1OMEA

Crystal structure of the omega loop deletion mutant (residues 163-178 deleted) of beta-lactamase from staphylococcus aureus pc1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
257
structure length
241
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Role of the omega-loop in the activity, substrate specificity, and structure of class A beta-lactamase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 82
structure length 241
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1omeA00
3AGEA 2CC1A 2XDMA 1HVBA 3OCLA 3M2KA 4BJPA 3P98A 3VP2A 2BLSA 4RX3A 1CEGA 1RP5A 5DTSA 3PBNA 1BLPA 4JXWA 1NYMA 5GLCA 4X69A 4KZ5A 4Q8IA 5U47A 4GOGA 3FYZA 5GLAA 4S2IA 1LL9A 2V2FF 3UN7A 1ERMA 1YLWA 1PWCA 1BSGA 1JTGA 5E2GA 4HBUA 3VFHA 4KZ3A 3WS0A 1K54A 4GNUA 4WM9A 3GQZA 3SH9A 3EQVA 1O07A 2IWBA 2EXAA 2Q9MA 4Y0TA 3VOYA 3B3XA 3I7JA 4UAAA 5EOOA 1IYSA 3ZG5A 3ZHHA 1XXMA 3LO7A 4UA9A 1E4DA 1H8YA 1GHMA 2WUQA 4IEDA 5EOEA 5TR7A 4OQHA 2ZM8A 1BUEA 1ES5A 5DF9A 2ZQDA 1OMEA 1Z6FA 1YT4A 4KG5A 5AQBA 1KE3A 3SOIA 4E3KA 3N6IA 1GCEA 3ISGA 5CTNA 4WZ5C 4IVKA 4WZ4A 5CEDA 1PI5A 2WGVA 4S2OA 4ZBEA 2XR0A 3A3FA 2QPNA 2H0TA 2HDQA 5GLDA 4YINA 4N9LA 2XGNA 3NCKA 3HUNA 3OPHA 1TEMA 3LEZA 3HLBA 2FFFB 4R3BA 4S2MA 2Y2LA 5FQ9A 5GHXA 3TG9A 5F1FA 3BRMA 4OOLA 2HDSA 3Q07A 3PBQA 2VGKA 2Y2NA 4OPQA 3Q7ZA 3VSLA 4XUZA 3ZG0A 1ESUA 2WZXA 1M6KA 2VGJA 2ZQ9A 4DDSA 4NK3A 4P6BA 4OONA 2EX9A 1K56A 3BFCA 2Y2HA 2DRWA 4S2NA 1K6SA 3OPRA 1BLCA 4XXRA 2UWXA 2ZQ7A 4OPZA 1L0FA 4RVAA 4WMCD 5CGXA 4QB8A 2WYXA 1MWTA 5L2FA 1KE4A 5EUAA 1GHIA 1IKIA 2V20A 4GDNA 4EBPA 5HW3A 1DJAA 3VP1A 5F83A 4Y0OA 4RX2A 2G2UA 1MWSA 4PM5A 1K57C 2ZC5B 3A3DA 1QMFA 4R1GA 4E3JA 1L0EA 3IF5A 5CXWA 1FCNA 1K25A 3QNBA 4B88A 3UDIA 4E3NA 5A93A 1RGYA 4X68A 1GHPA 1U60A 2Q9NA 2J9OA 2H10A 4B4ZA 3Q7VA 4HESA 2Y2KA 5HX9A 2J7VA 1PWGA 3CZDA 5TGFA 4KZ4A 4OQGA 3IF6C 3ZG9B 4NETA 2V1ZA 3IWIA 4KZ7A 1LI9A 1PZOA 3BFFA 2JC7A 4KQOA 1LI0A 4N9KA 4RA7A 1K4FA 4S2JA 4JBFA 3NI9A 4DE3A 1G6AA 4WBGA 4EBLA 3QNCA 2A3UA 1FR1A 2EX8A 1IYPA 1S6RA 3ZCZA 1XA7A 3IWOA 3V3RA 1XKZA 1ZC2A 1PIOA 2IWCA 2WKIA 1NY0A 2Y2OA 1ZG6A 5FQKA 4LV3A 1N9BA 5AQAA 4S2KA 4DE1A 1NYYA 3GR2A 3W4QA 5M18A 3PBSA 4OQIA 4IVIA 2ZQAA 5E2FA 4OOMA 4MBHA 3A3IA 2Z2LB 4ID4A 5E2EA 4XUXA 3MXRA 1K6RA 1MY8A 3G2ZA 4UA6A 5DF7A 4HEFA 1FR6A 1S0WA 2XK1A 3FZCA 4N1HA 3SS5A 4P0MA 1RCJA 5GLBA 4LCLA 4JPMA 1L2SA 5HAIA 3ZFZA 5GL9A 1RGZA 3V39A 5FQIA 1JWVA 2DCFA 2XFSA 3O86A 4YFMA 4P87A 1H8ZA 5BOHA 2X71A 3HUOA 3LCEA 1YLZA 4KZ9A 4EWFA 4O7DA 3HUMA 5FI2A 3M6HA 1IKGA 3LY3A 4K0XA 2G2WA 4IBRA 5CRFA 3OPLA 1FQGA 2GDNA 1XA1A 2XD1A 3C5AA 3A3EA 4L0LA 4PPRA 3VP0A 4GN2A 4PM8A 3V5MA 2HP5A 3W4OA 3W4PA 3DW0A 4BL3A 4EQIA 3BYDA 3BEBA 1EI5A 5EE8A 5CERA 1K55C 5CGWA 3UDFA 2ZJ9A 3MKFA 1YLJA 4JF5A 3RJUA 4WZ5A 3O88A 2B5RA 1W79A 1QMEA 1EWZA 2Y2MA 4C75A 5FAQA 1H5XA 2Y2GA 3G2YA 1MKIA 1FOFA 2WZZA 4KG6A 3FWLA 3WS5A 1PW1A 3G30A 2WAFA 1NXYA 3IXDA 1KDSA 4R4SA 3HLFA 1BZAA 2Y2PA 5FQMA 1FCOA 4BL2A 3MZEA 1ES4A 3PAGA 4BD0A 2X01A 4DXCA 3LY4A 1YLPA 4OH0A 3BM6A 4KQQA 1ES3A 3D4FA 1G68A 4LCMA 3G34A 1YLYA 3A3JA 3HLEA 5FAOA 5FA7A 3SH8A 4ZJ2A 4LENA 2A49A 2ZM0A 1K38A 4MLLA 5FASA 3UPNA 1JWZA 1KGEA 3HBRA 1E3UD 4GDBA 4LV2A 2H0YA 3G32A 3VP3A 1I5QA 1XX2A 5TFQA 3RXWA 1K57A 4EUZA 5FI7A 2Y2JA 4BD1A 1JVJA 4DF6A 5DTTA 3ZDJA 4U3TA 4N92A 1IELA 3ITAA 2DNSA 3HLWA 3BLSA 2WKHA 5DF8A 4EBNA 4KZ6A 3HL9A 4C3QA 2P74A 3N4IA 3IH8A 1SCWA 2WAEA 3IF6A 3MKEA 5M1AA 4E3OA 4ZDXA 1LL5A 5HFOA 4WMCA 1SDNA 1WYBA 2ZQCA 3MBZA 1SHVA 2P9VB 2ZMAA 4DRTA 1NZOA 5J8XA 5JYOA 5KSHA 1IYQA 2HP9A 3N8LA 3OPPA 3ZNYA 1WYCA 4FD8A 1Q2QA 3VMAA 3P09A 4MBKA 4PMAA 4DE0A 4JXGA 2J8YA 3WRZA 1JWPA 4EV4A 5HAPA 2ZD8A 4KG2A 1TDGA 1CI8A 2WADA 3OZHA 1MWRA 3UPOA 4FH2A 3W8KA 3NBLA 1W7FA 3PAEA 1KDWA 2H5SA 4UA7A 1ES2A 4OVDA 2RCXA 3UPPA 1WE4A 4LV0A 3G4PA 1PYYA 4KZAA 1ONHA 4K91A 3ZNTA 1KE0A 1MPLA 1PI4A 1ZG4A 5EECA 1KVLA 3Q82A 5CTMA 5EVID 5FAPA 3IHBA 2ZC6B 4MBFA 4ZJ1A 5CHMA 3GSGA 2OLUA 1XPBA 5EVIB 1FCMA 3BECA 1HD8A 4MEZA 2ZC3B 2Y2QA 4MNRA 4UHUA 1L0GA 2HDUA 3QHYA 3RXXA 3WS1A 4QJGA 4BLMA 5FATA 2Y55A 1LLBA 2R9WA 2Y4AA 3O87A 3S1YA 3MZDA 4M3KA 3FKWA 5EPHA 2Y91A 1VM1A 2WGWB 3SS3A 3CJMA 2PBYA 4DDYA 4KZ8A 3C7UA 1NJ4A 4D2OA 3MXSA 4GB7A 5G18A 4S2LA 4WYYA 1K55A 2EX6A 2EXBA 3M6BA 5FDHA 3V50A 5FI6A 1YLTA 2WGIA 4QHCA 4WEJA 3N8RA 5EVIC 1O7EA 2XLNA 3VOZA 5A92A 4H8RA 3ZVTA 2ZQ8A 4R3JA 2PU4A 5HL1A 3G31A 4JLFA 1SDEA 3UE1A 1Q2PA 4OPRA 3ZGAB 4S2PA 2E8IA 3ZG7B 4X56A 2XEPA 2ZC4B 4OP5A 4FSFA 5E43A 3BFDA 2WK0A 4U0TA 4GD6A 4E3IA 1CEFA 2Y2IA 3PBRA 4R0QA 5AQ9A 5HARA 3MZFA 5JYPA 2Z2MB 2XQZA 3NDGA 4CJNA 2J9PA 2X02A 3UDXA 3OCNA 3SS4A 3DWZA 1CK3A 4OLGA 4PM6A 5FQQA 3CG5A 1DY6A 2WKEA 2FFYA 4WEKA 5AQ7A 4HBTA 3GMWA 4Y0UA 3UNWA 3SH7A 4P85A 5F82A 4JKTA 3IQAA 3VSKA 1J9MA 1XGJA 3IXHA 1ALQA 5CHUA 1XP4A 3PBOA 2C5WB 4JXSA 4QY5A 3UE0A 1M40A 4X6TA 3Q1FA 5FQJA 4ZTKA 1MWUA 1K54C 4IBXA 3ZVWA 3WWXA 3IT9A 3IHAA 4U0XA 1AXBA 3HLGA 2HDRA 5KSCA 2ZC7A 4K0WA 4BQMA 3HLDA 2IWDA 4WELA 5GHYA 3WRTA 4ZJ3A 4PM7A 3DWKA 1BT5A 1VQQA 5F1GA 1BLHA 3TSGA 2XH9A 3BLMA 2ZM2A 1E3UA 4GZBA 5KMWA 4F94A 1ZKJA 1NZUA 1YMSA 1PZPA 3VFFA 1E25A 2JE5A 3ITBA 1BLSA 3CMZA 3NC8A 1K56D 3PBTA 1DJBA 2XFTA 5KZHA 4FH4A 1FSWA 1HTZA 3S4XA 2HP6A 3JYIA 3AGFA 4B4XA 1YM1A 3E2LA 3PTEA 3IXGA 2HPBA 3HREA 4Y7PA 3EQUA 3GVBA 2Y59A 3NDEA 5EVLA 1KGFA 4KENB 2OSUA 3N8SA 3UO9A 1MBLA 3IH9A 2ZLYA 3UY6A 2JBFA 4R4RA 5DTKA 1N4OA 3IF6B 3IWQA 4N1XA 3C4PA 5E2HA 1NRFA 2P9VA 4E6WA 3HVFA 4X53A 1YQSA 1BULA 1ERQA 1IYOA 1LHYA 3V3SA 4GKUA 3WS4A 1W5DA 4E3MA 1L0DA 3Q7VB 1FSYA 4C6YA 2EFUA 3ZG8B 4R23A 4S2NC 1MXOA 3GRJA 4KQRA 2XD5A 1DJCA 2PU2A 2RL3A 5IHVA 4QD4A 4OOYA 5CEBA 1TVFA 4OKPA 1GA0A 1K4EA 4OLDA 4GD8A 4JXVA 4CPKA 3NIAA 4E3LA 1ESIA 3Q81A 3HLCA 5CGSA 4BENA 5A90A 3E2KA 3FKVA 1C3BA 2EFXA 2XF3A 3FV7A 1XGIA 4LV1A 4OPYA 4ZAMA 3WS2A 1IEMA 1TDLA 3OC2A 3AGDA 4OP8A 5CHJA 3GV9A 3M2JA 2BG1A 3O3VA 4KZBA 4QU3A 1I2WA 5DVAA 5FSRA 3DTMA 3MFDA 1JTDA 1SKFA 1PW8A 1ONGA 4X55A 1W8YA 2R9XA 3N7WA 5EVIA 4JF6A 1I2SA 3BFGA 1W8QA 3NY4A 2OV5A 4RYEA 5D3OA 3BFEA 3G35A 3GTCA 1BTLA 4DKIA 1KVMA 3C4OA 2JCHA 5A91A 2QMIA 4A5RA 1HZOA 1CI9A 1YMXA 4PM9A 5CECA 3S22A 2WGWA 3TOIA 1Y54A 4QY6A 4DE2A 1GA9A 2C6WB 1KGGA 2QZ6A 3C7VA 4JF4A 3UE3A 1EROA 2OLVA 4OQ0A 3VP4A 5HAQA 2EX2A 5M19A 2I72A 3IXBA 5GHZA 4DXBA 5I94A 4Z9QA 4FCFA 4E6XA 1PWDA
chains in the Genus database with same CATH superfamily
2LB5A 3AGEA 2XDMA 4BJPA 3P98A 5DJTA 4HH3A 4RX3A 4JXWA 5GLCA 3QP8A 4KZ5A 5GLAA 1PWCA 1BSGA 1JTGA 4HBUA 1K54A 3MXQA 2IWBA 2EXAA 4Y0TA 3VOYA 3B3XA 1IYSA 4UA9A 1GHMA 4Y15A 2XROA 4OQHA 4Z1WA 1ES5A 5DF9A 2ZQDA 4HP4A 5AQBA 3SOIA 1TS0A 2JKTI 4WZ5C 3C38A 4S2OA 3A3FA 2PHYA 4XT2B 1JNUA 4OOLA 5FL3A 3K3DA 1YAXA 2Y2NA 1OPXA 2QKPA 1S66L 1PRQA 4CLCE 3B33A 3TE8A 4OONA 1K56A 2M1CA 5HD5A 1K6SA 3OPRA 3LIEA 4RVAA 2ACGA 1KE4A 5HW3A 3KSGA 1HLUP 2G2UA 1W63M 2ZOIA 5L07A 2JKFA 1K25A 3QNBA 4ETZA 1RGYA 3VE3A 2Q9NA 4B4ZA 2J9OA 3Q7VA 4HESA 4GCZA 5HX9A 2W3FA 3QP1A 4KZ4A 1PZOA 1VETB 4Y3IA 2NUPC 2JC7A 4N9KA 3MJQA 4S2JA 4JBFA 3MQ0A 3KO6A 2GJ3A 1SKOB 2E8JA 2NUTC 5HSQA 1FR1A 3OLOA 3V3RA 5FQKA 4LV3A 3NHQA 4NG2A 3BW6A 5E2FA 4M4XA 3MQOA 4ID4A 3H7WB 1K6RA 3D72A 2ZL1B 3L7HA 1FR6A 3F1OA 2XK1A 3SS5A 1RCJA 5GLBA 4LCLA 5G4YA 1RGZA 2L0WA 2VZWA 1H8ZA 5BOHA 3HUOA 4GS9B 5FI2A 2VV6A 2CMNA 2EWWA 2G2WA 3C5AA 4L0LA 3VP0A 3DW0A 4KUKA 2FH5A 1K55C 5CGWA 3MKFA 1X0OA 1YLJA 4JF5A 3DTEA 2Y2MA 2Y2GA 4KG6A 3WS5A 1OTAA 3UMDA 2W1TA 3IXDA 1BZAA 1FCOA 4NKPA 3T1SA 1ES4A 2MJ6A 4B9OA 2QHKA 4O8GA 2PYRA 5AVFA 3CHWP 1V9YA 2L4RA 1F5MA 1P9RA 4K08A 3A3JA 3HLEA 2L1MA 2QJ7A 2JKRM 2XRNA 5EVEA 4Q0IA 2H0YA 3RXWA 4EUZA 4IUKA 5DJUA 5TBMA 3ZDJA 3S7PA 1H3QA 2DNSA 2WKHA 4KZ6A 4BBUA 2P74A 1SCWA 5M1AA 4ZDXA 1T1AA 4WMCA 1SDNA 1WYBA 2ZMAA 3F1NA 1LSWA 4Y5FA 4FD8A 2WKQA 4FOFA 4MBKA 3B47A 1JWPA 4EV4A 2HGVA 2ZD8A 2HF6A 3O5YA 1CI8A 3W8KA 2PBDP 3NBLA 5FEFA 1KDWA 2H5SA 4PKYG 1D7EA 3UPPA 2RCXA 4LV0A 3A0RA 3G4PA 1XFQA 1ONHA 1KE0A 1ZG4A 5EECA 1KVLA 5CTMA 5FAPA 3IHBA 2HJEA 4MBFA 5CHMA 1L0GA 2HDUA 2JN7A 1UGUA 1PFLA 2Y55A 2Y4AA 1T19A 2VV8A 3MZDA 2WGWB 3CJMA 2PBYA 4CLCB 4WYYA 2PD7A 2EXBA 4P6ZM 3N8RA 2W1RA 4NXEA 2ZQ8A 2GNXA 3TJZC 3LR5A 4EQ1A 3ZGAB 4OP5A 5E43A 4CLCC 5HARA 3PBRA 3KSIA 1OTBA 3NDGA 2X02A 2PR5A 3OCNA 3SS4A 3DWZA 1DY6A 2WKEA 4HJ3A 1A0KA 2P7JA 3UNWA 2JKRI 2V9AA 3IQAA 3IXHA 4Y13A 1XP4A 2VJWA 4G3KA 2PRFA 2OWJA 1K54C 4IBXA 5L8MA 4XT2A 3IT9A 5C5KA 4K0WA 1Z09A 5EV0A 3HLDA 3UB9A 3WRTA 3LR4A 4PM7A 2KDKA 1BT5A 1BLHA 5DKLA 5KMWA 3FPWA 1OTIA 3LR3A 3CLOA 4MMNA 2JE5A 3ITBA 1BLSA 3CMZA 3NC8A 3T4KA 1DP6A 5CX7A 1FSWA 1HTZA 3S4XA 1YM1A 4Y7PA 3E98A 3EQUA 4LFUA 2A24A 5HPIA 3IH9A 2ZLYA 3UY6A 4R4RA 1N4OA 4N1XA 3C4PA 2P9VA 4X1MA 1YQSA 4DMZA 4PKYA 1LHYA 4E3MA 2PD8A 3Q7VB 1FSYA 2EFUA 1DJCA 4QD4A 2HV1A 3BJNA 4GD8A 4JXVA 3NIAA 1SKOA 4E3LA 1CJFA 5CGSA 4BENA 1WA9A 4B93A 1PNEA 1D1JA 3OC2A 4OP8A 5CHJA 1I2WA 5FSRA 1PW8A 3NULA 1ONGA 4MN7A 5K5BA 1NRJA 4RYEA 3G35A 4HJ6A 3GTCA 4A5RA 4PM9A 3S22A 3RTYA 3F1OB 4QY6A 4DE2A 3NOUC 2C6WB 3GDIA 5HAQA 5M19A 3VP4A 5GHZA 4DXBA 2OAQ1 1MC0A 5F5YA 1HVBA 4NXGA 5DTSA 4EETB 2OWHA 4X69A 4Q8IA 4GOGA 3T1RA 3LIAA 1ERMA 4ZRRA 5E2GA 3SH9A 4LRXC 1CF0A 1O07A 2DMWA 2Q9MA 2W1TB 3ZG5A 3ZHHA 1H8YA 2O9AA 1MKMA 1OMEA 1YT4A 1GCEA 3ISGA 4IVKA 4WZ4A 1PI5A 4ZBEA 2H0TA 5GLDA 3HUNA 3OPHA 1D06A 5FQ9A 4S2MA 1XFNA 3TG9A 3TRCA 2HDSA 3Q07A 2VGKA 4OPQA 3Q7ZA 1ZHHB 4EU0A 5TBMB 1XJ6A 1G5UA 3A0VA 2I9VA 4DDSA 4ARZB 3BFCA 5EFWA 2DRWA 2BTFP 5CGXA 2ZQ7A 3ZVTA 5L2FA 5EUAA 1IKIA 4EBPA 4HHDA 3F1NB 3VP1A 1TS8A 2ZC5B 3A3DA 1L0EA 3PHYA 3IF5A 5CXWA 3UDIA 4GW9A 4RQ9A 4X68A 4BBVA 1GHPA 1U60A 2H10A 3LI8A 1L3LA 4OQGA 3ZG9B 4G3VA 3IWIA 4WLAA 3BFFA 4ME4A 2H28A 4KQOA 1LI0A 4BMWA 1G6AA 4UQIS 4YWZA 3QNCA 1SZVA 3S7QA 2IWCA 1NY0A 4Q0HA 1LSXA 4DE1A 1NYYA 3GR2A 3W4QA 3PBSA 4OQIA 4IVIA 2ZQAA 4OOMA 2Z2LB 4HQAA 4XUXA 5E2EA 3MXRA 3S7NA 2P08A 4X1LA 3CITA 4HEFA 3K3CA 4N1HA 4P0MA 1L2SA 3JVVA 5HAIA 5HDCA 3V39A 1OTEA 4HIAA 3O86A 4WL9A 3LCEA 1YLZA 3T12B 2Q0OA 3M6HA 1IKGA 1P0ZA 4IBRA 4WF0A 1XA1A 3P7NA 3W2ZA 3W4PA 4EQIA 4BL3A 3BYDA 3BEBA 5CERA 1DP8A 4HI4A 2Y79A 4IHQA 2Y8HA 4O0PA 1FOFA 2WZZA 3G30A 4R4SA 3HLFA 2PR6A 3MZEA 3PAGA 4DXCA 2PT7A 4KQQA 4LCMA 3B42A 3VV4A 5FA7A 4ZJ2A 3T4QA 2A49A 2ZM0A 5FASA 4II7A 3NOPC 4Y2FA 4HJ4A 3VP3A 3D3OA 4BWIA 5FI7A 4KUOA 5DTTA 4U3TA 3HLWA 4EBNA 5DF8A 4C3QA 3E4PA 3IH8A 3S7OA 2A24B 2WAEA 1LL5A 4DRTA 2ZQCA 2P9VB 3IX8A 5JYOA 1IYQA 2HP9A 3HJIA 3OPPA 1Q2QA 2W3DA 1H8MA 1TDGA 1N9OA 3UPOA 2XSSA 4NXBA 1G28A 2GX5A 3ICYA 4UA7A 1ES2A 2W27A 4OVDA 1WE4A 3ZQ5A 5J3WA 3F1PA 2VV7A 4QWOA 3ZNTA 1PI4A 1EW0A 3K2NA 3H9WA 2ZC6B 2OLUA 2ZC3B 3CAXA 4MN6A 4QJGA 1J3WA 2M7UA 1LLBA 2K31A 3MMHA 2Y91A 3SS3A 4CLCD 4KZ8A 3C7UA 3C2WA 4S2LA 3CUEA 2IA2A 3IS2A 2EX6A 5DFYA 5KIZA 1YLTA 4WEJA 2XLNA 3G31A 4JLFA 2V8CA 3HCYA 4OPRA 4S2PA 2E8IA 2XEPA 4FSFA 3G6OA 4U0TA 2Y2IA 3EEHA 3T4JA 4R0QA 2XQZA 5IS1A 2K7SA 4OLGA 4PM6A 5G4ZA 5AJGA 5FQQA 3CG5A 2FFYA 1YKDA 5F82A 5F69A 4QY5A 4X6TA 3C8CA 3R4KA 3WWXA 4LPZA 2HDRA 2ZC7A 4BQMA 2IWDA 5GHYA 5F1GA 3LIDA 2ZM2A 1E3UA 3C30A 4F94A 1TF1A 3VFFA 1VEUB 2OAP1 4ARZA 1K56D 1IFQA 1OT6A 3JYIA 3PTEA 1GSVA 2VLGA 3GVBA 2HJ9C 4KENB 2OSUA 2BASA 1MBLA 4BBTA 4EXOA 4PAUA 3IF6B 3IWQA 4E6WA 3HVFA 4X53A 2B18A 3HJKA 1ERQA 3V3SA 4C6YA 3ZG8B 2XD5A 2PU2A 5CEBA 4OOYA 1TVFA 1GA0A 4OLDA 2VEAA 1C3BA 2EFXA 2XF3A 1XGIA 4YOFA 3V67A 3IX4A 3BQAA 3GV9A 3O3VA 4KZBA 4QU3A 4KQDA 5DVAA 3MFDA 1SKFA 4X55A 4I3JA 2XA7M 5EVIA 4ETXA 1I2SA 3BFGA 1W8QA 3NY4A 4LLOB 4I38A 1BTLA 5IU1A 4DKIA 1VHMA 3C4OA 5A91A 4JGPA 1CI9A 1YMXA 4DN0A 4Y17A 2D02A 1EROA 2VKSA 3BY8A 4OQ0A 2ZMVA 5I94A 4FCFA 1YPRA 3OCLA 3M2KA 3MS6A 3EGXC 2BLSA 1RP5A 1P97A 1NYMA 3RFBA 2ZBBA 3FYZA 3KSFA 3D9YA 2VGLS 4UQIM 1YLWA 4EEPA 2VK3A 4EW7A 3VFHA 4KZ3A 4GNUA 4WM9A 3GQZA 2Z6DA 3KYZA 5EOOA 4I5SA 3LO7A 2WUQA 1FILA 4IEDA 5EOEA 3EEAA 2ZM8A 4KG5A 1KE3A 3N6IA 5CTNA 2WKRA 2WGVA 2O9CA 2XR0A 2QPNA 4R38A 2HDQA 3T4TA 4YINA 4N9LA 3NCKA 4EERA 3LEZA 2FFFB 2Y2LA 5GHXA 1S1YA 1BYWA 4LGWA 3LUQA 1UWNX 3PBQA 1ESUA 2ZQ9A 1M6KA 4O01A 5F68A 2EX9A 3T50A 1XJ2A 3UB7A 4S2NA 4I39A 4AFIA 2UWXA 4WMCD 4QB8A 2WYXA 1MWTA 1GHIA 2V20A 1DJAA 3KX0X 2W3GA 4PM5A 1MWSA 1QMFA 3LYXA 4R1GA 4E3JA 1FCNA 4E3NA 1P9WA 4I3IA 2EWVA 2W3EA 2Y2KA 2AVXA 1PWGA 2ZMFA 1K4FA 3NI9A 3F1PB 1S4RA 1TS6A 3EGDC 2A3UA 2EX8A 1IYPA 1S6RA 3QP6A 1XA7A 3IWOA 1ZC2A 4DJ3A 1STZA 5J4EA 1N9BA 1S67L 3DBAA 3A3IA 4GJ4A 3G2ZA 1S0WA 3IS2B 3FPVA 5GL9A 3UMEA 5FQIA 2DCFA 2XFSA 4P87A 4EWFA 4KZ9A 4CQHA 4G3WA 4DJ2A 3VOLA 5CRFA 1FQGA 3A3EA 4GN2A 4PM8A 3V5MA 3NECA 1OT9A 4GHIB 5EE8A 3CUEC 3O88A 2B5RA 2UV0E 2GZAA 4C75A 1H5XA 3G2YA 5HWTA 5HZHA 3FWLA 4R3AA 1KDSA 3T1QB 5FQMA 1TD5A 3UB5P 4BD0A 2X01A 3LICA 1AWIA 3BM6A 5HPFA 1ES3A 4JGQA 3D4FA 1YLYA 4R70A 1K38A 1Y28A 4MLLA 3UPNA 4L9GA 4GDBA 3GECA 4LV2A 1VEUA 3G32A 3FC7A 1I5QA 3FG8A 1XX2A 2XA7S 5MC7A 4JGRA 1K57A 2Y2JA 4BD1A 2PYPA 3HL9A 3E0YA 3IF6A 4IUHA 1SHVA 1NZOA 3N8LA 3ZNYA 4DE0A 3P09A 3WRZA 3P01A 4KG2A 2V1BA 2YKHA 3OZHA 1MWRA 4FH2A 3LR0A 5HDDA 1W7FA 2V1AA 1K0KA 1PYYA 4KZAA 3RH8B 4K91A 1MPLA 3Q82A 3CPTA 4ZJ1A 3GSGA 1XPBA 5EVIB 1FCMA 1HD8A 2Y2QA 4UHUA 3QHYA 4BLMA 2VX8A 2R9WA 3O87A 3S1YA 3FKWA 5EPHA 3MXSA 4GB7A 5G18A 1W63Q 3PYPA 3M6BA 3V50A 5FI6A 4QHCA 5EVIC 1O7EA 1LSVA 4H8RA 4R3JA 2PU4A 5HL1A 1SDEA 2KLIA 5EM0A 4X56A 2Z6CA 2WK0A 4E3IA 4GD6A 1CEFA 5AQ9A 3MZFA 4CJNA 2R78A 1CK3A 2V0WA 4WEKA 2WKPA 1T1BA 3SH7A 3U2AA 4JKTA 4QPRA 3KYEA 1XGJA 1ALQA 2KOIA 3PBOA 2C5WB 4EUVA 5FQJA 3MF0A 4ZTKA 5DFXA 5DKKA 5J7EA 4U0XA 3IHAA 3HLGA 3ZYTA 4E04A 3TW8A 1H0MA 4MCWA 2INWA 1F2KA 4GLQA 1Y4OA 4GZBA 3A0SA 1NZUA 3LIFA 2VGLM 2HZ5A 5HWWA 1DJBA 2XFTA 5HWVA 5KZHA 4FH4A 2M7VA 4LRZE 3E2LA 5A8BA 3MFXA 2JKGA 2J3TC 3IXGA 3MR0A 5AVEA 2Y59A 3N8SA 3UO9A 2JBFA 5DTKA 1OTDA 4EEUA 1V9ZA 3WS4A 3L9KA 4R23A 4S2NC 4PHTA 3GRJA 4HOIA 2RL3A 5IHVA 4OKPA 1YSQA 1ESIA 3LEQA 5A90A 3DTKA 4LV1A 4OPYA 4ZAMA 3WS2A 3AGDA 5I5LA 1JTDA 1W8YA 2R9XA 3N7WA 4JF6A 3BQ8A 3IBJA 2OV5A 5D3OA 3BFEA 1GSWA 3LFVA 2QMIA 3LGOA 1HZOA 5CECA 1GA9A 4WUJA 5HD3A 3CWFA 2Z2MB 2CC1A 3VP2A 2JHEA 1CEGA 3LI9A 3PBNA 1BLPA 4GHIA 4D60A 1GSXA 2B02A 5U47A 4S2IA 1LL9A 2V2FF 3UN7A 3WS0A 2QJ5A 3EQVA 4MN5A 3I7JA 4UAAA 1N9LA 4NXFA 1XXMA 1E4DA 1N9NA 1G6OA 5TR7A 1ZTUA 1BUEA 1Z6FA 4WN5A 4E3KA 2KX6A 5FDSA 5CEDA 4ESPA 2XGNA 1TEMA 5F1FA 3HLBA 4R3BA 2FZ0A 3BRMA 4H6JB 3H82A 4HP9A 1IOUA 3VSLA 4FTXA 3UE6A 4Q0JA 4XUZA 3ZG0A 2WZXA 2VGJA 4NK3A 3KSHA 4P6BA 2Y2HA 5HL6A 1BLCA 4XXRA 4JGOA 1L0FA 4OPZA 2W0NA 4GDNA 1S4SA 3QP4A 5F83A 4Y0OA 3OOVA 4RX2A 1K57C 1YSPA 1NLYA 4B88A 5A93A 1KOUA 3T4LA 2B95A 4F3LA 2J7VA 3CZDA 5TGFA 3IF6C 4NETA 2V1ZA 3NJAA 4KZ7A 1LI9A 2J80A 4RA7A 4DE3A 3JVUA 4WBGA 4EBLA 3T4OA 3EWKA 3CPTB 3ZCZA 5F6AA 1XKZA 2EA9A 1PIOA 2WKIA 2Y2OA 1ZG6A 2W3HA 4R6LA 4MDZA 5AQAA 4S2KA 5M18A 4MBHA 5FEGA 3IBRA 1OJGA 1MY8A 4UA6A 5DF7A 3R7WA 3FZCA 4JPMA 3ZFZA 2OOLA 1JWVA 4YFMA 2X71A 4O7DA 3HUMA 2P04A 3LY3A 4K0XA 3OPLA 2GDNA 2XD1A 4PPRA 3W4OA 4UEYA 2HP5A 3MQQA 1EI5A 1NLZA 3UDFA 2ZJ9A 3SW1A 3RJUA 4WZ5A 2VA0A 1W79A 1QMEA 1EWZA 5FAQA 3NOTC 1MKIA 1PW1A 3BY9A 2WAFA 3QP2A 3CI6A 1NXYA 2Y2PA 5HDSA 4BL2A 3ULFA 3LY4A 1TS7A 1YLPA 4OH0A 1G68A 3G34A 5FAOA 3SH8A 4LENA 1JWZA 1KGEA 3HBRA 1E3UD 1FIKA 3E4OA 2QYBA 3T1XA 1XJ3A 4IJGA 5TFQA 1JVJA 4DF6A 4EESA 4I3AA 4N92A 1IELA 3ITAA 3BLSA 3N4IA 3MKEA 4HY8A 4E3OA 5HFOA 3MBZA 5J8XA 1ACFA 1WYCA 3VMAA 4PMAA 4JXGA 2J8YA 5HAPA 3U4LP 3IX3A 2WADA 2G7UA 3PAEA 4LRYC 1VETA 5L10A 4NEED 4YNRA 1LT0A 1NWZA 5EVID 3LIBA 3BECA 4MEZA 4MNRA 3QP5A 2K2NA 3RXXA 3WS1A 5FATA 4HNBA 4M3KA 3H7WA 1VM1A 4FUWA 1LL8A 4DDYA 5TJJA 1NJ4A 4D2OA 2ZL1A 1K55A 5FDHA 2O0YA 3PXPA 2WGIA 3VOZA 5A92A 4L9EA 4GS9A 3BWLA 3UE1A 1Q2PA 3KYQA 3ZG7B 2ZC4B 5EM1A 3BFDA 5KSHA 5JYPA 3MSHA 2J9PA 2ZOHA 3UDXA 1DRMA 3DAVA 5AQ7A 4HBTA 2O99A 3GMWA 4Y0UA 4P85A 3OBFA 3E4QA 3VSKA 1J9MA 5L09A 5CHUA 4JXSA 3UE0A 1M40A 1OJ5A 3Q1FA 1MWUA 1MZUA 1DP9A 3ZVWA 2J3TD 1AXBA 5KSCA 4H6JA 3T4SA 4WELA 3PR6A 2J3WA 4ZJ3A 1S1ZA 3H82B 3DWKA 1VQQA 2A2LA 3TSGA 2XH9A 3BLMA 3VE4A 2JKTM 1ZKJA 1YMSA 1PZPA 1E25A 3PBTA 4B4XA 2HP6A 1F98A 2QWSA 3AGFA 2O9BA 5IT5A 2HPBA 3HREA 4HH2A 2YKFA 3NDEA 2V0UA 5EVLA 1KGFA 1F9IA 5E2HA 1NRFA 1BULA 3UB8A 1IYOA 4P6ZS 4GKUA 1W5DA 1L0DA 1XJ4A 4F3LB 2PAVP 3EOIA 1MXOA 5LBRA 1CQAA 4KQRA 1K4EA 4CPKA 3Q81A 4X25A 3HLCA 3SZTA 3E2KA 3FKVA 3FV7A 4L9FA 1IEMA 1TDLA 3M2JA 2BG1A 2PDRA 1T1CA 2LB9A 3DTMA 2V8FA 1ODVA 1VB6A 1T18A 1KVMA 2JCHA 3DTIA 1UWPX 2WGWA 3R7WB 3TOIA 3UB6A 1Y54A 2D01A 1KGGA 2QZ6A 3C7VA 3UE3A 4CLCA 2OLVA 2EX2A 3JPUA 2I72A 3IXBA 4Z9QA 4JF4A 4E6XA 1PWDA
chains in the Genus database with same CATH topology
3AGEA 2CC1A 2XDMA 1HVBA 3OCLA 3M2KA 4BJPA 3P98A 3VP2A 2BLSA 4RX3A 1CEGA 1RP5A 5DTSA 3PBNA 1BLPA 4JXWA 1NYMA 5GLCA 4X69A 4KZ5A 4Q8IA 5U47A 4GOGA 3FYZA 5GLAA 4S2IA 1LL9A 2V2FF 3UN7A 1ERMA 1YLWA 1PWCA 1BSGA 1JTGA 5E2GA 4HBUA 3VFHA 4KZ3A 3WS0A 1K54A 4GNUA 4WM9A 3GQZA 3SH9A 3EQVA 1O07A 2IWBA 2EXAA 2Q9MA 4Y0TA 3VOYA 3B3XA 3I7JA 4UAAA 5EOOA 1IYSA 3ZG5A 3ZHHA 1XXMA 3LO7A 4UA9A 1E4DA 1H8YA 1GHMA 2WUQA 4IEDA 5EOEA 5TR7A 4OQHA 2ZM8A 1BUEA 1ES5A 5DF9A 2ZQDA 1OMEA 1Z6FA 1YT4A 4KG5A 5AQBA 1KE3A 3SOIA 4E3KA 3N6IA 1GCEA 3ISGA 5CTNA 4WZ5C 4IVKA 4WZ4A 5CEDA 1PI5A 2WGVA 4S2OA 4ZBEA 2XR0A 3A3FA 2QPNA 2H0TA 2HDQA 5GLDA 4YINA 4N9LA 2XGNA 3NCKA 3HUNA 3OPHA 1TEMA 3LEZA 3HLBA 2FFFB 4R3BA 4S2MA 2Y2LA 5FQ9A 5GHXA 3TG9A 5F1FA 3BRMA 4OOLA 2HDSA 3Q07A 3PBQA 2VGKA 2Y2NA 4OPQA 3Q7ZA 3VSLA 4XUZA 3ZG0A 1ESUA 2WZXA 1M6KA 2VGJA 2ZQ9A 4DDSA 4NK3A 4P6BA 4OONA 2EX9A 1K56A 3BFCA 2Y2HA 2DRWA 4S2NA 1K6SA 3OPRA 1BLCA 4XXRA 2UWXA 2ZQ7A 4OPZA 1L0FA 4RVAA 4WMCD 5CGXA 4QB8A 2WYXA 1MWTA 5L2FA 1KE4A 5EUAA 1GHIA 1IKIA 2V20A 4GDNA 4EBPA 5HW3A 1DJAA 3VP1A 5F83A 4Y0OA 4RX2A 2G2UA 1MWSA 4PM5A 1K57C 2ZC5B 3A3DA 1QMFA 4R1GA 4E3JA 1L0EA 3IF5A 5CXWA 1FCNA 1K25A 3QNBA 4B88A 3UDIA 4E3NA 5A93A 1RGYA 4X68A 1GHPA 1U60A 2Q9NA 2J9OA 2H10A 4B4ZA 3Q7VA 4HESA 2Y2KA 5HX9A 2J7VA 1PWGA 3CZDA 5TGFA 4KZ4A 4OQGA 3IF6C 3ZG9B 4NETA 2V1ZA 3IWIA 4KZ7A 1LI9A 1PZOA 3BFFA 2JC7A 4KQOA 1LI0A 4N9KA 4RA7A 1K4FA 4S2JA 4JBFA 3NI9A 4DE3A 1G6AA 4WBGA 4EBLA 3QNCA 2A3UA 1FR1A 2EX8A 1IYPA 1S6RA 3ZCZA 1XA7A 3IWOA 3V3RA 1XKZA 1ZC2A 1PIOA 2IWCA 2WKIA 1NY0A 2Y2OA 1ZG6A 5FQKA 4LV3A 1N9BA 5AQAA 4S2KA 4DE1A 1NYYA 3GR2A 3W4QA 5M18A 3PBSA 4OQIA 4IVIA 2ZQAA 5E2FA 4OOMA 4MBHA 3A3IA 2Z2LB 4ID4A 5E2EA 4XUXA 3MXRA 1K6RA 1MY8A 3G2ZA 4UA6A 5DF7A 4HEFA 1FR6A 1S0WA 2XK1A 3FZCA 4N1HA 3SS5A 4P0MA 1RCJA 5GLBA 4LCLA 4JPMA 1L2SA 5HAIA 3ZFZA 5GL9A 1RGZA 3V39A 5FQIA 1JWVA 2DCFA 2XFSA 3O86A 4YFMA 4P87A 1H8ZA 5BOHA 2X71A 3HUOA 3LCEA 1YLZA 4KZ9A 4EWFA 4O7DA 3HUMA 5FI2A 3M6HA 1IKGA 3LY3A 4K0XA 2G2WA 4IBRA 5CRFA 3OPLA 1FQGA 2GDNA 1XA1A 2XD1A 3C5AA 3A3EA 4L0LA 4PPRA 3VP0A 4GN2A 4PM8A 3V5MA 2HP5A 3W4OA 3W4PA 3DW0A 4BL3A 4EQIA 3BYDA 3BEBA 1EI5A 5EE8A 5CERA 1K55C 5CGWA 3UDFA 2ZJ9A 3MKFA 1YLJA 4JF5A 3RJUA 4WZ5A 3O88A 2B5RA 1W79A 1QMEA 1EWZA 2Y2MA 4C75A 5FAQA 1H5XA 2Y2GA 3G2YA 1MKIA 1FOFA 2WZZA 4KG6A 3FWLA 3WS5A 1PW1A 3G30A 2WAFA 1NXYA 3IXDA 1KDSA 4R4SA 3HLFA 1BZAA 2Y2PA 5FQMA 1FCOA 4BL2A 3MZEA 1ES4A 3PAGA 4BD0A 2X01A 4DXCA 3LY4A 1YLPA 4OH0A 3BM6A 4KQQA 1ES3A 3D4FA 1G68A 4LCMA 3G34A 1YLYA 3A3JA 3HLEA 5FAOA 5FA7A 3SH8A 4ZJ2A 4LENA 2A49A 2ZM0A 1K38A 4MLLA 5FASA 3UPNA 1JWZA 1KGEA 3HBRA 1E3UD 4GDBA 4LV2A 2H0YA 3G32A 3VP3A 1I5QA 1XX2A 5TFQA 3RXWA 1K57A 4EUZA 5FI7A 2Y2JA 4BD1A 1JVJA 4DF6A 5DTTA 3ZDJA 4U3TA 4N92A 1IELA 3ITAA 2DNSA 3HLWA 3BLSA 2WKHA 5DF8A 4EBNA 4KZ6A 3HL9A 4C3QA 2P74A 3N4IA 3IH8A 1SCWA 2WAEA 3IF6A 3MKEA 5M1AA 4E3OA 4ZDXA 1LL5A 5HFOA 4WMCA 1SDNA 1WYBA 2ZQCA 3MBZA 1SHVA 2P9VB 2ZMAA 4DRTA 1NZOA 5J8XA 5JYOA 5KSHA 1IYQA 2HP9A 3N8LA 3OPPA 3ZNYA 1WYCA 4FD8A 1Q2QA 3VMAA 3P09A 4MBKA 4PMAA 4DE0A 4JXGA 2J8YA 3WRZA 1JWPA 4EV4A 5HAPA 2ZD8A 4KG2A 1TDGA 1CI8A 2WADA 3OZHA 1MWRA 3UPOA 4FH2A 3W8KA 3NBLA 1W7FA 3PAEA 1KDWA 2H5SA 4UA7A 1ES2A 4OVDA 2RCXA 3UPPA 1WE4A 4LV0A 3G4PA 1PYYA 4KZAA 1ONHA 4K91A 3ZNTA 1KE0A 1MPLA 1PI4A 1ZG4A 5EECA 1KVLA 3Q82A 5CTMA 5EVID 5FAPA 3IHBA 2ZC6B 4MBFA 4ZJ1A 5CHMA 3GSGA 2OLUA 1XPBA 5EVIB 1FCMA 3BECA 1HD8A 4MEZA 2ZC3B 2Y2QA 4MNRA 4UHUA 1L0GA 2HDUA 3QHYA 3RXXA 3WS1A 4QJGA 4BLMA 5FATA 2Y55A 1LLBA 2R9WA 2Y4AA 3O87A 3S1YA 3MZDA 4M3KA 3FKWA 5EPHA 2Y91A 1VM1A 2WGWB 3SS3A 3CJMA 2PBYA 4DDYA 4KZ8A 3C7UA 1NJ4A 4D2OA 3MXSA 4GB7A 5G18A 4S2LA 4WYYA 1K55A 2EX6A 2EXBA 3M6BA 5FDHA 3V50A 5FI6A 1YLTA 2WGIA 4QHCA 4WEJA 3N8RA 5EVIC 1O7EA 2XLNA 3VOZA 5A92A 4H8RA 3ZVTA 2ZQ8A 4R3JA 2PU4A 5HL1A 3G31A 4JLFA 1SDEA 3UE1A 1Q2PA 4OPRA 3ZGAB 4S2PA 2E8IA 3ZG7B 4X56A 2XEPA 2ZC4B 4OP5A 4FSFA 5E43A 3BFDA 2WK0A 4U0TA 4GD6A 4E3IA 1CEFA 2Y2IA 3PBRA 4R0QA 5AQ9A 5HARA 3MZFA 5JYPA 2Z2MB 2XQZA 3NDGA 4CJNA 2J9PA 2X02A 3UDXA 3OCNA 3SS4A 3DWZA 1CK3A 4OLGA 4PM6A 5FQQA 3CG5A 1DY6A 2WKEA 2FFYA 4WEKA 5AQ7A 4HBTA 3GMWA 4Y0UA 3UNWA 3SH7A 4P85A 5F82A 4JKTA 3IQAA 3VSKA 1J9MA 1XGJA 3IXHA 1ALQA 5CHUA 1XP4A 3PBOA 2C5WB 4JXSA 4QY5A 3UE0A 1M40A 4X6TA 3Q1FA 5FQJA 4ZTKA 1MWUA 1K54C 4IBXA 3ZVWA 3WWXA 3IT9A 3IHAA 4U0XA 1AXBA 3HLGA 2HDRA 5KSCA 2ZC7A 4K0WA 4BQMA 3HLDA 2IWDA 4WELA 5GHYA 3WRTA 4ZJ3A 4PM7A 3DWKA 1BT5A 1VQQA 5F1GA 1BLHA 3TSGA 2XH9A 3BLMA 2ZM2A 1E3UA 4GZBA 5KMWA 4F94A 1ZKJA 1NZUA 1YMSA 1PZPA 3VFFA 1E25A 2JE5A 3ITBA 1BLSA 3CMZA 3NC8A 1K56D 3PBTA 1DJBA 2XFTA 5KZHA 4FH4A 1FSWA 1HTZA 3S4XA 2HP6A 3JYIA 3AGFA 4B4XA 1YM1A 3E2LA 3PTEA 3IXGA 2HPBA 3HREA 4Y7PA 3EQUA 3GVBA 2Y59A 3NDEA 5EVLA 1KGFA 4KENB 2OSUA 3N8SA 3UO9A 1MBLA 3IH9A 2ZLYA 3UY6A 2JBFA 4R4RA 5DTKA 1N4OA 3IF6B 3IWQA 4N1XA 3C4PA 5E2HA 1NRFA 2P9VA 4E6WA 3HVFA 4X53A 1YQSA 1BULA 1ERQA 1IYOA 1LHYA 3V3SA 4GKUA 3WS4A 1W5DA 4E3MA 1L0DA 3Q7VB 1FSYA 4C6YA 2EFUA 3ZG8B 4R23A 4S2NC 1MXOA 3GRJA 4KQRA 2XD5A 1DJCA 2PU2A 2RL3A 5IHVA 4QD4A 4OOYA 5CEBA 1TVFA 4OKPA 1GA0A 1K4EA 4OLDA 4GD8A 4JXVA 4CPKA 3NIAA 4E3LA 1ESIA 3Q81A 3HLCA 5CGSA 4BENA 5A90A 3E2KA 3FKVA 1C3BA 2EFXA 2XF3A 3FV7A 1XGIA 4LV1A 4OPYA 4ZAMA 3WS2A 1IEMA 1TDLA 3OC2A 3AGDA 4OP8A 5CHJA 3GV9A 3M2JA 2BG1A 3O3VA 4KZBA 4QU3A 1I2WA 5DVAA 5FSRA 3DTMA 3MFDA 1JTDA 1SKFA 1PW8A 1ONGA 4X55A 1W8YA 2R9XA 3N7WA 5EVIA 4JF6A 1I2SA 3BFGA 1W8QA 3NY4A 2OV5A 4RYEA 5D3OA 3BFEA 3G35A 3GTCA 1BTLA 4DKIA 1KVMA 3C4OA 2JCHA 5A91A 2QMIA 4A5RA 1HZOA 1CI9A 1YMXA 4PM9A 5CECA 3S22A 2WGWA 3TOIA 1Y54A 4QY6A 4DE2A 1GA9A 2C6WB 1KGGA 2QZ6A 3C7VA 4JF4A 3UE3A 1EROA 2OLVA 4OQ0A 3VP4A 5HAQA 2EX2A 5M19A 2I72A 3IXBA 5GHZA 4DXBA 5I94A 4Z9QA 4FCFA 4E6XA 1PWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGE A;  2CC1 A;  2XDM A;  1HVB A;  3OCL A;  3M2K A;  4BJP A;  3P98 A;  3VP2 A;  2BLS A;  4RX3 A;  1CEG A;  1RP5 A;  5DTS A;  3PBN A;  1BLP A;  4JXW A;  1NYM A;  5GLC A;  4X69 A;  4KZ5 A;  4Q8I A;  5U47 A;  4GOG A;  3FYZ A;  5GLA A;  4S2I A;  1LL9 A;  2V2F F;  3UN7 A;  1ERM A;  1YLW A;  1PWC A;  1BSG A;  1JTG A;  5E2G A;  4HBU A;  3VFH A;  4KZ3 A;  3WS0 A;  1K54 A;  4GNU A;  4WM9 A;  3GQZ A;  3SH9 A;  3EQV A;  1O07 A;  2IWB A;  2EXA A;  2Q9M A;  4Y0T A;  3VOY A;  3B3X A;  3I7J A;  4UAA A;  5EOO A;  1IYS A;  3ZG5 A;  3ZHH A;  1XXM A;  3LO7 A;  4UA9 A;  1E4D A;  1H8Y A;  1GHM A;  2WUQ A;  4IED A;  5EOE A;  5TR7 A;  4OQH A;  2ZM8 A;  1BUE A;  1ES5 A;  5DF9 A;  2ZQD A;  1OME A;  1Z6F A;  1YT4 A;  4KG5 A;  5AQB A;  1KE3 A;  3SOI A;  4E3K A;  3N6I A;  1GCE A;  3ISG A;  5CTN A;  4WZ5 C;  4IVK A;  4WZ4 A;  5CED A;  1PI5 A;  2WGV A;  4S2O A;  4ZBE A;  2XR0 A;  3A3F A;  2QPN A;  2H0T A;  2HDQ A;  5GLD A;  4YIN A;  4N9L A;  2XGN A;  3NCK A;  3HUN A;  3OPH A;  1TEM A;  3LEZ A;  3HLB A;  2FFF B;  4R3B A;  4S2M A;  2Y2L A;  5FQ9 A;  5GHX A;  3TG9 A;  5F1F A;  3BRM A;  4OOL A;  2HDS A;  3Q07 A;  3PBQ A;  2VGK A;  2Y2N A;  4OPQ A;  3Q7Z A;  3VSL A;  4XUZ A;  3ZG0 A;  1ESU A;  2WZX A;  1M6K A;  2VGJ A;  2ZQ9 A;  4DDS A;  4NK3 A;  4P6B A;  4OON A;  2EX9 A;  1K56 A;  3BFC A;  2Y2H A;  2DRW A;  4S2N A;  1K6S A;  3OPR A;  1BLC A;  4XXR A;  2UWX A;  2ZQ7 A;  4OPZ A;  1L0F A;  4RVA A;  4WMC D;  5CGX A;  4QB8 A;  2WYX A;  1MWT A;  5L2F A;  1KE4 A;  5EUA A;  1GHI A;  1IKI A;  2V20 A;  4GDN A;  4EBP A;  5HW3 A;  1DJA A;  3VP1 A;  5F83 A;  4Y0O A;  4RX2 A;  2G2U A;  1MWS A;  4PM5 A;  1K57 C;  2ZC5 B;  3A3D A;  1QMF A;  4R1G A;  4E3J A;  1L0E A;  3IF5 A;  5CXW A;  1FCN A;  1K25 A;  3QNB A;  4B88 A;  3UDI A;  4E3N A;  5A93 A;  1RGY A;  4X68 A;  1GHP A;  1U60 A;  2Q9N A;  2J9O A;  2H10 A;  4B4Z A;  3Q7V A;  4HES A;  2Y2K A;  5HX9 A;  2J7V A;  1PWG A;  3CZD A;  5TGF A;  4KZ4 A;  4OQG A;  3IF6 C;  3ZG9 B;  4NET A;  2V1Z A;  3IWI A;  4KZ7 A;  1LI9 A;  1PZO A;  3BFF A;  2JC7 A;  4KQO A;  1LI0 A;  4N9K A;  4RA7 A;  1K4F A;  4S2J A;  4JBF A;  3NI9 A;  4DE3 A;  1G6A A;  4WBG A;  4EBL A;  3QNC A;  2A3U A;  1FR1 A;  2EX8 A;  1IYP A;  1S6R A;  3ZCZ A;  1XA7 A;  3IWO A;  3V3R A;  1XKZ A;  1ZC2 A;  1PIO A;  2IWC A;  2WKI A;  1NY0 A;  2Y2O A;  1ZG6 A;  5FQK A;  4LV3 A;  1N9B A;  5AQA A;  4S2K A;  4DE1 A;  1NYY A;  3GR2 A;  3W4Q A;  5M18 A;  3PBS A;  4OQI A;  4IVI A;  2ZQA A;  5E2F A;  4OOM A;  4MBH A;  3A3I A;  2Z2L B;  4ID4 A;  5E2E A;  4XUX A;  3MXR A;  1K6R A;  1MY8 A;  3G2Z A;  4UA6 A;  5DF7 A;  4HEF A;  1FR6 A;  1S0W A;  2XK1 A;  3FZC A;  4N1H A;  3SS5 A;  4P0M A;  1RCJ A;  5GLB A;  4LCL A;  4JPM A;  1L2S A;  5HAI A;  3ZFZ A;  5GL9 A;  1RGZ A;  3V39 A;  5FQI A;  1JWV A;  2DCF A;  2XFS A;  3O86 A;  4YFM A;  4P87 A;  1H8Z A;  5BOH A;  2X71 A;  3HUO A;  3LCE A;  1YLZ A;  4KZ9 A;  4EWF A;  4O7D A;  3HUM A;  5FI2 A;  3M6H A;  1IKG A;  3LY3 A;  4K0X A;  2G2W A;  4IBR A;  5CRF A;  3OPL A;  1FQG A;  2GDN A;  1XA1 A;  2XD1 A;  3C5A A;  3A3E A;  4L0L A;  4PPR A;  3VP0 A;  4GN2 A;  4PM8 A;  3V5M A;  2HP5 A;  3W4O A;  3W4P A;  3DW0 A;  4BL3 A;  4EQI A;  3BYD A;  3BEB A;  1EI5 A;  5EE8 A;  5CER A;  1K55 C;  5CGW A;  3UDF A;  2ZJ9 A;  3MKF A;  1YLJ A;  4JF5 A;  3RJU A;  4WZ5 A;  3O88 A;  2B5R A;  1W79 A;  1QME A;  1EWZ A;  2Y2M A;  4C75 A;  5FAQ A;  1H5X A;  2Y2G A;  3G2Y A;  1MKI A;  1FOF A;  2WZZ A;  4KG6 A;  3FWL A;  3WS5 A;  1PW1 A;  3G30 A;  2WAF A;  1NXY A;  3IXD A;  1KDS A;  4R4S A;  3HLF A;  1BZA A;  2Y2P A;  5FQM A;  1FCO A;  4BL2 A;  3MZE A;  1ES4 A;  3PAG A;  4BD0 A;  2X01 A;  4DXC A;  3LY4 A;  1YLP A;  4OH0 A;  3BM6 A;  4KQQ A;  1ES3 A;  3D4F A;  1G68 A;  4LCM A;  3G34 A;  1YLY A;  3A3J A;  3HLE A;  5FAO A;  5FA7 A;  3SH8 A;  4ZJ2 A;  4LEN A;  2A49 A;  2ZM0 A;  1K38 A;  4MLL A;  5FAS A;  3UPN A;  1JWZ A;  1KGE A;  3HBR A;  1E3U D;  4GDB A;  4LV2 A;  2H0Y A;  3G32 A;  3VP3 A;  1I5Q A;  1XX2 A;  5TFQ A;  3RXW A;  1K57 A;  4EUZ A;  5FI7 A;  2Y2J A;  4BD1 A;  1JVJ A;  4DF6 A;  5DTT A;  3ZDJ A;  4U3T A;  4N92 A;  1IEL A;  3ITA A;  2DNS A;  3HLW A;  3BLS A;  2WKH A;  5DF8 A;  4EBN A;  4KZ6 A;  3HL9 A;  4C3Q A;  2P74 A;  3N4I A;  3IH8 A;  1SCW A;  2WAE A;  3IF6 A;  3MKE A;  5M1A A;  4E3O A;  4ZDX A;  1LL5 A;  5HFO A;  4WMC A;  1SDN A;  1WYB A;  2ZQC A;  3MBZ A;  1SHV A;  2P9V B;  2ZMA A;  4DRT A;  1NZO A;  5J8X A;  5JYO A;  5KSH A;  1IYQ A;  2HP9 A;  3N8L A;  3OPP A;  3ZNY A;  1WYC A;  4FD8 A;  1Q2Q A;  3VMA A;  3P09 A;  4MBK A;  4PMA A;  4DE0 A;  4JXG A;  2J8Y A;  3WRZ A;  1JWP A;  4EV4 A;  5HAP A;  2ZD8 A;  4KG2 A;  1TDG A;  1CI8 A;  2WAD A;  3OZH A;  1MWR A;  3UPO A;  4FH2 A;  3W8K A;  3NBL A;  1W7F A;  3PAE A;  1KDW A;  2H5S A;  4UA7 A;  1ES2 A;  4OVD A;  2RCX A;  3UPP A;  1WE4 A;  4LV0 A;  3G4P A;  1PYY A;  4KZA A;  1ONH A;  4K91 A;  3ZNT A;  1KE0 A;  1MPL A;  1PI4 A;  1ZG4 A;  5EEC A;  1KVL A;  3Q82 A;  5CTM A;  5EVI D;  5FAP A;  3IHB A;  2ZC6 B;  4MBF A;  4ZJ1 A;  5CHM A;  3GSG A;  2OLU A;  1XPB A;  5EVI B;  1FCM A;  3BEC A;  1HD8 A;  4MEZ A;  2ZC3 B;  2Y2Q A;  4MNR A;  4UHU A;  1L0G A;  2HDU A;  3QHY A;  3RXX A;  3WS1 A;  4QJG A;  4BLM A;  5FAT A;  2Y55 A;  1LLB A;  2R9W A;  2Y4A A;  3O87 A;  3S1Y A;  3MZD A;  4M3K A;  3FKW A;  5EPH A;  2Y91 A;  1VM1 A;  2WGW B;  3SS3 A;  3CJM A;  2PBY A;  4DDY A;  4KZ8 A;  3C7U A;  1NJ4 A;  4D2O A;  3MXS A;  4GB7 A;  5G18 A;  4S2L A;  4WYY A;  1K55 A;  2EX6 A;  2EXB A;  3M6B A;  5FDH A;  3V50 A;  5FI6 A;  1YLT A;  2WGI A;  4QHC A;  4WEJ A;  3N8R A;  5EVI C;  1O7E A;  2XLN A;  3VOZ A;  5A92 A;  4H8R A;  3ZVT A;  2ZQ8 A;  4R3J A;  2PU4 A;  5HL1 A;  3G31 A;  4JLF A;  1SDE A;  3UE1 A;  1Q2P A;  4OPR A;  3ZGA B;  4S2P A;  2E8I A;  3ZG7 B;  4X56 A;  2XEP A;  2ZC4 B;  4OP5 A;  4FSF A;  5E43 A;  3BFD A;  2WK0 A;  4U0T A;  4GD6 A;  4E3I A;  1CEF A;  2Y2I A;  3PBR A;  4R0Q A;  5AQ9 A;  5HAR A;  3MZF A;  5JYP A;  2Z2M B;  2XQZ A;  3NDG A;  4CJN A;  2J9P A;  2X02 A;  3UDX A;  3OCN A;  3SS4 A;  3DWZ A;  1CK3 A;  4OLG A;  4PM6 A;  5FQQ A;  3CG5 A;  1DY6 A;  2WKE A;  2FFY A;  4WEK A;  5AQ7 A;  4HBT A;  3GMW A;  4Y0U A;  3UNW A;  3SH7 A;  4P85 A;  5F82 A;  4JKT A;  3IQA A;  3VSK A;  1J9M A;  1XGJ A;  3IXH A;  1ALQ A;  5CHU A;  1XP4 A;  3PBO A;  2C5W B;  4JXS A;  4QY5 A;  3UE0 A;  1M40 A;  4X6T A;  3Q1F A;  5FQJ A;  4ZTK A;  1MWU A;  1K54 C;  4IBX A;  3ZVW A;  3WWX A;  3IT9 A;  3IHA A;  4U0X A;  1AXB A;  3HLG A;  2HDR A;  5KSC A;  2ZC7 A;  4K0W A;  4BQM A;  3HLD A;  2IWD A;  4WEL A;  5GHY A;  3WRT A;  4ZJ3 A;  4PM7 A;  3DWK A;  1BT5 A;  1VQQ A;  5F1G A;  1BLH A;  3TSG A;  2XH9 A;  3BLM A;  2ZM2 A;  1E3U A;  4GZB A;  5KMW A;  4F94 A;  1ZKJ A;  1NZU A;  1YMS A;  1PZP A;  3VFF A;  1E25 A;  2JE5 A;  3ITB A;  1BLS A;  3CMZ A;  3NC8 A;  1K56 D;  3PBT A;  1DJB A;  2XFT A;  5KZH A;  4FH4 A;  1FSW A;  1HTZ A;  3S4X A;  2HP6 A;  3JYI A;  3AGF A;  4B4X A;  1YM1 A;  3E2L A;  3PTE A;  3IXG A;  2HPB A;  3HRE A;  4Y7P A;  3EQU A;  3GVB A;  2Y59 A;  3NDE A;  5EVL A;  1KGF A;  4KEN B;  2OSU A;  3N8S A;  3UO9 A;  1MBL A;  3IH9 A;  2ZLY A;  3UY6 A;  2JBF A;  4R4R A;  5DTK A;  1N4O A;  3IF6 B;  3IWQ A;  4N1X A;  3C4P A;  5E2H A;  1NRF A;  2P9V A;  4E6W A;  3HVF A;  4X53 A;  1YQS A;  1BUL A;  1ERQ A;  1IYO A;  1LHY A;  3V3S A;  4GKU A;  3WS4 A;  1W5D A;  4E3M A;  1L0D A;  3Q7V B;  1FSY A;  4C6Y A;  2EFU A;  3ZG8 B;  4R23 A;  4S2N C;  1MXO A;  3GRJ A;  4KQR A;  2XD5 A;  1DJC A;  2PU2 A;  2RL3 A;  5IHV A;  4QD4 A;  4OOY A;  5CEB A;  1TVF A;  4OKP A;  1GA0 A;  1K4E A;  4OLD A;  4GD8 A;  4JXV A;  4CPK A;  3NIA A;  4E3L A;  1ESI A;  3Q81 A;  3HLC A;  5CGS A;  4BEN A;  5A90 A;  3E2K A;  3FKV A;  1C3B A;  2EFX A;  2XF3 A;  3FV7 A;  1XGI A;  4LV1 A;  4OPY A;  4ZAM A;  3WS2 A;  1IEM A;  1TDL A;  3OC2 A;  3AGD A;  4OP8 A;  5CHJ A;  3GV9 A;  3M2J A;  2BG1 A;  3O3V A;  4KZB A;  4QU3 A;  1I2W A;  5DVA A;  5FSR A;  3DTM A;  3MFD A;  1JTD A;  1SKF A;  1PW8 A;  1ONG A;  4X55 A;  1W8Y A;  2R9X A;  3N7W A;  5EVI A;  4JF6 A;  1I2S A;  3BFG A;  1W8Q A;  3NY4 A;  2OV5 A;  4RYE A;  5D3O A;  3BFE A;  3G35 A;  3GTC A;  1BTL A;  4DKI A;  1KVM A;  3C4O A;  2JCH A;  5A91 A;  2QMI A;  4A5R A;  1HZO A;  1CI9 A;  1YMX A;  4PM9 A;  5CEC A;  3S22 A;  2WGW A;  3TOI A;  1Y54 A;  4QY6 A;  4DE2 A;  1GA9 A;  2C6W B;  1KGG A;  2QZ6 A;  3C7V A;  4JF4 A;  3UE3 A;  1ERO A;  2OLV A;  4OQ0 A;  3VP4 A;  5HAQ A;  2EX2 A;  5M19 A;  2I72 A;  3IXB A;  5GHZ A;  4DXB A;  5I94 A;  4Z9Q A;  4FCF A;  4E6X A;  1PWD A; 
#chains in the Genus database with same CATH topology
 2LB5 A;  3AGE A;  2XDM A;  4BJP A;  3P98 A;  5DJT A;  4HH3 A;  4RX3 A;  4JXW A;  5GLC A;  3QP8 A;  4KZ5 A;  5GLA A;  1PWC A;  1BSG A;  1JTG A;  4HBU A;  1K54 A;  3MXQ A;  2IWB A;  2EXA A;  4Y0T A;  3VOY A;  3B3X A;  1IYS A;  4UA9 A;  1GHM A;  4Y15 A;  2XRO A;  4OQH A;  4Z1W A;  1ES5 A;  5DF9 A;  2ZQD A;  4HP4 A;  5AQB A;  3SOI A;  1TS0 A;  2JKT I;  4WZ5 C;  3C38 A;  4S2O A;  3A3F A;  2PHY A;  4XT2 B;  1JNU A;  4OOL A;  5FL3 A;  3K3D A;  1YAX A;  2Y2N A;  1OPX A;  2QKP A;  1S66 L;  1PRQ A;  4CLC E;  3B33 A;  3TE8 A;  4OON A;  1K56 A;  2M1C A;  5HD5 A;  1K6S A;  3OPR A;  3LIE A;  4RVA A;  2ACG A;  1KE4 A;  5HW3 A;  3KSG A;  1HLU P;  2G2U A;  1W63 M;  2ZOI A;  5L07 A;  2JKF A;  1K25 A;  3QNB A;  4ETZ A;  1RGY A;  3VE3 A;  2Q9N A;  4B4Z A;  2J9O A;  3Q7V A;  4HES A;  4GCZ A;  5HX9 A;  2W3F A;  3QP1 A;  4KZ4 A;  1PZO A;  1VET B;  4Y3I A;  2NUP C;  2JC7 A;  4N9K A;  3MJQ A;  4S2J A;  4JBF A;  3MQ0 A;  3KO6 A;  2GJ3 A;  1SKO B;  2E8J A;  2NUT C;  5HSQ A;  1FR1 A;  3OLO A;  3V3R A;  5FQK A;  4LV3 A;  3NHQ A;  4NG2 A;  3BW6 A;  5E2F A;  4M4X A;  3MQO A;  4ID4 A;  3H7W B;  1K6R A;  3D72 A;  2ZL1 B;  3L7H A;  1FR6 A;  3F1O A;  2XK1 A;  3SS5 A;  1RCJ A;  5GLB A;  4LCL A;  5G4Y A;  1RGZ A;  2L0W A;  2VZW A;  1H8Z A;  5BOH A;  3HUO A;  4GS9 B;  5FI2 A;  2VV6 A;  2CMN A;  2EWW A;  2G2W A;  3C5A A;  4L0L A;  3VP0 A;  3DW0 A;  4KUK A;  2FH5 A;  1K55 C;  5CGW A;  3MKF A;  1X0O A;  1YLJ A;  4JF5 A;  3DTE A;  2Y2M A;  2Y2G A;  4KG6 A;  3WS5 A;  1OTA A;  3UMD A;  2W1T A;  3IXD A;  1BZA A;  1FCO A;  4NKP A;  3T1S A;  1ES4 A;  2MJ6 A;  4B9O A;  2QHK A;  4O8G A;  2PYR A;  5AVF A;  3CHW P;  1V9Y A;  2L4R A;  1F5M A;  1P9R A;  4K08 A;  3A3J A;  3HLE A;  2L1M A;  2QJ7 A;  2JKR M;  2XRN A;  5EVE A;  4Q0I A;  2H0Y A;  3RXW A;  4EUZ A;  4IUK A;  5DJU A;  5TBM A;  3ZDJ A;  3S7P A;  1H3Q A;  2DNS A;  2WKH A;  4KZ6 A;  4BBU A;  2P74 A;  1SCW A;  5M1A A;  4ZDX A;  1T1A A;  4WMC A;  1SDN A;  1WYB A;  2ZMA A;  3F1N A;  1LSW A;  4Y5F A;  4FD8 A;  2WKQ A;  4FOF A;  4MBK A;  3B47 A;  1JWP A;  4EV4 A;  2HGV A;  2ZD8 A;  2HF6 A;  3O5Y A;  1CI8 A;  3W8K A;  2PBD P;  3NBL A;  5FEF A;  1KDW A;  2H5S A;  4PKY G;  1D7E A;  3UPP A;  2RCX A;  4LV0 A;  3A0R A;  3G4P A;  1XFQ A;  1ONH A;  1KE0 A;  1ZG4 A;  5EEC A;  1KVL A;  5CTM A;  5FAP A;  3IHB A;  2HJE A;  4MBF A;  5CHM A;  1L0G A;  2HDU A;  2JN7 A;  1UGU A;  1PFL A;  2Y55 A;  2Y4A A;  1T19 A;  2VV8 A;  3MZD A;  2WGW B;  3CJM A;  2PBY A;  4CLC B;  4WYY A;  2PD7 A;  2EXB A;  4P6Z M;  3N8R A;  2W1R A;  4NXE A;  2ZQ8 A;  2GNX A;  3TJZ C;  3LR5 A;  4EQ1 A;  3ZGA B;  4OP5 A;  5E43 A;  4CLC C;  5HAR A;  3PBR A;  3KSI A;  1OTB A;  3NDG A;  2X02 A;  2PR5 A;  3OCN A;  3SS4 A;  3DWZ A;  1DY6 A;  2WKE A;  4HJ3 A;  1A0K A;  2P7J A;  3UNW A;  2JKR I;  2V9A A;  3IQA A;  3IXH A;  4Y13 A;  1XP4 A;  2VJW A;  4G3K A;  2PRF A;  2OWJ A;  1K54 C;  4IBX A;  5L8M A;  4XT2 A;  3IT9 A;  5C5K A;  4K0W A;  1Z09 A;  5EV0 A;  3HLD A;  3UB9 A;  3WRT A;  3LR4 A;  4PM7 A;  2KDK A;  1BT5 A;  1BLH A;  5DKL A;  5KMW A;  3FPW A;  1OTI A;  3LR3 A;  3CLO A;  4MMN A;  2JE5 A;  3ITB A;  1BLS A;  3CMZ A;  3NC8 A;  3T4K A;  1DP6 A;  5CX7 A;  1FSW A;  1HTZ A;  3S4X A;  1YM1 A;  4Y7P A;  3E98 A;  3EQU A;  4LFU A;  2A24 A;  5HPI A;  3IH9 A;  2ZLY A;  3UY6 A;  4R4R A;  1N4O A;  4N1X A;  3C4P A;  2P9V A;  4X1M A;  1YQS A;  4DMZ A;  4PKY A;  1LHY A;  4E3M A;  2PD8 A;  3Q7V B;  1FSY A;  2EFU A;  1DJC A;  4QD4 A;  2HV1 A;  3BJN A;  4GD8 A;  4JXV A;  3NIA A;  1SKO A;  4E3L A;  1CJF A;  5CGS A;  4BEN A;  1WA9 A;  4B93 A;  1PNE A;  1D1J A;  3OC2 A;  4OP8 A;  5CHJ A;  1I2W A;  5FSR A;  1PW8 A;  3NUL A;  1ONG A;  4MN7 A;  5K5B A;  1NRJ A;  4RYE A;  3G35 A;  4HJ6 A;  3GTC A;  4A5R A;  4PM9 A;  3S22 A;  3RTY A;  3F1O B;  4QY6 A;  4DE2 A;  3NOU C;  2C6W B;  3GDI A;  5HAQ A;  5M19 A;  3VP4 A;  5GHZ A;  4DXB A;  2OAQ 1;  1MC0 A;  5F5Y A;  1HVB A;  4NXG A;  5DTS A;  4EET B;  2OWH A;  4X69 A;  4Q8I A;  4GOG A;  3T1R A;  3LIA A;  1ERM A;  4ZRR A;  5E2G A;  3SH9 A;  4LRX C;  1CF0 A;  1O07 A;  2DMW A;  2Q9M A;  2W1T B;  3ZG5 A;  3ZHH A;  1H8Y A;  2O9A A;  1MKM A;  1OME A;  1YT4 A;  1GCE A;  3ISG A;  4IVK A;  4WZ4 A;  1PI5 A;  4ZBE A;  2H0T A;  5GLD A;  3HUN A;  3OPH A;  1D06 A;  5FQ9 A;  4S2M A;  1XFN A;  3TG9 A;  3TRC A;  2HDS A;  3Q07 A;  2VGK A;  4OPQ A;  3Q7Z A;  1ZHH B;  4EU0 A;  5TBM B;  1XJ6 A;  1G5U A;  3A0V A;  2I9V A;  4DDS A;  4ARZ B;  3BFC A;  5EFW A;  2DRW A;  2BTF P;  5CGX A;  2ZQ7 A;  3ZVT A;  5L2F A;  5EUA A;  1IKI A;  4EBP A;  4HHD A;  3F1N B;  3VP1 A;  1TS8 A;  2ZC5 B;  3A3D A;  1L0E A;  3PHY A;  3IF5 A;  5CXW A;  3UDI A;  4GW9 A;  4RQ9 A;  4X68 A;  4BBV A;  1GHP A;  1U60 A;  2H10 A;  3LI8 A;  1L3L A;  4OQG A;  3ZG9 B;  4G3V A;  3IWI A;  4WLA A;  3BFF A;  4ME4 A;  2H28 A;  4KQO A;  1LI0 A;  4BMW A;  1G6A A;  4UQI S;  4YWZ A;  3QNC A;  1SZV A;  3S7Q A;  2IWC A;  1NY0 A;  4Q0H A;  1LSX A;  4DE1 A;  1NYY A;  3GR2 A;  3W4Q A;  3PBS A;  4OQI A;  4IVI A;  2ZQA A;  4OOM A;  2Z2L B;  4HQA A;  4XUX A;  5E2E A;  3MXR A;  3S7N A;  2P08 A;  4X1L A;  3CIT A;  4HEF A;  3K3C A;  4N1H A;  4P0M A;  1L2S A;  3JVV A;  5HAI A;  5HDC A;  3V39 A;  1OTE A;  4HIA A;  3O86 A;  4WL9 A;  3LCE A;  1YLZ A;  3T12 B;  2Q0O A;  3M6H A;  1IKG A;  1P0Z A;  4IBR A;  4WF0 A;  1XA1 A;  3P7N A;  3W2Z A;  3W4P A;  4EQI A;  4BL3 A;  3BYD A;  3BEB A;  5CER A;  1DP8 A;  4HI4 A;  2Y79 A;  4IHQ A;  2Y8H A;  4O0P A;  1FOF A;  2WZZ A;  3G30 A;  4R4S A;  3HLF A;  2PR6 A;  3MZE A;  3PAG A;  4DXC A;  2PT7 A;  4KQQ A;  4LCM A;  3B42 A;  3VV4 A;  5FA7 A;  4ZJ2 A;  3T4Q A;  2A49 A;  2ZM0 A;  5FAS A;  4II7 A;  3NOP C;  4Y2F A;  4HJ4 A;  3VP3 A;  3D3O A;  4BWI A;  5FI7 A;  4KUO A;  5DTT A;  4U3T A;  3HLW A;  4EBN A;  5DF8 A;  4C3Q A;  3E4P A;  3IH8 A;  3S7O A;  2A24 B;  2WAE A;  1LL5 A;  4DRT A;  2ZQC A;  2P9V B;  3IX8 A;  5JYO A;  1IYQ A;  2HP9 A;  3HJI A;  3OPP A;  1Q2Q A;  2W3D A;  1H8M A;  1TDG A;  1N9O A;  3UPO A;  2XSS A;  4NXB A;  1G28 A;  2GX5 A;  3ICY A;  4UA7 A;  1ES2 A;  2W27 A;  4OVD A;  1WE4 A;  3ZQ5 A;  5J3W A;  3F1P A;  2VV7 A;  4QWO A;  3ZNT A;  1PI4 A;  1EW0 A;  3K2N A;  3H9W A;  2ZC6 B;  2OLU A;  2ZC3 B;  3CAX A;  4MN6 A;  4QJG A;  1J3W A;  2M7U A;  1LLB A;  2K31 A;  3MMH A;  2Y91 A;  3SS3 A;  4CLC D;  4KZ8 A;  3C7U A;  3C2W A;  4S2L A;  3CUE A;  2IA2 A;  3IS2 A;  2EX6 A;  5DFY A;  5KIZ A;  1YLT A;  4WEJ A;  2XLN A;  3G31 A;  4JLF A;  2V8C A;  3HCY A;  4OPR A;  4S2P A;  2E8I A;  2XEP A;  4FSF A;  3G6O A;  4U0T A;  2Y2I A;  3EEH A;  3T4J A;  4R0Q A;  2XQZ A;  5IS1 A;  2K7S A;  4OLG A;  4PM6 A;  5G4Z A;  5AJG A;  5FQQ A;  3CG5 A;  2FFY A;  1YKD A;  5F82 A;  5F69 A;  4QY5 A;  4X6T A;  3C8C A;  3R4K A;  3WWX A;  4LPZ A;  2HDR A;  2ZC7 A;  4BQM A;  2IWD A;  5GHY A;  5F1G A;  3LID A;  2ZM2 A;  1E3U A;  3C30 A;  4F94 A;  1TF1 A;  3VFF A;  1VEU B;  2OAP 1;  4ARZ A;  1K56 D;  1IFQ A;  1OT6 A;  3JYI A;  3PTE A;  1GSV A;  2VLG A;  3GVB A;  2HJ9 C;  4KEN B;  2OSU A;  2BAS A;  1MBL A;  4BBT A;  4EXO A;  4PAU A;  3IF6 B;  3IWQ A;  4E6W A;  3HVF A;  4X53 A;  2B18 A;  3HJK A;  1ERQ A;  3V3S A;  4C6Y A;  3ZG8 B;  2XD5 A;  2PU2 A;  5CEB A;  4OOY A;  1TVF A;  1GA0 A;  4OLD A;  2VEA A;  1C3B A;  2EFX A;  2XF3 A;  1XGI A;  4YOF A;  3V67 A;  3IX4 A;  3BQA A;  3GV9 A;  3O3V A;  4KZB A;  4QU3 A;  4KQD A;  5DVA A;  3MFD A;  1SKF A;  4X55 A;  4I3J A;  2XA7 M;  5EVI A;  4ETX A;  1I2S A;  3BFG A;  1W8Q A;  3NY4 A;  4LLO B;  4I38 A;  1BTL A;  5IU1 A;  4DKI A;  1VHM A;  3C4O A;  5A91 A;  4JGP A;  1CI9 A;  1YMX A;  4DN0 A;  4Y17 A;  2D02 A;  1ERO A;  2VKS A;  3BY8 A;  4OQ0 A;  2ZMV A;  5I94 A;  4FCF A;  1YPR A;  3OCL A;  3M2K A;  3MS6 A;  3EGX C;  2BLS A;  1RP5 A;  1P97 A;  1NYM A;  3RFB A;  2ZBB A;  3FYZ A;  3KSF A;  3D9Y A;  2VGL S;  4UQI M;  1YLW A;  4EEP A;  2VK3 A;  4EW7 A;  3VFH A;  4KZ3 A;  4GNU A;  4WM9 A;  3GQZ A;  2Z6D A;  3KYZ A;  5EOO A;  4I5S A;  3LO7 A;  2WUQ A;  1FIL A;  4IED A;  5EOE A;  3EEA A;  2ZM8 A;  4KG5 A;  1KE3 A;  3N6I A;  5CTN A;  2WKR A;  2WGV A;  2O9C A;  2XR0 A;  2QPN A;  4R38 A;  2HDQ A;  3T4T A;  4YIN A;  4N9L A;  3NCK A;  4EER A;  3LEZ A;  2FFF B;  2Y2L A;  5GHX A;  1S1Y A;  1BYW A;  4LGW A;  3LUQ A;  1UWN X;  3PBQ A;  1ESU A;  2ZQ9 A;  1M6K A;  4O01 A;  5F68 A;  2EX9 A;  3T50 A;  1XJ2 A;  3UB7 A;  4S2N A;  4I39 A;  4AFI A;  2UWX A;  4WMC D;  4QB8 A;  2WYX A;  1MWT A;  1GHI A;  2V20 A;  1DJA A;  3KX0 X;  2W3G A;  4PM5 A;  1MWS A;  1QMF A;  3LYX A;  4R1G A;  4E3J A;  1FCN A;  4E3N A;  1P9W A;  4I3I A;  2EWV A;  2W3E A;  2Y2K A;  2AVX A;  1PWG A;  2ZMF A;  1K4F A;  3NI9 A;  3F1P B;  1S4R A;  1TS6 A;  3EGD C;  2A3U A;  2EX8 A;  1IYP A;  1S6R A;  3QP6 A;  1XA7 A;  3IWO A;  1ZC2 A;  4DJ3 A;  1STZ A;  5J4E A;  1N9B A;  1S67 L;  3DBA A;  3A3I A;  4GJ4 A;  3G2Z A;  1S0W A;  3IS2 B;  3FPV A;  5GL9 A;  3UME A;  5FQI A;  2DCF A;  2XFS A;  4P87 A;  4EWF A;  4KZ9 A;  4CQH A;  4G3W A;  4DJ2 A;  3VOL A;  5CRF A;  1FQG A;  3A3E A;  4GN2 A;  4PM8 A;  3V5M A;  3NEC A;  1OT9 A;  4GHI B;  5EE8 A;  3CUE C;  3O88 A;  2B5R A;  2UV0 E;  2GZA A;  4C75 A;  1H5X A;  3G2Y A;  5HWT A;  5HZH A;  3FWL A;  4R3A A;  1KDS A;  3T1Q B;  5FQM A;  1TD5 A;  3UB5 P;  4BD0 A;  2X01 A;  3LIC A;  1AWI A;  3BM6 A;  5HPF A;  1ES3 A;  4JGQ A;  3D4F A;  1YLY A;  4R70 A;  1K38 A;  1Y28 A;  4MLL A;  3UPN A;  4L9G A;  4GDB A;  3GEC A;  4LV2 A;  1VEU A;  3G32 A;  3FC7 A;  1I5Q A;  3FG8 A;  1XX2 A;  2XA7 S;  5MC7 A;  4JGR A;  1K57 A;  2Y2J A;  4BD1 A;  2PYP A;  3HL9 A;  3E0Y A;  3IF6 A;  4IUH A;  1SHV A;  1NZO A;  3N8L A;  3ZNY A;  4DE0 A;  3P09 A;  3WRZ A;  3P01 A;  4KG2 A;  2V1B A;  2YKH A;  3OZH A;  1MWR A;  4FH2 A;  3LR0 A;  5HDD A;  1W7F A;  2V1A A;  1K0K A;  1PYY A;  4KZA A;  3RH8 B;  4K91 A;  1MPL A;  3Q82 A;  3CPT A;  4ZJ1 A;  3GSG A;  1XPB A;  5EVI B;  1FCM A;  1HD8 A;  2Y2Q A;  4UHU A;  3QHY A;  4BLM A;  2VX8 A;  2R9W A;  3O87 A;  3S1Y A;  3FKW A;  5EPH A;  3MXS A;  4GB7 A;  5G18 A;  1W63 Q;  3PYP A;  3M6B A;  3V50 A;  5FI6 A;  4QHC A;  5EVI C;  1O7E A;  1LSV A;  4H8R A;  4R3J A;  2PU4 A;  5HL1 A;  1SDE A;  2KLI A;  5EM0 A;  4X56 A;  2Z6C A;  2WK0 A;  4E3I A;  4GD6 A;  1CEF A;  5AQ9 A;  3MZF A;  4CJN A;  2R78 A;  1CK3 A;  2V0W A;  4WEK A;  2WKP A;  1T1B A;  3SH7 A;  3U2A A;  4JKT A;  4QPR A;  3KYE A;  1XGJ A;  1ALQ A;  2KOI A;  3PBO A;  2C5W B;  4EUV A;  5FQJ A;  3MF0 A;  4ZTK A;  5DFX A;  5DKK A;  5J7E A;  4U0X A;  3IHA A;  3HLG A;  3ZYT A;  4E04 A;  3TW8 A;  1H0M A;  4MCW A;  2INW A;  1F2K A;  4GLQ A;  1Y4O A;  4GZB A;  3A0S A;  1NZU A;  3LIF A;  2VGL M;  2HZ5 A;  5HWW A;  1DJB A;  2XFT A;  5HWV A;  5KZH A;  4FH4 A;  2M7V A;  4LRZ E;  3E2L A;  5A8B A;  3MFX A;  2JKG A;  2J3T C;  3IXG A;  3MR0 A;  5AVE A;  2Y59 A;  3N8S A;  3UO9 A;  2JBF A;  5DTK A;  1OTD A;  4EEU A;  1V9Z A;  3WS4 A;  3L9K A;  4R23 A;  4S2N C;  4PHT A;  3GRJ A;  4HOI A;  2RL3 A;  5IHV A;  4OKP A;  1YSQ A;  1ESI A;  3LEQ A;  5A90 A;  3DTK A;  4LV1 A;  4OPY A;  4ZAM A;  3WS2 A;  3AGD A;  5I5L A;  1JTD A;  1W8Y A;  2R9X A;  3N7W A;  4JF6 A;  3BQ8 A;  3IBJ A;  2OV5 A;  5D3O A;  3BFE A;  1GSW A;  3LFV A;  2QMI A;  3LGO A;  1HZO A;  5CEC A;  1GA9 A;  4WUJ A;  5HD3 A;  3CWF A;  2Z2M B;  2CC1 A;  3VP2 A;  2JHE A;  1CEG A;  3LI9 A;  3PBN A;  1BLP A;  4GHI A;  4D60 A;  1GSX A;  2B02 A;  5U47 A;  4S2I A;  1LL9 A;  2V2F F;  3UN7 A;  3WS0 A;  2QJ5 A;  3EQV A;  4MN5 A;  3I7J A;  4UAA A;  1N9L A;  4NXF A;  1XXM A;  1E4D A;  1N9N A;  1G6O A;  5TR7 A;  1ZTU A;  1BUE A;  1Z6F A;  4WN5 A;  4E3K A;  2KX6 A;  5FDS A;  5CED A;  4ESP A;  2XGN A;  1TEM A;  5F1F A;  3HLB A;  4R3B A;  2FZ0 A;  3BRM A;  4H6J B;  3H82 A;  4HP9 A;  1IOU A;  3VSL A;  4FTX A;  3UE6 A;  4Q0J A;  4XUZ A;  3ZG0 A;  2WZX A;  2VGJ A;  4NK3 A;  3KSH A;  4P6B A;  2Y2H A;  5HL6 A;  1BLC A;  4XXR A;  4JGO A;  1L0F A;  4OPZ A;  2W0N A;  4GDN A;  1S4S A;  3QP4 A;  5F83 A;  4Y0O A;  3OOV A;  4RX2 A;  1K57 C;  1YSP A;  1NLY A;  4B88 A;  5A93 A;  1KOU A;  3T4L A;  2B95 A;  4F3L A;  2J7V A;  3CZD A;  5TGF A;  3IF6 C;  4NET A;  2V1Z A;  3NJA A;  4KZ7 A;  1LI9 A;  2J80 A;  4RA7 A;  4DE3 A;  3JVU A;  4WBG A;  4EBL A;  3T4O A;  3EWK A;  3CPT B;  3ZCZ A;  5F6A A;  1XKZ A;  2EA9 A;  1PIO A;  2WKI A;  2Y2O A;  1ZG6 A;  2W3H A;  4R6L A;  4MDZ A;  5AQA A;  4S2K A;  5M18 A;  4MBH A;  5FEG A;  3IBR A;  1OJG A;  1MY8 A;  4UA6 A;  5DF7 A;  3R7W A;  3FZC A;  4JPM A;  3ZFZ A;  2OOL A;  1JWV A;  4YFM A;  2X71 A;  4O7D A;  3HUM A;  2P04 A;  3LY3 A;  4K0X A;  3OPL A;  2GDN A;  2XD1 A;  4PPR A;  3W4O A;  4UEY A;  2HP5 A;  3MQQ A;  1EI5 A;  1NLZ A;  3UDF A;  2ZJ9 A;  3SW1 A;  3RJU A;  4WZ5 A;  2VA0 A;  1W79 A;  1QME A;  1EWZ A;  5FAQ A;  3NOT C;  1MKI A;  1PW1 A;  3BY9 A;  2WAF A;  3QP2 A;  3CI6 A;  1NXY A;  2Y2P A;  5HDS A;  4BL2 A;  3ULF A;  3LY4 A;  1TS7 A;  1YLP A;  4OH0 A;  1G68 A;  3G34 A;  5FAO A;  3SH8 A;  4LEN A;  1JWZ A;  1KGE A;  3HBR A;  1E3U D;  1FIK A;  3E4O A;  2QYB A;  3T1X A;  1XJ3 A;  4IJG A;  5TFQ A;  1JVJ A;  4DF6 A;  4EES A;  4I3A A;  4N92 A;  1IEL A;  3ITA A;  3BLS A;  3N4I A;  3MKE A;  4HY8 A;  4E3O A;  5HFO A;  3MBZ A;  5J8X A;  1ACF A;  1WYC A;  3VMA A;  4PMA A;  4JXG A;  2J8Y A;  5HAP A;  3U4L P;  3IX3 A;  2WAD A;  2G7U A;  3PAE A;  4LRY C;  1VET A;  5L10 A;  4NEE D;  4YNR A;  1LT0 A;  1NWZ A;  5EVI D;  3LIB A;  3BEC A;  4MEZ A;  4MNR A;  3QP5 A;  2K2N A;  3RXX A;  3WS1 A;  5FAT A;  4HNB A;  4M3K A;  3H7W A;  1VM1 A;  4FUW A;  1LL8 A;  4DDY A;  5TJJ A;  1NJ4 A;  4D2O A;  2ZL1 A;  1K55 A;  5FDH A;  2O0Y A;  3PXP A;  2WGI A;  3VOZ A;  5A92 A;  4L9E A;  4GS9 A;  3BWL A;  3UE1 A;  1Q2P A;  3KYQ A;  3ZG7 B;  2ZC4 B;  5EM1 A;  3BFD A;  5KSH A;  5JYP A;  3MSH A;  2J9P A;  2ZOH A;  3UDX A;  1DRM A;  3DAV A;  5AQ7 A;  4HBT A;  2O99 A;  3GMW A;  4Y0U A;  4P85 A;  3OBF A;  3E4Q A;  3VSK A;  1J9M A;  5L09 A;  5CHU A;  4JXS A;  3UE0 A;  1M40 A;  1OJ5 A;  3Q1F A;  1MWU A;  1MZU A;  1DP9 A;  3ZVW A;  2J3T D;  1AXB A;  5KSC A;  4H6J A;  3T4S A;  4WEL A;  3PR6 A;  2J3W A;  4ZJ3 A;  1S1Z A;  3H82 B;  3DWK A;  1VQQ A;  2A2L A;  3TSG A;  2XH9 A;  3BLM A;  3VE4 A;  2JKT M;  1ZKJ A;  1YMS A;  1PZP A;  1E25 A;  3PBT A;  4B4X A;  2HP6 A;  1F98 A;  2QWS A;  3AGF A;  2O9B A;  5IT5 A;  2HPB A;  3HRE A;  4HH2 A;  2YKF A;  3NDE A;  2V0U A;  5EVL A;  1KGF A;  1F9I A;  5E2H A;  1NRF A;  1BUL A;  3UB8 A;  1IYO A;  4P6Z S;  4GKU A;  1W5D A;  1L0D A;  1XJ4 A;  4F3L B;  2PAV P;  3EOI A;  1MXO A;  5LBR A;  1CQA A;  4KQR A;  1K4E A;  4CPK A;  3Q81 A;  4X25 A;  3HLC A;  3SZT A;  3E2K A;  3FKV A;  3FV7 A;  4L9F A;  1IEM A;  1TDL A;  3M2J A;  2BG1 A;  2PDR A;  1T1C A;  2LB9 A;  3DTM A;  2V8F A;  1ODV A;  1VB6 A;  1T18 A;  1KVM A;  2JCH A;  3DTI A;  1UWP X;  2WGW A;  3R7W B;  3TOI A;  3UB6 A;  1Y54 A;  2D01 A;  1KGG A;  2QZ6 A;  3C7V A;  3UE3 A;  4CLC A;  2OLV A;  2EX2 A;  3JPU A;  2I72 A;  3IXB A;  4Z9Q A;  4JF4 A;  4E6X A;  1PWD A; 
#chains in the Genus database with same CATH homology
 3AGE A;  2CC1 A;  2XDM A;  1HVB A;  3OCL A;  3M2K A;  4BJP A;  3P98 A;  3VP2 A;  2BLS A;  4RX3 A;  1CEG A;  1RP5 A;  5DTS A;  3PBN A;  1BLP A;  4JXW A;  1NYM A;  5GLC A;  4X69 A;  4KZ5 A;  4Q8I A;  5U47 A;  4GOG A;  3FYZ A;  5GLA A;  4S2I A;  1LL9 A;  2V2F F;  3UN7 A;  1ERM A;  1YLW A;  1PWC A;  1BSG A;  1JTG A;  5E2G A;  4HBU A;  3VFH A;  4KZ3 A;  3WS0 A;  1K54 A;  4GNU A;  4WM9 A;  3GQZ A;  3SH9 A;  3EQV A;  1O07 A;  2IWB A;  2EXA A;  2Q9M A;  4Y0T A;  3VOY A;  3B3X A;  3I7J A;  4UAA A;  5EOO A;  1IYS A;  3ZG5 A;  3ZHH A;  1XXM A;  3LO7 A;  4UA9 A;  1E4D A;  1H8Y A;  1GHM A;  2WUQ A;  4IED A;  5EOE A;  5TR7 A;  4OQH A;  2ZM8 A;  1BUE A;  1ES5 A;  5DF9 A;  2ZQD A;  1OME A;  1Z6F A;  1YT4 A;  4KG5 A;  5AQB A;  1KE3 A;  3SOI A;  4E3K A;  3N6I A;  1GCE A;  3ISG A;  5CTN A;  4WZ5 C;  4IVK A;  4WZ4 A;  5CED A;  1PI5 A;  2WGV A;  4S2O A;  4ZBE A;  2XR0 A;  3A3F A;  2QPN A;  2H0T A;  2HDQ A;  5GLD A;  4YIN A;  4N9L A;  2XGN A;  3NCK A;  3HUN A;  3OPH A;  1TEM A;  3LEZ A;  3HLB A;  2FFF B;  4R3B A;  4S2M A;  2Y2L A;  5FQ9 A;  5GHX A;  3TG9 A;  5F1F A;  3BRM A;  4OOL A;  2HDS A;  3Q07 A;  3PBQ A;  2VGK A;  2Y2N A;  4OPQ A;  3Q7Z A;  3VSL A;  4XUZ A;  3ZG0 A;  1ESU A;  2WZX A;  1M6K A;  2VGJ A;  2ZQ9 A;  4DDS A;  4NK3 A;  4P6B A;  4OON A;  2EX9 A;  1K56 A;  3BFC A;  2Y2H A;  2DRW A;  4S2N A;  1K6S A;  3OPR A;  1BLC A;  4XXR A;  2UWX A;  2ZQ7 A;  4OPZ A;  1L0F A;  4RVA A;  4WMC D;  5CGX A;  4QB8 A;  2WYX A;  1MWT A;  5L2F A;  1KE4 A;  5EUA A;  1GHI A;  1IKI A;  2V20 A;  4GDN A;  4EBP A;  5HW3 A;  1DJA A;  3VP1 A;  5F83 A;  4Y0O A;  4RX2 A;  2G2U A;  1MWS A;  4PM5 A;  1K57 C;  2ZC5 B;  3A3D A;  1QMF A;  4R1G A;  4E3J A;  1L0E A;  3IF5 A;  5CXW A;  1FCN A;  1K25 A;  3QNB A;  4B88 A;  3UDI A;  4E3N A;  5A93 A;  1RGY A;  4X68 A;  1GHP A;  1U60 A;  2Q9N A;  2J9O A;  2H10 A;  4B4Z A;  3Q7V A;  4HES A;  2Y2K A;  5HX9 A;  2J7V A;  1PWG A;  3CZD A;  5TGF A;  4KZ4 A;  4OQG A;  3IF6 C;  3ZG9 B;  4NET A;  2V1Z A;  3IWI A;  4KZ7 A;  1LI9 A;  1PZO A;  3BFF A;  2JC7 A;  4KQO A;  1LI0 A;  4N9K A;  4RA7 A;  1K4F A;  4S2J A;  4JBF A;  3NI9 A;  4DE3 A;  1G6A A;  4WBG A;  4EBL A;  3QNC A;  2A3U A;  1FR1 A;  2EX8 A;  1IYP A;  1S6R A;  3ZCZ A;  1XA7 A;  3IWO A;  3V3R A;  1XKZ A;  1ZC2 A;  1PIO A;  2IWC A;  2WKI A;  1NY0 A;  2Y2O A;  1ZG6 A;  5FQK A;  4LV3 A;  1N9B A;  5AQA A;  4S2K A;  4DE1 A;  1NYY A;  3GR2 A;  3W4Q A;  5M18 A;  3PBS A;  4OQI A;  4IVI A;  2ZQA A;  5E2F A;  4OOM A;  4MBH A;  3A3I A;  2Z2L B;  4ID4 A;  5E2E A;  4XUX A;  3MXR A;  1K6R A;  1MY8 A;  3G2Z A;  4UA6 A;  5DF7 A;  4HEF A;  1FR6 A;  1S0W A;  2XK1 A;  3FZC A;  4N1H A;  3SS5 A;  4P0M A;  1RCJ A;  5GLB A;  4LCL A;  4JPM A;  1L2S A;  5HAI A;  3ZFZ A;  5GL9 A;  1RGZ A;  3V39 A;  5FQI A;  1JWV A;  2DCF A;  2XFS A;  3O86 A;  4YFM A;  4P87 A;  1H8Z A;  5BOH A;  2X71 A;  3HUO A;  3LCE A;  1YLZ A;  4KZ9 A;  4EWF A;  4O7D A;  3HUM A;  5FI2 A;  3M6H A;  1IKG A;  3LY3 A;  4K0X A;  2G2W A;  4IBR A;  5CRF A;  3OPL A;  1FQG A;  2GDN A;  1XA1 A;  2XD1 A;  3C5A A;  3A3E A;  4L0L A;  4PPR A;  3VP0 A;  4GN2 A;  4PM8 A;  3V5M A;  2HP5 A;  3W4O A;  3W4P A;  3DW0 A;  4BL3 A;  4EQI A;  3BYD A;  3BEB A;  1EI5 A;  5EE8 A;  5CER A;  1K55 C;  5CGW A;  3UDF A;  2ZJ9 A;  3MKF A;  1YLJ A;  4JF5 A;  3RJU A;  4WZ5 A;  3O88 A;  2B5R A;  1W79 A;  1QME A;  1EWZ A;  2Y2M A;  4C75 A;  5FAQ A;  1H5X A;  2Y2G A;  3G2Y A;  1MKI A;  1FOF A;  2WZZ A;  4KG6 A;  3FWL A;  3WS5 A;  1PW1 A;  3G30 A;  2WAF A;  1NXY A;  3IXD A;  1KDS A;  4R4S A;  3HLF A;  1BZA A;  2Y2P A;  5FQM A;  1FCO A;  4BL2 A;  3MZE A;  1ES4 A;  3PAG A;  4BD0 A;  2X01 A;  4DXC A;  3LY4 A;  1YLP A;  4OH0 A;  3BM6 A;  4KQQ A;  1ES3 A;  3D4F A;  1G68 A;  4LCM A;  3G34 A;  1YLY A;  3A3J A;  3HLE A;  5FAO A;  5FA7 A;  3SH8 A;  4ZJ2 A;  4LEN A;  2A49 A;  2ZM0 A;  1K38 A;  4MLL A;  5FAS A;  3UPN A;  1JWZ A;  1KGE A;  3HBR A;  1E3U D;  4GDB A;  4LV2 A;  2H0Y A;  3G32 A;  3VP3 A;  1I5Q A;  1XX2 A;  5TFQ A;  3RXW A;  1K57 A;  4EUZ A;  5FI7 A;  2Y2J A;  4BD1 A;  1JVJ A;  4DF6 A;  5DTT A;  3ZDJ A;  4U3T A;  4N92 A;  1IEL A;  3ITA A;  2DNS A;  3HLW A;  3BLS A;  2WKH A;  5DF8 A;  4EBN A;  4KZ6 A;  3HL9 A;  4C3Q A;  2P74 A;  3N4I A;  3IH8 A;  1SCW A;  2WAE A;  3IF6 A;  3MKE A;  5M1A A;  4E3O A;  4ZDX A;  1LL5 A;  5HFO A;  4WMC A;  1SDN A;  1WYB A;  2ZQC A;  3MBZ A;  1SHV A;  2P9V B;  2ZMA A;  4DRT A;  1NZO A;  5J8X A;  5JYO A;  5KSH A;  1IYQ A;  2HP9 A;  3N8L A;  3OPP A;  3ZNY A;  1WYC A;  4FD8 A;  1Q2Q A;  3VMA A;  3P09 A;  4MBK A;  4PMA A;  4DE0 A;  4JXG A;  2J8Y A;  3WRZ A;  1JWP A;  4EV4 A;  5HAP A;  2ZD8 A;  4KG2 A;  1TDG A;  1CI8 A;  2WAD A;  3OZH A;  1MWR A;  3UPO A;  4FH2 A;  3W8K A;  3NBL A;  1W7F A;  3PAE A;  1KDW A;  2H5S A;  4UA7 A;  1ES2 A;  4OVD A;  2RCX A;  3UPP A;  1WE4 A;  4LV0 A;  3G4P A;  1PYY A;  4KZA A;  1ONH A;  4K91 A;  3ZNT A;  1KE0 A;  1MPL A;  1PI4 A;  1ZG4 A;  5EEC A;  1KVL A;  3Q82 A;  5CTM A;  5EVI D;  5FAP A;  3IHB A;  2ZC6 B;  4MBF A;  4ZJ1 A;  5CHM A;  3GSG A;  2OLU A;  1XPB A;  5EVI B;  1FCM A;  3BEC A;  1HD8 A;  4MEZ A;  2ZC3 B;  2Y2Q A;  4MNR A;  4UHU A;  1L0G A;  2HDU A;  3QHY A;  3RXX A;  3WS1 A;  4QJG A;  4BLM A;  5FAT A;  2Y55 A;  1LLB A;  2R9W A;  2Y4A A;  3O87 A;  3S1Y A;  3MZD A;  4M3K A;  3FKW A;  5EPH A;  2Y91 A;  1VM1 A;  2WGW B;  3SS3 A;  3CJM A;  2PBY A;  4DDY A;  4KZ8 A;  3C7U A;  1NJ4 A;  4D2O A;  3MXS A;  4GB7 A;  5G18 A;  4S2L A;  4WYY A;  1K55 A;  2EX6 A;  2EXB A;  3M6B A;  5FDH A;  3V50 A;  5FI6 A;  1YLT A;  2WGI A;  4QHC A;  4WEJ A;  3N8R A;  5EVI C;  1O7E A;  2XLN A;  3VOZ A;  5A92 A;  4H8R A;  3ZVT A;  2ZQ8 A;  4R3J A;  2PU4 A;  5HL1 A;  3G31 A;  4JLF A;  1SDE A;  3UE1 A;  1Q2P A;  4OPR A;  3ZGA B;  4S2P A;  2E8I A;  3ZG7 B;  4X56 A;  2XEP A;  2ZC4 B;  4OP5 A;  4FSF A;  5E43 A;  3BFD A;  2WK0 A;  4U0T A;  4GD6 A;  4E3I A;  1CEF A;  2Y2I A;  3PBR A;  4R0Q A;  5AQ9 A;  5HAR A;  3MZF A;  5JYP A;  2Z2M B;  2XQZ A;  3NDG A;  4CJN A;  2J9P A;  2X02 A;  3UDX A;  3OCN A;  3SS4 A;  3DWZ A;  1CK3 A;  4OLG A;  4PM6 A;  5FQQ A;  3CG5 A;  1DY6 A;  2WKE A;  2FFY A;  4WEK A;  5AQ7 A;  4HBT A;  3GMW A;  4Y0U A;  3UNW A;  3SH7 A;  4P85 A;  5F82 A;  4JKT A;  3IQA A;  3VSK A;  1J9M A;  1XGJ A;  3IXH A;  1ALQ A;  5CHU A;  1XP4 A;  3PBO A;  2C5W B;  4JXS A;  4QY5 A;  3UE0 A;  1M40 A;  4X6T A;  3Q1F A;  5FQJ A;  4ZTK A;  1MWU A;  1K54 C;  4IBX A;  3ZVW A;  3WWX A;  3IT9 A;  3IHA A;  4U0X A;  1AXB A;  3HLG A;  2HDR A;  5KSC A;  2ZC7 A;  4K0W A;  4BQM A;  3HLD A;  2IWD A;  4WEL A;  5GHY A;  3WRT A;  4ZJ3 A;  4PM7 A;  3DWK A;  1BT5 A;  1VQQ A;  5F1G A;  1BLH A;  3TSG A;  2XH9 A;  3BLM A;  2ZM2 A;  1E3U A;  4GZB A;  5KMW A;  4F94 A;  1ZKJ A;  1NZU A;  1YMS A;  1PZP A;  3VFF A;  1E25 A;  2JE5 A;  3ITB A;  1BLS A;  3CMZ A;  3NC8 A;  1K56 D;  3PBT A;  1DJB A;  2XFT A;  5KZH A;  4FH4 A;  1FSW A;  1HTZ A;  3S4X A;  2HP6 A;  3JYI A;  3AGF A;  4B4X A;  1YM1 A;  3E2L A;  3PTE A;  3IXG A;  2HPB A;  3HRE A;  4Y7P A;  3EQU A;  3GVB A;  2Y59 A;  3NDE A;  5EVL A;  1KGF A;  4KEN B;  2OSU A;  3N8S A;  3UO9 A;  1MBL A;  3IH9 A;  2ZLY A;  3UY6 A;  2JBF A;  4R4R A;  5DTK A;  1N4O A;  3IF6 B;  3IWQ A;  4N1X A;  3C4P A;  5E2H A;  1NRF A;  2P9V A;  4E6W A;  3HVF A;  4X53 A;  1YQS A;  1BUL A;  1ERQ A;  1IYO A;  1LHY A;  3V3S A;  4GKU A;  3WS4 A;  1W5D A;  4E3M A;  1L0D A;  3Q7V B;  1FSY A;  4C6Y A;  2EFU A;  3ZG8 B;  4R23 A;  4S2N C;  1MXO A;  3GRJ A;  4KQR A;  2XD5 A;  1DJC A;  2PU2 A;  2RL3 A;  5IHV A;  4QD4 A;  4OOY A;  5CEB A;  1TVF A;  4OKP A;  1GA0 A;  1K4E A;  4OLD A;  4GD8 A;  4JXV A;  4CPK A;  3NIA A;  4E3L A;  1ESI A;  3Q81 A;  3HLC A;  5CGS A;  4BEN A;  5A90 A;  3E2K A;  3FKV A;  1C3B A;  2EFX A;  2XF3 A;  3FV7 A;  1XGI A;  4LV1 A;  4OPY A;  4ZAM A;  3WS2 A;  1IEM A;  1TDL A;  3OC2 A;  3AGD A;  4OP8 A;  5CHJ A;  3GV9 A;  3M2J A;  2BG1 A;  3O3V A;  4KZB A;  4QU3 A;  1I2W A;  5DVA A;  5FSR A;  3DTM A;  3MFD A;  1JTD A;  1SKF A;  1PW8 A;  1ONG A;  4X55 A;  1W8Y A;  2R9X A;  3N7W A;  5EVI A;  4JF6 A;  1I2S A;  3BFG A;  1W8Q A;  3NY4 A;  2OV5 A;  4RYE A;  5D3O A;  3BFE A;  3G35 A;  3GTC A;  1BTL A;  4DKI A;  1KVM A;  3C4O A;  2JCH A;  5A91 A;  2QMI A;  4A5R A;  1HZO A;  1CI9 A;  1YMX A;  4PM9 A;  5CEC A;  3S22 A;  2WGW A;  3TOI A;  1Y54 A;  4QY6 A;  4DE2 A;  1GA9 A;  2C6W B;  1KGG A;  2QZ6 A;  3C7V A;  4JF4 A;  3UE3 A;  1ERO A;  2OLV A;  4OQ0 A;  3VP4 A;  5HAQ A;  2EX2 A;  5M19 A;  2I72 A;  3IXB A;  5GHZ A;  4DXB A;  5I94 A;  4Z9Q A;  4FCF A;  4E6X A;  1PWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...