1N9OA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. composite data set.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative blue light receptor
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9oA00
3A0VA 4GCZA 1N9OA 2QJ7A 5F68A 5G4ZA 2VV8A 2ZOIA 4HOIA 1V9YA 1MZUA 4HQAA 4MN6A 1TS7A 2HV1A 3E4PA 1XJ6A 4H6JA 4JGPA 2V1BA 4WL9A 1S67L 5HDCA 4HI4A 2VLGA 4HJ4A 2PYPA 3CLOA 3H7WB 2JHEA 1F9IA 1N9NA 2OWHA 4JGRA 5DKKA 3VE3A 2V9AA 2I9VA 4I3IA 1T1AA 2PR5A 4I39A 3F1NB 3FC7A 3PHYA 4HJ6A 5DJTA 2V0UA 2PD7A 4R3AA 3LIBA 3LI9A 3CAXA 2WKPA 5DKLA 2J80A 4NXBA 4EXOA 3BY8A 4LRXC 1T1CA 3KX0X 3B33A 2GJ3A 1LL8A 1T18A 2KX6A 1BYWA 4WLAA 5I5LA 3MQOA 4HH2A 2R78A 4KQDA 1UWPX 3H82B 2L1MA 1OJ5A 4HY8A 4LRZE 2ZOHA 1D06A 3LICA 3F1NA 4WF0A 4NXEA 1P97A 4GHIB 4EEPA 2H28A 1P0ZA 3LI8A 4LLOB 5EFWA 5F6AA 2Z6DA 2B02A 1S1ZA 3MJQA 1TS0A 4HHDA 4YWZA 3D72A 4GS9B 3NHQA 2A24B 4EQ1A 4NXGA 3UB9A 2W0NA 4DJ2A 3A0SA 3OLOA 4EW7A 1S66L 5AVFA 3IBRA 3ZQ5A 4HNBA 1KOUA 5F5YA 1OTAA 4R38A 3F1OB 2L0WA 3HJIA 4GHIA 3UB8A 4XT2B 5HWVA 5HSQA 1DP6A 1XFQA 1S1YA 1T1BA 2V1AA 4RQ9A 1F98A 1OTIA 3K3CA 3UMDA 1EW0A 2W27A 4EESA 3G6OA 2VV7A 3RH8B 3T50A 4BBTA 5J4EA 1GSXA 3MFXA 5HWTA 3VE4A 1DP9A 4HIAA 3E4QA 3F1PB 4F3LB 1GSVA 5AVEA 3NJAA 4KUOA 1GSWA 2QWSA 4L9GA 3F1OA 2L4RA 5G4YA 4M4XA 4LPZA 4XT2A 3NOUC 1TS8A 5J7EA 3E4OA 3A0RA 1UGUA 5DJUA 2PYRA 1XJ3A 3LIFA 4GW9A 4WUJA 1LSXA 4K08A 2M1CA 3H7WA 4HP9A 5HWWA 1UWNX 4EEUA 3NOTC 4I38A 4R70A 4BBUA 3F1PA 4F3LA 4HJ3A 4I5SA 4BBVA 1T19A 3CWFA 3LIAA 3RTYA 2YKHA 2BASA 4I3AA 1TS6A 4E04A 3LIDA 4PKYG 3LUQA 1LSVA 1WA9A 4MN5A 2Z6CA 3C8CA 2D01A 2P7JA 3H82A 5HD3A 4KUKA 3BWLA 2EA9A 2V0WA 4NXFA 1N9LA 3K3DA 2JN7A 3IS2B 3GECA 1XJ2A 5IU1A 1LSWA 1S4SA 5HD5A 5TBMB 1XJ4A 3MR0A 2YKFA 4L9FA 4HH3A 3LYXA 4GS9A 4LRYC 2QKPA 2A24A 3GDIA 4EETB 1XFNA 3BY9A 2K7SA 3FG8A 4PKYA 5KIZA 3NOPC 3PYPA 2PR6A 1X0OA 3SW1A 1OT6A 4EERA 3IS2A 1S4RA 3EEHA 2WKRA 5HDDA 1ODVA 1DRMA 3ULFA 1OJGA 5A8BA 2VV6A 2OWJA 1Y28A 1OT9A 5TBMA 2VEAA 2PHYA 3C2WA 1OTEA 2WKQA 5IS1A 1JNUA 4WN5A 4HP4A 3UB7A 1OTBA 1D7EA 4L9EA 1G28A 3H9WA 5J3WA 5F69A 2PD8A 4JGQA 3ICYA 2KDKA 2CMNA 3P7NA 4JGOA 1VB6A 2QHKA 4DJ3A 3UB6A 4R6LA 3MQQA 2ZBBA 3UMEA 1DP8A 3UE6A 1LT0A 5HZHA 5HDSA 3MXQA 2PDRA 3LIEA 3VOLA 1NWZA 4I3JA 3EWKA 1OTDA 2QJ5A 4H6JB 4B9OA 2D02A 2INWA 2OOLA 1V9ZA 3HJKA
chains in the Genus database with same CATH superfamily
3QP1A 3DBAA 2ZQ8A 3A0VA 4UQIM 1Q2PA 1N9OA 4OPRA 3T1QB 2V20A 3OPPA 4X55A 5GLDA 5G4ZA 3W4OA 4M3KA 2ZOIA 1W5DA 4HOIA 1KVMA 3O87A 4OONA 5IHVA 1MWTA 4Y13A 2ACGA 4S2JA 1ACFA 1PWCA 1MZUA 1TS7A 2HV1A 2P04A 4H6JA 4LFUA 5CGXA 4O0PA 3R7WB 5HDCA 4EBLA 4HJ4A 2E8JA 3A3IA 3FV7A 3CLOA 3WRTA 4KG6A 5E2EA 2J3TD 1TDGA 4JGRA 5FAOA 5CGWA 1J9MA 1FSYA 5F83A 1T1AA 3OBFA 4NK3A 4I39A 1NJ4A 2X02A 3PXPA 2PD7A 2Y2OA 1KGEA 4S2MA 4EXOA 5DKLA 2DMWA 1FOFA 2Q0OA 5M18A 5M19A 1PNEA 3BY8A 1ESUA 3NDGA 4LRXC 3LEQA 2ZQ7A 3BYDA 4HH2A 2R78A 1SHVA 4OP8A 3S22A 3G30A 2WKHA 3LR5A 2PU4A 4PM9A 1PFLA 1EI5A 4Y15A 4JLFA 5DF7A 1TEMA 4X53A 3LI8A 5EFWA 4JF6A 5L10A 4OQIA 4PPRA 2ZM2A 2Y2PA 5E2GA 3UPPA 3A3DA 1PWGA 1CI8A 4OPYA 4PM7A 3ZHHA 1H0MA 1CEFA 1PW1A 1S66L 1SKOB 3QP2A 1E3UD 4CJNA 3ZQ5A 4HNBA 1KOUA 1CF0A 4RVAA 1YMSA 4R38A 1PI4A 5DTTA 1YQSA 3D4FA 3W4QA 3Q07A 2DCFA 3IX4A 4PAUA 4KG5A 4XT2B 5FQKA 4DE2A 3M6HA 1S1YA 1NLZA 4CLCB 2V1AA 4RQ9A 4IJGA 5F82A 5U47A 3HUOA 2WZXA 4UAAA 2O9AA 2GZAA 5KMWA 3QP5A 3DTMA 4ID4A 4B88A 1MC0A 1SKOA 3SS4A 5HX9A 2XA7S 3NJAA 4KENB 4KUOA 2OAQ1 5DTKA 4L9GA 3ZCZA 5GLBA 3T12B 4X25A 4XT2A 4RX2A 4LPZA 3IWIA 3VFHA 2EX6A 4CLCA 2B5RA 3M2JA 3T4JA 4WZ5A 5FI7A 4WUJA 4ZTKA 1Z09A 3U2AA 3DWZA 1YSQA 4K08A 3IT9A 5AQAA 4RA7A 2EX2A 5FL3A 1LHYA 2HZ5A 4AFIA 4HP9A 3CZDA 3NOTC 3KSGA 3RXWA 4BBUA 5FA7A 1Q2QA 3CWFA 4R3JA 3G34A 2VKSA 4I3AA 3Q7VB 1PW8A 4NKPA 2WGWA 3TRCA 5EOEA 4BJPA 1ESIA 2XA7M 3FYZA 5HFOA 3LUQA 3ZG9B 3IBJA 1GCEA 1WA9A 1E4DA 1YAXA 2Y2QA 4WZ4A 5GLAA 3VP0A 2AVXA 2E8IA 3BFEA 1IKGA 5HD3A 1XGIA 4KUKA 3LY3A 3T4QA 3S1YA 4OP5A 2WUQA 2OSUA 4WEKA 5A92A 2LB9A 4PHTA 2HJEA 4P0MA 3C4PA 1K57A 1XP4A 5IU1A 4IEDA 1S4SA 5HD5A 5CHUA 2Y2GA 5HPIA 4P85A 4OOMA 2JKRM 5HAIA 4FD8A 4GS9A 3N4IA 4C75A 2V1ZA 2XH9A 3IF6C 4MCWA 2WYXA 4KZBA 2HJ9C 3TE8A 2XF3A 4YFMA 3RJUA 3T4LA 1M40A 1LL9A 1X0OA 1XPBA 4U0XA 1ODVA 3ULFA 2NUPC 2J7VA 5HL6A 2H10A 1TD5A 1OT9A 1CI9A 3C2WA 5KSHA 3BM6A 1MKIA 5IS1A 1JNUA 3LO7A 3ZVWA 5EE8A 3MKFA 4ZDXA 4N1HA 4Z1WA 1L0DA 3H9WA 5J3WA 4LV3A 2GDNA 2Z2MB 3PAGA 2PD8A 3B42A 1S6RA 4JGQA 3W2ZA 3QP4A 4P87A 3N8LA 3CG5A 3A3EA 3NDEA 1VB6A 5G18A 5L09A 3UB6A 5HW3A 4R6LA 4S2LA 1CEGA 1K54C 4DE3A 3PR6A 1CJFA 2G2UA 3N7WA 5HZHA 4BL3A 2PDRA 4GOGA 1K6RA 2EWVA 2JKTI 3K2NA 3BW6A 2R9WA 3ZNTA 1IELA 3E2KA 4XUXA 1H3QA 1RGZA 1OTDA 2M7UA 3CUEC 1VEUB 2ZC5B 3LR4A 4G3WA 2D02A 4X6TA 1VM1A 1L0FA 2INWA 2HDUA 3HREA 4HESA 2OOLA 2BTFP 1YLJA 5EVIC 3T4OA 3OZHA 2O9BA 1JTDA 1W8YA 1E3UA 3A3JA 4R0QA 4GCZA 5EOOA 4ARZB 1IFQA 4FUWA 5F68A 3NULA 3TOIA 1IOUA 1V9YA 3BFDA 1LI9A 1DJBA 1ZKJA 4FH2A 1G6OA 5TGFA 4YOFA 2UV0E 5FQIA 1P9WA 1S67L 2ZQ9A 4BQMA 2X01A 2PYPA 3UNWA 4GDNA 4X69A 3O86A 3H7WB 3EOIA 4E3JA 2WK0A 4Y3IA 1N9NA 1ES5A 3ZG7B 1L3LA 3OPHA 2PR5A 3F1NB 3MZDA 4HJ6A 2JE5A 4DF6A 4R3AA 1M6KA 3LIBA 3LI9A 3MXSA 5FEFA 4C3QA 3WS4A 1IYOA 5CEDA 2HDRA 3KSFA 2JKRI 4FCFA 5FDHA 4GB7A 3KO6A 2GJ3A 3FZCA 4BL2A 4O01A 4QJGA 4G3KA 5L07A 3MQOA 2V8CA 2Y2JA 4OPQA 4IUHA 1C3BA 1GA0A 1JWPA 3D3OA 3HCYA 4HY8A 4LRZE 3F1NA 4WF0A 4Y0UA 4NG2A 4EV4A 4NXEA 1P97A 1ES2A 1CQAA 3EGXC 2QYBA 4KZ7A 1P0ZA 3PBOA 4QPRA 1W63M 1GA9A 1ALQA 1J3WA 4OOLA 2B02A 3MJQA 1TS0A 1F2KA 4HHDA 4N9LA 4ZJ2A 2A24B 3EEAA 4X68A 3UDFA 4WYYA 1I2SA 3BLSA 2K2NA 4N92A 1Y4OA 4DJ2A 3A0SA 3BRMA 5GHYA 4B4XA 4JXVA 5EVEA 1SCWA 5AVFA 2ZMVA 4ME4A 1XGJA 2Y59A 4II7A 4EU0A 5F5YA 3HBRA 3Q7ZA 1MBLA 1KGFA 4UEYA 1RGYA 2PBDP 4QD4A 4WM9A 4O7DA 1XFQA 2EFUA 1KDWA 5A90A 1L2SA 1F98A 1OTIA 1S0WA 2WKEA 3UMDA 1BTLA 1EW0A 2VGKA 2W27A 2XD1A 4EESA 3UDIA 2J9PA 3G6OA 4QY5A 4UA9A 1YMXA 1GSXA 5M1AA 2XFSA 3KYQA 1JWZA 5TJJA 2O0YA 4HIAA 1PZOA 1KDSA 2EXAA 3A3FA 3RFBA 2G2WA 2QWSA 5CHMA 2ZC6B 3BEBA 3S7PA 4UA6A 2BLSA 5CX7A 2XD5A 4S2NA 3VP1A 3NOUC 2K31A 1K55C 3N8RA 4G3VA 2QPNA 2VX8A 3A0RA 5DJUA 3T4TA 3GSGA 4B4ZA 3R7WA 2CC1A 2ZM8A 4OLGA 2XDMA 1NLYA 1UWNX 4FOFA 4IHQA 5L2FA 2HGVA 5CTMA 3NY4A 1WYBA 1IYPA 1PRQA 1T19A 4CLCE 2YKHA 2H5SA 3HLDA 3KYZA 1TS6A 2JC7A 4N9KA 3N8SA 1SKFA 2JBFA 2VK3A 5IT5A 4MBFA 1LLBA 1BZAA 3LIDA 3T1RA 4Y17A 4MDZA 4Y5FA 1O07A 1FR6A 3NECA 3Q1FA 2J9OA 3FPVA 3SS3A 4MN5A 5EM0A 3AGFA 2IWCA 4R4SA 5DF8A 3OOVA 2D01A 3G4PA 1GHIA 2R9XA 3BWLA 2EA9A 1HZOA 2O99A 2IWDA 1N9LA 4DE1A 3IS2B 4KZ3A 3MQ0A 3V3RA 4K91A 5TBMB 2XSSA 3ZVTA 5EM1A 4Q0JA 1EROA 4MN7A 4L9FA 5EPHA 2Y55A 4LRYC 3GDIA 4EETB 5EUAA 1XFNA 4H8RA 1BT5A 2XR0A 2OLUA 2ZM0A 4WEJA 1K25A 2WAEA 3FG8A 3VP2A 1NYYA 3NOPC 3IF6B 2ZJ9A 4JF4A 5FEGA 2Y91A 4L0LA 3SW1A 4P6ZS 3IS2A 3KSHA 1S4RA 2WKRA 5AQ7A 5HDDA 4LGWA 1DRMA 2Y8HA 5K5BA 5HAPA 3NI9A 3QHYA 1YKDA 1KE4A 5TBMA 4Q8IA 4LCLA 3VP3A 4OQ0A 2WKQA 2PT7A 3BQAA 4HP4A 3UB7A 3HLBA 3TJZC 3CITA 1TF1A 4KQQA 3HLCA 1NRJA 1P9RA 5CGSA 3JVUA 5F69A 2FFYA 3LR3A 3IF6A 3LEZA 3ZG0A 3GRJA 5FQQA 1ZG4A 2B95A 3T4KA 2CMNA 1Z6FA 1MPLA 2A49A 4MNRA 3KSIA 2QMIA 3VSLA 1PIOA 3O88A 3ITBA 1PWDA 5CRFA 3NCKA 2ZBBA 4OOYA 4P6ZM 3UE6A 1LT0A 3QNCA 2Y2HA 2C5WB 4MMNA 3IWOA 2A3UA 1NZUA 2HF6A 4I3JA 3EWKA 2QJ5A 4B9OA 1MXOA 5FATA 2XRNA 1U60A 1H8MA 1XA1A 3IX3A 3UE1A 2EFXA 2XFTA 5FI2A 5C5KA 3B3XA 3BQ8A 3IH9A 3O5YA 4Y0TA 2QZ6A 5GHZA 3HJKA 2Q9NA 3G35A 2IWBA 3Q7VA 2EWWA 1H8ZA 3P09A 3UY6A 1KE3A 3MBZA 1VHMA 2W1RA 5BOHA 3S7OA 3OPLA 4YINA 4S2PA 1K54A 5EECA 3MFDA 4D60A 4R3BA 4HQAA 4MN6A 5GLCA 3MXRA 1ZC2A 4HBUA 4WZ5C 5JYPA 4MLLA 1XJ6A 3WS5A 2LB5A 3WS0A 2BG1A 2V1BA 4WL9A 4PM5A 3T1XA 5KSCA 3EGDC 3UDXA 2KLIA 3GMWA 3OCLA 3V39A 3E2LA 3FKVA 4QHCA 2JHEA 2W3HA 4A5RA 1ZG6A 3GTCA 2NUTC 2ZD8A 3ZG8B 1BLSA 2V9AA 3DWKA 1FQGA 2I9VA 3QP8A 1YLZA 5I94A 4R4RA 4PMAA 5DFXA 2P9VB 3C4OA 2V0UA 4JXGA 5HAQA 2IA2A 2WKPA 4NXBA 4K0WA 3IHAA 3OCNA 1DJCA 4CPKA 4GJ4A 4E3IA 3AGDA 4KZ9A 1YLPA 1AXBA 3MSHA 1N9BA 2J8YA 3B33A 1T18A 2KX6A 5TFQA 1BYWA 4E3OA 1I2WA 4WLAA 5I5LA 1LL5A 3IWQA 3UB5P 3D9YA 2W1TB 4S2IA 3M2KA 5HL1A 1UWPX 3H82B 3HLGA 2L1MA 1OJ5A 2XK1A 1FILA 2ZOHA 1D06A 2B18A 2Y2NA 4X1LA 2Y4AA 2Z2LB 5CECA 2FFFB 5F6AA 3BFFA 4ZRRA 3UN7A 4GNUA 1MKMA 1S1ZA 4GLQA 2ZL1B 4YWZA 3DTKA 1GHPA 3D72A 3NHQA 4DDSA 1W63Q 4KZ4A 2WGIA 5D3OA 3UB9A 1KVLA 2Y2MA 2W3DA 2W1TA 1LI0A 3T4SA 3V5MA 4WBGA 3S4XA 1FIKA 1YM1A 1FR1A 4N1XA 3TG9A 3G32A 1WYCA 3OPRA 4OLDA 1YLYA 3F1OB 3LCEA 3HJIA 2W3EA 5F1FA 3DTIA 2I72A 2VA0A 5HSQA 1A0KA 1YSPA 1VEUA 1T1BA 4U3TA 1BLHA 2Q9MA 2ZL1A 3K3CA 3WRZA 4EBPA 2HDQA 4DRTA 3NC8A 1GHMA 4Y0OA 3RH8B 5DFYA 4BBTA 3MFXA 4ARZA 3R4KA 1STZA 1FCNA 1QMFA 3F1PB 1GSVA 4S2OA 1SZVA 1ES3A 4Q0IA 3LFVA 1QMEA 2GX5A 1GSWA 3MF0A 1JVJA 3F1OA 3HLEA 2L4RA 5DTSA 3ZNYA 4M4XA 2PAVP 1TS8A 3E4OA 2HP9A 5CERA 1UGUA 4EWFA 4E3MA 2PYRA 1XJ3A 2H0TA 3LIFA 3IXGA 5TR7A 1K56D 1XX2A 1LSXA 1YLWA 1BLCA 4RYEA 2M1CA 3H7WA 2RCXA 2EXBA 5HWWA 1ZHHB 4I38A 4R70A 3F1PA 4HJ3A 4I5SA 1ERQA 3LIAA 3MMHA 1HTZA 3HUNA 1XA7A 1IYQA 3MZEA 4EQIA 2BASA 4E3LA 2ZC7A 4ZAMA 5MC7A 4LV0A 3E98A 1XXMA 1K0KA 2HDSA 3CHWP 4U0TA 3WS2A 2Y2IA 3SH7A 1NZOA 2XROA 2FZ0A 1KE0A 4UHUA 4P6BA 1DJAA 4GD6A 4IUKA 2PBYA 2Z6CA 1F5MA 2ZQCA 2Y2KA 4EUVA 2H0YA 3CJMA 1RP5A 1PYYA 4MEZA 3SZTA 3L7HA 2ZC4B 4NXFA 3K3DA 2JN7A 4JXSA 3V67A 3GECA 3I7JA 5E2FA 1XJ2A 4Z9QA 2A2LA 1HLUP 1LSWA 3LY4A 4RX3A 2YKFA 3GR2A 4HH3A 2QKPA 2A24A 3BY9A 3U4LP 3UO9A 4JBFA 3EQUA 5EV0A 4FSFA 4O8GA 4PKYA 4ZJ1A 5KIZA 3PYPA 2Y2LA 4IVIA 1BULA 1NY0A 5FQ9A 2PR6A 3M6BA 4C6YA 1OT6A 2V2FF 5EVID 5CEBA 1MWSA 3V3SA 2EX9A 5GL9A 2OWJA 3VP4A 2OLVA 1OTEA 4QU3A 3SH8A 4WN5A 3PBQA 2HPBA 5FDSA 1D7EA 2PU2A 1G28A 1FCOA 2JCHA 5E2HA 5FQJA 3S7NA 4EBNA 2KDKA 3JVVA 3MZFA 4JGOA 3L9KA 2QHKA 3DAVA 4DJ3A 3SS5A 1VETB 4DN0A 5AQ9A 4Y7PA 1H5XA 1HD8A 4IBRA 3MQQA 3TW8A 1G6AA 5HARA 5AJGA 3IH8A 1PZPA 3LIEA 4BMWA 4KQRA 2XQZA 5AQBA 2FH5A 1K6SA 1G68A 4JF5A 2J3WA 3P98A 1NWZA 3T1SA 3DTEA 4GKUA 3GV9A 1I5QA 5JYOA 3LGOA 4KQOA 3IXDA 2ZLYA 4LCMA 5FI6A 1DY6A 4XUZA 4MBKA 4QWOA 1VETA 2W3GA 4BD0A 2QJ7A 4LV2A 4DMZA 3ZFZA 4S2NC 2VV8A 4ZJ3A 4PM6A 4FH4A 1MWUA 2HP5A 3IX8A 3PAEA 2XEPA 3IXBA 3E4PA 3O3VA 2UWXA 2OAP1 3MKEA 4E3NA 4X1MA 3HLFA 3NIAA 4JGPA 4DXCA 3WS1A 4EUZA 4Y2FA 3KYEA 4NEED 3FWLA 4HI4A 2VLGA 2ZQAA 3CPTB 3ISGA 3C7VA 1H8YA 1E25A 3VMAA 4GZBA 2DNSA 3HUMA 1F9IA 3HL9A 4KG2A 2OWHA 5DKKA 4LENA 3S7QA 3FKWA 3VE3A 1FSWA 2XLNA 4BLMA 4I3IA 1HVBA 3FC7A 3PHYA 3ZGAB 5DJTA 2M7VA 3ZDJA 2JKTM 2WGWB 3CAXA 1K56A 2J80A 3ZG5A 3SOIA 3P01A 4E6WA 3NBLA 3C30A 4D2OA 5DF9A 4K0XA 3RXXA 1T1CA 3KX0X 3IXHA 3CPTA 1LL8A 4ZBEA 4OVDA 5HPFA 1IEMA 2VGLS 4KQDA 1ONHA 4KZ5A 3LICA 2V8FA 1W7FA 2WAFA 4WMCD 4GHIB 4EEPA 2WGVA 2H28A 3GVBA 3LR0A 1XKZA 4LLOB 3PTEA 4IVKA 1W8QA 2DRWA 2Z6DA 4DDYA 3C7UA 1RCJA 3SH9A 3QP6A 4GS9B 4E3KA 4EQ1A 4NXGA 5FSRA 2W0NA 4KZAA 3HLWA 5EVIB 3OLOA 4EW7A 2MJ6A 3UE3A 3IBRA 3W8KA 4S2KA 3TSGA 1OTAA 4CLCC 3W4PA 2L0WA 3BFCA 4OQHA 4GHIA 2VGLM 4UA7A 3UB8A 2P08A 4BENA 4KZ6A 5HWVA 4HEFA 4CQHA 4JKTA 4WELA 1DP6A 3Q81A 3G2ZA 1L0GA 2C6WB 3WWXA 5DVAA 4IBXA 5FQMA 3UPOA 2ZC3B 3CUEA 4HBTA 2OV5A 1YT4A 2VV7A 3T50A 5J4EA 4PM8A 5HWTA 3VE4A 1K38A 1OMEA 5EVIA 1DP9A 4OH0A 1EWZA 4DKIA 1MWRA 3E4QA 4F3LB 5FASA 5AVEA 1W79A 4Q0HA 5CXWA 5G4YA 5J7EA 3ZYTA 1Y54A 2HP6A 4JPMA 4QB8A 2W3FA 1BLPA 4NETA 4ESPA 2VJWA 1KGGA 5LBRA 4GW9A 4E6XA 5L8MA 4GDBA 3Q82A 4EEUA 3VFFA 3B47A 3HVFA 4F3LA 3UPNA 1VQQA 4BBVA 5CHJA 3RTYA 1K57C 3OC2A 2G7UA 2P9VA 1D1JA 3IHBA 2WZZA 2KOIA 4E04A 4KZ8A 1OPXA 1JTGA 4DXBA 2ZQDA 4PKYG 3JPUA 2Y79A 1LSVA 4R23A 1IKIA 1ZTUA 1MY8A 5A93A 4OPZA 1YPRA 1FCMA 2RL3A 3EQVA 2J3TC 3C8CA 4GD8A 3QNBA 1YLTA 2P7JA 3H82A 3GQZA 2X71A 3E0YA 4XXRA 2EX8A 3PBRA 4X56A 2V0WA 3VSKA 1BUEA 3BLMA 1AWIA 2VGJA 2ZMAA 3PBTA 1XJ4A 3MR0A 3VOZA 3MS6A 1NYMA 1TVFA 3LYXA 5EVLA 4F94A 2ZMFA 1BSGA 3G31A 3N6IA 3CI6A 1JWVA 2K7SA 1K4EA 3PBNA 4JXWA 2WADA 3V50A 3BECA 2P74A 4BWIA 2O9CA 4EERA 1TDLA 4ETXA 3EEHA 4BD1A 3FPWA 4QY6A 1OJGA 5A8BA 5A91A 2VV6A 1G5UA 1Y28A 2JKGA 2VEAA 2PHYA 2XGNA 5FAPA 1OTBA 4DE0A 4CLCD 3C38A 5KZHA 1O7EA 1N4OA 3UE0A 4L9EA 5F1GA 3BFGA 1ONGA 1K4FA 4GN2A 5GHXA 1NXYA 5FAQA 3JYIA 1ERMA 2PRFA 3ICYA 2JKFA 3IF5A 4UQIS 1WE4A 3P7NA 3VV4A 1ES4A 3AGEA 3G2YA 3PBSA 3CMZA 5E43A 1SDNA 4OQGA 5CTNA 3UMEA 1DP8A 1PI5A 4WMCA 4FTXA 5HDSA 3MXQA 4B93A 1IYSA 1K55A 3VOLA 4ETZA 4LV1A 5J8XA 3C5AA 3IQAA 4H6JB 4R1GA 1L0EA 3BJNA 4YNRA 3DW0A 3VOYA 4MBHA 4OKPA 2VZWA 1CK3A 1V9ZA 2GNXA 3ITAA 1NRFA 2WKIA 1SDEA
chains in the Genus database with same CATH topology
3DBAA 3A0VA 4UQIM 4GCZA 1N9OA 2W3GA 4ARZB 2QJ7A 1VHMA 2W1RA 1IFQA 3S7OA 4DMZA 5F68A 5G4ZA 2VV8A 2ZOIA 4HOIA 1IOUA 1V9YA 1MZUA 4HQAA 4MN6A 1TS7A 2HV1A 3E4PA 2P04A 2OAP1 1XJ6A 4H6JA 1G6OA 2LB5A 4JGPA 2V1BA 4WL9A 4YOFA 4O0PA 4Y2FA 1P9WA 1S67L 3R7WB 5HDCA 4NEED 4HI4A 2VLGA 3EGDC 4HJ4A 2PYPA 2KLIA 3OCLA 3CLOA 3H7WB 3EOIA 2JHEA 2W3HA 2NUTC 1F9IA 1N9NA 2J3TD 4Y3IA 2OWHA 4JGRA 5DKKA 3VE3A 2V9AA 3S7QA 2I9VA 4I3IA 1T1AA 3OBFA 2PR5A 4I39A 3F1NB 3FC7A 3PHYA 4HJ6A 5DFXA 5DJTA 3PXPA 2M7VA 2V0UA 2JKTM 2PD7A 4R3AA 3LIBA 3LI9A 3CAXA 2IA2A 2WKPA 5DKLA 2DMWA 2J80A 4NXBA 4EXOA 3P01A 3KSFA 2JKRI 3OCNA 3BY8A 3C30A 4GJ4A 5DF9A 4LRXC 1T1CA 3KX0X 3KO6A 3B33A 2GJ3A 1LL8A 1T18A 2KX6A 1BYWA 4O01A 4WLAA 5I5LA 4G3KA 3MQOA 4HH2A 5HPFA 2R78A 2W1TB 2VGLS 4KQDA 1UWPX 4IUHA 3H82B 2L1MA 1OJ5A 3D3OA 3HCYA 4HY8A 3LR5A 4LRZE 2ZOHA 1D06A 3LICA 2B18A 3F1NA 4WF0A 4NXEA 1P97A 3EGXC 2QYBA 4GHIB 4EEPA 2H28A 1P0ZA 3PBOA 4QPRA 1W63M 3LI8A 3LR0A 4LLOB 5EFWA 5F6AA 4OOLA 4ZRRA 2Z6DA 2B02A 1MKMA 1S1ZA 4GLQA 3MJQA 1TS0A 4HHDA 4YWZA 3D72A 4GS9B 3NHQA 2A24B 3EEAA 1W63Q 2K2NA 4EQ1A 4NXGA 3UB9A 2W0NA 4DJ2A 3A0SA 2W3DA 2W1TA 3T4SA 3OLOA 4EW7A 1S66L 2MJ6A 3UE3A 5AVFA 2ZMVA 3IBRA 4ME4A 3ZQ5A 4II7A 4EU0A 4HNBA 1KOUA 5F5YA 1OTAA 4R38A 4CLCC 3F1OB 2L0WA 3HJIA 4GHIA 2VGLM 4UEYA 2W3EA 3UB8A 2P08A 4PAUA 4XT2B 5HWVA 2VA0A 5HSQA 4CQHA 4WELA 1DP6A 1XFQA 1S1YA 1NLZA 1YSPA 4CLCB 1T1BA 2V1AA 4RQ9A 1F98A 1OTIA 4IJGA 3K3CA 3UMDA 1EW0A 3CUEA 2W27A 2O9AA 4EESA 2GZAA 3G6OA 2VV7A 3RH8B 3T50A 5DFYA 4BBTA 5J4EA 1GSXA 3MFXA 4ARZA 3KYQA 5HWTA 3VE4A 5TJJA 2O0YA 1DP9A 3R4KA 1STZA 4HIAA 3E4QA 3F1PB 4F3LB 1GSVA 1MC0A 2XA7S 4Q0IA 3LFVA 5AVEA 3NJAA 3RFBA 4KUOA 2GX5A 2OAQ1 1GSWA 2QWSA 3MF0A 4Q0HA 4L9GA 3F1OA 3S7PA 2L4RA 5CX7A 4M4XA 4XT2A 4LPZA 5G4YA 3NOUC 1TS8A 5J7EA 2K31A 3ZYTA 3E4OA 4G3VA 2VX8A 3A0RA 2W3FA 1UGUA 5DJUA 2PYRA 3T4TA 4CLCA 1XJ3A 2VJWA 3LIFA 3T4JA 3R7WA 5LBRA 4GW9A 4WUJA 3U2AA 1LSXA 1YSQA 5L8MA 4K08A 2M1CA 5FL3A 3H7WA 4AFIA 4HP9A 1NLYA 5HWWA 1UWNX 1ZHHB 4EEUA 3NOTC 3KSGA 4FOFA 4IHQA 3B47A 2HGVA 4I38A 4R70A 4BBUA 3F1PA 4F3LA 4HJ3A 4I5SA 4BBVA 4CLCE 1T19A 3CWFA 3LIAA 3MMHA 3RTYA 2YKHA 3OC2A 2VKSA 2G7UA 2BASA 4I3AA 3KYZA 4NKPA 5MC7A 1TS6A 3E98A 3TRCA 4BJPA 2KOIA 4E04A 2XA7M 1OPXA 5IT5A 3LIDA 2XROA 4PKYG 4MDZA 3LUQA 2Y79A 2FZ0A 1LSVA 4Y5FA 1ZTUA 3IBJA 3FPVA 1WA9A 4MN5A 1YAXA 4IUKA 2Z6CA 1F5MA 3EQVA 2J3TC 3C8CA 4EUVA 3OOVA 2D01A 2P7JA 3H82A 5HD3A 4KUKA 3E0YA 3BWLA 2EA9A 2O99A 3PBRA 3T4QA 2V0WA 4NXFA 1N9LA 3K3DA 2JN7A 3IS2B 4WEKA 3V67A 2LB9A 4PHTA 3GECA 3MQ0A 2HJEA 1XJ2A 2A2LA 5IU1A 1LSWA 3PBTA 1S4SA 5HD5A 5TBMB 2XSSA 5HPIA 4Q0JA 1XJ4A 3MR0A 2YKFA 4OOMA 2JKRM 4L9FA 4MN7A 4HH3A 3LYXA 4GS9A 4LRYC 2QKPA 2ZMFA 2A24A 3GDIA 4EETB 1XFNA 4MCWA 3BY9A 2HJ9C 3CI6A 3TE8A 4WEJA 2K7SA 3EQUA 3PBNA 4FSFA 3FG8A 4O8GA 4PKYA 3T4LA 5KIZA 3NOPC 3PYPA 4BWIA 2O9CA 2PR6A 1X0OA 4L0LA 3SW1A 1OT6A 4P6ZS 4EERA 3IS2A 3KSHA 1S4RA 4ETXA 3EEHA 2WKRA 5HDDA 1ODVA 1DRMA 3FPWA 3ULFA 2Y8HA 1OJGA 2NUPC 5K5BA 5A8BA 5HL6A 1TD5A 2VV6A 2OWJA 1YKDA 1Y28A 1OT9A 5TBMA 2VEAA 2PHYA 3C2WA 1OTEA 5KSHA 2WKQA 2PT7A 3BQAA 1JNUA 5IS1A 4WN5A 3PBQA 4HP4A 3TJZC 3UB7A 1OTBA 4CLCD 3CITA 1D7EA 1TF1A 3C38A 4L9EA 1G28A 1NRJA 1P9RA 4Z1WA 3S7NA 3H9WA 5J3WA 3JVUA 5F69A 2PD8A 3B42A 3LR3A 4JGQA 3ICYA 3W2ZA 2KDKA 4UQIS 3T4KA 3JVVA 2CMNA 3P7NA 3VV4A 4JGOA 1VB6A 2QHKA 3KSIA 4DJ3A 3UB6A 4R6LA 4DN0A 3PBSA 3PR6A 3MQQA 2ZBBA 3TW8A 3UMEA 1DP8A 4P6ZM 3UE6A 1LT0A 5HZHA 5AJGA 3MXQA 5HDSA 2PDRA 3LIEA 4BMWA 2EWVA 4B93A 2JKTI 3K2NA 3BW6A 2FH5A 3VOLA 4ETZA 2J3WA 1NWZA 4MMNA 1H3QA 2HF6A 4I3JA 3EWKA 1OTDA 2QJ5A 4H6JB 4B9OA 2M7UA 4KQOA 2XRNA 3CUEC 1H8MA 3BJNA 3LR4A 4G3WA 4YNRA 2D02A 5C5KA 2INWA 3BQ8A 2OOLA 2VZWA 3O5YA 1V9ZA 3HJKA 2GNXA 3T4OA 2EWWA 2O9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0V A;  4GCZ A;  1N9O A;  2QJ7 A;  5F68 A;  5G4Z A;  2VV8 A;  2ZOI A;  4HOI A;  1V9Y A;  1MZU A;  4HQA A;  4MN6 A;  1TS7 A;  2HV1 A;  3E4P A;  1XJ6 A;  4H6J A;  4JGP A;  2V1B A;  4WL9 A;  1S67 L;  5HDC A;  4HI4 A;  2VLG A;  4HJ4 A;  2PYP A;  3CLO A;  3H7W B;  2JHE A;  1F9I A;  1N9N A;  2OWH A;  4JGR A;  5DKK A;  3VE3 A;  2V9A A;  2I9V A;  4I3I A;  1T1A A;  2PR5 A;  4I39 A;  3F1N B;  3FC7 A;  3PHY A;  4HJ6 A;  5DJT A;  2V0U A;  2PD7 A;  4R3A A;  3LIB A;  3LI9 A;  3CAX A;  2WKP A;  5DKL A;  2J80 A;  4NXB A;  4EXO A;  3BY8 A;  4LRX C;  1T1C A;  3KX0 X;  3B33 A;  2GJ3 A;  1LL8 A;  1T18 A;  2KX6 A;  1BYW A;  4WLA A;  5I5L A;  3MQO A;  4HH2 A;  2R78 A;  4KQD A;  1UWP X;  3H82 B;  2L1M A;  1OJ5 A;  4HY8 A;  4LRZ E;  2ZOH A;  1D06 A;  3LIC A;  3F1N A;  4WF0 A;  4NXE A;  1P97 A;  4GHI B;  4EEP A;  2H28 A;  1P0Z A;  3LI8 A;  4LLO B;  5EFW A;  5F6A A;  2Z6D A;  2B02 A;  1S1Z A;  3MJQ A;  1TS0 A;  4HHD A;  4YWZ A;  3D72 A;  4GS9 B;  3NHQ A;  2A24 B;  4EQ1 A;  4NXG A;  3UB9 A;  2W0N A;  4DJ2 A;  3A0S A;  3OLO A;  4EW7 A;  1S66 L;  5AVF A;  3IBR A;  3ZQ5 A;  4HNB A;  1KOU A;  5F5Y A;  1OTA A;  4R38 A;  3F1O B;  2L0W A;  3HJI A;  4GHI A;  3UB8 A;  4XT2 B;  5HWV A;  5HSQ A;  1DP6 A;  1XFQ A;  1S1Y A;  1T1B A;  2V1A A;  4RQ9 A;  1F98 A;  1OTI A;  3K3C A;  3UMD A;  1EW0 A;  2W27 A;  4EES A;  3G6O A;  2VV7 A;  3RH8 B;  3T50 A;  4BBT A;  5J4E A;  1GSX A;  3MFX A;  5HWT A;  3VE4 A;  1DP9 A;  4HIA A;  3E4Q A;  3F1P B;  4F3L B;  1GSV A;  5AVE A;  3NJA A;  4KUO A;  1GSW A;  2QWS A;  4L9G A;  3F1O A;  2L4R A;  5G4Y A;  4M4X A;  4LPZ A;  4XT2 A;  3NOU C;  1TS8 A;  5J7E A;  3E4O A;  3A0R A;  1UGU A;  5DJU A;  2PYR A;  1XJ3 A;  3LIF A;  4GW9 A;  4WUJ A;  1LSX A;  4K08 A;  2M1C A;  3H7W A;  4HP9 A;  5HWW A;  1UWN X;  4EEU A;  3NOT C;  4I38 A;  4R70 A;  4BBU A;  3F1P A;  4F3L A;  4HJ3 A;  4I5S A;  4BBV A;  1T19 A;  3CWF A;  3LIA A;  3RTY A;  2YKH A;  2BAS A;  4I3A A;  1TS6 A;  4E04 A;  3LID A;  4PKY G;  3LUQ A;  1LSV A;  1WA9 A;  4MN5 A;  2Z6C A;  3C8C A;  2D01 A;  2P7J A;  3H82 A;  5HD3 A;  4KUK A;  3BWL A;  2EA9 A;  2V0W A;  4NXF A;  1N9L A;  3K3D A;  2JN7 A;  3IS2 B;  3GEC A;  1XJ2 A;  5IU1 A;  1LSW A;  1S4S A;  5HD5 A;  5TBM B;  1XJ4 A;  3MR0 A;  2YKF A;  4L9F A;  4HH3 A;  3LYX A;  4GS9 A;  4LRY C;  2QKP A;  2A24 A;  3GDI A;  4EET B;  1XFN A;  3BY9 A;  2K7S A;  3FG8 A;  4PKY A;  5KIZ A;  3NOP C;  3PYP A;  2PR6 A;  1X0O A;  3SW1 A;  1OT6 A;  4EER A;  3IS2 A;  1S4R A;  3EEH A;  2WKR A;  5HDD A;  1ODV A;  1DRM A;  3ULF A;  1OJG A;  5A8B A;  2VV6 A;  2OWJ A;  1Y28 A;  1OT9 A;  5TBM A;  2VEA A;  2PHY A;  3C2W A;  1OTE A;  2WKQ A;  5IS1 A;  1JNU A;  4WN5 A;  4HP4 A;  3UB7 A;  1OTB A;  1D7E A;  4L9E A;  1G28 A;  3H9W A;  5J3W A;  5F69 A;  2PD8 A;  4JGQ A;  3ICY A;  2KDK A;  2CMN A;  3P7N A;  4JGO A;  1VB6 A;  2QHK A;  4DJ3 A;  3UB6 A;  4R6L A;  3MQQ A;  2ZBB A;  3UME A;  1DP8 A;  3UE6 A;  1LT0 A;  5HZH A;  5HDS A;  3MXQ A;  2PDR A;  3LIE A;  3VOL A;  1NWZ A;  4I3J A;  3EWK A;  1OTD A;  2QJ5 A;  4H6J B;  4B9O A;  2D02 A;  2INW A;  2OOL A;  1V9Z A;  3HJK A; 
#chains in the Genus database with same CATH topology
 3QP1 A;  3DBA A;  2ZQ8 A;  3A0V A;  4UQI M;  1Q2P A;  1N9O A;  4OPR A;  3T1Q B;  2V20 A;  3OPP A;  4X55 A;  5GLD A;  5G4Z A;  3W4O A;  4M3K A;  2ZOI A;  1W5D A;  4HOI A;  1KVM A;  3O87 A;  4OON A;  5IHV A;  1MWT A;  4Y13 A;  2ACG A;  4S2J A;  1ACF A;  1PWC A;  1MZU A;  1TS7 A;  2HV1 A;  2P04 A;  4H6J A;  4LFU A;  5CGX A;  4O0P A;  3R7W B;  5HDC A;  4EBL A;  4HJ4 A;  2E8J A;  3A3I A;  3FV7 A;  3CLO A;  3WRT A;  4KG6 A;  5E2E A;  2J3T D;  1TDG A;  4JGR A;  5FAO A;  5CGW A;  1J9M A;  1FSY A;  5F83 A;  1T1A A;  3OBF A;  4NK3 A;  4I39 A;  1NJ4 A;  2X02 A;  3PXP A;  2PD7 A;  2Y2O A;  1KGE A;  4S2M A;  4EXO A;  5DKL A;  2DMW A;  1FOF A;  2Q0O A;  5M18 A;  5M19 A;  1PNE A;  3BY8 A;  1ESU A;  3NDG A;  4LRX C;  3LEQ A;  2ZQ7 A;  3BYD A;  4HH2 A;  2R78 A;  1SHV A;  4OP8 A;  3S22 A;  3G30 A;  2WKH A;  3LR5 A;  2PU4 A;  4PM9 A;  1PFL A;  1EI5 A;  4Y15 A;  4JLF A;  5DF7 A;  1TEM A;  4X53 A;  3LI8 A;  5EFW A;  4JF6 A;  5L10 A;  4OQI A;  4PPR A;  2ZM2 A;  2Y2P A;  5E2G A;  3UPP A;  3A3D A;  1PWG A;  1CI8 A;  4OPY A;  4PM7 A;  3ZHH A;  1H0M A;  1CEF A;  1PW1 A;  1S66 L;  1SKO B;  3QP2 A;  1E3U D;  4CJN A;  3ZQ5 A;  4HNB A;  1KOU A;  1CF0 A;  4RVA A;  1YMS A;  4R38 A;  1PI4 A;  5DTT A;  1YQS A;  3D4F A;  3W4Q A;  3Q07 A;  2DCF A;  3IX4 A;  4PAU A;  4KG5 A;  4XT2 B;  5FQK A;  4DE2 A;  3M6H A;  1S1Y A;  1NLZ A;  4CLC B;  2V1A A;  4RQ9 A;  4IJG A;  5F82 A;  5U47 A;  3HUO A;  2WZX A;  4UAA A;  2O9A A;  2GZA A;  5KMW A;  3QP5 A;  3DTM A;  4ID4 A;  4B88 A;  1MC0 A;  1SKO A;  3SS4 A;  5HX9 A;  2XA7 S;  3NJA A;  4KEN B;  4KUO A;  2OAQ 1;  5DTK A;  4L9G A;  3ZCZ A;  5GLB A;  3T12 B;  4X25 A;  4XT2 A;  4RX2 A;  4LPZ A;  3IWI A;  3VFH A;  2EX6 A;  4CLC A;  2B5R A;  3M2J A;  3T4J A;  4WZ5 A;  5FI7 A;  4WUJ A;  4ZTK A;  1Z09 A;  3U2A A;  3DWZ A;  1YSQ A;  4K08 A;  3IT9 A;  5AQA A;  4RA7 A;  2EX2 A;  5FL3 A;  1LHY A;  2HZ5 A;  4AFI A;  4HP9 A;  3CZD A;  3NOT C;  3KSG A;  3RXW A;  4BBU A;  5FA7 A;  1Q2Q A;  3CWF A;  4R3J A;  3G34 A;  2VKS A;  4I3A A;  3Q7V B;  1PW8 A;  4NKP A;  2WGW A;  3TRC A;  5EOE A;  4BJP A;  1ESI A;  2XA7 M;  3FYZ A;  5HFO A;  3LUQ A;  3ZG9 B;  3IBJ A;  1GCE A;  1WA9 A;  1E4D A;  1YAX A;  2Y2Q A;  4WZ4 A;  5GLA A;  3VP0 A;  2AVX A;  2E8I A;  3BFE A;  1IKG A;  5HD3 A;  1XGI A;  4KUK A;  3LY3 A;  3T4Q A;  3S1Y A;  4OP5 A;  2WUQ A;  2OSU A;  4WEK A;  5A92 A;  2LB9 A;  4PHT A;  2HJE A;  4P0M A;  3C4P A;  1K57 A;  1XP4 A;  5IU1 A;  4IED A;  1S4S A;  5HD5 A;  5CHU A;  2Y2G A;  5HPI A;  4P85 A;  4OOM A;  2JKR M;  5HAI A;  4FD8 A;  4GS9 A;  3N4I A;  4C75 A;  2V1Z A;  2XH9 A;  3IF6 C;  4MCW A;  2WYX A;  4KZB A;  2HJ9 C;  3TE8 A;  2XF3 A;  4YFM A;  3RJU A;  3T4L A;  1M40 A;  1LL9 A;  1X0O A;  1XPB A;  4U0X A;  1ODV A;  3ULF A;  2NUP C;  2J7V A;  5HL6 A;  2H10 A;  1TD5 A;  1OT9 A;  1CI9 A;  3C2W A;  5KSH A;  3BM6 A;  1MKI A;  5IS1 A;  1JNU A;  3LO7 A;  3ZVW A;  5EE8 A;  3MKF A;  4ZDX A;  4N1H A;  4Z1W A;  1L0D A;  3H9W A;  5J3W A;  4LV3 A;  2GDN A;  2Z2M B;  3PAG A;  2PD8 A;  3B42 A;  1S6R A;  4JGQ A;  3W2Z A;  3QP4 A;  4P87 A;  3N8L A;  3CG5 A;  3A3E A;  3NDE A;  1VB6 A;  5G18 A;  5L09 A;  3UB6 A;  5HW3 A;  4R6L A;  4S2L A;  1CEG A;  1K54 C;  4DE3 A;  3PR6 A;  1CJF A;  2G2U A;  3N7W A;  5HZH A;  4BL3 A;  2PDR A;  4GOG A;  1K6R A;  2EWV A;  2JKT I;  3K2N A;  3BW6 A;  2R9W A;  3ZNT A;  1IEL A;  3E2K A;  4XUX A;  1H3Q A;  1RGZ A;  1OTD A;  2M7U A;  3CUE C;  1VEU B;  2ZC5 B;  3LR4 A;  4G3W A;  2D02 A;  4X6T A;  1VM1 A;  1L0F A;  2INW A;  2HDU A;  3HRE A;  4HES A;  2OOL A;  2BTF P;  1YLJ A;  5EVI C;  3T4O A;  3OZH A;  2O9B A;  1JTD A;  1W8Y A;  1E3U A;  3A3J A;  4R0Q A;  4GCZ A;  5EOO A;  4ARZ B;  1IFQ A;  4FUW A;  5F68 A;  3NUL A;  3TOI A;  1IOU A;  1V9Y A;  3BFD A;  1LI9 A;  1DJB A;  1ZKJ A;  4FH2 A;  1G6O A;  5TGF A;  4YOF A;  2UV0 E;  5FQI A;  1P9W A;  1S67 L;  2ZQ9 A;  4BQM A;  2X01 A;  2PYP A;  3UNW A;  4GDN A;  4X69 A;  3O86 A;  3H7W B;  3EOI A;  4E3J A;  2WK0 A;  4Y3I A;  1N9N A;  1ES5 A;  3ZG7 B;  1L3L A;  3OPH A;  2PR5 A;  3F1N B;  3MZD A;  4HJ6 A;  2JE5 A;  4DF6 A;  4R3A A;  1M6K A;  3LIB A;  3LI9 A;  3MXS A;  5FEF A;  4C3Q A;  3WS4 A;  1IYO A;  5CED A;  2HDR A;  3KSF A;  2JKR I;  4FCF A;  5FDH A;  4GB7 A;  3KO6 A;  2GJ3 A;  3FZC A;  4BL2 A;  4O01 A;  4QJG A;  4G3K A;  5L07 A;  3MQO A;  2V8C A;  2Y2J A;  4OPQ A;  4IUH A;  1C3B A;  1GA0 A;  1JWP A;  3D3O A;  3HCY A;  4HY8 A;  4LRZ E;  3F1N A;  4WF0 A;  4Y0U A;  4NG2 A;  4EV4 A;  4NXE A;  1P97 A;  1ES2 A;  1CQA A;  3EGX C;  2QYB A;  4KZ7 A;  1P0Z A;  3PBO A;  4QPR A;  1W63 M;  1GA9 A;  1ALQ A;  1J3W A;  4OOL A;  2B02 A;  3MJQ A;  1TS0 A;  1F2K A;  4HHD A;  4N9L A;  4ZJ2 A;  2A24 B;  3EEA A;  4X68 A;  3UDF A;  4WYY A;  1I2S A;  3BLS A;  2K2N A;  4N92 A;  1Y4O A;  4DJ2 A;  3A0S A;  3BRM A;  5GHY A;  4B4X A;  4JXV A;  5EVE A;  1SCW A;  5AVF A;  2ZMV A;  4ME4 A;  1XGJ A;  2Y59 A;  4II7 A;  4EU0 A;  5F5Y A;  3HBR A;  3Q7Z A;  1MBL A;  1KGF A;  4UEY A;  1RGY A;  2PBD P;  4QD4 A;  4WM9 A;  4O7D A;  1XFQ A;  2EFU A;  1KDW A;  5A90 A;  1L2S A;  1F98 A;  1OTI A;  1S0W A;  2WKE A;  3UMD A;  1BTL A;  1EW0 A;  2VGK A;  2W27 A;  2XD1 A;  4EES A;  3UDI A;  2J9P A;  3G6O A;  4QY5 A;  4UA9 A;  1YMX A;  1GSX A;  5M1A A;  2XFS A;  3KYQ A;  1JWZ A;  5TJJ A;  2O0Y A;  4HIA A;  1PZO A;  1KDS A;  2EXA A;  3A3F A;  3RFB A;  2G2W A;  2QWS A;  5CHM A;  2ZC6 B;  3BEB A;  3S7P A;  4UA6 A;  2BLS A;  5CX7 A;  2XD5 A;  4S2N A;  3VP1 A;  3NOU C;  2K31 A;  1K55 C;  3N8R A;  4G3V A;  2QPN A;  2VX8 A;  3A0R A;  5DJU A;  3T4T A;  3GSG A;  4B4Z A;  3R7W A;  2CC1 A;  2ZM8 A;  4OLG A;  2XDM A;  1NLY A;  1UWN X;  4FOF A;  4IHQ A;  5L2F A;  2HGV A;  5CTM A;  3NY4 A;  1WYB A;  1IYP A;  1PRQ A;  1T19 A;  4CLC E;  2YKH A;  2H5S A;  3HLD A;  3KYZ A;  1TS6 A;  2JC7 A;  4N9K A;  3N8S A;  1SKF A;  2JBF A;  2VK3 A;  5IT5 A;  4MBF A;  1LLB A;  1BZA A;  3LID A;  3T1R A;  4Y17 A;  4MDZ A;  4Y5F A;  1O07 A;  1FR6 A;  3NEC A;  3Q1F A;  2J9O A;  3FPV A;  3SS3 A;  4MN5 A;  5EM0 A;  3AGF A;  2IWC A;  4R4S A;  5DF8 A;  3OOV A;  2D01 A;  3G4P A;  1GHI A;  2R9X A;  3BWL A;  2EA9 A;  1HZO A;  2O99 A;  2IWD A;  1N9L A;  4DE1 A;  3IS2 B;  4KZ3 A;  3MQ0 A;  3V3R A;  4K91 A;  5TBM B;  2XSS A;  3ZVT A;  5EM1 A;  4Q0J A;  1ERO A;  4MN7 A;  4L9F A;  5EPH A;  2Y55 A;  4LRY C;  3GDI A;  4EET B;  5EUA A;  1XFN A;  4H8R A;  1BT5 A;  2XR0 A;  2OLU A;  2ZM0 A;  4WEJ A;  1K25 A;  2WAE A;  3FG8 A;  3VP2 A;  1NYY A;  3NOP C;  3IF6 B;  2ZJ9 A;  4JF4 A;  5FEG A;  2Y91 A;  4L0L A;  3SW1 A;  4P6Z S;  3IS2 A;  3KSH A;  1S4R A;  2WKR A;  5AQ7 A;  5HDD A;  4LGW A;  1DRM A;  2Y8H A;  5K5B A;  5HAP A;  3NI9 A;  3QHY A;  1YKD A;  1KE4 A;  5TBM A;  4Q8I A;  4LCL A;  3VP3 A;  4OQ0 A;  2WKQ A;  2PT7 A;  3BQA A;  4HP4 A;  3UB7 A;  3HLB A;  3TJZ C;  3CIT A;  1TF1 A;  4KQQ A;  3HLC A;  1NRJ A;  1P9R A;  5CGS A;  3JVU A;  5F69 A;  2FFY A;  3LR3 A;  3IF6 A;  3LEZ A;  3ZG0 A;  3GRJ A;  5FQQ A;  1ZG4 A;  2B95 A;  3T4K A;  2CMN A;  1Z6F A;  1MPL A;  2A49 A;  4MNR A;  3KSI A;  2QMI A;  3VSL A;  1PIO A;  3O88 A;  3ITB A;  1PWD A;  5CRF A;  3NCK A;  2ZBB A;  4OOY A;  4P6Z M;  3UE6 A;  1LT0 A;  3QNC A;  2Y2H A;  2C5W B;  4MMN A;  3IWO A;  2A3U A;  1NZU A;  2HF6 A;  4I3J A;  3EWK A;  2QJ5 A;  4B9O A;  1MXO A;  5FAT A;  2XRN A;  1U60 A;  1H8M A;  1XA1 A;  3IX3 A;  3UE1 A;  2EFX A;  2XFT A;  5FI2 A;  5C5K A;  3B3X A;  3BQ8 A;  3IH9 A;  3O5Y A;  4Y0T A;  2QZ6 A;  5GHZ A;  3HJK A;  2Q9N A;  3G35 A;  2IWB A;  3Q7V A;  2EWW A;  1H8Z A;  3P09 A;  3UY6 A;  1KE3 A;  3MBZ A;  1VHM A;  2W1R A;  5BOH A;  3S7O A;  3OPL A;  4YIN A;  4S2P A;  1K54 A;  5EEC A;  3MFD A;  4D60 A;  4R3B A;  4HQA A;  4MN6 A;  5GLC A;  3MXR A;  1ZC2 A;  4HBU A;  4WZ5 C;  5JYP A;  4MLL A;  1XJ6 A;  3WS5 A;  2LB5 A;  3WS0 A;  2BG1 A;  2V1B A;  4WL9 A;  4PM5 A;  3T1X A;  5KSC A;  3EGD C;  3UDX A;  2KLI A;  3GMW A;  3OCL A;  3V39 A;  3E2L A;  3FKV A;  4QHC A;  2JHE A;  2W3H A;  4A5R A;  1ZG6 A;  3GTC A;  2NUT C;  2ZD8 A;  3ZG8 B;  1BLS A;  2V9A A;  3DWK A;  1FQG A;  2I9V A;  3QP8 A;  1YLZ A;  5I94 A;  4R4R A;  4PMA A;  5DFX A;  2P9V B;  3C4O A;  2V0U A;  4JXG A;  5HAQ A;  2IA2 A;  2WKP A;  4NXB A;  4K0W A;  3IHA A;  3OCN A;  1DJC A;  4CPK A;  4GJ4 A;  4E3I A;  3AGD A;  4KZ9 A;  1YLP A;  1AXB A;  3MSH A;  1N9B A;  2J8Y A;  3B33 A;  1T18 A;  2KX6 A;  5TFQ A;  1BYW A;  4E3O A;  1I2W A;  4WLA A;  5I5L A;  1LL5 A;  3IWQ A;  3UB5 P;  3D9Y A;  2W1T B;  4S2I A;  3M2K A;  5HL1 A;  1UWP X;  3H82 B;  3HLG A;  2L1M A;  1OJ5 A;  2XK1 A;  1FIL A;  2ZOH A;  1D06 A;  2B18 A;  2Y2N A;  4X1L A;  2Y4A A;  2Z2L B;  5CEC A;  2FFF B;  5F6A A;  3BFF A;  4ZRR A;  3UN7 A;  4GNU A;  1MKM A;  1S1Z A;  4GLQ A;  2ZL1 B;  4YWZ A;  3DTK A;  1GHP A;  3D72 A;  3NHQ A;  4DDS A;  1W63 Q;  4KZ4 A;  2WGI A;  5D3O A;  3UB9 A;  1KVL A;  2Y2M A;  2W3D A;  2W1T A;  1LI0 A;  3T4S A;  3V5M A;  4WBG A;  3S4X A;  1FIK A;  1YM1 A;  1FR1 A;  4N1X A;  3TG9 A;  3G32 A;  1WYC A;  3OPR A;  4OLD A;  1YLY A;  3F1O B;  3LCE A;  3HJI A;  2W3E A;  5F1F A;  3DTI A;  2I72 A;  2VA0 A;  5HSQ A;  1A0K A;  1YSP A;  1VEU A;  1T1B A;  4U3T A;  1BLH A;  2Q9M A;  2ZL1 A;  3K3C A;  3WRZ A;  4EBP A;  2HDQ A;  4DRT A;  3NC8 A;  1GHM A;  4Y0O A;  3RH8 B;  5DFY A;  4BBT A;  3MFX A;  4ARZ A;  3R4K A;  1STZ A;  1FCN A;  1QMF A;  3F1P B;  1GSV A;  4S2O A;  1SZV A;  1ES3 A;  4Q0I A;  3LFV A;  1QME A;  2GX5 A;  1GSW A;  3MF0 A;  1JVJ A;  3F1O A;  3HLE A;  2L4R A;  5DTS A;  3ZNY A;  4M4X A;  2PAV P;  1TS8 A;  3E4O A;  2HP9 A;  5CER A;  1UGU A;  4EWF A;  4E3M A;  2PYR A;  1XJ3 A;  2H0T A;  3LIF A;  3IXG A;  5TR7 A;  1K56 D;  1XX2 A;  1LSX A;  1YLW A;  1BLC A;  4RYE A;  2M1C A;  3H7W A;  2RCX A;  2EXB A;  5HWW A;  1ZHH B;  4I38 A;  4R70 A;  3F1P A;  4HJ3 A;  4I5S A;  1ERQ A;  3LIA A;  3MMH A;  1HTZ A;  3HUN A;  1XA7 A;  1IYQ A;  3MZE A;  4EQI A;  2BAS A;  4E3L A;  2ZC7 A;  4ZAM A;  5MC7 A;  4LV0 A;  3E98 A;  1XXM A;  1K0K A;  2HDS A;  3CHW P;  4U0T A;  3WS2 A;  2Y2I A;  3SH7 A;  1NZO A;  2XRO A;  2FZ0 A;  1KE0 A;  4UHU A;  4P6B A;  1DJA A;  4GD6 A;  4IUK A;  2PBY A;  2Z6C A;  1F5M A;  2ZQC A;  2Y2K A;  4EUV A;  2H0Y A;  3CJM A;  1RP5 A;  1PYY A;  4MEZ A;  3SZT A;  3L7H A;  2ZC4 B;  4NXF A;  3K3D A;  2JN7 A;  4JXS A;  3V67 A;  3GEC A;  3I7J A;  5E2F A;  1XJ2 A;  4Z9Q A;  2A2L A;  1HLU P;  1LSW A;  3LY4 A;  4RX3 A;  2YKF A;  3GR2 A;  4HH3 A;  2QKP A;  2A24 A;  3BY9 A;  3U4L P;  3UO9 A;  4JBF A;  3EQU A;  5EV0 A;  4FSF A;  4O8G A;  4PKY A;  4ZJ1 A;  5KIZ A;  3PYP A;  2Y2L A;  4IVI A;  1BUL A;  1NY0 A;  5FQ9 A;  2PR6 A;  3M6B A;  4C6Y A;  1OT6 A;  2V2F F;  5EVI D;  5CEB A;  1MWS A;  3V3S A;  2EX9 A;  5GL9 A;  2OWJ A;  3VP4 A;  2OLV A;  1OTE A;  4QU3 A;  3SH8 A;  4WN5 A;  3PBQ A;  2HPB A;  5FDS A;  1D7E A;  2PU2 A;  1G28 A;  1FCO A;  2JCH A;  5E2H A;  5FQJ A;  3S7N A;  4EBN A;  2KDK A;  3JVV A;  3MZF A;  4JGO A;  3L9K A;  2QHK A;  3DAV A;  4DJ3 A;  3SS5 A;  1VET B;  4DN0 A;  5AQ9 A;  4Y7P A;  1H5X A;  1HD8 A;  4IBR A;  3MQQ A;  3TW8 A;  1G6A A;  5HAR A;  5AJG A;  3IH8 A;  1PZP A;  3LIE A;  4BMW A;  4KQR A;  2XQZ A;  5AQB A;  2FH5 A;  1K6S A;  1G68 A;  4JF5 A;  2J3W A;  3P98 A;  1NWZ A;  3T1S A;  3DTE A;  4GKU A;  3GV9 A;  1I5Q A;  5JYO A;  3LGO A;  4KQO A;  3IXD A;  2ZLY A;  4LCM A;  5FI6 A;  1DY6 A;  4XUZ A;  4MBK A;  4QWO A;  1VET A;  2W3G A;  4BD0 A;  2QJ7 A;  4LV2 A;  4DMZ A;  3ZFZ A;  4S2N C;  2VV8 A;  4ZJ3 A;  4PM6 A;  4FH4 A;  1MWU A;  2HP5 A;  3IX8 A;  3PAE A;  2XEP A;  3IXB A;  3E4P A;  3O3V A;  2UWX A;  2OAP 1;  3MKE A;  4E3N A;  4X1M A;  3HLF A;  3NIA A;  4JGP A;  4DXC A;  3WS1 A;  4EUZ A;  4Y2F A;  3KYE A;  4NEE D;  3FWL A;  4HI4 A;  2VLG A;  2ZQA A;  3CPT B;  3ISG A;  3C7V A;  1H8Y A;  1E25 A;  3VMA A;  4GZB A;  2DNS A;  3HUM A;  1F9I A;  3HL9 A;  4KG2 A;  2OWH A;  5DKK A;  4LEN A;  3S7Q A;  3FKW A;  3VE3 A;  1FSW A;  2XLN A;  4BLM A;  4I3I A;  1HVB A;  3FC7 A;  3PHY A;  3ZGA B;  5DJT A;  2M7V A;  3ZDJ A;  2JKT M;  2WGW B;  3CAX A;  1K56 A;  2J80 A;  3ZG5 A;  3SOI A;  3P01 A;  4E6W A;  3NBL A;  3C30 A;  4D2O A;  5DF9 A;  4K0X A;  3RXX A;  1T1C A;  3KX0 X;  3IXH A;  3CPT A;  1LL8 A;  4ZBE A;  4OVD A;  5HPF A;  1IEM A;  2VGL S;  4KQD A;  1ONH A;  4KZ5 A;  3LIC A;  2V8F A;  1W7F A;  2WAF A;  4WMC D;  4GHI B;  4EEP A;  2WGV A;  2H28 A;  3GVB A;  3LR0 A;  1XKZ A;  4LLO B;  3PTE A;  4IVK A;  1W8Q A;  2DRW A;  2Z6D A;  4DDY A;  3C7U A;  1RCJ A;  3SH9 A;  3QP6 A;  4GS9 B;  4E3K A;  4EQ1 A;  4NXG A;  5FSR A;  2W0N A;  4KZA A;  3HLW A;  5EVI B;  3OLO A;  4EW7 A;  2MJ6 A;  3UE3 A;  3IBR A;  3W8K A;  4S2K A;  3TSG A;  1OTA A;  4CLC C;  3W4P A;  2L0W A;  3BFC A;  4OQH A;  4GHI A;  2VGL M;  4UA7 A;  3UB8 A;  2P08 A;  4BEN A;  4KZ6 A;  5HWV A;  4HEF A;  4CQH A;  4JKT A;  4WEL A;  1DP6 A;  3Q81 A;  3G2Z A;  1L0G A;  2C6W B;  3WWX A;  5DVA A;  4IBX A;  5FQM A;  3UPO A;  2ZC3 B;  3CUE A;  4HBT A;  2OV5 A;  1YT4 A;  2VV7 A;  3T50 A;  5J4E A;  4PM8 A;  5HWT A;  3VE4 A;  1K38 A;  1OME A;  5EVI A;  1DP9 A;  4OH0 A;  1EWZ A;  4DKI A;  1MWR A;  3E4Q A;  4F3L B;  5FAS A;  5AVE A;  1W79 A;  4Q0H A;  5CXW A;  5G4Y A;  5J7E A;  3ZYT A;  1Y54 A;  2HP6 A;  4JPM A;  4QB8 A;  2W3F A;  1BLP A;  4NET A;  4ESP A;  2VJW A;  1KGG A;  5LBR A;  4GW9 A;  4E6X A;  5L8M A;  4GDB A;  3Q82 A;  4EEU A;  3VFF A;  3B47 A;  3HVF A;  4F3L A;  3UPN A;  1VQQ A;  4BBV A;  5CHJ A;  3RTY A;  1K57 C;  3OC2 A;  2G7U A;  2P9V A;  1D1J A;  3IHB A;  2WZZ A;  2KOI A;  4E04 A;  4KZ8 A;  1OPX A;  1JTG A;  4DXB A;  2ZQD A;  4PKY G;  3JPU A;  2Y79 A;  1LSV A;  4R23 A;  1IKI A;  1ZTU A;  1MY8 A;  5A93 A;  4OPZ A;  1YPR A;  1FCM A;  2RL3 A;  3EQV A;  2J3T C;  3C8C A;  4GD8 A;  3QNB A;  1YLT A;  2P7J A;  3H82 A;  3GQZ A;  2X71 A;  3E0Y A;  4XXR A;  2EX8 A;  3PBR A;  4X56 A;  2V0W A;  3VSK A;  1BUE A;  3BLM A;  1AWI A;  2VGJ A;  2ZMA A;  3PBT A;  1XJ4 A;  3MR0 A;  3VOZ A;  3MS6 A;  1NYM A;  1TVF A;  3LYX A;  5EVL A;  4F94 A;  2ZMF A;  1BSG A;  3G31 A;  3N6I A;  3CI6 A;  1JWV A;  2K7S A;  1K4E A;  3PBN A;  4JXW A;  2WAD A;  3V50 A;  3BEC A;  2P74 A;  4BWI A;  2O9C A;  4EER A;  1TDL A;  4ETX A;  3EEH A;  4BD1 A;  3FPW A;  4QY6 A;  1OJG A;  5A8B A;  5A91 A;  2VV6 A;  1G5U A;  1Y28 A;  2JKG A;  2VEA A;  2PHY A;  2XGN A;  5FAP A;  1OTB A;  4DE0 A;  4CLC D;  3C38 A;  5KZH A;  1O7E A;  1N4O A;  3UE0 A;  4L9E A;  5F1G A;  3BFG A;  1ONG A;  1K4F A;  4GN2 A;  5GHX A;  1NXY A;  5FAQ A;  3JYI A;  1ERM A;  2PRF A;  3ICY A;  2JKF A;  3IF5 A;  4UQI S;  1WE4 A;  3P7N A;  3VV4 A;  1ES4 A;  3AGE A;  3G2Y A;  3PBS A;  3CMZ A;  5E43 A;  1SDN A;  4OQG A;  5CTN A;  3UME A;  1DP8 A;  1PI5 A;  4WMC A;  4FTX A;  5HDS A;  3MXQ A;  4B93 A;  1IYS A;  1K55 A;  3VOL A;  4ETZ A;  4LV1 A;  5J8X A;  3C5A A;  3IQA A;  4H6J B;  4R1G A;  1L0E A;  3BJN A;  4YNR A;  3DW0 A;  3VOY A;  4MBH A;  4OKP A;  2VZW A;  1CK3 A;  1V9Z A;  2GNX A;  3ITA A;  1NRF A;  2WKI A;  1SDE A; 
#chains in the Genus database with same CATH homology
 3DBA A;  3A0V A;  4UQI M;  4GCZ A;  1N9O A;  2W3G A;  4ARZ B;  2QJ7 A;  1VHM A;  2W1R A;  1IFQ A;  3S7O A;  4DMZ A;  5F68 A;  5G4Z A;  2VV8 A;  2ZOI A;  4HOI A;  1IOU A;  1V9Y A;  1MZU A;  4HQA A;  4MN6 A;  1TS7 A;  2HV1 A;  3E4P A;  2P04 A;  2OAP 1;  1XJ6 A;  4H6J A;  1G6O A;  2LB5 A;  4JGP A;  2V1B A;  4WL9 A;  4YOF A;  4O0P A;  4Y2F A;  1P9W A;  1S67 L;  3R7W B;  5HDC A;  4NEE D;  4HI4 A;  2VLG A;  3EGD C;  4HJ4 A;  2PYP A;  2KLI A;  3OCL A;  3CLO A;  3H7W B;  3EOI A;  2JHE A;  2W3H A;  2NUT C;  1F9I A;  1N9N A;  2J3T D;  4Y3I A;  2OWH A;  4JGR A;  5DKK A;  3VE3 A;  2V9A A;  3S7Q A;  2I9V A;  4I3I A;  1T1A A;  3OBF A;  2PR5 A;  4I39 A;  3F1N B;  3FC7 A;  3PHY A;  4HJ6 A;  5DFX A;  5DJT A;  3PXP A;  2M7V A;  2V0U A;  2JKT M;  2PD7 A;  4R3A A;  3LIB A;  3LI9 A;  3CAX A;  2IA2 A;  2WKP A;  5DKL A;  2DMW A;  2J80 A;  4NXB A;  4EXO A;  3P01 A;  3KSF A;  2JKR I;  3OCN A;  3BY8 A;  3C30 A;  4GJ4 A;  5DF9 A;  4LRX C;  1T1C A;  3KX0 X;  3KO6 A;  3B33 A;  2GJ3 A;  1LL8 A;  1T18 A;  2KX6 A;  1BYW A;  4O01 A;  4WLA A;  5I5L A;  4G3K A;  3MQO A;  4HH2 A;  5HPF A;  2R78 A;  2W1T B;  2VGL S;  4KQD A;  1UWP X;  4IUH A;  3H82 B;  2L1M A;  1OJ5 A;  3D3O A;  3HCY A;  4HY8 A;  3LR5 A;  4LRZ E;  2ZOH A;  1D06 A;  3LIC A;  2B18 A;  3F1N A;  4WF0 A;  4NXE A;  1P97 A;  3EGX C;  2QYB A;  4GHI B;  4EEP A;  2H28 A;  1P0Z A;  3PBO A;  4QPR A;  1W63 M;  3LI8 A;  3LR0 A;  4LLO B;  5EFW A;  5F6A A;  4OOL A;  4ZRR A;  2Z6D A;  2B02 A;  1MKM A;  1S1Z A;  4GLQ A;  3MJQ A;  1TS0 A;  4HHD A;  4YWZ A;  3D72 A;  4GS9 B;  3NHQ A;  2A24 B;  3EEA A;  1W63 Q;  2K2N A;  4EQ1 A;  4NXG A;  3UB9 A;  2W0N A;  4DJ2 A;  3A0S A;  2W3D A;  2W1T A;  3T4S A;  3OLO A;  4EW7 A;  1S66 L;  2MJ6 A;  3UE3 A;  5AVF A;  2ZMV A;  3IBR A;  4ME4 A;  3ZQ5 A;  4II7 A;  4EU0 A;  4HNB A;  1KOU A;  5F5Y A;  1OTA A;  4R38 A;  4CLC C;  3F1O B;  2L0W A;  3HJI A;  4GHI A;  2VGL M;  4UEY A;  2W3E A;  3UB8 A;  2P08 A;  4PAU A;  4XT2 B;  5HWV A;  2VA0 A;  5HSQ A;  4CQH A;  4WEL A;  1DP6 A;  1XFQ A;  1S1Y A;  1NLZ A;  1YSP A;  4CLC B;  1T1B A;  2V1A A;  4RQ9 A;  1F98 A;  1OTI A;  4IJG A;  3K3C A;  3UMD A;  1EW0 A;  3CUE A;  2W27 A;  2O9A A;  4EES A;  2GZA A;  3G6O A;  2VV7 A;  3RH8 B;  3T50 A;  5DFY A;  4BBT A;  5J4E A;  1GSX A;  3MFX A;  4ARZ A;  3KYQ A;  5HWT A;  3VE4 A;  5TJJ A;  2O0Y A;  1DP9 A;  3R4K A;  1STZ A;  4HIA A;  3E4Q A;  3F1P B;  4F3L B;  1GSV A;  1MC0 A;  2XA7 S;  4Q0I A;  3LFV A;  5AVE A;  3NJA A;  3RFB A;  4KUO A;  2GX5 A;  2OAQ 1;  1GSW A;  2QWS A;  3MF0 A;  4Q0H A;  4L9G A;  3F1O A;  3S7P A;  2L4R A;  5CX7 A;  4M4X A;  4XT2 A;  4LPZ A;  5G4Y A;  3NOU C;  1TS8 A;  5J7E A;  2K31 A;  3ZYT A;  3E4O A;  4G3V A;  2VX8 A;  3A0R A;  2W3F A;  1UGU A;  5DJU A;  2PYR A;  3T4T A;  4CLC A;  1XJ3 A;  2VJW A;  3LIF A;  3T4J A;  3R7W A;  5LBR A;  4GW9 A;  4WUJ A;  3U2A A;  1LSX A;  1YSQ A;  5L8M A;  4K08 A;  2M1C A;  5FL3 A;  3H7W A;  4AFI A;  4HP9 A;  1NLY A;  5HWW A;  1UWN X;  1ZHH B;  4EEU A;  3NOT C;  3KSG A;  4FOF A;  4IHQ A;  3B47 A;  2HGV A;  4I38 A;  4R70 A;  4BBU A;  3F1P A;  4F3L A;  4HJ3 A;  4I5S A;  4BBV A;  4CLC E;  1T19 A;  3CWF A;  3LIA A;  3MMH A;  3RTY A;  2YKH A;  3OC2 A;  2VKS A;  2G7U A;  2BAS A;  4I3A A;  3KYZ A;  4NKP A;  5MC7 A;  1TS6 A;  3E98 A;  3TRC A;  4BJP A;  2KOI A;  4E04 A;  2XA7 M;  1OPX A;  5IT5 A;  3LID A;  2XRO A;  4PKY G;  4MDZ A;  3LUQ A;  2Y79 A;  2FZ0 A;  1LSV A;  4Y5F A;  1ZTU A;  3IBJ A;  3FPV A;  1WA9 A;  4MN5 A;  1YAX A;  4IUK A;  2Z6C A;  1F5M A;  3EQV A;  2J3T C;  3C8C A;  4EUV A;  3OOV A;  2D01 A;  2P7J A;  3H82 A;  5HD3 A;  4KUK A;  3E0Y A;  3BWL A;  2EA9 A;  2O99 A;  3PBR A;  3T4Q A;  2V0W A;  4NXF A;  1N9L A;  3K3D A;  2JN7 A;  3IS2 B;  4WEK A;  3V67 A;  2LB9 A;  4PHT A;  3GEC A;  3MQ0 A;  2HJE A;  1XJ2 A;  2A2L A;  5IU1 A;  1LSW A;  3PBT A;  1S4S A;  5HD5 A;  5TBM B;  2XSS A;  5HPI A;  4Q0J A;  1XJ4 A;  3MR0 A;  2YKF A;  4OOM A;  2JKR M;  4L9F A;  4MN7 A;  4HH3 A;  3LYX A;  4GS9 A;  4LRY C;  2QKP A;  2ZMF A;  2A24 A;  3GDI A;  4EET B;  1XFN A;  4MCW A;  3BY9 A;  2HJ9 C;  3CI6 A;  3TE8 A;  4WEJ A;  2K7S A;  3EQU A;  3PBN A;  4FSF A;  3FG8 A;  4O8G A;  4PKY A;  3T4L A;  5KIZ A;  3NOP C;  3PYP A;  4BWI A;  2O9C A;  2PR6 A;  1X0O A;  4L0L A;  3SW1 A;  1OT6 A;  4P6Z S;  4EER A;  3IS2 A;  3KSH A;  1S4R A;  4ETX A;  3EEH A;  2WKR A;  5HDD A;  1ODV A;  1DRM A;  3FPW A;  3ULF A;  2Y8H A;  1OJG A;  2NUP C;  5K5B A;  5A8B A;  5HL6 A;  1TD5 A;  2VV6 A;  2OWJ A;  1YKD A;  1Y28 A;  1OT9 A;  5TBM A;  2VEA A;  2PHY A;  3C2W A;  1OTE A;  5KSH A;  2WKQ A;  2PT7 A;  3BQA A;  1JNU A;  5IS1 A;  4WN5 A;  3PBQ A;  4HP4 A;  3TJZ C;  3UB7 A;  1OTB A;  4CLC D;  3CIT A;  1D7E A;  1TF1 A;  3C38 A;  4L9E A;  1G28 A;  1NRJ A;  1P9R A;  4Z1W A;  3S7N A;  3H9W A;  5J3W A;  3JVU A;  5F69 A;  2PD8 A;  3B42 A;  3LR3 A;  4JGQ A;  3ICY A;  3W2Z A;  2KDK A;  4UQI S;  3T4K A;  3JVV A;  2CMN A;  3P7N A;  3VV4 A;  4JGO A;  1VB6 A;  2QHK A;  3KSI A;  4DJ3 A;  3UB6 A;  4R6L A;  4DN0 A;  3PBS A;  3PR6 A;  3MQQ A;  2ZBB A;  3TW8 A;  3UME A;  1DP8 A;  4P6Z M;  3UE6 A;  1LT0 A;  5HZH A;  5AJG A;  3MXQ A;  5HDS A;  2PDR A;  3LIE A;  4BMW A;  2EWV A;  4B93 A;  2JKT I;  3K2N A;  3BW6 A;  2FH5 A;  3VOL A;  4ETZ A;  2J3W A;  1NWZ A;  4MMN A;  1H3Q A;  2HF6 A;  4I3J A;  3EWK A;  1OTD A;  2QJ5 A;  4H6J B;  4B9O A;  2M7U A;  4KQO A;  2XRN A;  3CUE C;  1H8M A;  3BJN A;  3LR4 A;  4G3W A;  4YNR A;  2D02 A;  5C5K A;  2INW A;  3BQ8 A;  2OOL A;  2VZW A;  3O5Y A;  1V9Z A;  3HJK A;  2GNX A;  3T4O A;  2EWW A;  2O9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...