2DMWA

Solution structure of the longin domain of synaptobrevin-like protein 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
131
structure length
131
Chain Sequence
GSSGSSGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTAPPYAMNSEFSSVLAAQLKHHSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords synaptobrevin-like 1 variant
publication title Solution structure of the LONGIN domain of Synaptobrevin-like protein 1
rcsb
source organism Homo sapiens
total genus 24
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2dmwA01
1H8MA 3KYQA 3BW6A 3EGXC 2DMWA 1IOUA 1IFQA 2VX8A 2NUPC 4AFIA 4B93A 3EGDC 2NUTC
chains in the Genus database with same CATH superfamily
1MWUA 5DTSA 4IJGA 1YLJA 2Q9NA 5FQ9A 5M1AA 2V1BA 3A3FA 2Y2OA 3EWKA 1LHYA 1N9LA 2OSUA 1K0KA 4EESA 3RJUA 3IXHA 4UQIS 5DTTA 2P7JA 2BLSA 5EVEA 2EFXA 2IA2A 3H82B 1KDSA 1G68A 2ZOHA 4O01A 5CECA 2ZLYA 1J3WA 4G3WA 5F69A 3VOYA 3WS4A 1L0DA 3EQVA 3P98A 2WZXA 4G3KA 2Y2JA 4P85A 3A3IA 3C8CA 5IS1A 2IWCA 4GJ4A 3U2AA 3IS2B 1MWTA 4GOGA 4LRYC 1WE4A 1FOFA 3CWFA 1ONGA 2ZC5B 1PZPA 2PU4A 4JXVA 4Q0JA 3T4QA 5CEDA 3ZNTA 3CMZA 1IFQA 3HLGA 2GJ3A 4FTXA 4Y3IA 5EPHA 4I5SA 3CUEA 2WAEA 1N9BA 5FDHA 1TEMA 1L2SA 1N9OA 1K4FA 1XJ6A 4KQRA 3KYEA 3ZHHA 4JF6A 3CLOA 1GA9A 5TGFA 4CJNA 1VHMA 3LR4A 5DJTA 3DWZA 1N4OA 4EBPA 4XXRA 5FSRA 3UB6A 5HWWA 2WADA 5FA7A 3KSHA 3BYDA 4R3BA 1H3QA 4ME4A 5TBMB 4OH0A 2H0TA 3OOVA 3NOTC 4LRZE 2WKRA 2M1CA 4DE1A 2C6WB 2W3DA 2XROA 4MDZA 1X0OA 4QD4A 4NXFA 4HJ3A 1OJ5A 4MN6A 1G6AA 5DF7A 3NULA 1G6OA 5FQJA 3HUNA 4RX2A 2YKFA 2L0WA 4LGWA 1GSXA 1XPBA 2HP5A 4E3JA 4IEDA 1L0EA 1L0FA 2V9AA 1PWGA 4ZJ2A 1MZUA 4L9FA 3UNWA 4MBHA 3WS1A 5A92A 3OPRA 2QWSA 1TS0A 4K0WA 5F68A 3C30A 5HD3A 4L9EA 4WYYA 4E3KA 2VGJA 2Q0OA 3GR2A 2WGIA 3P7NA 5F1GA 2WAFA 3Q81A 1MWRA 3FKVA 1KVLA 3VP0A 3N4IA 5GHZA 2HV1A 4Y13A 3EEAA 3UE6A 3Q82A 2W3EA 2P9VA 1BLSA 5G4ZA 3QP5A 1VETB 2DCFA 3T4TA 1OT6A 2WGWA 3K3CA 4OPYA 2PBDP 2OWHA 5FAOA 5G18A 4NXBA 1PW1A 2JC7A 4E3NA 4OVDA 5GHYA 2HF6A 3IH9A 3UB7A 1XX2A 4O8GA 4DN0A 3MXSA 3RFBA 3T4JA 3LI8A 2Z2MB 4IUKA 1BTLA 1DRMA 3RXXA 4GCZA 5F6AA 4S2OA 5DKKA 2PDRA 3LYXA 3PBNA 5EVIA 2ZQDA 4U0XA 2A3UA 3UPPA 1H8MA 1YMXA 3HJIA 3T50A 1WYBA 4S2NC 2X01A 4EUZA 3IF5A 3VFHA 4BMWA 5FI7A 3NOPC 4MBKA 2VEAA 1A0KA 5DVAA 3SS5A 3C2WA 3VSLA 2ZC6B 4HHDA 3IH8A 1JVJA 3VP4A 4WZ5A 3SS3A 1PWDA 1LT0A 3CHWP 4ZTKA 2VGKA 1HTZA 3HLFA 1HZOA 1ES2A 3GECA 2OOLA 1AXBA 4MLLA 1E3UA 4GDNA 3EGXC 3IX3A 1E25A 2J80A 4GNUA 2XK1A 1PWCA 1SZVA 1K57A 2BTFP 3IWOA 2B02A 4R3AA 2I9VA 1DY6A 3B42A 4B4XA 3F1OB 3FZCA 1XA1A 4EQ1A 2B18A 3E4OA 1ESIA 5BOHA 5EM1A 4NK3A 5M19A 4P6ZM 2Y2PA 4Q8IA 1D1JA 2HGVA 4P87A 4Y0UA 4JLFA 3FYZA 2QHKA 3VOZA 2Y55A 3LIFA 4N1HA 5DJUA 4OPQA 1IOUA 3UDIA 3GV9A 3K3DA 3CPTB 5FASA 3LIEA 5FEFA 4GHIB 4N9KA 3OCNA 2XRNA 3OPPA 2ZOIA 5DFYA 4C6YA 4JXGA 4DE3A 1KE4A 3BM6A 4KZ5A 1C3BA 1CI8A 5EOEA 1W63M 3G35A 4X68A 3E4PA 2QMIA 3EOIA 4CLCE 4DKIA 5EECA 2JHEA 3E0YA 1RGZA 1BLHA 1M40A 5J7EA 1JTDA 1MY8A 4HP9A 3OCLA 3T12B 4IBXA 3IS2A 4RYEA 4E3IA 5JYOA 1IKGA 4JXSA 1IEMA 2PD7A 3F1PB 4O0PA 1OPXA 1LI0A 4IUHA 3ITBA 3O87A 2Y91A 1FCNA 4HP4A 1STZA 1TD5A 2G2UA 4Q0HA 1G28A 4DF6A 4BLMA 3QP1A 3ZYTA 2DNSA 3OC2A 1ZTUA 3PHYA 2J3TC 3S7QA 1EI5A 4CQHA 5FL3A 1I2WA 4UA6A 3HLWA 5HX9A 3M6BA 5AVEA 4XUZA 1KE3A 1BUEA 5CHMA 2DMWA 4Y7PA 4NG2A 2O9BA 3HJKA 3IF6A 1E4DA 5TBMA 4GKUA 3W4OA 2KX6A 1FSYA 3R7WA 4O7DA 1YQSA 3QNCA 2PR5A 1UWNX 2JKGA 4JPMA 5HPFA 3IHBA 5I5LA 2QZ6A 2Y2NA 1IYOA 4OOYA 4LLOB 4BWIA 2HJ9C 3LR5A 3Q1FA 1DJBA 1T1CA 4RVAA 5FATA 4WMCA 5G4YA 2YKHA 1FR1A 3QP4A 4N1XA 5HW3A 3SW1A 3HLDA 4JGRA 2XD5A 5DF9A 1MKIA 2QJ5A 3O86A 3MS6A 3UO9A 1K25A 1YKDA 2XA7M 4ID4A 3L9KA 4C3QA 3IBJA 1Q2QA 1LLBA 3HBRA 4DMZA 3E2KA 4QHCA 2VLGA 2MJ6A 4GLQA 2H5SA 3SZTA 4XT2A 1EWZA 3MXRA 2VV8A 3IX4A 1JWPA 1DJAA 1VETA 4OQ0A 3LGOA 4CPKA 5LBRA 3OZHA 3T1RA 4M4XA 2VK3A 2EWVA 3IHAA 4S2IA 1K6RA 5CRFA 3KYZA 4S2MA 5EVLA 4WBGA 4X1LA 1F5MA 4LPZA 2H0YA 3MKFA 3DAVA 3ZG8B 1L3LA 3UB8A 2EXAA 2Z6CA 4WUJA 3JYIA 2GNXA 2ZQ7A 3ZG0A 1I2SA 1HD8A 1IELA 1D06A 4BBVA 3V3SA 2JCHA 2XEPA 4YFMA 3BJNA 3PBRA 3UE0A 2GDNA 3NOUC 2W3FA 3EQUA 4DRTA 4CLCC 1ZKJA 1QMEA 4Y0TA 2XSSA 3CUEC 1F2KA 3BLMA 3VOLA 1BULA 1XJ3A 2ZM2A 2O99A 3MF0A 3JVVA 4MEZA 4E3MA 3MXQA 2PBYA 1K4EA 3I7JA 5EOOA 3VFFA 5GLAA 5C5KA 3PXPA 4LRXC 4I3IA 3ZVTA 3F1OA 1GHMA 2FFFB 3UPOA 1S4RA 4H8RA 2JKRI 2WKIA 3LUQA 1XA7A 3ZCZA 2G2WA 4Y0OA 3DTKA 3VSKA 1OTBA 4OLDA 2O9CA 2W0NA 3UN7A 3MQ0A 1ODVA 1LSVA 4R38A 3BEBA 1PFLA 3Q7VA 1OMEA 3BFEA 2QKPA 3CPTA 3VE3A 3B47A 4FOFA 4S2LA 3PTEA 2D01A 2A49A 4PM7A 4FCFA 4HBTA 4E04A 4GHIA 1JNUA 5FQKA 4RQ9A 5HD5A 2Y2HA 3ITAA 5HAQA 3MR0A 5F5YA 3U4LP 4PKYG 2XH9A 1YLTA 2VX8A 3OBFA 3H9WA 3CZDA 1EW0A 4GD6A 1BT5A 3AGFA 3IF6B 1GSWA 4OPZA 3NJAA 4LENA 3ZDJA 3R7WB 2UWXA 3T4SA 1XXMA 1AWIA 2NUPC 1JWZA 5HAPA 3MJQA 2Y2MA 3JVUA 4E3OA 2W1TB 1S0WA 3M2KA 4X25A 1Q2PA 5F83A 4GD8A 3G6OA 5L2FA 1NJ4A 4QPRA 2JN7A 1BSGA 2HPBA 1KVMA 3DBAA 1NY0A 1YT4A 1ZG4A 1S6RA 3G2YA 3F1PA 3P01A 4JKTA 1SCWA 4EERA 2ZQAA 2M7VA 2V8FA 1RGYA 3G2ZA 1PW8A 3BFDA 3SOIA 1NYMA 3BWLA 3UB5P 5HWVA 4OQGA 3TOIA 4HOIA 5A90A 4WMCD 3MBZA 5KZHA 5EVIC 3A0RA 4EXOA 4L9GA 1ZC2A 3QNBA 1F98A 4XT2B 3KSFA 4HH3A 1K55A 2OLUA 1S1ZA 5CGSA 3DTMA 3T1XA 3KSGA 4GB7A 1WA9A 3LR0A 1SKOB 4WZ5C 2ZMVA 4LCMA 3GRJA 3UMEA 2JKRM 4P6ZS 2WKQA 1K56D 3IQAA 4I39A 1SHVA 3KSIA 5CGWA 1ACFA 2HDUA 4N9LA 4ZJ1A 1K57C 2IWBA 1W8QA 2I72A 1NLZA 3ZVWA 3ZG9B 3LCEA 5AJGA 2WGVA 3MQQA 2A24A 4EUVA 5AQ7A 4Q0IA 1O07A 3S4XA 3SH9A 2OAQ1 5L09A 2J3WA 4KZ7A 1YLYA 4FD8A 4EWFA 3JPUA 2K7SA 4HJ6A 3A0VA 4WL9A 3ZG7B 1P97A 2ZD8A 3UE3A 4XUXA 4R0QA 3NIAA 2EFUA 2V1ZA 3S1YA 4MCWA 3RH8B 5HSQA 4I3JA 3IWQA 3S7OA 3V3RA 3V50A 2RL3A 3ZQ5A 3EEHA 3Q7ZA 2GX5A 2VGLS 4DDYA 3CI6A 1XFQA 2CC1A 5KMWA 4WLAA 5A93A 3DTEA 4R70A 5CHJA 5TR7A 4KZ9A 2ZM8A 5J4EA 3D4FA 5E2FA 3C38A 5TJJA 5E2HA 1KOUA 1YMSA 1W79A 2WKPA 3WS2A 5J3WA 4R6LA 3LEZA 2Y8HA 3EGDC 2KOIA 2E8IA 3Q7VB 4S2NA 1CI9A 2J7VA 4X6TA 4JXWA 2K2NA 5DF8A 5HDSA 3BW6A 2R78A 4EQIA 5F1FA 3ZGAB 2ZL1B 3WS5A 4Y17A 4DE0A 2LB5A 1PI5A 4YOFA 2JKTI 5FI2A 5HARA 4R23A 1BLCA 1BYWA 1S66L 4KQQA 1PRQA 4QWOA 3HVFA 4IHQA 2V0WA 3NHQA 3UPNA 4B93A 4X55A 1NZUA 4KZ3A 2B5RA 1OTIA 3SH7A 4BQMA 4ETXA 3CITA 2WZZA 1V9ZA 2V0UA 2OAP1 1S4SA 3IF6C 3PYPA 1HLUP 2HDSA 4KUKA 3A3DA 5IT5A 1SKFA 1H8YA 3FPVA 1GHPA 2XA7S 1SDNA 4EBLA 4E6XA 1MXOA 3N6IA 4QY5A 3HLCA 3DWKA 3MSHA 5A8BA 1S67L 3LICA 1OTDA 3OPHA 4KZ4A 4LCLA 4UEYA 4ZJ3A 1LI9A 5L8MA 4DDSA 4PPRA 4Y2FA 3PBQA 2O0YA 3A3EA 2XFSA 4P0MA 2ZJ9A 4X69A 2WKEA 2XDMA 1GCEA 1PI4A 1W8YA 4BBUA 1LSXA 1ES5A 5GL9A 2P04A 1OTAA 2K31A 2XGNA 3P09A 5J8XA 4Y5FA 1Z6FA 4AFIA 3UDXA 3FC7A 4KG6A 4D2OA 5FDSA 3T4LA 1FILA 3O88A 4OQIA 5GLCA 4NXGA 4BD0A 1IYPA 1VB6A 1ERQA 4NETA 1FIKA 2W1TA 3O3VA 4OOMA 4ZRRA 4M3KA 3QHYA 2OV5A 2A24B 2JKFA 1PZOA 1MC0A 2BG1A 5KSHA 3IBRA 5GLDA 1KGFA 3KO6A 3N8RA 5AVFA 4EW7A 3NCKA 2H28A 5HAIA 1MBLA 2E8JA 1JTGA 2C5WB 5CGXA 4BD1A 3W4PA 4Y15A 2VKSA 1LL9A 2FH5A 2JKTM 4HQAA 1N9NA 3W2ZA 1FSWA 3RXWA 4WF0A 3NI9A 4FUWA 3Q07A 2WKHA 1ES3A 3WRZA 1K56A 2ZQCA 4LV1A 5HFOA 4PAUA 3T1QB 2PYRA 3SH8A 3LY4A 2QJ7A 3LEQA 1LL5A 3AGDA 3K2NA 3ICYA 3IXDA 1SKOA 1P0ZA 3H7WA 1ZG6A 3SS4A 3B33A 2NUTC 3AGEA 4C75A 1TS6A 2ZC3B 3GTCA 1SDEA 4WN5A 2VZWA 3FKWA 3WS0A 3HLEA 2ZC7A 5HWTA 1XJ2A 1H0MA 3ZNYA 3A0SA 2PU2A 4YWZA 5HPIA 5L07A 2VV7A 3G34A 4U0TA 3IXGA 1PYYA 1TS7A 4WEKA 2B95A 4IVIA 5CERA 3W8KA 1QMFA 2ZC4B 1VEUB 3R4KA 2Y59A 4A5RA 3UE1A 3OPLA 2HP6A 3HUMA 3VV4A 1PIOA 2Y4AA 2UV0E 2EX6A 1K54A 1TVFA 4GS9A 4DJ2A 5AQAA 4R4RA 2LB9A 3DTIA 1ZHHB 1LSWA 2GZAA 2ACGA 4OKPA 2J8YA 1ONHA 4S2JA 3S7PA 2RCXA 3T4OA 1YPRA 3G4PA 1H8ZA 2HP9A 2X71A 3BFFA 2A2LA 2Y2LA 2L1MA 5AQBA 3IXBA 5DFXA 1ESUA 1G5UA 2XFTA 5KSCA 2O9AA 4LFUA 2OWJA 3BQ8A 5E2GA 2R9XA 5TFQA 5HDDA 5CEBA 3IT9A 3T1SA 3FV7A 3BY9A 1CQAA 5MC7A 4KQDA 4PM6A 2EX2A 1Y28A 2ZMAA 4MN5A 3F1NA 1CEGA 4Z9QA 4GZBA 2Z2LB 4EEPA 1GSVA 3MZEA 1NYYA 1YLPA 1BZAA 2PAVP 1CF0A 4H6JA 1GA0A 2VV6A 4HEFA 1PNEA 2ZBBA 4OONA 5IHVA 5FEGA 1XKZA 3GSGA 1OT9A 4NXEA 2ZL1A 4BL3A 4CLCA 3LIAA 3LO7A 2ZMFA 1YSQA 2Y2KA 2KLIA 3ULFA 4JGOA 3PAEA 2EWWA 2M7UA 4F3LA 1M6KA 1K38A 4JGPA 3W4QA 1NRJA 5L10A 3TSGA 3E2LA 1V9YA 1JWVA 4EEUA 4UA7A 3CAXA 4S2KA 5EV0A 5FQIA 1UWPX 1DP9A 4UQIM 3WWXA 4KZ6A 1CEFA 1K55C 5HL1A 1NZOA 3GMWA 4HY8A 3NC8A 4PM8A 1NWZA 3V39A 1P9WA 3MZFA 2PHYA 3BECA 3NBLA 4OLGA 3BY8A 5A91A 2V2FF 2ZM0A 2XLNA 4BBTA 4GW9A 4K0XA 2Z6DA 3IX8A 4R4SA 3LIDA 3VMAA 3GDIA 4E6WA 4FH2A 4JF5A 1NXYA 5E43A 4RX3A 4R3JA 3PBOA 1XGIA 3A3JA 4NKPA 5DTKA 4KZBA 1T1BA 3WRTA 2X02A 4UAAA 5I94A 4KUOA 4E3LA 3N8SA 2Y2IA 2INWA 5DKLA 2XQZA 5CTNA 3C4PA 1ERMA 4KZ8A 2J3TD 5HDCA 4B9OA 4QY6A 3LFVA 4R1GA 3M6HA 5GLBA 2PYPA 4YINA 3N8LA 3FPWA 3C5AA 5EUAA 4ZDXA 3KX0X 3H7WB 4G3VA 3ISGA 1S1YA 2BASA 1CJFA 2R9WA 4K91A 4WM9A 4MMNA 5D3OA 1KDWA 3CJMA 3G30A 2WUQA 4RA7A 4HJ4A 4LV2A 4D60A 3PBSA 4PM9A 2FFYA 4BJPA 4KQOA 5HL6A 3E98A 4ARZB 4ZAMA 3V5MA 1FCOA 4HESA 1U60A 1IYSA 4GDBA 4ETZA 1WYCA 1Y4OA 1K6SA 5IU1A 4GS9B 3VP1A 5FAQA 5M18A 4MN7A 3MZDA 2PT7A 2PR6A 1RP5A 4BL2A 4PHTA 4OQHA 5CX7A 1P9RA 1XJ4A 1KGGA 2AVXA 1I5QA 4I3AA 2WK0A 3BQAA 5CHUA 1IKIA 3HREA 5EE8A 4FH4A 5EM0A 3GVBA 4IVKA 4ZBEA 3VP3A 2P74A 3VP2A 3ZFZA 1RCJA 4OOLA 3ZG5A 1J9MA 2W1RA 4MNRA 2DRWA 1DP6A 1ALQA 4MBFA 3F1NB 2ZQ9A 4EV4A 2EX9A 1YLZA 4JBFA 4II7A 1OJGA 4YNRA 3MFXA 4HI4A 2CMNA 4KG2A 4DXBA 4HNBA 5GHXA 1TDLA 4H6JB 3CG5A 4FSFA 3LR3A 4B88A 4ESPA 1VQQA 2J9OA 4CLCB 4KG5A 2W3GA 3GQZA 1VEUA 4X53A 1T18A 3E4QA 2V1AA 4PM5A 3BRMA 2V20A 3UY6A 3DW0A 1L0GA 4F3LB 4BENA 3PR6A 4IBRA 1T1AA 4X1MA 3UB9A 4F94A 2PRFA 4K08A 1XP4A 4PMAA 5CTMA 5FAPA 5E2EA 4CLCD 4WZ4A 2D02A 1MWSA 4LV0A 3KYQA 3D9YA 1T19A 3TRCA 4X56A 3D3OA 2QYBA 4KENB 3H82A 3LI9A 3UMDA 1YM1A 2H10A 3LY3A 3HUOA 2VGLM 1YLWA 2QPNA 1GHIA 4B4ZA 5AQ9A 1VM1A 3N7WA 3TG9A 1Y54A 1FQGA 1TS8A 1NLYA 3MQOA 4S2PA 1TDGA 4L0LA 2VA0A 4WELA 1XGJA 4LV3A 4HH2A 5F82A 3BFCA 2Y2QA 1ES4A 2XD1A 2JE5A 4KZAA 2HZ5A 4EU0A 1D7EA 3PBTA 3S7NA 3V67A 4WEJA 2EX8A 3M2JA 3HLBA 3MKEA 1YSPA 2ZQ8A 3TE8A 5FQQA 1W7FA 1FCMA 3NY4A 3C7UA 3BLSA 3TW8A 4U3TA 3G31A 4QJGA 2P9VB 4DXCA 2W27A 3G32A 2IWDA 3QP2A 4GN2A 2G7UA 1KE0A 2WGWB 1IYQA 3S22A 3HCYA 3QP6A 1W5DA 3NDGA 1BLPA 3UDFA 3O5YA 4PKYA 3NDEA 2W3HA 1DP8A 5JYPA 2HDQA 3PAGA 5EFWA 1F9IA 4UHUA 1FR6A 3TJZC 4EBNA 2PD8A 1UGUA 2OLVA 4OP8A 1MPLA 2L4RA 5CXWA 3T4KA 1HVBA 5EVIB 2JBFA 1KGEA 1CK3A 3RTYA 1Z09A 1YAXA 5HZHA 3B3XA 1TF1A 3IWIA 4QB8A 4I38A 4N92A 4HIAA 4JF4A 5FQMA 4P6BA 3MFDA 1O7EA 3VE4A 1MKMA 2WYXA 5EVID 3MMHA 1LL8A 2J9PA 2Y79A 2EXBA 4OPRA 3LIBA 2VJWA 1K54C 3FWLA 3OLOA 4JGQA 4NEED 5FI6A 2XR0A 1H5XA 1W63Q 2V8CA 2XF3A 2Y2GA 2FZ0A 2EA9A 4HBUA 3D72A 5K5BA 3C7VA 3C4OA 5KIZA 4DJ3A 1OTEA 2HJEA 4Z1WA 2HDRA 1E3UD 5U47A 3BFGA 3NECA 1EROA 4OP5A 1DJCA 1NRFA 1XFNA 3QP8A 4ARZA 2Q9MA 4DE2A 4UA9A 2P08A 4QU3A 4EETB 3FG8A 3HL9A 2KDKA 3L7HA
chains in the Genus database with same CATH topology
3BY8A 5AVEA 4IJGA 4BBTA 4GW9A 2V1BA 2Z6DA 2DMWA 5J4EA 3LIDA 3C38A 5TJJA 1KOUA 2O9BA 3EWKA 3GDIA 2WKPA 3HJKA 1N9LA 5J3WA 4R6LA 5TBMA 3PBOA 4NKPA 4EESA 2KX6A 1T1BA 2Y8HA 3R7WA 4UQIS 3EGDC 2P7JA 2KOIA 4KUOA 2PR5A 1UWNX 5HPFA 5I5LA 2IA2A 2INWA 2K2NA 3H82B 5HDSA 5DKLA 4LLOB 3BW6A 4BWIA 2HJ9C 2ZOHA 4O01A 2R78A 2J3TD 3LR5A 5HDCA 4G3WA 1T1CA 5F69A 4B9OA 3EQVA 3LFVA 2PYPA 4G3KA 5G4YA 2YKHA 3FPWA 3KX0X 3C8CA 3H7WB 3SW1A 4JGRA 5IS1A 4GJ4A 2LB5A 4G3VA 4YOFA 2JKTI 1S1YA 2BASA 3U2AA 5DF9A 3IS2B 2QJ5A 1BYWA 1S66L 4LRYC 3CWFA 1YKDA 2XA7M 4IHQA 4MMNA 2V0WA 3NHQA 4Q0JA 3T4QA 4B93A 4HJ4A 3IBJA 1IFQA 1OTIA 3PBSA 2GJ3A 4ETXA 3CITA 4BJPA 4Y3IA 4KQOA 5HL6A 4DMZA 3E98A 4ARZB 4I5SA 3CUEA 2VLGA 1N9OA 1V9ZA 1XJ6A 2MJ6A 4GLQA 2V0UA 2OAP1 1S4SA 4XT2A 4ETZA 3CLOA 2VV8A 3PYPA 4KUKA 5IU1A 1VHMA 3LR4A 5DJTA 4GS9B 5IT5A 3FPVA 5LBRA 4MN7A 2XA7S 3UB6A 2PT7A 2PR6A 5HWWA 3KSHA 4M4XA 2EWVA 4PHTA 1H3QA 5CX7A 1P9RA 4ME4A 5TBMB 5A8BA 1XJ4A 1S67L 3LICA 1OTDA 3OOVA 3NOTC 3KYZA 4LRZE 2WKRA 2M1CA 2W3DA 1F5MA 4I3AA 4LPZA 4UEYA 4MDZA 2XROA 1X0OA 3BQAA 4NXFA 5L8MA 4Y2FA 4HJ3A 1OJ5A 4MN6A 3PBQA 2Z6CA 3UB8A 2O0YA 4WUJA 1G6OA 2GNXA 2YKFA 2L0WA 1D06A 4BBVA 1GSXA 4BBUA 3BJNA 1LSXA 3PBRA 2V9AA 4OOLA 2P04A 1OTAA 2W1RA 2K31A 1MZUA 4L9FA 1DP6A 4Y5FA 3NOUC 2W3FA 4AFIA 3FC7A 3EQUA 3F1NB 2QWSA 4II7A 1OJGA 1TS0A 4YNRA 3MFXA 3T4LA 4CLCC 4HI4A 2CMNA 5F68A 3C30A 5HD3A 4L9EA 4NXGA 2XSSA 4HNBA 3CUEC 1VB6A 4H6JB 3VOLA 4FSFA 1XJ3A 2W1TA 3LR3A 2O99A 3MF0A 3JVVA 4OOMA 4ZRRA 3MXQA 4CLCB 2A24B 1MC0A 5KSHA 2W3GA 3IBRA 3P7NA 1T18A 3E4QA 3KO6A 5C5KA 3PXPA 2V1AA 4LRXC 5AVFA 4EW7A 4I3IA 2H28A 4F3LB 3F1OA 3PR6A 1T1AA 2HV1A 1S4RA 3UB9A 2VKSA 3EEAA 2JKRI 3UE6A 2W3EA 3LUQA 4K08A 5G4ZA 2FH5A 2JKTM 4HQAA 1N9NA 1OTBA 3T4TA 3W2ZA 1OT6A 3K3CA 4CLCD 4WF0A 2O9CA 2D02A 2OWHA 2W0NA 4NXBA 3KYQA 3MQ0A 1ODVA 1LSVA 1T19A 4R38A 2HF6A 3TRCA 3UB7A 2QKPA 3D3OA 4PAUA 4O8GA 2PYRA 3VE3A 3B47A 2QYBA 4FOFA 3H82A 4DN0A 3RFBA 2D01A 3LI9A 2QJ7A 3LI8A 3T4JA 4E04A 3UMDA 4IUKA 4GHIA 1JNUA 1DRMA 4GCZA 4RQ9A 3K2NA 5F6AA 5HD5A 5DKKA 2PDRA 3ICYA 3LYXA 3PBNA 3MR0A 5F5YA 2VGLM 4PKYG 1H8MA 1P0ZA 3HJIA 2VX8A 3T50A 3OBFA 3H7WA 3H9WA 3B33A 1EW0A 2NUTC 4BMWA 1TS8A 1NLYA 3NOPC 2VEAA 1TS6A 3MQOA 3C2WA 1GSWA 4HHDA 3NJAA 3R7WB 4L0LA 2VA0A 4WELA 4WN5A 2VZWA 3T4SA 4HH2A 1LT0A 2NUPC 3MJQA 3GECA 3JVUA 2OOLA 2W1TB 5HWTA 4EU0A 1XJ2A 1D7EA 3A0SA 3PBTA 3S7NA 3V67A 4YWZA 4WEJA 5HPIA 3EGXC 2VV7A 2J80A 3G6OA 1TS7A 4WEKA 1YSPA 4QPRA 3TE8A 2JN7A 3R4KA 2B02A 4R3AA 2I9VA 3DBAA 3B42A 3VV4A 3F1OB 3TW8A 4EQ1A 2B18A 3E4OA 3F1PA 3P01A 4GS9A 4DJ2A 2LB9A 4EERA 2M7VA 2W27A 1ZHHB 1LSWA 4P6ZM 2GZAA 3S7PA 2HGVA 2G7UA 3BWLA 3T4OA 3HCYA 2A2LA 2QHKA 5HWVA 4HOIA 3LIFA 3O5YA 5DJUA 2L1MA 1IOUA 4PKYA 2W3HA 3A0RA 5DFXA 1DP8A 4EXOA 4L9GA 3K3DA 2O9AA 2OWJA 3BQ8A 5EFWA 1F9IA 5HDDA 1F98A 3LIEA 4XT2B 3TJZC 3KSFA 4HH3A 4GHIB 2PD8A 1UGUA 3OCNA 1S1ZA 2L4RA 3T4KA 3BY9A 3KSGA 2XRNA 2ZOIA 5DFYA 1WA9A 3LR0A 5MC7A 2ZMVA 4KQDA 3RTYA 1Y28A 4MN5A 3F1NA 1YAXA 3UMEA 5HZHA 2JKRM 4P6ZS 2WKQA 1TF1A 4I39A 4I38A 3KSIA 1W63M 4EEPA 1GSVA 4HIAA 3E4PA 4H6JA 2VV6A 3EOIA 4CLCE 2ZBBA 1NLZA 3VE4A 1MKMA 1OT9A 4NXEA 5AJGA 3MMHA 1LL8A 4CLCA 3LIAA 3MQQA 2A24A 2Y79A 4EUVA 2JHEA 3E0YA 4Q0IA 2ZMFA 2OAQ1 3LIBA 5J7EA 1YSQA 2VJWA 2KLIA 4HP9A 3ULFA 3OLOA 4JGOA 2J3WA 3OCLA 2EWWA 2M7UA 4JGQA 4NEED 4F3LA 3IS2A 1W63Q 2K7SA 4HJ6A 4JGPA 1NRJA 1V9YA 3A0VA 4EEUA 4WL9A 2FZ0A 3CAXA 1P97A 2EA9A 2PD7A 3F1PB 3D72A 5K5BA 4O0PA 5KIZA 1UWPX 1OPXA 3UE3A 4IUHA 4DJ3A 1DP9A 1OTEA 2HJEA 4Z1WA 4HP4A 4UQIM 1STZA 1TD5A 4Q0HA 1G28A 4MCWA 3RH8B 5HSQA 4I3JA 3S7OA 3ZYTA 1XFNA 4ARZA 3OC2A 3ZQ5A 3EEHA 1ZTUA 3PHYA 2J3TC 4HY8A 3S7QA 2GX5A 1NWZA 2VGLS 1P9WA 4CQHA 5FL3A 2P08A 2PHYA 3CI6A 1XFQA 4WLAA 4EETB 3FG8A 2KDKA 4R70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8M A;  3KYQ A;  3BW6 A;  3EGX C;  2DMW A;  1IOU A;  1IFQ A;  2VX8 A;  2NUP C;  4AFI A;  4B93 A;  3EGD C;  2NUT C; 
#chains in the Genus database with same CATH topology
 1MWU A;  5DTS A;  4IJG A;  1YLJ A;  2Q9N A;  5FQ9 A;  5M1A A;  2V1B A;  3A3F A;  2Y2O A;  3EWK A;  1LHY A;  1N9L A;  2OSU A;  1K0K A;  4EES A;  3RJU A;  3IXH A;  4UQI S;  5DTT A;  2P7J A;  2BLS A;  5EVE A;  2EFX A;  2IA2 A;  3H82 B;  1KDS A;  1G68 A;  2ZOH A;  4O01 A;  5CEC A;  2ZLY A;  1J3W A;  4G3W A;  5F69 A;  3VOY A;  3WS4 A;  1L0D A;  3EQV A;  3P98 A;  2WZX A;  4G3K A;  2Y2J A;  4P85 A;  3A3I A;  3C8C A;  5IS1 A;  2IWC A;  4GJ4 A;  3U2A A;  3IS2 B;  1MWT A;  4GOG A;  4LRY C;  1WE4 A;  1FOF A;  3CWF A;  1ONG A;  2ZC5 B;  1PZP A;  2PU4 A;  4JXV A;  4Q0J A;  3T4Q A;  5CED A;  3ZNT A;  3CMZ A;  1IFQ A;  3HLG A;  2GJ3 A;  4FTX A;  4Y3I A;  5EPH A;  4I5S A;  3CUE A;  2WAE A;  1N9B A;  5FDH A;  1TEM A;  1L2S A;  1N9O A;  1K4F A;  1XJ6 A;  4KQR A;  3KYE A;  3ZHH A;  4JF6 A;  3CLO A;  1GA9 A;  5TGF A;  4CJN A;  1VHM A;  3LR4 A;  5DJT A;  3DWZ A;  1N4O A;  4EBP A;  4XXR A;  5FSR A;  3UB6 A;  5HWW A;  2WAD A;  5FA7 A;  3KSH A;  3BYD A;  4R3B A;  1H3Q A;  4ME4 A;  5TBM B;  4OH0 A;  2H0T A;  3OOV A;  3NOT C;  4LRZ E;  2WKR A;  2M1C A;  4DE1 A;  2C6W B;  2W3D A;  2XRO A;  4MDZ A;  1X0O A;  4QD4 A;  4NXF A;  4HJ3 A;  1OJ5 A;  4MN6 A;  1G6A A;  5DF7 A;  3NUL A;  1G6O A;  5FQJ A;  3HUN A;  4RX2 A;  2YKF A;  2L0W A;  4LGW A;  1GSX A;  1XPB A;  2HP5 A;  4E3J A;  4IED A;  1L0E A;  1L0F A;  2V9A A;  1PWG A;  4ZJ2 A;  1MZU A;  4L9F A;  3UNW A;  4MBH A;  3WS1 A;  5A92 A;  3OPR A;  2QWS A;  1TS0 A;  4K0W A;  5F68 A;  3C30 A;  5HD3 A;  4L9E A;  4WYY A;  4E3K A;  2VGJ A;  2Q0O A;  3GR2 A;  2WGI A;  3P7N A;  5F1G A;  2WAF A;  3Q81 A;  1MWR A;  3FKV A;  1KVL A;  3VP0 A;  3N4I A;  5GHZ A;  2HV1 A;  4Y13 A;  3EEA A;  3UE6 A;  3Q82 A;  2W3E A;  2P9V A;  1BLS A;  5G4Z A;  3QP5 A;  1VET B;  2DCF A;  3T4T A;  1OT6 A;  2WGW A;  3K3C A;  4OPY A;  2PBD P;  2OWH A;  5FAO A;  5G18 A;  4NXB A;  1PW1 A;  2JC7 A;  4E3N A;  4OVD A;  5GHY A;  2HF6 A;  3IH9 A;  3UB7 A;  1XX2 A;  4O8G A;  4DN0 A;  3MXS A;  3RFB A;  3T4J A;  3LI8 A;  2Z2M B;  4IUK A;  1BTL A;  1DRM A;  3RXX A;  4GCZ A;  5F6A A;  4S2O A;  5DKK A;  2PDR A;  3LYX A;  3PBN A;  5EVI A;  2ZQD A;  4U0X A;  2A3U A;  3UPP A;  1H8M A;  1YMX A;  3HJI A;  3T50 A;  1WYB A;  4S2N C;  2X01 A;  4EUZ A;  3IF5 A;  3VFH A;  4BMW A;  5FI7 A;  3NOP C;  4MBK A;  2VEA A;  1A0K A;  5DVA A;  3SS5 A;  3C2W A;  3VSL A;  2ZC6 B;  4HHD A;  3IH8 A;  1JVJ A;  3VP4 A;  4WZ5 A;  3SS3 A;  1PWD A;  1LT0 A;  3CHW P;  4ZTK A;  2VGK A;  1HTZ A;  3HLF A;  1HZO A;  1ES2 A;  3GEC A;  2OOL A;  1AXB A;  4MLL A;  1E3U A;  4GDN A;  3EGX C;  3IX3 A;  1E25 A;  2J80 A;  4GNU A;  2XK1 A;  1PWC A;  1SZV A;  1K57 A;  2BTF P;  3IWO A;  2B02 A;  4R3A A;  2I9V A;  1DY6 A;  3B42 A;  4B4X A;  3F1O B;  3FZC A;  1XA1 A;  4EQ1 A;  2B18 A;  3E4O A;  1ESI A;  5BOH A;  5EM1 A;  4NK3 A;  5M19 A;  4P6Z M;  2Y2P A;  4Q8I A;  1D1J A;  2HGV A;  4P87 A;  4Y0U A;  4JLF A;  3FYZ A;  2QHK A;  3VOZ A;  2Y55 A;  3LIF A;  4N1H A;  5DJU A;  4OPQ A;  1IOU A;  3UDI A;  3GV9 A;  3K3D A;  3CPT B;  5FAS A;  3LIE A;  5FEF A;  4GHI B;  4N9K A;  3OCN A;  2XRN A;  3OPP A;  2ZOI A;  5DFY A;  4C6Y A;  4JXG A;  4DE3 A;  1KE4 A;  3BM6 A;  4KZ5 A;  1C3B A;  1CI8 A;  5EOE A;  1W63 M;  3G35 A;  4X68 A;  3E4P A;  2QMI A;  3EOI A;  4CLC E;  4DKI A;  5EEC A;  2JHE A;  3E0Y A;  1RGZ A;  1BLH A;  1M40 A;  5J7E A;  1JTD A;  1MY8 A;  4HP9 A;  3OCL A;  3T12 B;  4IBX A;  3IS2 A;  4RYE A;  4E3I A;  5JYO A;  1IKG A;  4JXS A;  1IEM A;  2PD7 A;  3F1P B;  4O0P A;  1OPX A;  1LI0 A;  4IUH A;  3ITB A;  3O87 A;  2Y91 A;  1FCN A;  4HP4 A;  1STZ A;  1TD5 A;  2G2U A;  4Q0H A;  1G28 A;  4DF6 A;  4BLM A;  3QP1 A;  3ZYT A;  2DNS A;  3OC2 A;  1ZTU A;  3PHY A;  2J3T C;  3S7Q A;  1EI5 A;  4CQH A;  5FL3 A;  1I2W A;  4UA6 A;  3HLW A;  5HX9 A;  3M6B A;  5AVE A;  4XUZ A;  1KE3 A;  1BUE A;  5CHM A;  2DMW A;  4Y7P A;  4NG2 A;  2O9B A;  3HJK A;  3IF6 A;  1E4D A;  5TBM A;  4GKU A;  3W4O A;  2KX6 A;  1FSY A;  3R7W A;  4O7D A;  1YQS A;  3QNC A;  2PR5 A;  1UWN X;  2JKG A;  4JPM A;  5HPF A;  3IHB A;  5I5L A;  2QZ6 A;  2Y2N A;  1IYO A;  4OOY A;  4LLO B;  4BWI A;  2HJ9 C;  3LR5 A;  3Q1F A;  1DJB A;  1T1C A;  4RVA A;  5FAT A;  4WMC A;  5G4Y A;  2YKH A;  1FR1 A;  3QP4 A;  4N1X A;  5HW3 A;  3SW1 A;  3HLD A;  4JGR A;  2XD5 A;  5DF9 A;  1MKI A;  2QJ5 A;  3O86 A;  3MS6 A;  3UO9 A;  1K25 A;  1YKD A;  2XA7 M;  4ID4 A;  3L9K A;  4C3Q A;  3IBJ A;  1Q2Q A;  1LLB A;  3HBR A;  4DMZ A;  3E2K A;  4QHC A;  2VLG A;  2MJ6 A;  4GLQ A;  2H5S A;  3SZT A;  4XT2 A;  1EWZ A;  3MXR A;  2VV8 A;  3IX4 A;  1JWP A;  1DJA A;  1VET A;  4OQ0 A;  3LGO A;  4CPK A;  5LBR A;  3OZH A;  3T1R A;  4M4X A;  2VK3 A;  2EWV A;  3IHA A;  4S2I A;  1K6R A;  5CRF A;  3KYZ A;  4S2M A;  5EVL A;  4WBG A;  4X1L A;  1F5M A;  4LPZ A;  2H0Y A;  3MKF A;  3DAV A;  3ZG8 B;  1L3L A;  3UB8 A;  2EXA A;  2Z6C A;  4WUJ A;  3JYI A;  2GNX A;  2ZQ7 A;  3ZG0 A;  1I2S A;  1HD8 A;  1IEL A;  1D06 A;  4BBV A;  3V3S A;  2JCH A;  2XEP A;  4YFM A;  3BJN A;  3PBR A;  3UE0 A;  2GDN A;  3NOU C;  2W3F A;  3EQU A;  4DRT A;  4CLC C;  1ZKJ A;  1QME A;  4Y0T A;  2XSS A;  3CUE C;  1F2K A;  3BLM A;  3VOL A;  1BUL A;  1XJ3 A;  2ZM2 A;  2O99 A;  3MF0 A;  3JVV A;  4MEZ A;  4E3M A;  3MXQ A;  2PBY A;  1K4E A;  3I7J A;  5EOO A;  3VFF A;  5GLA A;  5C5K A;  3PXP A;  4LRX C;  4I3I A;  3ZVT A;  3F1O A;  1GHM A;  2FFF B;  3UPO A;  1S4R A;  4H8R A;  2JKR I;  2WKI A;  3LUQ A;  1XA7 A;  3ZCZ A;  2G2W A;  4Y0O A;  3DTK A;  3VSK A;  1OTB A;  4OLD A;  2O9C A;  2W0N A;  3UN7 A;  3MQ0 A;  1ODV A;  1LSV A;  4R38 A;  3BEB A;  1PFL A;  3Q7V A;  1OME A;  3BFE A;  2QKP A;  3CPT A;  3VE3 A;  3B47 A;  4FOF A;  4S2L A;  3PTE A;  2D01 A;  2A49 A;  4PM7 A;  4FCF A;  4HBT A;  4E04 A;  4GHI A;  1JNU A;  5FQK A;  4RQ9 A;  5HD5 A;  2Y2H A;  3ITA A;  5HAQ A;  3MR0 A;  5F5Y A;  3U4L P;  4PKY G;  2XH9 A;  1YLT A;  2VX8 A;  3OBF A;  3H9W A;  3CZD A;  1EW0 A;  4GD6 A;  1BT5 A;  3AGF A;  3IF6 B;  1GSW A;  4OPZ A;  3NJA A;  4LEN A;  3ZDJ A;  3R7W B;  2UWX A;  3T4S A;  1XXM A;  1AWI A;  2NUP C;  1JWZ A;  5HAP A;  3MJQ A;  2Y2M A;  3JVU A;  4E3O A;  2W1T B;  1S0W A;  3M2K A;  4X25 A;  1Q2P A;  5F83 A;  4GD8 A;  3G6O A;  5L2F A;  1NJ4 A;  4QPR A;  2JN7 A;  1BSG A;  2HPB A;  1KVM A;  3DBA A;  1NY0 A;  1YT4 A;  1ZG4 A;  1S6R A;  3G2Y A;  3F1P A;  3P01 A;  4JKT A;  1SCW A;  4EER A;  2ZQA A;  2M7V A;  2V8F A;  1RGY A;  3G2Z A;  1PW8 A;  3BFD A;  3SOI A;  1NYM A;  3BWL A;  3UB5 P;  5HWV A;  4OQG A;  3TOI A;  4HOI A;  5A90 A;  4WMC D;  3MBZ A;  5KZH A;  5EVI C;  3A0R A;  4EXO A;  4L9G A;  1ZC2 A;  3QNB A;  1F98 A;  4XT2 B;  3KSF A;  4HH3 A;  1K55 A;  2OLU A;  1S1Z A;  5CGS A;  3DTM A;  3T1X A;  3KSG A;  4GB7 A;  1WA9 A;  3LR0 A;  1SKO B;  4WZ5 C;  2ZMV A;  4LCM A;  3GRJ A;  3UME A;  2JKR M;  4P6Z S;  2WKQ A;  1K56 D;  3IQA A;  4I39 A;  1SHV A;  3KSI A;  5CGW A;  1ACF A;  2HDU A;  4N9L A;  4ZJ1 A;  1K57 C;  2IWB A;  1W8Q A;  2I72 A;  1NLZ A;  3ZVW A;  3ZG9 B;  3LCE A;  5AJG A;  2WGV A;  3MQQ A;  2A24 A;  4EUV A;  5AQ7 A;  4Q0I A;  1O07 A;  3S4X A;  3SH9 A;  2OAQ 1;  5L09 A;  2J3W A;  4KZ7 A;  1YLY A;  4FD8 A;  4EWF A;  3JPU A;  2K7S A;  4HJ6 A;  3A0V A;  4WL9 A;  3ZG7 B;  1P97 A;  2ZD8 A;  3UE3 A;  4XUX A;  4R0Q A;  3NIA A;  2EFU A;  2V1Z A;  3S1Y A;  4MCW A;  3RH8 B;  5HSQ A;  4I3J A;  3IWQ A;  3S7O A;  3V3R A;  3V50 A;  2RL3 A;  3ZQ5 A;  3EEH A;  3Q7Z A;  2GX5 A;  2VGL S;  4DDY A;  3CI6 A;  1XFQ A;  2CC1 A;  5KMW A;  4WLA A;  5A93 A;  3DTE A;  4R70 A;  5CHJ A;  5TR7 A;  4KZ9 A;  2ZM8 A;  5J4E A;  3D4F A;  5E2F A;  3C38 A;  5TJJ A;  5E2H A;  1KOU A;  1YMS A;  1W79 A;  2WKP A;  3WS2 A;  5J3W A;  4R6L A;  3LEZ A;  2Y8H A;  3EGD C;  2KOI A;  2E8I A;  3Q7V B;  4S2N A;  1CI9 A;  2J7V A;  4X6T A;  4JXW A;  2K2N A;  5DF8 A;  5HDS A;  3BW6 A;  2R78 A;  4EQI A;  5F1F A;  3ZGA B;  2ZL1 B;  3WS5 A;  4Y17 A;  4DE0 A;  2LB5 A;  1PI5 A;  4YOF A;  2JKT I;  5FI2 A;  5HAR A;  4R23 A;  1BLC A;  1BYW A;  1S66 L;  4KQQ A;  1PRQ A;  4QWO A;  3HVF A;  4IHQ A;  2V0W A;  3NHQ A;  3UPN A;  4B93 A;  4X55 A;  1NZU A;  4KZ3 A;  2B5R A;  1OTI A;  3SH7 A;  4BQM A;  4ETX A;  3CIT A;  2WZZ A;  1V9Z A;  2V0U A;  2OAP 1;  1S4S A;  3IF6 C;  3PYP A;  1HLU P;  2HDS A;  4KUK A;  3A3D A;  5IT5 A;  1SKF A;  1H8Y A;  3FPV A;  1GHP A;  2XA7 S;  1SDN A;  4EBL A;  4E6X A;  1MXO A;  3N6I A;  4QY5 A;  3HLC A;  3DWK A;  3MSH A;  5A8B A;  1S67 L;  3LIC A;  1OTD A;  3OPH A;  4KZ4 A;  4LCL A;  4UEY A;  4ZJ3 A;  1LI9 A;  5L8M A;  4DDS A;  4PPR A;  4Y2F A;  3PBQ A;  2O0Y A;  3A3E A;  2XFS A;  4P0M A;  2ZJ9 A;  4X69 A;  2WKE A;  2XDM A;  1GCE A;  1PI4 A;  1W8Y A;  4BBU A;  1LSX A;  1ES5 A;  5GL9 A;  2P04 A;  1OTA A;  2K31 A;  2XGN A;  3P09 A;  5J8X A;  4Y5F A;  1Z6F A;  4AFI A;  3UDX A;  3FC7 A;  4KG6 A;  4D2O A;  5FDS A;  3T4L A;  1FIL A;  3O88 A;  4OQI A;  5GLC A;  4NXG A;  4BD0 A;  1IYP A;  1VB6 A;  1ERQ A;  4NET A;  1FIK A;  2W1T A;  3O3V A;  4OOM A;  4ZRR A;  4M3K A;  3QHY A;  2OV5 A;  2A24 B;  2JKF A;  1PZO A;  1MC0 A;  2BG1 A;  5KSH A;  3IBR A;  5GLD A;  1KGF A;  3KO6 A;  3N8R A;  5AVF A;  4EW7 A;  3NCK A;  2H28 A;  5HAI A;  1MBL A;  2E8J A;  1JTG A;  2C5W B;  5CGX A;  4BD1 A;  3W4P A;  4Y15 A;  2VKS A;  1LL9 A;  2FH5 A;  2JKT M;  4HQA A;  1N9N A;  3W2Z A;  1FSW A;  3RXW A;  4WF0 A;  3NI9 A;  4FUW A;  3Q07 A;  2WKH A;  1ES3 A;  3WRZ A;  1K56 A;  2ZQC A;  4LV1 A;  5HFO A;  4PAU A;  3T1Q B;  2PYR A;  3SH8 A;  3LY4 A;  2QJ7 A;  3LEQ A;  1LL5 A;  3AGD A;  3K2N A;  3ICY A;  3IXD A;  1SKO A;  1P0Z A;  3H7W A;  1ZG6 A;  3SS4 A;  3B33 A;  2NUT C;  3AGE A;  4C75 A;  1TS6 A;  2ZC3 B;  3GTC A;  1SDE A;  4WN5 A;  2VZW A;  3FKW A;  3WS0 A;  3HLE A;  2ZC7 A;  5HWT A;  1XJ2 A;  1H0M A;  3ZNY A;  3A0S A;  2PU2 A;  4YWZ A;  5HPI A;  5L07 A;  2VV7 A;  3G34 A;  4U0T A;  3IXG A;  1PYY A;  1TS7 A;  4WEK A;  2B95 A;  4IVI A;  5CER A;  3W8K A;  1QMF A;  2ZC4 B;  1VEU B;  3R4K A;  2Y59 A;  4A5R A;  3UE1 A;  3OPL A;  2HP6 A;  3HUM A;  3VV4 A;  1PIO A;  2Y4A A;  2UV0 E;  2EX6 A;  1K54 A;  1TVF A;  4GS9 A;  4DJ2 A;  5AQA A;  4R4R A;  2LB9 A;  3DTI A;  1ZHH B;  1LSW A;  2GZA A;  2ACG A;  4OKP A;  2J8Y A;  1ONH A;  4S2J A;  3S7P A;  2RCX A;  3T4O A;  1YPR A;  3G4P A;  1H8Z A;  2HP9 A;  2X71 A;  3BFF A;  2A2L A;  2Y2L A;  2L1M A;  5AQB A;  3IXB A;  5DFX A;  1ESU A;  1G5U A;  2XFT A;  5KSC A;  2O9A A;  4LFU A;  2OWJ A;  3BQ8 A;  5E2G A;  2R9X A;  5TFQ A;  5HDD A;  5CEB A;  3IT9 A;  3T1S A;  3FV7 A;  3BY9 A;  1CQA A;  5MC7 A;  4KQD A;  4PM6 A;  2EX2 A;  1Y28 A;  2ZMA A;  4MN5 A;  3F1N A;  1CEG A;  4Z9Q A;  4GZB A;  2Z2L B;  4EEP A;  1GSV A;  3MZE A;  1NYY A;  1YLP A;  1BZA A;  2PAV P;  1CF0 A;  4H6J A;  1GA0 A;  2VV6 A;  4HEF A;  1PNE A;  2ZBB A;  4OON A;  5IHV A;  5FEG A;  1XKZ A;  3GSG A;  1OT9 A;  4NXE A;  2ZL1 A;  4BL3 A;  4CLC A;  3LIA A;  3LO7 A;  2ZMF A;  1YSQ A;  2Y2K A;  2KLI A;  3ULF A;  4JGO A;  3PAE A;  2EWW A;  2M7U A;  4F3L A;  1M6K A;  1K38 A;  4JGP A;  3W4Q A;  1NRJ A;  5L10 A;  3TSG A;  3E2L A;  1V9Y A;  1JWV A;  4EEU A;  4UA7 A;  3CAX A;  4S2K A;  5EV0 A;  5FQI A;  1UWP X;  1DP9 A;  4UQI M;  3WWX A;  4KZ6 A;  1CEF A;  1K55 C;  5HL1 A;  1NZO A;  3GMW A;  4HY8 A;  3NC8 A;  4PM8 A;  1NWZ A;  3V39 A;  1P9W A;  3MZF A;  2PHY A;  3BEC A;  3NBL A;  4OLG A;  3BY8 A;  5A91 A;  2V2F F;  2ZM0 A;  2XLN A;  4BBT A;  4GW9 A;  4K0X A;  2Z6D A;  3IX8 A;  4R4S A;  3LID A;  3VMA A;  3GDI A;  4E6W A;  4FH2 A;  4JF5 A;  1NXY A;  5E43 A;  4RX3 A;  4R3J A;  3PBO A;  1XGI A;  3A3J A;  4NKP A;  5DTK A;  4KZB A;  1T1B A;  3WRT A;  2X02 A;  4UAA A;  5I94 A;  4KUO A;  4E3L A;  3N8S A;  2Y2I A;  2INW A;  5DKL A;  2XQZ A;  5CTN A;  3C4P A;  1ERM A;  4KZ8 A;  2J3T D;  5HDC A;  4B9O A;  4QY6 A;  3LFV A;  4R1G A;  3M6H A;  5GLB A;  2PYP A;  4YIN A;  3N8L A;  3FPW A;  3C5A A;  5EUA A;  4ZDX A;  3KX0 X;  3H7W B;  4G3V A;  3ISG A;  1S1Y A;  2BAS A;  1CJF A;  2R9W A;  4K91 A;  4WM9 A;  4MMN A;  5D3O A;  1KDW A;  3CJM A;  3G30 A;  2WUQ A;  4RA7 A;  4HJ4 A;  4LV2 A;  4D60 A;  3PBS A;  4PM9 A;  2FFY A;  4BJP A;  4KQO A;  5HL6 A;  3E98 A;  4ARZ B;  4ZAM A;  3V5M A;  1FCO A;  4HES A;  1U60 A;  1IYS A;  4GDB A;  4ETZ A;  1WYC A;  1Y4O A;  1K6S A;  5IU1 A;  4GS9 B;  3VP1 A;  5FAQ A;  5M18 A;  4MN7 A;  3MZD A;  2PT7 A;  2PR6 A;  1RP5 A;  4BL2 A;  4PHT A;  4OQH A;  5CX7 A;  1P9R A;  1XJ4 A;  1KGG A;  2AVX A;  1I5Q A;  4I3A A;  2WK0 A;  3BQA A;  5CHU A;  1IKI A;  3HRE A;  5EE8 A;  4FH4 A;  5EM0 A;  3GVB A;  4IVK A;  4ZBE A;  3VP3 A;  2P74 A;  3VP2 A;  3ZFZ A;  1RCJ A;  4OOL A;  3ZG5 A;  1J9M A;  2W1R A;  4MNR A;  2DRW A;  1DP6 A;  1ALQ A;  4MBF A;  3F1N B;  2ZQ9 A;  4EV4 A;  2EX9 A;  1YLZ A;  4JBF A;  4II7 A;  1OJG A;  4YNR A;  3MFX A;  4HI4 A;  2CMN A;  4KG2 A;  4DXB A;  4HNB A;  5GHX A;  1TDL A;  4H6J B;  3CG5 A;  4FSF A;  3LR3 A;  4B88 A;  4ESP A;  1VQQ A;  2J9O A;  4CLC B;  4KG5 A;  2W3G A;  3GQZ A;  1VEU A;  4X53 A;  1T18 A;  3E4Q A;  2V1A A;  4PM5 A;  3BRM A;  2V20 A;  3UY6 A;  3DW0 A;  1L0G A;  4F3L B;  4BEN A;  3PR6 A;  4IBR A;  1T1A A;  4X1M A;  3UB9 A;  4F94 A;  2PRF A;  4K08 A;  1XP4 A;  4PMA A;  5CTM A;  5FAP A;  5E2E A;  4CLC D;  4WZ4 A;  2D02 A;  1MWS A;  4LV0 A;  3KYQ A;  3D9Y A;  1T19 A;  3TRC A;  4X56 A;  3D3O A;  2QYB A;  4KEN B;  3H82 A;  3LI9 A;  3UMD A;  1YM1 A;  2H10 A;  3LY3 A;  3HUO A;  2VGL M;  1YLW A;  2QPN A;  1GHI A;  4B4Z A;  5AQ9 A;  1VM1 A;  3N7W A;  3TG9 A;  1Y54 A;  1FQG A;  1TS8 A;  1NLY A;  3MQO A;  4S2P A;  1TDG A;  4L0L A;  2VA0 A;  4WEL A;  1XGJ A;  4LV3 A;  4HH2 A;  5F82 A;  3BFC A;  2Y2Q A;  1ES4 A;  2XD1 A;  2JE5 A;  4KZA A;  2HZ5 A;  4EU0 A;  1D7E A;  3PBT A;  3S7N A;  3V67 A;  4WEJ A;  2EX8 A;  3M2J A;  3HLB A;  3MKE A;  1YSP A;  2ZQ8 A;  3TE8 A;  5FQQ A;  1W7F A;  1FCM A;  3NY4 A;  3C7U A;  3BLS A;  3TW8 A;  4U3T A;  3G31 A;  4QJG A;  2P9V B;  4DXC A;  2W27 A;  3G32 A;  2IWD A;  3QP2 A;  4GN2 A;  2G7U A;  1KE0 A;  2WGW B;  1IYQ A;  3S22 A;  3HCY A;  3QP6 A;  1W5D A;  3NDG A;  1BLP A;  3UDF A;  3O5Y A;  4PKY A;  3NDE A;  2W3H A;  1DP8 A;  5JYP A;  2HDQ A;  3PAG A;  5EFW A;  1F9I A;  4UHU A;  1FR6 A;  3TJZ C;  4EBN A;  2PD8 A;  1UGU A;  2OLV A;  4OP8 A;  1MPL A;  2L4R A;  5CXW A;  3T4K A;  1HVB A;  5EVI B;  2JBF A;  1KGE A;  1CK3 A;  3RTY A;  1Z09 A;  1YAX A;  5HZH A;  3B3X A;  1TF1 A;  3IWI A;  4QB8 A;  4I38 A;  4N92 A;  4HIA A;  4JF4 A;  5FQM A;  4P6B A;  3MFD A;  1O7E A;  3VE4 A;  1MKM A;  2WYX A;  5EVI D;  3MMH A;  1LL8 A;  2J9P A;  2Y79 A;  2EXB A;  4OPR A;  3LIB A;  2VJW A;  1K54 C;  3FWL A;  3OLO A;  4JGQ A;  4NEE D;  5FI6 A;  2XR0 A;  1H5X A;  1W63 Q;  2V8C A;  2XF3 A;  2Y2G A;  2FZ0 A;  2EA9 A;  4HBU A;  3D72 A;  5K5B A;  3C7V A;  3C4O A;  5KIZ A;  4DJ3 A;  1OTE A;  2HJE A;  4Z1W A;  2HDR A;  1E3U D;  5U47 A;  3BFG A;  3NEC A;  1ERO A;  4OP5 A;  1DJC A;  1NRF A;  1XFN A;  3QP8 A;  4ARZ A;  2Q9M A;  4DE2 A;  4UA9 A;  2P08 A;  4QU3 A;  4EET B;  3FG8 A;  3HL9 A;  2KDK A;  3L7H A; 
#chains in the Genus database with same CATH homology
 3BY8 A;  5AVE A;  4IJG A;  4BBT A;  4GW9 A;  2V1B A;  2Z6D A;  2DMW A;  5J4E A;  3LID A;  3C38 A;  5TJJ A;  1KOU A;  2O9B A;  3EWK A;  3GDI A;  2WKP A;  3HJK A;  1N9L A;  5J3W A;  4R6L A;  5TBM A;  3PBO A;  4NKP A;  4EES A;  2KX6 A;  1T1B A;  2Y8H A;  3R7W A;  4UQI S;  3EGD C;  2P7J A;  2KOI A;  4KUO A;  2PR5 A;  1UWN X;  5HPF A;  5I5L A;  2IA2 A;  2INW A;  2K2N A;  3H82 B;  5HDS A;  5DKL A;  4LLO B;  3BW6 A;  4BWI A;  2HJ9 C;  2ZOH A;  4O01 A;  2R78 A;  2J3T D;  3LR5 A;  5HDC A;  4G3W A;  1T1C A;  5F69 A;  4B9O A;  3EQV A;  3LFV A;  2PYP A;  4G3K A;  5G4Y A;  2YKH A;  3FPW A;  3KX0 X;  3C8C A;  3H7W B;  3SW1 A;  4JGR A;  5IS1 A;  4GJ4 A;  2LB5 A;  4G3V A;  4YOF A;  2JKT I;  1S1Y A;  2BAS A;  3U2A A;  5DF9 A;  3IS2 B;  2QJ5 A;  1BYW A;  1S66 L;  4LRY C;  3CWF A;  1YKD A;  2XA7 M;  4IHQ A;  4MMN A;  2V0W A;  3NHQ A;  4Q0J A;  3T4Q A;  4B93 A;  4HJ4 A;  3IBJ A;  1IFQ A;  1OTI A;  3PBS A;  2GJ3 A;  4ETX A;  3CIT A;  4BJP A;  4Y3I A;  4KQO A;  5HL6 A;  4DMZ A;  3E98 A;  4ARZ B;  4I5S A;  3CUE A;  2VLG A;  1N9O A;  1V9Z A;  1XJ6 A;  2MJ6 A;  4GLQ A;  2V0U A;  2OAP 1;  1S4S A;  4XT2 A;  4ETZ A;  3CLO A;  2VV8 A;  3PYP A;  4KUK A;  5IU1 A;  1VHM A;  3LR4 A;  5DJT A;  4GS9 B;  5IT5 A;  3FPV A;  5LBR A;  4MN7 A;  2XA7 S;  3UB6 A;  2PT7 A;  2PR6 A;  5HWW A;  3KSH A;  4M4X A;  2EWV A;  4PHT A;  1H3Q A;  5CX7 A;  1P9R A;  4ME4 A;  5TBM B;  5A8B A;  1XJ4 A;  1S67 L;  3LIC A;  1OTD A;  3OOV A;  3NOT C;  3KYZ A;  4LRZ E;  2WKR A;  2M1C A;  2W3D A;  1F5M A;  4I3A A;  4LPZ A;  4UEY A;  4MDZ A;  2XRO A;  1X0O A;  3BQA A;  4NXF A;  5L8M A;  4Y2F A;  4HJ3 A;  1OJ5 A;  4MN6 A;  3PBQ A;  2Z6C A;  3UB8 A;  2O0Y A;  4WUJ A;  1G6O A;  2GNX A;  2YKF A;  2L0W A;  1D06 A;  4BBV A;  1GSX A;  4BBU A;  3BJN A;  1LSX A;  3PBR A;  2V9A A;  4OOL A;  2P04 A;  1OTA A;  2W1R A;  2K31 A;  1MZU A;  4L9F A;  1DP6 A;  4Y5F A;  3NOU C;  2W3F A;  4AFI A;  3FC7 A;  3EQU A;  3F1N B;  2QWS A;  4II7 A;  1OJG A;  1TS0 A;  4YNR A;  3MFX A;  3T4L A;  4CLC C;  4HI4 A;  2CMN A;  5F68 A;  3C30 A;  5HD3 A;  4L9E A;  4NXG A;  2XSS A;  4HNB A;  3CUE C;  1VB6 A;  4H6J B;  3VOL A;  4FSF A;  1XJ3 A;  2W1T A;  3LR3 A;  2O99 A;  3MF0 A;  3JVV A;  4OOM A;  4ZRR A;  3MXQ A;  4CLC B;  2A24 B;  1MC0 A;  5KSH A;  2W3G A;  3IBR A;  3P7N A;  1T18 A;  3E4Q A;  3KO6 A;  5C5K A;  3PXP A;  2V1A A;  4LRX C;  5AVF A;  4EW7 A;  4I3I A;  2H28 A;  4F3L B;  3F1O A;  3PR6 A;  1T1A A;  2HV1 A;  1S4R A;  3UB9 A;  2VKS A;  3EEA A;  2JKR I;  3UE6 A;  2W3E A;  3LUQ A;  4K08 A;  5G4Z A;  2FH5 A;  2JKT M;  4HQA A;  1N9N A;  1OTB A;  3T4T A;  3W2Z A;  1OT6 A;  3K3C A;  4CLC D;  4WF0 A;  2O9C A;  2D02 A;  2OWH A;  2W0N A;  4NXB A;  3KYQ A;  3MQ0 A;  1ODV A;  1LSV A;  1T19 A;  4R38 A;  2HF6 A;  3TRC A;  3UB7 A;  2QKP A;  3D3O A;  4PAU A;  4O8G A;  2PYR A;  3VE3 A;  3B47 A;  2QYB A;  4FOF A;  3H82 A;  4DN0 A;  3RFB A;  2D01 A;  3LI9 A;  2QJ7 A;  3LI8 A;  3T4J A;  4E04 A;  3UMD A;  4IUK A;  4GHI A;  1JNU A;  1DRM A;  4GCZ A;  4RQ9 A;  3K2N A;  5F6A A;  5HD5 A;  5DKK A;  2PDR A;  3ICY A;  3LYX A;  3PBN A;  3MR0 A;  5F5Y A;  2VGL M;  4PKY G;  1H8M A;  1P0Z A;  3HJI A;  2VX8 A;  3T50 A;  3OBF A;  3H7W A;  3H9W A;  3B33 A;  1EW0 A;  2NUT C;  4BMW A;  1TS8 A;  1NLY A;  3NOP C;  2VEA A;  1TS6 A;  3MQO A;  3C2W A;  1GSW A;  4HHD A;  3NJA A;  3R7W B;  4L0L A;  2VA0 A;  4WEL A;  4WN5 A;  2VZW A;  3T4S A;  4HH2 A;  1LT0 A;  2NUP C;  3MJQ A;  3GEC A;  3JVU A;  2OOL A;  2W1T B;  5HWT A;  4EU0 A;  1XJ2 A;  1D7E A;  3A0S A;  3PBT A;  3S7N A;  3V67 A;  4YWZ A;  4WEJ A;  5HPI A;  3EGX C;  2VV7 A;  2J80 A;  3G6O A;  1TS7 A;  4WEK A;  1YSP A;  4QPR A;  3TE8 A;  2JN7 A;  3R4K A;  2B02 A;  4R3A A;  2I9V A;  3DBA A;  3B42 A;  3VV4 A;  3F1O B;  3TW8 A;  4EQ1 A;  2B18 A;  3E4O A;  3F1P A;  3P01 A;  4GS9 A;  4DJ2 A;  2LB9 A;  4EER A;  2M7V A;  2W27 A;  1ZHH B;  1LSW A;  4P6Z M;  2GZA A;  3S7P A;  2HGV A;  2G7U A;  3BWL A;  3T4O A;  3HCY A;  2A2L A;  2QHK A;  5HWV A;  4HOI A;  3LIF A;  3O5Y A;  5DJU A;  2L1M A;  1IOU A;  4PKY A;  2W3H A;  3A0R A;  5DFX A;  1DP8 A;  4EXO A;  4L9G A;  3K3D A;  2O9A A;  2OWJ A;  3BQ8 A;  5EFW A;  1F9I A;  5HDD A;  1F98 A;  3LIE A;  4XT2 B;  3TJZ C;  3KSF A;  4HH3 A;  4GHI B;  2PD8 A;  1UGU A;  3OCN A;  1S1Z A;  2L4R A;  3T4K A;  3BY9 A;  3KSG A;  2XRN A;  2ZOI A;  5DFY A;  1WA9 A;  3LR0 A;  5MC7 A;  2ZMV A;  4KQD A;  3RTY A;  1Y28 A;  4MN5 A;  3F1N A;  1YAX A;  3UME A;  5HZH A;  2JKR M;  4P6Z S;  2WKQ A;  1TF1 A;  4I39 A;  4I38 A;  3KSI A;  1W63 M;  4EEP A;  1GSV A;  4HIA A;  3E4P A;  4H6J A;  2VV6 A;  3EOI A;  4CLC E;  2ZBB A;  1NLZ A;  3VE4 A;  1MKM A;  1OT9 A;  4NXE A;  5AJG A;  3MMH A;  1LL8 A;  4CLC A;  3LIA A;  3MQQ A;  2A24 A;  2Y79 A;  4EUV A;  2JHE A;  3E0Y A;  4Q0I A;  2ZMF A;  2OAQ 1;  3LIB A;  5J7E A;  1YSQ A;  2VJW A;  2KLI A;  4HP9 A;  3ULF A;  3OLO A;  4JGO A;  2J3W A;  3OCL A;  2EWW A;  2M7U A;  4JGQ A;  4NEE D;  4F3L A;  3IS2 A;  1W63 Q;  2K7S A;  4HJ6 A;  4JGP A;  1NRJ A;  1V9Y A;  3A0V A;  4EEU A;  4WL9 A;  2FZ0 A;  3CAX A;  1P97 A;  2EA9 A;  2PD7 A;  3F1P B;  3D72 A;  5K5B A;  4O0P A;  5KIZ A;  1UWP X;  1OPX A;  3UE3 A;  4IUH A;  4DJ3 A;  1DP9 A;  1OTE A;  2HJE A;  4Z1W A;  4HP4 A;  4UQI M;  1STZ A;  1TD5 A;  4Q0H A;  1G28 A;  4MCW A;  3RH8 B;  5HSQ A;  4I3J A;  3S7O A;  3ZYT A;  1XFN A;  4ARZ A;  3OC2 A;  3ZQ5 A;  3EEH A;  1ZTU A;  3PHY A;  2J3T C;  4HY8 A;  3S7Q A;  2GX5 A;  1NWZ A;  2VGL S;  1P9W A;  4CQH A;  5FL3 A;  2P08 A;  2PHY A;  3CI6 A;  1XFQ A;  4WLA A;  4EET B;  3FG8 A;  2KDK A;  4R70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...