1N9OA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. composite data set.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
b'LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative blue light receptor
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
molecule tags Electron transport
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9oA00
1P0ZA 4MN6A 3RH8B 5HD3A 4WLAA 4GS9B 4HP9A 1MZUA 3H82B 5G4YA 5F68A 3OLOA 2WKPA 2M1CA 4PKYA 2V9AA 3LYXA 4LRYC 3MXQA 2D01A 2WKRA 1S1ZA 2K7SA 3A0VA 4I39A 2L0WA 5F6AA 2ZBBA 4BBUA 4F3LA 4GW9A 2B02A 4LRZE 2GJ3A 5J4EA 4H6JB 3PHYA 1GSVA 2L4RA 1S1YA 5DKLA 2V0WA 4K08A 3NJAA 3C8CA 3UE6A 1DP6A 4EERA 4NXFA 3F1OA 3F1NB 1OTEA 1P97A 2QKPA 3MJQA 4HJ4A 5IU1A 2V0UA 3E4OA 3GECA 4HHDA 4EEPA 1XJ2A 2VEAA 3P7NA 3VE4A 3H7WA 1XFNA 3ICYA 5A8BA 4EQ1A 1XJ6A 4JGOA 2ZOIA 4L9FA 2BASA 3ZQ5A 4L9EA 5HDCA 1JNUA 1D06A 1OTDA 3K3DA 1LL8A 5DJUA 1OJ5A 2ZOHA 1OTAA 5AVFA 1XFQA 4WF0A 4XT2B 3NHQA 4HQAA 4GHIB 3IS2A 4JGPA 5HWTA 1T19A 2EA9A 1T1CA 3KX0X 1NWZA 2VV6A 2PYRA 5IS1A 1LSXA 2CMNA 2JHEA 3RTYA 3NOTC 2W0NA 3MQOA 3G6OA 3MR0A 4I38A 4KUOA 2A24A 3UMDA 4HIAA 3MQQA 4HNBA 1S4SA 2V1BA 3IBRA 3LIAA 3FG8A 1LSVA 3LIFA 4I5SA 1G28A 1UWNX 4R6LA 4WL9A 4I3JA 2QHKA 3PYPA 1V9YA 4LLOB 1OT6A 3UB7A 1BYWA 1N9OA 3B33A 1V9ZA 4JGRA 4F3LB 3SW1A 1TS7A 4BBVA 3E4PA 5G4ZA 2P7JA 2HV1A 4LPZA 3D72A 3VE3A 4WN5A 4R3AA 1F98A 4NXGA 5I5LA 2Z6DA 2OWJA 1GSWA 2I9VA 1XJ3A 2PD8A 4NXEA 4HJ3A 5KIZA 4RQ9A 1UWPX 1XJ4A 3F1PA 2R78A 3F1OB 1N9LA 4M4XA 5DKKA 4B9OA 1F9IA 4PKYG 5HZHA 4HJ6A 5J3WA 1LT0A 4HY8A 4GCZA 3T50A 1OTBA 2D02A 2INWA 1TS8A 1EW0A 3H7WB 1T1AA 3UMEA 5DJTA 3A0SA 5TBMA 3ULFA 4HI4A 2JN7A 2OWHA 3NOUC 2YKFA 4I3IA 4EETB 2VV8A 4MN5A 4KUKA 2QJ5A 3K3CA 2YKHA 1S66L 3MFXA 3E4QA 1UGUA 4GS9A 2PDRA 1GSXA 3H82A 5HSQA 3EEHA 1DP9A 4R38A 4HH3A 3LIEA 2Z6CA 2J80A 3VOLA 5HWVA 4I3AA 3NOPC 3IS2B 5F69A 2QWSA 3BY8A 1LSWA 2VLGA 2L1MA 3HJKA 4DJ2A 3FC7A 5EFWA 3UB9A 5J7EA 2WKQA 4KQDA 3A0RA 3EWKA 4BBTA 2PR6A 2V1AA 5AVEA 3C2WA 4LRXC 4H6JA 2PHYA 2A24B 1DP8A 3F1NA 4WUJA 1X0OA 3UB8A 1WA9A 3LI9A 1OT9A 2PD7A 3LUQA 4JGQA 1KOUA 1S4RA 2QJ7A 3H9WA 4DJ3A 4L9GA 4YWZA 4R70A 3HJIA 1Y28A 1OJGA 4HH2A 3LIBA 2KDKA 1TS6A 1D7EA 1TS0A 1T1BA 4EEUA 5HD5A 1T18A 3BWLA 3F1PB 4EW7A 3CAXA 3BY9A 3CWFA 1VB6A 3LI8A 4NXBA 5HDDA 2KX6A 4XT2A 3CLOA 4GHIA 5HDSA 3GDIA 5HWWA 2OOLA 1DRMA 1N9NA 1S67L 4HOIA 2PR5A 3UB6A 4EESA 1ODVA 5TBMB 4HP4A 4EXOA 2PYPA 3LIDA 3LICA 2W27A 2H28A 1OTIA 4E04A 5F5YA 2VV7A
chains in the Genus database with same CATH superfamily
1M40A 3S7PA 3E2KA 1SKFA 4S2MA 1ZG6A 1XXMA 2Y2NA 3RH8B 5HD3A 3S1YA 1HVBA 3W4PA 3ISGA 4R0QA 3LEZA 5GHZA 1KE4A 4IHQA 3BM6A 4DE2A 4WZ4A 3CMZA 4PKYA 4R23A 3ZNYA 5L09A 1OPXA 2W3GA 5CGWA 3BFDA 2D01A 3IF6A 5HL6A 1VETB 4UQIS 2XFSA 4KG5A 1A0KA 1BT5A 2WGVA 2W3DA 1HLUP 3PBQA 3HCYA 3BFFA 4GW9A 1MBLA 3O3VA 1L0FA 1LLBA 2B02A 3S7QA 3Q1FA 2E8JA 3N8LA 2VGLM 5DF8A 1NYYA 2PRFA 4BD1A 1G5UA 3T1RA 5DKLA 2GNXA 3PR6A 2V8CA 4R4SA 1DP6A 1VQQA 3PBSA 4OP5A 5FI6A 1OTEA 3ZG0A 2QKPA 4WYYA 4JXSA 5EPHA 2VGJA 1JWZA 2V0UA 3E4OA 4PM8A 4FH2A 4JLFA 5CEBA 2AVXA 3SH7A 4MMNA 4PMAA 3ICYA 1J3WA 4EQ1A 4PAUA 4DDYA 2ZOIA 3G30A 3S7OA 5KZHA 1ZTUA 3ZQ5A 4L9EA 1D06A 3O88A 4MN7A 1OTDA 3K3DA 3N6IA 1M6KA 5DJUA 2IWDA 5FQKA 5AVFA 4JPMA 1ES5A 1XFQA 3ZDJA 4XT2B 1FR1A 4HQAA 2NUPC 4JGPA 5C5KA 4P6ZM 1N4OA 1Q2QA 4GD6A 3HUMA 4ID4A 4IUKA 2XD1A 2HJ9C 2Y2LA 2VV6A 4KZ7A 1LSXA 2GX5A 3MF0A 3W8KA 2CMNA 4EQIA 2WADA 3KYQA 1HD8A 2RCXA 1FOFA 3VP3A 3S4XA 3OPLA 3G6OA 3CUEA 4Y5FA 1WE4A 4KUOA 2A24A 3UMDA 4N9KA 2V1BA 4GB7A 4UQIM 3C7VA 4BD0A 4PM7A 4ZJ2A 3WS4A 4I3JA 3PYPA 5DTSA 1V9YA 2EX9A 4LLOB 1OT6A 3M6HA 3AGEA 5E2HA 1ONGA 2FFFB 5A91A 2B95A 1YPRA 5MC7A 4OOLA 3ZG7B 4Q0HA 5EM0A 4F3LB 3SW1A 4OPYA 3UPNA 3MZFA 5FQIA 5G4ZA 3GRJA 2P04A 1KVMA 1BSGA 5L07A 3VE3A 4LGWA 4NXGA 5I5LA 5L10A 2WKIA 3R7WA 1GSWA 4Y7PA 4NXEA 5D3OA 3HUOA 5KIZA 4RQ9A 3CUEC 4WMCD 2Y59A 3PBNA 2G2UA 5HZHA 4HJ6A 2ZQCA 4HY8A 3QP4A 1NYMA 5HX9A 4Y0OA 3T50A 4KQQA 4B93A 3SS4A 2K2NA 5CGSA 1TS8A 1EW0A 1H0MA 4IVKA 4NETA 3A0SA 3UY6A 2OWHA 4IVIA 2VV8A 3QNBA 4FD8A 2J7VA 1K25A 3TRCA 4B4XA 2XEPA 2WK0A 4HBTA 2XGNA 3EGDC 2J3TC 3ZVWA 4P85A 1PI5A 2PDRA 2QYBA 1GA9A 5HFOA 1K55A 1MWUA 4R4RA 4ETZA 4WZ5A 1RP5A 5EM1A 3LIEA 2M7UA 2JKFA 1MC0A 2VZWA 2J80A 3VOLA 5HWVA 1MKIA 3TG9A 1VETA 5F69A 5F83A 4D60A 3BQ8A 4S2JA 2W1RA 3NBLA 2Y2MA 1JTGA 3UDFA 1K0KA 1ZC2A 3JVVA 5EFWA 3HLCA 5CHMA 5J7EA 3IHAA 5FDHA 4B88A 2V1ZA 4KQDA 3UDIA 1G6OA 5A93A 1KE3A 4LRXC 3DTMA 3IXGA 1BZAA 1DP8A 2ZC5B 4E3IA 4FUWA 3L9KA 1CF0A 1SKOB 4AFIA 1MWSA 4HBUA 3ZG5A 4WUJA 4Q8IA 2QZ6A 4HESA 2XK1A 3VP0A 2P9VB 2B18A 1KOUA 1MWTA 4GKUA 4GLQA 4LFUA 4NK3A 1LI9A 3FPWA 1J9MA 4R70A 4X69A 1I5QA 4EUZA 1Y28A 2XROA 4O0PA 4P0MA 5FL3A 1K6RA 2H5SA 3BYDA 1D7EA 4KG2A 3QP8A 2ZMFA 4WELA 2XQZA 3F1PB 4G3VA 1YM1A 3LI8A 1TD5A 1W63Q 1H8MA 5HDDA 4XT2A 1ES4A 3MBZA 1G6AA 4N92A 1CQAA 4WEJA 2ZQ9A 2OOLA 5KSHA 3UB6A 4RVAA 4EESA 2ZLYA 1ODVA 2O99A 2EFXA 4E3NA 2ZMVA 5EVIB 5EE8A 4E04A 2VKSA 4EU0A 3W4QA 4X1LA 3C7UA 5EVID 1P0ZA 5AQAA 3MKEA 3Q07A 4Z1WA 3FKWA 1PRQA 3U4LP 1MZUA 3WS2A 3TSGA 1YMXA 4L0LA 3OLOA 5KMWA 2WKPA 3T4LA 2V9AA 3CITA 4JF6A 2HPBA 2XSSA 5TGFA 2WKRA 4P6BA 3A0VA 1VHMA 1E3UD 1MWRA 1CJFA 3IXDA 3OPRA 5F6AA 3C38A 4BBUA 4F3LA 2XDMA 5HAQA 4NKPA 2GJ3A 2HDUA 2ZC3B 1PWCA 4C6YA 4X55A 4FCFA 3MXSA 3T4QA 1BULA 2BLSA 3NIAA 4DDSA 4IBRA 4WMCA 2V0WA 3BQAA 4XUXA 3IQAA 3C8CA 1P9RA 4EERA 2ZM0A 1XA1A 3MJQA 3CHWP 4PM5A 1YLPA 4EEPA 1ZKJA 1XJ2A 1XGJA 3V39A 4S2PA 3SZTA 3U2AA 3CPTB 3SH8A 3VE4A 2A49A 4CPKA 5A8BA 2KOIA 3FZCA 3ZFZA 3EEAA 1IOUA 2WUQA 1G68A 4KZ9A 3HLBA 2BASA 1CEFA 3O5YA 3B47A 2ZL1B 3DTKA 4DXBA 5HDCA 2H0TA 3HUNA 4LV2A 3KSIA 3GSGA 2ZOHA 4PPRA 1OTAA 1YLZA 2Y2IA 3IXHA 4KZBA 1PW8A 1DY6A 4Q0JA 4EBNA 1DJCA 4FSFA 3WWXA 5I94A 3OZHA 3HVFA 3DBAA 3V50A 3FV7A 3KSHA 1FQGA 1DJBA 1T1CA 2Z2LB 2PYRA 5TFQA 5J8XA 3UE1A 4XXRA 5FQMA 4Z9QA 2V2FF 3ITBA 2W0NA 3I7JA 3MQOA 1PFLA 2DNSA 3MR0A 5FATA 4I38A 1FIKA 3GQZA 4R3JA 4HIAA 4GD8A 2G2WA 4K0WA 1KVLA 3DTEA 4M3KA 3LIFA 2BG1A 1SKOA 5HW3A 3OCLA 3BECA 3MMHA 5CHUA 4PM6A 4LCMA 3BEBA 3T4OA 2HF6A 4OKPA 4LV3A 3M2JA 2Y2HA 4CLCB 1V9ZA 2P9VA 2O9CA 5HPFA 5GLAA 3HLGA 3RXXA 4G3KA 4CLCD 3E0YA 3BLMA 4RX3A 4BBVA 3C5AA 5FAPA 1L2SA 1NXYA 2XLNA 3NULA 2R9XA 4S2KA 4WN5A 4OQGA 2XF3A 4R3AA 2I9VA 3A3JA 1XJ3A 3D4FA 4HJ3A 3IF6C 3UPOA 3TE8A 1XJ4A 3F1PA 1C3BA 2R78A 4JBFA 3F1OB 4M4XA 2HP6A 4QJGA 1F9IA 4DN0A 2JKRM 3BLSA 3N4IA 5FQJA 1AXBA 2LB9A 4YINA 5M18A 1O07A 2Y79A 3V3RA 1FSYA 3G2YA 3UMEA 1BLCA 1HZOA 4S2OA 3ULFA 3NOUC 2JKRI 4R3BA 4I3IA 5EVIA 2XRNA 1H3QA 4FOFA 1CI9A 5DVAA 2QJ5A 3K3CA 4ZJ1A 4X68A 5DF9A 1Q2PA 4KQRA 5CEDA 4DF6A 1S66L 1FR6A 3Q7VB 1W8YA 3E4QA 4C3QA 2Y2QA 4JKTA 2Y2KA 3EEHA 4OQHA 2Y2OA 3LR0A 3N8RA 3C30A 4IUHA 3NOPC 4R1GA 1E3UA 4EWFA 1W63M 5L2FA 1W79A 3MFDA 3IH8A 5FQQA 1JTDA 1LSWA 1H8YA 3TW8A 3TOIA 3FWLA 1YQSA 4ZBEA 4QB8A 1K38A 4ARZB 2WZZA 1BLHA 1SDNA 3C2WA 1STZA 2WYXA 2FFYA 4U0XA 3LGOA 4BLMA 2A3UA 2K31A 4ETXA 3P09A 3SS3A 5HAIA 1ACFA 1BLSA 2WGIA 3EOIA 4KZ4A 4BL2A 1VEUB 5DTKA 3UB8A 2O9AA 4ME4A 4E3LA 3LI9A 4CJNA 1F5MA 1K4FA 3GMWA 1XGIA 3QP5A 2ZM2A 3IWOA 5EV0A 2P08A 4OPRA 4NG2A 3CPTA 1BLPA 4LCLA 4BQMA 4GZBA 2JE5A 4DJ3A 1IFQA 3IBJA 4L9GA 1XA7A 1H8ZA 5KSCA 3M6BA 1OJGA 3O87A 4BMWA 2ZL1A 1TS6A 4XUZA 5FI2A 1TS0A 1T1BA 4EEUA 1WYBA 1JWVA 5F1FA 1T18A 1K6SA 1MY8A 3IHBA 3UE3A 5CERA 3BY9A 3CWFA 2UV0E 2WKEA 4NXBA 4FTXA 1SCWA 2KX6A 5GLBA 3CLOA 5FQ9A 4ZAMA 4DE3A 3T1QB 2EX6A 2JKTI 3GDIA 1S67L 1GCEA 2PR5A 5CECA 4OPQA 1RGYA 3P98A 4UEYA 4OP8A 1ESUA 4BENA 2KLIA 3RXWA 1YLYA 3VFFA 1VB6A 1LL9A 3A3DA 2H0YA 4MN6A 4GOGA 4OLGA 2I72A 3T4KA 3MXRA 1FSWA 3H82B 5G4YA 5K5BA 3LY3A 4K0XA 2M1CA 1PZOA 3LYXA 3A3IA 4LRYC 3MXQA 2JC7A 1FCOA 4PHTA 1JVJA 2K7SA 1LHYA 1YMSA 4CLCA 4Q0IA 4EV4A 2L0WA 1PI4A 2DRWA 4O8GA 3QP1A 4LRZE 1D1JA 2JBFA 2Z2MB 1BUEA 3Q82A 2LB5A 2ZQDA 3HREA 5DFXA 1S0WA 1K55C 2O9BA 3PHYA 3WRZA 1IELA 3V67A 4WZ5C 1GSVA 5FAOA 4MCWA 2L4RA 1TF1A 1S1YA 2ZC6B 4OQ0A 5HPIA 1XPBA 2VA0A 3NJAA 4NXFA 3ZNTA 3F1OA 1P97A 4KENB 1L0GA 4HJ4A 5IU1A 3UO9A 3B42A 4OOYA 3GECA 2VX8A 3HLDA 3ZCZA 1EI5A 1Y54A 3BJNA 4QPRA 1WYCA 2VEAA 3P7NA 1XFNA 2Y2GA 2Y2JA 3IWIA 4CLCC 1S6RA 5EOOA 2C6WB 5CX7A 1YLWA 3RFBA 3R4KA 1KGEA 4IJGA 3QP6A 3S7NA 3Q7VA 1YT4A 1LL8A 2J9PA 2WAEA 4WEKA 5E2GA 3HLFA 3ZVTA 2J8YA 1YKDA 1OJ5A 4NEED 4DE1A 2MJ6A 5EOEA 3UPPA 2EWVA 3NI9A 4C75A 1IYSA 5L8MA 3KSGA 4WF0A 2W3FA 3L7HA 1PYYA 3LR4A 2ZM8A 4GHIB 3EGXC 5F82A 3IXBA 2W1TB 2EA9A 3KX0X 1NWZA 1TDGA 3DWKA 1RGZA 5IS1A 2PU2A 4ARZA 2ZC7A 5JYPA 2ZQ7A 3Q7ZA 5DTTA 2HDSA 2X71A 3V3SA 3GTCA 3OPPA 5FSRA 3CZDA 3DW0A 3MQQA 5EUAA 1S4SA 4E6WA 3IBRA 3LIAA 3FG8A 1LSVA 1H5XA 4UAAA 1G28A 4R6LA 2HDRA 4LV1A 4MBKA 1PNEA 4MLLA 1VEUA 2HGVA 1K54A 4EBPA 3P01A 1IYOA 1TS7A 3PBOA 1IKIA 1MPLA 2VJWA 4Y0UA 2HV1A 4LPZA 3D72A 4X6TA 3UB5P 2OWJA 3WS0A 2ZMAA 2PD8A 4Y2FA 3DTIA 1K56A 5CTMA 2PBDP 3MS6A 5HL1A 1YSPA 3EQVA 5DKKA 1MXOA 4PKYG 3GR2A 3D3OA 4GCZA 4JF4A 2VGKA 4JF5A 3SS5A 1OTBA 4N1XA 4DMZA 4Y17A 4S2IA 4PM9A 3VSKA 2CC1A 2D02A 3W2ZA 3PBRA 2INWA 1W7FA 3H7WB 3T4JA 2XH9A 1T1AA 3A3FA 4HI4A 4K91A 2JN7A 2GZAA 4OLDA 1K54C 3VP4A 4MN5A 3HBRA 2Q0OA 3NDGA 4YFMA 2YKHA 2VK3A 4GNUA 1O7EA 1ZG4A 3WS1A 2OLVA 3VOYA 1UGUA 1GSXA 3TJZC 3H82A 4E3JA 2WAFA 2WGWB 4E3OA 1DP9A 2XA7S 1FCNA 4HH3A 2Z6CA 1KGFA 2B5RA 3OOVA 4DKIA 3IS2B 4KG6A 3DAVA 4H8RA 4QHCA 4ZDXA 5DFYA 3OC2A 3HJKA 2L1MA 4DJ2A 2FH5A 1TVFA 4Y13A 1GA0A 3OPHA 1ES3A 2WKHA 3BFGA 3T4TA 2PR6A 2V1AA 3B3XA 3LCEA 3E2LA 2ZJ9A 2PHYA 3S22A 1IEMA 5A92A 4CQHA 4O7DA 3T1SA 2Y55A 1KDWA 3EQUA 4S2NA 1FCMA 1EROA 5GLCA 1I2SA 3Q81A 1TDLA 1RCJA 3FYZA 5IHVA 4IBXA 1X0OA 3ZGAB 1OT9A 1NLYA 3IH9A 4QY6A 4JGQA 4UA7A 1ERMA 4KZ5A 3ZG8B 3RJUA 3QP2A 3UDXA 3VMAA 4MBFA 1YAXA 4E3MA 5CGXA 4HH2A 5FI7A 1K57A 3AGFA 5JYOA 3NDEA 3BWLA 4S2LA 3FPVA 1L0EA 4X25A 4EW7A 4X56A 5HAPA 2Y91A 5HARA 3MKFA 2IA2A 5FA7A 3BFCA 1XKZA 4S2NC 4GHIA 4BL3A 4X1MA 3ZG9B 2H10A 5HDSA 4YNRA 5HWWA 3D9YA 1DRMA 2W1TA 4HOIA 5TR7A 1Z09A 5TBMB 4HP4A 4EXOA 2PYPA 3G34A 3LIDA 3LICA 3T4SA 4MEZA 2VV7A 1L3LA 2XA7M 3KYZA 1NLZA 1W5DA 3VOZA 2R9WA 3PAEA 1GHMA 4WLAA 5AQ9A 4GS9B 4HP9A 3T12B 4Y15A 5F68A 4MDZA 1CI8A 1ESIA 1QMEA 3OBFA 3KO6A 1K57C 2HP5A 4ZRRA 2OSUA 4MNRA 5EVEA 5CTNA 4QY5A 3HLEA 3NC8A 1S1ZA 1VM1A 2JCHA 4I39A 2W3EA 3GV9A 3QHYA 1PWGA 2IWBA 2ZBBA 4F94A 2HDQA 5EVIC 1PIOA 1PWDA 4ZJ3A 4FH4A 4RYEA 4DXCA 2EXBA 2XR0A 1E25A 4U0TA 1PZPA 3T1XA 5EECA 5M19A 4KZAA 5J4EA 2ZC4B 1CK3A 2PT7A 5GHYA 4H6JB 2QPNA 2ACGA 2QMIA 2M7VA 1LL5A 1P9WA 1N9BA 4LV0A 1ERQA 4IEDA 4K08A 5AJGA 4DE0A 3G35A 3UE6A 4QWOA 2P74A 2PBYA 3F1NB 3WRTA 3LFVA 4G3WA 1IYPA 2NUTC 3SH9A 4HHDA 3UNWA 4BJPA 3W4OA 3IX8A 2HZ5A 4GN2A 4LENA 1I2WA 4B4ZA 4OOMA 2JKTM 3C4PA 3H7WA 3IWQA 5CXWA 1CEGA 1K56D 3BFEA 2EWWA 3MQ0A 1XJ6A 4JGOA 2A2LA 1IYQA 3JYIA 4L9FA 4HEFA 4RA7A 4KZ3A 3ITAA 4E3KA 1JNUA 3VSLA 2XD5A 1PW1A 4UA6A 2WGWA 1NZUA 2O0YA 4OH0A 5BOHA 1FILA 2J9OA 5FEFA 4KZ8A 4QD4A 3NHQA 3JVUA 3IS2A 4YOFA 5HWTA 5CRFA 1T19A 2V8FA 1Y4OA 2FZ0A 1KE0A 2UWXA 2EX2A 1NRJA 2JHEA 3RTYA 1SHVA 3NOTC 5U47A 4DRTA 2DMWA 4JXVA 2DCFA 3MZEA 4HNBA 1XX2A 5FASA 1NY0A 1YLTA 1L0DA 3JPUA 4N9LA 1MKMA 3G32A 3QNCA 4I5SA 3MZDA 2ZD8A 3PBTA 4UA9A 5DF7A 3G2ZA 1UWNX 3BW6A 3IX3A 3E98A 4WL9A 1F2KA 3IF6B 2QHKA 3MSHA 5A90A 3K2NA 3UB7A 1BYWA 1N9OA 3B33A 2HP9A 3ZYTA 2RL3A 1AWIA 1ES2A 2J3WA 4JGRA 4E6XA 4N1HA 3DWZA 2Q9NA 2OLUA 3E4PA 1SZVA 2P7JA 3AGDA 2ZQAA 5M1AA 3KYEA 5FEGA 1F98A 5GHXA 1IKGA 2Z6DA 5CHJA 4ESPA 5EVLA 4OONA 4EBLA 3G4PA 5IT5A 4WBGA 1ZHHB 4ZTKA 4OVDA 1Z6FA 3LR5A 1HTZA 1UWPX 1N9LA 4D2OA 1E4DA 4B9OA 5J3WA 1LT0A 1SDEA 2GDNA 3N7WA 3NCKA 4OQIA 3IT9A 3HL9A 5F1GA 2EX8A 1NRFA 2WZXA 3ZHHA 1XP4A 1BTLA 3PXPA 3G31A 5DJTA 5TBMA 2G7UA 2YKFA 4EETB 1JWPA 2OAP1 4Y3IA 4KUKA 2JKGA 3LO7A 3IF5A 3CG5A 3WS5A 5E43A 3MFXA 4GS9A 2X02A 5HSQA 2EXAA 3PTEA 3A3EA 2EFUA 4R38A 4EUVA 3PAGA 4RX2A 4KQOA 4I3AA 2OV5A 2C5WB 3V5MA 2QWSA 3BY8A 4U3TA 3OCNA 5G18A 2VLGA 3SOIA 3FC7A 3UB9A 4MBHA 1LI0A 1EWZA 2WKQA 3A0RA 3EWKA 4GDNA 4A5RA 3VFHA 4BBTA 1TEMA 5AVEA 2HJEA 4H6JA 1GHPA 3LY4A 4CLCE 3CJMA 4II7A 4JXGA 2A24B 2VGLS 1K4EA 2Q9MA 3LR3A 2E8IA 3LEQA 1KGGA 3VP1A 2XFTA 4JXWA 3BRMA 3F1NA 5TJJA 5E2FA 5AQ7A 1WA9A 3UN7A 2PD7A 3LUQA 3CI6A 4P87A 1ONHA 3NECA 1YSQA 1KDSA 1YLJA 3NY4A 1S4RA 1W8QA 2QJ7A 4O01A 4QU3A 4X53A 3H9WA 5GL9A 3UE0A 1GHIA 4YWZA 2BTFP 3HJIA 2PAVP 3O86A 4GJ4A 5FDSA 3R7WB 2J3TD 1OMEA 5GLDA 3LIBA 2KDKA 2X01A 3VP2A 5HD5A 5E2EA 5LBRA 3VV4A 3CAXA 4Y0TA 2PU4A 4OPZA 2IWCA 3IX4A 1DJAA 2Y8HA 3KSFA 4BWIA 2W3HA 3C4OA 3HLWA 4KZ6A 2V20A 3M2KA 3N8SA 1N9NA 1NZOA 3GVBA 2Y2PA 2OAQ1 1QMFA 2Y4AA 1ALQA 1U60A 5AQBA 4UHUA 2W27A 4P6ZS 4WM9A 3FKVA 1NJ4A 2H28A 1OTIA 2ZQ8A 5FAQA 5F5YA 4GDBA
chains in the Genus database with same CATH topology
1P0ZA 2XA7M 3KYZA 1NLZA 3S7PA 4MN6A 4Z1WA 3RH8B 3T4KA 5HD3A 4WLAA 4GS9B 4HP9A 1MZUA 3H82B 5G4YA 4IHQA 5F68A 4MDZA 5K5BA 4L0LA 3OLOA 3OBFA 2WKPA 3KO6A 3T4LA 2M1CA 4PKYA 4ZRRA 2V9AA 3LYXA 4LRYC 1OPXA 2W3GA 3CITA 2XSSA 3MXQA 2D01A 5HL6A 2WKRA 4PHTA 1S1ZA 2K7SA 3A0VA 4UQIS 4I39A 1VHMA 2W3EA 4CLCA 4Q0IA 2L0WA 5F6AA 2W3DA 2ZBBA 3PBQA 3C38A 3HCYA 4BBUA 4O8GA 4F3LA 4GW9A 4NKPA 2B02A 4LRZE 3S7QA 2GJ3A 2VGLM 5J4EA 2LB5A 5DFXA 2PT7A 2O9BA 3T4QA 4H6JB 3PHYA 3V67A 1GSVA 2M7VA 1P9WA 4MCWA 2L4RA 1TF1A 1S1YA 5DKLA 5HPIA 2V0WA 4K08A 2GNXA 3BQAA 2VA0A 3PR6A 3NJAA 5AJGA 3C8CA 1P9RA 1DP6A 3UE6A 4EERA 4NXFA 3PBSA 3F1OA 3F1NB 1OTEA 1P97A 2QKPA 3MJQA 4HJ4A 3LFVA 5IU1A 4G3WA 2NUTC 3B42A 2V0UA 3E4OA 3GECA 4HHDA 2VX8A 4BJPA 4EEPA 1XJ2A 3U2AA 3BJNA 4QPRA 4OOMA 2JKTM 2VEAA 4MMNA 3P7NA 3VE4A 3H7WA 1XFNA 3ICYA 2KOIA 5A8BA 4EQ1A 2EWWA 4CLCC 3MQ0A 4PAUA 3EEAA 1XJ6A 4JGOA 2A2LA 2ZOIA 1IOUA 4L9FA 3S7OA 2BASA 3O5YA 3B47A 5CX7A 1ZTUA 3RFBA 3ZQ5A 4L9EA 3R4KA 4IJGA 5HDCA 1JNUA 1D06A 3S7NA 4MN7A 1OTDA 3K3DA 1LL8A 4WEKA 5DJUA 3KSIA 1YKDA 1OJ5A 4NEED 2ZOHA 1OTAA 2MJ6A 2O0YA 5AVFA 2EWVA 1XFQA 5L8MA 3KSGA 4WF0A 2W3FA 4XT2B 3NHQA 4Q0JA 4HQAA 3LR4A 3JVUA 4FSFA 4GHIB 3EGXC 3IS2A 4JGPA 4YOFA 2NUPC 5C5KA 4P6ZM 5HWTA 3DBAA 3KSHA 1T19A 2W1TB 2EA9A 1T1CA 2FZ0A 3KX0X 1NWZA 4IUKA 2HJ9C 2VV6A 2PYRA 5IS1A 1LSXA 2GX5A 3MF0A 2CMNA 1NRJA 3KYQA 4ARZA 2JHEA 3RTYA 3NOTC 2W0NA 2DMWA 3MQOA 3G6OA 3CUEA 3MR0A 4Y5FA 4I38A 4KUOA 2A24A 3UMDA 4HIAA 3MQQA 4HNBA 1S4SA 2V1BA 4UQIM 3IBRA 3LIAA 3FG8A 1LSVA 3LIFA 1MKMA 4I5SA 3PBTA 1G28A 1UWNX 4R6LA 3OCLA 3BW6A 3E98A 3MMHA 4WL9A 4I3JA 2QHKA 3PYPA 1V9YA 3K2NA 4LLOB 1OT6A 2HF6A 2HGVA 3T4OA 3UB7A 1BYWA 1N9OA 3B33A 1V9ZA 4CLCB 3ZYTA 5MC7A 2O9CA 2J3WA 4OOLA 4JGRA 5HPFA 4Q0HA 4F3LB 4G3KA 3SW1A 4CLCD 3E0YA 3P01A 1TS7A 3PBOA 4BBVA 3E4PA 5G4ZA 2P7JA 2P04A 2VJWA 2HV1A 4LPZA 3D72A 3VE3A 4WN5A 4R3AA 1F98A 4NXGA 5I5LA 2Z6DA 2OWJA 3R7WA 1GSWA 2I9VA 1XJ3A 2PD8A 4NXEA 4Y2FA 5IT5A 4HJ3A 1ZHHB 3LR5A 5KIZA 4RQ9A 3TE8A 3CUEC 1UWPX 1XJ4A 3F1PA 2R78A 1YSPA 1N9LA 3F1OB 3EQVA 3PBNA 4M4XA 5DKKA 4B9OA 1F9IA 4PKYG 5HZHA 4DN0A 4HJ6A 5J3WA 1LT0A 2JKRM 4HY8A 3D3OA 4GCZA 3T50A 1OTBA 2LB9A 4B93A 4DMZA 2K2NA 2Y79A 2D02A 3W2ZA 3PBRA 2INWA 1TS8A 1EW0A 3H7WB 3T4JA 1T1AA 3PXPA 3UMEA 5DJTA 3A0SA 5TBMA 3ULFA 4HI4A 2JN7A 2GZAA 2OWHA 3NOUC 2G7UA 5F5YA 2JKRI 2YKFA 4I3IA 4EETB 2VV8A 4MN5A 2XRNA 2OAP1 4Y3IA 1H3QA 4FOFA 4KUKA 2QJ5A 3TRCA 3K3CA 2YKHA 5DF9A 1S66L 3MFXA 3EGDC 2J3TC 3E4QA 1UGUA 4GS9A 2PDRA 2QYBA 1GSXA 3TJZC 3H82A 5HSQA 3EEHA 1DP9A 4R38A 2XA7S 4ETZA 4EUVA 3LR0A 4HH3A 3LIEA 2Z6CA 2M7UA 4KQOA 1MC0A 2VZWA 2J80A 3C30A 3OOVA 4IUHA 4I3AA 3VOLA 3NOPC 5HWVA 3IS2B 5F69A 1W63M 2QWSA 3BY8A 3BQ8A 5DFYA 2W1RA 3OCNA 3OC2A 1LSWA 2VLGA 2L1MA 3HJKA 3TW8A 4DJ2A 3FC7A 3JVVA 5EFWA 3UB9A 2FH5A 5J7EA 4ARZB 2WKQA 4KQDA 3A0RA 3EWKA 4BBTA 3T4TA 2PR6A 2V1AA 5AVEA 1G6OA 3C2WA 4LRXC 2HJEA 4H6JA 4CLCE 4II7A 2PHYA 1STZA 2A24B 2VGLS 1DP8A 4CQHA 3LR3A 2K31A 4ETXA 3EQUA 4AFIA 3F1NA 3EOIA 4WUJA 5TJJA 1X0OA 3UB8A 1WA9A 2O9AA 4ME4A 3LI9A 1OT9A 1NLYA 2PD7A 3LUQA 1F5MA 2B18A 3CI6A 4JGQA 1YSQA 1KOUA 2P08A 4GLQA 1S4RA 2QJ7A 4O01A 3H9WA 3FPWA 1IFQA 4DJ3A 3IBJA 4L9GA 4YWZA 4R70A 1YAXA 3HJIA 1Y28A 2XROA 1OJGA 4GJ4A 4O0PA 3R7WB 4BMWA 2J3TD 4HH2A 5FL3A 3LIBA 2KDKA 1TS6A 1D7EA 1TS0A 1T1BA 2ZMFA 4EEUA 5HD5A 5LBRA 1T18A 3BWLA 3VV4A 4WELA 3FPVA 3F1PB 3UE3A 4EW7A 3CAXA 4G3VA 3BY9A 3CWFA 3LI8A 4NXBA 1TD5A 1W63Q 2IA2A 1H8MA 5HDDA 2KX6A 2Y8HA 3KSFA 4BWIA 4XT2A 2W3HA 3CLOA 4GHIA 4WEJA 5HDSA 2JKTI 3GDIA 4YNRA 5HWWA 2OOLA 1DRMA 2W1TA 1N9NA 1S67L 2OAQ1 4HOIA 2PR5A 5KSHA 3UB6A 4EESA 4UEYA 1ODVA 2O99A 5TBMB 4HP4A 4EXOA 2PYPA 2ZMVA 3LIDA 3LICA 2W27A 4P6ZS 3T4SA 2KLIA 2H28A 1OTIA 4E04A 4EU0A 2VKSA 1VB6A 2VV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0Z A;  4MN6 A;  3RH8 B;  5HD3 A;  4WLA A;  4GS9 B;  4HP9 A;  1MZU A;  3H82 B;  5G4Y A;  5F68 A;  3OLO A;  2WKP A;  2M1C A;  4PKY A;  2V9A A;  3LYX A;  4LRY C;  3MXQ A;  2D01 A;  2WKR A;  1S1Z A;  2K7S A;  3A0V A;  4I39 A;  2L0W A;  5F6A A;  2ZBB A;  4BBU A;  4F3L A;  4GW9 A;  2B02 A;  4LRZ E;  2GJ3 A;  5J4E A;  4H6J B;  3PHY A;  1GSV A;  2L4R A;  1S1Y A;  5DKL A;  2V0W A;  4K08 A;  3NJA A;  3C8C A;  3UE6 A;  1DP6 A;  4EER A;  4NXF A;  3F1O A;  3F1N B;  1OTE A;  1P97 A;  2QKP A;  3MJQ A;  4HJ4 A;  5IU1 A;  2V0U A;  3E4O A;  3GEC A;  4HHD A;  4EEP A;  1XJ2 A;  2VEA A;  3P7N A;  3VE4 A;  3H7W A;  1XFN A;  3ICY A;  5A8B A;  4EQ1 A;  1XJ6 A;  4JGO A;  2ZOI A;  4L9F A;  2BAS A;  3ZQ5 A;  4L9E A;  5HDC A;  1JNU A;  1D06 A;  1OTD A;  3K3D A;  1LL8 A;  5DJU A;  1OJ5 A;  2ZOH A;  1OTA A;  5AVF A;  1XFQ A;  4WF0 A;  4XT2 B;  3NHQ A;  4HQA A;  4GHI B;  3IS2 A;  4JGP A;  5HWT A;  1T19 A;  2EA9 A;  1T1C A;  3KX0 X;  1NWZ A;  2VV6 A;  2PYR A;  5IS1 A;  1LSX A;  2CMN A;  2JHE A;  3RTY A;  3NOT C;  2W0N A;  3MQO A;  3G6O A;  3MR0 A;  4I38 A;  4KUO A;  2A24 A;  3UMD A;  4HIA A;  3MQQ A;  4HNB A;  1S4S A;  2V1B A;  3IBR A;  3LIA A;  3FG8 A;  1LSV A;  3LIF A;  4I5S A;  1G28 A;  1UWN X;  4R6L A;  4WL9 A;  4I3J A;  2QHK A;  3PYP A;  1V9Y A;  4LLO B;  1OT6 A;  3UB7 A;  1BYW A;  1N9O A;  3B33 A;  1V9Z A;  4JGR A;  4F3L B;  3SW1 A;  1TS7 A;  4BBV A;  3E4P A;  5G4Z A;  2P7J A;  2HV1 A;  4LPZ A;  3D72 A;  3VE3 A;  4WN5 A;  4R3A A;  1F98 A;  4NXG A;  5I5L A;  2Z6D A;  2OWJ A;  1GSW A;  2I9V A;  1XJ3 A;  2PD8 A;  4NXE A;  4HJ3 A;  5KIZ A;  4RQ9 A;  1UWP X;  1XJ4 A;  3F1P A;  2R78 A;  3F1O B;  1N9L A;  4M4X A;  5DKK A;  4B9O A;  1F9I A;  4PKY G;  5HZH A;  4HJ6 A;  5J3W A;  1LT0 A;  4HY8 A;  4GCZ A;  3T50 A;  1OTB A;  2D02 A;  2INW A;  1TS8 A;  1EW0 A;  3H7W B;  1T1A A;  3UME A;  5DJT A;  3A0S A;  5TBM A;  3ULF A;  4HI4 A;  2JN7 A;  2OWH A;  3NOU C;  2YKF A;  4I3I A;  4EET B;  2VV8 A;  4MN5 A;  4KUK A;  2QJ5 A;  3K3C A;  2YKH A;  1S66 L;  3MFX A;  3E4Q A;  1UGU A;  4GS9 A;  2PDR A;  1GSX A;  3H82 A;  5HSQ A;  3EEH A;  1DP9 A;  4R38 A;  4HH3 A;  3LIE A;  2Z6C A;  2J80 A;  3VOL A;  5HWV A;  4I3A A;  3NOP C;  3IS2 B;  5F69 A;  2QWS A;  3BY8 A;  1LSW A;  2VLG A;  2L1M A;  3HJK A;  4DJ2 A;  3FC7 A;  5EFW A;  3UB9 A;  5J7E A;  2WKQ A;  4KQD A;  3A0R A;  3EWK A;  4BBT A;  2PR6 A;  2V1A A;  5AVE A;  3C2W A;  4LRX C;  4H6J A;  2PHY A;  2A24 B;  1DP8 A;  3F1N A;  4WUJ A;  1X0O A;  3UB8 A;  1WA9 A;  3LI9 A;  1OT9 A;  2PD7 A;  3LUQ A;  4JGQ A;  1KOU A;  1S4R A;  2QJ7 A;  3H9W A;  4DJ3 A;  4L9G A;  4YWZ A;  4R70 A;  3HJI A;  1Y28 A;  1OJG A;  4HH2 A;  3LIB A;  2KDK A;  1TS6 A;  1D7E A;  1TS0 A;  1T1B A;  4EEU A;  5HD5 A;  1T18 A;  3BWL A;  3F1P B;  4EW7 A;  3CAX A;  3BY9 A;  3CWF A;  1VB6 A;  3LI8 A;  4NXB A;  5HDD A;  2KX6 A;  4XT2 A;  3CLO A;  4GHI A;  5HDS A;  3GDI A;  5HWW A;  2OOL A;  1DRM A;  1N9N A;  1S67 L;  4HOI A;  2PR5 A;  3UB6 A;  4EES A;  1ODV A;  5TBM B;  4HP4 A;  4EXO A;  2PYP A;  3LID A;  3LIC A;  2W27 A;  2H28 A;  1OTI A;  4E04 A;  5F5Y A;  2VV7 A; 
#chains in the Genus database with same CATH topology
 1M40 A;  3S7P A;  3E2K A;  1SKF A;  4S2M A;  1ZG6 A;  1XXM A;  2Y2N A;  3RH8 B;  5HD3 A;  3S1Y A;  1HVB A;  3W4P A;  3ISG A;  4R0Q A;  3LEZ A;  5GHZ A;  1KE4 A;  4IHQ A;  3BM6 A;  4DE2 A;  4WZ4 A;  3CMZ A;  4PKY A;  4R23 A;  3ZNY A;  5L09 A;  1OPX A;  2W3G A;  5CGW A;  3BFD A;  2D01 A;  3IF6 A;  5HL6 A;  1VET B;  4UQI S;  2XFS A;  4KG5 A;  1A0K A;  1BT5 A;  2WGV A;  2W3D A;  1HLU P;  3PBQ A;  3HCY A;  3BFF A;  4GW9 A;  1MBL A;  3O3V A;  1L0F A;  1LLB A;  2B02 A;  3S7Q A;  3Q1F A;  2E8J A;  3N8L A;  2VGL M;  5DF8 A;  1NYY A;  2PRF A;  4BD1 A;  1G5U A;  3T1R A;  5DKL A;  2GNX A;  3PR6 A;  2V8C A;  4R4S A;  1DP6 A;  1VQQ A;  3PBS A;  4OP5 A;  5FI6 A;  1OTE A;  3ZG0 A;  2QKP A;  4WYY A;  4JXS A;  5EPH A;  2VGJ A;  1JWZ A;  2V0U A;  3E4O A;  4PM8 A;  4FH2 A;  4JLF A;  5CEB A;  2AVX A;  3SH7 A;  4MMN A;  4PMA A;  3ICY A;  1J3W A;  4EQ1 A;  4PAU A;  4DDY A;  2ZOI A;  3G30 A;  3S7O A;  5KZH A;  1ZTU A;  3ZQ5 A;  4L9E A;  1D06 A;  3O88 A;  4MN7 A;  1OTD A;  3K3D A;  3N6I A;  1M6K A;  5DJU A;  2IWD A;  5FQK A;  5AVF A;  4JPM A;  1ES5 A;  1XFQ A;  3ZDJ A;  4XT2 B;  1FR1 A;  4HQA A;  2NUP C;  4JGP A;  5C5K A;  4P6Z M;  1N4O A;  1Q2Q A;  4GD6 A;  3HUM A;  4ID4 A;  4IUK A;  2XD1 A;  2HJ9 C;  2Y2L A;  2VV6 A;  4KZ7 A;  1LSX A;  2GX5 A;  3MF0 A;  3W8K A;  2CMN A;  4EQI A;  2WAD A;  3KYQ A;  1HD8 A;  2RCX A;  1FOF A;  3VP3 A;  3S4X A;  3OPL A;  3G6O A;  3CUE A;  4Y5F A;  1WE4 A;  4KUO A;  2A24 A;  3UMD A;  4N9K A;  2V1B A;  4GB7 A;  4UQI M;  3C7V A;  4BD0 A;  4PM7 A;  4ZJ2 A;  3WS4 A;  4I3J A;  3PYP A;  5DTS A;  1V9Y A;  2EX9 A;  4LLO B;  1OT6 A;  3M6H A;  3AGE A;  5E2H A;  1ONG A;  2FFF B;  5A91 A;  2B95 A;  1YPR A;  5MC7 A;  4OOL A;  3ZG7 B;  4Q0H A;  5EM0 A;  4F3L B;  3SW1 A;  4OPY A;  3UPN A;  3MZF A;  5FQI A;  5G4Z A;  3GRJ A;  2P04 A;  1KVM A;  1BSG A;  5L07 A;  3VE3 A;  4LGW A;  4NXG A;  5I5L A;  5L10 A;  2WKI A;  3R7W A;  1GSW A;  4Y7P A;  4NXE A;  5D3O A;  3HUO A;  5KIZ A;  4RQ9 A;  3CUE C;  4WMC D;  2Y59 A;  3PBN A;  2G2U A;  5HZH A;  4HJ6 A;  2ZQC A;  4HY8 A;  3QP4 A;  1NYM A;  5HX9 A;  4Y0O A;  3T50 A;  4KQQ A;  4B93 A;  3SS4 A;  2K2N A;  5CGS A;  1TS8 A;  1EW0 A;  1H0M A;  4IVK A;  4NET A;  3A0S A;  3UY6 A;  2OWH A;  4IVI A;  2VV8 A;  3QNB A;  4FD8 A;  2J7V A;  1K25 A;  3TRC A;  4B4X A;  2XEP A;  2WK0 A;  4HBT A;  2XGN A;  3EGD C;  2J3T C;  3ZVW A;  4P85 A;  1PI5 A;  2PDR A;  2QYB A;  1GA9 A;  5HFO A;  1K55 A;  1MWU A;  4R4R A;  4ETZ A;  4WZ5 A;  1RP5 A;  5EM1 A;  3LIE A;  2M7U A;  2JKF A;  1MC0 A;  2VZW A;  2J80 A;  3VOL A;  5HWV A;  1MKI A;  3TG9 A;  1VET A;  5F69 A;  5F83 A;  4D60 A;  3BQ8 A;  4S2J A;  2W1R A;  3NBL A;  2Y2M A;  1JTG A;  3UDF A;  1K0K A;  1ZC2 A;  3JVV A;  5EFW A;  3HLC A;  5CHM A;  5J7E A;  3IHA A;  5FDH A;  4B88 A;  2V1Z A;  4KQD A;  3UDI A;  1G6O A;  5A93 A;  1KE3 A;  4LRX C;  3DTM A;  3IXG A;  1BZA A;  1DP8 A;  2ZC5 B;  4E3I A;  4FUW A;  3L9K A;  1CF0 A;  1SKO B;  4AFI A;  1MWS A;  4HBU A;  3ZG5 A;  4WUJ A;  4Q8I A;  2QZ6 A;  4HES A;  2XK1 A;  3VP0 A;  2P9V B;  2B18 A;  1KOU A;  1MWT A;  4GKU A;  4GLQ A;  4LFU A;  4NK3 A;  1LI9 A;  3FPW A;  1J9M A;  4R70 A;  4X69 A;  1I5Q A;  4EUZ A;  1Y28 A;  2XRO A;  4O0P A;  4P0M A;  5FL3 A;  1K6R A;  2H5S A;  3BYD A;  1D7E A;  4KG2 A;  3QP8 A;  2ZMF A;  4WEL A;  2XQZ A;  3F1P B;  4G3V A;  1YM1 A;  3LI8 A;  1TD5 A;  1W63 Q;  1H8M A;  5HDD A;  4XT2 A;  1ES4 A;  3MBZ A;  1G6A A;  4N92 A;  1CQA A;  4WEJ A;  2ZQ9 A;  2OOL A;  5KSH A;  3UB6 A;  4RVA A;  4EES A;  2ZLY A;  1ODV A;  2O99 A;  2EFX A;  4E3N A;  2ZMV A;  5EVI B;  5EE8 A;  4E04 A;  2VKS A;  4EU0 A;  3W4Q A;  4X1L A;  3C7U A;  5EVI D;  1P0Z A;  5AQA A;  3MKE A;  3Q07 A;  4Z1W A;  3FKW A;  1PRQ A;  3U4L P;  1MZU A;  3WS2 A;  3TSG A;  1YMX A;  4L0L A;  3OLO A;  5KMW A;  2WKP A;  3T4L A;  2V9A A;  3CIT A;  4JF6 A;  2HPB A;  2XSS A;  5TGF A;  2WKR A;  4P6B A;  3A0V A;  1VHM A;  1E3U D;  1MWR A;  1CJF A;  3IXD A;  3OPR A;  5F6A A;  3C38 A;  4BBU A;  4F3L A;  2XDM A;  5HAQ A;  4NKP A;  2GJ3 A;  2HDU A;  2ZC3 B;  1PWC A;  4C6Y A;  4X55 A;  4FCF A;  3MXS A;  3T4Q A;  1BUL A;  2BLS A;  3NIA A;  4DDS A;  4IBR A;  4WMC A;  2V0W A;  3BQA A;  4XUX A;  3IQA A;  3C8C A;  1P9R A;  4EER A;  2ZM0 A;  1XA1 A;  3MJQ A;  3CHW P;  4PM5 A;  1YLP A;  4EEP A;  1ZKJ A;  1XJ2 A;  1XGJ A;  3V39 A;  4S2P A;  3SZT A;  3U2A A;  3CPT B;  3SH8 A;  3VE4 A;  2A49 A;  4CPK A;  5A8B A;  2KOI A;  3FZC A;  3ZFZ A;  3EEA A;  1IOU A;  2WUQ A;  1G68 A;  4KZ9 A;  3HLB A;  2BAS A;  1CEF A;  3O5Y A;  3B47 A;  2ZL1 B;  3DTK A;  4DXB A;  5HDC A;  2H0T A;  3HUN A;  4LV2 A;  3KSI A;  3GSG A;  2ZOH A;  4PPR A;  1OTA A;  1YLZ A;  2Y2I A;  3IXH A;  4KZB A;  1PW8 A;  1DY6 A;  4Q0J A;  4EBN A;  1DJC A;  4FSF A;  3WWX A;  5I94 A;  3OZH A;  3HVF A;  3DBA A;  3V50 A;  3FV7 A;  3KSH A;  1FQG A;  1DJB A;  1T1C A;  2Z2L B;  2PYR A;  5TFQ A;  5J8X A;  3UE1 A;  4XXR A;  5FQM A;  4Z9Q A;  2V2F F;  3ITB A;  2W0N A;  3I7J A;  3MQO A;  1PFL A;  2DNS A;  3MR0 A;  5FAT A;  4I38 A;  1FIK A;  3GQZ A;  4R3J A;  4HIA A;  4GD8 A;  2G2W A;  4K0W A;  1KVL A;  3DTE A;  4M3K A;  3LIF A;  2BG1 A;  1SKO A;  5HW3 A;  3OCL A;  3BEC A;  3MMH A;  5CHU A;  4PM6 A;  4LCM A;  3BEB A;  3T4O A;  2HF6 A;  4OKP A;  4LV3 A;  3M2J A;  2Y2H A;  4CLC B;  1V9Z A;  2P9V A;  2O9C A;  5HPF A;  5GLA A;  3HLG A;  3RXX A;  4G3K A;  4CLC D;  3E0Y A;  3BLM A;  4RX3 A;  4BBV A;  3C5A A;  5FAP A;  1L2S A;  1NXY A;  2XLN A;  3NUL A;  2R9X A;  4S2K A;  4WN5 A;  4OQG A;  2XF3 A;  4R3A A;  2I9V A;  3A3J A;  1XJ3 A;  3D4F A;  4HJ3 A;  3IF6 C;  3UPO A;  3TE8 A;  1XJ4 A;  3F1P A;  1C3B A;  2R78 A;  4JBF A;  3F1O B;  4M4X A;  2HP6 A;  4QJG A;  1F9I A;  4DN0 A;  2JKR M;  3BLS A;  3N4I A;  5FQJ A;  1AXB A;  2LB9 A;  4YIN A;  5M18 A;  1O07 A;  2Y79 A;  3V3R A;  1FSY A;  3G2Y A;  3UME A;  1BLC A;  1HZO A;  4S2O A;  3ULF A;  3NOU C;  2JKR I;  4R3B A;  4I3I A;  5EVI A;  2XRN A;  1H3Q A;  4FOF A;  1CI9 A;  5DVA A;  2QJ5 A;  3K3C A;  4ZJ1 A;  4X68 A;  5DF9 A;  1Q2P A;  4KQR A;  5CED A;  4DF6 A;  1S66 L;  1FR6 A;  3Q7V B;  1W8Y A;  3E4Q A;  4C3Q A;  2Y2Q A;  4JKT A;  2Y2K A;  3EEH A;  4OQH A;  2Y2O A;  3LR0 A;  3N8R A;  3C30 A;  4IUH A;  3NOP C;  4R1G A;  1E3U A;  4EWF A;  1W63 M;  5L2F A;  1W79 A;  3MFD A;  3IH8 A;  5FQQ A;  1JTD A;  1LSW A;  1H8Y A;  3TW8 A;  3TOI A;  3FWL A;  1YQS A;  4ZBE A;  4QB8 A;  1K38 A;  4ARZ B;  2WZZ A;  1BLH A;  1SDN A;  3C2W A;  1STZ A;  2WYX A;  2FFY A;  4U0X A;  3LGO A;  4BLM A;  2A3U A;  2K31 A;  4ETX A;  3P09 A;  3SS3 A;  5HAI A;  1ACF A;  1BLS A;  2WGI A;  3EOI A;  4KZ4 A;  4BL2 A;  1VEU B;  5DTK A;  3UB8 A;  2O9A A;  4ME4 A;  4E3L A;  3LI9 A;  4CJN A;  1F5M A;  1K4F A;  3GMW A;  1XGI A;  3QP5 A;  2ZM2 A;  3IWO A;  5EV0 A;  2P08 A;  4OPR A;  4NG2 A;  3CPT A;  1BLP A;  4LCL A;  4BQM A;  4GZB A;  2JE5 A;  4DJ3 A;  1IFQ A;  3IBJ A;  4L9G A;  1XA7 A;  1H8Z A;  5KSC A;  3M6B A;  1OJG A;  3O87 A;  4BMW A;  2ZL1 A;  1TS6 A;  4XUZ A;  5FI2 A;  1TS0 A;  1T1B A;  4EEU A;  1WYB A;  1JWV A;  5F1F A;  1T18 A;  1K6S A;  1MY8 A;  3IHB A;  3UE3 A;  5CER A;  3BY9 A;  3CWF A;  2UV0 E;  2WKE A;  4NXB A;  4FTX A;  1SCW A;  2KX6 A;  5GLB A;  3CLO A;  5FQ9 A;  4ZAM A;  4DE3 A;  3T1Q B;  2EX6 A;  2JKT I;  3GDI A;  1S67 L;  1GCE A;  2PR5 A;  5CEC A;  4OPQ A;  1RGY A;  3P98 A;  4UEY A;  4OP8 A;  1ESU A;  4BEN A;  2KLI A;  3RXW A;  1YLY A;  3VFF A;  1VB6 A;  1LL9 A;  3A3D A;  2H0Y A;  4MN6 A;  4GOG A;  4OLG A;  2I72 A;  3T4K A;  3MXR A;  1FSW A;  3H82 B;  5G4Y A;  5K5B A;  3LY3 A;  4K0X A;  2M1C A;  1PZO A;  3LYX A;  3A3I A;  4LRY C;  3MXQ A;  2JC7 A;  1FCO A;  4PHT A;  1JVJ A;  2K7S A;  1LHY A;  1YMS A;  4CLC A;  4Q0I A;  4EV4 A;  2L0W A;  1PI4 A;  2DRW A;  4O8G A;  3QP1 A;  4LRZ E;  1D1J A;  2JBF A;  2Z2M B;  1BUE A;  3Q82 A;  2LB5 A;  2ZQD A;  3HRE A;  5DFX A;  1S0W A;  1K55 C;  2O9B A;  3PHY A;  3WRZ A;  1IEL A;  3V67 A;  4WZ5 C;  1GSV A;  5FAO A;  4MCW A;  2L4R A;  1TF1 A;  1S1Y A;  2ZC6 B;  4OQ0 A;  5HPI A;  1XPB A;  2VA0 A;  3NJA A;  4NXF A;  3ZNT A;  3F1O A;  1P97 A;  4KEN B;  1L0G A;  4HJ4 A;  5IU1 A;  3UO9 A;  3B42 A;  4OOY A;  3GEC A;  2VX8 A;  3HLD A;  3ZCZ A;  1EI5 A;  1Y54 A;  3BJN A;  4QPR A;  1WYC A;  2VEA A;  3P7N A;  1XFN A;  2Y2G A;  2Y2J A;  3IWI A;  4CLC C;  1S6R A;  5EOO A;  2C6W B;  5CX7 A;  1YLW A;  3RFB A;  3R4K A;  1KGE A;  4IJG A;  3QP6 A;  3S7N A;  3Q7V A;  1YT4 A;  1LL8 A;  2J9P A;  2WAE A;  4WEK A;  5E2G A;  3HLF A;  3ZVT A;  2J8Y A;  1YKD A;  1OJ5 A;  4NEE D;  4DE1 A;  2MJ6 A;  5EOE A;  3UPP A;  2EWV A;  3NI9 A;  4C75 A;  1IYS A;  5L8M A;  3KSG A;  4WF0 A;  2W3F A;  3L7H A;  1PYY A;  3LR4 A;  2ZM8 A;  4GHI B;  3EGX C;  5F82 A;  3IXB A;  2W1T B;  2EA9 A;  3KX0 X;  1NWZ A;  1TDG A;  3DWK A;  1RGZ A;  5IS1 A;  2PU2 A;  4ARZ A;  2ZC7 A;  5JYP A;  2ZQ7 A;  3Q7Z A;  5DTT A;  2HDS A;  2X71 A;  3V3S A;  3GTC A;  3OPP A;  5FSR A;  3CZD A;  3DW0 A;  3MQQ A;  5EUA A;  1S4S A;  4E6W A;  3IBR A;  3LIA A;  3FG8 A;  1LSV A;  1H5X A;  4UAA A;  1G28 A;  4R6L A;  2HDR A;  4LV1 A;  4MBK A;  1PNE A;  4MLL A;  1VEU A;  2HGV A;  1K54 A;  4EBP A;  3P01 A;  1IYO A;  1TS7 A;  3PBO A;  1IKI A;  1MPL A;  2VJW A;  4Y0U A;  2HV1 A;  4LPZ A;  3D72 A;  4X6T A;  3UB5 P;  2OWJ A;  3WS0 A;  2ZMA A;  2PD8 A;  4Y2F A;  3DTI A;  1K56 A;  5CTM A;  2PBD P;  3MS6 A;  5HL1 A;  1YSP A;  3EQV A;  5DKK A;  1MXO A;  4PKY G;  3GR2 A;  3D3O A;  4GCZ A;  4JF4 A;  2VGK A;  4JF5 A;  3SS5 A;  1OTB A;  4N1X A;  4DMZ A;  4Y17 A;  4S2I A;  4PM9 A;  3VSK A;  2CC1 A;  2D02 A;  3W2Z A;  3PBR A;  2INW A;  1W7F A;  3H7W B;  3T4J A;  2XH9 A;  1T1A A;  3A3F A;  4HI4 A;  4K91 A;  2JN7 A;  2GZA A;  4OLD A;  1K54 C;  3VP4 A;  4MN5 A;  3HBR A;  2Q0O A;  3NDG A;  4YFM A;  2YKH A;  2VK3 A;  4GNU A;  1O7E A;  1ZG4 A;  3WS1 A;  2OLV A;  3VOY A;  1UGU A;  1GSX A;  3TJZ C;  3H82 A;  4E3J A;  2WAF A;  2WGW B;  4E3O A;  1DP9 A;  2XA7 S;  1FCN A;  4HH3 A;  2Z6C A;  1KGF A;  2B5R A;  3OOV A;  4DKI A;  3IS2 B;  4KG6 A;  3DAV A;  4H8R A;  4QHC A;  4ZDX A;  5DFY A;  3OC2 A;  3HJK A;  2L1M A;  4DJ2 A;  2FH5 A;  1TVF A;  4Y13 A;  1GA0 A;  3OPH A;  1ES3 A;  2WKH A;  3BFG A;  3T4T A;  2PR6 A;  2V1A A;  3B3X A;  3LCE A;  3E2L A;  2ZJ9 A;  2PHY A;  3S22 A;  1IEM A;  5A92 A;  4CQH A;  4O7D A;  3T1S A;  2Y55 A;  1KDW A;  3EQU A;  4S2N A;  1FCM A;  1ERO A;  5GLC A;  1I2S A;  3Q81 A;  1TDL A;  1RCJ A;  3FYZ A;  5IHV A;  4IBX A;  1X0O A;  3ZGA B;  1OT9 A;  1NLY A;  3IH9 A;  4QY6 A;  4JGQ A;  4UA7 A;  1ERM A;  4KZ5 A;  3ZG8 B;  3RJU A;  3QP2 A;  3UDX A;  3VMA A;  4MBF A;  1YAX A;  4E3M A;  5CGX A;  4HH2 A;  5FI7 A;  1K57 A;  3AGF A;  5JYO A;  3NDE A;  3BWL A;  4S2L A;  3FPV A;  1L0E A;  4X25 A;  4EW7 A;  4X56 A;  5HAP A;  2Y91 A;  5HAR A;  3MKF A;  2IA2 A;  5FA7 A;  3BFC A;  1XKZ A;  4S2N C;  4GHI A;  4BL3 A;  4X1M A;  3ZG9 B;  2H10 A;  5HDS A;  4YNR A;  5HWW A;  3D9Y A;  1DRM A;  2W1T A;  4HOI A;  5TR7 A;  1Z09 A;  5TBM B;  4HP4 A;  4EXO A;  2PYP A;  3G34 A;  3LID A;  3LIC A;  3T4S A;  4MEZ A;  2VV7 A;  1L3L A;  2XA7 M;  3KYZ A;  1NLZ A;  1W5D A;  3VOZ A;  2R9W A;  3PAE A;  1GHM A;  4WLA A;  5AQ9 A;  4GS9 B;  4HP9 A;  3T12 B;  4Y15 A;  5F68 A;  4MDZ A;  1CI8 A;  1ESI A;  1QME A;  3OBF A;  3KO6 A;  1K57 C;  2HP5 A;  4ZRR A;  2OSU A;  4MNR A;  5EVE A;  5CTN A;  4QY5 A;  3HLE A;  3NC8 A;  1S1Z A;  1VM1 A;  2JCH A;  4I39 A;  2W3E A;  3GV9 A;  3QHY A;  1PWG A;  2IWB A;  2ZBB A;  4F94 A;  2HDQ A;  5EVI C;  1PIO A;  1PWD A;  4ZJ3 A;  4FH4 A;  4RYE A;  4DXC A;  2EXB A;  2XR0 A;  1E25 A;  4U0T A;  1PZP A;  3T1X A;  5EEC A;  5M19 A;  4KZA A;  5J4E A;  2ZC4 B;  1CK3 A;  2PT7 A;  5GHY A;  4H6J B;  2QPN A;  2ACG A;  2QMI A;  2M7V A;  1LL5 A;  1P9W A;  1N9B A;  4LV0 A;  1ERQ A;  4IED A;  4K08 A;  5AJG A;  4DE0 A;  3G35 A;  3UE6 A;  4QWO A;  2P74 A;  2PBY A;  3F1N B;  3WRT A;  3LFV A;  4G3W A;  1IYP A;  2NUT C;  3SH9 A;  4HHD A;  3UNW A;  4BJP A;  3W4O A;  3IX8 A;  2HZ5 A;  4GN2 A;  4LEN A;  1I2W A;  4B4Z A;  4OOM A;  2JKT M;  3C4P A;  3H7W A;  3IWQ A;  5CXW A;  1CEG A;  1K56 D;  3BFE A;  2EWW A;  3MQ0 A;  1XJ6 A;  4JGO A;  2A2L A;  1IYQ A;  3JYI A;  4L9F A;  4HEF A;  4RA7 A;  4KZ3 A;  3ITA A;  4E3K A;  1JNU A;  3VSL A;  2XD5 A;  1PW1 A;  4UA6 A;  2WGW A;  1NZU A;  2O0Y A;  4OH0 A;  5BOH A;  1FIL A;  2J9O A;  5FEF A;  4KZ8 A;  4QD4 A;  3NHQ A;  3JVU A;  3IS2 A;  4YOF A;  5HWT A;  5CRF A;  1T19 A;  2V8F A;  1Y4O A;  2FZ0 A;  1KE0 A;  2UWX A;  2EX2 A;  1NRJ A;  2JHE A;  3RTY A;  1SHV A;  3NOT C;  5U47 A;  4DRT A;  2DMW A;  4JXV A;  2DCF A;  3MZE A;  4HNB A;  1XX2 A;  5FAS A;  1NY0 A;  1YLT A;  1L0D A;  3JPU A;  4N9L A;  1MKM A;  3G32 A;  3QNC A;  4I5S A;  3MZD A;  2ZD8 A;  3PBT A;  4UA9 A;  5DF7 A;  3G2Z A;  1UWN X;  3BW6 A;  3IX3 A;  3E98 A;  4WL9 A;  1F2K A;  3IF6 B;  2QHK A;  3MSH A;  5A90 A;  3K2N A;  3UB7 A;  1BYW A;  1N9O A;  3B33 A;  2HP9 A;  3ZYT A;  2RL3 A;  1AWI A;  1ES2 A;  2J3W A;  4JGR A;  4E6X A;  4N1H A;  3DWZ A;  2Q9N A;  2OLU A;  3E4P A;  1SZV A;  2P7J A;  3AGD A;  2ZQA A;  5M1A A;  3KYE A;  5FEG A;  1F98 A;  5GHX A;  1IKG A;  2Z6D A;  5CHJ A;  4ESP A;  5EVL A;  4OON A;  4EBL A;  3G4P A;  5IT5 A;  4WBG A;  1ZHH B;  4ZTK A;  4OVD A;  1Z6F A;  3LR5 A;  1HTZ A;  1UWP X;  1N9L A;  4D2O A;  1E4D A;  4B9O A;  5J3W A;  1LT0 A;  1SDE A;  2GDN A;  3N7W A;  3NCK A;  4OQI A;  3IT9 A;  3HL9 A;  5F1G A;  2EX8 A;  1NRF A;  2WZX A;  3ZHH A;  1XP4 A;  1BTL A;  3PXP A;  3G31 A;  5DJT A;  5TBM A;  2G7U A;  2YKF A;  4EET B;  1JWP A;  2OAP 1;  4Y3I A;  4KUK A;  2JKG A;  3LO7 A;  3IF5 A;  3CG5 A;  3WS5 A;  5E43 A;  3MFX A;  4GS9 A;  2X02 A;  5HSQ A;  2EXA A;  3PTE A;  3A3E A;  2EFU A;  4R38 A;  4EUV A;  3PAG A;  4RX2 A;  4KQO A;  4I3A A;  2OV5 A;  2C5W B;  3V5M A;  2QWS A;  3BY8 A;  4U3T A;  3OCN A;  5G18 A;  2VLG A;  3SOI A;  3FC7 A;  3UB9 A;  4MBH A;  1LI0 A;  1EWZ A;  2WKQ A;  3A0R A;  3EWK A;  4GDN A;  4A5R A;  3VFH A;  4BBT A;  1TEM A;  5AVE A;  2HJE A;  4H6J A;  1GHP A;  3LY4 A;  4CLC E;  3CJM A;  4II7 A;  4JXG A;  2A24 B;  2VGL S;  1K4E A;  2Q9M A;  3LR3 A;  2E8I A;  3LEQ A;  1KGG A;  3VP1 A;  2XFT A;  4JXW A;  3BRM A;  3F1N A;  5TJJ A;  5E2F A;  5AQ7 A;  1WA9 A;  3UN7 A;  2PD7 A;  3LUQ A;  3CI6 A;  4P87 A;  1ONH A;  3NEC A;  1YSQ A;  1KDS A;  1YLJ A;  3NY4 A;  1S4R A;  1W8Q A;  2QJ7 A;  4O01 A;  4QU3 A;  4X53 A;  3H9W A;  5GL9 A;  3UE0 A;  1GHI A;  4YWZ A;  2BTF P;  3HJI A;  2PAV P;  3O86 A;  4GJ4 A;  5FDS A;  3R7W B;  2J3T D;  1OME A;  5GLD A;  3LIB A;  2KDK A;  2X01 A;  3VP2 A;  5HD5 A;  5E2E A;  5LBR A;  3VV4 A;  3CAX A;  4Y0T A;  2PU4 A;  4OPZ A;  2IWC A;  3IX4 A;  1DJA A;  2Y8H A;  3KSF A;  4BWI A;  2W3H A;  3C4O A;  3HLW A;  4KZ6 A;  2V20 A;  3M2K A;  3N8S A;  1N9N A;  1NZO A;  3GVB A;  2Y2P A;  2OAQ 1;  1QMF A;  2Y4A A;  1ALQ A;  1U60 A;  5AQB A;  4UHU A;  2W27 A;  4P6Z S;  4WM9 A;  3FKV A;  1NJ4 A;  2H28 A;  1OTI A;  2ZQ8 A;  5FAQ A;  5F5Y A;  4GDB A; 
#chains in the Genus database with same CATH homology
 1P0Z A;  2XA7 M;  3KYZ A;  1NLZ A;  3S7P A;  4MN6 A;  4Z1W A;  3RH8 B;  3T4K A;  5HD3 A;  4WLA A;  4GS9 B;  4HP9 A;  1MZU A;  3H82 B;  5G4Y A;  4IHQ A;  5F68 A;  4MDZ A;  5K5B A;  4L0L A;  3OLO A;  3OBF A;  2WKP A;  3KO6 A;  3T4L A;  2M1C A;  4PKY A;  4ZRR A;  2V9A A;  3LYX A;  4LRY C;  1OPX A;  2W3G A;  3CIT A;  2XSS A;  3MXQ A;  2D01 A;  5HL6 A;  2WKR A;  4PHT A;  1S1Z A;  2K7S A;  3A0V A;  4UQI S;  4I39 A;  1VHM A;  2W3E A;  4CLC A;  4Q0I A;  2L0W A;  5F6A A;  2W3D A;  2ZBB A;  3PBQ A;  3C38 A;  3HCY A;  4BBU A;  4O8G A;  4F3L A;  4GW9 A;  4NKP A;  2B02 A;  4LRZ E;  3S7Q A;  2GJ3 A;  2VGL M;  5J4E A;  2LB5 A;  5DFX A;  2PT7 A;  2O9B A;  3T4Q A;  4H6J B;  3PHY A;  3V67 A;  1GSV A;  2M7V A;  1P9W A;  4MCW A;  2L4R A;  1TF1 A;  1S1Y A;  5DKL A;  5HPI A;  2V0W A;  4K08 A;  2GNX A;  3BQA A;  2VA0 A;  3PR6 A;  3NJA A;  5AJG A;  3C8C A;  1P9R A;  1DP6 A;  3UE6 A;  4EER A;  4NXF A;  3PBS A;  3F1O A;  3F1N B;  1OTE A;  1P97 A;  2QKP A;  3MJQ A;  4HJ4 A;  3LFV A;  5IU1 A;  4G3W A;  2NUT C;  3B42 A;  2V0U A;  3E4O A;  3GEC A;  4HHD A;  2VX8 A;  4BJP A;  4EEP A;  1XJ2 A;  3U2A A;  3BJN A;  4QPR A;  4OOM A;  2JKT M;  2VEA A;  4MMN A;  3P7N A;  3VE4 A;  3H7W A;  1XFN A;  3ICY A;  2KOI A;  5A8B A;  4EQ1 A;  2EWW A;  4CLC C;  3MQ0 A;  4PAU A;  3EEA A;  1XJ6 A;  4JGO A;  2A2L A;  2ZOI A;  1IOU A;  4L9F A;  3S7O A;  2BAS A;  3O5Y A;  3B47 A;  5CX7 A;  1ZTU A;  3RFB A;  3ZQ5 A;  4L9E A;  3R4K A;  4IJG A;  5HDC A;  1JNU A;  1D06 A;  3S7N A;  4MN7 A;  1OTD A;  3K3D A;  1LL8 A;  4WEK A;  5DJU A;  3KSI A;  1YKD A;  1OJ5 A;  4NEE D;  2ZOH A;  1OTA A;  2MJ6 A;  2O0Y A;  5AVF A;  2EWV A;  1XFQ A;  5L8M A;  3KSG A;  4WF0 A;  2W3F A;  4XT2 B;  3NHQ A;  4Q0J A;  4HQA A;  3LR4 A;  3JVU A;  4FSF A;  4GHI B;  3EGX C;  3IS2 A;  4JGP A;  4YOF A;  2NUP C;  5C5K A;  4P6Z M;  5HWT A;  3DBA A;  3KSH A;  1T19 A;  2W1T B;  2EA9 A;  1T1C A;  2FZ0 A;  3KX0 X;  1NWZ A;  4IUK A;  2HJ9 C;  2VV6 A;  2PYR A;  5IS1 A;  1LSX A;  2GX5 A;  3MF0 A;  2CMN A;  1NRJ A;  3KYQ A;  4ARZ A;  2JHE A;  3RTY A;  3NOT C;  2W0N A;  2DMW A;  3MQO A;  3G6O A;  3CUE A;  3MR0 A;  4Y5F A;  4I38 A;  4KUO A;  2A24 A;  3UMD A;  4HIA A;  3MQQ A;  4HNB A;  1S4S A;  2V1B A;  4UQI M;  3IBR A;  3LIA A;  3FG8 A;  1LSV A;  3LIF A;  1MKM A;  4I5S A;  3PBT A;  1G28 A;  1UWN X;  4R6L A;  3OCL A;  3BW6 A;  3E98 A;  3MMH A;  4WL9 A;  4I3J A;  2QHK A;  3PYP A;  1V9Y A;  3K2N A;  4LLO B;  1OT6 A;  2HF6 A;  2HGV A;  3T4O A;  3UB7 A;  1BYW A;  1N9O A;  3B33 A;  1V9Z A;  4CLC B;  3ZYT A;  5MC7 A;  2O9C A;  2J3W A;  4OOL A;  4JGR A;  5HPF A;  4Q0H A;  4F3L B;  4G3K A;  3SW1 A;  4CLC D;  3E0Y A;  3P01 A;  1TS7 A;  3PBO A;  4BBV A;  3E4P A;  5G4Z A;  2P7J A;  2P04 A;  2VJW A;  2HV1 A;  4LPZ A;  3D72 A;  3VE3 A;  4WN5 A;  4R3A A;  1F98 A;  4NXG A;  5I5L A;  2Z6D A;  2OWJ A;  3R7W A;  1GSW A;  2I9V A;  1XJ3 A;  2PD8 A;  4NXE A;  4Y2F A;  5IT5 A;  4HJ3 A;  1ZHH B;  3LR5 A;  5KIZ A;  4RQ9 A;  3TE8 A;  3CUE C;  1UWP X;  1XJ4 A;  3F1P A;  2R78 A;  1YSP A;  1N9L A;  3F1O B;  3EQV A;  3PBN A;  4M4X A;  5DKK A;  4B9O A;  1F9I A;  4PKY G;  5HZH A;  4DN0 A;  4HJ6 A;  5J3W A;  1LT0 A;  2JKR M;  4HY8 A;  3D3O A;  4GCZ A;  3T50 A;  1OTB A;  2LB9 A;  4B93 A;  4DMZ A;  2K2N A;  2Y79 A;  2D02 A;  3W2Z A;  3PBR A;  2INW A;  1TS8 A;  1EW0 A;  3H7W B;  3T4J A;  1T1A A;  3PXP A;  3UME A;  5DJT A;  3A0S A;  5TBM A;  3ULF A;  4HI4 A;  2JN7 A;  2GZA A;  2OWH A;  3NOU C;  2G7U A;  5F5Y A;  2JKR I;  2YKF A;  4I3I A;  4EET B;  2VV8 A;  4MN5 A;  2XRN A;  2OAP 1;  4Y3I A;  1H3Q A;  4FOF A;  4KUK A;  2QJ5 A;  3TRC A;  3K3C A;  2YKH A;  5DF9 A;  1S66 L;  3MFX A;  3EGD C;  2J3T C;  3E4Q A;  1UGU A;  4GS9 A;  2PDR A;  2QYB A;  1GSX A;  3TJZ C;  3H82 A;  5HSQ A;  3EEH A;  1DP9 A;  4R38 A;  2XA7 S;  4ETZ A;  4EUV A;  3LR0 A;  4HH3 A;  3LIE A;  2Z6C A;  2M7U A;  4KQO A;  1MC0 A;  2VZW A;  2J80 A;  3C30 A;  3OOV A;  4IUH A;  4I3A A;  3VOL A;  3NOP C;  5HWV A;  3IS2 B;  5F69 A;  1W63 M;  2QWS A;  3BY8 A;  3BQ8 A;  5DFY A;  2W1R A;  3OCN A;  3OC2 A;  1LSW A;  2VLG A;  2L1M A;  3HJK A;  3TW8 A;  4DJ2 A;  3FC7 A;  3JVV A;  5EFW A;  3UB9 A;  2FH5 A;  5J7E A;  4ARZ B;  2WKQ A;  4KQD A;  3A0R A;  3EWK A;  4BBT A;  3T4T A;  2PR6 A;  2V1A A;  5AVE A;  1G6O A;  3C2W A;  4LRX C;  2HJE A;  4H6J A;  4CLC E;  4II7 A;  2PHY A;  1STZ A;  2A24 B;  2VGL S;  1DP8 A;  4CQH A;  3LR3 A;  2K31 A;  4ETX A;  3EQU A;  4AFI A;  3F1N A;  3EOI A;  4WUJ A;  5TJJ A;  1X0O A;  3UB8 A;  1WA9 A;  2O9A A;  4ME4 A;  3LI9 A;  1OT9 A;  1NLY A;  2PD7 A;  3LUQ A;  1F5M A;  2B18 A;  3CI6 A;  4JGQ A;  1YSQ A;  1KOU A;  2P08 A;  4GLQ A;  1S4R A;  2QJ7 A;  4O01 A;  3H9W A;  3FPW A;  1IFQ A;  4DJ3 A;  3IBJ A;  4L9G A;  4YWZ A;  4R70 A;  1YAX A;  3HJI A;  1Y28 A;  2XRO A;  1OJG A;  4GJ4 A;  4O0P A;  3R7W B;  4BMW A;  2J3T D;  4HH2 A;  5FL3 A;  3LIB A;  2KDK A;  1TS6 A;  1D7E A;  1TS0 A;  1T1B A;  2ZMF A;  4EEU A;  5HD5 A;  5LBR A;  1T18 A;  3BWL A;  3VV4 A;  4WEL A;  3FPV A;  3F1P B;  3UE3 A;  4EW7 A;  3CAX A;  4G3V A;  3BY9 A;  3CWF A;  3LI8 A;  4NXB A;  1TD5 A;  1W63 Q;  2IA2 A;  1H8M A;  5HDD A;  2KX6 A;  2Y8H A;  3KSF A;  4BWI A;  4XT2 A;  2W3H A;  3CLO A;  4GHI A;  4WEJ A;  5HDS A;  2JKT I;  3GDI A;  4YNR A;  5HWW A;  2OOL A;  1DRM A;  2W1T A;  1N9N A;  1S67 L;  2OAQ 1;  4HOI A;  2PR5 A;  5KSH A;  3UB6 A;  4EES A;  4UEY A;  1ODV A;  2O99 A;  5TBM B;  4HP4 A;  4EXO A;  2PYP A;  2ZMV A;  3LID A;  3LIC A;  2W27 A;  4P6Z S;  3T4S A;  2KLI A;  2H28 A;  1OTI A;  4E04 A;  4EU0 A;  2VKS A;  1VB6 A;  2VV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...