4ME4 A;  1XFN A;  2IA2 A;  3UE3 A;  3IS2 B;  4HH3 A;  4R6L A;  4GCZ A;  3O5Y A;  5F68 A;  3K3D A;  2J3W A;  4EET B;  2QYB A;  4R38 A;  2O0Y A;  1TS6 A;  1F5M A;  4EEU A;  4IUH A;  1N9O A;  1VHM A;  1XJ6 A;  1NRJ A;  4AFI A;  4CLC C;  4L9F A;  4WLA A;  3BWL A;  3BQ8 A;  2A2L A;  2EWV A;  4DN0 A;  3IS2 A;  4DJ2 A;  3PBT A;  2W1T B;  1XFQ A;  3LYX A;  3CLO A;  3OC2 A;  3KYZ A;  2L4R A;  2PYP A;  3FG8 A;  4ZRR A;  5FL3 A;  4R70 A;  2LB5 A;  1S4R A;  1LSX A;  4GW9 A;  1OJ5 A;  3ULF A;  1X0O A;  2J80 A;  1T1A A;  2K2N A;  1V9Y A;  1JNU A;  4H6J A;  3LR0 A;  3T4O A;  5DF9 A;  5AJG A;  2L0W A;  1TF1 A;  4KQO A;  4I38 A;  1DP6 A;  1WA9 A;  1XJ2 A;  4M4X A;  1OT6 A;  2FH5 A;  2W1T A;  3NOU C;  4PKY G;  2W0N A;  1VB6 A;  5HDC A;  3PYP A;  1S66 L;  2QHK A;  3C30 A;  1V9Z A;  2D02 A;  4BMW A;  3H82 B;  4K08 A;  1T1C A;  4ARZ B;  2O9C A;  1H3Q A;  3CAX A;  4HI4 A;  4JGO A;  2L1M A;  4YOF A;  2QJ7 A;  3PBR A;  3OLO A;  5IU1 A;  4O01 A;  1MZU A;  1GSX A;  3T4S A;  2NUT C;  3TJZ C;  1OT9 A;  3GDI A;  1XJ4 A;  3UE6 A;  5IS1 A;  3A0V A;  3NJA A;  4RQ9 A;  4XT2 B;  1P9R A;  3JVV A;  2K31 A;  3PXP A;  4KQD A;  3H82 A;  4HJ6 A;  2VA0 A;  1T18 A;  2LB9 A;  2VZW A;  4ARZ A;  2XRO A;  2M7V A;  2PR6 A;  2VV8 A;  2Y79 A;  5J4E A;  3FPW A;  1YAX A;  4HP4 A;  3VOL A;  3MFX A;  3UB8 A;  2HJ9 C;  4MN7 A;  2J3T D;  4I39 A;  2VV7 A;  3BQA A;  4WN5 A;  5HPF A;  3RFB A;  4FOF A;  4LRY C;  1P0Z A;  1YSP A;  4XT2 A;  2PDR A;  3MR0 A;  3C38 A;  4LLO B;  3DBA A;  2JHE A;  5HPI A;  4FSF A;  3TRC A;  4IJG A;  2P7J A;  3LIC A;  1TD5 A;  4MMN A;  1STZ A;  4KUO A;  3ZYT A;  4BWI A;  3C8C A;  4GS9 B;  5HWW A;  2Y8H A;  4HJ3 A;  3KX0 X;  1ZHH B;  4CLC E;  3CWF A;  2OWJ A;  3NHQ A;  5DFY A;  1XJ3 A;  3LR4 A;  1S1Y A;  2VV6 A;  3EWK A;  1LSV A;  1TS0 A;  4GLQ A;  5LBR A;  4ETZ A;  2WKR A;  1H8M A;  4EXO A;  5DKL A;  3LI8 A;  3TE8 A;  1D06 A;  5G4Y A;  3E4P A;  2HGV A;  2XSS A;  5HD5 A;  2PD8 A;  2W3H A;  4UQI M;  1YSQ A;  3BJN A;  2V0W A;  1T1B A;  1F9I A;  1OJG A;  1OTA A;  4BJP A;  4IUK A;  3PBN A;  4GS9 A;  3KO6 A;  2INW A;  3SW1 A;  2W3F A;  3FC7 A;  3P01 A;  2QJ5 A;  3F1P B;  1OTE A;  2W3D A;  2QWS A;  4LRX C;  1UWN X;  5KSH A;  3C2W A;  3HJI A;  5TJJ A;  2H28 A;  4DMZ A;  4MDZ A;  5K5B A;  2G7U A;  4MN6 A;  4JGP A;  3EEA A;  5F6A A;  5HWT A;  4GHI B;  2WKQ A;  3MMH A;  3KSF A;  5HD3 A;  2ZBB A;  4LRZ E;  1N9L A;  2BAS A;  3LFV A;  4WF0 A;  4EUV A;  4P6Z S;  3F1P A;  5HDD A;  3KSG A;  1EW0 A;  1OTI A;  3HJK A;  2JKR I;  3T4T A;  4CLC D;  3F1N B;  3T4K A;  4YWZ A;  5KIZ A;  4EES A;  2EWW A;  2OWH A;  4PAU A;  3PHY A;  1KOU A;  2HV1 A;  5J7E A;  2XRN A;  3E0Y A;  4ETX A;  1P97 A;  3LR3 A;  4G3V A;  3S7O A;  5F69 A;  2A24 B;  4O0P A;  3GEC A;  3CI6 A;  4I3J A;  2VGL M;  3T4L A;  1P9W A;  3H7W B;  4JGR A;  3E4O A;  5DFX A;  2ZMF A;  1MC0 A;  3B47 A;  5IT5 A;  4G3W A;  3TW8 A;  2JKR M;  2PT7 A;  4WL9 A;  4JGQ A;  3EEH A;  3MQ0 A;  4B93 A;  4HY8 A;  4Q0I A;  5AVE A;  3VE4 A;  3JVU A;  4GJ4 A;  4L9G A;  4P6Z M;  5A8B A;  4UQI S;  2GZA A;  4EQ1 A;  4F3L B;  2B02 A;  2A24 A;  3EQV A;  2GJ3 A;  3CUE A;  1BYW A;  3H7W A;  3UB6 A;  2W3E A;  2Z6D A;  5EFW A;  2KLI A;  2JKT M;  4LPZ A;  4L0L A;  3OBF A;  3V67 A;  3UB7 A;  2V1A A;  2Z6C A;  4HNB A;  4Z1W A;  4BBT A;  5AVF A;  3OCN A;  3T50 A;  1UWP X;  3CUE C;  4F3L A;  4Y2F A;  4HIA A;  5G4Z A;  3OOV A;  2QKP A;  2VX8 A;  3MF0 A;  2GX5 A;  5HSQ A;  1GSW A;  2V9A A;  2ZOH A;  4EU0 A;  1IOU A;  3P7N A;  3F1O B;  4WEL A;  4Q0H A;  2V1B A;  4BBU A;  2NUP C;  2I9V A;  1NLY A;  3EQU A;  3UMD A;  4OOL A;  2KDK A;  4HHD A;  1D7E A;  1GSV A;  3R4K A;  1T19 A;  2KX6 A;  5HL6 A;  1S1Z A;  3K2N A;  5TBM B;  2VJW A;  5L8M A;  2JN7 A;  4Y3I A;  1LT0 A;  4PHT A;  2DMW A;  2P04 A;  3LIB A;  1LSW A;  3S7N A;  2PHY A;  4WEJ A;  4I3I A;  1TS7 A;  5F5Y A;  3RTY A;  1ODV A;  3EOI A;  2WKP A;  1W63 Q;  2XA7 S;  3LIA A;  3BY8 A;  2VKS A;  4IHQ A;  4UEY A;  1N9N A;  4E04 A;  3F1O A;  3UME A;  3A0S A;  2VGL S;  1LL8 A;  5DJT A;  5CX7 A;  5I5L A;  3BW6 A;  4NKP A;  2B18 A;  4NXB A;  5DJU A;  4EEP A;  3EGX C;  4H6J B;  5TBM A;  4HJ4 A;  4HP9 A;  4II7 A;  3LIF A;  3NOP C;  1DP8 A;  1DP9 A;  1IFQ A;  2VEA A;  2W3G A;  4NXE A;  5DKK A;  3VV4 A;  4MCW A;  3MXQ A;  4NXG A;  5HWV A;  3LIE A;  3G6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...