1N9OA

Crystal structure of the phot-lov1 domain from chlamydomonas reinhardtii in illuminated state. composite data set.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPFWNLLTVTPIKTPDGRVSKFVGVQVDVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords putative blue light receptor
publication title Crystal Structures and Molecular Mechanism of a Light-Induced Signaling Switch: The Phot-LOV1 Domain from Chlamydomonas reinhardtii
pubmed rcsb
source organism Chlamydomonas reinhardtii
total genus 28
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2002-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1n9oA00
2V9AA 5J7EA 1V9ZA 1XJ4A 2OOLA 4WLAA 1N9LA 3B33A 4DJ2A 2B02A 2R78A 2VEAA 5IS1A 1EW0A 3MFXA 2L0WA 3RTYA 3IS2B 2CMNA 4GHIA 4LRXC 4EEUA 5TBMB 3GECA 3F1NA 1TS8A 3H82A 3HJIA 3MR0A 2V1AA 5IU1A 2WKQA 3NOPC 1UGUA 1MZUA 3LI8A 4NXGA 5F68A 4R3AA 2J80A 2KDKA 2INWA 1LL8A 4WUJA 5DKKA 2QHKA 4HQAA 2V1BA 4I3IA 4L9FA 3VOLA 3K3CA 4HJ3A 4EQ1A 1S1ZA 3LIBA 1S1YA 1OTDA 4MN6A 3LIAA 3VE3A 3NOUC 5I5LA 2V0WA 2A24A 2P7JA 1DRMA 4HH3A 4GS9A 4YWZA 4KQDA 4HHDA 1S67L 4BBTA 4F3LA 2QJ5A 2OWJA 5HDCA 4EETB 3UE6A 4EEPA 2PR6A 3F1OA 4EXOA 2JN7A 3E4OA 4H6JB 1KOUA 2D02A 4PKYG 3LUQA 2VV8A 1OTAA 3H7WB 4XT2A 4JGPA 3A0VA 1OTIA 5HDSA 1G28A 4R6LA 2PHYA 2WKPA 4LRYC 3HJKA 3E4PA 3BY8A 4JGOA 4EW7A 1BYWA 1X0OA 3MXQA 2YKFA 1XJ2A 4I38A 1NWZA 2PD7A 4EESA 4PKYA 4KUOA 1VB6A 3F1PA 2V0UA 5HD3A 4HY8A 2OWHA 5G4ZA 2WKRA 2H28A 3CAXA 4HH2A 3D72A 2D01A 3CLOA 1P97A 1DP8A 1F9IA 4HP9A 4GCZA 3UB7A 5F6AA 2ZOHA 4GW9A 1GSWA 4DJ3A 3BWLA 3LI9A 2KX6A 3H9WA 1N9NA 3SW1A 2M1CA 2BASA 4K08A 2PDRA 1WA9A 1S4RA 4WN5A 5DKLA 1JNUA 1D7EA 2I9VA 3MQOA 1UWPX 4I3JA 4HI4A 4M4XA 5DJUA 3UMDA 1XFQA 3EEHA 3ULFA 3LIEA 4R70A 4BBVA 3UB9A 3IS2A 1T1BA 4WL9A 1LT0A 5KIZA 3LIDA 3C2WA 1T18A 4L9EA 1P0ZA 5TBMA 3FG8A 4GHIB 3RH8B 3ICYA 2Z6CA 1LSWA 2ZOIA 3F1NB 3PYPA 3FC7A 4NXBA 5F5YA 4LPZA 2PD8A 3H82B 3UMEA 3LICA 2HV1A 2VV6A 3GDIA 1T19A 3A0RA 1DP6A 1LSXA 4KUKA 5HD5A 5HSQA 4R38A 3PHYA 4HP4A 4L9GA 2Z6DA 4EERA 3EWKA 2W0NA 1XFNA 2QJ7A 4JGQA 1OTEA 1S66L 4HIAA 3P7NA 5HWTA 4LLOB 2PR5A 4BBUA 3G6OA 1TS6A 3LYXA 4E04A 1GSVA 1OTBA 2QKPA 5AVFA 1OJGA 1TS0A 1V9YA 4HOIA 3CWFA 2A24B 5HWVA 4MN5A 3ZQ5A 4GS9B 2VLGA 1OT6A 3OLOA 3VE4A 4I5SA 4F3LB 3T50A 3MQQA 3C8CA 3A0SA 4H6JA 2ZBBA 3UB6A 3F1OB 4NXEA 5HZHA 2PYPA 2QWSA 1TS7A 5HDDA 2GJ3A 3H7WA 2EA9A 3NOTC 2JHEA 1Y28A 4RQ9A 4XT2B 4LRZE 3LIFA 4NXFA 5HWWA 4B9OA 5DJTA 3BY9A 2W27A 3NJAA 1F98A 2L4RA 5A8BA 1LSVA 1DP9A 1N9OA 5J4EA 3E4QA 5G4YA 4I39A 4WF0A 1UWNX 3K3DA 5F69A 4I3AA 1D06A 3F1PB 3KX0X 5J3WA 5EFWA 4JGRA 3UB8A 1T1CA 1OJ5A 2PYRA 2YKHA 1OT9A 3NHQA 1S4SA 2VV7A 4HNBA 5AVEA 2L1MA 1XJ6A 3IBRA 1ODVA 2K7SA 3MJQA 4HJ4A 1GSXA 1XJ3A 1T1AA 4HJ6A
chains in the Genus database with same CATH superfamily
2V9AA 3LFVA 3NIAA 1HD8A 1K4EA 4YOFA 2M7VA 1XJ4A 4WLAA 3B33A 3GVBA 2H5SA 2PBDP 2UV0E 4OPRA 4DJ2A 1P9WA 2B02A 5IS1A 4ETZA 1EW0A 1TD5A 2QZ6A 4JBFA 3BLMA 2WGIA 3HUOA 2I72A 3A3IA 3MFXA 2L0WA 4MLLA 4QJGA 1YAXA 5CERA 5FASA 1RP5A 3F1NA 1KE0A 5E2HA 3MKEA 3C30A 5EUAA 1CEGA 3HJIA 1PRQA 1K6SA 5GLBA 4QY6A 2WKQA 3IWQA 5M19A 2VJWA 1HLUP 3PBSA 2ZM8A 4P6ZM 4NXGA 1NZOA 1IYQA 3VV4A 3FV7A 3GMWA 3CUEC 5HFOA 1W79A 1MC0A 5HL1A 4HQAA 3S7PA 4CLCB 1ES3A 3DBAA 1FCMA 4G3WA 2VGJA 3V5MA 4X1MA 1YSQA 4G3VA 4DN0A 4MN6A 1QMFA 3LIAA 3VE3A 1GCEA 1BLCA 2A24A 3MS6A 1K6RA 3Q1FA 4RX3A 2KLIA 2HP6A 1K4FA 4HESA 3T4QA 1OPXA 4HHDA 1W7FA 1ZHHB 4F3LA 3BFCA 3DAVA 1GHIA 2QJ5A 5TR7A 2PT7A 3VP1A 3T1RA 2ZM0A 1ZTUA 1EWZA 3R7WA 5AQ7A 3ZNTA 4ZDXA 3CHWP 1W63M 4KZ6A 4DF6A 5CTNA 3IT9A 2G7UA 4YINA 4JGPA 1G6AA 1PFLA 4OP5A 1SCWA 3K2NA 4O7DA 5FEFA 3HJKA 4Y17A 3E4PA 1ESUA 4JGOA 1X0OA 2XR0A 2JCHA 3ZVTA 1KDSA 4Z9QA 1E3UD 3G30A 2XROA 3SS4A 4X25A 1IOUA 3PTEA 4KUOA 2IA2A 3F1PA 3HLFA 5HD3A 1RGYA 2OWHA 3FPWA 5G4ZA 2WKRA 2XSSA 4PM5A 2JBFA 1LHYA 1YLYA 4JF5A 1SZVA 1H8YA 2XH9A 4HH2A 3VP0A 3CLOA 3OC2A 1L0EA 4ZAMA 4L0LA 3UB7A 5F6AA 1G68A 3JYIA 3SH7A 4GW9A 4LGWA 1GSWA 5AQAA 1N9NA 5EVIB 5GLDA 3VOZA 3UNWA 3VFHA 2JKFA 2BASA 4Y7PA 3VSLA 2R9WA 1JWVA 4WN5A 2HP9A 1D1JA 2PU2A 4R3BA 1BTLA 4OH0A 5DKLA 1RGZA 4BMWA 3ZG8B 1JNUA 1D7EA 1LI0A 3LR4A 4M4XA 1VHMA 4GJ4A 4HBUA 4LCMA 5JYPA 3S7QA 3HL9A 3NBLA 2UWXA 2O9AA 3W2ZA 1MXOA 1PZOA 1XFQA 3OCNA 5GLAA 3T4TA 1T1BA 4QD4A 3LIDA 1O7EA 5HAQA 4L9EA 3KYQA 3MZDA 4LENA 4P85A 3ICYA 3HCYA 3F1NB 3W4OA 1PWGA 4GZBA 1XGIA 1W5DA 4P6ZS 1YM1A 5E43A 1W8QA 3A0RA 1DP6A 3NC8A 3EGXC 2DCFA 2EX9A 2Q0OA 2OAQ1 2VGKA 4HP4A 4EERA 1NLYA 1Q2PA 3EWKA 1XFNA 2V2FF 3PBNA 1S66L 2ZC7A 2PR5A 4FCFA 4S2NA 3G2YA 3DWZA 2Y2OA 1YLWA 3ZVWA 4E04A 1XPBA 1OJGA 2J9OA 1TS0A 5A90A 2A24B 4PM7A 5KZHA 1YLZA 3VP2A 1OT6A 4Q0HA 4E3OA 1L3LA 5FI2A 3VE4A 2Y2LA 3Q7ZA 4S2OA 1TVFA 3T4KA 4YNRA 4GDBA 4OLDA 4F3LB 2O99A 5GHXA 3HLWA 2BLSA 5EM0A 3BW6A 1AWIA 4GOGA 3T50A 3MQQA 3R7WB 3ISGA 4JF4A 1CK3A 1KVMA 4DXCA 3HLGA 3LGOA 2PYPA 3FKVA 3S1YA 3KSFA 5CHMA 4BJPA 5HARA 1ALQA 2GJ3A 2BTFP 3ITBA 3NOTC 2W3DA 3WS1A 3TOIA 4MMNA 2V8CA 3FWLA 4ZJ3A 5EECA 4MDZA 3LIFA 5HWWA 2Y2JA 5DJTA 3NY4A 2W27A 4ARZA 1IKIA 3N8SA 3KSIA 3NDGA 5A8BA 4JXSA 4Y13A 1H3QA 3TE8A 3IH8A 3G31A 4I39A 1UWNX 1L2SA 3HLDA 1IYSA 5FSRA 1YMXA 5F69A 2E8JA 2VKSA 4U0TA 2W3EA 1D06A 3F1PB 2KOIA 4IBRA 1NY0A 5EFWA 5FDHA 3JVVA 1K57A 3B47A 2Y2PA 4OP8A 1OT9A 2W3HA 1LL5A 4KZ5A 1H8ZA 4ESPA 3UPNA 2VA0A 1FILA 1PI5A 1KGEA 1STZA 3UE3A 1MBLA 1E4DA 1IELA 3IXGA 3CMZA 1XGJA 2GNXA 4HJ6A 4CPKA 1ONHA 2ZLYA 2Y2QA 3NI9A 1V9ZA 3W4QA 4B4ZA 3UDFA 3UY6A 4Q0JA 3GV9A 4NK3A 1NZUA 1S0WA 3IX4A 3T12B 5EVID 2G2UA 3VOYA 1TDGA 3DTMA 3UO9A 2XFSA 3T4LA 3PXPA 5AQBA 5FI7A 1ERMA 4PHTA 5DF9A 4EEUA 2JC7A 5GL9A 4MBFA 2LB9A 2WGVA 1N9BA 3MR0A 2HZ5A 4PM6A 4MCWA 4WZ4A 1PYYA 2Q9NA 3NOPC 4D2OA 1XA7A 2J9PA 3LI8A 2WKIA 3ZG0A 2J80A 2KDKA 3ZHHA 5DKKA 2QHKA 2V1BA 2ZQCA 1GHPA 4I3IA 3T1QB 4B4XA 2HGVA 4ZJ2A 4JXVA 3VOLA 1KDWA 2ACGA 3O5YA 3A3EA 4FH4A 5DTKA 4O0PA 3UDXA 3N8LA 4CLCC 3IF6A 1GHMA 3NOUC 1Z09A 4DE0A 5IHVA 3FYZA 4OOMA 5I5LA 2P7JA 2R9XA 2Y8HA 4GS9A 4IEDA 4YWZA 1XXMA 2WGWA 1S67L 3PBRA 1NYMA 2DRWA 4Z1WA 1F2KA 1BT5A 1JTDA 4FD8A 1SKFA 3UE6A 4EEPA 4MN7A 3C4OA 3DTKA 4BQMA 4JF6A 4WBGA 1KE4A 3QP8A 4Q8IA 4PM8A 2HDUA 3LUQA 2MJ6A 1XKZA 3A3FA 3PAEA 3LR5A 5CTMA 4R6LA 2PHYA 5E2EA 2J3TC 4BWIA 3B3XA 5FI6A 4ARZB 4XUZA 3IF5A 4EWFA 3BFFA 1NWZA 2PD7A 5HPIA 2BG1A 5A92A 3Q07A 2HJ9C 3C5AA 3N7WA 2WADA 2XD1A 3ZCZA 3SOIA 2B5RA 4GNUA 2XA7M 1Q2QA 1DJBA 5E2FA 1FSYA 3D72A 2D01A 4BENA 5AQ9A 1PIOA 4WM9A 3BFDA 4E6XA 2O0YA 1PNEA 1M6KA 2G2WA 4DJ3A 3BWLA 2ZC3B 3LCEA 1ZC2A 3SW1A 3T4OA 2M1CA 4P87A 4RVAA 2Y4AA 2H0TA 3B42A 5KSCA 2PAVP 1WA9A 1YLJA 4PMAA 5EVIC 1U60A 5HPFA 1PWDA 2I9VA 5EOEA 4E3MA 4I3JA 3SH9A 1K55C 2ZC6B 1W8YA 2Q9MA 2IWBA 2DMWA 4RA7A 3ZG5A 1AXBA 1VM1A 3QNCA 1BUEA 4WELA 4IVKA 5G18A 3ULFA 1ACFA 3WRTA 3IS2A 1ZG6A 4WL9A 3C38A 3C2WA 3G32A 5TBMA 1P0ZA 3FG8A 1ZKJA 4R0QA 2Z6CA 1LSWA 3FC7A 4NXBA 3UMEA 2PD8A 4B93A 2ZQ9A 4N1HA 4Y2FA 1ES4A 1T19A 4GKUA 1BZAA 3QP1A 4KZ3A 5DTTA 5GHZA 1NLZA 4XXRA 2OLVA 3SS3A 4R38A 2WZXA 2Z6DA 2ZM2A 2QJ7A 1HZOA 3ZYTA 4JGQA 3ZG9B 3P7NA 4QWOA 4OQGA 4UA7A 2Z2MB 3N8RA 4S2MA 4BBUA 2C5WB 4MNRA 1TS6A 3LYXA 4KQQA 3ZG7B 1MWSA 5JYOA 5F82A 4HEFA 4WZ5A 2IWCA 3IF6B 3MBZA 3LR0A 5FAOA 3ZFZA 3CWFA 3I7JA 4MN5A 3ZQ5A 4GS9B 4ZBEA 3MQ0A 2WGWB 3V39A 3BQAA 3U4LP 2ZD8A 3IXHA 1P9RA 2QPNA 5CEBA 4H6JA 3HLCA 5FQ9A 5CX7A 4GDNA 3UB6A 4NXEA 4II7A 1YLTA 3NCKA 4IJGA 2QWSA 5KMWA 5HDDA 5CGWA 3IHAA 1BSGA 2JHEA 4KENB 2XK1A 1YSPA 4DMZA 1Y28A 4RQ9A 4R3JA 1KVLA 4B9OA 3DTIA 4X53A 3D4FA 3OCLA 3HLEA 3IXDA 1I5QA 1PW1A 1FR6A 3GR2A 3TRCA 4MBKA 5FL3A 4E6WA 4ME4A 1FCNA 1HVBA 4WF0A 2XA7S 3K3DA 4OQ0A 3C7VA 3QP6A 3KX0X 2Y2IA 5FQJA 3RFBA 3AGFA 3UB8A 4S2JA 1F5MA 5EE8A 3WS0A 1OJ5A 2EXAA 3LR3A 1G5UA 2W3FA 4JXGA 1DJCA 2VV7A 4GLQA 1H0MA 4HNBA 4OQIA 2L1MA 1XJ6A 3O87A 5CGXA 4FUWA 3CI6A 2Y59A 2X01A 2K7SA 4HJ4A 1XJ3A 3IBJA 4UEYA 3TSGA 2WAFA 1S6RA 5EPHA 4DKIA 2JKTM 5E2GA 2OOLA 1K54A 1MKIA 2EX2A 2VK3A 2VEAA 3T4SA 4S2KA 4S2IA 4DDYA 1K25A 3UN7A 3RTYA 5CHUA 1EROA 2ZJ9A 3IS2B 3T1XA 2ZC4B 4LRXC 3SZTA 5EM1A 4IVIA 1KGGA 5D3OA 5TBMB 1TS8A 3LY4A 5I94A 4OONA 1NXYA 4OQHA 2XEPA 5IU1A 5FATA 3QNBA 3IWOA 1UGUA 5F68A 1MWTA 5FQKA 2INWA 1LL8A 2VX8A 1FR1A 4L9FA 1DJAA 4OKPA 2P74A 5FEGA 3K3CA 3AGDA 1BLSA 4EQ1A 1S1ZA 3LIBA 2XFTA 3MFDA 1HTZA 3EQVA 2ZL1A 3RXWA 3P01A 4R1GA 1DRMA 4S2NC 3HREA 1GA9A 3EQUA 2RCXA 3E2KA 3Q7VA 3LO7A 5A91A 3HUNA 4EU0A 2J7VA 3GRJA 4NKPA 5HDCA 1EI5A 4KZ7A 4C6YA 3VP4A 3NECA 2ZQDA 3C7UA 3F1OA 4ZTKA 3WS2A 4EXOA 4H6JB 3QHYA 1KOUA 4H8RA 3MKFA 4PKYG 3RXXA 4M3KA 1OTAA 2Y91A 3BEBA 1OTIA 3S7OA 4IHQA 1G28A 3U2AA 2PU4A 3ITAA 2WKPA 2JKGA 4EW7A 1BYWA 2YKFA 4KQOA 1XJ2A 3FKWA 4I38A 4KG6A 1I2WA 4DXBA 2WUQA 4EESA 1YLPA 4EUZA 2WKHA 2XQZA 3GQZA 3IX3A 1IEMA 2V0UA 4UA9A 4HY8A 4PPRA 2J8YA 2H28A 2JKTI 1ES5A 3CAXA 3UPOA 3KSGA 3WS5A 1ESIA 5EVEA 1CEFA 2XGNA 4JXWA 4X56A 2FFYA 3PR6A 5L07A 1K57C 4O01A 1CQAA 3S7NA 3LI9A 2KX6A 3O86A 2A49A 5C5KA 1JVJA 1E25A 3V67A 2PDRA 1MWRA 1NRJA 1JWZA 3ZGAB 1YQSA 1YT4A 2HPBA 4R4SA 4LCLA 3E0YA 3SH8A 2XLNA 2J3WA 3MSHA 2O9CA 2X71A 3EEHA 3LIEA 4R70A 4BBVA 3UB9A 2VGLM 1XA1A 1GA0A 2HF6A 5DVAA 5FQQA 1OMEA 1PI4A 4DE3A 3KSHA 2A2LA 2W1RA 4LPZA 5CECA 2K31A 3OPHA 1SKOA 2HV1A 3HLBA 2VZWA 3TG9A 2VV6A 3GDIA 3A3JA 4WMCD 3CUEA 3VMAA 1LSXA 5TGFA 5HD5A 4U3TA 3W8KA 2NUTC 3PHYA 4L9GA 2XF3A 1OTEA 3IQAA 3D3OA 4UAAA 4X69A 3T1SA 3G6OA 3O3VA 4LFUA 1GSVA 4LV3A 1OTBA 5HL6A 2QKPA 4WEKA 5AVFA 2ZL1B 3MF0A 1YPRA 1V9YA 3OPPA 1ERQA 1SHVA 5HWVA 3V50A 4E3KA 5CHJA 5HAPA 2VLGA 4C75A 3DTEA 3IF6C 3Q7VB 2B18A 4BL3A 4S2PA 4AFIA 5GHYA 2V1ZA 5TJJA 4KG5A 3M6HA 4K91A 1NJ4A 1KE3A 3C8CA 2P9VA 5KSHA 2ZBBA 4G3KA 3F1OB 4Y0TA 3ZNYA 3CJMA 2M7UA 3WS4A 4Y0OA 3S4XA 4FTXA 4NEED 3IX8A 3T4JA 2EFUA 1K56D 3H7WA 4NETA 2ZQ7A 1FCOA 2NUPC 2FZ0A 4LRZE 4KZBA 5HW3A 3UDIA 3NJAA 2Y79A 3PAGA 5K5BA 1F98A 2L4RA 3D9YA 2ZMVA 2A3UA 4F94A 5L10A 5MC7A 5AJGA 4OPZA 1DP9A 4WMCA 1N9OA 1TEMA 4QB8A 5FA7A 3BM6A 5G4YA 3CPTA 1J3WA 5DFYA 5BOHA 1A0KA 2WAEA 4WYYA 1PWCA 1LL9A 3EEAA 2W1TA 5DTSA 5FQIA 2PYRA 4MBHA 3LY3A 3NHQA 4BD1A 1N4OA 2P04A 1RCJA 5AVEA 3WRZA 3IBRA 2C6WB 2PRFA 4X6TA 2Y2GA 1MKMA 2XRNA 4IBXA 5F83A 1VEUA 4R23A 3MJQA 4IUKA 1T1AA 3TW8A 2OLUA 4R4RA 3UE0A 4FSFA 1IYOA 1WE4A 5J7EA 3AGEA 1N9LA 2VGLS 4Y5FA 5GLCA 2EX8A 2R78A 2ZMFA 2JKRI 1K56A 1ZG4A 4X55A 3LEZA 4X68A 2Y55A 4EV4A 3HUMA 2CMNA 4GHIA 1MY8A 3GECA 4ETXA 1CF0A 3MZEA 3H82A 4OOYA 5LBRA 4E3JA 5J8XA 4JKTA 2V1AA 1SKOB 2Y2HA 3MZFA 4QU3A 3VFFA 3FZCA 1QMEA 3CITA 3WWXA 3G2ZA 4UQIM 5EV0A 5CRFA 3UPPA 4PM9A 4ZJ1A 1MZUA 4YFMA 4BLMA 4R3AA 1IFQA 4A5RA 5FQMA 1IKGA 1BLPA 2LB5A 1CJFA 4WUJA 5M18A 1K0KA 4KG2A 3ZDJA 3JVUA 4KZ9A 4HJ3A 2GZAA 3L7HA 3M2KA 4DRTA 1S1YA 3KO6A 4LV1A 4OVDA 1OTDA 4X1LA 2ZC5B 4QHCA 4QY5A 2GX5A 1VETA 2V0WA 3SS5A 3BFGA 4HH3A 3E98A 3P09A 4UA6A 3W4PA 4KQRA 3DWKA 1TDLA 1L0FA 4N9LA 4PAUA 3CG5A 4KQDA 4P0MA 4WZ5C 1CI8A 4BBTA 2HJEA 2OWJA 4EETB 3BQ8A 2ZQ8A 1XX2A 4E3LA 1Y4OA 3G35A 1NRFA 2PR6A 5EOOA 2PBYA 3PBOA 1FIKA 2P9VB 3KYZA 2JN7A 3E4OA 2WZZA 3HVFA 2ZQAA 2FH5A 3V3RA 2XDMA 1E3UA 1ES2A 2D02A 4KZAA 1MPLA 2VV8A 3OBFA 5L2FA 3A3DA 3H7WB 2K2NA 4XT2A 3A0VA 1ONGA 4ID4A 1L0DA 5HDSA 3G34A 4HBTA 3OZHA 4BL2A 3MMHA 4LRYC 3BY8A 3Q82A 1Y54A 4GD8A 3L9KA 3MXQA 1SDEA 1YMSA 4N92A 4RYEA 3IXBA 3HBRA 3MXRA 1C3BA 3OPLA 4UHUA 4DE2A 3CPTB 4JPMA 2QMIA 4PKYA 1VB6A 2Y2KA 5HX9A 3PBTA 1H8MA 3M6BA 3R4KA 2W1TB 4CLCD 5DF8A 4CJNA 4U0XA 4XUXA 2WKEA 3IH9A 4OOLA 4N1XA 1P97A 3TJZC 1DP8A 1F9IA 4HP9A 5TFQA 4GCZA 1K38A 5DF7A 4OPYA 4DDSA 2ZOHA 3VSKA 2HDRA 3IWIA 3EGDC 5F1FA 2O9BA 3H9WA 3FPVA 1VEUB 5CXWA 2Y2NA 2EXBA 4K08A 2XD5A 3E2LA 4GB7A 1FOFA 3OPRA 1S4RA 4Y15A 1IYPA 3MQOA 4DE1A 1UWPX 4CQHA 4HI4A 3GSGA 2H10A 4EBNA 1LLBA 5DJUA 4E3IA 4EQIA 2H0YA 4Q0IA 5L09A 1H5XA 3BECA 3G4PA 4GD6A 3UMDA 2EWVA 1TF1A 3RJUA 3QP5A 3JPUA 3BLSA 3S22A 1K54C 3BJNA 2J3TD 4Y0UA 4K0WA 1LT0A 2IWDA 5KIZA 1T18A 4GHIB 3RH8B 4GN2A 4RX2A 2DNSA 2GDNA 2ZOIA 5FAPA 3PYPA 4NG2A 4FOFA 4UQIS 5DFXA 3QP4A 3H82B 5F5YA 2X02A 3LICA 1FQGA 2Y2MA 5F1GA 4OLGA 4KUKA 1FSWA 2AVXA 3CZDA 3NDEA 5HSQA 4FH2A 4KZ4A 5M1AA 1WYBA 3EOIA 1NYYA 1JTGA 4K0XA 4S2LA 2W0NA 4CLCA 4HIAA 1BULA 5HWTA 4LLOB 1KGFA 3UE1A 3LEQA 5L8MA 1VQQA 2CC1A 1G6OA 4Y3IA 3VP3A 2QYBA 3QP2A 2FFFB 5U47A 5FAQA 1VETB 4HOIA 3MXSA 4EBLA 1BLHA 4D60A 1MWUA 2WYXA 4N9KA 1YKDA 1L0GA 3OLOA 5EVLA 3Q81A 3O88A 4OPQA 4I5SA 1LI9A 1PZPA 3UB5P 2JE5A 2ZMAA 3DW0A 4JLFA 3A0SA 4LV2A 2EWWA 2EX6A 2OAP1 5HZHA 2P08A 3N4IA 1TS7A 4E3NA 4KZ8A 3BFEA 2EA9A 5FDSA 2V8FA 1M40A 1PW8A 5CGSA 1XP4A 5A93A 1Z6FA 4CLCE 4XT2B 4IUHA 4EBPA 4NXFA 3BY9A 4BD0A 2E8IA 3V3SA 4ZRRA 2W3GA 1LSVA 2OSUA 1W63Q 5J4EA 3E4QA 5CEDA 4MEZA 3PBQA 1I2SA 4LV0A 4I3AA 3KYEA 4EUVA 2EFXA 4O8GA 5J3WA 3BRMA 3IHBA 1WYCA 2B95A 4JGRA 2HDSA 1T1CA 2YKHA 2OV5A 1DY6A 3GTCA 4WEJA 5HAIA 1S4SA 3OOVA 3P98A 3NULA 5IT5A 3M2JA 3N6IA 2HDQA 1CI9A 1SDNA 4P6BA 2JKRM 1JWPA 2V20A 3BYDA 1J9MA 5EVIA 3C4PA 2RL3A 1ODVA 4C3QA 1O07A 1K55A 1GSXA 2HP5A 4B88A 4QPRA 2Z2LB 2WK0A
chains in the Genus database with same CATH topology
2V9AA 3LFVA 5J7EA 1V9ZA 4YOFA 2JKTM 2M7VA 1XJ4A 2OOLA 4WLAA 1N9LA 3B33A 4Q0JA 2VGLS 4Y5FA 4DJ2A 1P9WA 2B02A 2R78A 2VEAA 3T4SA 1EW0A 2ZMFA 4ETZA 5IS1A 2JKRI 1TD5A 3MFXA 2L0WA 3RTYA 3IS2B 1YAXA 2CMNA 4GHIA 3T4LA 3PXPA 4LRXC 4PHTA 5DF9A 4EEUA 5TBMB 3GECA 3F1NA 4ETXA 1TS8A 3H82A 5LBRA 3C30A 2LB9A 3HJIA 3MR0A 2V1AA 5IU1A 4MCWA 2WKQA 2VJWA 3CITA 3NOPC 4UQIM 1UGUA 1MZUA 3PBSA 3LI8A 4P6ZM 4NXGA 5F68A 4R3AA 2J80A 1IFQA 3VV4A 2KDKA 2LB5A 3CUEC 2INWA 1LL8A 4WUJA 1MC0A 5DKKA 2QHKA 2VX8A 4HQAA 2V1BA 4I3IA 3S7PA 4CLCB 2HGVA 4L9FA 3JVUA 3DBAA 3VOLA 4G3WA 3O5YA 3K3CA 4HJ3A 2GZAA 4EQ1A 1S1ZA 3LIBA 4O0PA 1S1YA 1YSQA 4G3VA 3KO6A 4DN0A 1OTDA 4MN6A 3EQVA 4CLCC 3LIAA 3VE3A 3NOUC 2GX5A 4OOMA 5I5LA 2V0WA 3P01A 2A24A 2P7JA 1DRMA 4HH3A 3E98A 2KLIA 2Y8HA 4GS9A 3EQUA 4YWZA 3T4QA 4PAUA 1OPXA 4KQDA 4HHDA 1S67L 3PBRA 1ZHHB 4Z1WA 4BBTA 4F3LA 4EU0A 2QJ5A 2HJEA 2PT7A 2OWJA 4NKPA 5HDCA 4EETB 3BQ8A 1ZTUA 3UE6A 4EEPA 3R7WA 4MN7A 2PR6A 3PBOA 3F1OA 4EXOA 3KYZA 2JN7A 3E4OA 4H6JB 1KOUA 2FH5A 1W63M 2D02A 4PKYG 3LUQA 2G7UA 2VV8A 3OBFA 1OTAA 3H7WB 2MJ6A 2K2NA 4XT2A 4JGPA 3A0VA 1OTIA 3S7OA 3LR5A 4IHQA 5HDSA 1G28A 3U2AA 4R6LA 2PHYA 3K2NA 3MMHA 2WKPA 4LRYC 2J3TC 4BWIA 3HJKA 3E4PA 3BY8A 4JGOA 4ARZB 4EW7A 1BYWA 1X0OA 3MXQA 2YKFA 4KQOA 1XJ2A 4I38A 1NWZA 2PD7A 5HPIA 2XROA 4EESA 1IOUA 2HJ9C 4PKYA 4KUOA 1VB6A 2IA2A 3F1PA 3PBTA 2V0UA 1H8MA 4HY8A 5HD3A 2OWHA 3FPWA 5G4ZA 2WKRA 2XSSA 2H28A 2JKTI 3R4KA 2XA7M 3CAXA 2W1TB 4CLCD 4HH2A 3D72A 2D01A 3KSGA 3CLOA 3OC2A 4OOLA 1P97A 3TJZC 1DP8A 1F9IA 4HP9A 3PR6A 4GCZA 2O0YA 4L0LA 3UB7A 5F6AA 2ZOHA 4O01A 4GW9A 1GSWA 4DJ3A 3BWLA 3S7NA 3EGDC 2KX6A 2O9BA 3H9WA 3LI9A 1N9NA 3FPVA 3SW1A 3T4OA 2M1CA 5C5KA 2BASA 3B42A 3V67A 4K08A 2PDRA 1WA9A 1S4RA 4WN5A 1NRJA 5DKLA 4BMWA 5HPFA 1JNUA 1D7EA 2I9VA 3MQOA 1UWPX 4CQHA 3LR4A 4HI4A 4I3JA 4M4XA 1VHMA 4GJ4A 2DMWA 5DJUA 4Q0IA 3S7QA 3E0YA 2O9AA 3W2ZA 2J3WA 4WELA 3UMDA 2O9CA 2EWVA 1TF1A 1XFQA 3OCNA 3EEHA 3ULFA 3LIEA 3T4TA 4R70A 4BBVA 3UB9A 3BJNA 2VGLM 3IS2A 1T1BA 2J3TD 4WL9A 3C38A 1LT0A 5KIZA 2HF6A 3LIDA 3C2WA 1T18A 3KYQA 1P0ZA 4L9EA 5TBMA 3FG8A 4GHIB 3RH8B 3ICYA 2Z6CA 3HCYA 1LSWA 2ZOIA 3F1NB 3KSHA 3PYPA 2A2LA 4FOFA 3FC7A 4NXBA 2W1RA 4LPZA 2PD8A 3H82B 4UQIS 5DFXA 5F5YA 2K31A 4B93A 3LICA 2HV1A 2VZWA 4P6ZS 2VV6A 4Y2FA 3GDIA 1T19A 3CUEA 3A0RA 1DP6A 1LSXA 4KUKA 1NLZA 5HD5A 3EGXC 5HSQA 4R38A 3EOIA 2OAQ1 2NUTC 3PHYA 4HP4A 4L9GA 2Z6DA 4EERA 1NLYA 3EWKA 2W0NA 1XFNA 2QJ7A 3ZYTA 4CLCA 4JGQA 3PBNA 1OTEA 1S66L 4HIAA 3P7NA 5HWTA 4LLOB 2PR5A 3D3OA 5L8MA 4BBUA 3G6OA 1TS6A 1G6OA 4Y3IA 3LYXA 4E04A 1GSVA 1OTBA 5HL6A 2QKPA 4WEKA 5AVFA 1OJGA 2QYBA 1TS0A 3MF0A 3LR0A 1V9YA 4HOIA 3CWFA 2A24B 5HWVA 4MN5A 3ZQ5A 4GS9B 2VLGA 1OT6A 1YKDA 3MQ0A 4Q0HA 3OLOA 3VE4A 2B18A 3T4KA 4YNRA 4I5SA 4AFIA 3BQAA 4F3LB 2O99A 5TJJA 1P9RA 3BW6A 3T50A 3MQQA 3C8CA 3UMEA 3A0SA 3R7WB 5KSHA 2EWWA 4H6JA 5CX7A 2ZBBA 4G3KA 2OAP1 3UB6A 3F1OB 4NXEA 4II7A 5HZHA 2M7UA 2P08A 2PYPA 4IJGA 2QWSA 3KSFA 1TS7A 4NEED 4BJPA 5HDDA 3T4JA 2GJ3A 3H7WA 2EA9A 3NOTC 2JHEA 2W3DA 1YSPA 4MMNA 4DMZA 1Y28A 4RQ9A 2NUPC 4XT2B 4CLCE 2FZ0A 4MDZA 4LRZE 3LIFA 4IUHA 4NXFA 5HWWA 4B9OA 5DJTA 3BY9A 2W27A 3NJAA 2Y79A 5K5BA 1F98A 4ARZA 2L4RA 3KSIA 3OCLA 2ZMVA 4ZRRA 5A8BA 2W3GA 1LSVA 5MC7A 5AJGA 1H3QA 1DP9A 1N9OA 3TRCA 5FL3A 3TE8A 1W63Q 5J4EA 3E4QA 5G4YA 4ME4A 4I39A 4WF0A 1UWNX 2XA7S 3PBQA 3K3DA 5DFYA 5F69A 4I3AA 2VKSA 2W3EA 3F1PB 1D06A 2KOIA 3KX0X 4EUVA 3EEAA 4O8GA 5J3WA 5EFWA 2W1TA 4JGRA 3RFBA 3UB8A 1F5MA 3JVVA 1T1CA 1OJ5A 3B47A 2PYRA 2YKHA 3LR3A 1OT9A 2W3FA 2W3HA 3NHQA 4WEJA 1S4SA 2VV7A 4GLQA 3OOVA 4HNBA 2VA0A 5IT5A 2P04A 5AVEA 2L1MA 1XJ6A 3IBRA 1STZA 3UE3A 2JKRM 1MKMA 3CI6A 2XRNA 1ODVA 2K7SA 3MJQA 4HJ4A 1GSXA 2GNXA 4IUKA 1XJ3A 1T1AA 4HJ6A 3TW8A 4QPRA 3IBJA 4UEYA 4FSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9A A;  5J7E A;  1V9Z A;  1XJ4 A;  2OOL A;  4WLA A;  1N9L A;  3B33 A;  4DJ2 A;  2B02 A;  2R78 A;  2VEA A;  5IS1 A;  1EW0 A;  3MFX A;  2L0W A;  3RTY A;  3IS2 B;  2CMN A;  4GHI A;  4LRX C;  4EEU A;  5TBM B;  3GEC A;  3F1N A;  1TS8 A;  3H82 A;  3HJI A;  3MR0 A;  2V1A A;  5IU1 A;  2WKQ A;  3NOP C;  1UGU A;  1MZU A;  3LI8 A;  4NXG A;  5F68 A;  4R3A A;  2J80 A;  2KDK A;  2INW A;  1LL8 A;  4WUJ A;  5DKK A;  2QHK A;  4HQA A;  2V1B A;  4I3I A;  4L9F A;  3VOL A;  3K3C A;  4HJ3 A;  4EQ1 A;  1S1Z A;  3LIB A;  1S1Y A;  1OTD A;  4MN6 A;  3LIA A;  3VE3 A;  3NOU C;  5I5L A;  2V0W A;  2A24 A;  2P7J A;  1DRM A;  4HH3 A;  4GS9 A;  4YWZ A;  4KQD A;  4HHD A;  1S67 L;  4BBT A;  4F3L A;  2QJ5 A;  2OWJ A;  5HDC A;  4EET B;  3UE6 A;  4EEP A;  2PR6 A;  3F1O A;  4EXO A;  2JN7 A;  3E4O A;  4H6J B;  1KOU A;  2D02 A;  4PKY G;  3LUQ A;  2VV8 A;  1OTA A;  3H7W B;  4XT2 A;  4JGP A;  3A0V A;  1OTI A;  5HDS A;  1G28 A;  4R6L A;  2PHY A;  2WKP A;  4LRY C;  3HJK A;  3E4P A;  3BY8 A;  4JGO A;  4EW7 A;  1BYW A;  1X0O A;  3MXQ A;  2YKF A;  1XJ2 A;  4I38 A;  1NWZ A;  2PD7 A;  4EES A;  4PKY A;  4KUO A;  1VB6 A;  3F1P A;  2V0U A;  5HD3 A;  4HY8 A;  2OWH A;  5G4Z A;  2WKR A;  2H28 A;  3CAX A;  4HH2 A;  3D72 A;  2D01 A;  3CLO A;  1P97 A;  1DP8 A;  1F9I A;  4HP9 A;  4GCZ A;  3UB7 A;  5F6A A;  2ZOH A;  4GW9 A;  1GSW A;  4DJ3 A;  3BWL A;  3LI9 A;  2KX6 A;  3H9W A;  1N9N A;  3SW1 A;  2M1C A;  2BAS A;  4K08 A;  2PDR A;  1WA9 A;  1S4R A;  4WN5 A;  5DKL A;  1JNU A;  1D7E A;  2I9V A;  3MQO A;  1UWP X;  4I3J A;  4HI4 A;  4M4X A;  5DJU A;  3UMD A;  1XFQ A;  3EEH A;  3ULF A;  3LIE A;  4R70 A;  4BBV A;  3UB9 A;  3IS2 A;  1T1B A;  4WL9 A;  1LT0 A;  5KIZ A;  3LID A;  3C2W A;  1T18 A;  4L9E A;  1P0Z A;  5TBM A;  3FG8 A;  4GHI B;  3RH8 B;  3ICY A;  2Z6C A;  1LSW A;  2ZOI A;  3F1N B;  3PYP A;  3FC7 A;  4NXB A;  5F5Y A;  4LPZ A;  2PD8 A;  3H82 B;  3UME A;  3LIC A;  2HV1 A;  2VV6 A;  3GDI A;  1T19 A;  3A0R A;  1DP6 A;  1LSX A;  4KUK A;  5HD5 A;  5HSQ A;  4R38 A;  3PHY A;  4HP4 A;  4L9G A;  2Z6D A;  4EER A;  3EWK A;  2W0N A;  1XFN A;  2QJ7 A;  4JGQ A;  1OTE A;  1S66 L;  4HIA A;  3P7N A;  5HWT A;  4LLO B;  2PR5 A;  4BBU A;  3G6O A;  1TS6 A;  3LYX A;  4E04 A;  1GSV A;  1OTB A;  2QKP A;  5AVF A;  1OJG A;  1TS0 A;  1V9Y A;  4HOI A;  3CWF A;  2A24 B;  5HWV A;  4MN5 A;  3ZQ5 A;  4GS9 B;  2VLG A;  1OT6 A;  3OLO A;  3VE4 A;  4I5S A;  4F3L B;  3T50 A;  3MQQ A;  3C8C A;  3A0S A;  4H6J A;  2ZBB A;  3UB6 A;  3F1O B;  4NXE A;  5HZH A;  2PYP A;  2QWS A;  1TS7 A;  5HDD A;  2GJ3 A;  3H7W A;  2EA9 A;  3NOT C;  2JHE A;  1Y28 A;  4RQ9 A;  4XT2 B;  4LRZ E;  3LIF A;  4NXF A;  5HWW A;  4B9O A;  5DJT A;  3BY9 A;  2W27 A;  3NJA A;  1F98 A;  2L4R A;  5A8B A;  1LSV A;  1DP9 A;  1N9O A;  5J4E A;  3E4Q A;  5G4Y A;  4I39 A;  4WF0 A;  1UWN X;  3K3D A;  5F69 A;  4I3A A;  1D06 A;  3F1P B;  3KX0 X;  5J3W A;  5EFW A;  4JGR A;  3UB8 A;  1T1C A;  1OJ5 A;  2PYR A;  2YKH A;  1OT9 A;  3NHQ A;  1S4S A;  2VV7 A;  4HNB A;  5AVE A;  2L1M A;  1XJ6 A;  3IBR A;  1ODV A;  2K7S A;  3MJQ A;  4HJ4 A;  1GSX A;  1XJ3 A;  1T1A A;  4HJ6 A; 
#chains in the Genus database with same CATH topology
 2V9A A;  3LFV A;  3NIA A;  1HD8 A;  1K4E A;  4YOF A;  2M7V A;  1XJ4 A;  4WLA A;  3B33 A;  3GVB A;  2H5S A;  2PBD P;  2UV0 E;  4OPR A;  4DJ2 A;  1P9W A;  2B02 A;  5IS1 A;  4ETZ A;  1EW0 A;  1TD5 A;  2QZ6 A;  4JBF A;  3BLM A;  2WGI A;  3HUO A;  2I72 A;  3A3I A;  3MFX A;  2L0W A;  4MLL A;  4QJG A;  1YAX A;  5CER A;  5FAS A;  1RP5 A;  3F1N A;  1KE0 A;  5E2H A;  3MKE A;  3C30 A;  5EUA A;  1CEG A;  3HJI A;  1PRQ A;  1K6S A;  5GLB A;  4QY6 A;  2WKQ A;  3IWQ A;  5M19 A;  2VJW A;  1HLU P;  3PBS A;  2ZM8 A;  4P6Z M;  4NXG A;  1NZO A;  1IYQ A;  3VV4 A;  3FV7 A;  3GMW A;  3CUE C;  5HFO A;  1W79 A;  1MC0 A;  5HL1 A;  4HQA A;  3S7P A;  4CLC B;  1ES3 A;  3DBA A;  1FCM A;  4G3W A;  2VGJ A;  3V5M A;  4X1M A;  1YSQ A;  4G3V A;  4DN0 A;  4MN6 A;  1QMF A;  3LIA A;  3VE3 A;  1GCE A;  1BLC A;  2A24 A;  3MS6 A;  1K6R A;  3Q1F A;  4RX3 A;  2KLI A;  2HP6 A;  1K4F A;  4HES A;  3T4Q A;  1OPX A;  4HHD A;  1W7F A;  1ZHH B;  4F3L A;  3BFC A;  3DAV A;  1GHI A;  2QJ5 A;  5TR7 A;  2PT7 A;  3VP1 A;  3T1R A;  2ZM0 A;  1ZTU A;  1EWZ A;  3R7W A;  5AQ7 A;  3ZNT A;  4ZDX A;  3CHW P;  1W63 M;  4KZ6 A;  4DF6 A;  5CTN A;  3IT9 A;  2G7U A;  4YIN A;  4JGP A;  1G6A A;  1PFL A;  4OP5 A;  1SCW A;  3K2N A;  4O7D A;  5FEF A;  3HJK A;  4Y17 A;  3E4P A;  1ESU A;  4JGO A;  1X0O A;  2XR0 A;  2JCH A;  3ZVT A;  1KDS A;  4Z9Q A;  1E3U D;  3G30 A;  2XRO A;  3SS4 A;  4X25 A;  1IOU A;  3PTE A;  4KUO A;  2IA2 A;  3F1P A;  3HLF A;  5HD3 A;  1RGY A;  2OWH A;  3FPW A;  5G4Z A;  2WKR A;  2XSS A;  4PM5 A;  2JBF A;  1LHY A;  1YLY A;  4JF5 A;  1SZV A;  1H8Y A;  2XH9 A;  4HH2 A;  3VP0 A;  3CLO A;  3OC2 A;  1L0E A;  4ZAM A;  4L0L A;  3UB7 A;  5F6A A;  1G68 A;  3JYI A;  3SH7 A;  4GW9 A;  4LGW A;  1GSW A;  5AQA A;  1N9N A;  5EVI B;  5GLD A;  3VOZ A;  3UNW A;  3VFH A;  2JKF A;  2BAS A;  4Y7P A;  3VSL A;  2R9W A;  1JWV A;  4WN5 A;  2HP9 A;  1D1J A;  2PU2 A;  4R3B A;  1BTL A;  4OH0 A;  5DKL A;  1RGZ A;  4BMW A;  3ZG8 B;  1JNU A;  1D7E A;  1LI0 A;  3LR4 A;  4M4X A;  1VHM A;  4GJ4 A;  4HBU A;  4LCM A;  5JYP A;  3S7Q A;  3HL9 A;  3NBL A;  2UWX A;  2O9A A;  3W2Z A;  1MXO A;  1PZO A;  1XFQ A;  3OCN A;  5GLA A;  3T4T A;  1T1B A;  4QD4 A;  3LID A;  1O7E A;  5HAQ A;  4L9E A;  3KYQ A;  3MZD A;  4LEN A;  4P85 A;  3ICY A;  3HCY A;  3F1N B;  3W4O A;  1PWG A;  4GZB A;  1XGI A;  1W5D A;  4P6Z S;  1YM1 A;  5E43 A;  1W8Q A;  3A0R A;  1DP6 A;  3NC8 A;  3EGX C;  2DCF A;  2EX9 A;  2Q0O A;  2OAQ 1;  2VGK A;  4HP4 A;  4EER A;  1NLY A;  1Q2P A;  3EWK A;  1XFN A;  2V2F F;  3PBN A;  1S66 L;  2ZC7 A;  2PR5 A;  4FCF A;  4S2N A;  3G2Y A;  3DWZ A;  2Y2O A;  1YLW A;  3ZVW A;  4E04 A;  1XPB A;  1OJG A;  2J9O A;  1TS0 A;  5A90 A;  2A24 B;  4PM7 A;  5KZH A;  1YLZ A;  3VP2 A;  1OT6 A;  4Q0H A;  4E3O A;  1L3L A;  5FI2 A;  3VE4 A;  2Y2L A;  3Q7Z A;  4S2O A;  1TVF A;  3T4K A;  4YNR A;  4GDB A;  4OLD A;  4F3L B;  2O99 A;  5GHX A;  3HLW A;  2BLS A;  5EM0 A;  3BW6 A;  1AWI A;  4GOG A;  3T50 A;  3MQQ A;  3R7W B;  3ISG A;  4JF4 A;  1CK3 A;  1KVM A;  4DXC A;  3HLG A;  3LGO A;  2PYP A;  3FKV A;  3S1Y A;  3KSF A;  5CHM A;  4BJP A;  5HAR A;  1ALQ A;  2GJ3 A;  2BTF P;  3ITB A;  3NOT C;  2W3D A;  3WS1 A;  3TOI A;  4MMN A;  2V8C A;  3FWL A;  4ZJ3 A;  5EEC A;  4MDZ A;  3LIF A;  5HWW A;  2Y2J A;  5DJT A;  3NY4 A;  2W27 A;  4ARZ A;  1IKI A;  3N8S A;  3KSI A;  3NDG A;  5A8B A;  4JXS A;  4Y13 A;  1H3Q A;  3TE8 A;  3IH8 A;  3G31 A;  4I39 A;  1UWN X;  1L2S A;  3HLD A;  1IYS A;  5FSR A;  1YMX A;  5F69 A;  2E8J A;  2VKS A;  4U0T A;  2W3E A;  1D06 A;  3F1P B;  2KOI A;  4IBR A;  1NY0 A;  5EFW A;  5FDH A;  3JVV A;  1K57 A;  3B47 A;  2Y2P A;  4OP8 A;  1OT9 A;  2W3H A;  1LL5 A;  4KZ5 A;  1H8Z A;  4ESP A;  3UPN A;  2VA0 A;  1FIL A;  1PI5 A;  1KGE A;  1STZ A;  3UE3 A;  1MBL A;  1E4D A;  1IEL A;  3IXG A;  3CMZ A;  1XGJ A;  2GNX A;  4HJ6 A;  4CPK A;  1ONH A;  2ZLY A;  2Y2Q A;  3NI9 A;  1V9Z A;  3W4Q A;  4B4Z A;  3UDF A;  3UY6 A;  4Q0J A;  3GV9 A;  4NK3 A;  1NZU A;  1S0W A;  3IX4 A;  3T12 B;  5EVI D;  2G2U A;  3VOY A;  1TDG A;  3DTM A;  3UO9 A;  2XFS A;  3T4L A;  3PXP A;  5AQB A;  5FI7 A;  1ERM A;  4PHT A;  5DF9 A;  4EEU A;  2JC7 A;  5GL9 A;  4MBF A;  2LB9 A;  2WGV A;  1N9B A;  3MR0 A;  2HZ5 A;  4PM6 A;  4MCW A;  4WZ4 A;  1PYY A;  2Q9N A;  3NOP C;  4D2O A;  1XA7 A;  2J9P A;  3LI8 A;  2WKI A;  3ZG0 A;  2J80 A;  2KDK A;  3ZHH A;  5DKK A;  2QHK A;  2V1B A;  2ZQC A;  1GHP A;  4I3I A;  3T1Q B;  4B4X A;  2HGV A;  4ZJ2 A;  4JXV A;  3VOL A;  1KDW A;  2ACG A;  3O5Y A;  3A3E A;  4FH4 A;  5DTK A;  4O0P A;  3UDX A;  3N8L A;  4CLC C;  3IF6 A;  1GHM A;  3NOU C;  1Z09 A;  4DE0 A;  5IHV A;  3FYZ A;  4OOM A;  5I5L A;  2P7J A;  2R9X A;  2Y8H A;  4GS9 A;  4IED A;  4YWZ A;  1XXM A;  2WGW A;  1S67 L;  3PBR A;  1NYM A;  2DRW A;  4Z1W A;  1F2K A;  1BT5 A;  1JTD A;  4FD8 A;  1SKF A;  3UE6 A;  4EEP A;  4MN7 A;  3C4O A;  3DTK A;  4BQM A;  4JF6 A;  4WBG A;  1KE4 A;  3QP8 A;  4Q8I A;  4PM8 A;  2HDU A;  3LUQ A;  2MJ6 A;  1XKZ A;  3A3F A;  3PAE A;  3LR5 A;  5CTM A;  4R6L A;  2PHY A;  5E2E A;  2J3T C;  4BWI A;  3B3X A;  5FI6 A;  4ARZ B;  4XUZ A;  3IF5 A;  4EWF A;  3BFF A;  1NWZ A;  2PD7 A;  5HPI A;  2BG1 A;  5A92 A;  3Q07 A;  2HJ9 C;  3C5A A;  3N7W A;  2WAD A;  2XD1 A;  3ZCZ A;  3SOI A;  2B5R A;  4GNU A;  2XA7 M;  1Q2Q A;  1DJB A;  5E2F A;  1FSY A;  3D72 A;  2D01 A;  4BEN A;  5AQ9 A;  1PIO A;  4WM9 A;  3BFD A;  4E6X A;  2O0Y A;  1PNE A;  1M6K A;  2G2W A;  4DJ3 A;  3BWL A;  2ZC3 B;  3LCE A;  1ZC2 A;  3SW1 A;  3T4O A;  2M1C A;  4P87 A;  4RVA A;  2Y4A A;  2H0T A;  3B42 A;  5KSC A;  2PAV P;  1WA9 A;  1YLJ A;  4PMA A;  5EVI C;  1U60 A;  5HPF A;  1PWD A;  2I9V A;  5EOE A;  4E3M A;  4I3J A;  3SH9 A;  1K55 C;  2ZC6 B;  1W8Y A;  2Q9M A;  2IWB A;  2DMW A;  4RA7 A;  3ZG5 A;  1AXB A;  1VM1 A;  3QNC A;  1BUE A;  4WEL A;  4IVK A;  5G18 A;  3ULF A;  1ACF A;  3WRT A;  3IS2 A;  1ZG6 A;  4WL9 A;  3C38 A;  3C2W A;  3G32 A;  5TBM A;  1P0Z A;  3FG8 A;  1ZKJ A;  4R0Q A;  2Z6C A;  1LSW A;  3FC7 A;  4NXB A;  3UME A;  2PD8 A;  4B93 A;  2ZQ9 A;  4N1H A;  4Y2F A;  1ES4 A;  1T19 A;  4GKU A;  1BZA A;  3QP1 A;  4KZ3 A;  5DTT A;  5GHZ A;  1NLZ A;  4XXR A;  2OLV A;  3SS3 A;  4R38 A;  2WZX A;  2Z6D A;  2ZM2 A;  2QJ7 A;  1HZO A;  3ZYT A;  4JGQ A;  3ZG9 B;  3P7N A;  4QWO A;  4OQG A;  4UA7 A;  2Z2M B;  3N8R A;  4S2M A;  4BBU A;  2C5W B;  4MNR A;  1TS6 A;  3LYX A;  4KQQ A;  3ZG7 B;  1MWS A;  5JYO A;  5F82 A;  4HEF A;  4WZ5 A;  2IWC A;  3IF6 B;  3MBZ A;  3LR0 A;  5FAO A;  3ZFZ A;  3CWF A;  3I7J A;  4MN5 A;  3ZQ5 A;  4GS9 B;  4ZBE A;  3MQ0 A;  2WGW B;  3V39 A;  3BQA A;  3U4L P;  2ZD8 A;  3IXH A;  1P9R A;  2QPN A;  5CEB A;  4H6J A;  3HLC A;  5FQ9 A;  5CX7 A;  4GDN A;  3UB6 A;  4NXE A;  4II7 A;  1YLT A;  3NCK A;  4IJG A;  2QWS A;  5KMW A;  5HDD A;  5CGW A;  3IHA A;  1BSG A;  2JHE A;  4KEN B;  2XK1 A;  1YSP A;  4DMZ A;  1Y28 A;  4RQ9 A;  4R3J A;  1KVL A;  4B9O A;  3DTI A;  4X53 A;  3D4F A;  3OCL A;  3HLE A;  3IXD A;  1I5Q A;  1PW1 A;  1FR6 A;  3GR2 A;  3TRC A;  4MBK A;  5FL3 A;  4E6W A;  4ME4 A;  1FCN A;  1HVB A;  4WF0 A;  2XA7 S;  3K3D A;  4OQ0 A;  3C7V A;  3QP6 A;  3KX0 X;  2Y2I A;  5FQJ A;  3RFB A;  3AGF A;  3UB8 A;  4S2J A;  1F5M A;  5EE8 A;  3WS0 A;  1OJ5 A;  2EXA A;  3LR3 A;  1G5U A;  2W3F A;  4JXG A;  1DJC A;  2VV7 A;  4GLQ A;  1H0M A;  4HNB A;  4OQI A;  2L1M A;  1XJ6 A;  3O87 A;  5CGX A;  4FUW A;  3CI6 A;  2Y59 A;  2X01 A;  2K7S A;  4HJ4 A;  1XJ3 A;  3IBJ A;  4UEY A;  3TSG A;  2WAF A;  1S6R A;  5EPH A;  4DKI A;  2JKT M;  5E2G A;  2OOL A;  1K54 A;  1MKI A;  2EX2 A;  2VK3 A;  2VEA A;  3T4S A;  4S2K A;  4S2I A;  4DDY A;  1K25 A;  3UN7 A;  3RTY A;  5CHU A;  1ERO A;  2ZJ9 A;  3IS2 B;  3T1X A;  2ZC4 B;  4LRX C;  3SZT A;  5EM1 A;  4IVI A;  1KGG A;  5D3O A;  5TBM B;  1TS8 A;  3LY4 A;  5I94 A;  4OON A;  1NXY A;  4OQH A;  2XEP A;  5IU1 A;  5FAT A;  3QNB A;  3IWO A;  1UGU A;  5F68 A;  1MWT A;  5FQK A;  2INW A;  1LL8 A;  2VX8 A;  1FR1 A;  4L9F A;  1DJA A;  4OKP A;  2P74 A;  5FEG A;  3K3C A;  3AGD A;  1BLS A;  4EQ1 A;  1S1Z A;  3LIB A;  2XFT A;  3MFD A;  1HTZ A;  3EQV A;  2ZL1 A;  3RXW A;  3P01 A;  4R1G A;  1DRM A;  4S2N C;  3HRE A;  1GA9 A;  3EQU A;  2RCX A;  3E2K A;  3Q7V A;  3LO7 A;  5A91 A;  3HUN A;  4EU0 A;  2J7V A;  3GRJ A;  4NKP A;  5HDC A;  1EI5 A;  4KZ7 A;  4C6Y A;  3VP4 A;  3NEC A;  2ZQD A;  3C7U A;  3F1O A;  4ZTK A;  3WS2 A;  4EXO A;  4H6J B;  3QHY A;  1KOU A;  4H8R A;  3MKF A;  4PKY G;  3RXX A;  4M3K A;  1OTA A;  2Y91 A;  3BEB A;  1OTI A;  3S7O A;  4IHQ A;  1G28 A;  3U2A A;  2PU4 A;  3ITA A;  2WKP A;  2JKG A;  4EW7 A;  1BYW A;  2YKF A;  4KQO A;  1XJ2 A;  3FKW A;  4I38 A;  4KG6 A;  1I2W A;  4DXB A;  2WUQ A;  4EES A;  1YLP A;  4EUZ A;  2WKH A;  2XQZ A;  3GQZ A;  3IX3 A;  1IEM A;  2V0U A;  4UA9 A;  4HY8 A;  4PPR A;  2J8Y A;  2H28 A;  2JKT I;  1ES5 A;  3CAX A;  3UPO A;  3KSG A;  3WS5 A;  1ESI A;  5EVE A;  1CEF A;  2XGN A;  4JXW A;  4X56 A;  2FFY A;  3PR6 A;  5L07 A;  1K57 C;  4O01 A;  1CQA A;  3S7N A;  3LI9 A;  2KX6 A;  3O86 A;  2A49 A;  5C5K A;  1JVJ A;  1E25 A;  3V67 A;  2PDR A;  1MWR A;  1NRJ A;  1JWZ A;  3ZGA B;  1YQS A;  1YT4 A;  2HPB A;  4R4S A;  4LCL A;  3E0Y A;  3SH8 A;  2XLN A;  2J3W A;  3MSH A;  2O9C A;  2X71 A;  3EEH A;  3LIE A;  4R70 A;  4BBV A;  3UB9 A;  2VGL M;  1XA1 A;  1GA0 A;  2HF6 A;  5DVA A;  5FQQ A;  1OME A;  1PI4 A;  4DE3 A;  3KSH A;  2A2L A;  2W1R A;  4LPZ A;  5CEC A;  2K31 A;  3OPH A;  1SKO A;  2HV1 A;  3HLB A;  2VZW A;  3TG9 A;  2VV6 A;  3GDI A;  3A3J A;  4WMC D;  3CUE A;  3VMA A;  1LSX A;  5TGF A;  5HD5 A;  4U3T A;  3W8K A;  2NUT C;  3PHY A;  4L9G A;  2XF3 A;  1OTE A;  3IQA A;  3D3O A;  4UAA A;  4X69 A;  3T1S A;  3G6O A;  3O3V A;  4LFU A;  1GSV A;  4LV3 A;  1OTB A;  5HL6 A;  2QKP A;  4WEK A;  5AVF A;  2ZL1 B;  3MF0 A;  1YPR A;  1V9Y A;  3OPP A;  1ERQ A;  1SHV A;  5HWV A;  3V50 A;  4E3K A;  5CHJ A;  5HAP A;  2VLG A;  4C75 A;  3DTE A;  3IF6 C;  3Q7V B;  2B18 A;  4BL3 A;  4S2P A;  4AFI A;  5GHY A;  2V1Z A;  5TJJ A;  4KG5 A;  3M6H A;  4K91 A;  1NJ4 A;  1KE3 A;  3C8C A;  2P9V A;  5KSH A;  2ZBB A;  4G3K A;  3F1O B;  4Y0T A;  3ZNY A;  3CJM A;  2M7U A;  3WS4 A;  4Y0O A;  3S4X A;  4FTX A;  4NEE D;  3IX8 A;  3T4J A;  2EFU A;  1K56 D;  3H7W A;  4NET A;  2ZQ7 A;  1FCO A;  2NUP C;  2FZ0 A;  4LRZ E;  4KZB A;  5HW3 A;  3UDI A;  3NJA A;  2Y79 A;  3PAG A;  5K5B A;  1F98 A;  2L4R A;  3D9Y A;  2ZMV A;  2A3U A;  4F94 A;  5L10 A;  5MC7 A;  5AJG A;  4OPZ A;  1DP9 A;  4WMC A;  1N9O A;  1TEM A;  4QB8 A;  5FA7 A;  3BM6 A;  5G4Y A;  3CPT A;  1J3W A;  5DFY A;  5BOH A;  1A0K A;  2WAE A;  4WYY A;  1PWC A;  1LL9 A;  3EEA A;  2W1T A;  5DTS A;  5FQI A;  2PYR A;  4MBH A;  3LY3 A;  3NHQ A;  4BD1 A;  1N4O A;  2P04 A;  1RCJ A;  5AVE A;  3WRZ A;  3IBR A;  2C6W B;  2PRF A;  4X6T A;  2Y2G A;  1MKM A;  2XRN A;  4IBX A;  5F83 A;  1VEU A;  4R23 A;  3MJQ A;  4IUK A;  1T1A A;  3TW8 A;  2OLU A;  4R4R A;  3UE0 A;  4FSF A;  1IYO A;  1WE4 A;  5J7E A;  3AGE A;  1N9L A;  2VGL S;  4Y5F A;  5GLC A;  2EX8 A;  2R78 A;  2ZMF A;  2JKR I;  1K56 A;  1ZG4 A;  4X55 A;  3LEZ A;  4X68 A;  2Y55 A;  4EV4 A;  3HUM A;  2CMN A;  4GHI A;  1MY8 A;  3GEC A;  4ETX A;  1CF0 A;  3MZE A;  3H82 A;  4OOY A;  5LBR A;  4E3J A;  5J8X A;  4JKT A;  2V1A A;  1SKO B;  2Y2H A;  3MZF A;  4QU3 A;  3VFF A;  3FZC A;  1QME A;  3CIT A;  3WWX A;  3G2Z A;  4UQI M;  5EV0 A;  5CRF A;  3UPP A;  4PM9 A;  4ZJ1 A;  1MZU A;  4YFM A;  4BLM A;  4R3A A;  1IFQ A;  4A5R A;  5FQM A;  1IKG A;  1BLP A;  2LB5 A;  1CJF A;  4WUJ A;  5M18 A;  1K0K A;  4KG2 A;  3ZDJ A;  3JVU A;  4KZ9 A;  4HJ3 A;  2GZA A;  3L7H A;  3M2K A;  4DRT A;  1S1Y A;  3KO6 A;  4LV1 A;  4OVD A;  1OTD A;  4X1L A;  2ZC5 B;  4QHC A;  4QY5 A;  2GX5 A;  1VET A;  2V0W A;  3SS5 A;  3BFG A;  4HH3 A;  3E98 A;  3P09 A;  4UA6 A;  3W4P A;  4KQR A;  3DWK A;  1TDL A;  1L0F A;  4N9L A;  4PAU A;  3CG5 A;  4KQD A;  4P0M A;  4WZ5 C;  1CI8 A;  4BBT A;  2HJE A;  2OWJ A;  4EET B;  3BQ8 A;  2ZQ8 A;  1XX2 A;  4E3L A;  1Y4O A;  3G35 A;  1NRF A;  2PR6 A;  5EOO A;  2PBY A;  3PBO A;  1FIK A;  2P9V B;  3KYZ A;  2JN7 A;  3E4O A;  2WZZ A;  3HVF A;  2ZQA A;  2FH5 A;  3V3R A;  2XDM A;  1E3U A;  1ES2 A;  2D02 A;  4KZA A;  1MPL A;  2VV8 A;  3OBF A;  5L2F A;  3A3D A;  3H7W B;  2K2N A;  4XT2 A;  3A0V A;  1ONG A;  4ID4 A;  1L0D A;  5HDS A;  3G34 A;  4HBT A;  3OZH A;  4BL2 A;  3MMH A;  4LRY C;  3BY8 A;  3Q82 A;  1Y54 A;  4GD8 A;  3L9K A;  3MXQ A;  1SDE A;  1YMS A;  4N92 A;  4RYE A;  3IXB A;  3HBR A;  3MXR A;  1C3B A;  3OPL A;  4UHU A;  4DE2 A;  3CPT B;  4JPM A;  2QMI A;  4PKY A;  1VB6 A;  2Y2K A;  5HX9 A;  3PBT A;  1H8M A;  3M6B A;  3R4K A;  2W1T B;  4CLC D;  5DF8 A;  4CJN A;  4U0X A;  4XUX A;  2WKE A;  3IH9 A;  4OOL A;  4N1X A;  1P97 A;  3TJZ C;  1DP8 A;  1F9I A;  4HP9 A;  5TFQ A;  4GCZ A;  1K38 A;  5DF7 A;  4OPY A;  4DDS A;  2ZOH A;  3VSK A;  2HDR A;  3IWI A;  3EGD C;  5F1F A;  2O9B A;  3H9W A;  3FPV A;  1VEU B;  5CXW A;  2Y2N A;  2EXB A;  4K08 A;  2XD5 A;  3E2L A;  4GB7 A;  1FOF A;  3OPR A;  1S4R A;  4Y15 A;  1IYP A;  3MQO A;  4DE1 A;  1UWP X;  4CQH A;  4HI4 A;  3GSG A;  2H10 A;  4EBN A;  1LLB A;  5DJU A;  4E3I A;  4EQI A;  2H0Y A;  4Q0I A;  5L09 A;  1H5X A;  3BEC A;  3G4P A;  4GD6 A;  3UMD A;  2EWV A;  1TF1 A;  3RJU A;  3QP5 A;  3JPU A;  3BLS A;  3S22 A;  1K54 C;  3BJN A;  2J3T D;  4Y0U A;  4K0W A;  1LT0 A;  2IWD A;  5KIZ A;  1T18 A;  4GHI B;  3RH8 B;  4GN2 A;  4RX2 A;  2DNS A;  2GDN A;  2ZOI A;  5FAP A;  3PYP A;  4NG2 A;  4FOF A;  4UQI S;  5DFX A;  3QP4 A;  3H82 B;  5F5Y A;  2X02 A;  3LIC A;  1FQG A;  2Y2M A;  5F1G A;  4OLG A;  4KUK A;  1FSW A;  2AVX A;  3CZD A;  3NDE A;  5HSQ A;  4FH2 A;  4KZ4 A;  5M1A A;  1WYB A;  3EOI A;  1NYY A;  1JTG A;  4K0X A;  4S2L A;  2W0N A;  4CLC A;  4HIA A;  1BUL A;  5HWT A;  4LLO B;  1KGF A;  3UE1 A;  3LEQ A;  5L8M A;  1VQQ A;  2CC1 A;  1G6O A;  4Y3I A;  3VP3 A;  2QYB A;  3QP2 A;  2FFF B;  5U47 A;  5FAQ A;  1VET B;  4HOI A;  3MXS A;  4EBL A;  1BLH A;  4D60 A;  1MWU A;  2WYX A;  4N9K A;  1YKD A;  1L0G A;  3OLO A;  5EVL A;  3Q81 A;  3O88 A;  4OPQ A;  4I5S A;  1LI9 A;  1PZP A;  3UB5 P;  2JE5 A;  2ZMA A;  3DW0 A;  4JLF A;  3A0S A;  4LV2 A;  2EWW A;  2EX6 A;  2OAP 1;  5HZH A;  2P08 A;  3N4I A;  1TS7 A;  4E3N A;  4KZ8 A;  3BFE A;  2EA9 A;  5FDS A;  2V8F A;  1M40 A;  1PW8 A;  5CGS A;  1XP4 A;  5A93 A;  1Z6F A;  4CLC E;  4XT2 B;  4IUH A;  4EBP A;  4NXF A;  3BY9 A;  4BD0 A;  2E8I A;  3V3S A;  4ZRR A;  2W3G A;  1LSV A;  2OSU A;  1W63 Q;  5J4E A;  3E4Q A;  5CED A;  4MEZ A;  3PBQ A;  1I2S A;  4LV0 A;  4I3A A;  3KYE A;  4EUV A;  2EFX A;  4O8G A;  5J3W A;  3BRM A;  3IHB A;  1WYC A;  2B95 A;  4JGR A;  2HDS A;  1T1C A;  2YKH A;  2OV5 A;  1DY6 A;  3GTC A;  4WEJ A;  5HAI A;  1S4S A;  3OOV A;  3P98 A;  3NUL A;  5IT5 A;  3M2J A;  3N6I A;  2HDQ A;  1CI9 A;  1SDN A;  4P6B A;  2JKR M;  1JWP A;  2V20 A;  3BYD A;  1J9M A;  5EVI A;  3C4P A;  2RL3 A;  1ODV A;  4C3Q A;  1O07 A;  1K55 A;  1GSX A;  2HP5 A;  4B88 A;  4QPR A;  2Z2L B;  2WK0 A; 
#chains in the Genus database with same CATH homology
 2V9A A;  3LFV A;  5J7E A;  1V9Z A;  4YOF A;  2JKT M;  2M7V A;  1XJ4 A;  2OOL A;  4WLA A;  1N9L A;  3B33 A;  4Q0J A;  2VGL S;  4Y5F A;  4DJ2 A;  1P9W A;  2B02 A;  2R78 A;  2VEA A;  3T4S A;  1EW0 A;  2ZMF A;  4ETZ A;  5IS1 A;  2JKR I;  1TD5 A;  3MFX A;  2L0W A;  3RTY A;  3IS2 B;  1YAX A;  2CMN A;  4GHI A;  3T4L A;  3PXP A;  4LRX C;  4PHT A;  5DF9 A;  4EEU A;  5TBM B;  3GEC A;  3F1N A;  4ETX A;  1TS8 A;  3H82 A;  5LBR A;  3C30 A;  2LB9 A;  3HJI A;  3MR0 A;  2V1A A;  5IU1 A;  4MCW A;  2WKQ A;  2VJW A;  3CIT A;  3NOP C;  4UQI M;  1UGU A;  1MZU A;  3PBS A;  3LI8 A;  4P6Z M;  4NXG A;  5F68 A;  4R3A A;  2J80 A;  1IFQ A;  3VV4 A;  2KDK A;  2LB5 A;  3CUE C;  2INW A;  1LL8 A;  4WUJ A;  1MC0 A;  5DKK A;  2QHK A;  2VX8 A;  4HQA A;  2V1B A;  4I3I A;  3S7P A;  4CLC B;  2HGV A;  4L9F A;  3JVU A;  3DBA A;  3VOL A;  4G3W A;  3O5Y A;  3K3C A;  4HJ3 A;  2GZA A;  4EQ1 A;  1S1Z A;  3LIB A;  4O0P A;  1S1Y A;  1YSQ A;  4G3V A;  3KO6 A;  4DN0 A;  1OTD A;  4MN6 A;  3EQV A;  4CLC C;  3LIA A;  3VE3 A;  3NOU C;  2GX5 A;  4OOM A;  5I5L A;  2V0W A;  3P01 A;  2A24 A;  2P7J A;  1DRM A;  4HH3 A;  3E98 A;  2KLI A;  2Y8H A;  4GS9 A;  3EQU A;  4YWZ A;  3T4Q A;  4PAU A;  1OPX A;  4KQD A;  4HHD A;  1S67 L;  3PBR A;  1ZHH B;  4Z1W A;  4BBT A;  4F3L A;  4EU0 A;  2QJ5 A;  2HJE A;  2PT7 A;  2OWJ A;  4NKP A;  5HDC A;  4EET B;  3BQ8 A;  1ZTU A;  3UE6 A;  4EEP A;  3R7W A;  4MN7 A;  2PR6 A;  3PBO A;  3F1O A;  4EXO A;  3KYZ A;  2JN7 A;  3E4O A;  4H6J B;  1KOU A;  2FH5 A;  1W63 M;  2D02 A;  4PKY G;  3LUQ A;  2G7U A;  2VV8 A;  3OBF A;  1OTA A;  3H7W B;  2MJ6 A;  2K2N A;  4XT2 A;  4JGP A;  3A0V A;  1OTI A;  3S7O A;  3LR5 A;  4IHQ A;  5HDS A;  1G28 A;  3U2A A;  4R6L A;  2PHY A;  3K2N A;  3MMH A;  2WKP A;  4LRY C;  2J3T C;  4BWI A;  3HJK A;  3E4P A;  3BY8 A;  4JGO A;  4ARZ B;  4EW7 A;  1BYW A;  1X0O A;  3MXQ A;  2YKF A;  4KQO A;  1XJ2 A;  4I38 A;  1NWZ A;  2PD7 A;  5HPI A;  2XRO A;  4EES A;  1IOU A;  2HJ9 C;  4PKY A;  4KUO A;  1VB6 A;  2IA2 A;  3F1P A;  3PBT A;  2V0U A;  1H8M A;  4HY8 A;  5HD3 A;  2OWH A;  3FPW A;  5G4Z A;  2WKR A;  2XSS A;  2H28 A;  2JKT I;  3R4K A;  2XA7 M;  3CAX A;  2W1T B;  4CLC D;  4HH2 A;  3D72 A;  2D01 A;  3KSG A;  3CLO A;  3OC2 A;  4OOL A;  1P97 A;  3TJZ C;  1DP8 A;  1F9I A;  4HP9 A;  3PR6 A;  4GCZ A;  2O0Y A;  4L0L A;  3UB7 A;  5F6A A;  2ZOH A;  4O01 A;  4GW9 A;  1GSW A;  4DJ3 A;  3BWL A;  3S7N A;  3EGD C;  2KX6 A;  2O9B A;  3H9W A;  3LI9 A;  1N9N A;  3FPV A;  3SW1 A;  3T4O A;  2M1C A;  5C5K A;  2BAS A;  3B42 A;  3V67 A;  4K08 A;  2PDR A;  1WA9 A;  1S4R A;  4WN5 A;  1NRJ A;  5DKL A;  4BMW A;  5HPF A;  1JNU A;  1D7E A;  2I9V A;  3MQO A;  1UWP X;  4CQH A;  3LR4 A;  4HI4 A;  4I3J A;  4M4X A;  1VHM A;  4GJ4 A;  2DMW A;  5DJU A;  4Q0I A;  3S7Q A;  3E0Y A;  2O9A A;  3W2Z A;  2J3W A;  4WEL A;  3UMD A;  2O9C A;  2EWV A;  1TF1 A;  1XFQ A;  3OCN A;  3EEH A;  3ULF A;  3LIE A;  3T4T A;  4R70 A;  4BBV A;  3UB9 A;  3BJN A;  2VGL M;  3IS2 A;  1T1B A;  2J3T D;  4WL9 A;  3C38 A;  1LT0 A;  5KIZ A;  2HF6 A;  3LID A;  3C2W A;  1T18 A;  3KYQ A;  1P0Z A;  4L9E A;  5TBM A;  3FG8 A;  4GHI B;  3RH8 B;  3ICY A;  2Z6C A;  3HCY A;  1LSW A;  2ZOI A;  3F1N B;  3KSH A;  3PYP A;  2A2L A;  4FOF A;  3FC7 A;  4NXB A;  2W1R A;  4LPZ A;  2PD8 A;  3H82 B;  4UQI S;  5DFX A;  5F5Y A;  2K31 A;  4B93 A;  3LIC A;  2HV1 A;  2VZW A;  4P6Z S;  2VV6 A;  4Y2F A;  3GDI A;  1T19 A;  3CUE A;  3A0R A;  1DP6 A;  1LSX A;  4KUK A;  1NLZ A;  5HD5 A;  3EGX C;  5HSQ A;  4R38 A;  3EOI A;  2OAQ 1;  2NUT C;  3PHY A;  4HP4 A;  4L9G A;  2Z6D A;  4EER A;  1NLY A;  3EWK A;  2W0N A;  1XFN A;  2QJ7 A;  3ZYT A;  4CLC A;  4JGQ A;  3PBN A;  1OTE A;  1S66 L;  4HIA A;  3P7N A;  5HWT A;  4LLO B;  2PR5 A;  3D3O A;  5L8M A;  4BBU A;  3G6O A;  1TS6 A;  1G6O A;  4Y3I A;  3LYX A;  4E04 A;  1GSV A;  1OTB A;  5HL6 A;  2QKP A;  4WEK A;  5AVF A;  1OJG A;  2QYB A;  1TS0 A;  3MF0 A;  3LR0 A;  1V9Y A;  4HOI A;  3CWF A;  2A24 B;  5HWV A;  4MN5 A;  3ZQ5 A;  4GS9 B;  2VLG A;  1OT6 A;  1YKD A;  3MQ0 A;  4Q0H A;  3OLO A;  3VE4 A;  2B18 A;  3T4K A;  4YNR A;  4I5S A;  4AFI A;  3BQA A;  4F3L B;  2O99 A;  5TJJ A;  1P9R A;  3BW6 A;  3T50 A;  3MQQ A;  3C8C A;  3UME A;  3A0S A;  3R7W B;  5KSH A;  2EWW A;  4H6J A;  5CX7 A;  2ZBB A;  4G3K A;  2OAP 1;  3UB6 A;  3F1O B;  4NXE A;  4II7 A;  5HZH A;  2M7U A;  2P08 A;  2PYP A;  4IJG A;  2QWS A;  3KSF A;  1TS7 A;  4NEE D;  4BJP A;  5HDD A;  3T4J A;  2GJ3 A;  3H7W A;  2EA9 A;  3NOT C;  2JHE A;  2W3D A;  1YSP A;  4MMN A;  4DMZ A;  1Y28 A;  4RQ9 A;  2NUP C;  4XT2 B;  4CLC E;  2FZ0 A;  4MDZ A;  4LRZ E;  3LIF A;  4IUH A;  4NXF A;  5HWW A;  4B9O A;  5DJT A;  3BY9 A;  2W27 A;  3NJA A;  2Y79 A;  5K5B A;  1F98 A;  4ARZ A;  2L4R A;  3KSI A;  3OCL A;  2ZMV A;  4ZRR A;  5A8B A;  2W3G A;  1LSV A;  5MC7 A;  5AJG A;  1H3Q A;  1DP9 A;  1N9O A;  3TRC A;  5FL3 A;  3TE8 A;  1W63 Q;  5J4E A;  3E4Q A;  5G4Y A;  4ME4 A;  4I39 A;  4WF0 A;  1UWN X;  2XA7 S;  3PBQ A;  3K3D A;  5DFY A;  5F69 A;  4I3A A;  2VKS A;  2W3E A;  3F1P B;  1D06 A;  2KOI A;  3KX0 X;  4EUV A;  3EEA A;  4O8G A;  5J3W A;  5EFW A;  2W1T A;  4JGR A;  3RFB A;  3UB8 A;  1F5M A;  3JVV A;  1T1C A;  1OJ5 A;  3B47 A;  2PYR A;  2YKH A;  3LR3 A;  1OT9 A;  2W3F A;  2W3H A;  3NHQ A;  4WEJ A;  1S4S A;  2VV7 A;  4GLQ A;  3OOV A;  4HNB A;  2VA0 A;  5IT5 A;  2P04 A;  5AVE A;  2L1M A;  1XJ6 A;  3IBR A;  1STZ A;  3UE3 A;  2JKR M;  1MKM A;  3CI6 A;  2XRN A;  1ODV A;  2K7S A;  3MJQ A;  4HJ4 A;  1GSX A;  2GNX A;  4IUK A;  1XJ3 A;  1T1A A;  4HJ6 A;  3TW8 A;  4QPR A;  3IBJ A;  4UEY A;  4FSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...