1N9OA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. composite data set.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
molecule keywords putative blue light receptor
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9oA00
3KX0X 1Y28A 2PYPA 1T1BA 2I9VA 3EWKA 3PYPA 1OTDA 1P0ZA 4HP9A 1TS0A 2R78A 4MN6A 3IS2B 3K3CA 2W27A 3NOPC 4HI4A 1ODVA 4HJ3A 3NOUC 4JGRA 4WLAA 2V0UA 4GCZA 3C2WA 4KQDA 1LSWA 2VLGA 1T19A 1KOUA 1S67L 2ZOHA 2PDRA 5F6AA 2VV7A 4LRXC 1MZUA 2OWJA 4F3LB 4BBTA 1P97A 3H7WA 4EEPA 4WUJA 3VOLA 1GSXA 1OT9A 1UGUA 3H82B 1V9ZA 1F9IA 2V0WA 3LICA 4EERA 3F1OA 2WKPA 1WA9A 4EESA 1S4RA 3CLOA 2YKHA 3A0RA 2L0WA 2QJ5A 2P7JA 3NOTC 2EA9A 5HWTA 1T18A 1XJ2A 4H6JA 3PHYA 1S1ZA 4R70A 4YWZA 4BBUA 3UB6A 3MQQA 4L9FA 1GSVA 2L1MA 2L4RA 3IBRA 5F68A 2B02A 3F1OB 4LPZA 4HH3A 3UMEA 3VE4A 3VE3A 2ZOIA 2PR5A 3FC7A 2PHYA 4I3IA 1N9LA 5IU1A 2V1BA 3LYXA 3RTYA 5G4YA 2GJ3A 4HIAA 3MR0A 4HP4A 3LI8A 1NWZA 1OTAA 2KDKA 3EEHA 2Z6CA 1DP9A 1XJ6A 4KUKA 4LRZE 2W0NA 1XJ3A 1S1YA 1VB6A 3D72A 4I3JA 3RH8B 5J3WA 3C8CA 1OTEA 1D06A 3GDIA 4R3AA 1OT6A 4BBVA 4EW7A 4L9EA 3OLOA 4MN5A 4PKYG 1S4SA 4PKYA 3LIDA 5HD5A 2QJ7A 1LL8A 1T1AA 1XJ4A 5DKLA 1EW0A 1TS7A 3LIFA 2HV1A 2YKFA 2QKPA 3E4OA 4HOIA 5HD3A 4H6JB 1T1CA 1DRMA 3H82A 1OJ5A 1LT0A 4HHDA 3NJAA 3UE6A 4DJ2A 5KIZA 1DP8A 4NXBA 2ZBBA 4HY8A 1TS6A 4RQ9A 5HDDA 2Z6DA 2V1AA 3FG8A 3UMDA 1XFQA 3F1NA 3UB8A 2WKRA 3K3DA 4JGPA 4WL9A 1S66L 2PYRA 2PD7A 3SW1A 3BWLA 2H28A 1OJGA 4K08A 4F3LA 1GSWA 5HZHA 5HSQA 2J80A 1V9YA 1XFNA 2BASA 4I39A 4M4XA 1UWNX 2K7SA 5HDCA 4B9OA 1N9NA 1OTBA 2VEAA 3LIEA 2OWHA 3CWFA 4HJ4A 4NXFA 3UB7A 5IS1A 4HH2A 4WF0A 3GECA 3LIBA 1X0OA 2PD8A 3UB9A 2QHKA 4GS9B 3ULFA 2JN7A 1OTIA 2VV6A 3A0VA 2D01A 4WN5A 5G4ZA 5TBMB 1N9OA 3MXQA 3P7NA 3BY9A 4I3AA 3MJQA 2VV8A 5HDSA 4E04A 3H7WB 4EEUA 3ZQ5A 2QWSA 4XT2A 4GHIB 5EFWA 3E4QA 4I38A 5F69A 3NHQA 2INWA 4EETB 1D7EA 4HJ6A 5DJTA 2OOLA 3F1PB 1DP6A 3BY8A 3HJIA 4JGQA 3MFXA 4LRYC 4NXGA 3T50A 5DKKA 3LIAA 2JHEA 4NXEA 4JGOA 3B33A 1UWPX 3E4PA 3IS2A 4XT2B 4L9GA 4EXOA 2CMNA 3G6OA 4HQAA 1TS8A 2PR6A 4LLOB 3F1NB 3ICYA 2D02A 2M1CA 3F1PA 3A0SA 3LUQA 5DJUA 5AVFA 2A24A 3CAXA 1G28A 1LSXA 3LI9A 2KX6A 4GHIA 1BYWA 4HNBA 3H9WA 4GS9A 4R38A 1LSVA 5TBMA 5HWWA 5F5YA 2V9AA 2WKQA 4KUOA 5I5LA 4EQ1A 4R6LA 3MQOA 5HWVA 4I5SA 5AVEA 1F98A 4DJ3A 1JNUA 3HJKA 2A24B 5J4EA 4GW9A 5J7EA 5A8BA
chains in the Genus database with same CATH superfamily
2O99A 1FSWA 5HX9A 5FDSA 1BZAA 4BLMA 1DJCA 3HLGA 1FQGA 1WA9A 4OOLA 1Q2QA 3LCEA 1IYPA 3C7UA 1HLUP 4R1GA 2L4RA 2W1TB 1ERQA 4KZ8A 3VP0A 1J3WA 4GKUA 3HVFA 3NECA 1ZC2A 1OTAA 3SS3A 4HESA 1GHPA 3UO9A 4BL2A 4IJGA 4BENA 3TE8A 2PBDP 4E3OA 1PWGA 5KSCA 1LL9A 3BRMA 4EUVA 2WGWB 4CPKA 1YLZA 1BLCA 2XA7S 2UWXA 4GLQA 3FG8A 2V20A 3WS0A 2WKRA 3BWLA 3TG9A 3ZNTA 4OP5A 1MKMA 5EVIB 4JLFA 1AXBA 3C38A 5EVEA 4S2NA 3QHYA 4R23A 3UDIA 4QPRA 1MWSA 1RGYA 4GHIB 2IWBA 1D7EA 2OOLA 3ZGAB 2JHEA 4JXSA 3B33A 3PBOA 4EXOA 2OAQ1 4N9LA 2D02A 1G28A 5DF8A 3WRZA 5HWWA 1LSVA 3KYZA 4ARZA 4UAAA 3QNCA 3HUOA 3LO7A 4PM8A 3PYPA 4MN6A 3LEZA 1BTLA 2V0UA 2OV5A 4C6YA 4ETZA 2XEPA 5TR7A 2WZZA 2JKRI 4UA9A 4Y15A 4LRXC 2ZJ9A 1TEMA 1GA0A 1STZA 2P9VB 3DWZA 1XJ2A 5FAQA 1YM1A 5EECA 2Y2MA 3DTKA 2XDMA 2HJ9C 1EROA 3TW8A 2PU4A 3MZEA 3HLWA 3IF6C 4WZ5A 4EQIA 1L2SA 4IEDA 4KQRA 4CLCC 2DMWA 3BYDA 1FR1A 1I2WA 3O88A 4ETXA 4KZ9A 3H82A 2W1RA 1O07A 1PNEA 4PAUA 2V1AA 1XGJA 4KZ3A 4OQHA 3SS4A 5M1AA 1V9YA 2ZQ9A 2C5WB 1VETA 3PBTA 1E4DA 5FI7A 2VX8A 3EQUA 4N1XA 4GD6A 2Y2KA 5DVAA 5F69A 3KSHA 3NHQA 5CGXA 1VM1A 3JPUA 3CG5A 4JGQA 3VFFA 2DCFA 1ZHHB 1ONHA 4QB8A 2WKHA 3T4KA 1E3UA 1CQAA 2B5RA 2ZQ7A 4UA7A 4GS9A 3ZVTA 2ACGA 5F5YA 1LL5A 4EQ1A 3MQOA 3GMWA 4I5SA 2QZ6A 4X55A 4BL3A 1HZOA 3N7WA 1LI0A 3JVVA 5CHJA 2PYPA 4YOFA 4NXFA 1CEFA 4WF0A 3VE4A 3NBLA 1M40A 4JGRA 4UQIS 4EWFA 4DDYA 2RCXA 4C3QA 3W8KA 4JKTA 2VV7A 2EWWA 3TSGA 1BUEA 1HVBA 2RL3A 1GA9A 1GSVA 3W2ZA 1K6RA 3HL9A 3FC7A 4S2KA 5HAPA 3LI8A 2UV0E 3RH8B 2XR0A 3EOIA 2WAFA 4ZDXA 2MJ6A 1LL8A 1NZOA 2X01A 1LLBA 1G6OA 2O9AA 3MQ0A 5FQJA 1PI4A 1MC0A 5FQMA 4EBPA 1DP8A 2E8JA 4UHUA 4P6ZM 3K3DA 2JKTI 5AQBA 2V2FF 1W8QA 5HW3A 2V8CA 4PM7A 3IF6B 3DTIA 5FQQA 4YNRA 1HD8A 3BFGA 3P7NA 2P08A 1PZOA 3H7WB 3TJZC 4XT2A 5L10A 1DP6A 1W63M 5CXWA 4E3JA 1LI9A 2J3TD 4IHQA 2EXAA 5TBMA 4EU0A 5I94A 4NKPA 5CERA 2Q9NA 3RJUA 1ES2A 1H5XA 4O7DA 2KLIA 4IVIA 3FKWA 5F1FA 4WLAA 4X68A 3DWKA 3N8SA 3C2WA 1FIKA 2OLVA 5A91A 3M2KA 4EEPA 3VOLA 1UGUA 2H5SA 3CLOA 1I5QA 3S1YA 3TRCA 3OCLA 1PW1A 3UE1A 5HFOA 3B47A 4HP4A 2KDKA 1L0GA 4ME4A 4I3JA 3OPPA 4PPRA 1K4EA 4LV0A 1L0EA 4PKYA 4II7A 1KE4A 5HAIA 5HD3A 3MZDA 4HBUA 4DJ2A 4OP8A 3OCNA 2ZBBA 4Q0JA 3BFEA 1L0DA 4Y0OA 1G5UA 4M4XA 1MWTA 2K31A 3U2AA 4B9OA 3W4QA 2ZMAA 3QP8A 2ZQ8A 4BJPA 3P01A 2PD8A 3A0VA 1N9OA 4CLCE 1ESIA 4I3AA 3MJQA 3G30A 2WUQA 3G31A 5EVIA 3F1PB 1O7EA 3IF5A 4LCLA 3T1SA 3LIAA 4BWIA 2BLSA 5CHMA 1ZG4A 1KE3A 4LLOB 3F1PA 2A24A 3MSHA 5I5LA 5CGWA 3OZHA 3IF6A 3Q82A 5J7EA 2Y55A 2W27A 3G32A 5TFQA 1BLPA 2ZOHA 1PZPA 2PDRA 4DMZA 2K2NA 4E6XA 5AQAA 2X71A 5FEGA 2GX5A 4R3BA 5CEDA 3LICA 1S4RA 4PM9A 3LFVA 3MQQA 1MWRA 2L1MA 3LGOA 1E3UD 3IHBA 3VE3A 1NZUA 2HP9A 4OPRA 3T1RA 1YAXA 3RXXA 2W3FA 3SZTA 1XJ6A 4KUKA 2J8YA 1N4OA 1YT4A 5L09A 2J7VA 1HTZA 4L9EA 1SDEA 1T1AA 3NDGA 2GNXA 2QKPA 4KG2A 5DTSA 5HL1A 4Y7PA 4CLCA 1OPXA 3JYIA 3HLDA 2Z6DA 4U3TA 4DKIA 1DJAA 4U0TA 4JBFA 4MDZA 5AQ9A 3TOIA 2QHKA 4WMCA 3BQ8A 3UPNA 3MKFA 5DF9A 5HDSA 2Y2OA 3OPHA 1K54A 4HJ6A 3MFXA 1FCMA 3QP1A 3L9KA 4K0XA 5FEFA 3F1NB 2Z2MB 2HDRA 2C6WB 1K0KA 3H9WA 2R9XA 3FKVA 1F98A 1RGZA 4O8GA 2VA0A 1YLYA 4HP9A 1Q2PA 1TD5A 4FSFA 2CC1A 2IWCA 1KOUA 3SH7A 2EX6A 2Y2NA 4MMNA 4F3LB 4QY6A 3A3DA 3DBAA 5FQIA 2LB5A 4EERA 3E98A 2QPNA 3NOTC 4OQGA 3ZHHA 3C4PA 1YLPA 1TDGA 2G7UA 3BECA 3HUMA 4JXWA 2PHYA 4ZTKA 2H0TA 2VZWA 1BSGA 1YMXA 3BEBA 1ACFA 3D72A 4G3WA 3O3VA 3S7NA 1YMSA 3BFDA 5HD5A 3IWQA 2XK1A 4HOIA 2I72A 1RCJA 3C4OA 2ZM0A 3M2JA 4JF4A 3RFBA 4JXVA 4ZAMA 2PYRA 4X25A 2IA2A 1W79A 1OJGA 4F3LA 1W8YA 1GSWA 3VP1A 4I39A 2K7SA 3KYQA 2HF6A 5TJJA 3VFHA 3UB9A 3AGEA 3GECA 3HLEA 1ERMA 3OBFA 4FUWA 2EXBA 2VGKA 1OMEA 2EFXA 2Q0OA 3DTMA 1BT5A 3PAEA 4FTXA 5JYOA 4OOYA 4O0PA 4S2LA 5D3OA 3KO6A 3RXWA 1K25A 4L9GA 3G6OA 2PR6A 1U60A 4YWZA 3LI9A 2VGLM 2V9AA 3OOVA 1K57C 1JNUA 2Q9MA 5J4EA 3BW6A 2Y91A 2Y2GA 3B42A 4HJ3A 1I2SA 3HLBA 1IYQA 3KSIA 2OSUA 5DFXA 3D3OA 3T4JA 1CI8A 4QHCA 2Y59A 1YQSA 3FZCA 3VP3A 1G6AA 2EA9A 4BBUA 1JTGA 3UB6A 1P9RA 3S7QA 1GHMA 3Q7VB 5E2HA 3UPPA 3VSLA 5EE8A 2B18A 3OPRA 4KZAA 2FZ0A 1L3LA 2W0NA 3HLFA 1PI5A 3GDIA 4EW7A 3RTYA 4KZ7A 5A90A 3OC2A 4DDSA 1BLHA 1NLYA 3R7WB 3ISGA 2P9VA 4RQ9A 2ZL1A 2GZAA 3UMDA 4KZ4A 1CEGA 1WYCA 2H28A 3LR3A 4BQMA 2KOIA 4OLDA 2Y2QA 4R0QA 5L07A 2XLNA 4OQIA 3UB5P 3C30A 5TGFA 2D01A 5E2GA 5HPFA 1A0KA 2O9BA 5E43A 4ARZB 2Y4AA 3UE3A 3E4QA 3MFDA 4LRYC 4XT2B 1S6RA 4QU3A 5FI6A 3GSGA 3IXDA 5EFWA 4P6BA 4FH2A 5IT5A 3A3FA 4K0WA 3W4PA 1KVMA 3IXBA 3Q7ZA 2V8FA 2W3GA 3MZFA 2VKSA 3IX4A 3O86A 2V1ZA 4NK3A 1MXOA 2WGIA 4N9KA 4UQIM 1WE4A 4BBTA 4KZBA 4D2OA 2ZC7A 3T4LA 2XF3A 2P7JA 5DTKA 3G2YA 5FSRA 1IKIA 1H3QA 3N8LA 3O5YA 1P9WA 5EOOA 4DE1A 2ZOIA 1ZG6A 3UDFA 1GHIA 1NRFA 4KENB 3BFFA 1ONGA 4LRZE 1S1YA 3T4SA 3C8CA 1OTEA 5DKLA 5F1GA 3EEAA 3E4OA 1SZVA 5E2EA 4GDNA 5CX7A 5KIZA 2X02A 4HY8A 2WADA 4JF6A 2ZC6B 4WL9A 5FL3A 3O87A 1VQQA 5L2FA 1F5MA 2XD1A 4ZBEA 3ZG9B 4P87A 2EX2A 4FD8A 4GS9B 1EI5A 4OH0A 5KMWA 2WK0A 5IHVA 5CGSA 3GR2A 1VHMA 4FH4A 2CMNA 1NJ4A 4HEFA 2EX8A 4Q0HA 4DE2A 3ZG8B 3PR6A 2ZMVA 3QNBA 5G18A 1ES3A 4LV2A 1OTDA 2R78A 3IQAA 2ZQDA 3NOUC 5C5KA 4OKPA 1S67L 5KSHA 1MZUA 3LY3A 1FSYA 3IXHA 3VP4A 2V0WA 3F1OA 1IELA 2QJ5A 1S1ZA 2HDUA 3G35A 3QP2A 3WWXA 5IU1A 5G4YA 2GJ3A 3N6IA 3UN7A 4X56A 1N9BA 3G2ZA 3OLOA 4E3KA 2QJ7A 3IT9A 3V67A 1TS7A 3LIFA 3CUEC 4OONA 1FCOA 1SHVA 2PT7A 1WYBA 4R3JA 4GNUA 4HJ4A 4GOGA 2HDQA 1PWCA 3LY4A 2JN7A 2H10A 1KE0A 1EWZA 4C75A 5FDHA 3T50A 3PAGA 2XD5A 3CUEA 4NXEA 3JVUA 3BQAA 4JGOA 4RX3A 2JBFA 4MLLA 4EESA 1LHYA 4E3IA 3CAXA 4Y5FA 1BYWA 4OPYA 4DJ3A 4X53A 2XH9A 4DXCA 2DRWA 2I9VA 2VGJA 3NOPC 1ODVA 2HJEA 3GQZA 1LSWA 1T19A 3ZYTA 3N8RA 5FI2A 4OQ0A 4Y17A 3A3EA 1SCWA 4DRTA 3CHWP 2J9PA 1V9ZA 3H82B 1XP4A 4RA7A 2Y2PA 3AGDA 5GHZA 5HWTA 3MKEA 3NULA 1NXYA 1DJBA 3CITA 3SH8A 2B02A 3Q1FA 1N9LA 5AJGA 4NETA 1VB6A 3NI9A 4BBVA 3T12B 3BM6A 1LT0A 3QP4A 3IH8A 3PBRA 2W3DA 5EM1A 4JPMA 5FAOA 1XFQA 4JXGA 5HZHA 4GD8A 5HDCA 4IBXA 1K38A 2WGVA 5L8MA 2AVXA 3DW0A 3WS1A 3E2KA 3ITAA 1SKOB 3IXGA 4Q0IA 4I38A 4MNRA 4U0XA 1PRQA 4L0LA 1JTDA 3IS2A 2Y2LA 4LENA 5G4ZA 5DJUA 5FQKA 5FASA 3R7WA 5J8XA 5AVEA 1KDSA 2XFSA 1G68A 2WKIA 3MXRA 2XSSA 3EWKA 1K6SA 1QMFA 3V3SA 4HI4A 4G3KA 2ZC3B 1IYOA 2Y8HA 3E0YA 5FAPA 5EVLA 3S4XA 4ESPA 4WUJA 3ZG5A 2WGWA 3Q7VA 3S7PA 1TVFA 4FOFA 1JWZA 2YKHA 4BMWA 5EUAA 4Z9QA 4GDBA 1YSPA 4E6WA 3WS2A 4M3KA 1NY0A 1PYYA 4IBRA 4D60A 4DXBA 4LV3A 3Q81A 4ZJ1A 2W1TA 2IWDA 3VOZA 2FFFB 1VEUA 2JKGA 5CECA 1OT6A 3UY6A 5GLAA 3LR4A 2YKFA 3DTEA 3PBNA 3MMHA 4KZ6A 1OJ5A 4YINA 5E2FA 4LGWA 5HAQA 5K5BA 4Z1WA 1NLZA 1TS6A 3FWLA 1KGEA 2WYXA 3P09A 3IBJA 2QMIA 2HP6A 4HBTA 3M6HA 1S0WA 1N9NA 1OTBA 3OPLA 4S2JA 3U4LP 1L0FA 3CMZA 3ITBA 5TBMB 3MXQA 4WZ5C 3BY9A 3UNWA 4WYYA 2NUPC 1CF0A 2ZLYA 1CK3A 3BY8A 5DKKA 3IWOA 4QJGA 1IEMA 1TS8A 2PAVP 5AVFA 4HNBA 1H0MA 4GHIA 3IX8A 4R38A 2WKEA 5HWVA 2ZM8A 1YSQA 2G2WA 4UEYA 1TF1A 1K4FA 4GW9A 4B88A 3A3IA 1T1BA 1P0ZA 3ZVWA 4OLGA 3IS2B 3K3CA 3MF0A 3V39A 4KQDA 5A93A 2O9CA 4KG6A 4WMCD 2OAP1 1K56A 4A5RA 1NRJA 3V3RA 1AWIA 1KGGA 4WEKA 2Y79A 5CHUA 4OPZA 4R70A 5DTTA 3IBRA 3UMEA 3FV7A 3BJNA 4HH3A 3GRJA 3FPVA 4IUKA 2V1BA 4WEJA 3HBRA 4HIAA 3NC8A 4MCWA 3MR0A 3E2LA 3EGXC 3EEHA 1KVLA 2ZMFA 1Z6FA 3GV9A 4R3AA 4BD0A 5FA7A 1ZKJA 2PRFA 1DY6A 4UA6A 1IOUA 2WAEA 1K56D 4RVAA 1CI9A 4KG5A 5FATA 4LCMA 3M6BA 4OOMA 2G2UA 2BASA 3G4PA 3WS5A 1ALQA 1K54C 3LIEA 2ZC4B 3CWFA 1X0OA 1XX2A 2EFUA 4PHTA 2XGNA 4WN5A 1FCNA 1H8ZA 4K91A 1SDNA 1W5DA 2HP5A 3C5AA 3ZQ5A 4QD4A 4MEZA 4E3MA 4MBKA 3EGDC 1UWPX 5M19A 4R4RA 1H8YA 4CQHA 2KX6A 3PXPA 4ID4A 1IYSA 1XGIA 5HL6A 2VGLS 3HJKA 3FYZA 4H8RA 1M6KA 2LB9A 4YFMA 3HCYA 3K2NA 5KZHA 5AQ7A 2VLGA 1W7FA 3FPWA 2P04A 2H0YA 2XROA 3Q07A 4QWOA 4S2MA 3T4OA 3V5MA 3VP2A 1OT9A 5CRFA 3DAVA 5F83A 3ZG0A 1FR6A 4XXRA 3IH9A 2PR5A 3UDXA 2W3HA 4ZRRA 4Y0UA 1SKFA 4LV1A 1NWZA 2ZQCA 1XA7A 4Q8IA 4X1MA 4MN5A 1Y4OA 4PKYG 4XUXA 1S4SA 3T4TA 4DE0A 5CEBA 4B93A 4HHDA 3ZCZA 2J3TC 5CTMA 1K55C 2XRNA 1KGFA 5EV0A 4FCFA 1BULA 3SW1A 5CTNA 1D1JA 1XFNA 1UWNX 1MKIA 4AFIA 3I7JA 5GHYA 3WS4A 2VV6A 2R9WA 4Y2FA 2EWVA 4E04A 4E3NA 2QWSA 5DJTA 3HJIA 4GJ4A 3SH9A 1YLJA 3ZFZA 4E3LA 4HQAA 1MBLA 1XA1A 3LUQA 2M1CA 3A0SA 3D4FA 2O0YA 4MBFA 2JE5A 5EVID 4R6LA 1PIOA 1NYMA 4O01A 3HLCA 1PFLA 2ZD8A 3L7HA 1VETB 2DNSA 3AGFA 3S7OA 2Y2HA 3QP5A 2OWJA 1K55A 1GSXA 4GN2A 4MN7A 5HARA 2WKPA 4KQQA 2HGVA 4EUZA 3CZDA 2A2LA 1T18A 1ES5A 5M18A 5F68A 1MPLA 2JKFA 2ZQAA 4OVDA 1TDLA 4RYEA 5BOHA 5J3WA 2P74A 5EOEA 2JC7A 4N92A 2WZXA 3NCKA 1XJ4A 1IKGA 1EW0A 5GHXA 4QY5A 1YLTA 2HV1A 1XPBA 4H6JB 1T1CA 5LBRA 4P0MA 3BLMA 3NDEA 4X6TA 3MXSA 3NJAA 3UE6A 5GLCA 5GLBA 2JKTM 4JGPA 4WM9A 1NYYA 5FQ9A 2OWHA 2GDNA 4KQOA 3UB7A 2QYBA 1MWUA 4GB7A 5EM0A 1SKOA 4RX2A 1RP5A 3MBZA 4Y3IA 2VV8A 4EBLA 3NIAA 4WZ4A 5MC7A 3PBSA 3SOIA 5DF7A 2M7UA 3IX3A 2Y2JA 1LSXA 4G3VA 1ESUA 1GCEA 4KUOA 2BG1A 2FH5A 3VSKA 2A24B 4EV4A 1E25A 5A8BA 4DN0A 1Y28A 3LR0A 3CI6A 3ZNYA 2B95A 4GCZA 2A3UA 4R4SA 5F6AA 3ZDJA 2BTFP 4S2NC 4EBNA 4CLCD 4IUHA 3HREA 4NEED 3GVBA 3A0RA 2L0WA 4H6JA 3T1XA 2XQZA 4LPZA 3T4QA 4I3IA 1YPRA 3A3JA 2ZL1B 3HUNA 2HDSA 4OPQA 2NUTC 1DP9A 1XJ3A 1D06A 3PTEA 4B4XA 1CJFA 4S2IA 3GTCA 1DRMA 4Y0TA 1XKZA 2VJWA 3B3XA 4NXBA 5JYPA 3VV4A 5GL9A 3F1NA 3UB8A 4S2OA 1S66L 1J9MA 1PWDA 3KSGA 3G34A 3V50A 1MY8A 4IVKA 5HPIA 5F82A 3ZG7B 5EVIC 4MBHA 4HH2A 3LIBA 2J9OA 4B4ZA 3ULFA 3CJMA 1YKDA 4EEUA 3C7VA 2FFYA 3CPTB 3VMAA 4XUZA 2EX9A 4Y13A 1KDWA 4ZJ3A 3E4PA 1F2KA 3KYEA 4WELA 2J3WA 3WRTA 4PM6A 1JWPA 1QMEA 2E8IA 3KX0X 5A92A 1ZTUA 5HSQA 1TS0A 1IFQA 2JKRM 1BLSA 3IHAA 3KSFA 4WBGA 3NY4A 3W4OA 3R4KA 3CPTA 3VOYA 2XA7M 1P97A 3H7WA 3P98A 3QP6A 3UPOA 1F9IA 3LEQA 4DE3A 5DFYA 3PHYA 4X1LA 4F94A 2VK3A 1VEUB 4L9FA 3F1OB 4GZBA 4DF6A 3LYXA 4P85A 1K57A 3S22A 3SS5A 2Z6CA 4BD1A 3IWIA 1XXMA 2A49A 3LIDA 5U47A 2HZ5A 2Y2IA 4X69A 4PM5A 1FILA 3EQVA 4LFUA 3D9YA 2PU2A 1Z09A 3MS6A 5HDDA 4S2PA 5EPHA 4KZ5A 1W63Q 2PD7A 2W3EA 4K08A 2J80A 4JF5A 3T1QB 1H8MA 2VEAA 1PW8A 2Z2LB 4ZJ2A 4CJNA 5IS1A 1Y54A 2JCHA 4N1HA 1OTIA 2ZC5B 1YLWA 2PBYA 2OLUA 3LR5A 2INWA 4EETB 4NXGA 2M7VA 1JVJA 3BFCA 4P6ZS 1JWVA 4PMAA 4NG2A 3ICYA 1FOFA 3UE0A 3PBQA 1ES4A 3N4IA 2ZM2A 2HPBA 4CLCB 2XFTA 2WKQA 3BLSA 1C3BA 5GLDA
chains in the Genus database with same CATH topology
2O99A 2LB9A 1OTDA 2R78A 3HCYA 2W27A 3K2NA 3NOUC 2VLGA 5C5KA 3FPWA 1S67L 2P04A 2PDRA 2ZOHA 2K2NA 4DMZA 5KSHA 2XROA 1MZUA 3T4OA 1OT9A 2GX5A 2V0WA 3LICA 3F1OA 1WA9A 1S4RA 4OOLA 2QJ5A 3LFVA 1S1ZA 3MQQA 2L1MA 2L4RA 2W1TB 3VE3A 2PR5A 5IU1A 5G4YA 2GJ3A 1YAXA 2W3HA 4ZRRA 2W3FA 1NWZA 1OTAA 1XJ6A 4KUKA 4IJGA 3TE8A 4L9EA 3OLOA 4MN5A 4PKYG 1S4SA 2QJ7A 1T1AA 3T4TA 3V67A 1TS7A 3LIFA 4B93A 3CUEC 4EUVA 2GNXA 2QKPA 4HHDA 2J3TC 2XRNA 4CLCA 1OPXA 2XA7S 2Z6DA 3FG8A 4GLQA 2WKRA 3SW1A 3BWLA 2PT7A 1XFNA 1MKMA 1UWNX 4HJ4A 4AFIA 4MDZA 3PR6A 3C38A 2QHKA 2JN7A 2VV6A 3BQ8A 4Y2FA 5DF9A 5HDSA 2EWVA 4QPRA 4E04A 2QWSA 4GHIB 1D7EA 4HJ6A 5DJTA 2OOLA 3HJIA 4GJ4A 3T50A 3MFXA 3CUEA 2JHEA 3JVUA 3BQAA 4JGOA 4NXEA 3B33A 3PBOA 4EXOA 2OAQ1 4HQAA 4EESA 3F1NB 3LUQA 2D02A 2M1CA 3A0SA 3CAXA 1G28A 4Y5FA 1BYWA 2O0YA 3H9WA 5HWWA 1LSVA 3KYZA 4ARZA 4R6LA 1F98A 4DJ3A 4O8GA 2VA0A 4O01A 2I9VA 3PYPA 4HP9A 4MN6A 3NOPC 1ODVA 2HJEA 2V0UA 1TD5A 4FSFA 4ETZA 1LSWA 1T19A 1KOUA 3ZYTA 3S7OA 2JKRI 4MMNA 4F3LB 4LRXC 2OWJA 1GSXA 3DBAA 3H82B 1V9ZA 4MN7A 2LB5A 4EERA 2WKPA 1STZA 3E98A 2HGVA 3NOTC 2A2LA 5HWTA 1T18A 1XJ2A 3CITA 5F68A 2G7UA 2B02A 2PHYA 2HJ9C 1N9LA 3TW8A 2VZWA 5AJGA 1VB6A 3D72A 5J3WA 4CLCC 4G3WA 3S7NA 4BBVA 5HD5A 2DMWA 1XJ4A 1EW0A 2HV1A 4ETXA 4HOIA 4H6JB 1T1CA 3H82A 2W1RA 5LBRA 1LT0A 3NJAA 3UE6A 3PBRA 4PAUA 2W3DA 3RFBA 2V1AA 1XFQA 2JKTM 4JGPA 2PYRA 2IA2A 1OJGA 4F3LA 1GSWA 5HZHA 1V9YA 4I39A 2K7SA 5HDCA 3PBTA 2OWHA 3KYQA 2HF6A 4KQOA 3UB7A 2QYBA 5TJJA 3UB9A 3GECA 2VX8A 5L8MA 4Y3IA 3EQUA 3OBFA 2VV8A 4Q0IA 5MC7A 4I38A 5F69A 3KSHA 3NHQA 4O0PA 4JGQA 4L0LA 3PBSA 3KO6A 3IS2A 4L9GA 1ZHHB 3G6OA 2PR6A 5DJUA 5G4ZA 2M7UA 3T4KA 4YWZA 1LSXA 3LI9A 4G3VA 4GS9A 2VGLM 5F5YA 2V9AA 3OOVA 4KUOA 3R7WA 4EQ1A 3MQOA 4I5SA 5AVEA 2FH5A 1JNUA 2A24B 5J4EA 3BW6A 5A8BA 2XSSA 4DN0A 1Y28A 3JVVA 3LR0A 2PYPA 4YOFA 3EWKA 4NXFA 4WF0A 3VE4A 3B42A 3CI6A 4HI4A 4G3KA 4HJ3A 4JGRA 4GCZA 4UQIS 3KSIA 2Y8HA 3E0YA 5F6AA 2VV7A 5DFXA 2EWWA 3D3OA 3T4JA 4WUJA 4CLCD 4IUHA 3S7PA 4FOFA 4NEED 2YKHA 3A0RA 2L0WA 2EA9A 4H6JA 4BBUA 4BMWA 3UB6A 1P9RA 1GSVA 1YSPA 3W2ZA 4LPZA 3S7QA 3T4QA 3FC7A 4I3IA 2B18A 3LI8A 2FZ0A 2W1TA 2NUTC 1DP9A 3RH8B 2W0NA 1XJ3A 3EOIA 1D06A 3GDIA 1OT6A 4EW7A 3RTYA 2MJ6A 1LL8A 3LR4A 3OC2A 1G6OA 2YKFA 3PBNA 3MMHA 2O9AA 1DRMA 3MQ0A 1OJ5A 1MC0A 1NLYA 3R7WB 2VJWA 1DP8A 5K5BA 4NXBA 4Z1WA 1NLZA 1TS6A 4RQ9A 2GZAA 3UMDA 4P6ZM 3VV4A 3F1NA 3IBJA 3K3DA 3UB8A 1S66L 2JKTI 2H28A 3LR3A 2KOIA 3KSGA 1N9NA 1OTBA 5HPIA 4HH2A 3LIBA 3ULFA 4YNRA 3C30A 2D01A 5TBMB 3P7NA 2P08A 1YKDA 3MXQA 5HPFA 2O9BA 3BY9A 4ARZB 4EEUA 3H7WB 3TJZC 3UE3A 2NUPC 4XT2A 3E4QA 1DP6A 3BY8A 4LRYC 1W63M 5DKKA 2J3TD 3E4PA 4XT2B 1TS8A 4IHQA 5AVFA 4HNBA 5EFWA 4GHIA 5TBMA 4EU0A 4R38A 4WELA 2J3WA 4NKPA 5HWVA 1YSQA 5IT5A 4UEYA 1TF1A 4GW9A 3KX0X 2KLIA 1T1BA 1ZTUA 1P0ZA 5HSQA 1TS0A 1IFQA 3IS2B 3K3CA 4WLAA 3MF0A 2JKRM 2W3GA 2VKSA 3C2WA 4KQDA 2O9CA 3KSFA 3R4KA 4UQIM 2OAP1 2XA7M 4BBTA 1P97A 3H7WA 4EEPA 3VOLA 1NRJA 1UGUA 1F9IA 3T4LA 4WEKA 3CLOA 2Y79A 5DFYA 2P7JA 3PHYA 4R70A 1H3QA 3O5YA 4L9FA 1P9WA 3IBRA 3UMEA 3F1OB 3BJNA 4HH3A 2ZOIA 3FPVA 3TRCA 4IUKA 2V1BA 3LYXA 4WEJA 3OCLA 4HIAA 4MCWA 3MR0A 3B47A 4HP4A 3EGXC 3EEHA 2KDKA 2ZMFA 2Z6CA 4LRZE 1S1YA 4ME4A 4I3JA 3T4SA 3C8CA 1OTEA 4R3AA 4PKYA 3LIDA 5DKLA 3EEAA 3E4OA 4II7A 5HD3A 1IOUA 3EQVA 5CX7A 4DJ2A 5KIZA 3OCNA 2ZBBA 4Q0JA 4HY8A 5HDDA 4WL9A 1W63Q 2PD7A 5FL3A 2W3EA 4K08A 2J80A 4OOMA 2BASA 4M4XA 2K31A 3U2AA 1H8MA 4B9OA 1F5MA 2VEAA 3LIEA 3CWFA 5IS1A 4BJPA 3P01A 1X0OA 2PD8A 4GS9B 4PHTA 1OTIA 3A0VA 4WN5A 1N9OA 4CLCE 4I3AA 3MJQA 3ZQ5A 3LR5A 2INWA 4EETB 3F1PB 4NXGA 2M7VA 1VHMA 3LIAA 4BWIA 3EGDC 4P6ZS 1UWPX 2CMNA 4LLOB 3ICYA 3F1PA 4CQHA 3PBQA 2A24A 2KX6A 3PXPA 4CLCB 5I5LA 2WKQA 4Q0HA 5HL6A 2VGLS 3HJKA 2ZMVA 5J7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KX0 X;  1Y28 A;  2PYP A;  1T1B A;  2I9V A;  3EWK A;  3PYP A;  1OTD A;  1P0Z A;  4HP9 A;  1TS0 A;  2R78 A;  4MN6 A;  3IS2 B;  3K3C A;  2W27 A;  3NOP C;  4HI4 A;  1ODV A;  4HJ3 A;  3NOU C;  4JGR A;  4WLA A;  2V0U A;  4GCZ A;  3C2W A;  4KQD A;  1LSW A;  2VLG A;  1T19 A;  1KOU A;  1S67 L;  2ZOH A;  2PDR A;  5F6A A;  2VV7 A;  4LRX C;  1MZU A;  2OWJ A;  4F3L B;  4BBT A;  1P97 A;  3H7W A;  4EEP A;  4WUJ A;  3VOL A;  1GSX A;  1OT9 A;  1UGU A;  3H82 B;  1V9Z A;  1F9I A;  2V0W A;  3LIC A;  4EER A;  3F1O A;  2WKP A;  1WA9 A;  4EES A;  1S4R A;  3CLO A;  2YKH A;  3A0R A;  2L0W A;  2QJ5 A;  2P7J A;  3NOT C;  2EA9 A;  5HWT A;  1T18 A;  1XJ2 A;  4H6J A;  3PHY A;  1S1Z A;  4R70 A;  4YWZ A;  4BBU A;  3UB6 A;  3MQQ A;  4L9F A;  1GSV A;  2L1M A;  2L4R A;  3IBR A;  5F68 A;  2B02 A;  3F1O B;  4LPZ A;  4HH3 A;  3UME A;  3VE4 A;  3VE3 A;  2ZOI A;  2PR5 A;  3FC7 A;  2PHY A;  4I3I A;  1N9L A;  5IU1 A;  2V1B A;  3LYX A;  3RTY A;  5G4Y A;  2GJ3 A;  4HIA A;  3MR0 A;  4HP4 A;  3LI8 A;  1NWZ A;  1OTA A;  2KDK A;  3EEH A;  2Z6C A;  1DP9 A;  1XJ6 A;  4KUK A;  4LRZ E;  2W0N A;  1XJ3 A;  1S1Y A;  1VB6 A;  3D72 A;  4I3J A;  3RH8 B;  5J3W A;  3C8C A;  1OTE A;  1D06 A;  3GDI A;  4R3A A;  1OT6 A;  4BBV A;  4EW7 A;  4L9E A;  3OLO A;  4MN5 A;  4PKY G;  1S4S A;  4PKY A;  3LID A;  5HD5 A;  2QJ7 A;  1LL8 A;  1T1A A;  1XJ4 A;  5DKL A;  1EW0 A;  1TS7 A;  3LIF A;  2HV1 A;  2YKF A;  2QKP A;  3E4O A;  4HOI A;  5HD3 A;  4H6J B;  1T1C A;  1DRM A;  3H82 A;  1OJ5 A;  1LT0 A;  4HHD A;  3NJA A;  3UE6 A;  4DJ2 A;  5KIZ A;  1DP8 A;  4NXB A;  2ZBB A;  4HY8 A;  1TS6 A;  4RQ9 A;  5HDD A;  2Z6D A;  2V1A A;  3FG8 A;  3UMD A;  1XFQ A;  3F1N A;  3UB8 A;  2WKR A;  3K3D A;  4JGP A;  4WL9 A;  1S66 L;  2PYR A;  2PD7 A;  3SW1 A;  3BWL A;  2H28 A;  1OJG A;  4K08 A;  4F3L A;  1GSW A;  5HZH A;  5HSQ A;  2J80 A;  1V9Y A;  1XFN A;  2BAS A;  4I39 A;  4M4X A;  1UWN X;  2K7S A;  5HDC A;  4B9O A;  1N9N A;  1OTB A;  2VEA A;  3LIE A;  2OWH A;  3CWF A;  4HJ4 A;  4NXF A;  3UB7 A;  5IS1 A;  4HH2 A;  4WF0 A;  3GEC A;  3LIB A;  1X0O A;  2PD8 A;  3UB9 A;  2QHK A;  4GS9 B;  3ULF A;  2JN7 A;  1OTI A;  2VV6 A;  3A0V A;  2D01 A;  4WN5 A;  5G4Z A;  5TBM B;  1N9O A;  3MXQ A;  3P7N A;  3BY9 A;  4I3A A;  3MJQ A;  2VV8 A;  5HDS A;  4E04 A;  3H7W B;  4EEU A;  3ZQ5 A;  2QWS A;  4XT2 A;  4GHI B;  5EFW A;  3E4Q A;  4I38 A;  5F69 A;  3NHQ A;  2INW A;  4EET B;  1D7E A;  4HJ6 A;  5DJT A;  2OOL A;  3F1P B;  1DP6 A;  3BY8 A;  3HJI A;  4JGQ A;  3MFX A;  4LRY C;  4NXG A;  3T50 A;  5DKK A;  3LIA A;  2JHE A;  4NXE A;  4JGO A;  3B33 A;  1UWP X;  3E4P A;  3IS2 A;  4XT2 B;  4L9G A;  4EXO A;  2CMN A;  3G6O A;  4HQA A;  1TS8 A;  2PR6 A;  4LLO B;  3F1N B;  3ICY A;  2D02 A;  2M1C A;  3F1P A;  3A0S A;  3LUQ A;  5DJU A;  5AVF A;  2A24 A;  3CAX A;  1G28 A;  1LSX A;  3LI9 A;  2KX6 A;  4GHI A;  1BYW A;  4HNB A;  3H9W A;  4GS9 A;  4R38 A;  1LSV A;  5TBM A;  5HWW A;  5F5Y A;  2V9A A;  2WKQ A;  4KUO A;  5I5L A;  4EQ1 A;  4R6L A;  3MQO A;  5HWV A;  4I5S A;  5AVE A;  1F98 A;  4DJ3 A;  1JNU A;  3HJK A;  2A24 B;  5J4E A;  4GW9 A;  5J7E A;  5A8B A; 
#chains in the Genus database with same CATH topology
 2O99 A;  1FSW A;  5HX9 A;  5FDS A;  1BZA A;  4BLM A;  1DJC A;  3HLG A;  1FQG A;  1WA9 A;  4OOL A;  1Q2Q A;  3LCE A;  1IYP A;  3C7U A;  1HLU P;  4R1G A;  2L4R A;  2W1T B;  1ERQ A;  4KZ8 A;  3VP0 A;  1J3W A;  4GKU A;  3HVF A;  3NEC A;  1ZC2 A;  1OTA A;  3SS3 A;  4HES A;  1GHP A;  3UO9 A;  4BL2 A;  4IJG A;  4BEN A;  3TE8 A;  2PBD P;  4E3O A;  1PWG A;  5KSC A;  1LL9 A;  3BRM A;  4EUV A;  2WGW B;  4CPK A;  1YLZ A;  1BLC A;  2XA7 S;  2UWX A;  4GLQ A;  3FG8 A;  2V20 A;  3WS0 A;  2WKR A;  3BWL A;  3TG9 A;  3ZNT A;  4OP5 A;  1MKM A;  5EVI B;  4JLF A;  1AXB A;  3C38 A;  5EVE A;  4S2N A;  3QHY A;  4R23 A;  3UDI A;  4QPR A;  1MWS A;  1RGY A;  4GHI B;  2IWB A;  1D7E A;  2OOL A;  3ZGA B;  2JHE A;  4JXS A;  3B33 A;  3PBO A;  4EXO A;  2OAQ 1;  4N9L A;  2D02 A;  1G28 A;  5DF8 A;  3WRZ A;  5HWW A;  1LSV A;  3KYZ A;  4ARZ A;  4UAA A;  3QNC A;  3HUO A;  3LO7 A;  4PM8 A;  3PYP A;  4MN6 A;  3LEZ A;  1BTL A;  2V0U A;  2OV5 A;  4C6Y A;  4ETZ A;  2XEP A;  5TR7 A;  2WZZ A;  2JKR I;  4UA9 A;  4Y15 A;  4LRX C;  2ZJ9 A;  1TEM A;  1GA0 A;  1STZ A;  2P9V B;  3DWZ A;  1XJ2 A;  5FAQ A;  1YM1 A;  5EEC A;  2Y2M A;  3DTK A;  2XDM A;  2HJ9 C;  1ERO A;  3TW8 A;  2PU4 A;  3MZE A;  3HLW A;  3IF6 C;  4WZ5 A;  4EQI A;  1L2S A;  4IED A;  4KQR A;  4CLC C;  2DMW A;  3BYD A;  1FR1 A;  1I2W A;  3O88 A;  4ETX A;  4KZ9 A;  3H82 A;  2W1R A;  1O07 A;  1PNE A;  4PAU A;  2V1A A;  1XGJ A;  4KZ3 A;  4OQH A;  3SS4 A;  5M1A A;  1V9Y A;  2ZQ9 A;  2C5W B;  1VET A;  3PBT A;  1E4D A;  5FI7 A;  2VX8 A;  3EQU A;  4N1X A;  4GD6 A;  2Y2K A;  5DVA A;  5F69 A;  3KSH A;  3NHQ A;  5CGX A;  1VM1 A;  3JPU A;  3CG5 A;  4JGQ A;  3VFF A;  2DCF A;  1ZHH B;  1ONH A;  4QB8 A;  2WKH A;  3T4K A;  1E3U A;  1CQA A;  2B5R A;  2ZQ7 A;  4UA7 A;  4GS9 A;  3ZVT A;  2ACG A;  5F5Y A;  1LL5 A;  4EQ1 A;  3MQO A;  3GMW A;  4I5S A;  2QZ6 A;  4X55 A;  4BL3 A;  1HZO A;  3N7W A;  1LI0 A;  3JVV A;  5CHJ A;  2PYP A;  4YOF A;  4NXF A;  1CEF A;  4WF0 A;  3VE4 A;  3NBL A;  1M40 A;  4JGR A;  4UQI S;  4EWF A;  4DDY A;  2RCX A;  4C3Q A;  3W8K A;  4JKT A;  2VV7 A;  2EWW A;  3TSG A;  1BUE A;  1HVB A;  2RL3 A;  1GA9 A;  1GSV A;  3W2Z A;  1K6R A;  3HL9 A;  3FC7 A;  4S2K A;  5HAP A;  3LI8 A;  2UV0 E;  3RH8 B;  2XR0 A;  3EOI A;  2WAF A;  4ZDX A;  2MJ6 A;  1LL8 A;  1NZO A;  2X01 A;  1LLB A;  1G6O A;  2O9A A;  3MQ0 A;  5FQJ A;  1PI4 A;  1MC0 A;  5FQM A;  4EBP A;  1DP8 A;  2E8J A;  4UHU A;  4P6Z M;  3K3D A;  2JKT I;  5AQB A;  2V2F F;  1W8Q A;  5HW3 A;  2V8C A;  4PM7 A;  3IF6 B;  3DTI A;  5FQQ A;  4YNR A;  1HD8 A;  3BFG A;  3P7N A;  2P08 A;  1PZO A;  3H7W B;  3TJZ C;  4XT2 A;  5L10 A;  1DP6 A;  1W63 M;  5CXW A;  4E3J A;  1LI9 A;  2J3T D;  4IHQ A;  2EXA A;  5TBM A;  4EU0 A;  5I94 A;  4NKP A;  5CER A;  2Q9N A;  3RJU A;  1ES2 A;  1H5X A;  4O7D A;  2KLI A;  4IVI A;  3FKW A;  5F1F A;  4WLA A;  4X68 A;  3DWK A;  3N8S A;  3C2W A;  1FIK A;  2OLV A;  5A91 A;  3M2K A;  4EEP A;  3VOL A;  1UGU A;  2H5S A;  3CLO A;  1I5Q A;  3S1Y A;  3TRC A;  3OCL A;  1PW1 A;  3UE1 A;  5HFO A;  3B47 A;  4HP4 A;  2KDK A;  1L0G A;  4ME4 A;  4I3J A;  3OPP A;  4PPR A;  1K4E A;  4LV0 A;  1L0E A;  4PKY A;  4II7 A;  1KE4 A;  5HAI A;  5HD3 A;  3MZD A;  4HBU A;  4DJ2 A;  4OP8 A;  3OCN A;  2ZBB A;  4Q0J A;  3BFE A;  1L0D A;  4Y0O A;  1G5U A;  4M4X A;  1MWT A;  2K31 A;  3U2A A;  4B9O A;  3W4Q A;  2ZMA A;  3QP8 A;  2ZQ8 A;  4BJP A;  3P01 A;  2PD8 A;  3A0V A;  1N9O A;  4CLC E;  1ESI A;  4I3A A;  3MJQ A;  3G30 A;  2WUQ A;  3G31 A;  5EVI A;  3F1P B;  1O7E A;  3IF5 A;  4LCL A;  3T1S A;  3LIA A;  4BWI A;  2BLS A;  5CHM A;  1ZG4 A;  1KE3 A;  4LLO B;  3F1P A;  2A24 A;  3MSH A;  5I5L A;  5CGW A;  3OZH A;  3IF6 A;  3Q82 A;  5J7E A;  2Y55 A;  2W27 A;  3G32 A;  5TFQ A;  1BLP A;  2ZOH A;  1PZP A;  2PDR A;  4DMZ A;  2K2N A;  4E6X A;  5AQA A;  2X71 A;  5FEG A;  2GX5 A;  4R3B A;  5CED A;  3LIC A;  1S4R A;  4PM9 A;  3LFV A;  3MQQ A;  1MWR A;  2L1M A;  3LGO A;  1E3U D;  3IHB A;  3VE3 A;  1NZU A;  2HP9 A;  4OPR A;  3T1R A;  1YAX A;  3RXX A;  2W3F A;  3SZT A;  1XJ6 A;  4KUK A;  2J8Y A;  1N4O A;  1YT4 A;  5L09 A;  2J7V A;  1HTZ A;  4L9E A;  1SDE A;  1T1A A;  3NDG A;  2GNX A;  2QKP A;  4KG2 A;  5DTS A;  5HL1 A;  4Y7P A;  4CLC A;  1OPX A;  3JYI A;  3HLD A;  2Z6D A;  4U3T A;  4DKI A;  1DJA A;  4U0T A;  4JBF A;  4MDZ A;  5AQ9 A;  3TOI A;  2QHK A;  4WMC A;  3BQ8 A;  3UPN A;  3MKF A;  5DF9 A;  5HDS A;  2Y2O A;  3OPH A;  1K54 A;  4HJ6 A;  3MFX A;  1FCM A;  3QP1 A;  3L9K A;  4K0X A;  5FEF A;  3F1N B;  2Z2M B;  2HDR A;  2C6W B;  1K0K A;  3H9W A;  2R9X A;  3FKV A;  1F98 A;  1RGZ A;  4O8G A;  2VA0 A;  1YLY A;  4HP9 A;  1Q2P A;  1TD5 A;  4FSF A;  2CC1 A;  2IWC A;  1KOU A;  3SH7 A;  2EX6 A;  2Y2N A;  4MMN A;  4F3L B;  4QY6 A;  3A3D A;  3DBA A;  5FQI A;  2LB5 A;  4EER A;  3E98 A;  2QPN A;  3NOT C;  4OQG A;  3ZHH A;  3C4P A;  1YLP A;  1TDG A;  2G7U A;  3BEC A;  3HUM A;  4JXW A;  2PHY A;  4ZTK A;  2H0T A;  2VZW A;  1BSG A;  1YMX A;  3BEB A;  1ACF A;  3D72 A;  4G3W A;  3O3V A;  3S7N A;  1YMS A;  3BFD A;  5HD5 A;  3IWQ A;  2XK1 A;  4HOI A;  2I72 A;  1RCJ A;  3C4O A;  2ZM0 A;  3M2J A;  4JF4 A;  3RFB A;  4JXV A;  4ZAM A;  2PYR A;  4X25 A;  2IA2 A;  1W79 A;  1OJG A;  4F3L A;  1W8Y A;  1GSW A;  3VP1 A;  4I39 A;  2K7S A;  3KYQ A;  2HF6 A;  5TJJ A;  3VFH A;  3UB9 A;  3AGE A;  3GEC A;  3HLE A;  1ERM A;  3OBF A;  4FUW A;  2EXB A;  2VGK A;  1OME A;  2EFX A;  2Q0O A;  3DTM A;  1BT5 A;  3PAE A;  4FTX A;  5JYO A;  4OOY A;  4O0P A;  4S2L A;  5D3O A;  3KO6 A;  3RXW A;  1K25 A;  4L9G A;  3G6O A;  2PR6 A;  1U60 A;  4YWZ A;  3LI9 A;  2VGL M;  2V9A A;  3OOV A;  1K57 C;  1JNU A;  2Q9M A;  5J4E A;  3BW6 A;  2Y91 A;  2Y2G A;  3B42 A;  4HJ3 A;  1I2S A;  3HLB A;  1IYQ A;  3KSI A;  2OSU A;  5DFX A;  3D3O A;  3T4J A;  1CI8 A;  4QHC A;  2Y59 A;  1YQS A;  3FZC A;  3VP3 A;  1G6A A;  2EA9 A;  4BBU A;  1JTG A;  3UB6 A;  1P9R A;  3S7Q A;  1GHM A;  3Q7V B;  5E2H A;  3UPP A;  3VSL A;  5EE8 A;  2B18 A;  3OPR A;  4KZA A;  2FZ0 A;  1L3L A;  2W0N A;  3HLF A;  1PI5 A;  3GDI A;  4EW7 A;  3RTY A;  4KZ7 A;  5A90 A;  3OC2 A;  4DDS A;  1BLH A;  1NLY A;  3R7W B;  3ISG A;  2P9V A;  4RQ9 A;  2ZL1 A;  2GZA A;  3UMD A;  4KZ4 A;  1CEG A;  1WYC A;  2H28 A;  3LR3 A;  4BQM A;  2KOI A;  4OLD A;  2Y2Q A;  4R0Q A;  5L07 A;  2XLN A;  4OQI A;  3UB5 P;  3C30 A;  5TGF A;  2D01 A;  5E2G A;  5HPF A;  1A0K A;  2O9B A;  5E43 A;  4ARZ B;  2Y4A A;  3UE3 A;  3E4Q A;  3MFD A;  4LRY C;  4XT2 B;  1S6R A;  4QU3 A;  5FI6 A;  3GSG A;  3IXD A;  5EFW A;  4P6B A;  4FH2 A;  5IT5 A;  3A3F A;  4K0W A;  3W4P A;  1KVM A;  3IXB A;  3Q7Z A;  2V8F A;  2W3G A;  3MZF A;  2VKS A;  3IX4 A;  3O86 A;  2V1Z A;  4NK3 A;  1MXO A;  2WGI A;  4N9K A;  4UQI M;  1WE4 A;  4BBT A;  4KZB A;  4D2O A;  2ZC7 A;  3T4L A;  2XF3 A;  2P7J A;  5DTK A;  3G2Y A;  5FSR A;  1IKI A;  1H3Q A;  3N8L A;  3O5Y A;  1P9W A;  5EOO A;  4DE1 A;  2ZOI A;  1ZG6 A;  3UDF A;  1GHI A;  1NRF A;  4KEN B;  3BFF A;  1ONG A;  4LRZ E;  1S1Y A;  3T4S A;  3C8C A;  1OTE A;  5DKL A;  5F1G A;  3EEA A;  3E4O A;  1SZV A;  5E2E A;  4GDN A;  5CX7 A;  5KIZ A;  2X02 A;  4HY8 A;  2WAD A;  4JF6 A;  2ZC6 B;  4WL9 A;  5FL3 A;  3O87 A;  1VQQ A;  5L2F A;  1F5M A;  2XD1 A;  4ZBE A;  3ZG9 B;  4P87 A;  2EX2 A;  4FD8 A;  4GS9 B;  1EI5 A;  4OH0 A;  5KMW A;  2WK0 A;  5IHV A;  5CGS A;  3GR2 A;  1VHM A;  4FH4 A;  2CMN A;  1NJ4 A;  4HEF A;  2EX8 A;  4Q0H A;  4DE2 A;  3ZG8 B;  3PR6 A;  2ZMV A;  3QNB A;  5G18 A;  1ES3 A;  4LV2 A;  1OTD A;  2R78 A;  3IQA A;  2ZQD A;  3NOU C;  5C5K A;  4OKP A;  1S67 L;  5KSH A;  1MZU A;  3LY3 A;  1FSY A;  3IXH A;  3VP4 A;  2V0W A;  3F1O A;  1IEL A;  2QJ5 A;  1S1Z A;  2HDU A;  3G35 A;  3QP2 A;  3WWX A;  5IU1 A;  5G4Y A;  2GJ3 A;  3N6I A;  3UN7 A;  4X56 A;  1N9B A;  3G2Z A;  3OLO A;  4E3K A;  2QJ7 A;  3IT9 A;  3V67 A;  1TS7 A;  3LIF A;  3CUE C;  4OON A;  1FCO A;  1SHV A;  2PT7 A;  1WYB A;  4R3J A;  4GNU A;  4HJ4 A;  4GOG A;  2HDQ A;  1PWC A;  3LY4 A;  2JN7 A;  2H10 A;  1KE0 A;  1EWZ A;  4C75 A;  5FDH A;  3T50 A;  3PAG A;  2XD5 A;  3CUE A;  4NXE A;  3JVU A;  3BQA A;  4JGO A;  4RX3 A;  2JBF A;  4MLL A;  4EES A;  1LHY A;  4E3I A;  3CAX A;  4Y5F A;  1BYW A;  4OPY A;  4DJ3 A;  4X53 A;  2XH9 A;  4DXC A;  2DRW A;  2I9V A;  2VGJ A;  3NOP C;  1ODV A;  2HJE A;  3GQZ A;  1LSW A;  1T19 A;  3ZYT A;  3N8R A;  5FI2 A;  4OQ0 A;  4Y17 A;  3A3E A;  1SCW A;  4DRT A;  3CHW P;  2J9P A;  1V9Z A;  3H82 B;  1XP4 A;  4RA7 A;  2Y2P A;  3AGD A;  5GHZ A;  5HWT A;  3MKE A;  3NUL A;  1NXY A;  1DJB A;  3CIT A;  3SH8 A;  2B02 A;  3Q1F A;  1N9L A;  5AJG A;  4NET A;  1VB6 A;  3NI9 A;  4BBV A;  3T12 B;  3BM6 A;  1LT0 A;  3QP4 A;  3IH8 A;  3PBR A;  2W3D A;  5EM1 A;  4JPM A;  5FAO A;  1XFQ A;  4JXG A;  5HZH A;  4GD8 A;  5HDC A;  4IBX A;  1K38 A;  2WGV A;  5L8M A;  2AVX A;  3DW0 A;  3WS1 A;  3E2K A;  3ITA A;  1SKO B;  3IXG A;  4Q0I A;  4I38 A;  4MNR A;  4U0X A;  1PRQ A;  4L0L A;  1JTD A;  3IS2 A;  2Y2L A;  4LEN A;  5G4Z A;  5DJU A;  5FQK A;  5FAS A;  3R7W A;  5J8X A;  5AVE A;  1KDS A;  2XFS A;  1G68 A;  2WKI A;  3MXR A;  2XSS A;  3EWK A;  1K6S A;  1QMF A;  3V3S A;  4HI4 A;  4G3K A;  2ZC3 B;  1IYO A;  2Y8H A;  3E0Y A;  5FAP A;  5EVL A;  3S4X A;  4ESP A;  4WUJ A;  3ZG5 A;  2WGW A;  3Q7V A;  3S7P A;  1TVF A;  4FOF A;  1JWZ A;  2YKH A;  4BMW A;  5EUA A;  4Z9Q A;  4GDB A;  1YSP A;  4E6W A;  3WS2 A;  4M3K A;  1NY0 A;  1PYY A;  4IBR A;  4D60 A;  4DXB A;  4LV3 A;  3Q81 A;  4ZJ1 A;  2W1T A;  2IWD A;  3VOZ A;  2FFF B;  1VEU A;  2JKG A;  5CEC A;  1OT6 A;  3UY6 A;  5GLA A;  3LR4 A;  2YKF A;  3DTE A;  3PBN A;  3MMH A;  4KZ6 A;  1OJ5 A;  4YIN A;  5E2F A;  4LGW A;  5HAQ A;  5K5B A;  4Z1W A;  1NLZ A;  1TS6 A;  3FWL A;  1KGE A;  2WYX A;  3P09 A;  3IBJ A;  2QMI A;  2HP6 A;  4HBT A;  3M6H A;  1S0W A;  1N9N A;  1OTB A;  3OPL A;  4S2J A;  3U4L P;  1L0F A;  3CMZ A;  3ITB A;  5TBM B;  3MXQ A;  4WZ5 C;  3BY9 A;  3UNW A;  4WYY A;  2NUP C;  1CF0 A;  2ZLY A;  1CK3 A;  3BY8 A;  5DKK A;  3IWO A;  4QJG A;  1IEM A;  1TS8 A;  2PAV P;  5AVF A;  4HNB A;  1H0M A;  4GHI A;  3IX8 A;  4R38 A;  2WKE A;  5HWV A;  2ZM8 A;  1YSQ A;  2G2W A;  4UEY A;  1TF1 A;  1K4F A;  4GW9 A;  4B88 A;  3A3I A;  1T1B A;  1P0Z A;  3ZVW A;  4OLG A;  3IS2 B;  3K3C A;  3MF0 A;  3V39 A;  4KQD A;  5A93 A;  2O9C A;  4KG6 A;  4WMC D;  2OAP 1;  1K56 A;  4A5R A;  1NRJ A;  3V3R A;  1AWI A;  1KGG A;  4WEK A;  2Y79 A;  5CHU A;  4OPZ A;  4R70 A;  5DTT A;  3IBR A;  3UME A;  3FV7 A;  3BJN A;  4HH3 A;  3GRJ A;  3FPV A;  4IUK A;  2V1B A;  4WEJ A;  3HBR A;  4HIA A;  3NC8 A;  4MCW A;  3MR0 A;  3E2L A;  3EGX C;  3EEH A;  1KVL A;  2ZMF A;  1Z6F A;  3GV9 A;  4R3A A;  4BD0 A;  5FA7 A;  1ZKJ A;  2PRF A;  1DY6 A;  4UA6 A;  1IOU A;  2WAE A;  1K56 D;  4RVA A;  1CI9 A;  4KG5 A;  5FAT A;  4LCM A;  3M6B A;  4OOM A;  2G2U A;  2BAS A;  3G4P A;  3WS5 A;  1ALQ A;  1K54 C;  3LIE A;  2ZC4 B;  3CWF A;  1X0O A;  1XX2 A;  2EFU A;  4PHT A;  2XGN A;  4WN5 A;  1FCN A;  1H8Z A;  4K91 A;  1SDN A;  1W5D A;  2HP5 A;  3C5A A;  3ZQ5 A;  4QD4 A;  4MEZ A;  4E3M A;  4MBK A;  3EGD C;  1UWP X;  5M19 A;  4R4R A;  1H8Y A;  4CQH A;  2KX6 A;  3PXP A;  4ID4 A;  1IYS A;  1XGI A;  5HL6 A;  2VGL S;  3HJK A;  3FYZ A;  4H8R A;  1M6K A;  2LB9 A;  4YFM A;  3HCY A;  3K2N A;  5KZH A;  5AQ7 A;  2VLG A;  1W7F A;  3FPW A;  2P04 A;  2H0Y A;  2XRO A;  3Q07 A;  4QWO A;  4S2M A;  3T4O A;  3V5M A;  3VP2 A;  1OT9 A;  5CRF A;  3DAV A;  5F83 A;  3ZG0 A;  1FR6 A;  4XXR A;  3IH9 A;  2PR5 A;  3UDX A;  2W3H A;  4ZRR A;  4Y0U A;  1SKF A;  4LV1 A;  1NWZ A;  2ZQC A;  1XA7 A;  4Q8I A;  4X1M A;  4MN5 A;  1Y4O A;  4PKY G;  4XUX A;  1S4S A;  3T4T A;  4DE0 A;  5CEB A;  4B93 A;  4HHD A;  3ZCZ A;  2J3T C;  5CTM A;  1K55 C;  2XRN A;  1KGF A;  5EV0 A;  4FCF A;  1BUL A;  3SW1 A;  5CTN A;  1D1J A;  1XFN A;  1UWN X;  1MKI A;  4AFI A;  3I7J A;  5GHY A;  3WS4 A;  2VV6 A;  2R9W A;  4Y2F A;  2EWV A;  4E04 A;  4E3N A;  2QWS A;  5DJT A;  3HJI A;  4GJ4 A;  3SH9 A;  1YLJ A;  3ZFZ A;  4E3L A;  4HQA A;  1MBL A;  1XA1 A;  3LUQ A;  2M1C A;  3A0S A;  3D4F A;  2O0Y A;  4MBF A;  2JE5 A;  5EVI D;  4R6L A;  1PIO A;  1NYM A;  4O01 A;  3HLC A;  1PFL A;  2ZD8 A;  3L7H A;  1VET B;  2DNS A;  3AGF A;  3S7O A;  2Y2H A;  3QP5 A;  2OWJ A;  1K55 A;  1GSX A;  4GN2 A;  4MN7 A;  5HAR A;  2WKP A;  4KQQ A;  2HGV A;  4EUZ A;  3CZD A;  2A2L A;  1T18 A;  1ES5 A;  5M18 A;  5F68 A;  1MPL A;  2JKF A;  2ZQA A;  4OVD A;  1TDL A;  4RYE A;  5BOH A;  5J3W A;  2P74 A;  5EOE A;  2JC7 A;  4N92 A;  2WZX A;  3NCK A;  1XJ4 A;  1IKG A;  1EW0 A;  5GHX A;  4QY5 A;  1YLT A;  2HV1 A;  1XPB A;  4H6J B;  1T1C A;  5LBR A;  4P0M A;  3BLM A;  3NDE A;  4X6T A;  3MXS A;  3NJA A;  3UE6 A;  5GLC A;  5GLB A;  2JKT M;  4JGP A;  4WM9 A;  1NYY A;  5FQ9 A;  2OWH A;  2GDN A;  4KQO A;  3UB7 A;  2QYB A;  1MWU A;  4GB7 A;  5EM0 A;  1SKO A;  4RX2 A;  1RP5 A;  3MBZ A;  4Y3I A;  2VV8 A;  4EBL A;  3NIA A;  4WZ4 A;  5MC7 A;  3PBS A;  3SOI A;  5DF7 A;  2M7U A;  3IX3 A;  2Y2J A;  1LSX A;  4G3V A;  1ESU A;  1GCE A;  4KUO A;  2BG1 A;  2FH5 A;  3VSK A;  2A24 B;  4EV4 A;  1E25 A;  5A8B A;  4DN0 A;  1Y28 A;  3LR0 A;  3CI6 A;  3ZNY A;  2B95 A;  4GCZ A;  2A3U A;  4R4S A;  5F6A A;  3ZDJ A;  2BTF P;  4S2N C;  4EBN A;  4CLC D;  4IUH A;  3HRE A;  4NEE D;  3GVB A;  3A0R A;  2L0W A;  4H6J A;  3T1X A;  2XQZ A;  4LPZ A;  3T4Q A;  4I3I A;  1YPR A;  3A3J A;  2ZL1 B;  3HUN A;  2HDS A;  4OPQ A;  2NUT C;  1DP9 A;  1XJ3 A;  1D06 A;  3PTE A;  4B4X A;  1CJF A;  4S2I A;  3GTC A;  1DRM A;  4Y0T A;  1XKZ A;  2VJW A;  3B3X A;  4NXB A;  5JYP A;  3VV4 A;  5GL9 A;  3F1N A;  3UB8 A;  4S2O A;  1S66 L;  1J9M A;  1PWD A;  3KSG A;  3G34 A;  3V50 A;  1MY8 A;  4IVK A;  5HPI A;  5F82 A;  3ZG7 B;  5EVI C;  4MBH A;  4HH2 A;  3LIB A;  2J9O A;  4B4Z A;  3ULF A;  3CJM A;  1YKD A;  4EEU A;  3C7V A;  2FFY A;  3CPT B;  3VMA A;  4XUZ A;  2EX9 A;  4Y13 A;  1KDW A;  4ZJ3 A;  3E4P A;  1F2K A;  3KYE A;  4WEL A;  2J3W A;  3WRT A;  4PM6 A;  1JWP A;  1QME A;  2E8I A;  3KX0 X;  5A92 A;  1ZTU A;  5HSQ A;  1TS0 A;  1IFQ A;  2JKR M;  1BLS A;  3IHA A;  3KSF A;  4WBG A;  3NY4 A;  3W4O A;  3R4K A;  3CPT A;  3VOY A;  2XA7 M;  1P97 A;  3H7W A;  3P98 A;  3QP6 A;  3UPO A;  1F9I A;  3LEQ A;  4DE3 A;  5DFY A;  3PHY A;  4X1L A;  4F94 A;  2VK3 A;  1VEU B;  4L9F A;  3F1O B;  4GZB A;  4DF6 A;  3LYX A;  4P85 A;  1K57 A;  3S22 A;  3SS5 A;  2Z6C A;  4BD1 A;  3IWI A;  1XXM A;  2A49 A;  3LID A;  5U47 A;  2HZ5 A;  2Y2I A;  4X69 A;  4PM5 A;  1FIL A;  3EQV A;  4LFU A;  3D9Y A;  2PU2 A;  1Z09 A;  3MS6 A;  5HDD A;  4S2P A;  5EPH A;  4KZ5 A;  1W63 Q;  2PD7 A;  2W3E A;  4K08 A;  2J80 A;  4JF5 A;  3T1Q B;  1H8M A;  2VEA A;  1PW8 A;  2Z2L B;  4ZJ2 A;  4CJN A;  5IS1 A;  1Y54 A;  2JCH A;  4N1H A;  1OTI A;  2ZC5 B;  1YLW A;  2PBY A;  2OLU A;  3LR5 A;  2INW A;  4EET B;  4NXG A;  2M7V A;  1JVJ A;  3BFC A;  4P6Z S;  1JWV A;  4PMA A;  4NG2 A;  3ICY A;  1FOF A;  3UE0 A;  3PBQ A;  1ES4 A;  3N4I A;  2ZM2 A;  2HPB A;  4CLC B;  2XFT A;  2WKQ A;  3BLS A;  1C3B A;  5GLD A; 
#chains in the Genus database with same CATH homology
 2O99 A;  2LB9 A;  1OTD A;  2R78 A;  3HCY A;  2W27 A;  3K2N A;  3NOU C;  2VLG A;  5C5K A;  3FPW A;  1S67 L;  2P04 A;  2PDR A;  2ZOH A;  2K2N A;  4DMZ A;  5KSH A;  2XRO A;  1MZU A;  3T4O A;  1OT9 A;  2GX5 A;  2V0W A;  3LIC A;  3F1O A;  1WA9 A;  1S4R A;  4OOL A;  2QJ5 A;  3LFV A;  1S1Z A;  3MQQ A;  2L1M A;  2L4R A;  2W1T B;  3VE3 A;  2PR5 A;  5IU1 A;  5G4Y A;  2GJ3 A;  1YAX A;  2W3H A;  4ZRR A;  2W3F A;  1NWZ A;  1OTA A;  1XJ6 A;  4KUK A;  4IJG A;  3TE8 A;  4L9E A;  3OLO A;  4MN5 A;  4PKY G;  1S4S A;  2QJ7 A;  1T1A A;  3T4T A;  3V67 A;  1TS7 A;  3LIF A;  4B93 A;  3CUE C;  4EUV A;  2GNX A;  2QKP A;  4HHD A;  2J3T C;  2XRN A;  4CLC A;  1OPX A;  2XA7 S;  2Z6D A;  3FG8 A;  4GLQ A;  2WKR A;  3SW1 A;  3BWL A;  2PT7 A;  1XFN A;  1MKM A;  1UWN X;  4HJ4 A;  4AFI A;  4MDZ A;  3PR6 A;  3C38 A;  2QHK A;  2JN7 A;  2VV6 A;  3BQ8 A;  4Y2F A;  5DF9 A;  5HDS A;  2EWV A;  4QPR A;  4E04 A;  2QWS A;  4GHI B;  1D7E A;  4HJ6 A;  5DJT A;  2OOL A;  3HJI A;  4GJ4 A;  3T50 A;  3MFX A;  3CUE A;  2JHE A;  3JVU A;  3BQA A;  4JGO A;  4NXE A;  3B33 A;  3PBO A;  4EXO A;  2OAQ 1;  4HQA A;  4EES A;  3F1N B;  3LUQ A;  2D02 A;  2M1C A;  3A0S A;  3CAX A;  1G28 A;  4Y5F A;  1BYW A;  2O0Y A;  3H9W A;  5HWW A;  1LSV A;  3KYZ A;  4ARZ A;  4R6L A;  1F98 A;  4DJ3 A;  4O8G A;  2VA0 A;  4O01 A;  2I9V A;  3PYP A;  4HP9 A;  4MN6 A;  3NOP C;  1ODV A;  2HJE A;  2V0U A;  1TD5 A;  4FSF A;  4ETZ A;  1LSW A;  1T19 A;  1KOU A;  3ZYT A;  3S7O A;  2JKR I;  4MMN A;  4F3L B;  4LRX C;  2OWJ A;  1GSX A;  3DBA A;  3H82 B;  1V9Z A;  4MN7 A;  2LB5 A;  4EER A;  2WKP A;  1STZ A;  3E98 A;  2HGV A;  3NOT C;  2A2L A;  5HWT A;  1T18 A;  1XJ2 A;  3CIT A;  5F68 A;  2G7U A;  2B02 A;  2PHY A;  2HJ9 C;  1N9L A;  3TW8 A;  2VZW A;  5AJG A;  1VB6 A;  3D72 A;  5J3W A;  4CLC C;  4G3W A;  3S7N A;  4BBV A;  5HD5 A;  2DMW A;  1XJ4 A;  1EW0 A;  2HV1 A;  4ETX A;  4HOI A;  4H6J B;  1T1C A;  3H82 A;  2W1R A;  5LBR A;  1LT0 A;  3NJA A;  3UE6 A;  3PBR A;  4PAU A;  2W3D A;  3RFB A;  2V1A A;  1XFQ A;  2JKT M;  4JGP A;  2PYR A;  2IA2 A;  1OJG A;  4F3L A;  1GSW A;  5HZH A;  1V9Y A;  4I39 A;  2K7S A;  5HDC A;  3PBT A;  2OWH A;  3KYQ A;  2HF6 A;  4KQO A;  3UB7 A;  2QYB A;  5TJJ A;  3UB9 A;  3GEC A;  2VX8 A;  5L8M A;  4Y3I A;  3EQU A;  3OBF A;  2VV8 A;  4Q0I A;  5MC7 A;  4I38 A;  5F69 A;  3KSH A;  3NHQ A;  4O0P A;  4JGQ A;  4L0L A;  3PBS A;  3KO6 A;  3IS2 A;  4L9G A;  1ZHH B;  3G6O A;  2PR6 A;  5DJU A;  5G4Z A;  2M7U A;  3T4K A;  4YWZ A;  1LSX A;  3LI9 A;  4G3V A;  4GS9 A;  2VGL M;  5F5Y A;  2V9A A;  3OOV A;  4KUO A;  3R7W A;  4EQ1 A;  3MQO A;  4I5S A;  5AVE A;  2FH5 A;  1JNU A;  2A24 B;  5J4E A;  3BW6 A;  5A8B A;  2XSS A;  4DN0 A;  1Y28 A;  3JVV A;  3LR0 A;  2PYP A;  4YOF A;  3EWK A;  4NXF A;  4WF0 A;  3VE4 A;  3B42 A;  3CI6 A;  4HI4 A;  4G3K A;  4HJ3 A;  4JGR A;  4GCZ A;  4UQI S;  3KSI A;  2Y8H A;  3E0Y A;  5F6A A;  2VV7 A;  5DFX A;  2EWW A;  3D3O A;  3T4J A;  4WUJ A;  4CLC D;  4IUH A;  3S7P A;  4FOF A;  4NEE D;  2YKH A;  3A0R A;  2L0W A;  2EA9 A;  4H6J A;  4BBU A;  4BMW A;  3UB6 A;  1P9R A;  1GSV A;  1YSP A;  3W2Z A;  4LPZ A;  3S7Q A;  3T4Q A;  3FC7 A;  4I3I A;  2B18 A;  3LI8 A;  2FZ0 A;  2W1T A;  2NUT C;  1DP9 A;  3RH8 B;  2W0N A;  1XJ3 A;  3EOI A;  1D06 A;  3GDI A;  1OT6 A;  4EW7 A;  3RTY A;  2MJ6 A;  1LL8 A;  3LR4 A;  3OC2 A;  1G6O A;  2YKF A;  3PBN A;  3MMH A;  2O9A A;  1DRM A;  3MQ0 A;  1OJ5 A;  1MC0 A;  1NLY A;  3R7W B;  2VJW A;  1DP8 A;  5K5B A;  4NXB A;  4Z1W A;  1NLZ A;  1TS6 A;  4RQ9 A;  2GZA A;  3UMD A;  4P6Z M;  3VV4 A;  3F1N A;  3IBJ A;  3K3D A;  3UB8 A;  1S66 L;  2JKT I;  2H28 A;  3LR3 A;  2KOI A;  3KSG A;  1N9N A;  1OTB A;  5HPI A;  4HH2 A;  3LIB A;  3ULF A;  4YNR A;  3C30 A;  2D01 A;  5TBM B;  3P7N A;  2P08 A;  1YKD A;  3MXQ A;  5HPF A;  2O9B A;  3BY9 A;  4ARZ B;  4EEU A;  3H7W B;  3TJZ C;  3UE3 A;  2NUP C;  4XT2 A;  3E4Q A;  1DP6 A;  3BY8 A;  4LRY C;  1W63 M;  5DKK A;  2J3T D;  3E4P A;  4XT2 B;  1TS8 A;  4IHQ A;  5AVF A;  4HNB A;  5EFW A;  4GHI A;  5TBM A;  4EU0 A;  4R38 A;  4WEL A;  2J3W A;  4NKP A;  5HWV A;  1YSQ A;  5IT5 A;  4UEY A;  1TF1 A;  4GW9 A;  3KX0 X;  2KLI A;  1T1B A;  1ZTU A;  1P0Z A;  5HSQ A;  1TS0 A;  1IFQ A;  3IS2 B;  3K3C A;  4WLA A;  3MF0 A;  2JKR M;  2W3G A;  2VKS A;  3C2W A;  4KQD A;  2O9C A;  3KSF A;  3R4K A;  4UQI M;  2OAP 1;  2XA7 M;  4BBT A;  1P97 A;  3H7W A;  4EEP A;  3VOL A;  1NRJ A;  1UGU A;  1F9I A;  3T4L A;  4WEK A;  3CLO A;  2Y79 A;  5DFY A;  2P7J A;  3PHY A;  4R70 A;  1H3Q A;  3O5Y A;  4L9F A;  1P9W A;  3IBR A;  3UME A;  3F1O B;  3BJN A;  4HH3 A;  2ZOI A;  3FPV A;  3TRC A;  4IUK A;  2V1B A;  3LYX A;  4WEJ A;  3OCL A;  4HIA A;  4MCW A;  3MR0 A;  3B47 A;  4HP4 A;  3EGX C;  3EEH A;  2KDK A;  2ZMF A;  2Z6C A;  4LRZ E;  1S1Y A;  4ME4 A;  4I3J A;  3T4S A;  3C8C A;  1OTE A;  4R3A A;  4PKY A;  3LID A;  5DKL A;  3EEA A;  3E4O A;  4II7 A;  5HD3 A;  1IOU A;  3EQV A;  5CX7 A;  4DJ2 A;  5KIZ A;  3OCN A;  2ZBB A;  4Q0J A;  4HY8 A;  5HDD A;  4WL9 A;  1W63 Q;  2PD7 A;  5FL3 A;  2W3E A;  4K08 A;  2J80 A;  4OOM A;  2BAS A;  4M4X A;  2K31 A;  3U2A A;  1H8M A;  4B9O A;  1F5M A;  2VEA A;  3LIE A;  3CWF A;  5IS1 A;  4BJP A;  3P01 A;  1X0O A;  2PD8 A;  4GS9 B;  4PHT A;  1OTI A;  3A0V A;  4WN5 A;  1N9O A;  4CLC E;  4I3A A;  3MJQ A;  3ZQ5 A;  3LR5 A;  2INW A;  4EET B;  3F1P B;  4NXG A;  2M7V A;  1VHM A;  3LIA A;  4BWI A;  3EGD C;  4P6Z S;  1UWP X;  2CMN A;  4LLO B;  3ICY A;  3F1P A;  4CQH A;  3PBQ A;  2A24 A;  2KX6 A;  3PXP A;  4CLC B;  5I5L A;  2WKQ A;  4Q0H A;  5HL6 A;  2VGL S;  3HJK A;  2ZMV A;  5J7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...