5TBMA

Crystal structure of pt2385 bound to hif2a-b*:arnt-b* complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
106
Chain Sequence
LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title A Small-Molecule Antagonist of HIF2 alpha Is Efficacious in Preclinical Models of Renal Cell Carcinoma.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 106
sequence length 110
ec nomenclature
pdb deposition date 2016-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5tbmA00
2R78A 1OTDA 4HH2A 4KUKA 3VOLA 4EESA 4EEPA 5F6AA 4NXEA 2ZBBA 2PYPA 3BWLA 1GSXA 4WN5A 5TBMA 3FG8A 5AVEA 3UMEA 1OTBA 3F1NA 1S4SA 2BASA 1F9IA 3UB8A 2H28A 2KX6A 4LPZA 1JNUA 4PKYA 1GSWA 1S67L 3EWKA 3LIEA 3B33A 5J7EA 4JGQA 2Z6DA 1DP6A 2PR6A 5HSQA 4R70A 5A8BA 1TS0A 4EW7A 2V0UA 4E04A 2PD7A 2VV8A 3RTYA 1V9ZA 4JGOA 1OTIA 2PD8A 3PHYA 2VV6A 2QJ5A 5HD3A 1XFNA 4BBVA 1LT0A 1V9YA 4HJ6A 1LSXA 5F69A 4B9OA 3UE6A 5G4ZA 5DKKA 1P97A 1T18A 1X0OA 4HP4A 3LI8A 4JGRA 4EQ1A 4NXBA 2VLGA 3F1NB 3G6OA 3NHQA 2J80A 3K3DA 5F5YA 1S1ZA 5HZHA 1N9LA 1UGUA 4EERA 5EFWA 3H7WB 2D02A 3ULFA 2W0NA 4I5SA 4H6JB 1TS8A 2P7JA 4DJ3A 1T1AA 2KDKA 4F3LA 2WKRA 1UWNX 3LUQA 3E4OA 3MXQA 4L9EA 2A24A 3VE4A 1S4RA 2JN7A 1DP9A 5G4YA 4K08A 2K7SA 4XT2B 1XFQA 1T19A 3UB7A 4YWZA 3D72A 1LSVA 4HI4A 1DRMA 5HDDA 3UB6A 2OWJA 3H7WA 1LL8A 1NWZA 1OJGA 2PHYA 5I5LA 3A0RA 5DJUA 4H6JA 3MJQA 4DJ2A 4I3IA 4WL9A 2OOLA 2V1BA 3ICYA 5DKLA 3A0SA 3A0VA 3GDIA 2M1CA 5HWTA 3F1PB 1KOUA 3NJAA 4LRXC 1EW0A 4JGPA 4EETB 4F3LB 2I9VA 1N9NA 2INWA 1WA9A 4RQ9A 1OTAA 3BY9A 1D06A 2QKPA 2V0WA 3LIBA 2A24B 4EEUA 4GCZA 4HJ4A 5HDCA 3LICA 4M4XA 4XT2A 2CMNA 2PR5A 4LRYC 3H82B 3LIFA 3VE3A 4NXGA 3K3CA 5AVFA 3MFXA 4HOIA 4BBUA 5J4EA 4HNBA 3SW1A 5HD5A 4L9GA 1OT9A 3NOUC 2L4RA 4I3AA 1XJ4A 4R3AA 2VV7A 3C2WA 1LSWA 2ZOHA 4HHDA 3LYXA 4EXOA 3F1PA 4GS9A 4HY8A 3ZQ5A 2PDRA 1G28A 1MZUA 4I39A 2WKQA 1S66L 4HIAA 1OT6A 4LLOB 1P0ZA 3FC7A 4WLAA 1T1BA 3IBRA 5HWWA 1UWPX 2D01A 3C8CA 1D7EA 3H82A 3KX0X 3T50A 3LIDA 5DJTA 1OJ5A 2QHKA 2EA9A 4LRZE 5IS1A 4HP9A 5F68A 2ZOIA 3HJKA 3OLOA 5HDSA 3IS2B 1XJ3A 3MQQA 3RH8B 3NOPC 2Z6CA 4KQDA 3LI9A 5IU1A 3H9WA 3E4QA 4WUJA 2VEAA 2QJ7A 2WKPA 4WF0A 4GS9B 4HJ3A 2V1AA 1BYWA 4L9FA 3CLOA 4I3JA 2B02A 3CWFA 3E4PA 3UMDA 3HJIA 2HV1A 2OWHA 3PYPA 4MN6A 4HH3A 3GECA 5KIZA 3F1OA 4HQAA 2W27A 5HWVA 1GSVA 3MQOA 1F98A 1S1YA 4GHIB 2PYRA 4GW9A 1OTEA 1ODVA 1XJ6A 4BBTA 2L0WA 3BY8A 4I38A 1VB6A 1Y28A 5TBMB 3IS2A 1TS6A 4MN5A 2L1MA 2YKFA 5J3WA 4R6LA 2V9AA 4KUOA 1T1CA 2YKHA 3P7NA 1N9OA 4PKYG 2GJ3A 4R38A 1TS7A 3UB9A 3MR0A 4NXFA 3LIAA 2JHEA 2QWSA 3EEHA 1XJ2A 1DP8A 3NOTC 3CAXA 3F1OB 4GHIA
chains in the Genus database with same CATH superfamily
2HGVA 1VETA 3RXXA 1ESIA 1DY6A 2PYPA 2ZBBA 1GSXA 2IWDA 4WN5A 3V67A 4DE0A 3UPOA 4DE1A 1WYBA 3K2NA 3T1SA 3HLCA 2ACGA 3FV7A 1EROA 2VGJA 3KYEA 3S1YA 1F9IA 3LR0A 4EUZA 1YQSA 2GNXA 4E3NA 5KSHA 4KQOA 4PM6A 3EWKA 3LY3A 2R9XA 4Y0UA 4E3JA 3B33A 4DE3A 4JGQA 3VV4A 4S2IA 1DP6A 3MFDA 3KSHA 5A90A 3T4OA 3A3FA 3MKFA 1D1JA 1LL5A 3HLGA 4EW7A 1A0KA 3Q07A 4N92A 4OQ0A 1ZKJA 3IXHA 3WWXA 4ETXA 4WMCD 2VV8A 2ZQAA 1V9ZA 2O9AA 4JGOA 3HREA 2W3HA 2C6WB 1I2WA 1IYSA 3GVBA 3KYQA 2XD1A 1KVMA 2ZMFA 3N4IA 5CGXA 1VETB 2Y2PA 2ZC4B 1LT0A 1V9YA 4IBRA 3BQAA 5EOOA 5F69A 4B9OA 2V1ZA 2FH5A 1X0OA 4WZ5C 3TOIA 3A3JA 4L0LA 4OOLA 3K3DA 2ZMAA 5HZHA 1UGUA 3ZG8B 1E3UD 1LL9A 4ZRRA 1YM1A 2UV0E 3VFHA 3VFFA 1VEUB 5EE8A 1GCEA 4H6JB 2DRWA 3PBNA 2PT7A 1TS8A 2P7JA 1CI8A 3SS5A 4DJ3A 1T1AA 2KDKA 1MC0A 3BQ8A 4WZ5A 3BLMA 2WKRA 4F94A 3LEZA 4GLQA 3MXQA 3PTEA 3N7WA 2Y2KA 1XXMA 2ZC6B 1JVJA 5DFXA 5HL1A 5AQ7A 2JKRI 1TEMA 5KSCA 2JN7A 1DP9A 3HUOA 1RP5A 1M40A 4K08A 3PR6A 4FD8A 4A5RA 3O3VA 4KQQA 3EGXC 1LSVA 4BMWA 4Y3IA 1DRMA 4CLCE 2Q9MA 4MEZA 5HDDA 1HZOA 1K25A 3GQZA 1IELA 1YLJA 3VOYA 4MBFA 2QZ6A 3MJQA 1I5QA 3ZG0A 4I3IA 1L3LA 4OQIA 1KGGA 4GN2A 2OOLA 3ICYA 4GD6A 5DKLA 3Q7ZA 2Y59A 1E25A 5CX7A 5FQIA 1YLPA 3TSGA 2I9VA 3S7QA 1W8QA 5GHXA 3VP3A 4GZBA 2INWA 2Y4AA 2V0WA 3D3OA 2PAVP 4WEJA 3C7VA 1BT5A 4EEUA 1SKFA 5DTTA 5GL9A 4DKIA 4ESPA 3LICA 2VKSA 4U0TA 4MN7A 4LRYC 1ERQA 2H0YA 4CQHA 3H82B 3VE3A 3HLWA 3QP8A 4JPMA 4KZ9A 4HOIA 5J4EA 3BECA 3BFEA 1YMSA 1ONHA 4LFUA 5C5KA 4HEFA 3NI9A 1XPBA 1YLYA 4QJGA 2WGVA 3ZYTA 3DTKA 3HLEA 2XF3A 5IHVA 4FH2A 5EPHA 5FQ9A 2HP9A 3I7JA 1MWTA 4II7A 4BD1A 5FASA 3O86A 2BTFP 4I39A 1N4OA 2EFUA 5TR7A 3IH8A 2PU4A 4BJPA 4OPQA 3SH9A 1P0ZA 2VX8A 1O07A 3QP2A 4WLAA 3HBRA 4OP5A 5HWWA 3C8CA 1EWZA 2Y8HA 3KX0X 2Y2HA 5DVAA 3OCLA 3T50A 3LR5A 5DJTA 1L0FA 1G5UA 4R3JA 4LRZE 5IS1A 4HP9A 5F68A 4OVDA 1MKMA 4LGWA 2W3EA 5FSRA 1MKIA 3SZTA 4O7DA 3L7HA 5E2EA 3TJZC 3V5MA 1DJBA 3SS4A 4FUWA 3MQQA 3RH8B 2J3TC 5EVIC 1NRFA 1YLZA 2NUPC 4JF5A 4OLGA 2Q0OA 2W3DA 3E4QA 4WUJA 3C4OA 1MWUA 4RX3A 5HL6A 4WF0A 4HJ3A 1BYWA 4OONA 4L9FA 3CLOA 2B02A 3MF0A 3CWFA 3UMDA 3MZEA 3HJIA 2HV1A 2OWHA 3PYPA 3RFBA 1PZOA 4MN6A 1OMEA 5KIZA 1W63M 4DN0A 1J3WA 1K4FA 2W27A 5K5BA 3C7UA 4R4RA 2PYRA 2FFFB 5EVIA 2WZXA 1XJ6A 4GDBA 3GMWA 3JPUA 5E2HA 3OZHA 2L0WA 3ZVTA 4I38A 1VB6A 1Y28A 3CPTA 1PW8A 3HLFA 3UPNA 4KZ5A 3HVFA 2X01A 1IYOA 3MBZA 4Y13A 2L1MA 2YKFA 1BZAA 4R6LA 5FI6A 5TJJA 2WGWA 2ZM8A 3CITA 3P7NA 1ES5A 3O88A 3IX8A 1CI9A 1KGEA 4Y2FA 1ZC2A 3UDFA 1H5XA 2G7UA 2JCHA 3EEHA 1FIKA 3T4QA 2Y2MA 2X02A 4X69A 1BLCA 3PXPA 3OPRA 1OTDA 4AFIA 3G35A 3VOLA 4EESA 3EOIA 4G3VA 1YMXA 1L0GA 5KZHA 1H8MA 4YINA 4R23A 3DW0A 3E2LA 4OQHA 3VP0A 5HARA 2WK0A 3UMEA 1ZHHB 4N9LA 2QMIA 4OOYA 3LEQA 4DF6A 1FSYA 4PM8A 2H28A 2HJEA 1JNUA 1STZA 5EM1A 4OH0A 3VP2A 2M7UA 2IWCA 3HUMA 2WGWB 5F82A 1J9MA 4XUXA 1L0EA 3BLSA 3N8SA 1F2KA 4ZJ3A 3TG9A 2PR6A 2X71A 1EI5A 4UA9A 2WAFA 3T4TA 1N9BA 3WS0A 5F83A 3P98A 5EECA 4NG2A 1W8YA 3E0YA 3V3SA 3W8KA 4Q0IA 1RGZA 1TDGA 1IOUA 4WM9A 3OPLA 2VV6A 1K38A 4HJ6A 2DNSA 3G31A 5L8MA 1ZTUA 3UDIA 2Y79A 2I72A 4ETZA 1PNEA 3HUNA 5DKKA 2H10A 3LI8A 1YAXA 2H0TA 1NZOA 4PM7A 4MCWA 1ESUA 1TVFA 1KE4A 4Z1WA 2J80A 3WS2A 1BTLA 4S2NC 3DTMA 3DWZA 2JKTM 1YLTA 4EERA 4GOGA 4MBKA 1ONGA 3Q7VB 4BENA 1DJAA 4B4ZA 3O5YA 1IKIA 3SH8A 4I5SA 2VK3A 1KDWA 3SH7A 1XX2A 2XA7S 4S2PA 2XK1A 4H8RA 4ID4A 4F3LA 1AXBA 5GHZA 1UWNX 3LUQA 5IT5A 3P01A 4ARZB 3KYZA 4S2NA 2ZC5B 4MDZA 1S4RA 3GV9A 5TFQA 3V3RA 2VZWA 1E4DA 1YKDA 4OPYA 4WEKA 4XT2B 5E2FA 2QYBA 5M18A 3V39A 1KVLA 4HI4A 4LCMA 5M1AA 3ZDJA 4DXCA 2OWJA 4N1XA 5EV0A 1VEUA 1MXOA 2PHYA 3QNBA 5DJUA 3BRMA 4H6JA 1TDLA 3IX4A 1K57C 3QP5A 5TGFA 2HF6A 2IA2A 2KOIA 2M1CA 2EXAA 3F1PB 1KOUA 4JGPA 5HPFA 1PYYA 2KLIA 5CHJA 3FKWA 5HFOA 2O9BA 4F3LB 4UA7A 3PBOA 5FATA 1WA9A 4RQ9A 1OTAA 2QKPA 2EWWA 1NRJA 3TE8A 2VA0A 4R4SA 3VSKA 5L09A 5CEDA 3IBJA 2Y2QA 2CMNA 5GLCA 4EBLA 3QNCA 5LBRA 3T1RA 4CLCB 1K55C 5CECA 3UE3A 3KSGA 3HLBA 4NK3A 4L9GA 4KG5A 4KZ8A 4IUHA 2L4RA 2WYXA 3ZFZA 5D3OA 3OOVA 4R3AA 3C2WA 1QMFA 2ZQ9A 3MZDA 5FAPA 2ZOHA 4HHDA 3LYXA 1K54C 1G68A 4GS9A 3ZQ5A 2XRNA 2PDRA 4DRTA 3O87A 3U2AA 3A3DA 2XDMA 2ZQ7A 4LV1A 1K55A 4N9KA 4KZAA 3LCEA 3ZG7B 2A2LA 4CPKA 2EX9A 4GDNA 1T1BA 3IBRA 3CG5A 4RX2A 1UWPX 1GA9A 3E98A 4UAAA 3H82A 2P08A 2HP6A 1NLZA 3BJNA 2XFTA 3EEAA 1K54A 3IF5A 3AGFA 2EA9A 4KG2A 1MWRA 4JXVA 4QY6A 3C5AA 3MSHA 3OLOA 3IS2B 5HDSA 2GDNA 3M6HA 2PBYA 3LI9A 1BULA 1JTDA 5IU1A 3H9WA 1BUEA 4JXWA 4QB8A 2VEAA 5CHMA 3QP4A 4WBGA 4GS9B 5BOHA 4Q0JA 3UO9A 4Q8IA 3W4PA 3PBQA 4I3JA 3IXGA 2ZQCA 4OP8A 4X56A 3HCYA 4KENB 2HDRA 2OSUA 3QP1A 2G2UA 3GECA 5HAPA 3LO7A 2CC1A 1K6RA 1GA0A 3IXBA 4QPRA 4PHTA 1PIOA 4GHIB 4P85A 4BL3A 1LLBA 3NECA 1OTEA 1ODVA 2HPBA 4XXRA 4BBTA 3NBLA 3BEBA 4R3BA 2J3WA 3MS6A 2OAQ1 5F1GA 2W3FA 2OLVA 4BL2A 5TBMB 4O0PA 3ZCZA 4P6ZM 3BM6A 4M3KA 2V8CA 3RXWA 1Q2PA 4GD8A 1T1CA 4IEDA 4S2JA 5L2FA 3SOIA 1N9OA 3ISGA 4PKYG 3G34A 3OC2A 5HPIA 2XA7M 1H8ZA 3MR0A 1Y54A 5EVID 5DF8A 2QPNA 1KDSA 4NXFA 4PAUA 1XJ2A 1AWIA 4Q0HA 3U4LP 3ZGAB 3NOTC 2AVXA 4GB7A 4KZ6A 2BLSA 4IVKA 2R78A 1K6SA 4C75A 2Z2LB 5DTKA 1NXYA 4HH2A 5HW3A 3PBSA 5CHUA 4BLMA 5F6AA 3MXSA 1XP4A 3BWLA 5L10A 3IXDA 2J7VA 5MC7A 3IH9A 4FCFA 3FG8A 4KZ3A 5CRFA 3T12B 1OTBA 3F1NA 2BASA 3T1QB 1S6RA 1M6KA 3DBAA 1XGIA 1NJ4A 1GSWA 5CTMA 4QWOA 1ZG6A 3QP6A 4X1LA 2W1RA 5J7EA 3W4OA 2BG1A 2Z6DA 4KZ7A 4R70A 2J9OA 3IWIA 1PZPA 4WYYA 3N8RA 5A8BA 1TS0A 2V0UA 1ALQA 3OPPA 1HLUP 1PWGA 2PD7A 4P0MA 3PHYA 2K31A 2JE5A 3A3EA 5HD3A 4BBVA 4EV4A 2Z2MB 5G4ZA 1P97A 1T18A 3NDGA 1HTZA 4LV0A 4ME4A 1OPXA 4UHUA 1W63Q 3LR3A 1IYPA 4DDSA 5EOEA 4NXBA 4PPRA 1MY8A 3F1NB 3C30A 4JF6A 4PMAA 3NHQA 4X55A 5F5YA 1S1ZA 3CI6A 3UB5P 1IKGA 5FDSA 2ZMVA 3S7NA 3H7WB 4IBXA 2D02A 4C6YA 1Z09A 2W0NA 4X25A 4FSFA 1I2SA 1U60A 5CEBA 2V20A 3OCNA 2O99A 4YFMA 3T4JA 5F1FA 2OV5A 5FA7A 4B4XA 3HL9A 3HLDA 5FQQA 2A24A 3E2KA 1Q2QA 4D60A 2RL3A 5FDHA 5A93A 3M6BA 5G4YA 2P04A 3WRTA 3BYDA 2OLUA 2B95A 4HBTA 3VP4A 1KE0A 1XFQA 1T19A 4E6WA 3GSGA 3UB6A 4JLFA 2JBFA 4JXGA 1LL8A 2PBDP 3UNWA 1NWZA 1OJGA 3Q7VA 5I5LA 3S22A 2EX8A 2JKTI 3EGDC 3NIAA 4UQIS 4ZDXA 2HDSA 3AGEA 3VSLA 4YOFA 5JYPA 3RJUA 3A0VA 3GDIA 2JKFA 5CXWA 5HWTA 3NJAA 1EW0A 4EETB 4ZAMA 2EFXA 5FEGA 4ARZA 4WELA 3BY9A 1G6AA 2GZAA 2WKIA 4G3WA 3QHYA 4B88A 1XGJA 1K56A 2A24B 1PFLA 4IJGA 4GCZA 3FPVA 3D4FA 4HJ4A 5HDCA 4O01A 1ZG4A 4M4XA 4XT2A 1CEFA 2PRFA 4DXBA 1NY0A 5DTSA 3ZG9B 4N1HA 1W7FA 4P6ZS 3WS4A 1KGFA 1W5DA 4E3KA 4BBUA 4OOMA 3W2ZA 2PU2A 3PAEA 2ZD8A 3UN7A 3TW8A 4CLCC 1SZVA 1LSWA 3UPPA 4EXOA 3F1PA 2ZM2A 3IWOA 5FL3A 2A49A 3UE0A 3VOZA 2XH9A 1YPRA 2XSSA 4BD0A 2P74A 2HJ9C 4EUVA 1S66L 1H0MA 1OT6A 5EM0A 1BSGA 5DF9A 2WADA 3FC7A 2HDUA 4NKPA 3FYZA 1L0DA 2VJWA 2K2NA 2NUTC 1CQAA 1RGYA 1D7EA 4K91A 3LFVA 3JVUA 4CLCA 3R7WA 3MZFA 1HVBA 4NEED 1OJ5A 2W1TB 2QHKA 3ZG5A 3PBRA 4EBNA 3HJKA 3MMHA 1GHMA 5L07A 4Z9QA 2EX2A 1FCMA 4LCLA 1SDEA 5CERA 3S7PA 4Y17A 4ZBEA 1WYCA 3NOPC 3C4PA 2Z6CA 3MKEA 2P9VB 2QJ7A 2WKPA 1FSWA 3Q1FA 5EVLA 1O7EA 5AQBA 4P6BA 1ERMA 4YNRA 2XLNA 1BLSA 4UEYA 4Y7PA 2XD5A 5FAQA 2C5WB 1NZUA 1YLWA 3JVVA 2EXBA 3F1OA 3ZNTA 4HQAA 2ZL1B 3OPHA 3FPWA 1Z6FA 3ITAA 3G2YA 3MQOA 4ZJ2A 5GHYA 4GW9A 1IEMA 1GHPA 1L2SA 4OPRA 2Q9NA 3LR4A 1CEGA 1K57A 3GRJA 4UA6A 1CK3A 1MWSA 3BY8A 4KZBA 3R7WB 2JC7A 2XEPA 3IS2A 2FFYA 2ZJ9A 2Y2IA 3IWQA 2OAP1 4QY5A 1C3BA 1TF1A 4KUOA 2YKHA 4S2MA 4X53A 4IVIA 1HD8A 2GJ3A 3IHAA 4O8GA 5KMWA 3UDXA 3UB9A 1XA7A 5FI2A 3NDEA 4S2LA 5GLBA 2O0YA 3LIAA 4CJNA 2WKEA 3CAXA 3F1OB 4GHIA 4JKTA 3P09A 4FOFA 5JYOA 4Y5FA 2B18A 3ZHHA 4KUKA 1XA1A 4EEPA 4WZ4A 4MNRA 4NETA 3S4XA 2JKGA 2O9CA 4NXEA 2HZ5A 5HAQA 1VQQA 4RVAA 5TBMA 5GLAA 1H8YA 1BLPA 4WMCA 1YSPA 2H5SA 1BLHA 5EVEA 4S2OA 4FH4A 5FAOA 3V50A 4KQRA 5AVEA 4Y15A 4GKUA 1S4SA 2A3UA 2R9WA 3R4KA 3UB8A 2KX6A 4LPZA 2ZC7A 2VGLS 3CJMA 1GHIA 4PKYA 1S67L 4EWFA 3LIEA 4UQIM 3KSFA 5GLDA 1FQGA 3NC8A 5CTNA 3EQUA 1LHYA 3TRCA 2J8YA 3M2KA 3NCKA 5AJGA 3KSIA 5HSQA 1JWZA 1P9WA 4E04A 1E3UA 3IQAA 2M7VA 1NYYA 1FCNA 3RTYA 1OTIA 4LV3A 1PW1A 2PD8A 3CMZA 2Y2JA 5DF7A 2JKRM 2GX5A 2QJ5A 4QD4A 3G32A 1XFNA 1FOFA 4ZJ1A 1LSXA 4FTXA 3UE6A 3CZDA 1MPLA 4HP4A 4BQMA 1LI9A 1XKZA 3UY6A 3T1XA 4JGRA 4EQ1A 2VLGA 4PM5A 2EWVA 4E3OA 3G6OA 1SCWA 2XFSA 4JBFA 3T4SA 3C38A 2WGIA 1N9LA 4GJ4A 2VGKA 5EFWA 4HBUA 3ULFA 2J3TD 3A3IA 1SDNA 5HAIA 1ACFA 3L9KA 1PI4A 4E3IA 2LB9A 2ZQ8A 3DWKA 3W4QA 1IYQA 3S7OA 2V8FA 2WUQA 2V2FF 3T4LA 3E4OA 3GR2A 1JTGA 2HP5A 2DMWA 3B42A 1PRQA 4R0QA 4BWIA 4QU3A 4L9EA 5FQJA 2DCFA 3VE4A 4X6TA 3BW6A 1DJCA 4Y0OA 2K7SA 1YSQA 1CJFA 1FR1A 4GNUA 3T4KA 3UB7A 4YWZA 3D72A 4MMNA 2FZ0A 1H3QA 4MBHA 3H7WA 4IHQA 4S2KA 4DDYA 1PI5A 3A0RA 4JXSA 4RA7A 4DJ2A 4WL9A 4E6XA 4R1GA 2V1BA 3SS3A 3IT9A 3A0SA 4RYEA 3ZVWA 2WZZA 4LRXC 3GTCA 3IF6C 3WS5A 3PAGA 1PWCA 1N9NA 5M19A 2ZM0A 2EX6A 3BFCA 3IX3A 2J9PA 1D06A 4OLDA 3ZNYA 4LV2A 3LIBA 4EBPA 5FEFA 3MXRA 1S0WA 1SHVA 1VM1A 5EUAA 1Y4OA 2Y2LA 3ITBA 3CUEC 3KO6A 4G3KA 1ES4A 3LGOA 2IWBA 2PR5A 3IHBA 1WE4A 3LIFA 3BFDA 4NXGA 2UWXA 2HDQA 3K3CA 5AVFA 1LI0A 3MFXA 4K0WA 4Y0TA 1ES3A 4HNBA 2ZQDA 3SW1A 5AQ9A 4EU0A 3IF6A 3DAVA 5HD5A 1OT9A 4PM9A 3NOUC 1IFQA 4I3AA 2ZLYA 1XJ4A 2W3GA 1FCOA 3NY4A 2VV7A 1MBLA 2XGNA 4P87A 5E2GA 1W79A 3DTEA 1TD5A 4HY8A 4JF4A 1VHMA 1K56D 3CUEA 1G28A 2XR0A 2Y91A 3B3XA 1MZUA 1FR6A 3G4PA 1JWVA 3VMAA 2WKQA 4X1MA 5FQMA 4HIAA 3BFGA 5AQAA 4LLOB 4X68A 1FILA 4OPZA 3VP1A 4QHCA 3JYIA 5E43A 2D01A 3CHWP 1RCJA 5CGWA 5EVIB 5FQKA 3LIDA 3G2ZA 4DMZA 3N8LA 3OBFA 2ZOIA 3CPTB 1PWDA 3EQVA 2G2WA 1ES2A 2VGLM 1XJ3A 1QMEA 3AGDA 1YT4A 2WAEA 4D2OA 3IF6B 3WRZA 4KQDA 3M2JA 1NLYA 3LY4A 5HX9A 2E8JA 2E8IA 3BFFA 4E3LA 2XQZA 3UE1A 4OQGA 5DFYA 2RCXA 2V1AA 2WKHA 2Y2OA 3E4PA 4IUKA 1K4EA 4B93A 4U0XA 2LB5A 4HH3A 1SKOA 4CLCD 3B47A 1G6OA 3FZCA 5HWVA 2ZC3B 1GSVA 5A92A 1F98A 1S1YA 5FI7A 4K0XA 3G30A 3Q81A 1F5MA 4HESA 3FWLA 4LENA 2W1TA 5J8XA 1JWPA 1KE3A 4DE2A 4U3TA 3Q82A 3N6IA 4MLLA 4KG6A 4OKPA 4XUZA 3D9YA 3MQ0A 1NYMA 4ZTKA 2Y2GA 5CGSA 2MJ6A 2XROA 3DTIA 1K0KA 1TS6A 4MN5A 2P9VA 3FKVA 4C3QA 5J3WA 2V9AA 3PBTA 4KZ4A 5U47A 2Y55A 1CF0A 2Y2NA 4R38A 2B5RA 5I94A 1TS7A 1P9RA 4E3MA 4EQIA 2ZL1A 3NULA 2JHEA 2QWSA 5G18A 3WS1A 5A91A 1DP8A 1SKOB
chains in the Genus database with same CATH topology
2R78A 1OTDA 4FOFA 4AFIA 4Y5FA 2B18A 4HH2A 4KUKA 3VOLA 4EESA 3EOIA 4G3VA 2HGVA 3PBSA 4EEPA 5F6AA 1H8MA 4NXEA 2O9CA 2ZBBA 2PYPA 3BWLA 1GSXA 4WN5A 3V67A 5TBMA 5MC7A 1YSPA 3FG8A 3K2NA 5AVEA 3UMEA 1ZHHB 1OTBA 3F1NA 1S4SA 2BASA 3R4KA 3DBAA 1F9IA 3LR0A 3UB8A 2H28A 2HJEA 2KX6A 2GNXA 4LPZA 1JNUA 1STZA 2VGLS 4PKYA 1GSWA 5KSHA 1S67L 4KQOA 2M7UA 3EWKA 3LIEA 4UQIM 3KSFA 2W1RA 3B33A 5J7EA 4JGQA 3EQUA 3VV4A 2Z6DA 3TRCA 1DP6A 3KSHA 5AJGA 3KSIA 2PR6A 3T4OA 5HSQA 4R70A 3T4TA 1P9WA 5A8BA 1TS0A 4EW7A 2V0UA 4E04A 4ETXA 2M7VA 3E0YA 2PD7A 2VV8A 3RTYA 1V9ZA 2O9AA 4JGOA 1OTIA 2W3HA 2PD8A 4Q0IA 3PHYA 1IOUA 3KYQA 2JKRM 2GX5A 2K31A 2VV6A 2ZMFA 2QJ5A 5HD3A 1XFNA 4BBVA 1LT0A 1V9YA 4HJ6A 1LSXA 3BQAA 5L8MA 1ZTUA 2Y79A 5F69A 4B9OA 4ETZA 3UE6A 5G4ZA 5DKKA 1P97A 1T18A 2FH5A 1X0OA 4HP4A 4ME4A 1OPXA 3LI8A 1W63Q 1YAXA 3LR3A 4JGRA 4EQ1A 4NXBA 4MCWA 2VLGA 2EWVA 3F1NB 3C30A 3G6OA 4L0LA 4Z1WA 4OOLA 3T4SA 3NHQA 2J80A 3K3DA 5F5YA 1S1ZA 3C38A 2JKTM 5HZHA 1N9LA 1UGUA 3CI6A 4GJ4A 4EERA 4ZRRA 2ZMVA 3S7NA 5EFWA 3H7WB 2D02A 3ULFA 2J3TD 2W0NA 4FSFA 3O5YA 4I5SA 4H6JB 3PBNA 2PT7A 2XA7S 1TS8A 2P7JA 2LB9A 3OCNA 4DJ3A 1T1AA 2KDKA 1MC0A 3BQ8A 2O99A 3S7OA 4F3LA 3T4JA 2WKRA 1UWNX 4GLQA 3T4LA 3LUQA 3E4OA 3MXQA 5IT5A 3P01A 4ARZB 3KYZA 2DMWA 3B42A 4BWIA 4L9EA 2A24A 5DFXA 3VE4A 2JKRI 4MDZA 1S4RA 2JN7A 1DP9A 5G4YA 2P04A 3BW6A 4K08A 2VZWA 1YKDA 2K7SA 1YSQA 4WEKA 3T4KA 4XT2B 3PR6A 1XFQA 1T19A 2QYBA 3UB7A 3EGXC 4YWZA 3D72A 1LSVA 4BMWA 4HI4A 4Y3IA 1DRMA 4MMNA 4CLCE 2FZ0A 1H3QA 5HDDA 3UB6A 2OWJA 3H7WA 4IHQA 1LL8A 1NWZA 1OJGA 2PHYA 5I5LA 3A0RA 5DJUA 2JKTI 3EGDC 4H6JA 3MJQA 4DJ2A 4UQIS 4I3IA 4WL9A 2OOLA 2V1BA 3ICYA 2HF6A 5DKLA 4YOFA 3A0SA 2IA2A 2KOIA 3GDIA 3A0VA 2M1CA 5HWTA 3F1PB 1KOUA 3NJAA 4LRXC 1EW0A 4JGPA 4EETB 5HPFA 5CX7A 2KLIA 4ARZA 2O9BA 4F3LB 2I9VA 3S7QA 1N9NA 3PBOA 2INWA 4WELA 1WA9A 3BY9A 1OTAA 2GZAA 4RQ9A 4G3WA 1D06A 2QKPA 2EWWA 2V0WA 3LIBA 3D3OA 1NRJA 3TE8A 4WEJA 2VA0A 2A24B 4EEUA 4IJGA 4GCZA 3FPVA 4HJ4A 5HDCA 4O01A 3CUEC 3LICA 3KO6A 4G3KA 3IBJA 2VKSA 4M4XA 4XT2A 2CMNA 2PR5A 4MN7A 4LRYC 5LBRA 4CQHA 3H82B 3LIFA 3VE3A 4NXGA 4CLCB 4P6ZS 3K3CA 5AVFA 3UE3A 3MFXA 4HOIA 4BBUA 5J4EA 4HNBA 4OOMA 3KSGA 3SW1A 5C5KA 4EU0A 3W2ZA 5HD5A 4L9GA 1OT9A 3NOUC 4IUHA 2L4RA 1IFQA 3TW8A 3OOVA 4I3AA 1XJ4A 2W3GA 4R3AA 2VV7A 3C2WA 4CLCC 1LSWA 2ZOHA 3ZYTA 4HHDA 3LYXA 4EXOA 1TD5A 3F1PA 4GS9A 4HY8A 5FL3A 3ZQ5A 2XRNA 1VHMA 3CUEA 2PDRA 1G28A 4II7A 1MZUA 4I39A 2XSSA 2HJ9C 3U2AA 2WKQA 4EUVA 1S66L 4HIAA 1OT6A 4LLOB 4BJPA 5DF9A 1P0ZA 2VX8A 3FC7A 2A2LA 4NKPA 4WLAA 2VJWA 1T1BA 3IBRA 2K2NA 2NUTC 5HWWA 1UWPX 2D01A 3C8CA 3E98A 2Y8HA 1D7EA 3H82A 3KX0X 2P08A 3LFVA 1NLZA 3JVUA 4CLCA 3OCLA 3T50A 3R7WA 3LR5A 3BJNA 3LIDA 3EEAA 4NEED 5DJTA 1OJ5A 2W1TB 4DMZA 2QHKA 2EA9A 4LRZE 5IS1A 4HP9A 5F68A 1MKMA 3OBFA 2W3EA 2ZOIA 3PBRA 3EQVA 3HJKA 3MMHA 3OLOA 3TJZC 2VGLM 3S7PA 3IS2B 5HDSA 1XJ3A 3MQQA 3RH8B 2J3TC 3NOPC 2NUPC 2Z6CA 4KQDA 3LI9A 1NLYA 2W3DA 5IU1A 3H9WA 3E4QA 4WUJA 2VEAA 2QJ7A 2WKPA 5HL6A 4WF0A 4GS9B 5DFYA 4HJ3A 2V1AA 4Q0JA 1BYWA 4YNRA 4L9FA 3CLOA 3PBQA 4I3JA 2B02A 3MF0A 4UEYA 3CWFA 3E4PA 3UMDA 4IUKA 3HJIA 2HV1A 2OWHA 3PYPA 3RFBA 4B93A 3HCYA 4MN6A 2LB5A 4HH3A 4CLCD 3GECA 3JVVA 5KIZA 3F1OA 1W63M 4HQAA 3B47A 1G6OA 3FPWA 4DN0A 2W27A 5K5BA 5HWVA 1GSVA 4QPRA 3MQOA 1F98A 4PHTA 1S1YA 4GHIB 2PYRA 4GW9A 1OTEA 1ODVA 1XJ6A 1F5MA 3LR4A 4BBTA 2W1TA 2J3WA 2OAQ1 2L0WA 3BY8A 4I38A 1VB6A 2W3FA 3R7WB 1Y28A 5TBMB 4O0PA 3IS2A 3MQ0A 4P6ZM 2MJ6A 2XROA 1TS6A 2OAP1 4MN5A 2L1MA 1TF1A 2YKFA 5J3WA 4R6LA 2V9AA 4KUOA 1T1CA 2YKHA 3PBTA 5TJJA 3CITA 3P7NA 1N9OA 4PKYG 2GJ3A 4R38A 4O8GA 3OC2A 1TS7A 1P9RA 5HPIA 3UB9A 4Y2FA 2XA7M 3MR0A 2G7UA 2O0YA 4NXFA 3LIAA 2JHEA 2QWSA 4PAUA 3EEHA 1XJ2A 1DP8A 4Q0HA 3T4QA 3NOTC 3CAXA 3F1OB 4GHIA 3PXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R78 A;  1OTD A;  4HH2 A;  4KUK A;  3VOL A;  4EES A;  4EEP A;  5F6A A;  4NXE A;  2ZBB A;  2PYP A;  3BWL A;  1GSX A;  4WN5 A;  5TBM A;  3FG8 A;  5AVE A;  3UME A;  1OTB A;  3F1N A;  1S4S A;  2BAS A;  1F9I A;  3UB8 A;  2H28 A;  2KX6 A;  4LPZ A;  1JNU A;  4PKY A;  1GSW A;  1S67 L;  3EWK A;  3LIE A;  3B33 A;  5J7E A;  4JGQ A;  2Z6D A;  1DP6 A;  2PR6 A;  5HSQ A;  4R70 A;  5A8B A;  1TS0 A;  4EW7 A;  2V0U A;  4E04 A;  2PD7 A;  2VV8 A;  3RTY A;  1V9Z A;  4JGO A;  1OTI A;  2PD8 A;  3PHY A;  2VV6 A;  2QJ5 A;  5HD3 A;  1XFN A;  4BBV A;  1LT0 A;  1V9Y A;  4HJ6 A;  1LSX A;  5F69 A;  4B9O A;  3UE6 A;  5G4Z A;  5DKK A;  1P97 A;  1T18 A;  1X0O A;  4HP4 A;  3LI8 A;  4JGR A;  4EQ1 A;  4NXB A;  2VLG A;  3F1N B;  3G6O A;  3NHQ A;  2J80 A;  3K3D A;  5F5Y A;  1S1Z A;  5HZH A;  1N9L A;  1UGU A;  4EER A;  5EFW A;  3H7W B;  2D02 A;  3ULF A;  2W0N A;  4I5S A;  4H6J B;  1TS8 A;  2P7J A;  4DJ3 A;  1T1A A;  2KDK A;  4F3L A;  2WKR A;  1UWN X;  3LUQ A;  3E4O A;  3MXQ A;  4L9E A;  2A24 A;  3VE4 A;  1S4R A;  2JN7 A;  1DP9 A;  5G4Y A;  4K08 A;  2K7S A;  4XT2 B;  1XFQ A;  1T19 A;  3UB7 A;  4YWZ A;  3D72 A;  1LSV A;  4HI4 A;  1DRM A;  5HDD A;  3UB6 A;  2OWJ A;  3H7W A;  1LL8 A;  1NWZ A;  1OJG A;  2PHY A;  5I5L A;  3A0R A;  5DJU A;  4H6J A;  3MJQ A;  4DJ2 A;  4I3I A;  4WL9 A;  2OOL A;  2V1B A;  3ICY A;  5DKL A;  3A0S A;  3A0V A;  3GDI A;  2M1C A;  5HWT A;  3F1P B;  1KOU A;  3NJA A;  4LRX C;  1EW0 A;  4JGP A;  4EET B;  4F3L B;  2I9V A;  1N9N A;  2INW A;  1WA9 A;  4RQ9 A;  1OTA A;  3BY9 A;  1D06 A;  2QKP A;  2V0W A;  3LIB A;  2A24 B;  4EEU A;  4GCZ A;  4HJ4 A;  5HDC A;  3LIC A;  4M4X A;  4XT2 A;  2CMN A;  2PR5 A;  4LRY C;  3H82 B;  3LIF A;  3VE3 A;  4NXG A;  3K3C A;  5AVF A;  3MFX A;  4HOI A;  4BBU A;  5J4E A;  4HNB A;  3SW1 A;  5HD5 A;  4L9G A;  1OT9 A;  3NOU C;  2L4R A;  4I3A A;  1XJ4 A;  4R3A A;  2VV7 A;  3C2W A;  1LSW A;  2ZOH A;  4HHD A;  3LYX A;  4EXO A;  3F1P A;  4GS9 A;  4HY8 A;  3ZQ5 A;  2PDR A;  1G28 A;  1MZU A;  4I39 A;  2WKQ A;  1S66 L;  4HIA A;  1OT6 A;  4LLO B;  1P0Z A;  3FC7 A;  4WLA A;  1T1B A;  3IBR A;  5HWW A;  1UWP X;  2D01 A;  3C8C A;  1D7E A;  3H82 A;  3KX0 X;  3T50 A;  3LID A;  5DJT A;  1OJ5 A;  2QHK A;  2EA9 A;  4LRZ E;  5IS1 A;  4HP9 A;  5F68 A;  2ZOI A;  3HJK A;  3OLO A;  5HDS A;  3IS2 B;  1XJ3 A;  3MQQ A;  3RH8 B;  3NOP C;  2Z6C A;  4KQD A;  3LI9 A;  5IU1 A;  3H9W A;  3E4Q A;  4WUJ A;  2VEA A;  2QJ7 A;  2WKP A;  4WF0 A;  4GS9 B;  4HJ3 A;  2V1A A;  1BYW A;  4L9F A;  3CLO A;  4I3J A;  2B02 A;  3CWF A;  3E4P A;  3UMD A;  3HJI A;  2HV1 A;  2OWH A;  3PYP A;  4MN6 A;  4HH3 A;  3GEC A;  5KIZ A;  3F1O A;  4HQA A;  2W27 A;  5HWV A;  1GSV A;  3MQO A;  1F98 A;  1S1Y A;  4GHI B;  2PYR A;  4GW9 A;  1OTE A;  1ODV A;  1XJ6 A;  4BBT A;  2L0W A;  3BY8 A;  4I38 A;  1VB6 A;  1Y28 A;  5TBM B;  3IS2 A;  1TS6 A;  4MN5 A;  2L1M A;  2YKF A;  5J3W A;  4R6L A;  2V9A A;  4KUO A;  1T1C A;  2YKH A;  3P7N A;  1N9O A;  4PKY G;  2GJ3 A;  4R38 A;  1TS7 A;  3UB9 A;  3MR0 A;  4NXF A;  3LIA A;  2JHE A;  2QWS A;  3EEH A;  1XJ2 A;  1DP8 A;  3NOT C;  3CAX A;  3F1O B;  4GHI A; 
#chains in the Genus database with same CATH topology
 2HGV A;  1VET A;  3RXX A;  1ESI A;  1DY6 A;  2PYP A;  2ZBB A;  1GSX A;  2IWD A;  4WN5 A;  3V67 A;  4DE0 A;  3UPO A;  4DE1 A;  1WYB A;  3K2N A;  3T1S A;  3HLC A;  2ACG A;  3FV7 A;  1ERO A;  2VGJ A;  3KYE A;  3S1Y A;  1F9I A;  3LR0 A;  4EUZ A;  1YQS A;  2GNX A;  4E3N A;  5KSH A;  4KQO A;  4PM6 A;  3EWK A;  3LY3 A;  2R9X A;  4Y0U A;  4E3J A;  3B33 A;  4DE3 A;  4JGQ A;  3VV4 A;  4S2I A;  1DP6 A;  3MFD A;  3KSH A;  5A90 A;  3T4O A;  3A3F A;  3MKF A;  1D1J A;  1LL5 A;  3HLG A;  4EW7 A;  1A0K A;  3Q07 A;  4N92 A;  4OQ0 A;  1ZKJ A;  3IXH A;  3WWX A;  4ETX A;  4WMC D;  2VV8 A;  2ZQA A;  1V9Z A;  2O9A A;  4JGO A;  3HRE A;  2W3H A;  2C6W B;  1I2W A;  1IYS A;  3GVB A;  3KYQ A;  2XD1 A;  1KVM A;  2ZMF A;  3N4I A;  5CGX A;  1VET B;  2Y2P A;  2ZC4 B;  1LT0 A;  1V9Y A;  4IBR A;  3BQA A;  5EOO A;  5F69 A;  4B9O A;  2V1Z A;  2FH5 A;  1X0O A;  4WZ5 C;  3TOI A;  3A3J A;  4L0L A;  4OOL A;  3K3D A;  2ZMA A;  5HZH A;  1UGU A;  3ZG8 B;  1E3U D;  1LL9 A;  4ZRR A;  1YM1 A;  2UV0 E;  3VFH A;  3VFF A;  1VEU B;  5EE8 A;  1GCE A;  4H6J B;  2DRW A;  3PBN A;  2PT7 A;  1TS8 A;  2P7J A;  1CI8 A;  3SS5 A;  4DJ3 A;  1T1A A;  2KDK A;  1MC0 A;  3BQ8 A;  4WZ5 A;  3BLM A;  2WKR A;  4F94 A;  3LEZ A;  4GLQ A;  3MXQ A;  3PTE A;  3N7W A;  2Y2K A;  1XXM A;  2ZC6 B;  1JVJ A;  5DFX A;  5HL1 A;  5AQ7 A;  2JKR I;  1TEM A;  5KSC A;  2JN7 A;  1DP9 A;  3HUO A;  1RP5 A;  1M40 A;  4K08 A;  3PR6 A;  4FD8 A;  4A5R A;  3O3V A;  4KQQ A;  3EGX C;  1LSV A;  4BMW A;  4Y3I A;  1DRM A;  4CLC E;  2Q9M A;  4MEZ A;  5HDD A;  1HZO A;  1K25 A;  3GQZ A;  1IEL A;  1YLJ A;  3VOY A;  4MBF A;  2QZ6 A;  3MJQ A;  1I5Q A;  3ZG0 A;  4I3I A;  1L3L A;  4OQI A;  1KGG A;  4GN2 A;  2OOL A;  3ICY A;  4GD6 A;  5DKL A;  3Q7Z A;  2Y59 A;  1E25 A;  5CX7 A;  5FQI A;  1YLP A;  3TSG A;  2I9V A;  3S7Q A;  1W8Q A;  5GHX A;  3VP3 A;  4GZB A;  2INW A;  2Y4A A;  2V0W A;  3D3O A;  2PAV P;  4WEJ A;  3C7V A;  1BT5 A;  4EEU A;  1SKF A;  5DTT A;  5GL9 A;  4DKI A;  4ESP A;  3LIC A;  2VKS A;  4U0T A;  4MN7 A;  4LRY C;  1ERQ A;  2H0Y A;  4CQH A;  3H82 B;  3VE3 A;  3HLW A;  3QP8 A;  4JPM A;  4KZ9 A;  4HOI A;  5J4E A;  3BEC A;  3BFE A;  1YMS A;  1ONH A;  4LFU A;  5C5K A;  4HEF A;  3NI9 A;  1XPB A;  1YLY A;  4QJG A;  2WGV A;  3ZYT A;  3DTK A;  3HLE A;  2XF3 A;  5IHV A;  4FH2 A;  5EPH A;  5FQ9 A;  2HP9 A;  3I7J A;  1MWT A;  4II7 A;  4BD1 A;  5FAS A;  3O86 A;  2BTF P;  4I39 A;  1N4O A;  2EFU A;  5TR7 A;  3IH8 A;  2PU4 A;  4BJP A;  4OPQ A;  3SH9 A;  1P0Z A;  2VX8 A;  1O07 A;  3QP2 A;  4WLA A;  3HBR A;  4OP5 A;  5HWW A;  3C8C A;  1EWZ A;  2Y8H A;  3KX0 X;  2Y2H A;  5DVA A;  3OCL A;  3T50 A;  3LR5 A;  5DJT A;  1L0F A;  1G5U A;  4R3J A;  4LRZ E;  5IS1 A;  4HP9 A;  5F68 A;  4OVD A;  1MKM A;  4LGW A;  2W3E A;  5FSR A;  1MKI A;  3SZT A;  4O7D A;  3L7H A;  5E2E A;  3TJZ C;  3V5M A;  1DJB A;  3SS4 A;  4FUW A;  3MQQ A;  3RH8 B;  2J3T C;  5EVI C;  1NRF A;  1YLZ A;  2NUP C;  4JF5 A;  4OLG A;  2Q0O A;  2W3D A;  3E4Q A;  4WUJ A;  3C4O A;  1MWU A;  4RX3 A;  5HL6 A;  4WF0 A;  4HJ3 A;  1BYW A;  4OON A;  4L9F A;  3CLO A;  2B02 A;  3MF0 A;  3CWF A;  3UMD A;  3MZE A;  3HJI A;  2HV1 A;  2OWH A;  3PYP A;  3RFB A;  1PZO A;  4MN6 A;  1OME A;  5KIZ A;  1W63 M;  4DN0 A;  1J3W A;  1K4F A;  2W27 A;  5K5B A;  3C7U A;  4R4R A;  2PYR A;  2FFF B;  5EVI A;  2WZX A;  1XJ6 A;  4GDB A;  3GMW A;  3JPU A;  5E2H A;  3OZH A;  2L0W A;  3ZVT A;  4I38 A;  1VB6 A;  1Y28 A;  3CPT A;  1PW8 A;  3HLF A;  3UPN A;  4KZ5 A;  3HVF A;  2X01 A;  1IYO A;  3MBZ A;  4Y13 A;  2L1M A;  2YKF A;  1BZA A;  4R6L A;  5FI6 A;  5TJJ A;  2WGW A;  2ZM8 A;  3CIT A;  3P7N A;  1ES5 A;  3O88 A;  3IX8 A;  1CI9 A;  1KGE A;  4Y2F A;  1ZC2 A;  3UDF A;  1H5X A;  2G7U A;  2JCH A;  3EEH A;  1FIK A;  3T4Q A;  2Y2M A;  2X02 A;  4X69 A;  1BLC A;  3PXP A;  3OPR A;  1OTD A;  4AFI A;  3G35 A;  3VOL A;  4EES A;  3EOI A;  4G3V A;  1YMX A;  1L0G A;  5KZH A;  1H8M A;  4YIN A;  4R23 A;  3DW0 A;  3E2L A;  4OQH A;  3VP0 A;  5HAR A;  2WK0 A;  3UME A;  1ZHH B;  4N9L A;  2QMI A;  4OOY A;  3LEQ A;  4DF6 A;  1FSY A;  4PM8 A;  2H28 A;  2HJE A;  1JNU A;  1STZ A;  5EM1 A;  4OH0 A;  3VP2 A;  2M7U A;  2IWC A;  3HUM A;  2WGW B;  5F82 A;  1J9M A;  4XUX A;  1L0E A;  3BLS A;  3N8S A;  1F2K A;  4ZJ3 A;  3TG9 A;  2PR6 A;  2X71 A;  1EI5 A;  4UA9 A;  2WAF A;  3T4T A;  1N9B A;  3WS0 A;  5F83 A;  3P98 A;  5EEC A;  4NG2 A;  1W8Y A;  3E0Y A;  3V3S A;  3W8K A;  4Q0I A;  1RGZ A;  1TDG A;  1IOU A;  4WM9 A;  3OPL A;  2VV6 A;  1K38 A;  4HJ6 A;  2DNS A;  3G31 A;  5L8M A;  1ZTU A;  3UDI A;  2Y79 A;  2I72 A;  4ETZ A;  1PNE A;  3HUN A;  5DKK A;  2H10 A;  3LI8 A;  1YAX A;  2H0T A;  1NZO A;  4PM7 A;  4MCW A;  1ESU A;  1TVF A;  1KE4 A;  4Z1W A;  2J80 A;  3WS2 A;  1BTL A;  4S2N C;  3DTM A;  3DWZ A;  2JKT M;  1YLT A;  4EER A;  4GOG A;  4MBK A;  1ONG A;  3Q7V B;  4BEN A;  1DJA A;  4B4Z A;  3O5Y A;  1IKI A;  3SH8 A;  4I5S A;  2VK3 A;  1KDW A;  3SH7 A;  1XX2 A;  2XA7 S;  4S2P A;  2XK1 A;  4H8R A;  4ID4 A;  4F3L A;  1AXB A;  5GHZ A;  1UWN X;  3LUQ A;  5IT5 A;  3P01 A;  4ARZ B;  3KYZ A;  4S2N A;  2ZC5 B;  4MDZ A;  1S4R A;  3GV9 A;  5TFQ A;  3V3R A;  2VZW A;  1E4D A;  1YKD A;  4OPY A;  4WEK A;  4XT2 B;  5E2F A;  2QYB A;  5M18 A;  3V39 A;  1KVL A;  4HI4 A;  4LCM A;  5M1A A;  3ZDJ A;  4DXC A;  2OWJ A;  4N1X A;  5EV0 A;  1VEU A;  1MXO A;  2PHY A;  3QNB A;  5DJU A;  3BRM A;  4H6J A;  1TDL A;  3IX4 A;  1K57 C;  3QP5 A;  5TGF A;  2HF6 A;  2IA2 A;  2KOI A;  2M1C A;  2EXA A;  3F1P B;  1KOU A;  4JGP A;  5HPF A;  1PYY A;  2KLI A;  5CHJ A;  3FKW A;  5HFO A;  2O9B A;  4F3L B;  4UA7 A;  3PBO A;  5FAT A;  1WA9 A;  4RQ9 A;  1OTA A;  2QKP A;  2EWW A;  1NRJ A;  3TE8 A;  2VA0 A;  4R4S A;  3VSK A;  5L09 A;  5CED A;  3IBJ A;  2Y2Q A;  2CMN A;  5GLC A;  4EBL A;  3QNC A;  5LBR A;  3T1R A;  4CLC B;  1K55 C;  5CEC A;  3UE3 A;  3KSG A;  3HLB A;  4NK3 A;  4L9G A;  4KG5 A;  4KZ8 A;  4IUH A;  2L4R A;  2WYX A;  3ZFZ A;  5D3O A;  3OOV A;  4R3A A;  3C2W A;  1QMF A;  2ZQ9 A;  3MZD A;  5FAP A;  2ZOH A;  4HHD A;  3LYX A;  1K54 C;  1G68 A;  4GS9 A;  3ZQ5 A;  2XRN A;  2PDR A;  4DRT A;  3O87 A;  3U2A A;  3A3D A;  2XDM A;  2ZQ7 A;  4LV1 A;  1K55 A;  4N9K A;  4KZA A;  3LCE A;  3ZG7 B;  2A2L A;  4CPK A;  2EX9 A;  4GDN A;  1T1B A;  3IBR A;  3CG5 A;  4RX2 A;  1UWP X;  1GA9 A;  3E98 A;  4UAA A;  3H82 A;  2P08 A;  2HP6 A;  1NLZ A;  3BJN A;  2XFT A;  3EEA A;  1K54 A;  3IF5 A;  3AGF A;  2EA9 A;  4KG2 A;  1MWR A;  4JXV A;  4QY6 A;  3C5A A;  3MSH A;  3OLO A;  3IS2 B;  5HDS A;  2GDN A;  3M6H A;  2PBY A;  3LI9 A;  1BUL A;  1JTD A;  5IU1 A;  3H9W A;  1BUE A;  4JXW A;  4QB8 A;  2VEA A;  5CHM A;  3QP4 A;  4WBG A;  4GS9 B;  5BOH A;  4Q0J A;  3UO9 A;  4Q8I A;  3W4P A;  3PBQ A;  4I3J A;  3IXG A;  2ZQC A;  4OP8 A;  4X56 A;  3HCY A;  4KEN B;  2HDR A;  2OSU A;  3QP1 A;  2G2U A;  3GEC A;  5HAP A;  3LO7 A;  2CC1 A;  1K6R A;  1GA0 A;  3IXB A;  4QPR A;  4PHT A;  1PIO A;  4GHI B;  4P85 A;  4BL3 A;  1LLB A;  3NEC A;  1OTE A;  1ODV A;  2HPB A;  4XXR A;  4BBT A;  3NBL A;  3BEB A;  4R3B A;  2J3W A;  3MS6 A;  2OAQ 1;  5F1G A;  2W3F A;  2OLV A;  4BL2 A;  5TBM B;  4O0P A;  3ZCZ A;  4P6Z M;  3BM6 A;  4M3K A;  2V8C A;  3RXW A;  1Q2P A;  4GD8 A;  1T1C A;  4IED A;  4S2J A;  5L2F A;  3SOI A;  1N9O A;  3ISG A;  4PKY G;  3G34 A;  3OC2 A;  5HPI A;  2XA7 M;  1H8Z A;  3MR0 A;  1Y54 A;  5EVI D;  5DF8 A;  2QPN A;  1KDS A;  4NXF A;  4PAU A;  1XJ2 A;  1AWI A;  4Q0H A;  3U4L P;  3ZGA B;  3NOT C;  2AVX A;  4GB7 A;  4KZ6 A;  2BLS A;  4IVK A;  2R78 A;  1K6S A;  4C75 A;  2Z2L B;  5DTK A;  1NXY A;  4HH2 A;  5HW3 A;  3PBS A;  5CHU A;  4BLM A;  5F6A A;  3MXS A;  1XP4 A;  3BWL A;  5L10 A;  3IXD A;  2J7V A;  5MC7 A;  3IH9 A;  4FCF A;  3FG8 A;  4KZ3 A;  5CRF A;  3T12 B;  1OTB A;  3F1N A;  2BAS A;  3T1Q B;  1S6R A;  1M6K A;  3DBA A;  1XGI A;  1NJ4 A;  1GSW A;  5CTM A;  4QWO A;  1ZG6 A;  3QP6 A;  4X1L A;  2W1R A;  5J7E A;  3W4O A;  2BG1 A;  2Z6D A;  4KZ7 A;  4R70 A;  2J9O A;  3IWI A;  1PZP A;  4WYY A;  3N8R A;  5A8B A;  1TS0 A;  2V0U A;  1ALQ A;  3OPP A;  1HLU P;  1PWG A;  2PD7 A;  4P0M A;  3PHY A;  2K31 A;  2JE5 A;  3A3E A;  5HD3 A;  4BBV A;  4EV4 A;  2Z2M B;  5G4Z A;  1P97 A;  1T18 A;  3NDG A;  1HTZ A;  4LV0 A;  4ME4 A;  1OPX A;  4UHU A;  1W63 Q;  3LR3 A;  1IYP A;  4DDS A;  5EOE A;  4NXB A;  4PPR A;  1MY8 A;  3F1N B;  3C30 A;  4JF6 A;  4PMA A;  3NHQ A;  4X55 A;  5F5Y A;  1S1Z A;  3CI6 A;  3UB5 P;  1IKG A;  5FDS A;  2ZMV A;  3S7N A;  3H7W B;  4IBX A;  2D02 A;  4C6Y A;  1Z09 A;  2W0N A;  4X25 A;  4FSF A;  1I2S A;  1U60 A;  5CEB A;  2V20 A;  3OCN A;  2O99 A;  4YFM A;  3T4J A;  5F1F A;  2OV5 A;  5FA7 A;  4B4X A;  3HL9 A;  3HLD A;  5FQQ A;  2A24 A;  3E2K A;  1Q2Q A;  4D60 A;  2RL3 A;  5FDH A;  5A93 A;  3M6B A;  5G4Y A;  2P04 A;  3WRT A;  3BYD A;  2OLU A;  2B95 A;  4HBT A;  3VP4 A;  1KE0 A;  1XFQ A;  1T19 A;  4E6W A;  3GSG A;  3UB6 A;  4JLF A;  2JBF A;  4JXG A;  1LL8 A;  2PBD P;  3UNW A;  1NWZ A;  1OJG A;  3Q7V A;  5I5L A;  3S22 A;  2EX8 A;  2JKT I;  3EGD C;  3NIA A;  4UQI S;  4ZDX A;  2HDS A;  3AGE A;  3VSL A;  4YOF A;  5JYP A;  3RJU A;  3A0V A;  3GDI A;  2JKF A;  5CXW A;  5HWT A;  3NJA A;  1EW0 A;  4EET B;  4ZAM A;  2EFX A;  5FEG A;  4ARZ A;  4WEL A;  3BY9 A;  1G6A A;  2GZA A;  2WKI A;  4G3W A;  3QHY A;  4B88 A;  1XGJ A;  1K56 A;  2A24 B;  1PFL A;  4IJG A;  4GCZ A;  3FPV A;  3D4F A;  4HJ4 A;  5HDC A;  4O01 A;  1ZG4 A;  4M4X A;  4XT2 A;  1CEF A;  2PRF A;  4DXB A;  1NY0 A;  5DTS A;  3ZG9 B;  4N1H A;  1W7F A;  4P6Z S;  3WS4 A;  1KGF A;  1W5D A;  4E3K A;  4BBU A;  4OOM A;  3W2Z A;  2PU2 A;  3PAE A;  2ZD8 A;  3UN7 A;  3TW8 A;  4CLC C;  1SZV A;  1LSW A;  3UPP A;  4EXO A;  3F1P A;  2ZM2 A;  3IWO A;  5FL3 A;  2A49 A;  3UE0 A;  3VOZ A;  2XH9 A;  1YPR A;  2XSS A;  4BD0 A;  2P74 A;  2HJ9 C;  4EUV A;  1S66 L;  1H0M A;  1OT6 A;  5EM0 A;  1BSG A;  5DF9 A;  2WAD A;  3FC7 A;  2HDU A;  4NKP A;  3FYZ A;  1L0D A;  2VJW A;  2K2N A;  2NUT C;  1CQA A;  1RGY A;  1D7E A;  4K91 A;  3LFV A;  3JVU A;  4CLC A;  3R7W A;  3MZF A;  1HVB A;  4NEE D;  1OJ5 A;  2W1T B;  2QHK A;  3ZG5 A;  3PBR A;  4EBN A;  3HJK A;  3MMH A;  1GHM A;  5L07 A;  4Z9Q A;  2EX2 A;  1FCM A;  4LCL A;  1SDE A;  5CER A;  3S7P A;  4Y17 A;  4ZBE A;  1WYC A;  3NOP C;  3C4P A;  2Z6C A;  3MKE A;  2P9V B;  2QJ7 A;  2WKP A;  1FSW A;  3Q1F A;  5EVL A;  1O7E A;  5AQB A;  4P6B A;  1ERM A;  4YNR A;  2XLN A;  1BLS A;  4UEY A;  4Y7P A;  2XD5 A;  5FAQ A;  2C5W B;  1NZU A;  1YLW A;  3JVV A;  2EXB A;  3F1O A;  3ZNT A;  4HQA A;  2ZL1 B;  3OPH A;  3FPW A;  1Z6F A;  3ITA A;  3G2Y A;  3MQO A;  4ZJ2 A;  5GHY A;  4GW9 A;  1IEM A;  1GHP A;  1L2S A;  4OPR A;  2Q9N A;  3LR4 A;  1CEG A;  1K57 A;  3GRJ A;  4UA6 A;  1CK3 A;  1MWS A;  3BY8 A;  4KZB A;  3R7W B;  2JC7 A;  2XEP A;  3IS2 A;  2FFY A;  2ZJ9 A;  2Y2I A;  3IWQ A;  2OAP 1;  4QY5 A;  1C3B A;  1TF1 A;  4KUO A;  2YKH A;  4S2M A;  4X53 A;  4IVI A;  1HD8 A;  2GJ3 A;  3IHA A;  4O8G A;  5KMW A;  3UDX A;  3UB9 A;  1XA7 A;  5FI2 A;  3NDE A;  4S2L A;  5GLB A;  2O0Y A;  3LIA A;  4CJN A;  2WKE A;  3CAX A;  3F1O B;  4GHI A;  4JKT A;  3P09 A;  4FOF A;  5JYO A;  4Y5F A;  2B18 A;  3ZHH A;  4KUK A;  1XA1 A;  4EEP A;  4WZ4 A;  4MNR A;  4NET A;  3S4X A;  2JKG A;  2O9C A;  4NXE A;  2HZ5 A;  5HAQ A;  1VQQ A;  4RVA A;  5TBM A;  5GLA A;  1H8Y A;  1BLP A;  4WMC A;  1YSP A;  2H5S A;  1BLH A;  5EVE A;  4S2O A;  4FH4 A;  5FAO A;  3V50 A;  4KQR A;  5AVE A;  4Y15 A;  4GKU A;  1S4S A;  2A3U A;  2R9W A;  3R4K A;  3UB8 A;  2KX6 A;  4LPZ A;  2ZC7 A;  2VGL S;  3CJM A;  1GHI A;  4PKY A;  1S67 L;  4EWF A;  3LIE A;  4UQI M;  3KSF A;  5GLD A;  1FQG A;  3NC8 A;  5CTN A;  3EQU A;  1LHY A;  3TRC A;  2J8Y A;  3M2K A;  3NCK A;  5AJG A;  3KSI A;  5HSQ A;  1JWZ A;  1P9W A;  4E04 A;  1E3U A;  3IQA A;  2M7V A;  1NYY A;  1FCN A;  3RTY A;  1OTI A;  4LV3 A;  1PW1 A;  2PD8 A;  3CMZ A;  2Y2J A;  5DF7 A;  2JKR M;  2GX5 A;  2QJ5 A;  4QD4 A;  3G32 A;  1XFN A;  1FOF A;  4ZJ1 A;  1LSX A;  4FTX A;  3UE6 A;  3CZD A;  1MPL A;  4HP4 A;  4BQM A;  1LI9 A;  1XKZ A;  3UY6 A;  3T1X A;  4JGR A;  4EQ1 A;  2VLG A;  4PM5 A;  2EWV A;  4E3O A;  3G6O A;  1SCW A;  2XFS A;  4JBF A;  3T4S A;  3C38 A;  2WGI A;  1N9L A;  4GJ4 A;  2VGK A;  5EFW A;  4HBU A;  3ULF A;  2J3T D;  3A3I A;  1SDN A;  5HAI A;  1ACF A;  3L9K A;  1PI4 A;  4E3I A;  2LB9 A;  2ZQ8 A;  3DWK A;  3W4Q A;  1IYQ A;  3S7O A;  2V8F A;  2WUQ A;  2V2F F;  3T4L A;  3E4O A;  3GR2 A;  1JTG A;  2HP5 A;  2DMW A;  3B42 A;  1PRQ A;  4R0Q A;  4BWI A;  4QU3 A;  4L9E A;  5FQJ A;  2DCF A;  3VE4 A;  4X6T A;  3BW6 A;  1DJC A;  4Y0O A;  2K7S A;  1YSQ A;  1CJF A;  1FR1 A;  4GNU A;  3T4K A;  3UB7 A;  4YWZ A;  3D72 A;  4MMN A;  2FZ0 A;  1H3Q A;  4MBH A;  3H7W A;  4IHQ A;  4S2K A;  4DDY A;  1PI5 A;  3A0R A;  4JXS A;  4RA7 A;  4DJ2 A;  4WL9 A;  4E6X A;  4R1G A;  2V1B A;  3SS3 A;  3IT9 A;  3A0S A;  4RYE A;  3ZVW A;  2WZZ A;  4LRX C;  3GTC A;  3IF6 C;  3WS5 A;  3PAG A;  1PWC A;  1N9N A;  5M19 A;  2ZM0 A;  2EX6 A;  3BFC A;  3IX3 A;  2J9P A;  1D06 A;  4OLD A;  3ZNY A;  4LV2 A;  3LIB A;  4EBP A;  5FEF A;  3MXR A;  1S0W A;  1SHV A;  1VM1 A;  5EUA A;  1Y4O A;  2Y2L A;  3ITB A;  3CUE C;  3KO6 A;  4G3K A;  1ES4 A;  3LGO A;  2IWB A;  2PR5 A;  3IHB A;  1WE4 A;  3LIF A;  3BFD A;  4NXG A;  2UWX A;  2HDQ A;  3K3C A;  5AVF A;  1LI0 A;  3MFX A;  4K0W A;  4Y0T A;  1ES3 A;  4HNB A;  2ZQD A;  3SW1 A;  5AQ9 A;  4EU0 A;  3IF6 A;  3DAV A;  5HD5 A;  1OT9 A;  4PM9 A;  3NOU C;  1IFQ A;  4I3A A;  2ZLY A;  1XJ4 A;  2W3G A;  1FCO A;  3NY4 A;  2VV7 A;  1MBL A;  2XGN A;  4P87 A;  5E2G A;  1W79 A;  3DTE A;  1TD5 A;  4HY8 A;  4JF4 A;  1VHM A;  1K56 D;  3CUE A;  1G28 A;  2XR0 A;  2Y91 A;  3B3X A;  1MZU A;  1FR6 A;  3G4P A;  1JWV A;  3VMA A;  2WKQ A;  4X1M A;  5FQM A;  4HIA A;  3BFG A;  5AQA A;  4LLO B;  4X68 A;  1FIL A;  4OPZ A;  3VP1 A;  4QHC A;  3JYI A;  5E43 A;  2D01 A;  3CHW P;  1RCJ A;  5CGW A;  5EVI B;  5FQK A;  3LID A;  3G2Z A;  4DMZ A;  3N8L A;  3OBF A;  2ZOI A;  3CPT B;  1PWD A;  3EQV A;  2G2W A;  1ES2 A;  2VGL M;  1XJ3 A;  1QME A;  3AGD A;  1YT4 A;  2WAE A;  4D2O A;  3IF6 B;  3WRZ A;  4KQD A;  3M2J A;  1NLY A;  3LY4 A;  5HX9 A;  2E8J A;  2E8I A;  3BFF A;  4E3L A;  2XQZ A;  3UE1 A;  4OQG A;  5DFY A;  2RCX A;  2V1A A;  2WKH A;  2Y2O A;  3E4P A;  4IUK A;  1K4E A;  4B93 A;  4U0X A;  2LB5 A;  4HH3 A;  1SKO A;  4CLC D;  3B47 A;  1G6O A;  3FZC A;  5HWV A;  2ZC3 B;  1GSV A;  5A92 A;  1F98 A;  1S1Y A;  5FI7 A;  4K0X A;  3G30 A;  3Q81 A;  1F5M A;  4HES A;  3FWL A;  4LEN A;  2W1T A;  5J8X A;  1JWP A;  1KE3 A;  4DE2 A;  4U3T A;  3Q82 A;  3N6I A;  4MLL A;  4KG6 A;  4OKP A;  4XUZ A;  3D9Y A;  3MQ0 A;  1NYM A;  4ZTK A;  2Y2G A;  5CGS A;  2MJ6 A;  2XRO A;  3DTI A;  1K0K A;  1TS6 A;  4MN5 A;  2P9V A;  3FKV A;  4C3Q A;  5J3W A;  2V9A A;  3PBT A;  4KZ4 A;  5U47 A;  2Y55 A;  1CF0 A;  2Y2N A;  4R38 A;  2B5R A;  5I94 A;  1TS7 A;  1P9R A;  4E3M A;  4EQI A;  2ZL1 A;  3NUL A;  2JHE A;  2QWS A;  5G18 A;  3WS1 A;  5A91 A;  1DP8 A;  1SKO B; 
#chains in the Genus database with same CATH homology
 2R78 A;  1OTD A;  4FOF A;  4AFI A;  4Y5F A;  2B18 A;  4HH2 A;  4KUK A;  3VOL A;  4EES A;  3EOI A;  4G3V A;  2HGV A;  3PBS A;  4EEP A;  5F6A A;  1H8M A;  4NXE A;  2O9C A;  2ZBB A;  2PYP A;  3BWL A;  1GSX A;  4WN5 A;  3V67 A;  5TBM A;  5MC7 A;  1YSP A;  3FG8 A;  3K2N A;  5AVE A;  3UME A;  1ZHH B;  1OTB A;  3F1N A;  1S4S A;  2BAS A;  3R4K A;  3DBA A;  1F9I A;  3LR0 A;  3UB8 A;  2H28 A;  2HJE A;  2KX6 A;  2GNX A;  4LPZ A;  1JNU A;  1STZ A;  2VGL S;  4PKY A;  1GSW A;  5KSH A;  1S67 L;  4KQO A;  2M7U A;  3EWK A;  3LIE A;  4UQI M;  3KSF A;  2W1R A;  3B33 A;  5J7E A;  4JGQ A;  3EQU A;  3VV4 A;  2Z6D A;  3TRC A;  1DP6 A;  3KSH A;  5AJG A;  3KSI A;  2PR6 A;  3T4O A;  5HSQ A;  4R70 A;  3T4T A;  1P9W A;  5A8B A;  1TS0 A;  4EW7 A;  2V0U A;  4E04 A;  4ETX A;  2M7V A;  3E0Y A;  2PD7 A;  2VV8 A;  3RTY A;  1V9Z A;  2O9A A;  4JGO A;  1OTI A;  2W3H A;  2PD8 A;  4Q0I A;  3PHY A;  1IOU A;  3KYQ A;  2JKR M;  2GX5 A;  2K31 A;  2VV6 A;  2ZMF A;  2QJ5 A;  5HD3 A;  1XFN A;  4BBV A;  1LT0 A;  1V9Y A;  4HJ6 A;  1LSX A;  3BQA A;  5L8M A;  1ZTU A;  2Y79 A;  5F69 A;  4B9O A;  4ETZ A;  3UE6 A;  5G4Z A;  5DKK A;  1P97 A;  1T18 A;  2FH5 A;  1X0O A;  4HP4 A;  4ME4 A;  1OPX A;  3LI8 A;  1W63 Q;  1YAX A;  3LR3 A;  4JGR A;  4EQ1 A;  4NXB A;  4MCW A;  2VLG A;  2EWV A;  3F1N B;  3C30 A;  3G6O A;  4L0L A;  4Z1W A;  4OOL A;  3T4S A;  3NHQ A;  2J80 A;  3K3D A;  5F5Y A;  1S1Z A;  3C38 A;  2JKT M;  5HZH A;  1N9L A;  1UGU A;  3CI6 A;  4GJ4 A;  4EER A;  4ZRR A;  2ZMV A;  3S7N A;  5EFW A;  3H7W B;  2D02 A;  3ULF A;  2J3T D;  2W0N A;  4FSF A;  3O5Y A;  4I5S A;  4H6J B;  3PBN A;  2PT7 A;  2XA7 S;  1TS8 A;  2P7J A;  2LB9 A;  3OCN A;  4DJ3 A;  1T1A A;  2KDK A;  1MC0 A;  3BQ8 A;  2O99 A;  3S7O A;  4F3L A;  3T4J A;  2WKR A;  1UWN X;  4GLQ A;  3T4L A;  3LUQ A;  3E4O A;  3MXQ A;  5IT5 A;  3P01 A;  4ARZ B;  3KYZ A;  2DMW A;  3B42 A;  4BWI A;  4L9E A;  2A24 A;  5DFX A;  3VE4 A;  2JKR I;  4MDZ A;  1S4R A;  2JN7 A;  1DP9 A;  5G4Y A;  2P04 A;  3BW6 A;  4K08 A;  2VZW A;  1YKD A;  2K7S A;  1YSQ A;  4WEK A;  3T4K A;  4XT2 B;  3PR6 A;  1XFQ A;  1T19 A;  2QYB A;  3UB7 A;  3EGX C;  4YWZ A;  3D72 A;  1LSV A;  4BMW A;  4HI4 A;  4Y3I A;  1DRM A;  4MMN A;  4CLC E;  2FZ0 A;  1H3Q A;  5HDD A;  3UB6 A;  2OWJ A;  3H7W A;  4IHQ A;  1LL8 A;  1NWZ A;  1OJG A;  2PHY A;  5I5L A;  3A0R A;  5DJU A;  2JKT I;  3EGD C;  4H6J A;  3MJQ A;  4DJ2 A;  4UQI S;  4I3I A;  4WL9 A;  2OOL A;  2V1B A;  3ICY A;  2HF6 A;  5DKL A;  4YOF A;  3A0S A;  2IA2 A;  2KOI A;  3GDI A;  3A0V A;  2M1C A;  5HWT A;  3F1P B;  1KOU A;  3NJA A;  4LRX C;  1EW0 A;  4JGP A;  4EET B;  5HPF A;  5CX7 A;  2KLI A;  4ARZ A;  2O9B A;  4F3L B;  2I9V A;  3S7Q A;  1N9N A;  3PBO A;  2INW A;  4WEL A;  1WA9 A;  3BY9 A;  1OTA A;  2GZA A;  4RQ9 A;  4G3W A;  1D06 A;  2QKP A;  2EWW A;  2V0W A;  3LIB A;  3D3O A;  1NRJ A;  3TE8 A;  4WEJ A;  2VA0 A;  2A24 B;  4EEU A;  4IJG A;  4GCZ A;  3FPV A;  4HJ4 A;  5HDC A;  4O01 A;  3CUE C;  3LIC A;  3KO6 A;  4G3K A;  3IBJ A;  2VKS A;  4M4X A;  4XT2 A;  2CMN A;  2PR5 A;  4MN7 A;  4LRY C;  5LBR A;  4CQH A;  3H82 B;  3LIF A;  3VE3 A;  4NXG A;  4CLC B;  4P6Z S;  3K3C A;  5AVF A;  3UE3 A;  3MFX A;  4HOI A;  4BBU A;  5J4E A;  4HNB A;  4OOM A;  3KSG A;  3SW1 A;  5C5K A;  4EU0 A;  3W2Z A;  5HD5 A;  4L9G A;  1OT9 A;  3NOU C;  4IUH A;  2L4R A;  1IFQ A;  3TW8 A;  3OOV A;  4I3A A;  1XJ4 A;  2W3G A;  4R3A A;  2VV7 A;  3C2W A;  4CLC C;  1LSW A;  2ZOH A;  3ZYT A;  4HHD A;  3LYX A;  4EXO A;  1TD5 A;  3F1P A;  4GS9 A;  4HY8 A;  5FL3 A;  3ZQ5 A;  2XRN A;  1VHM A;  3CUE A;  2PDR A;  1G28 A;  4II7 A;  1MZU A;  4I39 A;  2XSS A;  2HJ9 C;  3U2A A;  2WKQ A;  4EUV A;  1S66 L;  4HIA A;  1OT6 A;  4LLO B;  4BJP A;  5DF9 A;  1P0Z A;  2VX8 A;  3FC7 A;  2A2L A;  4NKP A;  4WLA A;  2VJW A;  1T1B A;  3IBR A;  2K2N A;  2NUT C;  5HWW A;  1UWP X;  2D01 A;  3C8C A;  3E98 A;  2Y8H A;  1D7E A;  3H82 A;  3KX0 X;  2P08 A;  3LFV A;  1NLZ A;  3JVU A;  4CLC A;  3OCL A;  3T50 A;  3R7W A;  3LR5 A;  3BJN A;  3LID A;  3EEA A;  4NEE D;  5DJT A;  1OJ5 A;  2W1T B;  4DMZ A;  2QHK A;  2EA9 A;  4LRZ E;  5IS1 A;  4HP9 A;  5F68 A;  1MKM A;  3OBF A;  2W3E A;  2ZOI A;  3PBR A;  3EQV A;  3HJK A;  3MMH A;  3OLO A;  3TJZ C;  2VGL M;  3S7P A;  3IS2 B;  5HDS A;  1XJ3 A;  3MQQ A;  3RH8 B;  2J3T C;  3NOP C;  2NUP C;  2Z6C A;  4KQD A;  3LI9 A;  1NLY A;  2W3D A;  5IU1 A;  3H9W A;  3E4Q A;  4WUJ A;  2VEA A;  2QJ7 A;  2WKP A;  5HL6 A;  4WF0 A;  4GS9 B;  5DFY A;  4HJ3 A;  2V1A A;  4Q0J A;  1BYW A;  4YNR A;  4L9F A;  3CLO A;  3PBQ A;  4I3J A;  2B02 A;  3MF0 A;  4UEY A;  3CWF A;  3E4P A;  3UMD A;  4IUK A;  3HJI A;  2HV1 A;  2OWH A;  3PYP A;  3RFB A;  4B93 A;  3HCY A;  4MN6 A;  2LB5 A;  4HH3 A;  4CLC D;  3GEC A;  3JVV A;  5KIZ A;  3F1O A;  1W63 M;  4HQA A;  3B47 A;  1G6O A;  3FPW A;  4DN0 A;  2W27 A;  5K5B A;  5HWV A;  1GSV A;  4QPR A;  3MQO A;  1F98 A;  4PHT A;  1S1Y A;  4GHI B;  2PYR A;  4GW9 A;  1OTE A;  1ODV A;  1XJ6 A;  1F5M A;  3LR4 A;  4BBT A;  2W1T A;  2J3W A;  2OAQ 1;  2L0W A;  3BY8 A;  4I38 A;  1VB6 A;  2W3F A;  3R7W B;  1Y28 A;  5TBM B;  4O0P A;  3IS2 A;  3MQ0 A;  4P6Z M;  2MJ6 A;  2XRO A;  1TS6 A;  2OAP 1;  4MN5 A;  2L1M A;  1TF1 A;  2YKF A;  5J3W A;  4R6L A;  2V9A A;  4KUO A;  1T1C A;  2YKH A;  3PBT A;  5TJJ A;  3CIT A;  3P7N A;  1N9O A;  4PKY G;  2GJ3 A;  4R38 A;  4O8G A;  3OC2 A;  1TS7 A;  1P9R A;  5HPI A;  3UB9 A;  4Y2F A;  2XA7 M;  3MR0 A;  2G7U A;  2O0Y A;  4NXF A;  3LIA A;  2JHE A;  2QWS A;  4PAU A;  3EEH A;  1XJ2 A;  1DP8 A;  4Q0H A;  3T4Q A;  3NOT C;  3CAX A;  3F1O B;  4GHI A;  3PXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...