3LY3A

Crystal structure of fluorophore-labeled class a beta-lactamase penp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
259
structure length
259
Chain Sequence
KDDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALNMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of fluorophore-labeled Class A Beta-lactamase PenP
rcsb
source organism Bacillus licheniformis
total genus 89
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3ly3A00
3VSLA 4BJPA 2P9VB 3BECA 3OPHA 2Y2HA 3BFGA 4JBFA 1K6SA 4ZTKA 3SH7A 3MBZA 1FQGA 3BRMA 1MKIA 3UY6A 5KSHA 3BYDA 4DXCA 1IKIA 4JKTA 1EROA 4KZBA 4KG5A 3PAEA 4UAAA 5HARA 2HPBA 4KZ4A 4LCMA 4QY5A 1FSYA 1W79A 4K0XA 3ZVWA 3EQUA 1MWTA 3ZGAB 3N8LA 1YMSA 4E3KA 5A91A 1QMFA 1N9BA 3PBTA 1U60A 4KZAA 4E3MA 4EBPA 3FV7A 3W4OA 1KE0A 2XLNA 4GB7A 1ES2A 4B88A 3G31A 4DDSA 1I2WA 4GZBA 3Q7ZA 1O07A 5HAQA 2XDMA 1W8QA 5CERA 3BFCA 1HVBA 2XEPA 4WEJA 3PBSA 3GQZA 1GHIA 2DCFA 1CI9A 1VM1A 2QZ6A 2Y2JA 3PBNA 4DE3A 4OKPA 3ZG9B 5J8XA 1Z6FA 4Y0TA 1XA7A 4JXVA 1XXMA 1ONHA 1Q2QA 1FCMA 1IEMA 3SH8A 3DW0A 3A3JA 2ZJ9A 1RCJA 2X71A 3GTCA 3A3IA 4PM8A 1IYPA 1K6RA 3A3DA 3G34A 1HZOA 3C4OA 5GHXA 4HEFA 4NK3A 2G2WA 4WZ4A 3NIAA 1K55A 4Z9QA 4MBHA 1BSGA 2FFYA 1YT4A 2OV5A 4OQIA 2VGKA 4OPQA 5DTTA 5CEBA 3N8RA 5HL1A 1LHYA 2Y2KA 4X69A 4OOLA 3G4PA 3OCNA 4S2IA 3ZDJA 1PWCA 4DKIA 4EV4A 1ERMA 2A3UA 4GKUA 1H5XA 3SS3A 3NY4A 4X55A 3HUOA 2HP5A 4WM9A 5CHJA 1L0GA 1OMEA 1CEFA 1AXBA 2Y91A 5E2EA 3HLBA 1MXOA 3BM6A 1KGEA 3IWIA 2HDQA 3S22A 4YINA 4IVIA 3Q7VB 1E25A 3ZVTA 1MY8A 3LEZA 2G2UA 3ISGA 2Y2GA 4O7DA 4S2PA 2ZM8A 3HUNA 4E3LA 5CECA 4S2JA 1YLTA 4QJGA 1BLHA 5GLCA 1CK3A 2WKHA 5JYPA 1Y54A 2WKIA 1K54C 3EQVA 1IKGA 5CEDA 4GN2A 1NZOA 3A3FA 4BD0A 5JYOA 1J9MA 1FR1A 3W4PA 4KQOA 1TDLA 1W5DA 2ZQ8A 1KDSA 3IF6A 4JPMA 5F83A 5FQJA 1BZAA 5A93A 1JWVA 2ZQAA 3IWQA 2Y2IA 3OPLA 1ONGA 4GD8A 3E2KA 5M19A 3UPOA 4C75A 2WAFA 3TSGA 1N4OA 3MZDA 4RX3A 3G32A 4RA7A 3BFDA 3GV9A 3HBRA 1PI5A 1WYBA 4FSFA 3V3SA 3D4FA 3HLGA 2QPNA 3IQAA 3ZG8B 2ZMAA 2EX8A 2IWBA 1ZG4A 3MKEA 4S2OA 4IBRA 2PU4A 4D2OA 5DF7A 1YM1A 4P6BA 3AGDA 4UA7A 1DY6A 5CHUA 3UE0A 1KE3A 1FSWA 5CGSA 5KSCA 3NDGA 3QNBA 1ES3A 3V5MA 4LCLA 4KZ6A 3NBLA 2WZXA 1SDEA 2Y2NA 3WS4A 2WGVA 5FQMA 4S2NA 2V20A 4FD8A 3VP3A 1YQSA 1K25A 3PBOA 2WUQA 2ZQCA 2DNSA 4MBKA 3VP0A 1BLPA 2R9WA 3C5AA 1TVFA 1H8ZA 2WK0A 4ZAMA 1HD8A 4N9KA 1SDNA 2J9PA 3N7WA 4QD4A 4QY6A 1W7FA 5TFQA 1MPLA 3FKVA 3WS2A 2HDUA 4PM5A 4E3NA 2ZQ7A 1PW8A 4OQHA 5FSRA 4HESA 1H8YA 4DXBA 4KENB 4OH0A 3FWLA 2EX2A 1PYYA 4ID4A 4IVKA 4R3JA 3UDIA 3VOYA 4A5RA 2DRWA 2Y2OA 5FQQA 4GD6A 4JXGA 1CEGA 3ZFZA 2XFSA 2X01A 5E43A 3OPPA 4LENA 1L0DA 1MWRA 4N1HA 4OP5A 3E2LA 2BLSA 5FI7A 3HREA 2HDSA 4KZ9A 4Y0OA 4YFMA 3ITAA 1PW1A 4X56A 2VGJA 2OSUA 4Q8IA 5EECA 1KVLA 2ZC7A 1E3UA 4P87A 3HLWA 5BOHA 3WWXA 3LY3A 3AGEA 4DE0A 5CGWA 3QNCA 3AGFA 4K0WA 4Y0UA 4WEKA 5FI6A 3Q81A 4OPZA 1JWZA 2ZQ9A 1IYQA 4BD1A 4UHUA 1YLYA 5GLBA 3IHBA 3NDEA 2B5RA 3PTEA 5TGFA 3IXDA 4C6YA 4DF6A 3G30A 4E3OA 1LL5A 2OLVA 5F1GA 5A92A 5GHYA 5A90A 4DRTA 1L2SA 4WMCA 5IHVA 2EXAA 4CJNA 3IXHA 5EVIA 1PIOA 1EI5A 2PU2A 4Y7PA 2ZD8A 4ZBEA 4ZJ2A 3WRTA 3MFDA 1ERQA 1LI0A 4XUZA 4EBNA 4WZ5C 3UPPA 5M18A 2Q9MA 5I94A 4OOYA 4IEDA 3JYIA 4GNUA 2I72A 1TEMA 3O3VA 4LV2A 1JWPA 1NYMA 4FH2A 3VP4A 4JF4A 5KZHA 2ZC3B 3VFFA 4H8RA 4JXSA 5E2FA 4U3TA 5FAQA 4PM7A 3UE1A 1ALQA 4MNRA 3NC8A 4JF6A 2XR0A 4OONA 3C7VA 4U0TA 3N6IA 4JF5A 1TDGA 2ZC4B 3HLFA 2HDRA 2Z2LB 4OLGA 3S1YA 3UE3A 3WS1A 2J7VA 2UWXA 1PWGA 3CG5A 4OP8A 5U47A 4EWFA 4X68A 1GHPA 4OPRA 3Q82A 4E3JA 3WS0A 1YLWA 3V50A 3CZDA 3C7UA 1SCWA 5FI2A 4BQMA 1RGZA 2A49A 4L0LA 4EUZA 1XGIA 1BLSA 1VQQA 2IWDA 3HL9A 4N9LA 4NETA 4GDNA 4QU3A 4ZJ1A 4B4XA 1HTZA 5M1AA 4KQQA 4EQIA 1ES5A 1NRFA 1JTDA 5G18A 4BL2A 2ZLYA 3A3EA 5CXWA 3WRZA 3IXGA 3ZHHA 3WS5A 3CJMA 3IF5A 1I5QA 4R23A 1XX2A 2PBYA 3M6HA 5DTKA 1YMXA 1WE4A 1ESIA 3FKWA 1E3UD 3HLEA 4GDBA 1K55C 4MEZA 3DWKA 2V1ZA 3IXBA 4R0QA 1L0EA 1XPBA 2H10A 3HUMA 4P0MA 1ZKJA 5AQ9A 4BLMA 3O86A 1G68A 4N92A 4E3IA 3IHAA 5FATA 2QMIA 3Q07A 3OZHA 2XGNA 3HLDA 4UA9A 4R4RA 3UN7A 4LV0A 4MLLA 1PZPA 5CHMA 4WYYA 2HP9A 3O87A 1M40A 3UO9A 3NCKA 4RYEA 1KGGA 4MBFA 2EX9A 4WMCD 1PI4A 4PM6A 4KG6A 5EVID 3IF6B 1BLCA 2ZC6B 1FCOA 3NI9A 2XD1A 3S4XA 4DE2A 4EBLA 5EPHA 1K56D 2WKEA 1NY0A 2CC1A 3MKFA 5GL9A 2XFTA 2RCXA 4KZ7A 2EX6A 5EOOA 5GHZA 3B3XA 4PPRA 3N8SA 3BFFA 3VMAA 1DJCA 1ZC2A 2H0YA 5D3OA 1MBLA 3V3RA 1YLJA 1CI8A 3DWZA 4E6XA 1YLZA 4FCFA 3ZCZA 2C6WB 1XKZA 2ZQDA 3UPNA 2J9OA 3HVFA 1K57C 1LL9A 3M2KA 1NJ4A 1NXYA 3IWOA 5DVAA 4WZ5A 5E2HA 1YLPA 2WZZA 3TOIA 3OC2A 4KZ5A 1BUEA 2XK1A 4JLFA 4HBTA 5GLAA 1BULA 1SKFA 4M3KA 3BEBA 5CTMA 3GMWA 1EWZA 3P98A 4OQGA 2H0TA 3N4IA 2WYXA 3IF6C 1JVJA 1KGFA 1IELA 2ZM0A 3ZNTA 5FASA 3W8KA 3LY4A 5AQAA 2JE5A 3CMZA 3PAGA 3LO7A 1K38A 3VP1A 4U0XA 1DJBA 5FQ9A 1RP5A 1C3BA 4KZ3A 1NZUA 2J8YA 3MXRA 2EFXA 4UA6A 1K4FA 1PWDA 2Z2MB 3GRJA 3IH9A 1ES4A 5CRFA 1GHMA 1K54A 3ZNYA 1S6RA 4OOMA 3VOZA 4OLDA 3BLMA 2XQZA 5HFOA 2Q9NA 5CTNA 2RL3A 3V39A 5FQIA 4PM9A 3SOIA 4R1GA 5L2FA 1K4EA 4IBXA 1O7EA 1XGJA 1XP4A 5DF8A 3VSKA 4HBUA 1GA9A 1GA0A 4S2NC 1ESUA 3Q7VA 4LV3A 4S2KA 5E2GA 5EE8A 3MZFA 5AQ7A 1IYOA 3IT9A 5HAPA 3OPRA 1K56A 5AQBA 4ZJ3A 1SHVA 4RX2A 2JCHA 4WBGA 2XD5A 3C4PA 3G2YA 1KE4A 4CPKA 5TR7A 4N1XA 1KVMA 3PBRA 2WADA 5FA7A 3RXWA 4DE1A 3O88A 2ZM2A 5EVLA 3TG9A 4PMAA 4P85A 3MZEA 3SS4A 2XF3A 3PBQA 4R3BA 3RJUA 4BENA 1ZG6A 1RGYA 1Q2PA 3ZG7B 3UNWA 3G2ZA 2WGWA 2GDNA 3GR2A 4WELA 4E6WA 5EUAA 2EXBA 4KG2A 3SS5A 3QHYA 5F1FA 2Y4AA 1WYCA 4QB8A 4GOGA 3UDXA 1PZOA 1E4DA 2Y59A 3Q1FA 4R4SA 5HAIA 2HP6A 3FZCA 4K91A 5DTSA 4C3QA 1BTLA 2X02A 4B4ZA 2Y2LA 3HLCA 1FCNA 2WAEA 3ITBA 2FFFB 5KMWA 1XA1A 5EVIB 3VP2A 1L0FA 5HX9A 1K57A 4X6TA 4X53A 2Y2MA 3IH8A 4XXRA 1I2SA 5GLDA 3MXSA 1LLBA 1M6KA 3GVBA 4BL3A 5FAPA 5FAOA 4FH4A 3I7JA 5CGXA 1KDWA 2IWCA 2Y55A 3P09A 2ZC5B 3W4QA 1GCEA 2P9VA 4OVDA 1NYYA 2Y2PA 4F94A 2JBFA 5DF9A 4ZDXA 3G35A 3M2JA 1FOFA 3GSGA 1G6AA 1DJAA 2C5WB 4RVAA 3UDFA 2R9XA 2WGWB 2JC7A 3ZG0A 2V2FF 5HW3A 4OPYA 1IYSA 1JTGA 2BG1A 4XUXA 5EVIC 2Y2QA 4OQ0A 3DTMA 2XH9A 2H5SA 3FYZA 3LCEA 1BT5A 2E8IA 3RXXA 5FQKA 4KZ8A 4QHCA 1MWSA 2EFUA 3OCLA 3M6BA 4DDYA 1S0WA 3ZG5A 3BLSA 1FR6A 5FDHA 4KQRA 1W8YA 2OLUA 4LV1A 5F82A 1MWUA 2WGIA 3BFEA 3VFHA 1QMEA 5EOEA 1LI9A 3SH9A 4JXWA 4S2LA 4S2MA 2P74A
chains in the Genus database with same CATH superfamily
2G7UA 5DJTA 5KSHA 1IKIA 3MF0A 2PD7A 1P9RA 4QY5A 2VGLS 3R4KA 3EQUA 1YMSA 1KOUA 5EVEA 1F98A 4HJ3A 3UB7A 4GB7A 1XJ3A 3Q7ZA 5HAQA 4ARZA 1W8QA 3S7OA 1Y28A 3KYQA 3ZQ5A 4LPZA 5J8XA 1Z6FA 3EGXC 2VJWA 1Q2QA 4NXEA 3A3IA 3EGDC 1K6RA 1SKOA 2Y8HA 4Z9QA 2OV5A 2UV0E 2VGKA 1LHYA 4X69A 4OOLA 3G4PA 4S2IA 4II7A 3P01A 1PWCA 1ERMA 4MMNA 3F1OA 4X55A 3HUOA 4EESA 3BM6A 3LIDA 3S22A 4YINA 1OPXA 4CLCB 3LEZA 3ISGA 2Y2GA 5CECA 2ZM8A 3HUNA 4L9FA 3DTIA 5JYPA 4LLOB 1K54C 1IKGA 1NZOA 5DJUA 4HJ4A 4BD0A 1FR1A 4KQOA 1TDLA 2XSSA 2ZQAA 3QP8A 5EFWA 4QWOA 3MSHA 4C75A 2WAFA 1N4OA 2XROA 2JKTI 2E8JA 3HBRA 4FSFA 4PKYA 3KYZA 2IWBA 2OWJA 2PU4A 3CITA 1YM1A 4P6BA 4UA7A 5DF7A 5CHUA 4O01A 4KQDA 3K3DA 3SZTA 2EA9A 1VETB 3OLOA 2AVXA 3C5AA 1TVFA 2W27A 4EXOA 4ZAMA 1HD8A 1SDNA 3N7WA 4NXBA 1MPLA 3FKVA 3T4TA 4JGQA 1UWNX 2J3WA 4KENB 1S66L 4EU0A 3MJQA 4GD6A 4JXGA 1CEGA 2XFSA 3T4OA 3OPPA 1IOUA 3E2LA 3HREA 4Y0OA 4G3WA 4DJ3A 2VGJA 2VA0A 5EECA 4P87A 5BOHA 3QNCA 4K0WA 4O0PA 4WEKA 1P9WA 3Q81A 2PD8A 2Q0OA 2ZQ9A 4I38A 4UHUA 1YLYA 3PTEA 2B5RA 3R7WB 4C6YA 3LFVA 1PIOA 4Y7PA 3MFDA 1ERQA 2V1AA 2Q9MA 1S1YA 4IEDA 2I72A 3T4LA 3IX3A 4JXSA 1ALQA 3NC8A 3N6IA 4JF5A 2ZC4B 3WS1A 2HDRA 4I5SA 3CG5A 3T4SA 2O9AA 1GSXA 3T50A 4E3JA 3T1SA 4Q0JA 1YLWA 2ZL1B 3CZDA 4L0LA 2Z6CA 3T1XA 2KX6A 1XGIA 3IS2A 1VQQA 3LEQA 4NETA 2J3TC 1ES5A 5CXWA 4CLCC 3BWLA 3IF5A 4GS9B 4R23A 3M6HA 1WE4A 3L7HA 3GECA 3PR6A 4MEZA 4NG2A 3HUMA 4E3IA 3OOVA 5TJJA 2QMIA 3LYXA 3HLDA 3V67A 3SW1A 1PI4A 4WF0A 3H82B 2R78A 2ZC6B 4EBLA 5EPHA 5C5KA 1NY0A 5TBMA 2CC1A 3JPUA 5GL9A 2RCXA 5EOOA 1N9OA 3BFFA 1DJCA 1ACFA 3UB5P 2C6WB 1XKZA 3HJKA 3IWOA 5E2HA 1YLPA 3TOIA 1XJ6A 3JVVA 5HDSA 1BULA 4LRXC 2V0WA 3RFBA 5AJGA 3IF6C 1JVJA 1KGFA 1IELA 5FASA 3LY4A 5AQAA 3PAGA 3LO7A 3VP1A 4U0XA 5FQ9A 3UB9A 1RP5A 1C3BA 1NZUA 2J8YA 2M7UA 3DTEA 1PRQA 5EM1A 2W3DA 1G5UA 5CTNA 3FPVA 4PM9A 3SOIA 5L2FA 1O7EA 3F1PA 5CX7A 4S2NC 1ESUA 3Q7VA 2JN7A 1VEUA 3MZFA 5AQ7A 5HAPA 4ZJ3A 3BY9A 5HD3A 2XD5A 4LRZE 3PBRA 5EVLA 3TG9A 4PMAA 3MFXA 2XF3A 4R3BA 1DRMA 1RGYA 2P7JA 3ZG7B 3UNWA 3G2ZA 3P7NA 2WGWA 2GDNA 3GR2A 3E4QA 3C30A 5EUAA 2Y4AA 4QB8A 1E4DA 4X1MA 2HP6A 5J3WA 2X02A 3HLCA 1D1JA 5KMWA 3KSGA 3LUQA 2L4RA 4X6TA 2HF6A 4MN5A 1LLBA 4BL3A 3GVBA 5FAOA 4FH4A 3I7JA 4X25A 2Y55A 3P09A 2ZC5B 4OVDA 2Y2PA 5DF9A 4RVAA 1LL8A 1JTGA 2BG1A 5EVIC 3E98A 2VV8A 2H5SA 3FYZA 2VV6A 5FQKA 1MWSA 3OCLA 2QYBA 3UMDA 4KQRA 3RH8B 3TRCA 1LI9A 4S2LA 3IBRA 2P74A 4BJPA 3OPHA 4GW9A 2Y2HA 3BFGA 1FQGA 3BRMA 3UY6A 3EWKA 2QHKA 3MQ0A 3PAEA 4LCMA 1FSYA 1W79A 4K0XA 3ZVWA 3ZGAB 3N8LA 4E3KA 5A91A 1QMFA 2XA7M 1KE0A 1I2WA 1O07A 2MJ6A 2XDMA 1HVBA 4WLAA 3GQZA 1GHIA 4HY8A 2QZ6A 3PBNA 3ZG9B 4UQIM 4Y0TA 1PFLA 1DP8A 1ONHA 3DW0A 1RCJA 3A3DA 2O9CA 3C4OA 5GHXA 4HEFA 2G2WA 3FG8A 4DN0A 2FFYA 1YT4A 1FIKA 1OJGA 3OCNA 1TF1A 2VGLM 3SS3A 4ARZB 3UE6A 3NY4A 2HP5A 4WM9A 5CHJA 5F69A 1OMEA 1OTBA 2Y91A 3HLBA 2FH5A 3IWIA 4L9EA 3NOTC 1E25A 4WUJA 4I3IA 4NXFA 4O7DA 4S2PA 4S2JA 1YLTA 3QP6A 2WKHA 3LI9A 2WKIA 3A3FA 4DMZA 3D3OA 1P0ZA 1BYWA 4Q0HA 5JYOA 3D72A 3W4PA 2A24B 1BZAA 1JWVA 3IWQA 4I3AA 5DKKA 3MZDA 4RX3A 3G32A 1N9LA 2IA2A 1V9YA 3ZG8B 2ZMAA 3F1NA 4UQIS 3LICA 2QJ5A 3AGDA 1DY6A 3UE0A 1KE3A 5CGSA 4XT2B 2W3HA 5KSCA 3V5MA 2CMNA 2Y2NA 3O5YA 5FQMA 2W3EA 3PBOA 3EOIA 3ICYA 1BLPA 1YKDA 2R9WA 1V9ZA 1H8ZA 2WK0A 5AVFA 3UN7A 2J9PA 4QY6A 5TFQA 1NWZA 2HDUA 4E3NA 1PW8A 4OQHA 4HESA 1H8YA 2WKQA 4OH0A 4R3JA 4IVKA 5EM0A 4A5RA 5HPFA 2Z6DA 2QKPA 5DFXA 1MWRA 2YKHA 5IS1A 5FI7A 4YFMA 3NHQA 2OSUA 4CLCE 1E3UA 3LY3A 3KO6A 4H6JB 3AGFA 4Y0UA 1T19A 3B33A 4OPZA 5GLBA 3IHBA 3NDEA 1LSWA 3G30A 4E3OA 1LL5A 2OLVA 5GHYA 1L2SA 5IHVA 4GHIB 4CJNA 2PU2A 2ZD8A 4ZBEA 4ZJ2A 3UB8A 2V9AA 3IX4A 4XUZA 4EBNA 4WZ5C 4LV2A 1JWPA 2ZC3B 1A0KA 5FAQA 3UE1A 4MNRA 1TDGA 3S1YA 2UWXA 3E4PA 1PWGA 4OP8A 2KLIA 3WS0A 3QP2A 5A8BA 3LGOA 3V50A 1SCWA 2H28A 1JNUA 4BQMA 3HL9A 3BQ8A 4N9LA 2K7SA 4GDNA 4QU3A 4ZJ1A 1HTZA 4EEPA 4I3JA 4EQIA 1JTDA 2ZLYA 2NUPC 1OTAA 3WS5A 3MXQA 5DTKA 1YMXA 3HLEA 2VV7A 4GDBA 2V1ZA 1L0EA 1XPBA 1ZKJA 1SZVA 3G6OA 4UA9A 4R4RA 1CQAA 4MLLA 4WYYA 4Y5FA 5HSQA 4RYEA 3IS2B 4WMCD 2HJ9C 4KG6A 5EVID 1Y4OA 3IF6B 1BLCA 1H8MA 1FCOA 3K2NA 4DE2A 3MKFA 2WKEA 2EWVA 2XFTA 3VV4A 4LRYC 3CAXA 1Z09A 2H0YA 5J7EA 3V3RA 3DWZA 1YLZA 4FCFA 2ZQDA 3LR0A 2J9OA 3HJIA 1LL9A 2P08A 2W3GA 5AVEA 5LBRA 3M2KA 3S7PA 1NXYA 2WZZA 3OC2A 4KZ5A 1BUEA 5IT5A 3U2AA 5GLAA 4YOFA 4M3KA 4GLQA 2WYXA 2ZM0A 3ZNTA 3W8KA 3CMZA 1L3LA 1K38A 3KSIA 4KZ3A 3MXRA 2EFXA 1CJFA 4K08A 4UA6A 1PWDA 3GRJA 3IH9A 1ES4A 1S6RA 3VOZA 5HFOA 2RL3A 3V39A 5FQIA 4Y17A 1XGJA 1XP4A 3VSKA 1ZHHB 4CLCA 3OPRA 5AQBA 1SHVA 2PBDP 2JCHA 4WBGA 3C4PA 1H0MA 1KE4A 2B02A 4N1XA 1KVMA 5FDSA 2WADA 4DE1A 3T4QA 2ZM2A 2W1TB 4P85A 4BENA 1ZG6A 1Q2PA 4E6WA 2EXBA 4MN7A 3QHYA 4R4SA 4K91A 3CUEA 1BTLA 1FCNA 2FFFB 3T12B 5EVIB 3VP2A 2QJ7A 4MN6A 2L0WA 4XXRA 3MXSA 1VETA 2O99A 5FAPA 1OTEA 2IWCA 1GCEA 2P9VA 4F94A 1T18A 1TD5A 5FEGA 1G6AA 1DJAA 2C5WB 2R9XA 2WGWB 3CPTB 2V2FF 1IYSA 4XUXA 2Y2QA 3DTMA 3TJZC 2HZ5A 3LR4A 1BT5A 2E8IA 3RXXA 4QHCA 2V0UA 5HPIA 2EFUA 4DDYA 3IX8A 1W8YA 3VFHA 2K31A 5EOEA 4HNBA 4FTXA 3H7WB 3SH9A 4S2MA 1TS8A 4L9GA 3HCYA 1UGUA 3VSLA 3BECA 3SH7A 4JBFA 3MBZA 1MKIA 3MMHA 4DXCA 1S67L 1EROA 4KZBA 1P97A 4UAAA 2HPBA 3DTKA 4KZ4A 3T4KA 4JGRA 3OBFA 5L09A 3R7WA 5F68A 2JKRM 1N9BA 3MS6A 3PBTA 4KZAA 3CWFA 3FV7A 4O8GA 1F2KA 2XLNA 5HD5A 4B88A 4DDSA 3VE4A 5CERA 1TS0A 2DCFA 3IBJA 1VM1A 2Y2JA 4DE3A 5J4EA 4OKPA 1XA7A 4PKYG 5F6AA 1IEMA 2KDKA 2V8FA 4IUKA 3A3JA 2ZJ9A 2X71A 3GTCA 2W0NA 3G34A 4NK3A 4WZ4A 2JHEA 3EEAA 1K55A 3NIAA 4BBTA 3L9KA 2ZL1A 4OPQA 5DTTA 5HL1A 4GJ4A 2Y2KA 4HI4A 3U4LP 4DKIA 4EV4A 4GKUA 1H5XA 1STZA 4F3LB 1AXBA 1DP9A 4GS9A 4HH3A 2HDQA 4IVIA 3ZVTA 1MY8A 2G2UA 1GSWA 5G4YA 4E3LA 1UWPX 4QJGA 5GLCA 1CK3A 1YAXA 1Y54A 3EQVA 5CEDA 4GN2A 2J80A 1W5DA 3H82A 1KDSA 2W1RA 4RQ9A 5FQJA 3RTYA 1XFQA 2Y2IA 3OPLA 5DKLA 1ONGA 4GD8A 3E2KA 5M19A 3UPOA 2BTFP 3GV9A 1XJ2A 5HDCA 3V3SA 3D4FA 3HLGA 2QPNA 3IQAA 4M4XA 3MKEA 4D2OA 4IBRA 4PAUA 1AWIA 3QNBA 1OT6A 4LCLA 3NBLA 3LIBA 1SDEA 2WGVA 2V20A 4FD8A 3VP3A 1YQSA 2WUQA 2ZQCA 2DNSA 4BBUA 3W2ZA 3K3CA 3NOPC 2YKFA 4N9KA 2ZBBA 4QD4A 3BJNA 5HWVA 4HHDA 2HGVA 4AFIA 4PM5A 2ZQ7A 4JGOA 5FSRA 4BWIA 1ODVA 1GSVA 1HLUP 2EX2A 4Z1WA 2ZOIA 2Y2OA 4HP9A 5FQQA 2FZ0A 2X01A 5E43A 4LENA 1L0DA 1F5MA 2VKSA 3E4OA 2HDSA 4I39A 5G4ZA 3ITAA 1PW1A 4X56A 4Q8IA 1KVLA 2ZC7A 3WWXA 1TS7A 4DE0A 5CGWA 2W3FA 5FI6A 1JWZA 1IYQA 1OJ5A 2O0YA 2Y79A 3IXDA 4DRTA 3IXHA 1EI5A 3WRTA 4WL9A 5M18A 5I94A 4OOYA 4GNUA 4LGWA 5FL3A 3VP4A 5KZHA 3VFFA 4R3AA 4PM7A 1X0OA 4JF6A 4U0TA 3C7VA 3HLFA 4OLGA 4Q0IA 4UEYA 1GHPA 1SKOB 3Q82A 3C7UA 5FI2A 2LB9A 1BLSA 2IWDA 3LIAA 4FUWA 3F1OB 2GX5A 4X1LA 3IXGA 2PBYA 5L10A 3DWKA 3TE8A 2H10A 4P0MA 1G28A 5AQ9A 4BLMA 3O86A 1G68A 4N92A 3IHAA 3Q07A 3OZHA 4LV0A 1PZPA 2HP9A 3O87A 3NCKA 4MBFA 4NKPA 3BQAA 2VEAA 3NI9A 3UB6A 3A0SA 4KZ7A 2EX6A 5GHZA 4PPRA 4B9OA 1ZC2A 2V8CA 5D3OA 1MBLA 1CI8A 3ZCZA 2DMWA 3HVFA 1K57C 4QPRA 2PR5A 2PHYA 1NJ4A 4WZ5A 1H3QA 4EETB 2XK1A 4IUHA 4HBTA 2OWHA 1FILA 4Y13A 1LSXA 1EWZA 3TW8A 4OQGA 2H0TA 3N4IA 5HDDA 4D60A 3KSHA 1DJBA 5I5LA 2O9BA 3E0YA 2Z2MB 2GJ3A 2LB5A 1D7EA 5CRFA 3ZNYA 1GHMA 1K54A 2XQZA 2Q9NA 4ESPA 1LT0A 3CLOA 4R1GA 1K4EA 3T1RA 2A2LA 4GCZA 5DF8A 3BW6A 2PYRA 2VX8A 3C2WA 5E2GA 4LV3A 4R6LA 3IT9A 1K56A 4RX2A 4ME4A 3G2YA 4CPKA 5FA7A 3RXWA 3O88A 4P6ZS 2D02A 3MZEA 3SS4A 2M1CA 2A24A 3QP1A 5HWTA 4WELA 4KG2A 3SS5A 3C8CA 1PZOA 2OAQ1 5HAIA 4C3QA 2Y2LA 2WAEA 3ITBA 5MC7A 1XA1A 5L8MA 2JKRI 4XT2A 5HX9A 1OTDA 2Y2MA 3IH8A 5GLDA 1M6KA 5CGXA 1KDWA 1NYYA 3DAVA 2JBFA 4ZDXA 3G35A 3M2JA 1FOFA 5IU1A 3GSGA 3LR3A 1YSQA 3UDFA 3ZG0A 5HW3A 2ACGA 3JVUA 1CF0A 2B95A 3LIFA 2XH9A 4KZ8A 3B47A 3ZG5A 1FR6A 4LV1A 1MWUA 2WGIA 4IJGA 4JXWA 4HH2A 2XRNA 2P9VB 2B18A 1K6SA 4ZTKA 4HOIA 4NXGA 3BYDA 4HJ6A 4JKTA 4H6JA 1W63M 4KG5A 4CQHA 2GNXA 5HARA 3ZYTA 3MQQA 1MWTA 1S1ZA 1U60A 4E3MA 1WA9A 4EBPA 3W4OA 4GHIA 5K5BA 1ES2A 3G31A 5TBMB 4GZBA 2VLGA 3BFCA 2XEPA 4WEJA 3PBSA 1T1BA 1CI9A 3S7NA 4JXVA 1XXMA 1PNEA 4ETXA 1FCMA 1S4RA 3SH8A 2HV1A 4PM8A 1IYPA 4MDZA 2ZMVA 1HZOA 1G6OA 4MBHA 1BSGA 2ZMFA 4OQIA 5CEBA 3FC7A 3N8RA 3C38A 4LFUA 2PRFA 5EV0A 4MCWA 4ZRRA 3ZDJA 2A3UA 3LIEA 1L0GA 1MZUA 1CEFA 5E2EA 3QP4A 1MXOA 1KGEA 3F1PB 2PAVP 2OOLA 3Q7VB 1XJ4A 1VEUB 1BLHA 4EUVA 3VE3A 4HQAA 1J9MA 3T4JA 1W63Q 2ZQ8A 3IF6A 4JPMA 5F83A 5A93A 2PYPA 2KOIA 5HWWA 3TSGA 2L1MA 4RA7A 3PXPA 3BFDA 1PI5A 1WYBA 3KSFA 3LI8A 2EX8A 3MR0A 1ZG4A 4S2OA 4R38A 4B93A 1FSWA 3NDGA 1ES3A 4KZ6A 2WZXA 3WS4A 4S2NA 2WKRA 1K25A 2WKPA 4MBKA 3VP0A 5FEFA 5DFYA 1VB6A 1EW0A 4YWZA 3CUEC 1W7FA 4BBVA 1S4SA 1XFNA 3WS2A 5KIZA 1F9IA 3H9WA 4DXBA 1T1CA 3FWLA 4ID4A 1PYYA 3UDIA 3VOYA 2NUTC 2DRWA 1MC0A 1LSVA 1IFQA 2P04A 5F5YA 2PDRA 3ZFZA 4YNRA 4EW7A 4N1HA 4OP5A 3NOUC 2BLSA 1T1AA 4KZ9A 4IHQA 4E04A 4Y15A 2W1TA 3HLWA 2JKTM 3AGEA 3QP5A 1NLZA 1MKMA 4G3VA 3PYPA 4BD1A 5TGFA 4DF6A 5F1GA 5A92A 5A90A 4WMCA 3NJAA 2EXAA 4HIAA 2D01A 5EVIA 3UMEA 4R70A 1LI0A 3UPPA 3NULA 3JYIA 1NLYA 3VOLA 1TEMA 3O3VA 1NYMA 4FH2A 4JF4A 4H8RA 3D9YA 2I9VA 4U3TA 5E2FA 3B42A 2XR0A 4OONA 2Z2LB 3UE3A 3CPTA 2J7VA 5U47A 4EWFA 4X68A 3CI6A 4OPRA 1OT9A 5HL6A 1YSPA 4HP4A 1RGZA 2A49A 4EUZA 4B4XA 3A0VA 3KX0X 5M1AA 4KQQA 1NRFA 4BL2A 3KYEA 5G18A 3LR5A 3A3EA 3GDIA 3WRZA 3H7WA 3ZHHA 3CJMA 1I5QA 1XX2A 3A0RA 3FKWA 1ESIA 1E3UD 1K55C 3IXBA 4R0QA 5FATA 2XGNA 2PT7A 1K0KA 4JGPA 5CHMA 1M40A 3UO9A 1KGGA 2EX9A 4BMWA 4PM6A 3S4XA 1D06A 2JKGA 2XD1A 2PR6A 1K56D 3CHWP 1NRJA 3B3XA 3N8SA 3VMAA 1ZTUA 1YLJA 4E6XA 3FPWA 3UPNA 1YPRA 5DVAA 3F1NB 2QWSA 4PHTA 3T1QB 4JLFA 1SKFA 3BEBA 5CTMA 3GMWA 2VK3A 3P98A 4KUKA 4EERA 2JE5A 1K4FA 4OOMA 4F3LA 5HZHA 4G3KA 4OLDA 3BLMA 1VHMA 3PHYA 4EQ1A 3EEHA 3S7QA 4IBXA 3ULFA 4HBUA 1GA9A 1GA0A 4S2KA 5EE8A 1IYOA 3BY8A 4KUOA 5TR7A 1J3WA 3PBQA 3RJUA 5L07A 3DBAA 2INWA 1OTIA 5F1FA 1WYCA 3UDXA 4GOGA 4NEED 2Y59A 3Q1FA 1N9NA 3FZCA 5DTSA 4ETZA 2ZOHA 2OAP1 4B4ZA 4WN5A 1TS6A 2HJEA 2VZWA 4Y2FA 1L0FA 1K57A 4X53A 4DJ2A 1I2SA 3NECA 3W4QA 2JKFA 1DP6A 2GZAA 2BASA 2XA7S 2M7VA 2JC7A 2J3TD 4OPYA 4P6ZM 4EEUA 4OQ0A 2K2NA 3MQOA 4FOFA 3LCEA 4CLCD 2EWWA 3M6BA 1S0WA 3BLSA 5FDHA 2OLUA 2V1BA 5F82A 3BFEA 1QMEA 4Y3IA
chains in the Genus database with same CATH topology
3VSLA 4BJPA 2P9VB 3BECA 3OPHA 2Y2HA 3BFGA 4JBFA 1K6SA 4ZTKA 3SH7A 3MBZA 1FQGA 3BRMA 1MKIA 3UY6A 5KSHA 3BYDA 4DXCA 1IKIA 4JKTA 1EROA 4KZBA 4KG5A 3PAEA 4UAAA 5HARA 2HPBA 4KZ4A 4LCMA 4QY5A 1FSYA 1W79A 4K0XA 3ZVWA 3EQUA 1MWTA 3ZGAB 3N8LA 1YMSA 4E3KA 5A91A 1QMFA 1N9BA 3PBTA 1U60A 4KZAA 4E3MA 4EBPA 3FV7A 3W4OA 1KE0A 2XLNA 4GB7A 1ES2A 4B88A 3G31A 4DDSA 1I2WA 4GZBA 3Q7ZA 1O07A 5HAQA 2XDMA 1W8QA 5CERA 3BFCA 1HVBA 2XEPA 4WEJA 3PBSA 3GQZA 1GHIA 2DCFA 1CI9A 1VM1A 2QZ6A 2Y2JA 3PBNA 4DE3A 4OKPA 3ZG9B 5J8XA 1Z6FA 4Y0TA 1XA7A 4JXVA 1XXMA 1ONHA 1Q2QA 1FCMA 1IEMA 3SH8A 3DW0A 3A3JA 2ZJ9A 1RCJA 2X71A 3GTCA 3A3IA 4PM8A 1IYPA 1K6RA 3A3DA 3G34A 1HZOA 3C4OA 5GHXA 4HEFA 4NK3A 2G2WA 4WZ4A 3NIAA 1K55A 4Z9QA 4MBHA 1BSGA 2FFYA 1YT4A 2OV5A 4OQIA 2VGKA 4OPQA 5DTTA 5CEBA 3N8RA 5HL1A 1LHYA 2Y2KA 4X69A 4OOLA 3G4PA 3OCNA 4S2IA 3ZDJA 1PWCA 4DKIA 4EV4A 1ERMA 2A3UA 4GKUA 1H5XA 3SS3A 3NY4A 4X55A 3HUOA 2HP5A 4WM9A 5CHJA 1L0GA 1OMEA 1CEFA 1AXBA 2Y91A 5E2EA 3HLBA 1MXOA 3BM6A 1KGEA 3IWIA 2HDQA 3S22A 4YINA 4IVIA 3Q7VB 1E25A 3ZVTA 1MY8A 3LEZA 2G2UA 3ISGA 2Y2GA 4O7DA 4S2PA 2ZM8A 3HUNA 4E3LA 5CECA 4S2JA 1YLTA 4QJGA 1BLHA 5GLCA 1CK3A 2WKHA 5JYPA 1Y54A 2WKIA 1K54C 3EQVA 1IKGA 5CEDA 4GN2A 1NZOA 3A3FA 4BD0A 5JYOA 1J9MA 1FR1A 3W4PA 4KQOA 1TDLA 1W5DA 2ZQ8A 1KDSA 3IF6A 4JPMA 5F83A 5FQJA 1BZAA 5A93A 1JWVA 2ZQAA 3IWQA 2Y2IA 3OPLA 1ONGA 4GD8A 3E2KA 5M19A 3UPOA 4C75A 2WAFA 3TSGA 1N4OA 3MZDA 4RX3A 3G32A 4RA7A 3BFDA 3GV9A 3HBRA 1PI5A 1WYBA 4FSFA 3V3SA 3D4FA 3HLGA 2QPNA 3IQAA 3ZG8B 2ZMAA 2EX8A 2IWBA 1ZG4A 3MKEA 4S2OA 4IBRA 2PU4A 4D2OA 5DF7A 1YM1A 4P6BA 3AGDA 4UA7A 1DY6A 5CHUA 3UE0A 1KE3A 1FSWA 5CGSA 5KSCA 3NDGA 3QNBA 1ES3A 3V5MA 4LCLA 4KZ6A 3NBLA 2WZXA 1SDEA 2Y2NA 3WS4A 2WGVA 5FQMA 4S2NA 2V20A 4FD8A 3VP3A 1YQSA 1K25A 3PBOA 2WUQA 2ZQCA 2DNSA 4MBKA 3VP0A 1BLPA 2R9WA 3C5AA 1TVFA 1H8ZA 2WK0A 4ZAMA 1HD8A 4N9KA 1SDNA 2J9PA 3N7WA 4QD4A 4QY6A 1W7FA 5TFQA 1MPLA 3FKVA 3WS2A 2HDUA 4PM5A 4E3NA 2ZQ7A 1PW8A 4OQHA 5FSRA 4HESA 1H8YA 4DXBA 4KENB 4OH0A 3FWLA 2EX2A 1PYYA 4ID4A 4IVKA 4R3JA 3UDIA 3VOYA 4A5RA 2DRWA 2Y2OA 5FQQA 4GD6A 4JXGA 1CEGA 3ZFZA 2XFSA 2X01A 5E43A 3OPPA 4LENA 1L0DA 1MWRA 4N1HA 4OP5A 3E2LA 2BLSA 5FI7A 3HREA 2HDSA 4KZ9A 4Y0OA 4YFMA 3ITAA 1PW1A 4X56A 2VGJA 2OSUA 4Q8IA 5EECA 1KVLA 2ZC7A 1E3UA 4P87A 3HLWA 5BOHA 3WWXA 3LY3A 3AGEA 4DE0A 5CGWA 3QNCA 3AGFA 4K0WA 4Y0UA 4WEKA 5FI6A 3Q81A 4OPZA 1JWZA 2ZQ9A 1IYQA 4BD1A 4UHUA 1YLYA 5GLBA 3IHBA 3NDEA 2B5RA 3PTEA 5TGFA 3IXDA 4C6YA 4DF6A 3G30A 4E3OA 1LL5A 2OLVA 5F1GA 5A92A 5GHYA 5A90A 4DRTA 1L2SA 4WMCA 5IHVA 2EXAA 4CJNA 3IXHA 5EVIA 1PIOA 1EI5A 2PU2A 4Y7PA 2ZD8A 4ZBEA 4ZJ2A 3WRTA 3MFDA 1ERQA 1LI0A 4XUZA 4EBNA 4WZ5C 3UPPA 5M18A 2Q9MA 5I94A 4OOYA 4IEDA 3JYIA 4GNUA 2I72A 1TEMA 3O3VA 4LV2A 1JWPA 1NYMA 4FH2A 3VP4A 4JF4A 5KZHA 2ZC3B 3VFFA 4H8RA 4JXSA 5E2FA 4U3TA 5FAQA 4PM7A 3UE1A 1ALQA 4MNRA 3NC8A 4JF6A 2XR0A 4OONA 3C7VA 4U0TA 3N6IA 4JF5A 1TDGA 2ZC4B 3HLFA 2HDRA 2Z2LB 4OLGA 3S1YA 3UE3A 3WS1A 2J7VA 2UWXA 1PWGA 3CG5A 4OP8A 5U47A 4EWFA 4X68A 1GHPA 4OPRA 3Q82A 4E3JA 3WS0A 1YLWA 3V50A 3CZDA 3C7UA 1SCWA 5FI2A 4BQMA 1RGZA 2A49A 4L0LA 4EUZA 1XGIA 1BLSA 1VQQA 2IWDA 3HL9A 4N9LA 4NETA 4GDNA 4QU3A 4ZJ1A 4B4XA 1HTZA 5M1AA 4KQQA 4EQIA 1ES5A 1NRFA 1JTDA 5G18A 4BL2A 2ZLYA 3A3EA 5CXWA 3WRZA 3IXGA 3ZHHA 3WS5A 3CJMA 3IF5A 1I5QA 4R23A 1XX2A 2PBYA 3M6HA 5DTKA 1YMXA 1WE4A 1ESIA 3FKWA 1E3UD 3HLEA 4GDBA 1K55C 4MEZA 3DWKA 2V1ZA 3IXBA 4R0QA 1L0EA 1XPBA 2H10A 3HUMA 4P0MA 1ZKJA 5AQ9A 4BLMA 3O86A 1G68A 4N92A 4E3IA 3IHAA 5FATA 2QMIA 3Q07A 3OZHA 2XGNA 3HLDA 4UA9A 4R4RA 3UN7A 4LV0A 4MLLA 1PZPA 5CHMA 4WYYA 2HP9A 3O87A 1M40A 3UO9A 3NCKA 4RYEA 1KGGA 4MBFA 2EX9A 4WMCD 1PI4A 4PM6A 4KG6A 5EVID 3IF6B 1BLCA 2ZC6B 1FCOA 3NI9A 2XD1A 3S4XA 4DE2A 4EBLA 5EPHA 1K56D 2WKEA 1NY0A 2CC1A 3MKFA 5GL9A 2XFTA 2RCXA 4KZ7A 2EX6A 5EOOA 5GHZA 3B3XA 4PPRA 3N8SA 3BFFA 3VMAA 1DJCA 1ZC2A 2H0YA 5D3OA 1MBLA 3V3RA 1YLJA 1CI8A 3DWZA 4E6XA 1YLZA 4FCFA 3ZCZA 2C6WB 1XKZA 2ZQDA 3UPNA 2J9OA 3HVFA 1K57C 1LL9A 3M2KA 1NJ4A 1NXYA 3IWOA 5DVAA 4WZ5A 5E2HA 1YLPA 2WZZA 3TOIA 3OC2A 4KZ5A 1BUEA 2XK1A 4JLFA 4HBTA 5GLAA 1BULA 1SKFA 4M3KA 3BEBA 5CTMA 3GMWA 1EWZA 3P98A 4OQGA 2H0TA 3N4IA 2WYXA 3IF6C 1JVJA 1KGFA 1IELA 2ZM0A 3ZNTA 5FASA 3W8KA 3LY4A 5AQAA 2JE5A 3CMZA 3PAGA 3LO7A 1K38A 3VP1A 4U0XA 1DJBA 5FQ9A 1RP5A 1C3BA 4KZ3A 1NZUA 2J8YA 3MXRA 2EFXA 4UA6A 1K4FA 1PWDA 2Z2MB 3GRJA 3IH9A 1ES4A 5CRFA 1GHMA 1K54A 3ZNYA 1S6RA 4OOMA 3VOZA 4OLDA 3BLMA 2XQZA 5HFOA 2Q9NA 5CTNA 2RL3A 3V39A 5FQIA 4PM9A 3SOIA 4R1GA 5L2FA 1K4EA 4IBXA 1O7EA 1XGJA 1XP4A 5DF8A 3VSKA 4HBUA 1GA9A 1GA0A 4S2NC 1ESUA 3Q7VA 4LV3A 4S2KA 5E2GA 5EE8A 3MZFA 5AQ7A 1IYOA 3IT9A 5HAPA 3OPRA 1K56A 5AQBA 4ZJ3A 1SHVA 4RX2A 2JCHA 4WBGA 2XD5A 3C4PA 3G2YA 1KE4A 4CPKA 5TR7A 4N1XA 1KVMA 3PBRA 2WADA 5FA7A 3RXWA 4DE1A 3O88A 2ZM2A 5EVLA 3TG9A 4PMAA 4P85A 3MZEA 3SS4A 2XF3A 3PBQA 4R3BA 3RJUA 4BENA 1ZG6A 1RGYA 1Q2PA 3ZG7B 3UNWA 3G2ZA 2WGWA 2GDNA 3GR2A 4WELA 4E6WA 5EUAA 2EXBA 4KG2A 3SS5A 3QHYA 5F1FA 2Y4AA 1WYCA 4QB8A 4GOGA 3UDXA 1PZOA 1E4DA 2Y59A 3Q1FA 4R4SA 5HAIA 2HP6A 3FZCA 4K91A 5DTSA 4C3QA 1BTLA 2X02A 4B4ZA 2Y2LA 3HLCA 1FCNA 2WAEA 3ITBA 2FFFB 5KMWA 1XA1A 5EVIB 3VP2A 1L0FA 5HX9A 1K57A 4X6TA 4X53A 2Y2MA 3IH8A 4XXRA 1I2SA 5GLDA 3MXSA 1LLBA 1M6KA 3GVBA 4BL3A 5FAPA 5FAOA 4FH4A 3I7JA 5CGXA 1KDWA 2IWCA 2Y55A 3P09A 2ZC5B 3W4QA 1GCEA 2P9VA 4OVDA 1NYYA 2Y2PA 4F94A 2JBFA 5DF9A 4ZDXA 3G35A 3M2JA 1FOFA 3GSGA 1G6AA 1DJAA 2C5WB 4RVAA 3UDFA 2R9XA 2WGWB 2JC7A 3ZG0A 2V2FF 5HW3A 4OPYA 1IYSA 1JTGA 2BG1A 4XUXA 5EVIC 2Y2QA 4OQ0A 3DTMA 2XH9A 2H5SA 3FYZA 3LCEA 1BT5A 2E8IA 3RXXA 5FQKA 4KZ8A 4QHCA 1MWSA 2EFUA 3OCLA 3M6BA 4DDYA 1S0WA 3ZG5A 3BLSA 1FR6A 5FDHA 4KQRA 1W8YA 2OLUA 4LV1A 5F82A 1MWUA 2WGIA 3BFEA 3VFHA 1QMEA 5EOEA 1LI9A 3SH9A 4JXWA 4S2LA 4S2MA 2P74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSL A;  4BJP A;  2P9V B;  3BEC A;  3OPH A;  2Y2H A;  3BFG A;  4JBF A;  1K6S A;  4ZTK A;  3SH7 A;  3MBZ A;  1FQG A;  3BRM A;  1MKI A;  3UY6 A;  5KSH A;  3BYD A;  4DXC A;  1IKI A;  4JKT A;  1ERO A;  4KZB A;  4KG5 A;  3PAE A;  4UAA A;  5HAR A;  2HPB A;  4KZ4 A;  4LCM A;  4QY5 A;  1FSY A;  1W79 A;  4K0X A;  3ZVW A;  3EQU A;  1MWT A;  3ZGA B;  3N8L A;  1YMS A;  4E3K A;  5A91 A;  1QMF A;  1N9B A;  3PBT A;  1U60 A;  4KZA A;  4E3M A;  4EBP A;  3FV7 A;  3W4O A;  1KE0 A;  2XLN A;  4GB7 A;  1ES2 A;  4B88 A;  3G31 A;  4DDS A;  1I2W A;  4GZB A;  3Q7Z A;  1O07 A;  5HAQ A;  2XDM A;  1W8Q A;  5CER A;  3BFC A;  1HVB A;  2XEP A;  4WEJ A;  3PBS A;  3GQZ A;  1GHI A;  2DCF A;  1CI9 A;  1VM1 A;  2QZ6 A;  2Y2J A;  3PBN A;  4DE3 A;  4OKP A;  3ZG9 B;  5J8X A;  1Z6F A;  4Y0T A;  1XA7 A;  4JXV A;  1XXM A;  1ONH A;  1Q2Q A;  1FCM A;  1IEM A;  3SH8 A;  3DW0 A;  3A3J A;  2ZJ9 A;  1RCJ A;  2X71 A;  3GTC A;  3A3I A;  4PM8 A;  1IYP A;  1K6R A;  3A3D A;  3G34 A;  1HZO A;  3C4O A;  5GHX A;  4HEF A;  4NK3 A;  2G2W A;  4WZ4 A;  3NIA A;  1K55 A;  4Z9Q A;  4MBH A;  1BSG A;  2FFY A;  1YT4 A;  2OV5 A;  4OQI A;  2VGK A;  4OPQ A;  5DTT A;  5CEB A;  3N8R A;  5HL1 A;  1LHY A;  2Y2K A;  4X69 A;  4OOL A;  3G4P A;  3OCN A;  4S2I A;  3ZDJ A;  1PWC A;  4DKI A;  4EV4 A;  1ERM A;  2A3U A;  4GKU A;  1H5X A;  3SS3 A;  3NY4 A;  4X55 A;  3HUO A;  2HP5 A;  4WM9 A;  5CHJ A;  1L0G A;  1OME A;  1CEF A;  1AXB A;  2Y91 A;  5E2E A;  3HLB A;  1MXO A;  3BM6 A;  1KGE A;  3IWI A;  2HDQ A;  3S22 A;  4YIN A;  4IVI A;  3Q7V B;  1E25 A;  3ZVT A;  1MY8 A;  3LEZ A;  2G2U A;  3ISG A;  2Y2G A;  4O7D A;  4S2P A;  2ZM8 A;  3HUN A;  4E3L A;  5CEC A;  4S2J A;  1YLT A;  4QJG A;  1BLH A;  5GLC A;  1CK3 A;  2WKH A;  5JYP A;  1Y54 A;  2WKI A;  1K54 C;  3EQV A;  1IKG A;  5CED A;  4GN2 A;  1NZO A;  3A3F A;  4BD0 A;  5JYO A;  1J9M A;  1FR1 A;  3W4P A;  4KQO A;  1TDL A;  1W5D A;  2ZQ8 A;  1KDS A;  3IF6 A;  4JPM A;  5F83 A;  5FQJ A;  1BZA A;  5A93 A;  1JWV A;  2ZQA A;  3IWQ A;  2Y2I A;  3OPL A;  1ONG A;  4GD8 A;  3E2K A;  5M19 A;  3UPO A;  4C75 A;  2WAF A;  3TSG A;  1N4O A;  3MZD A;  4RX3 A;  3G32 A;  4RA7 A;  3BFD A;  3GV9 A;  3HBR A;  1PI5 A;  1WYB A;  4FSF A;  3V3S A;  3D4F A;  3HLG A;  2QPN A;  3IQA A;  3ZG8 B;  2ZMA A;  2EX8 A;  2IWB A;  1ZG4 A;  3MKE A;  4S2O A;  4IBR A;  2PU4 A;  4D2O A;  5DF7 A;  1YM1 A;  4P6B A;  3AGD A;  4UA7 A;  1DY6 A;  5CHU A;  3UE0 A;  1KE3 A;  1FSW A;  5CGS A;  5KSC A;  3NDG A;  3QNB A;  1ES3 A;  3V5M A;  4LCL A;  4KZ6 A;  3NBL A;  2WZX A;  1SDE A;  2Y2N A;  3WS4 A;  2WGV A;  5FQM A;  4S2N A;  2V20 A;  4FD8 A;  3VP3 A;  1YQS A;  1K25 A;  3PBO A;  2WUQ A;  2ZQC A;  2DNS A;  4MBK A;  3VP0 A;  1BLP A;  2R9W A;  3C5A A;  1TVF A;  1H8Z A;  2WK0 A;  4ZAM A;  1HD8 A;  4N9K A;  1SDN A;  2J9P A;  3N7W A;  4QD4 A;  4QY6 A;  1W7F A;  5TFQ A;  1MPL A;  3FKV A;  3WS2 A;  2HDU A;  4PM5 A;  4E3N A;  2ZQ7 A;  1PW8 A;  4OQH A;  5FSR A;  4HES A;  1H8Y A;  4DXB A;  4KEN B;  4OH0 A;  3FWL A;  2EX2 A;  1PYY A;  4ID4 A;  4IVK A;  4R3J A;  3UDI A;  3VOY A;  4A5R A;  2DRW A;  2Y2O A;  5FQQ A;  4GD6 A;  4JXG A;  1CEG A;  3ZFZ A;  2XFS A;  2X01 A;  5E43 A;  3OPP A;  4LEN A;  1L0D A;  1MWR A;  4N1H A;  4OP5 A;  3E2L A;  2BLS A;  5FI7 A;  3HRE A;  2HDS A;  4KZ9 A;  4Y0O A;  4YFM A;  3ITA A;  1PW1 A;  4X56 A;  2VGJ A;  2OSU A;  4Q8I A;  5EEC A;  1KVL A;  2ZC7 A;  1E3U A;  4P87 A;  3HLW A;  5BOH A;  3WWX A;  3LY3 A;  3AGE A;  4DE0 A;  5CGW A;  3QNC A;  3AGF A;  4K0W A;  4Y0U A;  4WEK A;  5FI6 A;  3Q81 A;  4OPZ A;  1JWZ A;  2ZQ9 A;  1IYQ A;  4BD1 A;  4UHU A;  1YLY A;  5GLB A;  3IHB A;  3NDE A;  2B5R A;  3PTE A;  5TGF A;  3IXD A;  4C6Y A;  4DF6 A;  3G30 A;  4E3O A;  1LL5 A;  2OLV A;  5F1G A;  5A92 A;  5GHY A;  5A90 A;  4DRT A;  1L2S A;  4WMC A;  5IHV A;  2EXA A;  4CJN A;  3IXH A;  5EVI A;  1PIO A;  1EI5 A;  2PU2 A;  4Y7P A;  2ZD8 A;  4ZBE A;  4ZJ2 A;  3WRT A;  3MFD A;  1ERQ A;  1LI0 A;  4XUZ A;  4EBN A;  4WZ5 C;  3UPP A;  5M18 A;  2Q9M A;  5I94 A;  4OOY A;  4IED A;  3JYI A;  4GNU A;  2I72 A;  1TEM A;  3O3V A;  4LV2 A;  1JWP A;  1NYM A;  4FH2 A;  3VP4 A;  4JF4 A;  5KZH A;  2ZC3 B;  3VFF A;  4H8R A;  4JXS A;  5E2F A;  4U3T A;  5FAQ A;  4PM7 A;  3UE1 A;  1ALQ A;  4MNR A;  3NC8 A;  4JF6 A;  2XR0 A;  4OON A;  3C7V A;  4U0T A;  3N6I A;  4JF5 A;  1TDG A;  2ZC4 B;  3HLF A;  2HDR A;  2Z2L B;  4OLG A;  3S1Y A;  3UE3 A;  3WS1 A;  2J7V A;  2UWX A;  1PWG A;  3CG5 A;  4OP8 A;  5U47 A;  4EWF A;  4X68 A;  1GHP A;  4OPR A;  3Q82 A;  4E3J A;  3WS0 A;  1YLW A;  3V50 A;  3CZD A;  3C7U A;  1SCW A;  5FI2 A;  4BQM A;  1RGZ A;  2A49 A;  4L0L A;  4EUZ A;  1XGI A;  1BLS A;  1VQQ A;  2IWD A;  3HL9 A;  4N9L A;  4NET A;  4GDN A;  4QU3 A;  4ZJ1 A;  4B4X A;  1HTZ A;  5M1A A;  4KQQ A;  4EQI A;  1ES5 A;  1NRF A;  1JTD A;  5G18 A;  4BL2 A;  2ZLY A;  3A3E A;  5CXW A;  3WRZ A;  3IXG A;  3ZHH A;  3WS5 A;  3CJM A;  3IF5 A;  1I5Q A;  4R23 A;  1XX2 A;  2PBY A;  3M6H A;  5DTK A;  1YMX A;  1WE4 A;  1ESI A;  3FKW A;  1E3U D;  3HLE A;  4GDB A;  1K55 C;  4MEZ A;  3DWK A;  2V1Z A;  3IXB A;  4R0Q A;  1L0E A;  1XPB A;  2H10 A;  3HUM A;  4P0M A;  1ZKJ A;  5AQ9 A;  4BLM A;  3O86 A;  1G68 A;  4N92 A;  4E3I A;  3IHA A;  5FAT A;  2QMI A;  3Q07 A;  3OZH A;  2XGN A;  3HLD A;  4UA9 A;  4R4R A;  3UN7 A;  4LV0 A;  4MLL A;  1PZP A;  5CHM A;  4WYY A;  2HP9 A;  3O87 A;  1M40 A;  3UO9 A;  3NCK A;  4RYE A;  1KGG A;  4MBF A;  2EX9 A;  4WMC D;  1PI4 A;  4PM6 A;  4KG6 A;  5EVI D;  3IF6 B;  1BLC A;  2ZC6 B;  1FCO A;  3NI9 A;  2XD1 A;  3S4X A;  4DE2 A;  4EBL A;  5EPH A;  1K56 D;  2WKE A;  1NY0 A;  2CC1 A;  3MKF A;  5GL9 A;  2XFT A;  2RCX A;  4KZ7 A;  2EX6 A;  5EOO A;  5GHZ A;  3B3X A;  4PPR A;  3N8S A;  3BFF A;  3VMA A;  1DJC A;  1ZC2 A;  2H0Y A;  5D3O A;  1MBL A;  3V3R A;  1YLJ A;  1CI8 A;  3DWZ A;  4E6X A;  1YLZ A;  4FCF A;  3ZCZ A;  2C6W B;  1XKZ A;  2ZQD A;  3UPN A;  2J9O A;  3HVF A;  1K57 C;  1LL9 A;  3M2K A;  1NJ4 A;  1NXY A;  3IWO A;  5DVA A;  4WZ5 A;  5E2H A;  1YLP A;  2WZZ A;  3TOI A;  3OC2 A;  4KZ5 A;  1BUE A;  2XK1 A;  4JLF A;  4HBT A;  5GLA A;  1BUL A;  1SKF A;  4M3K A;  3BEB A;  5CTM A;  3GMW A;  1EWZ A;  3P98 A;  4OQG A;  2H0T A;  3N4I A;  2WYX A;  3IF6 C;  1JVJ A;  1KGF A;  1IEL A;  2ZM0 A;  3ZNT A;  5FAS A;  3W8K A;  3LY4 A;  5AQA A;  2JE5 A;  3CMZ A;  3PAG A;  3LO7 A;  1K38 A;  3VP1 A;  4U0X A;  1DJB A;  5FQ9 A;  1RP5 A;  1C3B A;  4KZ3 A;  1NZU A;  2J8Y A;  3MXR A;  2EFX A;  4UA6 A;  1K4F A;  1PWD A;  2Z2M B;  3GRJ A;  3IH9 A;  1ES4 A;  5CRF A;  1GHM A;  1K54 A;  3ZNY A;  1S6R A;  4OOM A;  3VOZ A;  4OLD A;  3BLM A;  2XQZ A;  5HFO A;  2Q9N A;  5CTN A;  2RL3 A;  3V39 A;  5FQI A;  4PM9 A;  3SOI A;  4R1G A;  5L2F A;  1K4E A;  4IBX A;  1O7E A;  1XGJ A;  1XP4 A;  5DF8 A;  3VSK A;  4HBU A;  1GA9 A;  1GA0 A;  4S2N C;  1ESU A;  3Q7V A;  4LV3 A;  4S2K A;  5E2G A;  5EE8 A;  3MZF A;  5AQ7 A;  1IYO A;  3IT9 A;  5HAP A;  3OPR A;  1K56 A;  5AQB A;  4ZJ3 A;  1SHV A;  4RX2 A;  2JCH A;  4WBG A;  2XD5 A;  3C4P A;  3G2Y A;  1KE4 A;  4CPK A;  5TR7 A;  4N1X A;  1KVM A;  3PBR A;  2WAD A;  5FA7 A;  3RXW A;  4DE1 A;  3O88 A;  2ZM2 A;  5EVL A;  3TG9 A;  4PMA A;  4P85 A;  3MZE A;  3SS4 A;  2XF3 A;  3PBQ A;  4R3B A;  3RJU A;  4BEN A;  1ZG6 A;  1RGY A;  1Q2P A;  3ZG7 B;  3UNW A;  3G2Z A;  2WGW A;  2GDN A;  3GR2 A;  4WEL A;  4E6W A;  5EUA A;  2EXB A;  4KG2 A;  3SS5 A;  3QHY A;  5F1F A;  2Y4A A;  1WYC A;  4QB8 A;  4GOG A;  3UDX A;  1PZO A;  1E4D A;  2Y59 A;  3Q1F A;  4R4S A;  5HAI A;  2HP6 A;  3FZC A;  4K91 A;  5DTS A;  4C3Q A;  1BTL A;  2X02 A;  4B4Z A;  2Y2L A;  3HLC A;  1FCN A;  2WAE A;  3ITB A;  2FFF B;  5KMW A;  1XA1 A;  5EVI B;  3VP2 A;  1L0F A;  5HX9 A;  1K57 A;  4X6T A;  4X53 A;  2Y2M A;  3IH8 A;  4XXR A;  1I2S A;  5GLD A;  3MXS A;  1LLB A;  1M6K A;  3GVB A;  4BL3 A;  5FAP A;  5FAO A;  4FH4 A;  3I7J A;  5CGX A;  1KDW A;  2IWC A;  2Y55 A;  3P09 A;  2ZC5 B;  3W4Q A;  1GCE A;  2P9V A;  4OVD A;  1NYY A;  2Y2P A;  4F94 A;  2JBF A;  5DF9 A;  4ZDX A;  3G35 A;  3M2J A;  1FOF A;  3GSG A;  1G6A A;  1DJA A;  2C5W B;  4RVA A;  3UDF A;  2R9X A;  2WGW B;  2JC7 A;  3ZG0 A;  2V2F F;  5HW3 A;  4OPY A;  1IYS A;  1JTG A;  2BG1 A;  4XUX A;  5EVI C;  2Y2Q A;  4OQ0 A;  3DTM A;  2XH9 A;  2H5S A;  3FYZ A;  3LCE A;  1BT5 A;  2E8I A;  3RXX A;  5FQK A;  4KZ8 A;  4QHC A;  1MWS A;  2EFU A;  3OCL A;  3M6B A;  4DDY A;  1S0W A;  3ZG5 A;  3BLS A;  1FR6 A;  5FDH A;  4KQR A;  1W8Y A;  2OLU A;  4LV1 A;  5F82 A;  1MWU A;  2WGI A;  3BFE A;  3VFH A;  1QME A;  5EOE A;  1LI9 A;  3SH9 A;  4JXW A;  4S2L A;  4S2M A;  2P74 A; 
#chains in the Genus database with same CATH topology
 2G7U A;  5DJT A;  5KSH A;  1IKI A;  3MF0 A;  2PD7 A;  1P9R A;  4QY5 A;  2VGL S;  3R4K A;  3EQU A;  1YMS A;  1KOU A;  5EVE A;  1F98 A;  4HJ3 A;  3UB7 A;  4GB7 A;  1XJ3 A;  3Q7Z A;  5HAQ A;  4ARZ A;  1W8Q A;  3S7O A;  1Y28 A;  3KYQ A;  3ZQ5 A;  4LPZ A;  5J8X A;  1Z6F A;  3EGX C;  2VJW A;  1Q2Q A;  4NXE A;  3A3I A;  3EGD C;  1K6R A;  1SKO A;  2Y8H A;  4Z9Q A;  2OV5 A;  2UV0 E;  2VGK A;  1LHY A;  4X69 A;  4OOL A;  3G4P A;  4S2I A;  4II7 A;  3P01 A;  1PWC A;  1ERM A;  4MMN A;  3F1O A;  4X55 A;  3HUO A;  4EES A;  3BM6 A;  3LID A;  3S22 A;  4YIN A;  1OPX A;  4CLC B;  3LEZ A;  3ISG A;  2Y2G A;  5CEC A;  2ZM8 A;  3HUN A;  4L9F A;  3DTI A;  5JYP A;  4LLO B;  1K54 C;  1IKG A;  1NZO A;  5DJU A;  4HJ4 A;  4BD0 A;  1FR1 A;  4KQO A;  1TDL A;  2XSS A;  2ZQA A;  3QP8 A;  5EFW A;  4QWO A;  3MSH A;  4C75 A;  2WAF A;  1N4O A;  2XRO A;  2JKT I;  2E8J A;  3HBR A;  4FSF A;  4PKY A;  3KYZ A;  2IWB A;  2OWJ A;  2PU4 A;  3CIT A;  1YM1 A;  4P6B A;  4UA7 A;  5DF7 A;  5CHU A;  4O01 A;  4KQD A;  3K3D A;  3SZT A;  2EA9 A;  1VET B;  3OLO A;  2AVX A;  3C5A A;  1TVF A;  2W27 A;  4EXO A;  4ZAM A;  1HD8 A;  1SDN A;  3N7W A;  4NXB A;  1MPL A;  3FKV A;  3T4T A;  4JGQ A;  1UWN X;  2J3W A;  4KEN B;  1S66 L;  4EU0 A;  3MJQ A;  4GD6 A;  4JXG A;  1CEG A;  2XFS A;  3T4O A;  3OPP A;  1IOU A;  3E2L A;  3HRE A;  4Y0O A;  4G3W A;  4DJ3 A;  2VGJ A;  2VA0 A;  5EEC A;  4P87 A;  5BOH A;  3QNC A;  4K0W A;  4O0P A;  4WEK A;  1P9W A;  3Q81 A;  2PD8 A;  2Q0O A;  2ZQ9 A;  4I38 A;  4UHU A;  1YLY A;  3PTE A;  2B5R A;  3R7W B;  4C6Y A;  3LFV A;  1PIO A;  4Y7P A;  3MFD A;  1ERQ A;  2V1A A;  2Q9M A;  1S1Y A;  4IED A;  2I72 A;  3T4L A;  3IX3 A;  4JXS A;  1ALQ A;  3NC8 A;  3N6I A;  4JF5 A;  2ZC4 B;  3WS1 A;  2HDR A;  4I5S A;  3CG5 A;  3T4S A;  2O9A A;  1GSX A;  3T50 A;  4E3J A;  3T1S A;  4Q0J A;  1YLW A;  2ZL1 B;  3CZD A;  4L0L A;  2Z6C A;  3T1X A;  2KX6 A;  1XGI A;  3IS2 A;  1VQQ A;  3LEQ A;  4NET A;  2J3T C;  1ES5 A;  5CXW A;  4CLC C;  3BWL A;  3IF5 A;  4GS9 B;  4R23 A;  3M6H A;  1WE4 A;  3L7H A;  3GEC A;  3PR6 A;  4MEZ A;  4NG2 A;  3HUM A;  4E3I A;  3OOV A;  5TJJ A;  2QMI A;  3LYX A;  3HLD A;  3V67 A;  3SW1 A;  1PI4 A;  4WF0 A;  3H82 B;  2R78 A;  2ZC6 B;  4EBL A;  5EPH A;  5C5K A;  1NY0 A;  5TBM A;  2CC1 A;  3JPU A;  5GL9 A;  2RCX A;  5EOO A;  1N9O A;  3BFF A;  1DJC A;  1ACF A;  3UB5 P;  2C6W B;  1XKZ A;  3HJK A;  3IWO A;  5E2H A;  1YLP A;  3TOI A;  1XJ6 A;  3JVV A;  5HDS A;  1BUL A;  4LRX C;  2V0W A;  3RFB A;  5AJG A;  3IF6 C;  1JVJ A;  1KGF A;  1IEL A;  5FAS A;  3LY4 A;  5AQA A;  3PAG A;  3LO7 A;  3VP1 A;  4U0X A;  5FQ9 A;  3UB9 A;  1RP5 A;  1C3B A;  1NZU A;  2J8Y A;  2M7U A;  3DTE A;  1PRQ A;  5EM1 A;  2W3D A;  1G5U A;  5CTN A;  3FPV A;  4PM9 A;  3SOI A;  5L2F A;  1O7E A;  3F1P A;  5CX7 A;  4S2N C;  1ESU A;  3Q7V A;  2JN7 A;  1VEU A;  3MZF A;  5AQ7 A;  5HAP A;  4ZJ3 A;  3BY9 A;  5HD3 A;  2XD5 A;  4LRZ E;  3PBR A;  5EVL A;  3TG9 A;  4PMA A;  3MFX A;  2XF3 A;  4R3B A;  1DRM A;  1RGY A;  2P7J A;  3ZG7 B;  3UNW A;  3G2Z A;  3P7N A;  2WGW A;  2GDN A;  3GR2 A;  3E4Q A;  3C30 A;  5EUA A;  2Y4A A;  4QB8 A;  1E4D A;  4X1M A;  2HP6 A;  5J3W A;  2X02 A;  3HLC A;  1D1J A;  5KMW A;  3KSG A;  3LUQ A;  2L4R A;  4X6T A;  2HF6 A;  4MN5 A;  1LLB A;  4BL3 A;  3GVB A;  5FAO A;  4FH4 A;  3I7J A;  4X25 A;  2Y55 A;  3P09 A;  2ZC5 B;  4OVD A;  2Y2P A;  5DF9 A;  4RVA A;  1LL8 A;  1JTG A;  2BG1 A;  5EVI C;  3E98 A;  2VV8 A;  2H5S A;  3FYZ A;  2VV6 A;  5FQK A;  1MWS A;  3OCL A;  2QYB A;  3UMD A;  4KQR A;  3RH8 B;  3TRC A;  1LI9 A;  4S2L A;  3IBR A;  2P74 A;  4BJP A;  3OPH A;  4GW9 A;  2Y2H A;  3BFG A;  1FQG A;  3BRM A;  3UY6 A;  3EWK A;  2QHK A;  3MQ0 A;  3PAE A;  4LCM A;  1FSY A;  1W79 A;  4K0X A;  3ZVW A;  3ZGA B;  3N8L A;  4E3K A;  5A91 A;  1QMF A;  2XA7 M;  1KE0 A;  1I2W A;  1O07 A;  2MJ6 A;  2XDM A;  1HVB A;  4WLA A;  3GQZ A;  1GHI A;  4HY8 A;  2QZ6 A;  3PBN A;  3ZG9 B;  4UQI M;  4Y0T A;  1PFL A;  1DP8 A;  1ONH A;  3DW0 A;  1RCJ A;  3A3D A;  2O9C A;  3C4O A;  5GHX A;  4HEF A;  2G2W A;  3FG8 A;  4DN0 A;  2FFY A;  1YT4 A;  1FIK A;  1OJG A;  3OCN A;  1TF1 A;  2VGL M;  3SS3 A;  4ARZ B;  3UE6 A;  3NY4 A;  2HP5 A;  4WM9 A;  5CHJ A;  5F69 A;  1OME A;  1OTB A;  2Y91 A;  3HLB A;  2FH5 A;  3IWI A;  4L9E A;  3NOT C;  1E25 A;  4WUJ A;  4I3I A;  4NXF A;  4O7D A;  4S2P A;  4S2J A;  1YLT A;  3QP6 A;  2WKH A;  3LI9 A;  2WKI A;  3A3F A;  4DMZ A;  3D3O A;  1P0Z A;  1BYW A;  4Q0H A;  5JYO A;  3D72 A;  3W4P A;  2A24 B;  1BZA A;  1JWV A;  3IWQ A;  4I3A A;  5DKK A;  3MZD A;  4RX3 A;  3G32 A;  1N9L A;  2IA2 A;  1V9Y A;  3ZG8 B;  2ZMA A;  3F1N A;  4UQI S;  3LIC A;  2QJ5 A;  3AGD A;  1DY6 A;  3UE0 A;  1KE3 A;  5CGS A;  4XT2 B;  2W3H A;  5KSC A;  3V5M A;  2CMN A;  2Y2N A;  3O5Y A;  5FQM A;  2W3E A;  3PBO A;  3EOI A;  3ICY A;  1BLP A;  1YKD A;  2R9W A;  1V9Z A;  1H8Z A;  2WK0 A;  5AVF A;  3UN7 A;  2J9P A;  4QY6 A;  5TFQ A;  1NWZ A;  2HDU A;  4E3N A;  1PW8 A;  4OQH A;  4HES A;  1H8Y A;  2WKQ A;  4OH0 A;  4R3J A;  4IVK A;  5EM0 A;  4A5R A;  5HPF A;  2Z6D A;  2QKP A;  5DFX A;  1MWR A;  2YKH A;  5IS1 A;  5FI7 A;  4YFM A;  3NHQ A;  2OSU A;  4CLC E;  1E3U A;  3LY3 A;  3KO6 A;  4H6J B;  3AGF A;  4Y0U A;  1T19 A;  3B33 A;  4OPZ A;  5GLB A;  3IHB A;  3NDE A;  1LSW A;  3G30 A;  4E3O A;  1LL5 A;  2OLV A;  5GHY A;  1L2S A;  5IHV A;  4GHI B;  4CJN A;  2PU2 A;  2ZD8 A;  4ZBE A;  4ZJ2 A;  3UB8 A;  2V9A A;  3IX4 A;  4XUZ A;  4EBN A;  4WZ5 C;  4LV2 A;  1JWP A;  2ZC3 B;  1A0K A;  5FAQ A;  3UE1 A;  4MNR A;  1TDG A;  3S1Y A;  2UWX A;  3E4P A;  1PWG A;  4OP8 A;  2KLI A;  3WS0 A;  3QP2 A;  5A8B A;  3LGO A;  3V50 A;  1SCW A;  2H28 A;  1JNU A;  4BQM A;  3HL9 A;  3BQ8 A;  4N9L A;  2K7S A;  4GDN A;  4QU3 A;  4ZJ1 A;  1HTZ A;  4EEP A;  4I3J A;  4EQI A;  1JTD A;  2ZLY A;  2NUP C;  1OTA A;  3WS5 A;  3MXQ A;  5DTK A;  1YMX A;  3HLE A;  2VV7 A;  4GDB A;  2V1Z A;  1L0E A;  1XPB A;  1ZKJ A;  1SZV A;  3G6O A;  4UA9 A;  4R4R A;  1CQA A;  4MLL A;  4WYY A;  4Y5F A;  5HSQ A;  4RYE A;  3IS2 B;  4WMC D;  2HJ9 C;  4KG6 A;  5EVI D;  1Y4O A;  3IF6 B;  1BLC A;  1H8M A;  1FCO A;  3K2N A;  4DE2 A;  3MKF A;  2WKE A;  2EWV A;  2XFT A;  3VV4 A;  4LRY C;  3CAX A;  1Z09 A;  2H0Y A;  5J7E A;  3V3R A;  3DWZ A;  1YLZ A;  4FCF A;  2ZQD A;  3LR0 A;  2J9O A;  3HJI A;  1LL9 A;  2P08 A;  2W3G A;  5AVE A;  5LBR A;  3M2K A;  3S7P A;  1NXY A;  2WZZ A;  3OC2 A;  4KZ5 A;  1BUE A;  5IT5 A;  3U2A A;  5GLA A;  4YOF A;  4M3K A;  4GLQ A;  2WYX A;  2ZM0 A;  3ZNT A;  3W8K A;  3CMZ A;  1L3L A;  1K38 A;  3KSI A;  4KZ3 A;  3MXR A;  2EFX A;  1CJF A;  4K08 A;  4UA6 A;  1PWD A;  3GRJ A;  3IH9 A;  1ES4 A;  1S6R A;  3VOZ A;  5HFO A;  2RL3 A;  3V39 A;  5FQI A;  4Y17 A;  1XGJ A;  1XP4 A;  3VSK A;  1ZHH B;  4CLC A;  3OPR A;  5AQB A;  1SHV A;  2PBD P;  2JCH A;  4WBG A;  3C4P A;  1H0M A;  1KE4 A;  2B02 A;  4N1X A;  1KVM A;  5FDS A;  2WAD A;  4DE1 A;  3T4Q A;  2ZM2 A;  2W1T B;  4P85 A;  4BEN A;  1ZG6 A;  1Q2P A;  4E6W A;  2EXB A;  4MN7 A;  3QHY A;  4R4S A;  4K91 A;  3CUE A;  1BTL A;  1FCN A;  2FFF B;  3T12 B;  5EVI B;  3VP2 A;  2QJ7 A;  4MN6 A;  2L0W A;  4XXR A;  3MXS A;  1VET A;  2O99 A;  5FAP A;  1OTE A;  2IWC A;  1GCE A;  2P9V A;  4F94 A;  1T18 A;  1TD5 A;  5FEG A;  1G6A A;  1DJA A;  2C5W B;  2R9X A;  2WGW B;  3CPT B;  2V2F F;  1IYS A;  4XUX A;  2Y2Q A;  3DTM A;  3TJZ C;  2HZ5 A;  3LR4 A;  1BT5 A;  2E8I A;  3RXX A;  4QHC A;  2V0U A;  5HPI A;  2EFU A;  4DDY A;  3IX8 A;  1W8Y A;  3VFH A;  2K31 A;  5EOE A;  4HNB A;  4FTX A;  3H7W B;  3SH9 A;  4S2M A;  1TS8 A;  4L9G A;  3HCY A;  1UGU A;  3VSL A;  3BEC A;  3SH7 A;  4JBF A;  3MBZ A;  1MKI A;  3MMH A;  4DXC A;  1S67 L;  1ERO A;  4KZB A;  1P97 A;  4UAA A;  2HPB A;  3DTK A;  4KZ4 A;  3T4K A;  4JGR A;  3OBF A;  5L09 A;  3R7W A;  5F68 A;  2JKR M;  1N9B A;  3MS6 A;  3PBT A;  4KZA A;  3CWF A;  3FV7 A;  4O8G A;  1F2K A;  2XLN A;  5HD5 A;  4B88 A;  4DDS A;  3VE4 A;  5CER A;  1TS0 A;  2DCF A;  3IBJ A;  1VM1 A;  2Y2J A;  4DE3 A;  5J4E A;  4OKP A;  1XA7 A;  4PKY G;  5F6A A;  1IEM A;  2KDK A;  2V8F A;  4IUK A;  3A3J A;  2ZJ9 A;  2X71 A;  3GTC A;  2W0N A;  3G34 A;  4NK3 A;  4WZ4 A;  2JHE A;  3EEA A;  1K55 A;  3NIA A;  4BBT A;  3L9K A;  2ZL1 A;  4OPQ A;  5DTT A;  5HL1 A;  4GJ4 A;  2Y2K A;  4HI4 A;  3U4L P;  4DKI A;  4EV4 A;  4GKU A;  1H5X A;  1STZ A;  4F3L B;  1AXB A;  1DP9 A;  4GS9 A;  4HH3 A;  2HDQ A;  4IVI A;  3ZVT A;  1MY8 A;  2G2U A;  1GSW A;  5G4Y A;  4E3L A;  1UWP X;  4QJG A;  5GLC A;  1CK3 A;  1YAX A;  1Y54 A;  3EQV A;  5CED A;  4GN2 A;  2J80 A;  1W5D A;  3H82 A;  1KDS A;  2W1R A;  4RQ9 A;  5FQJ A;  3RTY A;  1XFQ A;  2Y2I A;  3OPL A;  5DKL A;  1ONG A;  4GD8 A;  3E2K A;  5M19 A;  3UPO A;  2BTF P;  3GV9 A;  1XJ2 A;  5HDC A;  3V3S A;  3D4F A;  3HLG A;  2QPN A;  3IQA A;  4M4X A;  3MKE A;  4D2O A;  4IBR A;  4PAU A;  1AWI A;  3QNB A;  1OT6 A;  4LCL A;  3NBL A;  3LIB A;  1SDE A;  2WGV A;  2V20 A;  4FD8 A;  3VP3 A;  1YQS A;  2WUQ A;  2ZQC A;  2DNS A;  4BBU A;  3W2Z A;  3K3C A;  3NOP C;  2YKF A;  4N9K A;  2ZBB A;  4QD4 A;  3BJN A;  5HWV A;  4HHD A;  2HGV A;  4AFI A;  4PM5 A;  2ZQ7 A;  4JGO A;  5FSR A;  4BWI A;  1ODV A;  1GSV A;  1HLU P;  2EX2 A;  4Z1W A;  2ZOI A;  2Y2O A;  4HP9 A;  5FQQ A;  2FZ0 A;  2X01 A;  5E43 A;  4LEN A;  1L0D A;  1F5M A;  2VKS A;  3E4O A;  2HDS A;  4I39 A;  5G4Z A;  3ITA A;  1PW1 A;  4X56 A;  4Q8I A;  1KVL A;  2ZC7 A;  3WWX A;  1TS7 A;  4DE0 A;  5CGW A;  2W3F A;  5FI6 A;  1JWZ A;  1IYQ A;  1OJ5 A;  2O0Y A;  2Y79 A;  3IXD A;  4DRT A;  3IXH A;  1EI5 A;  3WRT A;  4WL9 A;  5M18 A;  5I94 A;  4OOY A;  4GNU A;  4LGW A;  5FL3 A;  3VP4 A;  5KZH A;  3VFF A;  4R3A A;  4PM7 A;  1X0O A;  4JF6 A;  4U0T A;  3C7V A;  3HLF A;  4OLG A;  4Q0I A;  4UEY A;  1GHP A;  1SKO B;  3Q82 A;  3C7U A;  5FI2 A;  2LB9 A;  1BLS A;  2IWD A;  3LIA A;  4FUW A;  3F1O B;  2GX5 A;  4X1L A;  3IXG A;  2PBY A;  5L10 A;  3DWK A;  3TE8 A;  2H10 A;  4P0M A;  1G28 A;  5AQ9 A;  4BLM A;  3O86 A;  1G68 A;  4N92 A;  3IHA A;  3Q07 A;  3OZH A;  4LV0 A;  1PZP A;  2HP9 A;  3O87 A;  3NCK A;  4MBF A;  4NKP A;  3BQA A;  2VEA A;  3NI9 A;  3UB6 A;  3A0S A;  4KZ7 A;  2EX6 A;  5GHZ A;  4PPR A;  4B9O A;  1ZC2 A;  2V8C A;  5D3O A;  1MBL A;  1CI8 A;  3ZCZ A;  2DMW A;  3HVF A;  1K57 C;  4QPR A;  2PR5 A;  2PHY A;  1NJ4 A;  4WZ5 A;  1H3Q A;  4EET B;  2XK1 A;  4IUH A;  4HBT A;  2OWH A;  1FIL A;  4Y13 A;  1LSX A;  1EWZ A;  3TW8 A;  4OQG A;  2H0T A;  3N4I A;  5HDD A;  4D60 A;  3KSH A;  1DJB A;  5I5L A;  2O9B A;  3E0Y A;  2Z2M B;  2GJ3 A;  2LB5 A;  1D7E A;  5CRF A;  3ZNY A;  1GHM A;  1K54 A;  2XQZ A;  2Q9N A;  4ESP A;  1LT0 A;  3CLO A;  4R1G A;  1K4E A;  3T1R A;  2A2L A;  4GCZ A;  5DF8 A;  3BW6 A;  2PYR A;  2VX8 A;  3C2W A;  5E2G A;  4LV3 A;  4R6L A;  3IT9 A;  1K56 A;  4RX2 A;  4ME4 A;  3G2Y A;  4CPK A;  5FA7 A;  3RXW A;  3O88 A;  4P6Z S;  2D02 A;  3MZE A;  3SS4 A;  2M1C A;  2A24 A;  3QP1 A;  5HWT A;  4WEL A;  4KG2 A;  3SS5 A;  3C8C A;  1PZO A;  2OAQ 1;  5HAI A;  4C3Q A;  2Y2L A;  2WAE A;  3ITB A;  5MC7 A;  1XA1 A;  5L8M A;  2JKR I;  4XT2 A;  5HX9 A;  1OTD A;  2Y2M A;  3IH8 A;  5GLD A;  1M6K A;  5CGX A;  1KDW A;  1NYY A;  3DAV A;  2JBF A;  4ZDX A;  3G35 A;  3M2J A;  1FOF A;  5IU1 A;  3GSG A;  3LR3 A;  1YSQ A;  3UDF A;  3ZG0 A;  5HW3 A;  2ACG A;  3JVU A;  1CF0 A;  2B95 A;  3LIF A;  2XH9 A;  4KZ8 A;  3B47 A;  3ZG5 A;  1FR6 A;  4LV1 A;  1MWU A;  2WGI A;  4IJG A;  4JXW A;  4HH2 A;  2XRN A;  2P9V B;  2B18 A;  1K6S A;  4ZTK A;  4HOI A;  4NXG A;  3BYD A;  4HJ6 A;  4JKT A;  4H6J A;  1W63 M;  4KG5 A;  4CQH A;  2GNX A;  5HAR A;  3ZYT A;  3MQQ A;  1MWT A;  1S1Z A;  1U60 A;  4E3M A;  1WA9 A;  4EBP A;  3W4O A;  4GHI A;  5K5B A;  1ES2 A;  3G31 A;  5TBM B;  4GZB A;  2VLG A;  3BFC A;  2XEP A;  4WEJ A;  3PBS A;  1T1B A;  1CI9 A;  3S7N A;  4JXV A;  1XXM A;  1PNE A;  4ETX A;  1FCM A;  1S4R A;  3SH8 A;  2HV1 A;  4PM8 A;  1IYP A;  4MDZ A;  2ZMV A;  1HZO A;  1G6O A;  4MBH A;  1BSG A;  2ZMF A;  4OQI A;  5CEB A;  3FC7 A;  3N8R A;  3C38 A;  4LFU A;  2PRF A;  5EV0 A;  4MCW A;  4ZRR A;  3ZDJ A;  2A3U A;  3LIE A;  1L0G A;  1MZU A;  1CEF A;  5E2E A;  3QP4 A;  1MXO A;  1KGE A;  3F1P B;  2PAV P;  2OOL A;  3Q7V B;  1XJ4 A;  1VEU B;  1BLH A;  4EUV A;  3VE3 A;  4HQA A;  1J9M A;  3T4J A;  1W63 Q;  2ZQ8 A;  3IF6 A;  4JPM A;  5F83 A;  5A93 A;  2PYP A;  2KOI A;  5HWW A;  3TSG A;  2L1M A;  4RA7 A;  3PXP A;  3BFD A;  1PI5 A;  1WYB A;  3KSF A;  3LI8 A;  2EX8 A;  3MR0 A;  1ZG4 A;  4S2O A;  4R38 A;  4B93 A;  1FSW A;  3NDG A;  1ES3 A;  4KZ6 A;  2WZX A;  3WS4 A;  4S2N A;  2WKR A;  1K25 A;  2WKP A;  4MBK A;  3VP0 A;  5FEF A;  5DFY A;  1VB6 A;  1EW0 A;  4YWZ A;  3CUE C;  1W7F A;  4BBV A;  1S4S A;  1XFN A;  3WS2 A;  5KIZ A;  1F9I A;  3H9W A;  4DXB A;  1T1C A;  3FWL A;  4ID4 A;  1PYY A;  3UDI A;  3VOY A;  2NUT C;  2DRW A;  1MC0 A;  1LSV A;  1IFQ A;  2P04 A;  5F5Y A;  2PDR A;  3ZFZ A;  4YNR A;  4EW7 A;  4N1H A;  4OP5 A;  3NOU C;  2BLS A;  1T1A A;  4KZ9 A;  4IHQ A;  4E04 A;  4Y15 A;  2W1T A;  3HLW A;  2JKT M;  3AGE A;  3QP5 A;  1NLZ A;  1MKM A;  4G3V A;  3PYP A;  4BD1 A;  5TGF A;  4DF6 A;  5F1G A;  5A92 A;  5A90 A;  4WMC A;  3NJA A;  2EXA A;  4HIA A;  2D01 A;  5EVI A;  3UME A;  4R70 A;  1LI0 A;  3UPP A;  3NUL A;  3JYI A;  1NLY A;  3VOL A;  1TEM A;  3O3V A;  1NYM A;  4FH2 A;  4JF4 A;  4H8R A;  3D9Y A;  2I9V A;  4U3T A;  5E2F A;  3B42 A;  2XR0 A;  4OON A;  2Z2L B;  3UE3 A;  3CPT A;  2J7V A;  5U47 A;  4EWF A;  4X68 A;  3CI6 A;  4OPR A;  1OT9 A;  5HL6 A;  1YSP A;  4HP4 A;  1RGZ A;  2A49 A;  4EUZ A;  4B4X A;  3A0V A;  3KX0 X;  5M1A A;  4KQQ A;  1NRF A;  4BL2 A;  3KYE A;  5G18 A;  3LR5 A;  3A3E A;  3GDI A;  3WRZ A;  3H7W A;  3ZHH A;  3CJM A;  1I5Q A;  1XX2 A;  3A0R A;  3FKW A;  1ESI A;  1E3U D;  1K55 C;  3IXB A;  4R0Q A;  5FAT A;  2XGN A;  2PT7 A;  1K0K A;  4JGP A;  5CHM A;  1M40 A;  3UO9 A;  1KGG A;  2EX9 A;  4BMW A;  4PM6 A;  3S4X A;  1D06 A;  2JKG A;  2XD1 A;  2PR6 A;  1K56 D;  3CHW P;  1NRJ A;  3B3X A;  3N8S A;  3VMA A;  1ZTU A;  1YLJ A;  4E6X A;  3FPW A;  3UPN A;  1YPR A;  5DVA A;  3F1N B;  2QWS A;  4PHT A;  3T1Q B;  4JLF A;  1SKF A;  3BEB A;  5CTM A;  3GMW A;  2VK3 A;  3P98 A;  4KUK A;  4EER A;  2JE5 A;  1K4F A;  4OOM A;  4F3L A;  5HZH A;  4G3K A;  4OLD A;  3BLM A;  1VHM A;  3PHY A;  4EQ1 A;  3EEH A;  3S7Q A;  4IBX A;  3ULF A;  4HBU A;  1GA9 A;  1GA0 A;  4S2K A;  5EE8 A;  1IYO A;  3BY8 A;  4KUO A;  5TR7 A;  1J3W A;  3PBQ A;  3RJU A;  5L07 A;  3DBA A;  2INW A;  1OTI A;  5F1F A;  1WYC A;  3UDX A;  4GOG A;  4NEE D;  2Y59 A;  3Q1F A;  1N9N A;  3FZC A;  5DTS A;  4ETZ A;  2ZOH A;  2OAP 1;  4B4Z A;  4WN5 A;  1TS6 A;  2HJE A;  2VZW A;  4Y2F A;  1L0F A;  1K57 A;  4X53 A;  4DJ2 A;  1I2S A;  3NEC A;  3W4Q A;  2JKF A;  1DP6 A;  2GZA A;  2BAS A;  2XA7 S;  2M7V A;  2JC7 A;  2J3T D;  4OPY A;  4P6Z M;  4EEU A;  4OQ0 A;  2K2N A;  3MQO A;  4FOF A;  3LCE A;  4CLC D;  2EWW A;  3M6B A;  1S0W A;  3BLS A;  5FDH A;  2OLU A;  2V1B A;  5F82 A;  3BFE A;  1QME A;  4Y3I A; 
#chains in the Genus database with same CATH homology
 3VSL A;  4BJP A;  2P9V B;  3BEC A;  3OPH A;  2Y2H A;  3BFG A;  4JBF A;  1K6S A;  4ZTK A;  3SH7 A;  3MBZ A;  1FQG A;  3BRM A;  1MKI A;  3UY6 A;  5KSH A;  3BYD A;  4DXC A;  1IKI A;  4JKT A;  1ERO A;  4KZB A;  4KG5 A;  3PAE A;  4UAA A;  5HAR A;  2HPB A;  4KZ4 A;  4LCM A;  4QY5 A;  1FSY A;  1W79 A;  4K0X A;  3ZVW A;  3EQU A;  1MWT A;  3ZGA B;  3N8L A;  1YMS A;  4E3K A;  5A91 A;  1QMF A;  1N9B A;  3PBT A;  1U60 A;  4KZA A;  4E3M A;  4EBP A;  3FV7 A;  3W4O A;  1KE0 A;  2XLN A;  4GB7 A;  1ES2 A;  4B88 A;  3G31 A;  4DDS A;  1I2W A;  4GZB A;  3Q7Z A;  1O07 A;  5HAQ A;  2XDM A;  1W8Q A;  5CER A;  3BFC A;  1HVB A;  2XEP A;  4WEJ A;  3PBS A;  3GQZ A;  1GHI A;  2DCF A;  1CI9 A;  1VM1 A;  2QZ6 A;  2Y2J A;  3PBN A;  4DE3 A;  4OKP A;  3ZG9 B;  5J8X A;  1Z6F A;  4Y0T A;  1XA7 A;  4JXV A;  1XXM A;  1ONH A;  1Q2Q A;  1FCM A;  1IEM A;  3SH8 A;  3DW0 A;  3A3J A;  2ZJ9 A;  1RCJ A;  2X71 A;  3GTC A;  3A3I A;  4PM8 A;  1IYP A;  1K6R A;  3A3D A;  3G34 A;  1HZO A;  3C4O A;  5GHX A;  4HEF A;  4NK3 A;  2G2W A;  4WZ4 A;  3NIA A;  1K55 A;  4Z9Q A;  4MBH A;  1BSG A;  2FFY A;  1YT4 A;  2OV5 A;  4OQI A;  2VGK A;  4OPQ A;  5DTT A;  5CEB A;  3N8R A;  5HL1 A;  1LHY A;  2Y2K A;  4X69 A;  4OOL A;  3G4P A;  3OCN A;  4S2I A;  3ZDJ A;  1PWC A;  4DKI A;  4EV4 A;  1ERM A;  2A3U A;  4GKU A;  1H5X A;  3SS3 A;  3NY4 A;  4X55 A;  3HUO A;  2HP5 A;  4WM9 A;  5CHJ A;  1L0G A;  1OME A;  1CEF A;  1AXB A;  2Y91 A;  5E2E A;  3HLB A;  1MXO A;  3BM6 A;  1KGE A;  3IWI A;  2HDQ A;  3S22 A;  4YIN A;  4IVI A;  3Q7V B;  1E25 A;  3ZVT A;  1MY8 A;  3LEZ A;  2G2U A;  3ISG A;  2Y2G A;  4O7D A;  4S2P A;  2ZM8 A;  3HUN A;  4E3L A;  5CEC A;  4S2J A;  1YLT A;  4QJG A;  1BLH A;  5GLC A;  1CK3 A;  2WKH A;  5JYP A;  1Y54 A;  2WKI A;  1K54 C;  3EQV A;  1IKG A;  5CED A;  4GN2 A;  1NZO A;  3A3F A;  4BD0 A;  5JYO A;  1J9M A;  1FR1 A;  3W4P A;  4KQO A;  1TDL A;  1W5D A;  2ZQ8 A;  1KDS A;  3IF6 A;  4JPM A;  5F83 A;  5FQJ A;  1BZA A;  5A93 A;  1JWV A;  2ZQA A;  3IWQ A;  2Y2I A;  3OPL A;  1ONG A;  4GD8 A;  3E2K A;  5M19 A;  3UPO A;  4C75 A;  2WAF A;  3TSG A;  1N4O A;  3MZD A;  4RX3 A;  3G32 A;  4RA7 A;  3BFD A;  3GV9 A;  3HBR A;  1PI5 A;  1WYB A;  4FSF A;  3V3S A;  3D4F A;  3HLG A;  2QPN A;  3IQA A;  3ZG8 B;  2ZMA A;  2EX8 A;  2IWB A;  1ZG4 A;  3MKE A;  4S2O A;  4IBR A;  2PU4 A;  4D2O A;  5DF7 A;  1YM1 A;  4P6B A;  3AGD A;  4UA7 A;  1DY6 A;  5CHU A;  3UE0 A;  1KE3 A;  1FSW A;  5CGS A;  5KSC A;  3NDG A;  3QNB A;  1ES3 A;  3V5M A;  4LCL A;  4KZ6 A;  3NBL A;  2WZX A;  1SDE A;  2Y2N A;  3WS4 A;  2WGV A;  5FQM A;  4S2N A;  2V20 A;  4FD8 A;  3VP3 A;  1YQS A;  1K25 A;  3PBO A;  2WUQ A;  2ZQC A;  2DNS A;  4MBK A;  3VP0 A;  1BLP A;  2R9W A;  3C5A A;  1TVF A;  1H8Z A;  2WK0 A;  4ZAM A;  1HD8 A;  4N9K A;  1SDN A;  2J9P A;  3N7W A;  4QD4 A;  4QY6 A;  1W7F A;  5TFQ A;  1MPL A;  3FKV A;  3WS2 A;  2HDU A;  4PM5 A;  4E3N A;  2ZQ7 A;  1PW8 A;  4OQH A;  5FSR A;  4HES A;  1H8Y A;  4DXB A;  4KEN B;  4OH0 A;  3FWL A;  2EX2 A;  1PYY A;  4ID4 A;  4IVK A;  4R3J A;  3UDI A;  3VOY A;  4A5R A;  2DRW A;  2Y2O A;  5FQQ A;  4GD6 A;  4JXG A;  1CEG A;  3ZFZ A;  2XFS A;  2X01 A;  5E43 A;  3OPP A;  4LEN A;  1L0D A;  1MWR A;  4N1H A;  4OP5 A;  3E2L A;  2BLS A;  5FI7 A;  3HRE A;  2HDS A;  4KZ9 A;  4Y0O A;  4YFM A;  3ITA A;  1PW1 A;  4X56 A;  2VGJ A;  2OSU A;  4Q8I A;  5EEC A;  1KVL A;  2ZC7 A;  1E3U A;  4P87 A;  3HLW A;  5BOH A;  3WWX A;  3LY3 A;  3AGE A;  4DE0 A;  5CGW A;  3QNC A;  3AGF A;  4K0W A;  4Y0U A;  4WEK A;  5FI6 A;  3Q81 A;  4OPZ A;  1JWZ A;  2ZQ9 A;  1IYQ A;  4BD1 A;  4UHU A;  1YLY A;  5GLB A;  3IHB A;  3NDE A;  2B5R A;  3PTE A;  5TGF A;  3IXD A;  4C6Y A;  4DF6 A;  3G30 A;  4E3O A;  1LL5 A;  2OLV A;  5F1G A;  5A92 A;  5GHY A;  5A90 A;  4DRT A;  1L2S A;  4WMC A;  5IHV A;  2EXA A;  4CJN A;  3IXH A;  5EVI A;  1PIO A;  1EI5 A;  2PU2 A;  4Y7P A;  2ZD8 A;  4ZBE A;  4ZJ2 A;  3WRT A;  3MFD A;  1ERQ A;  1LI0 A;  4XUZ A;  4EBN A;  4WZ5 C;  3UPP A;  5M18 A;  2Q9M A;  5I94 A;  4OOY A;  4IED A;  3JYI A;  4GNU A;  2I72 A;  1TEM A;  3O3V A;  4LV2 A;  1JWP A;  1NYM A;  4FH2 A;  3VP4 A;  4JF4 A;  5KZH A;  2ZC3 B;  3VFF A;  4H8R A;  4JXS A;  5E2F A;  4U3T A;  5FAQ A;  4PM7 A;  3UE1 A;  1ALQ A;  4MNR A;  3NC8 A;  4JF6 A;  2XR0 A;  4OON A;  3C7V A;  4U0T A;  3N6I A;  4JF5 A;  1TDG A;  2ZC4 B;  3HLF A;  2HDR A;  2Z2L B;  4OLG A;  3S1Y A;  3UE3 A;  3WS1 A;  2J7V A;  2UWX A;  1PWG A;  3CG5 A;  4OP8 A;  5U47 A;  4EWF A;  4X68 A;  1GHP A;  4OPR A;  3Q82 A;  4E3J A;  3WS0 A;  1YLW A;  3V50 A;  3CZD A;  3C7U A;  1SCW A;  5FI2 A;  4BQM A;  1RGZ A;  2A49 A;  4L0L A;  4EUZ A;  1XGI A;  1BLS A;  1VQQ A;  2IWD A;  3HL9 A;  4N9L A;  4NET A;  4GDN A;  4QU3 A;  4ZJ1 A;  4B4X A;  1HTZ A;  5M1A A;  4KQQ A;  4EQI A;  1ES5 A;  1NRF A;  1JTD A;  5G18 A;  4BL2 A;  2ZLY A;  3A3E A;  5CXW A;  3WRZ A;  3IXG A;  3ZHH A;  3WS5 A;  3CJM A;  3IF5 A;  1I5Q A;  4R23 A;  1XX2 A;  2PBY A;  3M6H A;  5DTK A;  1YMX A;  1WE4 A;  1ESI A;  3FKW A;  1E3U D;  3HLE A;  4GDB A;  1K55 C;  4MEZ A;  3DWK A;  2V1Z A;  3IXB A;  4R0Q A;  1L0E A;  1XPB A;  2H10 A;  3HUM A;  4P0M A;  1ZKJ A;  5AQ9 A;  4BLM A;  3O86 A;  1G68 A;  4N92 A;  4E3I A;  3IHA A;  5FAT A;  2QMI A;  3Q07 A;  3OZH A;  2XGN A;  3HLD A;  4UA9 A;  4R4R A;  3UN7 A;  4LV0 A;  4MLL A;  1PZP A;  5CHM A;  4WYY A;  2HP9 A;  3O87 A;  1M40 A;  3UO9 A;  3NCK A;  4RYE A;  1KGG A;  4MBF A;  2EX9 A;  4WMC D;  1PI4 A;  4PM6 A;  4KG6 A;  5EVI D;  3IF6 B;  1BLC A;  2ZC6 B;  1FCO A;  3NI9 A;  2XD1 A;  3S4X A;  4DE2 A;  4EBL A;  5EPH A;  1K56 D;  2WKE A;  1NY0 A;  2CC1 A;  3MKF A;  5GL9 A;  2XFT A;  2RCX A;  4KZ7 A;  2EX6 A;  5EOO A;  5GHZ A;  3B3X A;  4PPR A;  3N8S A;  3BFF A;  3VMA A;  1DJC A;  1ZC2 A;  2H0Y A;  5D3O A;  1MBL A;  3V3R A;  1YLJ A;  1CI8 A;  3DWZ A;  4E6X A;  1YLZ A;  4FCF A;  3ZCZ A;  2C6W B;  1XKZ A;  2ZQD A;  3UPN A;  2J9O A;  3HVF A;  1K57 C;  1LL9 A;  3M2K A;  1NJ4 A;  1NXY A;  3IWO A;  5DVA A;  4WZ5 A;  5E2H A;  1YLP A;  2WZZ A;  3TOI A;  3OC2 A;  4KZ5 A;  1BUE A;  2XK1 A;  4JLF A;  4HBT A;  5GLA A;  1BUL A;  1SKF A;  4M3K A;  3BEB A;  5CTM A;  3GMW A;  1EWZ A;  3P98 A;  4OQG A;  2H0T A;  3N4I A;  2WYX A;  3IF6 C;  1JVJ A;  1KGF A;  1IEL A;  2ZM0 A;  3ZNT A;  5FAS A;  3W8K A;  3LY4 A;  5AQA A;  2JE5 A;  3CMZ A;  3PAG A;  3LO7 A;  1K38 A;  3VP1 A;  4U0X A;  1DJB A;  5FQ9 A;  1RP5 A;  1C3B A;  4KZ3 A;  1NZU A;  2J8Y A;  3MXR A;  2EFX A;  4UA6 A;  1K4F A;  1PWD A;  2Z2M B;  3GRJ A;  3IH9 A;  1ES4 A;  5CRF A;  1GHM A;  1K54 A;  3ZNY A;  1S6R A;  4OOM A;  3VOZ A;  4OLD A;  3BLM A;  2XQZ A;  5HFO A;  2Q9N A;  5CTN A;  2RL3 A;  3V39 A;  5FQI A;  4PM9 A;  3SOI A;  4R1G A;  5L2F A;  1K4E A;  4IBX A;  1O7E A;  1XGJ A;  1XP4 A;  5DF8 A;  3VSK A;  4HBU A;  1GA9 A;  1GA0 A;  4S2N C;  1ESU A;  3Q7V A;  4LV3 A;  4S2K A;  5E2G A;  5EE8 A;  3MZF A;  5AQ7 A;  1IYO A;  3IT9 A;  5HAP A;  3OPR A;  1K56 A;  5AQB A;  4ZJ3 A;  1SHV A;  4RX2 A;  2JCH A;  4WBG A;  2XD5 A;  3C4P A;  3G2Y A;  1KE4 A;  4CPK A;  5TR7 A;  4N1X A;  1KVM A;  3PBR A;  2WAD A;  5FA7 A;  3RXW A;  4DE1 A;  3O88 A;  2ZM2 A;  5EVL A;  3TG9 A;  4PMA A;  4P85 A;  3MZE A;  3SS4 A;  2XF3 A;  3PBQ A;  4R3B A;  3RJU A;  4BEN A;  1ZG6 A;  1RGY A;  1Q2P A;  3ZG7 B;  3UNW A;  3G2Z A;  2WGW A;  2GDN A;  3GR2 A;  4WEL A;  4E6W A;  5EUA A;  2EXB A;  4KG2 A;  3SS5 A;  3QHY A;  5F1F A;  2Y4A A;  1WYC A;  4QB8 A;  4GOG A;  3UDX A;  1PZO A;  1E4D A;  2Y59 A;  3Q1F A;  4R4S A;  5HAI A;  2HP6 A;  3FZC A;  4K91 A;  5DTS A;  4C3Q A;  1BTL A;  2X02 A;  4B4Z A;  2Y2L A;  3HLC A;  1FCN A;  2WAE A;  3ITB A;  2FFF B;  5KMW A;  1XA1 A;  5EVI B;  3VP2 A;  1L0F A;  5HX9 A;  1K57 A;  4X6T A;  4X53 A;  2Y2M A;  3IH8 A;  4XXR A;  1I2S A;  5GLD A;  3MXS A;  1LLB A;  1M6K A;  3GVB A;  4BL3 A;  5FAP A;  5FAO A;  4FH4 A;  3I7J A;  5CGX A;  1KDW A;  2IWC A;  2Y55 A;  3P09 A;  2ZC5 B;  3W4Q A;  1GCE A;  2P9V A;  4OVD A;  1NYY A;  2Y2P A;  4F94 A;  2JBF A;  5DF9 A;  4ZDX A;  3G35 A;  3M2J A;  1FOF A;  3GSG A;  1G6A A;  1DJA A;  2C5W B;  4RVA A;  3UDF A;  2R9X A;  2WGW B;  2JC7 A;  3ZG0 A;  2V2F F;  5HW3 A;  4OPY A;  1IYS A;  1JTG A;  2BG1 A;  4XUX A;  5EVI C;  2Y2Q A;  4OQ0 A;  3DTM A;  2XH9 A;  2H5S A;  3FYZ A;  3LCE A;  1BT5 A;  2E8I A;  3RXX A;  5FQK A;  4KZ8 A;  4QHC A;  1MWS A;  2EFU A;  3OCL A;  3M6B A;  4DDY A;  1S0W A;  3ZG5 A;  3BLS A;  1FR6 A;  5FDH A;  4KQR A;  1W8Y A;  2OLU A;  4LV1 A;  5F82 A;  1MWU A;  2WGI A;  3BFE A;  3VFH A;  1QME A;  5EOE A;  1LI9 A;  3SH9 A;  4JXW A;  4S2L A;  4S2M A;  2P74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...