2DMWA

Solution structure of the longin domain of synaptobrevin-like protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
131
structure length
131
Chain Sequence
GSSGSSGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTAPPYAMNSEFSSVLAAQLKHHSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords synaptobrevin-like 1 variant
publication title Solution structure of the LONGIN domain of Synaptobrevin-like protein 1
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 24
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2dmwA01
2DMWA 2NUPC 2NUTC 4AFIA 1IOUA 1H8MA 4B93A 3EGXC 1IFQA 3EGDC 3KYQA 2VX8A 3BW6A
chains in the Genus database with same CATH superfamily
4RA7A 5DTKA 3F1NA 3GRJA 3KYQA 3LR5A 5TR7A 1YLYA 4OOMA 1ZG6A 4E04A 3D4FA 4EU0A 5FQKA 1NWZA 2WAEA 5FQIA 4L9EA 2PYPA 4LRXC 2EWWA 2FH5A 3TE8A 4M3KA 1AXBA 3N8RA 3JPUA 4RX2A 4NG2A 2AVXA 4O0PA 4D2OA 1W63M 3DWZA 5E2GA 1CJFA 5HWWA 2J3TC 2G7UA 3MJQA 3Q7ZA 1YSQA 2W0NA 1YKDA 2MJ6A 2VZWA 3S7OA 4WEKA 1JVJA 2EA9A 4MBFA 1O7EA 3T12B 1H8YA 4F3LB 1H8MA 3TG9A 2FZ0A 4QJGA 3B47A 1IYSA 5IU1A 1KGGA 5AVFA 3V3RA 1WA9A 2HGVA 2VA0A 1NYMA 2XH9A 4X56A 2QWSA 2D02A 1P9RA 5CGWA 2W3GA 2K31A 4FOFA 1VHMA 1I2SA 4ETXA 4IJGA 5FI7A 4ME4A 2JKRI 3MFDA 3SS5A 4RVAA 4JXVA 4BBVA 4HH2A 5EM0A 1CEGA 4Y15A 1S4SA 1OTEA 4YWZA 3OOVA 5J3WA 5M19A 5E2EA 5EM1A 1VETB 3S7PA 1FCOA 3HUMA 2WGWA 5MC7A 3DAVA 5HWTA 4S2KA 1S0WA 2WGIA 5DF9A 3BLMA 2B02A 5EUAA 3PXPA 5GLBA 2WAFA 2QYBA 4Y2FA 3RXXA 4S2PA 1W8QA 2WKPA 1YLPA 1PRQA 2O9AA 4IBXA 4IEDA 1YT4A 1ZHHB 4EEPA 3NBLA 3IXBA 4QU3A 2J9OA 1IYQA 3L9KA 1CQAA 2L4RA 3BQAA 4DE3A 4GB7A 3ZQ5A 5HDCA 1OTAA 5AJGA 4KUOA 1V9ZA 2PU2A 2X01A 4BD1A 2BG1A 2W1RA 4OLDA 2O9BA 3W2ZA 5M18A 4WZ5A 2X71A 1M40A 1V9YA 4EV4A 5CEDA 4BJPA 3IF5A 2ZQDA 4IVKA 1L0GA 1TS6A 3WS2A 3UE0A 4G3VA 2CMNA 5A91A 2GNXA 3ZVTA 4PKYA 5EOEA 5J4EA 1LHYA 2EX2A 5FQMA 4I3AA 2XRNA 3Q81A 3KSIA 4B4XA 4LENA 4MBKA 2PRFA 3FKVA 2H10A 3NOTC 4OQGA 4D60A 4FCFA 3K3CA 4OQHA 1NRJA 2Y2JA 5CGSA 3VFFA 4ZAMA 1FIKA 2V8FA 5U47A 4R38A 2XD1A 3UY6A 4YOFA 4WUJA 3PBTA 2M7UA 2PDRA 1MKMA 1YQSA 4K0WA 1SZVA 1W7FA 1W8YA 1YM1A 1T1BA 1VEUA 4DXBA 1IYOA 3SH9A 2Y2MA 3K2NA 3IX8A 3BFEA 3IXDA 5HDDA 5DTSA 4DN0A 1JWZA 4ETZA 1PIOA 2Z6CA 4FUWA 2PD8A 3H7WB 4XXRA 5IT5A 4LV1A 5HPFA 3HUNA 2VLGA 3HBRA 2ZQ7A 4H8RA 5EVIB 1D1JA 4MLLA 3IF6A 1GA0A 1Z09A 4HHDA 2B95A 3E2KA 2W3HA 3UDXA 1BLHA 3DTKA 3KYZA 3VSKA 1GHPA 4DMZA 3MFXA 3ZG8B 4EERA 3CUEC 3T4SA 4MBHA 2PR6A 2KX6A 3CMZA 3KO6A 4X69A 4OH0A 2J80A 4EXOA 1MWSA 1ZC2A 4IUKA 1ERMA 3FV7A 1P97A 2D01A 2ZMAA 4K91A 4X1MA 1PW8A 3Q7VB 4YNRA 4JBFA 3PYPA 1MBLA 2OSUA 4B88A 1ONHA 4ARZA 1E3UA 4DRTA 5HWVA 3M2JA 3LIEA 5L2FA 5TGFA 3IX4A 1DP6A 1SKOB 4GDNA 2P7JA 4CLCA 3N8SA 5HL6A 2Y2HA 1DP8A 4KENB 5HAQA 3QP8A 5F1GA 3Q82A 5D3OA 3FC7A 4WBGA 4HP4A 2JKTI 5CTMA 3G35A 3JYIA 4DE1A 1N9BA 3IBJA 5DFXA 3BFFA 2VK3A 2Y2IA 5FSRA 3P09A 1PI4A 4UHUA 2ZC6B 5HX9A 3MQOA 5CGXA 4NXEA 2CC1A 3PHYA 3V39A 3G30A 1OTIA 2JE5A 2JKGA 3TSGA 1DJCA 2J3WA 2H0TA 4KZ7A 5DF7A 4U0TA 2QJ7A 3IS2B 1G68A 1S1YA 4MEZA 1K56A 2XA7S 2W1TB 3VP0A 3O3VA 3UMEA 2Y2OA 3LR4A 5TBMA 1S66L 3KSGA 4JPMA 2XFTA 4EETB 1XJ2A 2QHKA 3HUOA 4WYYA 3BY8A 2YKFA 2KOIA 3GTCA 3NCKA 3QP2A 4ZJ1A 2V2FF 3R7WB 3DBAA 3LIFA 4GDBA 3MXQA 1G6AA 5GHYA 4LRZE 3NOUC 5HD5A 4CLCE 1MY8A 2VX8A 5EVEA 2V9AA 3IBRA 3NHQA 3F1OA 2DMWA 3D3OA 3G4PA 4GS9A 1JTGA 5EECA 1L3LA 2PU4A 2OAP1 2Z2LB 4NK3A 1CEFA 2ZQ8A 5CXWA 3VP3A 2BLSA 1XGIA 4OPQA 2HZ5A 4X68A 3C8CA 3G32A 5L8MA 1XA7A 1FSYA 4LV0A 3T4QA 5DKKA 2EX6A 3ZNTA 4Y3IA 3LGOA 3ITBA 2ZMFA 4KQRA 4DKIA 4X25A 1D06A 5EPHA 4KQOA 5KMWA 2GZAA 1JNUA 1NZUA 3UE6A 5DF8A 2A49A 1PW1A 1K38A 3QNBA 2LB9A 4K0XA 5F6AA 4Z9QA 1W79A 4R6LA 2V0WA 2Y2KA 3RTYA 5F83A 4MN6A 3O87A 2DRWA 1BLSA 3OZHA 1IFQA 2Y2GA 1Y4OA 5FQJA 1E3UD 2P9VB 1LL9A 3ZNYA 2GJ3A 1PI5A 4S2MA 4WZ5C 4GLQA 4HESA 2WADA 4UQIS 4X55A 1HD8A 1DP9A 1SDNA 2H0YA 3C38A 5L07A 4E3NA 4CLCD 5DTTA 1F98A 4ZDXA 4XUXA 2QKPA 1LL8A 1OPXA 2IWCA 1GHIA 1W63Q 4KG6A 4OQIA 4PAUA 1FQGA 4B93A 4Y17A 4HQAA 5GLAA 3O86A 3HJIA 5FEGA 4E3JA 5CHUA 2HP5A 2ZL1B 2WZZA 2Z6DA 4XUZA 4R70A 2ZOIA 3VMAA 3E0YA 2W3DA 4WF0A 1P9WA 2OWHA 3CWFA 4RQ9A 5GHZA 5FASA 3EGDC 4PPRA 1LI0A 2ZM2A 4GJ4A 3VOLA 4BLMA 3V3SA 4P87A 4QD4A 3H82B 4Q0JA 3C4OA 1N9OA 1YMXA 3IWIA 5KZHA 2Y2LA 3DTMA 4GHIA 2HP6A 4JGOA 3N7WA 1UWPX 4R3BA 1ES2A 3HVFA 4HBUA 3TOIA 2B18A 1VETA 2H5SA 3L7HA 3SZTA 1K56D 4NXBA 5HAPA 1TEMA 3HLEA 3BECA 1K54A 1H8ZA 4NEED 2HJEA 4F94A 1J3WA 2QZ6A 4G3WA 3IF6C 3T1QB 2EXAA 5DKLA 2V1AA 3MZDA 2DNSA 3NI9A 3LR3A 4BENA 2QMIA 1ZTUA 3LFVA 3VFHA 2XD5A 3ZGAB 4GKUA 3UB9A 4C3QA 4ZRRA 4IBRA 5FATA 5KIZA 3MR0A 3HREA 5KSCA 4I3JA 4ESPA 3AGDA 3OPRA 3CJMA 1ALQA 1RP5A 5E43A 4LV2A 2IWBA 2NUPC 3RXWA 4B9OA 1UGUA 1LSXA 5CTNA 1IKIA 5G18A 3V67A 1CK3A 3V50A 5FDHA 3NC8A 3B33A 5DJTA 4I5SA 4Y13A 5A8BA 1XFNA 3E98A 1LSWA 3I7JA 3NIAA 5I5LA 1N9LA 5F69A 1BT5A 4Q0IA 4CLCC 3MZEA 4OONA 2KLIA 3OPPA 4NXFA 3MF0A 3IXGA 4P6ZM 3BW6A 4UAAA 4EWFA 1ESIA 3CLOA 3CITA 3ITAA 3LUQA 3LEQA 2UV0E 3G34A 2Y59A 4PHTA 2XA7M 3MQQA 1YLZA 1TS0A 3MXRA 3GVBA 4RX3A 1JTDA 3GDIA 2INWA 4QWOA 1OT6A 4HEFA 2Y8HA 3QP5A 2W27A 2ZM8A 3H7WA 1VB6A 5E2FA 2JKRM 3E4PA 3FZCA 3NDEA 5IHVA 2B5RA 3W4OA 1I5QA 1TVFA 5EVIA 4JKTA 4MDZA 4M4XA 4BWIA 4BQMA 3SW1A 5FAQA 3E4OA 3O5YA 4PM7A 1FSWA 4EEUA 4G3KA 1K4FA 1BLCA 4JLFA 4ZBEA 2VGLS 3VP4A 5FEFA 3BY9A 4II7A 4JF5A 4LLOB 4R0QA 1PZOA 4OPZA 3PTEA 4OP8A 3QP1A 2HDUA 2P08A 4LCLA 5GLDA 3BFCA 2X02A 3A0RA 4KZ5A 1YAXA 5F5YA 4EBLA 4OP5A 2EWVA 3QP4A 4C6YA 2BASA 3Q7VA 1JWVA 4RYEA 3EEAA 4S2NA 2W3EA 3DW0A 3PAEA 5HD3A 3UB8A 3HLBA 3E2LA 3BM6A 4DE2A 3FPWA 1XKZA 4XT2A 3D9YA 4R23A 2O99A 5C5KA 4BL2A 1LI9A 3C7VA 1SKOA 4X1LA 5EE8A 3DWKA 4S2LA 5F1FA 1BSGA 4P0MA 4PM6A 5CRFA 2EX9A 3T4JA 2WKHA 2XR0A 1K4EA 1Q2QA 3LO7A 3QHYA 5M1AA 2Q0OA 5GLCA 1ES3A 3AGEA 3M2KA 5F68A 2HDQA 4LRYC 3ZHHA 5JYPA 1G28A 1D7EA 1Y54A 2JHEA 4JGQA 4BBUA 4KQDA 1XJ6A 3N6IA 1MKIA 3CPTB 4JF6A 2EX8A 3QP6A 2A24A 3C4PA 4U0XA 2EFXA 2PAVP 1NRFA 4EUZA 3VP2A 3ICYA 2JN7A 4LV3A 1PYYA 4Y0TA 2Y79A 3ZG5A 3H9WA 1GHMA 4OPYA 3IS2A 2XSSA 5EV0A 2W1TA 4JF4A 3G6OA 2WUQA 3RH8B 5HAIA 3UDIA 2JKFA 4GD8A 1M6KA 2RCXA 4HIAA 4HOIA 4KZ8A 4HI4A 2I9VA 2XDMA 2FFFB 2RL3A 3R7WA 5J8XA 1STZA 1CI8A 1XA1A 2XFSA 4KQQA 3AGFA 3PBRA 4WL9A 2UWXA 4R3AA 1XJ3A 1G6OA 1KOUA 3IF6B 3EQUA 4UEYA 4DXCA 1SDEA 2HDSA 4DE0A 3MKEA 5HSQA 5EFWA 1XX2A 3LIAA 1DY6A 3FYZA 2OLUA 3A0VA 3PBNA 4H6JA 2VEAA 3S22A 1N9NA 1K55A 1YMSA 3NULA 1E25A 3VOZA 1H3QA 1XP4A 3MSHA 1BYWA 5DVAA 1YLWA 3TW8A 3IHAA 1BZAA 3OCNA 3HLFA 1EWZA 3A3JA 5GL9A 5CECA 4KZBA 3RJUA 2Y55A 5KSHA 1X0OA 5FAPA 5EVID 4CPKA 1BULA 3W4QA 1K54C 3KX0X 4I3IA 2J8YA 4BMWA 4OQ0A 2EFUA 4OLGA 3IWQA 4GCZA 1MWTA 4PMAA 4BD0A 4EBNA 5FL3A 4CLCB 2OOLA 3LICA 1ERQA 3LIDA 4FSFA 4E3MA 4GN2A 3VE3A 3OLOA 2JKTM 3EWKA 4UA7A 4PM9A 4X53A 2R9WA 3P01A 5EVLA 1MWRA 3ZG9B 5A92A 3A0SA 3VE4A 2P9VA 1XGJA 3GMWA 3OCLA 3G31A 4JGRA 1EROA 3VSLA 2XLNA 4NETA 1VQQA 1TF1A 1MWUA 3UB6A 3T1RA 2J3TD 3S7QA 4GW9A 1H5XA 4IVIA 2Y2NA 3BWLA 1K25A 1T1CA 4NXGA 1TD5A 2XK1A 3UPOA 1S1ZA 1T19A 2ZL1A 4O7DA 5TBMB 3JVUA 3W8KA 4LGWA 1ES4A 4CJNA 1IELA 2WKQA 3F1PB 3HL9A 1WYCA 2G2UA 4K08A 2ZC3B 3ZG0A 2LB5A 2OV5A 1IYPA 2QJ5A 3H82A 3LCEA 2VKSA 3K3DA 4BBTA 1U60A 3WS0A 2PT7A 1RCJA 5GHXA 1F9IA 3WS4A 3IXHA 4OOLA 1BUEA 4IUHA 1JWPA 3A3IA 4GS9B 3V5MA 1GSVA 4QY5A 3E4QA 3LIBA 1GA9A 1TS7A 3UO9A 4P6BA 4F3LA 1H0MA 1Y28A 2OAQ1 3LI9A 2VV6A 5G4YA 5EVIC 3Q1FA 3NOPC 3KSFA 2PBYA 2FFYA 2I72A 3EQVA 1SHVA 3GR2A 2NUTC 1K0KA 4DDSA 3W4PA 3UNWA 4HBTA 3S7NA 3M6HA 2M1CA 3VV4A 1ODVA 3WS1A 4S2JA 1AWIA 1PNEA 2ZQAA 3WRZA 2ZBBA 1FCMA 4BL3A 1NXYA 1CF0A 1NLZA 1BLPA 2J7VA 1KDSA 4GOGA 5G4ZA 3PBOA 1K6SA 3DTEA 3PBQA 1KGEA 2EXBA 2Y91A 3LYXA 4PM8A 4S2NC 3ISGA 2Y2QA 3O88A 5HZHA 1HVBA 4N1XA 3OPHA 3KSHA 3DTIA 5FA7A 3GSGA 3A3FA 2J9PA 4FTXA 2WKRA 1TS8A 4PM5A 4S2IA 2XGNA 4DJ2A 1N4OA 3WS5A 5AQBA 3MMHA 3VOYA 3T50A 1F2KA 1FR1A 5LBRA 3F1NB 1YLJA 2A2LA 3N8LA 1LT0A 3MXSA 2WKIA 3IT9A 3TRCA 4E6WA 4OPRA 1OJ5A 3P7NA 3SS4A 3U2AA 1KE4A 2QPNA 2R78A 3B3XA 4PKYG 3R4KA 3B42A 2M7VA 1IKGA 2E8IA 3G2YA 2OLVA 1K57A 2A3UA 4MCWA 4HJ4A 4CQHA 2ZC7A 3BLSA 4EQIA 1RGZA 3BQ8A 3MS6A 2ZMVA 4R1GA 3CHWP 3HLWA 1S6RA 3GECA 4HJ6A 5CX7A 4UA9A 3EOIA 3QNCA 2WKEA 4GHIB 2ZD8A 2W3FA 3IX3A 1LLBA 2Y4AA 3GV9A 5FDSA 3OPLA 1XPBA 2WGVA 3C30A 1F5MA 4KZ9A 4WELA 3ZCZA 5HPIA 4LPZA 3ZG7B 3M6BA 2L1MA 4ZTKA 2C5WB 3D72A 1FILA 3IHBA 5CHJA 2V20A 3PBSA 2HP9A 5A90A 2XQZA 5A93A 2V0UA 4EBPA 2XROA 5HFOA 5BOHA 1SKFA 2V1ZA 1XXMA 2L0WA 2HV1A 3BJNA 1K55C 4NKPA 2Q9NA 3OBFA 2JC7A 2ZJ9A 5L10A 3SH8A 4E3LA 3UPNA 3FWLA 2E8JA 2WK0A 3LY3A 3ZFZA 3JVVA 4L0LA 2VGJA 3IH9A 3MKFA 2OWJA 5JYOA 4E3KA 2VV7A 1ES5A 3ZDJA 3UE3A 4YINA 1L2SA 4R4RA 3T4KA 1NZOA 1Q2PA 3EGXC 5IS1A 1IEMA 4N9LA 2WGWB 4KG5A 1YPRA 3PAGA 1WYBA 2KDKA 4WN5A 5DJUA 5HARA 2G2WA 2O0YA 1DJAA 5FQ9A 2PYRA 4IHQA 1GCEA 1L0EA 2PD7A 4ZJ3A 3CPTA 1Z6FA 2GDNA 1HLUP 2HF6A 1ZG4A 1ZKJA 3Q07A 1BTLA 3HCYA 1EI5A 3A3EA 3UB5P 2ZQCA 1PWDA 4MNRA 4GD6A 4DF6A 4P85A 5HL1A 1NYYA 1KVMA 4N92A 3MBZA 1T1AA 3HLGA 2PR5A 1PWCA 1NY0A 5AQAA 1E4DA 1NLYA 1MC0A 2O9CA 1DJBA 4KZ6A 3UPPA 3SOIA 4AFIA 3WRTA 4WMCA 5DFYA 1OTDA 3UMDA 3BEBA 3LI8A 4KUKA 3EEHA 4Y5FA 4FH4A 3ULFA 2JCHA 2IWDA 3UN7A 4OVDA 4LFUA 2ZM0A 4UQIM 4R3JA 3UB7A 2Q9MA 3FG8A 4JXWA 4MMNA 2DCFA 1QMFA 2V1BA 4O8GA 2ZC5B 3LR0A 3HLCA 3ZYTA 4HNBA 4LCMA 3VP1A 1VEUB 1W5DA 1P0ZA 5E2HA 4U3TA 3CAXA 4YFMA 2ZC4B 4QHCA 2WZXA 4A5RA 1HZOA 1L0FA 5F82A 4DDYA 1VM1A 4O01A 4ZJ2A 4KG2A 1S4RA 3C5AA 3U4LP 4JGPA 1MPLA 2XEPA 3G2ZA 3N4IA 4HJ3A 1OMEA 5AVEA 1O07A 4XT2B 4Z1WA 2Y2PA 3CI6A 5CEBA 4Y7PA 1KVLA 1KDWA 2R9XA 1K6RA 5AQ9A 2PHYA 5FQQA 1OTBA 3BRMA 2C6WB 5FAOA 3ZVWA 4EW7A 3HLDA 2YKHA 4I38A 5CERA 4DJ3A 1PWGA 5CHMA 3UE1A 3KYEA 4EESA 4MN7A 3NECA 3T1SA 3CG5A 4GNUA 3FKWA 1XFQA 4WZ4A 3BYDA 4E6XA 3T4OA 3BFDA 3MQ0A 2A24B 2Z2MB 4C75A 5L09A 5FI6A 4P6ZS 2IA2A 4WLAA 4ARZB 3TJZC 3P98A 4KZ4A 5K5BA 1C3BA 1KGFA 4HP9A 3FPVA 3T1XA 3A3DA 3C7UA 1XJ4A 1ESUA 1CI9A 4OOYA 1OT9A 1TDLA 1WE4A 3IH8A 3CZDA 4FH2A 4L9GA 3RFBA 3BFGA 4GZBA 1GSXA 3F1PA 4Q8IA 3IQAA 1IOUA 2VGKA 4KZAA 5HW3A 1GSWA 3GQZA 3T4LA 2XF3A 2K2NA 2ACGA 1KE3A 1I2WA 3S4XA 1LSVA 2ZLYA 3C2WA 4EUVA 5I94A 3S1YA 4L9FA 2PBDP 1A0KA 1LL5A 1K57C 5AQ7A 1QMEA 1NJ4A 4JXGA 3IWOA 4JXSA 1KE0A 4UA6A 4H6JB 1PZPA 1MXOA 1T18A 2HJ9C 1G5UA 2ZOHA 4E3IA 4S2OA 1OJGA 4N9KA 4WMCD 4R4SA 4Y0UA 1EW0A 4MN5A 4KZ3A 2WYXA 1YLTA 1DRMA 2K7SA 4E3OA 1L0DA 4FD8A 2BTFP 2HDRA 3LEZA 3LY4A 1RGYA 3MZFA 2H28A 3CUEA 3UDFA 1ONGA 2GX5A 4X6TA 1PFLA 4QY6A 2VV8A 1ACFA 2JBFA 3NY4A 4HY8A 5TJJA 3T4TA 4EQ1A 1S67L 4WEJA 5EOOA 4QB8A 4I39A 1UWNX 1YSPA 2P74A 5J7EA 3HJKA 4ID4A 4HH3A 4QPRA 2HPBA 3F1OB 2V8CA 2VGLM 1FOFA 3NDGA 4OKPA 3WWXA 2ZQ9A 4WM9A 3PR6A 4N1HA 3SS3A 2P04A 1SCWA 1FR6A 3OC2A 3NJAA 4Y0OA 3SH7A 1J9MA 1MZUA 5FI2A 2VJWA 5TFQA 5HDSA 1TDGA 4B4ZA 1FCNA 1HTZA 4Q0HA
chains in the Genus database with same CATH topology
3BY8A 3F1NA 2YKFA 2KOIA 3KYQA 3LR5A 3R7WB 3DBAA 2L1MA 5F68A 4OOMA 3LIFA 4LRYC 3D72A 3MXQA 1G28A 1D7EA 2JHEA 4JGQA 4BBUA 4E04A 4KQDA 1XJ6A 4LRZE 3NOUC 5HD5A 4CLCE 4EU0A 2VX8A 3PBSA 1NWZA 2V9AA 2A24A 3IBRA 3NHQA 2V0UA 3F1OA 2DMWA 3D3OA 2XROA 4GS9A 4L9EA 2L0WA 2PYPA 2HV1A 3ICYA 2EWWA 4LRXC 3BJNA 2JN7A 2OAP1 4NKPA 2FH5A 3TE8A 2Y79A 3H9WA 3OBFA 3IS2A 3C8CA 5L8MA 3JVVA 4L0LA 4O0PA 1W63M 2XSSA 2OWJA 2W1TA 5HWWA 2J3TC 2VV7A 2G7UA 3G6OA 3MJQA 3T4QA 1YSQA 5DKKA 3RH8B 2W0NA 1YKDA 2MJ6A 4Y3IA 3UE3A 2VZWA 2ZMFA 3T4KA 3S7OA 4WEKA 3EGXC 2EA9A 4HOIA 4HIAA 5IS1A 1D06A 4HI4A 4KQOA 2I9VA 4F3LB 1H8MA 2KDKA 2FZ0A 3R7WA 1STZA 4WN5A 2GZAA 5DJUA 3B47A 5IU1A 3PBRA 5AVFA 1JNUA 2O0YA 4WL9A 4R3AA 3UE6A 1WA9A 2HGVA 2PYRA 1XJ3A 2VA0A 4IHQA 1G6OA 1KOUA 3EQUA 4UEYA 2PD7A 2LB9A 5F6AA 2HF6A 4R6LA 2V0WA 5HSQA 5EFWA 3RTYA 2QWSA 2D02A 1P9RA 2W3GA 4MN6A 3HCYA 2K31A 4FOFA 1VHMA 3LIAA 3A0VA 3PBNA 4H6JA 2VEAA 4ETXA 4IJGA 1N9NA 4ME4A 2JKRI 1IFQA 1H3QA 1BYWA 4BBVA 3TW8A 4HH2A 3OCNA 1T1AA 2PR5A 2GJ3A 1NLYA 1MC0A 1S4SA 5KSHA 1OTEA 2O9CA 1X0OA 4GLQA 3OOVA 4YWZA 5J3WA 4UQIS 1DP9A 4AFIA 3C38A 3S7PA 4CLCD 3KX0X 5DFYA 1OTDA 1F98A 3UMDA 4I3IA 5MC7A 4BMWA 2QKPA 5HWTA 1LL8A 1OPXA 3LI8A 1W63Q 5DF9A 4GCZA 4KUKA 2B02A 3EEHA 4PAUA 4Y5FA 4B93A 3PXPA 3ULFA 4HQAA 3HJIA 5FL3A 4CLCB 2QYBA 4Y2FA 2OOLA 2WKPA 2Z6DA 4R70A 2ZOIA 4UQIM 3LICA 3E0YA 3LIDA 4FSFA 2W3DA 4WF0A 3UB7A 1P9WA 2O9AA 3FG8A 2OWHA 3CWFA 4RQ9A 3VE3A 3OLOA 2JKTM 3EGDC 3EWKA 4MMNA 4GJ4A 3VOLA 1ZHHB 4EEPA 3P01A 3H82B 2L4RA 2V1BA 3BQAA 4O8GA 4Q0JA 1N9OA 3ZQ5A 5HDCA 1OTAA 3A0SA 3LR0A 3VE4A 5AJGA 4KUOA 1V9ZA 3ZYTA 4HNBA 2W1RA 4GHIA 4JGOA 1P0ZA 2O9BA 3W2ZA 1UWPX 3OCLA 4JGRA 3CAXA 1V9YA 2B18A 4BJPA 1TF1A 4NXBA 4O01A 3UB6A 2J3TD 1S4RA 4JGPA 1TS6A 3S7QA 4HJ3A 4G3VA 2CMNA 2GNXA 5J4EA 4PKYA 5AVEA 4NEED 2HJEA 4GW9A 4XT2B 4Z1WA 3CI6A 4I3AA 2XRNA 3BWLA 3KSIA 1T1CA 4NXGA 1TD5A 4G3WA 3NOTC 1S1ZA 1T19A 5DKLA 2V1AA 2PHYA 5TBMB 3JVUA 3K3CA 1NRJA 1OTBA 3LR3A 1ZTUA 2WKQA 3F1PB 3LFVA 4EW7A 4K08A 2YKHA 4R38A 4I38A 3UB9A 2LB5A 4YOFA 4WUJA 4ZRRA 4DJ3A 2QJ5A 5KIZA 3H82A 3MR0A 4EESA 2VKSA 3K3DA 4BBTA 3PBTA 4MN7A 2M7UA 4I3JA 2PDRA 1MKMA 2PT7A 1XFQA 1T1BA 2NUPC 3T4OA 1F9IA 4OOLA 3MQ0A 2A24B 3K2NA 4IUHA 4B9OA 4GS9B 1UGUA 5HDDA 4DN0A 1LSXA 1GSVA 4ETZA 2Z6CA 4P6ZS 3V67A 2IA2A 4WLAA 3B33A 3E4QA 3LIBA 4ARZB 2PD8A 3TJZC 5DJTA 4I5SA 1TS7A 3H7WB 5IT5A 4F3LA 5A8BA 1XFNA 5K5BA 3E98A 1Y28A 2OAQ1 3LI9A 1LSWA 5I5LA 2VV6A 5HPFA 1N9LA 5G4YA 2VLGA 5F69A 4HP9A 3FPVA 4Q0IA 3NOPC 1XJ4A 3KSFA 4CLCC 4HHDA 3EQVA 2KLIA 1OT9A 2W3HA 4NXFA 3KYZA 4DMZA 3MFXA 2NUTC 4L9GA 3MF0A 3RFBA 1GSXA 3F1PA 3S7NA 4P6ZM 3BW6A 4EERA 3CUEC 1IOUA 2M1CA 3T4SA 1GSWA 2PR6A 3VV4A 2KX6A 1ODVA 3KO6A 3T4LA 2K2NA 3CLOA 2J80A 4EXOA 3CITA 1LSVA 3LUQA 3C2WA 2ZBBA 4IUKA 4EUVA 4PHTA 1NLZA 2XA7M 3MQQA 4L9FA 1TS0A 5G4ZA 3PBOA 1P97A 2D01A 3PBQA 3GDIA 2INWA 3LYXA 4YNRA 1OT6A 2Y8HA 3PYPA 4H6JB 2W27A 1T18A 5HZHA 2HJ9C 3KSHA 4ARZA 3H7WA 1VB6A 2ZOHA 2JKRM 3E4PA 1OJGA 5HWVA 3LIEA 1EW0A 2WKRA 4MN5A 1TS8A 1DP6A 1DRMA 2K7SA 2P7JA 4CLCA 5HL6A 4MDZA 4M4XA 4BWIA 4DJ2A 1DP8A 3SW1A 3E4OA 3O5YA 4EEUA 4G3KA 2H28A 2VGLS 3FC7A 3MMHA 3BY9A 4II7A 4HP4A 2JKTI 4LLOB 3CUEA 3T50A 5LBRA 2GX5A 3F1NB 2A2LA 1LT0A 2VV8A 3TRCA 4HY8A 3IBJA 5TJJA 5DFXA 3T4TA 4EQ1A 1OJ5A 3P7NA 3U2AA 2P08A 1S67L 2R78A 4PKYG 3A0RA 4WEJA 3R4KA 4I39A 1UWNX 1YSPA 3B42A 2M7VA 5J7EA 1YAXA 3HJKA 5F5YA 2EWVA 4HH3A 2BASA 4QPRA 4MCWA 3F1OB 3MQOA 4NXEA 3EEAA 2VGLM 2W3EA 3PHYA 4HJ4A 4CQHA 1OTIA 5HD3A 3BQ8A 3UB8A 2ZMVA 3PR6A 3FPWA 2P04A 3GECA 4HJ6A 4XT2A 5CX7A 2J3WA 2O99A 5C5KA 3EOIA 3OC2A 4GHIB 2QJ7A 3NJAA 3IS2B 1S1YA 2W3FA 2XA7S 1MZUA 2W1TB 2VJWA 5HDSA 3UMEA 3C30A 3LR4A 5TBMA 1S66L 1F5MA 3KSGA 4WELA 3T4JA 4EETB 5HPIA 1XJ2A 2QHKA 4Q0HA 4LPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMW A;  2NUP C;  2NUT C;  4AFI A;  1IOU A;  1H8M A;  4B93 A;  3EGX C;  1IFQ A;  3EGD C;  3KYQ A;  2VX8 A;  3BW6 A; 
#chains in the Genus database with same CATH topology
 4RA7 A;  5DTK A;  3F1N A;  3GRJ A;  3KYQ A;  3LR5 A;  5TR7 A;  1YLY A;  4OOM A;  1ZG6 A;  4E04 A;  3D4F A;  4EU0 A;  5FQK A;  1NWZ A;  2WAE A;  5FQI A;  4L9E A;  2PYP A;  4LRX C;  2EWW A;  2FH5 A;  3TE8 A;  4M3K A;  1AXB A;  3N8R A;  3JPU A;  4RX2 A;  4NG2 A;  2AVX A;  4O0P A;  4D2O A;  1W63 M;  3DWZ A;  5E2G A;  1CJF A;  5HWW A;  2J3T C;  2G7U A;  3MJQ A;  3Q7Z A;  1YSQ A;  2W0N A;  1YKD A;  2MJ6 A;  2VZW A;  3S7O A;  4WEK A;  1JVJ A;  2EA9 A;  4MBF A;  1O7E A;  3T12 B;  1H8Y A;  4F3L B;  1H8M A;  3TG9 A;  2FZ0 A;  4QJG A;  3B47 A;  1IYS A;  5IU1 A;  1KGG A;  5AVF A;  3V3R A;  1WA9 A;  2HGV A;  2VA0 A;  1NYM A;  2XH9 A;  4X56 A;  2QWS A;  2D02 A;  1P9R A;  5CGW A;  2W3G A;  2K31 A;  4FOF A;  1VHM A;  1I2S A;  4ETX A;  4IJG A;  5FI7 A;  4ME4 A;  2JKR I;  3MFD A;  3SS5 A;  4RVA A;  4JXV A;  4BBV A;  4HH2 A;  5EM0 A;  1CEG A;  4Y15 A;  1S4S A;  1OTE A;  4YWZ A;  3OOV A;  5J3W A;  5M19 A;  5E2E A;  5EM1 A;  1VET B;  3S7P A;  1FCO A;  3HUM A;  2WGW A;  5MC7 A;  3DAV A;  5HWT A;  4S2K A;  1S0W A;  2WGI A;  5DF9 A;  3BLM A;  2B02 A;  5EUA A;  3PXP A;  5GLB A;  2WAF A;  2QYB A;  4Y2F A;  3RXX A;  4S2P A;  1W8Q A;  2WKP A;  1YLP A;  1PRQ A;  2O9A A;  4IBX A;  4IED A;  1YT4 A;  1ZHH B;  4EEP A;  3NBL A;  3IXB A;  4QU3 A;  2J9O A;  1IYQ A;  3L9K A;  1CQA A;  2L4R A;  3BQA A;  4DE3 A;  4GB7 A;  3ZQ5 A;  5HDC A;  1OTA A;  5AJG A;  4KUO A;  1V9Z A;  2PU2 A;  2X01 A;  4BD1 A;  2BG1 A;  2W1R A;  4OLD A;  2O9B A;  3W2Z A;  5M18 A;  4WZ5 A;  2X71 A;  1M40 A;  1V9Y A;  4EV4 A;  5CED A;  4BJP A;  3IF5 A;  2ZQD A;  4IVK A;  1L0G A;  1TS6 A;  3WS2 A;  3UE0 A;  4G3V A;  2CMN A;  5A91 A;  2GNX A;  3ZVT A;  4PKY A;  5EOE A;  5J4E A;  1LHY A;  2EX2 A;  5FQM A;  4I3A A;  2XRN A;  3Q81 A;  3KSI A;  4B4X A;  4LEN A;  4MBK A;  2PRF A;  3FKV A;  2H10 A;  3NOT C;  4OQG A;  4D60 A;  4FCF A;  3K3C A;  4OQH A;  1NRJ A;  2Y2J A;  5CGS A;  3VFF A;  4ZAM A;  1FIK A;  2V8F A;  5U47 A;  4R38 A;  2XD1 A;  3UY6 A;  4YOF A;  4WUJ A;  3PBT A;  2M7U A;  2PDR A;  1MKM A;  1YQS A;  4K0W A;  1SZV A;  1W7F A;  1W8Y A;  1YM1 A;  1T1B A;  1VEU A;  4DXB A;  1IYO A;  3SH9 A;  2Y2M A;  3K2N A;  3IX8 A;  3BFE A;  3IXD A;  5HDD A;  5DTS A;  4DN0 A;  1JWZ A;  4ETZ A;  1PIO A;  2Z6C A;  4FUW A;  2PD8 A;  3H7W B;  4XXR A;  5IT5 A;  4LV1 A;  5HPF A;  3HUN A;  2VLG A;  3HBR A;  2ZQ7 A;  4H8R A;  5EVI B;  1D1J A;  4MLL A;  3IF6 A;  1GA0 A;  1Z09 A;  4HHD A;  2B95 A;  3E2K A;  2W3H A;  3UDX A;  1BLH A;  3DTK A;  3KYZ A;  3VSK A;  1GHP A;  4DMZ A;  3MFX A;  3ZG8 B;  4EER A;  3CUE C;  3T4S A;  4MBH A;  2PR6 A;  2KX6 A;  3CMZ A;  3KO6 A;  4X69 A;  4OH0 A;  2J80 A;  4EXO A;  1MWS A;  1ZC2 A;  4IUK A;  1ERM A;  3FV7 A;  1P97 A;  2D01 A;  2ZMA A;  4K91 A;  4X1M A;  1PW8 A;  3Q7V B;  4YNR A;  4JBF A;  3PYP A;  1MBL A;  2OSU A;  4B88 A;  1ONH A;  4ARZ A;  1E3U A;  4DRT A;  5HWV A;  3M2J A;  3LIE A;  5L2F A;  5TGF A;  3IX4 A;  1DP6 A;  1SKO B;  4GDN A;  2P7J A;  4CLC A;  3N8S A;  5HL6 A;  2Y2H A;  1DP8 A;  4KEN B;  5HAQ A;  3QP8 A;  5F1G A;  3Q82 A;  5D3O A;  3FC7 A;  4WBG A;  4HP4 A;  2JKT I;  5CTM A;  3G35 A;  3JYI A;  4DE1 A;  1N9B A;  3IBJ A;  5DFX A;  3BFF A;  2VK3 A;  2Y2I A;  5FSR A;  3P09 A;  1PI4 A;  4UHU A;  2ZC6 B;  5HX9 A;  3MQO A;  5CGX A;  4NXE A;  2CC1 A;  3PHY A;  3V39 A;  3G30 A;  1OTI A;  2JE5 A;  2JKG A;  3TSG A;  1DJC A;  2J3W A;  2H0T A;  4KZ7 A;  5DF7 A;  4U0T A;  2QJ7 A;  3IS2 B;  1G68 A;  1S1Y A;  4MEZ A;  1K56 A;  2XA7 S;  2W1T B;  3VP0 A;  3O3V A;  3UME A;  2Y2O A;  3LR4 A;  5TBM A;  1S66 L;  3KSG A;  4JPM A;  2XFT A;  4EET B;  1XJ2 A;  2QHK A;  3HUO A;  4WYY A;  3BY8 A;  2YKF A;  2KOI A;  3GTC A;  3NCK A;  3QP2 A;  4ZJ1 A;  2V2F F;  3R7W B;  3DBA A;  3LIF A;  4GDB A;  3MXQ A;  1G6A A;  5GHY A;  4LRZ E;  3NOU C;  5HD5 A;  4CLC E;  1MY8 A;  2VX8 A;  5EVE A;  2V9A A;  3IBR A;  3NHQ A;  3F1O A;  2DMW A;  3D3O A;  3G4P A;  4GS9 A;  1JTG A;  5EEC A;  1L3L A;  2PU4 A;  2OAP 1;  2Z2L B;  4NK3 A;  1CEF A;  2ZQ8 A;  5CXW A;  3VP3 A;  2BLS A;  1XGI A;  4OPQ A;  2HZ5 A;  4X68 A;  3C8C A;  3G32 A;  5L8M A;  1XA7 A;  1FSY A;  4LV0 A;  3T4Q A;  5DKK A;  2EX6 A;  3ZNT A;  4Y3I A;  3LGO A;  3ITB A;  2ZMF A;  4KQR A;  4DKI A;  4X25 A;  1D06 A;  5EPH A;  4KQO A;  5KMW A;  2GZA A;  1JNU A;  1NZU A;  3UE6 A;  5DF8 A;  2A49 A;  1PW1 A;  1K38 A;  3QNB A;  2LB9 A;  4K0X A;  5F6A A;  4Z9Q A;  1W79 A;  4R6L A;  2V0W A;  2Y2K A;  3RTY A;  5F83 A;  4MN6 A;  3O87 A;  2DRW A;  1BLS A;  3OZH A;  1IFQ A;  2Y2G A;  1Y4O A;  5FQJ A;  1E3U D;  2P9V B;  1LL9 A;  3ZNY A;  2GJ3 A;  1PI5 A;  4S2M A;  4WZ5 C;  4GLQ A;  4HES A;  2WAD A;  4UQI S;  4X55 A;  1HD8 A;  1DP9 A;  1SDN A;  2H0Y A;  3C38 A;  5L07 A;  4E3N A;  4CLC D;  5DTT A;  1F98 A;  4ZDX A;  4XUX A;  2QKP A;  1LL8 A;  1OPX A;  2IWC A;  1GHI A;  1W63 Q;  4KG6 A;  4OQI A;  4PAU A;  1FQG A;  4B93 A;  4Y17 A;  4HQA A;  5GLA A;  3O86 A;  3HJI A;  5FEG A;  4E3J A;  5CHU A;  2HP5 A;  2ZL1 B;  2WZZ A;  2Z6D A;  4XUZ A;  4R70 A;  2ZOI A;  3VMA A;  3E0Y A;  2W3D A;  4WF0 A;  1P9W A;  2OWH A;  3CWF A;  4RQ9 A;  5GHZ A;  5FAS A;  3EGD C;  4PPR A;  1LI0 A;  2ZM2 A;  4GJ4 A;  3VOL A;  4BLM A;  3V3S A;  4P87 A;  4QD4 A;  3H82 B;  4Q0J A;  3C4O A;  1N9O A;  1YMX A;  3IWI A;  5KZH A;  2Y2L A;  3DTM A;  4GHI A;  2HP6 A;  4JGO A;  3N7W A;  1UWP X;  4R3B A;  1ES2 A;  3HVF A;  4HBU A;  3TOI A;  2B18 A;  1VET A;  2H5S A;  3L7H A;  3SZT A;  1K56 D;  4NXB A;  5HAP A;  1TEM A;  3HLE A;  3BEC A;  1K54 A;  1H8Z A;  4NEE D;  2HJE A;  4F94 A;  1J3W A;  2QZ6 A;  4G3W A;  3IF6 C;  3T1Q B;  2EXA A;  5DKL A;  2V1A A;  3MZD A;  2DNS A;  3NI9 A;  3LR3 A;  4BEN A;  2QMI A;  1ZTU A;  3LFV A;  3VFH A;  2XD5 A;  3ZGA B;  4GKU A;  3UB9 A;  4C3Q A;  4ZRR A;  4IBR A;  5FAT A;  5KIZ A;  3MR0 A;  3HRE A;  5KSC A;  4I3J A;  4ESP A;  3AGD A;  3OPR A;  3CJM A;  1ALQ A;  1RP5 A;  5E43 A;  4LV2 A;  2IWB A;  2NUP C;  3RXW A;  4B9O A;  1UGU A;  1LSX A;  5CTN A;  1IKI A;  5G18 A;  3V67 A;  1CK3 A;  3V50 A;  5FDH A;  3NC8 A;  3B33 A;  5DJT A;  4I5S A;  4Y13 A;  5A8B A;  1XFN A;  3E98 A;  1LSW A;  3I7J A;  3NIA A;  5I5L A;  1N9L A;  5F69 A;  1BT5 A;  4Q0I A;  4CLC C;  3MZE A;  4OON A;  2KLI A;  3OPP A;  4NXF A;  3MF0 A;  3IXG A;  4P6Z M;  3BW6 A;  4UAA A;  4EWF A;  1ESI A;  3CLO A;  3CIT A;  3ITA A;  3LUQ A;  3LEQ A;  2UV0 E;  3G34 A;  2Y59 A;  4PHT A;  2XA7 M;  3MQQ A;  1YLZ A;  1TS0 A;  3MXR A;  3GVB A;  4RX3 A;  1JTD A;  3GDI A;  2INW A;  4QWO A;  1OT6 A;  4HEF A;  2Y8H A;  3QP5 A;  2W27 A;  2ZM8 A;  3H7W A;  1VB6 A;  5E2F A;  2JKR M;  3E4P A;  3FZC A;  3NDE A;  5IHV A;  2B5R A;  3W4O A;  1I5Q A;  1TVF A;  5EVI A;  4JKT A;  4MDZ A;  4M4X A;  4BWI A;  4BQM A;  3SW1 A;  5FAQ A;  3E4O A;  3O5Y A;  4PM7 A;  1FSW A;  4EEU A;  4G3K A;  1K4F A;  1BLC A;  4JLF A;  4ZBE A;  2VGL S;  3VP4 A;  5FEF A;  3BY9 A;  4II7 A;  4JF5 A;  4LLO B;  4R0Q A;  1PZO A;  4OPZ A;  3PTE A;  4OP8 A;  3QP1 A;  2HDU A;  2P08 A;  4LCL A;  5GLD A;  3BFC A;  2X02 A;  3A0R A;  4KZ5 A;  1YAX A;  5F5Y A;  4EBL A;  4OP5 A;  2EWV A;  3QP4 A;  4C6Y A;  2BAS A;  3Q7V A;  1JWV A;  4RYE A;  3EEA A;  4S2N A;  2W3E A;  3DW0 A;  3PAE A;  5HD3 A;  3UB8 A;  3HLB A;  3E2L A;  3BM6 A;  4DE2 A;  3FPW A;  1XKZ A;  4XT2 A;  3D9Y A;  4R23 A;  2O99 A;  5C5K A;  4BL2 A;  1LI9 A;  3C7V A;  1SKO A;  4X1L A;  5EE8 A;  3DWK A;  4S2L A;  5F1F A;  1BSG A;  4P0M A;  4PM6 A;  5CRF A;  2EX9 A;  3T4J A;  2WKH A;  2XR0 A;  1K4E A;  1Q2Q A;  3LO7 A;  3QHY A;  5M1A A;  2Q0O A;  5GLC A;  1ES3 A;  3AGE A;  3M2K A;  5F68 A;  2HDQ A;  4LRY C;  3ZHH A;  5JYP A;  1G28 A;  1D7E A;  1Y54 A;  2JHE A;  4JGQ A;  4BBU A;  4KQD A;  1XJ6 A;  3N6I A;  1MKI A;  3CPT B;  4JF6 A;  2EX8 A;  3QP6 A;  2A24 A;  3C4P A;  4U0X A;  2EFX A;  2PAV P;  1NRF A;  4EUZ A;  3VP2 A;  3ICY A;  2JN7 A;  4LV3 A;  1PYY A;  4Y0T A;  2Y79 A;  3ZG5 A;  3H9W A;  1GHM A;  4OPY A;  3IS2 A;  2XSS A;  5EV0 A;  2W1T A;  4JF4 A;  3G6O A;  2WUQ A;  3RH8 B;  5HAI A;  3UDI A;  2JKF A;  4GD8 A;  1M6K A;  2RCX A;  4HIA A;  4HOI A;  4KZ8 A;  4HI4 A;  2I9V A;  2XDM A;  2FFF B;  2RL3 A;  3R7W A;  5J8X A;  1STZ A;  1CI8 A;  1XA1 A;  2XFS A;  4KQQ A;  3AGF A;  3PBR A;  4WL9 A;  2UWX A;  4R3A A;  1XJ3 A;  1G6O A;  1KOU A;  3IF6 B;  3EQU A;  4UEY A;  4DXC A;  1SDE A;  2HDS A;  4DE0 A;  3MKE A;  5HSQ A;  5EFW A;  1XX2 A;  3LIA A;  1DY6 A;  3FYZ A;  2OLU A;  3A0V A;  3PBN A;  4H6J A;  2VEA A;  3S22 A;  1N9N A;  1K55 A;  1YMS A;  3NUL A;  1E25 A;  3VOZ A;  1H3Q A;  1XP4 A;  3MSH A;  1BYW A;  5DVA A;  1YLW A;  3TW8 A;  3IHA A;  1BZA A;  3OCN A;  3HLF A;  1EWZ A;  3A3J A;  5GL9 A;  5CEC A;  4KZB A;  3RJU A;  2Y55 A;  5KSH A;  1X0O A;  5FAP A;  5EVI D;  4CPK A;  1BUL A;  3W4Q A;  1K54 C;  3KX0 X;  4I3I A;  2J8Y A;  4BMW A;  4OQ0 A;  2EFU A;  4OLG A;  3IWQ A;  4GCZ A;  1MWT A;  4PMA A;  4BD0 A;  4EBN A;  5FL3 A;  4CLC B;  2OOL A;  3LIC A;  1ERQ A;  3LID A;  4FSF A;  4E3M A;  4GN2 A;  3VE3 A;  3OLO A;  2JKT M;  3EWK A;  4UA7 A;  4PM9 A;  4X53 A;  2R9W A;  3P01 A;  5EVL A;  1MWR A;  3ZG9 B;  5A92 A;  3A0S A;  3VE4 A;  2P9V A;  1XGJ A;  3GMW A;  3OCL A;  3G31 A;  4JGR A;  1ERO A;  3VSL A;  2XLN A;  4NET A;  1VQQ A;  1TF1 A;  1MWU A;  3UB6 A;  3T1R A;  2J3T D;  3S7Q A;  4GW9 A;  1H5X A;  4IVI A;  2Y2N A;  3BWL A;  1K25 A;  1T1C A;  4NXG A;  1TD5 A;  2XK1 A;  3UPO A;  1S1Z A;  1T19 A;  2ZL1 A;  4O7D A;  5TBM B;  3JVU A;  3W8K A;  4LGW A;  1ES4 A;  4CJN A;  1IEL A;  2WKQ A;  3F1P B;  3HL9 A;  1WYC A;  2G2U A;  4K08 A;  2ZC3 B;  3ZG0 A;  2LB5 A;  2OV5 A;  1IYP A;  2QJ5 A;  3H82 A;  3LCE A;  2VKS A;  3K3D A;  4BBT A;  1U60 A;  3WS0 A;  2PT7 A;  1RCJ A;  5GHX A;  1F9I A;  3WS4 A;  3IXH A;  4OOL A;  1BUE A;  4IUH A;  1JWP A;  3A3I A;  4GS9 B;  3V5M A;  1GSV A;  4QY5 A;  3E4Q A;  3LIB A;  1GA9 A;  1TS7 A;  3UO9 A;  4P6B A;  4F3L A;  1H0M A;  1Y28 A;  2OAQ 1;  3LI9 A;  2VV6 A;  5G4Y A;  5EVI C;  3Q1F A;  3NOP C;  3KSF A;  2PBY A;  2FFY A;  2I72 A;  3EQV A;  1SHV A;  3GR2 A;  2NUT C;  1K0K A;  4DDS A;  3W4P A;  3UNW A;  4HBT A;  3S7N A;  3M6H A;  2M1C A;  3VV4 A;  1ODV A;  3WS1 A;  4S2J A;  1AWI A;  1PNE A;  2ZQA A;  3WRZ A;  2ZBB A;  1FCM A;  4BL3 A;  1NXY A;  1CF0 A;  1NLZ A;  1BLP A;  2J7V A;  1KDS A;  4GOG A;  5G4Z A;  3PBO A;  1K6S A;  3DTE A;  3PBQ A;  1KGE A;  2EXB A;  2Y91 A;  3LYX A;  4PM8 A;  4S2N C;  3ISG A;  2Y2Q A;  3O88 A;  5HZH A;  1HVB A;  4N1X A;  3OPH A;  3KSH A;  3DTI A;  5FA7 A;  3GSG A;  3A3F A;  2J9P A;  4FTX A;  2WKR A;  1TS8 A;  4PM5 A;  4S2I A;  2XGN A;  4DJ2 A;  1N4O A;  3WS5 A;  5AQB A;  3MMH A;  3VOY A;  3T50 A;  1F2K A;  1FR1 A;  5LBR A;  3F1N B;  1YLJ A;  2A2L A;  3N8L A;  1LT0 A;  3MXS A;  2WKI A;  3IT9 A;  3TRC A;  4E6W A;  4OPR A;  1OJ5 A;  3P7N A;  3SS4 A;  3U2A A;  1KE4 A;  2QPN A;  2R78 A;  3B3X A;  4PKY G;  3R4K A;  3B42 A;  2M7V A;  1IKG A;  2E8I A;  3G2Y A;  2OLV A;  1K57 A;  2A3U A;  4MCW A;  4HJ4 A;  4CQH A;  2ZC7 A;  3BLS A;  4EQI A;  1RGZ A;  3BQ8 A;  3MS6 A;  2ZMV A;  4R1G A;  3CHW P;  3HLW A;  1S6R A;  3GEC A;  4HJ6 A;  5CX7 A;  4UA9 A;  3EOI A;  3QNC A;  2WKE A;  4GHI B;  2ZD8 A;  2W3F A;  3IX3 A;  1LLB A;  2Y4A A;  3GV9 A;  5FDS A;  3OPL A;  1XPB A;  2WGV A;  3C30 A;  1F5M A;  4KZ9 A;  4WEL A;  3ZCZ A;  5HPI A;  4LPZ A;  3ZG7 B;  3M6B A;  2L1M A;  4ZTK A;  2C5W B;  3D72 A;  1FIL A;  3IHB A;  5CHJ A;  2V20 A;  3PBS A;  2HP9 A;  5A90 A;  2XQZ A;  5A93 A;  2V0U A;  4EBP A;  2XRO A;  5HFO A;  5BOH A;  1SKF A;  2V1Z A;  1XXM A;  2L0W A;  2HV1 A;  3BJN A;  1K55 C;  4NKP A;  2Q9N A;  3OBF A;  2JC7 A;  2ZJ9 A;  5L10 A;  3SH8 A;  4E3L A;  3UPN A;  3FWL A;  2E8J A;  2WK0 A;  3LY3 A;  3ZFZ A;  3JVV A;  4L0L A;  2VGJ A;  3IH9 A;  3MKF A;  2OWJ A;  5JYO A;  4E3K A;  2VV7 A;  1ES5 A;  3ZDJ A;  3UE3 A;  4YIN A;  1L2S A;  4R4R A;  3T4K A;  1NZO A;  1Q2P A;  3EGX C;  5IS1 A;  1IEM A;  4N9L A;  2WGW B;  4KG5 A;  1YPR A;  3PAG A;  1WYB A;  2KDK A;  4WN5 A;  5DJU A;  5HAR A;  2G2W A;  2O0Y A;  1DJA A;  5FQ9 A;  2PYR A;  4IHQ A;  1GCE A;  1L0E A;  2PD7 A;  4ZJ3 A;  3CPT A;  1Z6F A;  2GDN A;  1HLU P;  2HF6 A;  1ZG4 A;  1ZKJ A;  3Q07 A;  1BTL A;  3HCY A;  1EI5 A;  3A3E A;  3UB5 P;  2ZQC A;  1PWD A;  4MNR A;  4GD6 A;  4DF6 A;  4P85 A;  5HL1 A;  1NYY A;  1KVM A;  4N92 A;  3MBZ A;  1T1A A;  3HLG A;  2PR5 A;  1PWC A;  1NY0 A;  5AQA A;  1E4D A;  1NLY A;  1MC0 A;  2O9C A;  1DJB A;  4KZ6 A;  3UPP A;  3SOI A;  4AFI A;  3WRT A;  4WMC A;  5DFY A;  1OTD A;  3UMD A;  3BEB A;  3LI8 A;  4KUK A;  3EEH A;  4Y5F A;  4FH4 A;  3ULF A;  2JCH A;  2IWD A;  3UN7 A;  4OVD A;  4LFU A;  2ZM0 A;  4UQI M;  4R3J A;  3UB7 A;  2Q9M A;  3FG8 A;  4JXW A;  4MMN A;  2DCF A;  1QMF A;  2V1B A;  4O8G A;  2ZC5 B;  3LR0 A;  3HLC A;  3ZYT A;  4HNB A;  4LCM A;  3VP1 A;  1VEU B;  1W5D A;  1P0Z A;  5E2H A;  4U3T A;  3CAX A;  4YFM A;  2ZC4 B;  4QHC A;  2WZX A;  4A5R A;  1HZO A;  1L0F A;  5F82 A;  4DDY A;  1VM1 A;  4O01 A;  4ZJ2 A;  4KG2 A;  1S4R A;  3C5A A;  3U4L P;  4JGP A;  1MPL A;  2XEP A;  3G2Z A;  3N4I A;  4HJ3 A;  1OME A;  5AVE A;  1O07 A;  4XT2 B;  4Z1W A;  2Y2P A;  3CI6 A;  5CEB A;  4Y7P A;  1KVL A;  1KDW A;  2R9X A;  1K6R A;  5AQ9 A;  2PHY A;  5FQQ A;  1OTB A;  3BRM A;  2C6W B;  5FAO A;  3ZVW A;  4EW7 A;  3HLD A;  2YKH A;  4I38 A;  5CER A;  4DJ3 A;  1PWG A;  5CHM A;  3UE1 A;  3KYE A;  4EES A;  4MN7 A;  3NEC A;  3T1S A;  3CG5 A;  4GNU A;  3FKW A;  1XFQ A;  4WZ4 A;  3BYD A;  4E6X A;  3T4O A;  3BFD A;  3MQ0 A;  2A24 B;  2Z2M B;  4C75 A;  5L09 A;  5FI6 A;  4P6Z S;  2IA2 A;  4WLA A;  4ARZ B;  3TJZ C;  3P98 A;  4KZ4 A;  5K5B A;  1C3B A;  1KGF A;  4HP9 A;  3FPV A;  3T1X A;  3A3D A;  3C7U A;  1XJ4 A;  1ESU A;  1CI9 A;  4OOY A;  1OT9 A;  1TDL A;  1WE4 A;  3IH8 A;  3CZD A;  4FH2 A;  4L9G A;  3RFB A;  3BFG A;  4GZB A;  1GSX A;  3F1P A;  4Q8I A;  3IQA A;  1IOU A;  2VGK A;  4KZA A;  5HW3 A;  1GSW A;  3GQZ A;  3T4L A;  2XF3 A;  2K2N A;  2ACG A;  1KE3 A;  1I2W A;  3S4X A;  1LSV A;  2ZLY A;  3C2W A;  4EUV A;  5I94 A;  3S1Y A;  4L9F A;  2PBD P;  1A0K A;  1LL5 A;  1K57 C;  5AQ7 A;  1QME A;  1NJ4 A;  4JXG A;  3IWO A;  4JXS A;  1KE0 A;  4UA6 A;  4H6J B;  1PZP A;  1MXO A;  1T18 A;  2HJ9 C;  1G5U A;  2ZOH A;  4E3I A;  4S2O A;  1OJG A;  4N9K A;  4WMC D;  4R4S A;  4Y0U A;  1EW0 A;  4MN5 A;  4KZ3 A;  2WYX A;  1YLT A;  1DRM A;  2K7S A;  4E3O A;  1L0D A;  4FD8 A;  2BTF P;  2HDR A;  3LEZ A;  3LY4 A;  1RGY A;  3MZF A;  2H28 A;  3CUE A;  3UDF A;  1ONG A;  2GX5 A;  4X6T A;  1PFL A;  4QY6 A;  2VV8 A;  1ACF A;  2JBF A;  3NY4 A;  4HY8 A;  5TJJ A;  3T4T A;  4EQ1 A;  1S67 L;  4WEJ A;  5EOO A;  4QB8 A;  4I39 A;  1UWN X;  1YSP A;  2P74 A;  5J7E A;  3HJK A;  4ID4 A;  4HH3 A;  4QPR A;  2HPB A;  3F1O B;  2V8C A;  2VGL M;  1FOF A;  3NDG A;  4OKP A;  3WWX A;  2ZQ9 A;  4WM9 A;  3PR6 A;  4N1H A;  3SS3 A;  2P04 A;  1SCW A;  1FR6 A;  3OC2 A;  3NJA A;  4Y0O A;  3SH7 A;  1J9M A;  1MZU A;  5FI2 A;  2VJW A;  5TFQ A;  5HDS A;  1TDG A;  4B4Z A;  1FCN A;  1HTZ A;  4Q0H A; 
#chains in the Genus database with same CATH homology
 3BY8 A;  3F1N A;  2YKF A;  2KOI A;  3KYQ A;  3LR5 A;  3R7W B;  3DBA A;  2L1M A;  5F68 A;  4OOM A;  3LIF A;  4LRY C;  3D72 A;  3MXQ A;  1G28 A;  1D7E A;  2JHE A;  4JGQ A;  4BBU A;  4E04 A;  4KQD A;  1XJ6 A;  4LRZ E;  3NOU C;  5HD5 A;  4CLC E;  4EU0 A;  2VX8 A;  3PBS A;  1NWZ A;  2V9A A;  2A24 A;  3IBR A;  3NHQ A;  2V0U A;  3F1O A;  2DMW A;  3D3O A;  2XRO A;  4GS9 A;  4L9E A;  2L0W A;  2PYP A;  2HV1 A;  3ICY A;  2EWW A;  4LRX C;  3BJN A;  2JN7 A;  2OAP 1;  4NKP A;  2FH5 A;  3TE8 A;  2Y79 A;  3H9W A;  3OBF A;  3IS2 A;  3C8C A;  5L8M A;  3JVV A;  4L0L A;  4O0P A;  1W63 M;  2XSS A;  2OWJ A;  2W1T A;  5HWW A;  2J3T C;  2VV7 A;  2G7U A;  3G6O A;  3MJQ A;  3T4Q A;  1YSQ A;  5DKK A;  3RH8 B;  2W0N A;  1YKD A;  2MJ6 A;  4Y3I A;  3UE3 A;  2VZW A;  2ZMF A;  3T4K A;  3S7O A;  4WEK A;  3EGX C;  2EA9 A;  4HOI A;  4HIA A;  5IS1 A;  1D06 A;  4HI4 A;  4KQO A;  2I9V A;  4F3L B;  1H8M A;  2KDK A;  2FZ0 A;  3R7W A;  1STZ A;  4WN5 A;  2GZA A;  5DJU A;  3B47 A;  5IU1 A;  3PBR A;  5AVF A;  1JNU A;  2O0Y A;  4WL9 A;  4R3A A;  3UE6 A;  1WA9 A;  2HGV A;  2PYR A;  1XJ3 A;  2VA0 A;  4IHQ A;  1G6O A;  1KOU A;  3EQU A;  4UEY A;  2PD7 A;  2LB9 A;  5F6A A;  2HF6 A;  4R6L A;  2V0W A;  5HSQ A;  5EFW A;  3RTY A;  2QWS A;  2D02 A;  1P9R A;  2W3G A;  4MN6 A;  3HCY A;  2K31 A;  4FOF A;  1VHM A;  3LIA A;  3A0V A;  3PBN A;  4H6J A;  2VEA A;  4ETX A;  4IJG A;  1N9N A;  4ME4 A;  2JKR I;  1IFQ A;  1H3Q A;  1BYW A;  4BBV A;  3TW8 A;  4HH2 A;  3OCN A;  1T1A A;  2PR5 A;  2GJ3 A;  1NLY A;  1MC0 A;  1S4S A;  5KSH A;  1OTE A;  2O9C A;  1X0O A;  4GLQ A;  3OOV A;  4YWZ A;  5J3W A;  4UQI S;  1DP9 A;  4AFI A;  3C38 A;  3S7P A;  4CLC D;  3KX0 X;  5DFY A;  1OTD A;  1F98 A;  3UMD A;  4I3I A;  5MC7 A;  4BMW A;  2QKP A;  5HWT A;  1LL8 A;  1OPX A;  3LI8 A;  1W63 Q;  5DF9 A;  4GCZ A;  4KUK A;  2B02 A;  3EEH A;  4PAU A;  4Y5F A;  4B93 A;  3PXP A;  3ULF A;  4HQA A;  3HJI A;  5FL3 A;  4CLC B;  2QYB A;  4Y2F A;  2OOL A;  2WKP A;  2Z6D A;  4R70 A;  2ZOI A;  4UQI M;  3LIC A;  3E0Y A;  3LID A;  4FSF A;  2W3D A;  4WF0 A;  3UB7 A;  1P9W A;  2O9A A;  3FG8 A;  2OWH A;  3CWF A;  4RQ9 A;  3VE3 A;  3OLO A;  2JKT M;  3EGD C;  3EWK A;  4MMN A;  4GJ4 A;  3VOL A;  1ZHH B;  4EEP A;  3P01 A;  3H82 B;  2L4R A;  2V1B A;  3BQA A;  4O8G A;  4Q0J A;  1N9O A;  3ZQ5 A;  5HDC A;  1OTA A;  3A0S A;  3LR0 A;  3VE4 A;  5AJG A;  4KUO A;  1V9Z A;  3ZYT A;  4HNB A;  2W1R A;  4GHI A;  4JGO A;  1P0Z A;  2O9B A;  3W2Z A;  1UWP X;  3OCL A;  4JGR A;  3CAX A;  1V9Y A;  2B18 A;  4BJP A;  1TF1 A;  4NXB A;  4O01 A;  3UB6 A;  2J3T D;  1S4R A;  4JGP A;  1TS6 A;  3S7Q A;  4HJ3 A;  4G3V A;  2CMN A;  2GNX A;  5J4E A;  4PKY A;  5AVE A;  4NEE D;  2HJE A;  4GW9 A;  4XT2 B;  4Z1W A;  3CI6 A;  4I3A A;  2XRN A;  3BWL A;  3KSI A;  1T1C A;  4NXG A;  1TD5 A;  4G3W A;  3NOT C;  1S1Z A;  1T19 A;  5DKL A;  2V1A A;  2PHY A;  5TBM B;  3JVU A;  3K3C A;  1NRJ A;  1OTB A;  3LR3 A;  1ZTU A;  2WKQ A;  3F1P B;  3LFV A;  4EW7 A;  4K08 A;  2YKH A;  4R38 A;  4I38 A;  3UB9 A;  2LB5 A;  4YOF A;  4WUJ A;  4ZRR A;  4DJ3 A;  2QJ5 A;  5KIZ A;  3H82 A;  3MR0 A;  4EES A;  2VKS A;  3K3D A;  4BBT A;  3PBT A;  4MN7 A;  2M7U A;  4I3J A;  2PDR A;  1MKM A;  2PT7 A;  1XFQ A;  1T1B A;  2NUP C;  3T4O A;  1F9I A;  4OOL A;  3MQ0 A;  2A24 B;  3K2N A;  4IUH A;  4B9O A;  4GS9 B;  1UGU A;  5HDD A;  4DN0 A;  1LSX A;  1GSV A;  4ETZ A;  2Z6C A;  4P6Z S;  3V67 A;  2IA2 A;  4WLA A;  3B33 A;  3E4Q A;  3LIB A;  4ARZ B;  2PD8 A;  3TJZ C;  5DJT A;  4I5S A;  1TS7 A;  3H7W B;  5IT5 A;  4F3L A;  5A8B A;  1XFN A;  5K5B A;  3E98 A;  1Y28 A;  2OAQ 1;  3LI9 A;  1LSW A;  5I5L A;  2VV6 A;  5HPF A;  1N9L A;  5G4Y A;  2VLG A;  5F69 A;  4HP9 A;  3FPV A;  4Q0I A;  3NOP C;  1XJ4 A;  3KSF A;  4CLC C;  4HHD A;  3EQV A;  2KLI A;  1OT9 A;  2W3H A;  4NXF A;  3KYZ A;  4DMZ A;  3MFX A;  2NUT C;  4L9G A;  3MF0 A;  3RFB A;  1GSX A;  3F1P A;  3S7N A;  4P6Z M;  3BW6 A;  4EER A;  3CUE C;  1IOU A;  2M1C A;  3T4S A;  1GSW A;  2PR6 A;  3VV4 A;  2KX6 A;  1ODV A;  3KO6 A;  3T4L A;  2K2N A;  3CLO A;  2J80 A;  4EXO A;  3CIT A;  1LSV A;  3LUQ A;  3C2W A;  2ZBB A;  4IUK A;  4EUV A;  4PHT A;  1NLZ A;  2XA7 M;  3MQQ A;  4L9F A;  1TS0 A;  5G4Z A;  3PBO A;  1P97 A;  2D01 A;  3PBQ A;  3GDI A;  2INW A;  3LYX A;  4YNR A;  1OT6 A;  2Y8H A;  3PYP A;  4H6J B;  2W27 A;  1T18 A;  5HZH A;  2HJ9 C;  3KSH A;  4ARZ A;  3H7W A;  1VB6 A;  2ZOH A;  2JKR M;  3E4P A;  1OJG A;  5HWV A;  3LIE A;  1EW0 A;  2WKR A;  4MN5 A;  1TS8 A;  1DP6 A;  1DRM A;  2K7S A;  2P7J A;  4CLC A;  5HL6 A;  4MDZ A;  4M4X A;  4BWI A;  4DJ2 A;  1DP8 A;  3SW1 A;  3E4O A;  3O5Y A;  4EEU A;  4G3K A;  2H28 A;  2VGL S;  3FC7 A;  3MMH A;  3BY9 A;  4II7 A;  4HP4 A;  2JKT I;  4LLO B;  3CUE A;  3T50 A;  5LBR A;  2GX5 A;  3F1N B;  2A2L A;  1LT0 A;  2VV8 A;  3TRC A;  4HY8 A;  3IBJ A;  5TJJ A;  5DFX A;  3T4T A;  4EQ1 A;  1OJ5 A;  3P7N A;  3U2A A;  2P08 A;  1S67 L;  2R78 A;  4PKY G;  3A0R A;  4WEJ A;  3R4K A;  4I39 A;  1UWN X;  1YSP A;  3B42 A;  2M7V A;  5J7E A;  1YAX A;  3HJK A;  5F5Y A;  2EWV A;  4HH3 A;  2BAS A;  4QPR A;  4MCW A;  3F1O B;  3MQO A;  4NXE A;  3EEA A;  2VGL M;  2W3E A;  3PHY A;  4HJ4 A;  4CQH A;  1OTI A;  5HD3 A;  3BQ8 A;  3UB8 A;  2ZMV A;  3PR6 A;  3FPW A;  2P04 A;  3GEC A;  4HJ6 A;  4XT2 A;  5CX7 A;  2J3W A;  2O99 A;  5C5K A;  3EOI A;  3OC2 A;  4GHI B;  2QJ7 A;  3NJA A;  3IS2 B;  1S1Y A;  2W3F A;  2XA7 S;  1MZU A;  2W1T B;  2VJW A;  5HDS A;  3UME A;  3C30 A;  3LR4 A;  5TBM A;  1S66 L;  1F5M A;  3KSG A;  4WEL A;  3T4J A;  4EET B;  5HPI A;  1XJ2 A;  2QHK A;  4Q0H A;  4LPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...