1OMEA

Crystal structure of the omega loop deletion mutant (residues 163-178 deleted) of beta-lactamase from staphylococcus aureus pc1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
257
structure length
241
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Role of the omega-loop in the activity, substrate specificity, and structure of class A beta-lactamase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 82
structure length 241
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1omeA00
3QNBA 5CTMA 3UDIA 5EVIA 4E3KA 3S1YA 4WELA 1NZOA 1PW8A 4OQIA 1BT5A 5TFQA 2P9VB 2B5RA 4KZ6A 5CHMA 3DWZA 4L0LA 4N1HA 5FI6A 2ZM0A 4EUZA 3LO7A 1VM1A 5HL1A 5A90A 4QJGA 2QMIA 4DE2A 1BZAA 1L0FA 4P85A 4WM9A 4GNUA 1MBLA 4XUXA 1K54C 1JWVA 3G30A 4ZAMA 1ES3A 2VGJA 5AQ9A 4WMCD 3G2ZA 3RXWA 4DF6A 3CG5A 3E2KA 4KZ7A 4BL2A 3MZEA 5A91A 3G2YA 3IH9A 2EX9A 3FKVA 3BM6A 1KDWA 5E2FA 1Q2QA 4F94A 5A93A 3UNWA 2R9XA 3GRJA 3UE0A 2A3UA 1N4OA 4JF5A 3IF6C 3HLCA 4BENA 3DW0A 3EQUA 1LL5A 2G2WA 3A3IA 3IXHA 3FWLA 4LV3A 4KQOA 4Y0OA 3LY4A 2J8YA 5GL9A 1TEMA 2HDQA 1KE3A 4OKPA 1K38A 2XF3A 4Z9QA 4GD8A 5FQJA 3W4PA 4OPRA 2QPNA 5D3OA 1N9BA 2G2UA 1NZUA 1WYCA 4S2OA 5CHJA 4ZBEA 5FAOA 1K6SA 3A3JA 5FQIA 4DE0A 5E43A 2WK0A 3BRMA 3CMZA 3NC8A 4IEDA 4U0XA 1MWUA 2ZC3B 4R1GA 3IXDA 4UHUA 1LI9A 3IHAA 5FQMA 4NK3A 1YLWA 4DXCA 1AXBA 4EBLA 4LV0A 5FI2A 2ZC6B 4OQ0A 3UE3A 1SDEA 1I2WA 2ZLYA 3IQAA 1MWSA 3DWKA 3O3VA 4E3JA 1IEMA 2DRWA 1PWDA 3WWXA 3VMAA 2PU2A 3QNCA 3VP3A 2EFXA 2EX6A 5F82A 4KQQA 3IWOA 1HTZA 3PBSA 4Y0UA 5EVLA 1XXMA 3BFFA 4CJNA 1ZG6A 2EXBA 1JVJA 1Y54A 1CI9A 1DJCA 1BULA 2BLSA 3VSLA 3SS3A 5GLDA 2A49A 4S2PA 2IWCA 3V3RA 1FOFA 1IELA 1XKZA 5AQAA 3IF5A 4LENA 4QU3A 4WYYA 5GHYA 1MY8A 4EQIA 1RCJA 3HLBA 5EOEA 2Y2NA 2WGWB 1GCEA 3TSGA 1GA0A 4JXWA 3RXXA 3IWIA 1KDSA 3C4PA 2HDRA 2HDUA 1GHIA 4N9KA 4IBRA 3FYZA 5DVAA 2P9VA 1CEFA 5L2FA 1E3UD 3M6BA 4IVIA 2OLVA 2WKIA 3HREA 4EBPA 1G68A 4K0XA 2WUQA 1L0EA 2Y2HA 5FQ9A 3HVFA 1E25A 3ZG7B 3BFCA 3Q1FA 1ZG4A 3GV9A 4X68A 4Y7PA 5HFOA 4KZBA 4OVDA 2ZM8A 2X01A 4WEJA 4OP8A 1ALQA 1G6AA 1W8QA 1MPLA 3CJMA 3MXSA 1SKFA 4RYEA 3TG9A 5CEBA 4HEFA 1RP5A 3PBTA 1MWTA 3W4OA 3VP4A 2J9PA 4WZ5A 1YLZA 2RCXA 4PM7A 1WYBA 5FA7A 2XDMA 3ZG9B 2DNSA 4JBFA 2XQZA 4BL3A 2DCFA 3BFDA 4WEKA 1PI4A 1GA9A 2X71A 4WBGA 5DTTA 4OP5A 5FQKA 4XXRA 4IVKA 1EROA 5EVIC 3ZHHA 3BLMA 3N7WA 4P0MA 1QMEA 1DJBA 2P74A 3ZNYA 4S2KA 4DXBA 5JYOA 4FH4A 3UPNA 2ZQ8A 5HAIA 3G4PA 2XGNA 4K0WA 3LCEA 1SCWA 1FCOA 2CC1A 3IWQA 3PBOA 3OCNA 3I7JA 5GLBA 2Y2OA 3CZDA 3M2JA 3ZDJA 3ISGA 4QY5A 5G18A 5HARA 5I94A 4X55A 4DKIA 5FAQA 4KZ8A 4E3IA 1FSYA 2WGVA 3MZDA 4R4RA 3AGFA 3ZG5A 1IYSA 3UE1A 1YMSA 4MBKA 4PM9A 3G32A 4KZ3A 1O7EA 3Q7VB 1CK3A 1K6RA 1PWGA 3A3EA 3P09A 2Y4AA 3G34A 5BOHA 5GHZA 1YT4A 4X6TA 1KGGA 2Y2LA 5E2GA 2HP9A 2R9WA 1JTGA 1K4EA 1EWZA 1NJ4A 4UA7A 4BD0A 2JBFA 3OC2A 1FR1A 1SDNA 4ZJ3A 4S2IA 3SS5A 4Y0TA 1L0DA 1ESUA 4KG6A 1MXOA 3OZHA 2PBYA 3P98A 2ZC4B 2ZC7A 2IWBA 3S4XA 1YLTA 2WGWA 2BG1A 1W79A 4X53A 3IT9A 3ZNTA 4E6XA 5M19A 5F83A 1I2SA 4JPMA 1H5XA 3N8LA 3HLFA 1K56D 5E2EA 4E3NA 3VP0A 4R0QA 1NYMA 1XA1A 2H5SA 1HD8A 4OONA 1IKIA 5EECA 2OLUA 1SHVA 1ZC2A 1NY0A 2Y2PA 1IYQA 1BLCA 1PW1A 2IWDA 2ZQAA 3NIAA 5GLCA 1U60A 3TOIA 1K4FA 2JC7A 3PAGA 4OLGA 3NBLA 2Y55A 1MKIA 1XGIA 1ES4A 1LI0A 3OPHA 4MBFA 4OLDA 3WRZA 2Y59A 4OH0A 1CEGA 3GTCA 1K56A 2JE5A 3IXBA 4GZBA 4UA9A 2ZD8A 3FKWA 2ZQ7A 2WAEA 1YQSA 5CEDA 5KMWA 1FR6A 2H0YA 4KG2A 1TVFA 3IH8A 3O88A 4C75A 1ERMA 2RL3A 4KZ4A 3GVBA 2Z2LB 1IYOA 3BFGA 4PMAA 5DF8A 5FATA 5EE8A 3SS4A 1EI5A 2FFFB 2Q9NA 4OOMA 3NCKA 2EFUA 3HLEA 4FCFA 3Q7ZA 4HESA 2WYXA 3C4OA 3VP2A 3PBRA 3V39A 4OQGA 3IF6B 4N9LA 2WADA 3WS2A 3Q82A 3HBRA 2WKHA 4ZTKA 1O07A 3HLDA 4LV1A 3ZCZA 2WGIA 4B4ZA 4BD1A 1ES5A 3C7UA 3MKEA 2ZJ9A 4S2LA 1S0WA 3SH8A 3UDXA 5KSCA 1KE0A 4HBTA 1MWRA 2V20A 3DTMA 1LL9A 4OPYA 2WKEA 5TR7A 1J9MA 2HP6A 4WZ5C 1YMXA 3ZVWA 3BFEA 1WE4A 3UDFA 5JYPA 4C6YA 3B3XA 3N4IA 3N8SA 3C5AA 5HAPA 1XPBA 3N8RA 2Y91A 1PIOA 3SH7A 4UA6A 3Q7VA 5FSRA 4X56A 2V2FF 3BECA 1LHYA 4JF6A 5U47A 1JWPA 1K57A 1W5DA 3HUNA 4FSFA 4E3OA 2Z2MB 4R23A 4H8RA 3HL9A 4RX3A 3E2LA 4OOYA 4ZJ1A 4B88A 3ZVTA 4XUZA 1RGZA 1XA7A 2WZXA 5F1GA 2HDSA 2PU4A 1M6KA 4Q8IA 3HUMA 1BUEA 3Q07A 4R4SA 5KSHA 1K55A 1BLSA 1HVBA 1GHPA 3VOYA 3PBQA 4IBXA 4C3QA 4KZ9A 3VOZA 3PBNA 3IHBA 4DDYA 1ONHA 2XD1A 2Y2MA 2HPBA 5M1AA 2C5WB 4A5RA 1BTLA 1VQQA 4NETA 3M6HA 5TGFA 3JYIA 2EX2A 4JXVA 4BLMA 4OOLA 1Z6FA 4LCLA 4ZJ2A 3V5MA 5FAPA 5CERA 4P6BA 3V50A 4BQMA 3A3FA 3HLWA 1H8ZA 2Y2QA 5FI7A 4MLLA 3ZFZA 4RVAA 2OV5A 5CGXA 3FZCA 4E3LA 4JXSA 1KGEA 4OQHA 5GLAA 3ZGAB 5CRFA 2WZZA 3LEZA 1K54A 3VFFA 2H10A 1CI8A 3GMWA 3PAEA 4LCMA 1BLHA 2C6WB 4E6WA 3G31A 4E3MA 5HW3A 3AGDA 3OPRA 1TDGA 4JF4A 3GQZA 4P87A 4K91A 2UWXA 1GHMA 5DTSA 4MBHA 2Q9MA 2XLNA 3WS5A 3A3DA 1FQGA 2XR0A 4WMCA 3IF6A 1BLPA 3UO9A 3PTEA 3ITBA 1LLBA 1ZKJA 3GR2A 5M18A 2XH9A 1W8YA 1YLJA 2J9OA 1ERQA 4KQRA 1C3BA 1K25A 3MBZA 1KVMA 5EVIB 1E4DA 5FDHA 2Y2IA 4B4XA 5GHXA 3MZFA 4M3KA 1TDLA 1DJAA 2Y2KA 4QB8A 4ZDXA 1YLPA 1PYYA 2Y2JA 5DF9A 5CXWA 1RGYA 1YM1A 2Y2GA 4GOGA 4PPRA 1OMEA 3O86A 3IXGA 3SH9A 5KZHA 1NXYA 2GDNA 5EPHA 4GDNA 5HAQA 2V1ZA 3LY3A 3W8KA 4R3BA 4UAAA 2HP5A 4FD8A 4ID4A 1BSGA 1HZOA 4QY6A 2H0TA 4FH2A 3D4FA 4JLFA 4DE3A 4O7DA 1Q2PA 4OPQA 4DDSA 5F1FA 3BLSA 4YINA 3UPPA 4RA7A 4HBUA 4KZAA 5IHVA 1JWZA 4JXGA 3HUOA 4EBNA 1I5QA 4WZ4A 3RJUA 5AQBA 3QHYA 1FSWA 2ZC5B 3NI9A 3ZG8B 1M40A 4LV2A 5E2HA 2ZMAA 3AGEA 3WS4A 2XK1A 3NDEA 3UPOA 1S6RA 1L2SA 2X02A 3Q81A 2J7VA 2E8IA 3NY4A 2OSUA 4U3TA 5A92A 2XEPA 4KZ5A 4EWFA 1ES2A 4D2OA 5FASA 4S2NC 1FCMA 4GKUA 3WRTA 3EQVA 3NDGA 4X69A 1NYYA 3N6IA 1DY6A 5CGWA 3SOIA 3UY6A 4S2NA 1IYPA 5DTKA 4PM6A 1W7FA 1QMFA 4JKTA 5EOOA 3VP1A 1NRFA 4YFMA 5CTNA 1ONGA 3V3SA 2ZQCA 4KG5A 3ITAA 3OPLA 4PM5A 4GN2A 4MEZA 1KGFA 2EXAA 2ZM2A 4OPZA 3MXRA 5CGSA 2FFYA 3HLGA 2JCHA 3S22A 5AQ7A 1PZPA 2XFTA 1K57C 5J8XA 3WS0A 4EV4A 4PM8A 3UN7A 4GB7A 4MNRA 2XFSA 2ZQDA 4N92A 3MKFA 4RX2A 4CPKA 5HX9A 4DE1A 5CECA 1XP4A 4BJPA 2QZ6A 1PI5A 3BEBA 3O87A 4S2JA 3OPPA 4U0TA 5EUAA 1JTDA 3C7VA 1L0GA 1H8YA 1IKGA 2XD5A 3MFDA 4S2MA 3VSKA 3FV7A 3ZG0A 1E3UA 4QD4A 1K55C 3OCLA 5DF7A 1YLYA 2EX8A 4QHCA 3M2KA 5EVID 4GDBA 4DRTA 4KENB 1ESIA 1XX2A 4GD6A 5FQQA 1FCNA 2ZQ9A 1KVLA 5CHUA 1PZOA 3VFHA 3BYDA 4N1XA 2VGKA 2I72A 1KE4A 2WAFA 3GSGA 1PWCA 3W4QA 1XGJA 3G35A 3WS1A 4R3JA
chains in the Genus database with same CATH superfamily
3UDIA 1OJGA 3S1YA 1PW8A 4OQIA 4KZ6A 5CHMA 3DWZA 4L0LA 5FI6A 2O9AA 2L0WA 2PYRA 3IX4A 4GNUA 4XUXA 4BMWA 1H3QA 5L8MA 4WMCD 3G2ZA 3RXWA 1AWIA 2VV8A 4Y13A 3IH9A 2EX9A 1KDWA 1Q2QA 4WN5A 4F94A 2R9XA 3UE0A 1N4OA 4JF5A 2J3TD 4DN0A 3V67A 3FWLA 1DP9A 3LY4A 4KQDA 2J8YA 5CX7A 5GL9A 2HDQA 1KE3A 4OKPA 1OTAA 3BW6A 1N9BA 1WYCA 2QWSA 4NEED 5FAOA 3A3JA 5E43A 4LLOB 3BRMA 3NC8A 4X25A 4R1GA 3IXDA 5F68A 1I2WA 3IQAA 3O3VA 3WWXA 3VMAA 2EX6A 4Y0UA 1HTZA 3PBSA 5EFWA 2FZ0A 1BULA 2P7JA 5GLDA 2J80A 3MFXA 5GHYA 3QP8A 5L10A 2Y2NA 3O5YA 3U4LP 3TSGA 4GLQA 2XSSA 3LI9A 4N9KA 4YNRA 1E3UD 1CQAA 1VHMA 3ZG7B 3BFCA 4FTXA 1ZG4A 4Y7PA 4KZBA 2ZM8A 2V1BA 4HY8A 4OP8A 1ALQA 5CEBA 3CJMA 3TG9A 3F1PA 3QP1A 5IU1A 3H9WA 5FA7A 2XDMA 4JBFA 3BFDA 2K7SA 2W1TB 5HWTA 5FQKA 2VK3A 5AJGA 3MS6A 4FH4A 5HAIA 1NLZA 2XGNA 5HPFA 4D60A 2CC1A 4GCZA 4EESA 3OCNA 3I7JA 2Y2OA 2Y79A 2JN7A 4QWOA 3LIFA 4E3IA 4JGPA 3KSHA 4MBKA 2VGLM 4EEPA 2BASA 3G34A 5BOHA 2Y2LA 2PR6A 2PAVP 1FR1A 1SDNA 4ZJ3A 4GS9B 4S2IA 3SS5A 1L0DA 3S4XA 2ZC7A 5M19A 4E6XA 1I2SA 3JPUA 1H5XA 3N8LA 1D7EA 4E3NA 4MCWA 5EECA 2OWHA 1NY0A 2Y2PA 3VE3A 1BLCA 1PW1A 2JC7A 4EUVA 3OPHA 4OLDA 1MKIA 3D3OA 4Y17A 3IXBA 1YQSA 5CEDA 5KMWA 2VA0A 2B95A 2Z2LB 1IYOA 3H82B 3QP4A 5EE8A 1Y4OA 3RFBA 5L09A 2Q9NA 3NCKA 3NOTC 4FCFA 4HESA 2W3FA 4Q0IA 4OQGA 4N9LA 2R78A 2JKRM 3IS2B 1Z09A 1P9RA 3HLDA 4LV1A 1GSXA 3SH8A 3UDXA 3LR3A 3KO6A 1A0KA 3DTMA 3LI8A 1YSQA 2WKEA 2HJEA 1YMXA 3ZVWA 3BFEA 5JYPA 3N8SA 5HAPA 1SZVA 4M4XA 2V8CA 2V2FF 3EEHA 4JF6A 3SZTA 1W5DA 3HUNA 4FSFA 2LB9A 4R23A 4H8RA 4OOYA 4R70A 3FPVA 5F1GA 1M6KA 4R4SA 5KSHA 3PBQA 2W3HA 3CLOA 3CAXA 2M7UA 4CLCA 4NETA 4BLMA 2KLIA 3V5MA 5CERA 3V50A 4BQMA 1OTEA 5HWWA 5DJUA 3T4QA 5FI7A 3ZFZA 2OV5A 4E3LA 5DKLA 3IBJA 3LEZA 1CI8A 3P7NA 3KSFA 4BBUA 4E3MA 3AGDA 3OPRA 2W27A 2UWXA 4FOFA 3CHWP 1FQGA 1LSXA 1E4DA 1PYYA 2JKRI 2Y2JA 1OMEA 3S7NA 3O86A 3SH9A 2GDNA 3W8KA 4QY6A 5F5YA 2PYPA 4DDSA 4OPQA 5FEFA 1PRQA 5FDSA 3H7WA 4HBUA 4JXGA 4EBNA 5AQBA 3QHYA 3MQQA 3ZG8B 5HZHA 3C2WA 4U3TA 4I5SA 5A92A 4KZ5A 1OT6A 3LUQA 5FASA 3EQVA 1NYYA 3N6IA 1DY6A 5CGWA 4KUOA 3SOIA 1IYPA 4PM6A 1W7FA 1QMFA 1ONGA 2ZQCA 4MEZA 2ZM2A 2EXAA 5EM0A 2JCHA 3S22A 2KDKA 5AQ7A 4PM8A 3T4JA 3F1OA 4BJPA 2QZ6A 4EU0A 3T1RA 4DMZA 2XA7M 3ZG0A 1K55C 5DF7A 2EX8A 3BY9A 4GDBA 3BYDA 3NOUC 4N1XA 4UQIM 4HJ6A 5DKKA 3G35A 3CUEC 4E3KA 5TFQA 4N1HA 1VM1A 5A90A 3LICA 4DE2A 3DTKA 4GJ4A 2JHEA 1ES3A 1NLYA 2VGJA 3F1PB 1LSWA 3PXPA 4KZ7A 4BL2A 3MZEA 3G2YA 3FKVA 1MC0A 4HQAA 5A93A 3UNWA 3ZQ5A 2A3UA 3HLCA 1LT0A 2YKFA 1LL5A 3IXHA 4KQOA 1TEMA 1S1YA 1CF0A 2J3TC 4Z9QA 3W4PA 5D3OA 1NZUA 2ZMFA 4ZBEA 4DE0A 2WK0A 2GZAA 4BWIA 1MWUA 3MSHA 4IUKA 3IHAA 1AXBA 3T4TA 4OQ0A 5HWVA 3DWKA 2DRWA 2PU2A 3QNCA 2EFXA 4KQQA 1XJ4A 1XXMA 3BFFA 2EXBA 2P08A 1CI9A 2A49A 2IWCA 3U2AA 4QU3A 4EQIA 3HLBA 5EOEA 4JXWA 1VETA 3RXXA 4P6ZS 3C4PA 2ZOIA 3RTYA 2P9VA 4JGRA 2A24A 4Z1WA 4AFIA 4K0XA 1W63M 5FQ9A 1S4RA 3GV9A 5HFOA 4OVDA 4WEJA 1G6AA 1MPLA 2V0UA 5J4EA 1RP5A 3HCYA 3PBTA 1MWTA 2ZL1A 2J9PA 2RCXA 1WYBA 2DCFA 4IJGA 3E4QA 1GA9A 2X71A 5DTTA 4OP5A 5EVIC 3LEQA 2OAP1 3ZNYA 4DXBA 4ZRRA 3LR0A 2ZQ8A 3UPNA 4K0WA 3PBOA 3MJQA 5GLBA 3CZDA 3ZDJA 5HARA 4LRXC 5FAQA 2WGVA 3MZDA 3AGFA 1IYSA 3UE1A 1H0MA 4PM9A 2VJWA 1F2KA 1O7EA 3P09A 2DMWA 4X6TA 1JTGA 2XROA 1NJ4A 4BD0A 3OC2A 1MXOA 3P98A 2ZC4B 2Z6CA 2IWBA 1YLTA 2WGWA 1BYWA 4NG2A 4X53A 3IT9A 3EOIA 5F83A 3HLFA 5E2EA 4CLCB 4R0QA 2H5SA 1HD8A 1IKIA 2OLUA 1SHVA 2O0YA 3NIAA 5GLCA 1DRMA 4KUKA 1TS6A 1N9LA 3PAGA 2Y55A 4MBFA 1ES4A 1LI0A 3WRZA 4MN7A 2Y59A 1CEGA 3LIDA 3GTCA 1K56A 2JE5A 2ZD8A 1FR6A 2H0YA 4PAUA 3O88A 4C75A 2D01A 2RL3A 1G5UA 4EW7A 5EM1A 4OOMA 3MQ0A 3C4OA 2VLGA 4R6LA 3WS2A 3Q82A 3HBRA 4ZTKA 4Y5FA 3MKEA 2JKTM 2ZJ9A 1KE0A 1V9YA 4HBTA 2V20A 1LL9A 2HP6A 4WZ5C 2WKQA 3UDFA 2Z6DA 3BWLA 2GJ3A 4C6YA 3N4IA 1S67L 1XPBA 2Y91A 3H7WB 3Q7VA 4UA6A 5FSRA 2JKFA 3BECA 2Z2MB 1VEUA 3HL9A 2GX5A 4B88A 3ZVTA 4PHTA 1RGZA 2HJ9C 4YWZA 2WZXA 1FILA 2PU4A 4ETZA 2WKPA 1J3WA 4Q8IA 3HUMA 5G4YA 3MR0A 1K55A 3F1NA 3VOYA 4IBXA 4Y15A 4C3QA 2OWJA 3VOZA 3PBNA 3VOLA 1ONHA 2XD1A 2HPBA 5M1AA 2W3EA 1V9ZA 3FPWA 2HV1A 4GW9A 2EA9A 4JXVA 3CUEA 1Z6FA 4ZJ2A 5MC7A 3CITA 4P6BA 1PFLA 3HLWA 4RVAA 2V1AA 3F1OB 3FZCA 2ZOHA 4LRZE 4O8GA 1KGEA 2Q0OA 5GLAA 2AVXA 3VFFA 1DP6A 4HNBA 1BLHA 3R4KA 4JF4A 4P87A 4K91A 1T1BA 2XLNA 3WS5A 4R38A 3CPTA 4LGWA 2VV7A 2XR0A 4WMCA 3PTEA 3ITBA 3GR2A 1ZKJA 1YLJA 2QYBA 5HSQA 4KQRA 2MJ6A 1C3BA 3MBZA 5FDHA 4B4XA 4M3KA 5LBRA 5CXWA 1RGYA 5KZHA 1NXYA 3NULA 2G7UA 2V1ZA 1MZUA 2JKTI 2VKSA 1XFQA 1HZOA 3D4FA 4O7DA 1CJFA 5HDCA 5F1FA 5J7EA 5DJTA 3HUOA 1I5QA 2WKRA 3A0VA 4LV2A 1OTBA 2ZMAA 3NDEA 1S6RA 3Q81A 4X1MA 4Y2FA 2E8IA 5F69A 1XJ2A 4GKUA 2YKHA 2IA2A 3E4PA 2HF6A 4S2NA 5DTKA 3T4LA 3L7HA 3V3SA 1KGFA 1TF1A 3MXRA 1EW0A 2O99A 1WA9A 2XFTA 1K57C 2VX8A 3R7WA 3ZYTA 4EV4A 3UN7A 4MNRA 2ZQDA 4I39A 3MKFA 4CPKA 4DE1A 5CECA 1XP4A 4B9OA 1PI5A 2JKGA 3OPPA 1L0GA 2VEAA 1IKGA 3VSKA 1E3UA 3OCLA 1XX2A 4GD6A 5FQQA 5CHUA 1PZOA 1P9WA 1T1CA 4WL9A 1KE4A 2WAFA 3A0RA 4BBTA 4H6JA 1VETB 1XFNA 3OOVA 3QNBA 5CTMA 5EVIA 4WELA 1BT5A 4O01A 2P9VB 2B5RA 4G3KA 2A24B 2ZM0A 4EUZA 1PNEA 3LO7A 2QJ7A 3TW8A 1T18A 1L0FA 4WM9A 1MBLA 1Y28A 1OT9A 5AQ9A 1GSWA 3E2KA 3HJIA 5A91A 2ZL1B 3BM6A 2VGLS 3PHYA 2EWVA 3GRJA 4BENA 3IF6C 3DW0A 3D72A 3EQUA 3C38A 2G2WA 3A3IA 4FUWA 4GD8A 2QPNA 4QPRA 5FQIA 4L9EA 4LFUA 3B42A 1STZA 1XJ3A 4U0XA 2ZC3B 4UHUA 5FQMA 3IBRA 4EBLA 2V9AA 5FI2A 3UE3A 1SDEA 3QP2A 1MWSA 3LGOA 4E3JA 1PWDA 3VP3A 5F82A 2BLSA 3SS3A 3V3RA 1FOFA 5AQAA 1XKZA 3B33A 4WYYA 1MY8A 1RCJA 5F6AA 4PKYA 1TS7A 4GHIA 2B18A 1GCEA 2WGWB 3KX0X 5TJJA 1GA0A 3UE6A 1KDSA 2E8JA 5IS1A 2HDUA 1GHIA 5DVAA 5L2FA 4IVIA 2GNXA 3HREA 2WKIA 3IX8A 4P6ZM 1G68A 1L0EA 2WUQA 1E25A 2L4RA 3Q1FA 4X68A 4WF0A 2X01A 1YKDA 4HEFA 1F5MA 1K0KA 4HP4A 5HDDA 4ME4A 4WZ5A 1YLZA 3ZG9B 2XQZA 4BL3A 1P97A 4WBGA 2OOLA 2L1MA 4XXRA 2J3WA 1EROA 4I3JA 3N7WA 2P74A 3K3CA 2P04A 3LCEA 5G18A 1X0OA 5I94A 4DKIA 4KZ8A 5TBMB 1YMSA 4DJ2A 3G32A 3ICYA 3Q7VB 1K6RA 1PWGA 2Y4AA 4XT2A 2HP9A 2R9WA 3JVUA 1VEUB 1EWZA 4JGOA 4UA7A 1TS8A 3S7OA 4Y0TA 4KG6A 3MXQA 3F1NB 1W79A 5EV0A 3ZNTA 1T1AA 1K56D 3MMHA 3MQOA 5AVEA 3VP0A 1NYMA 1XA1A 4OONA 4L9GA 3S7PA 3TOIA 1U60A 1K4FA 3TJZC 4UA9A 4GZBA 2ZQ7A 2WAEA 3ULFA 1TVFA 3IH8A 1ERMA 3DBAA 3BFGA 3NOPC 3Q7ZA 2WYXA 3PBRA 3V39A 3CPTB 2WADA 5A8BA 2WKHA 1O07A 3ZCZA 3T1SA 4BD1A 1ES5A 5KSCA 3SW1A 1ZHHB 5IT5A 4MN6A 3EGXC 3DTIA 5KIZA 2EWWA 1IOUA 3D9YA 2H28A 1PIOA 5HD3A 3SH7A 4X56A 3BY8A 4LPZA 2XA7S 5U47A 1K57A 1NRJA 1LL8A 3CWFA 4RX3A 3E2LA 3K2NA 3QP6A 4XUZA 1W63Q 1XA7A 5HD5A 3K3DA 2HDSA 3DTEA 3KSGA 3Q07A 4UQIS 1N9NA 3E4OA 5FL3A 4DDYA 2Y2MA 5J3WA 4A5RA 2PD8A 3M6HA 3EEAA 3JYIA 2EX2A 1S4SA 4LCLA 1YAXA 5FAPA 3UB7A 3R7WB 1H8ZA 1SKOA 2M1CA 4Q0JA 4MLLA 5CGXA 2A2LA 2FH5A 4OQHA 3ZGAB 2H10A 3PAEA 3GMWA 4LCMA 5HW3A 1ACFA 1TDGA 3GQZA 5DTSA 2D02A 3LIEA 4ARZA 1L3LA 4MBHA 4UEYA 1TD5A 3TRCA 2OAQ1 1BLPA 3IF6A 4H6JB 5M18A 2XH9A 1W8YA 4IHQA 3FC7A 1ERQA 4NXEA 5EVIB 1KVMA 2Y2IA 5GHXA 3MZFA 1TDLA 2Y2KA 3T12B 2V0WA 5DF9A 3PR6A 2Y2GA 4PPRA 4GOGA 1UWPX 3LY3A 1OTDA 2HP5A 4FD8A 4ID4A 1BSGA 2CMNA 4FH2A 4JLFA 2PDRA 3BLSA 4YINA 3UPPA 3BQ8A 2Y8HA 4KZAA 5IHVA 3RJUA 2BTFP 1FSWA 1M40A 5E2HA 2W3GA 2XK1A 3UPOA 1L2SA 2OSUA 4HOIA 4EWFA 1T19A 1F9IA 3WRTA 3NDGA 2NUTC 3UY6A 4X1LA 3LFVA 4JKTA 5EOOA 1TS0A 2NUPC 1NRFA 4YFMA 5TBMA 3TE8A 3ITAA 3OPLA 4PM5A 4OPZA 1PZPA 5I5LA 3NECA 2XFSA 4N92A 4RX2A 4NXGA 1JTDA 1H8YA 3MFDA 2XD5A 1G6OA 4CLCD 4QD4A 1YLYA 4QHCA 5EVID 3M2KA 4DRTA 3BQAA 1FCNA 3VFHA 4NXBA 5C5KA 4I38A 4GHIB 3GSGA 3W4QA 3T1XA 1XGJA 3WS1A 1XJ6A 1NZOA 5HL1A 4QJGA 2ZBBA 4G3VA 2QMIA 3HJKA 1BZAA 1NWZA 4P85A 2K31A 4RQ9A 1K54C 1JWVA 3G30A 4ZAMA 3JVVA 4DF6A 3CG5A 4LRYC 5E2FA 2B02A 3UB5P 2I9VA 3CI6A 4LV3A 4Y0OA 5K5BA 4HJ4A 1K38A 2XF3A 5FQJA 4OPRA 3PYPA 2KX6A 2G2UA 4S2OA 5CHJA 5HDSA 5L07A 1K6SA 3LR4A 2XRNA 2PHYA 3CMZA 1JNUA 4IEDA 1LI9A 4NK3A 1YLWA 4DXCA 4LV0A 4WLAA 2ZC6B 2ZLYA 1FIKA 3NJAA 1LSVA 1UGUA 1IEMA 5EVLA 3IWOA 4HH2A 4CJNA 1ZG6A 4XT2B 1JVJA 2HZ5A 1Y54A 1DJCA 1MKMA 3VSLA 4S2PA 5DFXA 1IELA 4ETXA 3IF5A 4LENA 4F3LA 4HIAA 3KYZA 3UMEA 4NKPA 3IWIA 2HDRA 4IBRA 3FYZA 4MDZA 1CEFA 3M6BA 2OLVA 3LIBA 1S66L 2Y2HA 3HVFA 3BJNA 1W8QA 4RYEA 3MXSA 1SKFA 2W1RA 2QJ5A 3EGDC 3W4OA 3VP4A 3KYQA 4PM7A 2DNSA 4WEKA 1PI4A 4HH3A 2ZMVA 4HJ3A 1YPRA 4IVKA 4JGQA 3ZHHA 3BLMA 4P0MA 3G6OA 1QMEA 1DJBA 4S2KA 4CLCE 5JYOA 3G4PA 3VE4A 1SCWA 1FCOA 3QP5A 3NHQA 3IWQA 2KOIA 3M2JA 3ISGA 4QY5A 4IUHA 4WUJA 4X55A 1FSYA 3IX3A 4R4RA 3ZG5A 5FEGA 1OPXA 4EERA 4KZ3A 1CK3A 3A3EA 4YOFA 3C30A 5HPIA 3T50A 5GHZA 4B93A 1YT4A 1KGGA 5E2GA 1K4EA 2JBFA 1D06A 3P01A 3DAVA 4K08A 1ESUA 3OZHA 2PBYA 3EWKA 3RH8B 2BG1A 3GDIA 3C8CA 1IFQA 4JPMA 3UMDA 1OTIA 1ZC2A 1IYQA 1N9OA 2IWDA 2ZQAA 4OLGA 1S1ZA 3NBLA 1XGIA 2M7VA 1SKOB 4OH0A 3W2ZA 4CQHA 3FKWA 4HI4A 4KG2A 1HLUP 1GSVA 4KZ4A 3GVBA 1KOUA 3KSIA 2W1TA 4PMAA 5DF8A 5FATA 3SS4A 1EI5A 2FFFB 2EFUA 3HLEA 4ARZB 3VP2A 1YSPA 2O9BA 4E04A 3IF6B 3FG8A 2LB5A 2WGIA 3KYEA 1UWNX 3OBFA 4B4ZA 1F98A 3C7UA 4MMNA 4S2LA 1S0WA 2INWA 2HGVA 1MWRA 3MF0A 2QKPA 4OPYA 5TR7A 1J9MA 4G3WA 1WE4A 2V8FA 4I3IA 4I3AA 3B3XA 3L9KA 3C5AA 2UV0E 1D1JA 1ODVA 3N8RA 1G28A 1LHYA 1JWPA 4E3OA 3GECA 4R3AA 4ZJ1A 4BBVA 4Y3IA 4GS9A 3LYXA 1BUEA 1BLSA 4HP9A 1HVBA 1GHPA 4EQ1A 4KZ9A 1DP8A 3IHBA 3T4OA 4EXOA 2C5WB 3E0YA 1BTLA 1VQQA 3LR5A 5TGFA 1OJ5A 4OOLA 3E98A 4ESPA 3A3FA 3OLOA 2Y2QA 3UB9A 4JXSA 4II7A 5CRFA 2WZZA 1K54A 2W0NA 3H82A 2C6WB 4DJ3A 4E6WA 3G31A 1H8MA 1GHMA 2Q9MA 2VZWA 3A3DA 1P0ZA 3UO9A 3IS2A 1LLBA 2O9CA 4HHDA 2J9OA 3S7QA 1K25A 5HL6A 4QB8A 1DJAA 4ZDXA 1YLPA 1YM1A 3IXGA 5EPHA 4GDNA 5HAQA 2PRFA 4R3BA 4UAAA 3LIAA 3B47A 3A0SA 4L9FA 1VB6A 3T4SA 2H0TA 4DE3A 2W3DA 1Q2PA 4RA7A 5AVFA 1JWZA 4WZ4A 2VV6A 3T4KA 2ZC5B 3NI9A 5DFYA 2PD7A 3AGEA 3WS4A 2X02A 2QHKA 2J7VA 2PT7A 3NY4A 3UB8A 2XEPA 1ES2A 4D2OA 3VV4A 4S2NC 1FCMA 4X69A 2K2NA 1ZTUA 4EEUA 3VP1A 4MN5A 5CTNA 4KG5A 4GN2A 5EVEA 5CGSA 2FFYA 3HLGA 5J8XA 3WS0A 3UB6A 4GB7A 4PKYG 5HX9A 4NXFA 4EETB 4S2JA 5EUAA 3BEBA 3O87A 4U0TA 3C7VA 4Q0HA 5G4ZA 4S2MA 3FV7A 4O0PA 3T1QB 2PR5A 2PBDP 4KENB 1ESIA 2ZQ9A 4F3LB 1KVLA 2VGKA 4CLCC 2I72A 1PWCA 4EBPA 4R3JA 2ACGA
chains in the Genus database with same CATH topology
3QNBA 5CTMA 3UDIA 5EVIA 4E3KA 3S1YA 4WELA 1NZOA 1PW8A 4OQIA 1BT5A 5TFQA 2P9VB 2B5RA 4KZ6A 5CHMA 3DWZA 4L0LA 4N1HA 5FI6A 2ZM0A 4EUZA 3LO7A 1VM1A 5HL1A 5A90A 4QJGA 2QMIA 4DE2A 1BZAA 1L0FA 4P85A 4WM9A 4GNUA 1MBLA 4XUXA 1K54C 1JWVA 3G30A 4ZAMA 1ES3A 2VGJA 5AQ9A 4WMCD 3G2ZA 3RXWA 4DF6A 3CG5A 3E2KA 4KZ7A 4BL2A 3MZEA 5A91A 3G2YA 3IH9A 2EX9A 3FKVA 3BM6A 1KDWA 5E2FA 1Q2QA 4F94A 5A93A 3UNWA 2R9XA 3GRJA 3UE0A 2A3UA 1N4OA 4JF5A 3IF6C 3HLCA 4BENA 3DW0A 3EQUA 1LL5A 2G2WA 3A3IA 3IXHA 3FWLA 4LV3A 4KQOA 4Y0OA 3LY4A 2J8YA 5GL9A 1TEMA 2HDQA 1KE3A 4OKPA 1K38A 2XF3A 4Z9QA 4GD8A 5FQJA 3W4PA 4OPRA 2QPNA 5D3OA 1N9BA 2G2UA 1NZUA 1WYCA 4S2OA 5CHJA 4ZBEA 5FAOA 1K6SA 3A3JA 5FQIA 4DE0A 5E43A 2WK0A 3BRMA 3CMZA 3NC8A 4IEDA 4U0XA 1MWUA 2ZC3B 4R1GA 3IXDA 4UHUA 1LI9A 3IHAA 5FQMA 4NK3A 1YLWA 4DXCA 1AXBA 4EBLA 4LV0A 5FI2A 2ZC6B 4OQ0A 3UE3A 1SDEA 1I2WA 2ZLYA 3IQAA 1MWSA 3DWKA 3O3VA 4E3JA 1IEMA 2DRWA 1PWDA 3WWXA 3VMAA 2PU2A 3QNCA 3VP3A 2EFXA 2EX6A 5F82A 4KQQA 3IWOA 1HTZA 3PBSA 4Y0UA 5EVLA 1XXMA 3BFFA 4CJNA 1ZG6A 2EXBA 1JVJA 1Y54A 1CI9A 1DJCA 1BULA 2BLSA 3VSLA 3SS3A 5GLDA 2A49A 4S2PA 2IWCA 3V3RA 1FOFA 1IELA 1XKZA 5AQAA 3IF5A 4LENA 4QU3A 4WYYA 5GHYA 1MY8A 4EQIA 1RCJA 3HLBA 5EOEA 2Y2NA 2WGWB 1GCEA 3TSGA 1GA0A 4JXWA 3RXXA 3IWIA 1KDSA 3C4PA 2HDRA 2HDUA 1GHIA 4N9KA 4IBRA 3FYZA 5DVAA 2P9VA 1CEFA 5L2FA 1E3UD 3M6BA 4IVIA 2OLVA 2WKIA 3HREA 4EBPA 1G68A 4K0XA 2WUQA 1L0EA 2Y2HA 5FQ9A 3HVFA 1E25A 3ZG7B 3BFCA 3Q1FA 1ZG4A 3GV9A 4X68A 4Y7PA 5HFOA 4KZBA 4OVDA 2ZM8A 2X01A 4WEJA 4OP8A 1ALQA 1G6AA 1W8QA 1MPLA 3CJMA 3MXSA 1SKFA 4RYEA 3TG9A 5CEBA 4HEFA 1RP5A 3PBTA 1MWTA 3W4OA 3VP4A 2J9PA 4WZ5A 1YLZA 2RCXA 4PM7A 1WYBA 5FA7A 2XDMA 3ZG9B 2DNSA 4JBFA 2XQZA 4BL3A 2DCFA 3BFDA 4WEKA 1PI4A 1GA9A 2X71A 4WBGA 5DTTA 4OP5A 5FQKA 4XXRA 4IVKA 1EROA 5EVIC 3ZHHA 3BLMA 3N7WA 4P0MA 1QMEA 1DJBA 2P74A 3ZNYA 4S2KA 4DXBA 5JYOA 4FH4A 3UPNA 2ZQ8A 5HAIA 3G4PA 2XGNA 4K0WA 3LCEA 1SCWA 1FCOA 2CC1A 3IWQA 3PBOA 3OCNA 3I7JA 5GLBA 2Y2OA 3CZDA 3M2JA 3ZDJA 3ISGA 4QY5A 5G18A 5HARA 5I94A 4X55A 4DKIA 5FAQA 4KZ8A 4E3IA 1FSYA 2WGVA 3MZDA 4R4RA 3AGFA 3ZG5A 1IYSA 3UE1A 1YMSA 4MBKA 4PM9A 3G32A 4KZ3A 1O7EA 3Q7VB 1CK3A 1K6RA 1PWGA 3A3EA 3P09A 2Y4AA 3G34A 5BOHA 5GHZA 1YT4A 4X6TA 1KGGA 2Y2LA 5E2GA 2HP9A 2R9WA 1JTGA 1K4EA 1EWZA 1NJ4A 4UA7A 4BD0A 2JBFA 3OC2A 1FR1A 1SDNA 4ZJ3A 4S2IA 3SS5A 4Y0TA 1L0DA 1ESUA 4KG6A 1MXOA 3OZHA 2PBYA 3P98A 2ZC4B 2ZC7A 2IWBA 3S4XA 1YLTA 2WGWA 2BG1A 1W79A 4X53A 3IT9A 3ZNTA 4E6XA 5M19A 5F83A 1I2SA 4JPMA 1H5XA 3N8LA 3HLFA 1K56D 5E2EA 4E3NA 3VP0A 4R0QA 1NYMA 1XA1A 2H5SA 1HD8A 4OONA 1IKIA 5EECA 2OLUA 1SHVA 1ZC2A 1NY0A 2Y2PA 1IYQA 1BLCA 1PW1A 2IWDA 2ZQAA 3NIAA 5GLCA 1U60A 3TOIA 1K4FA 2JC7A 3PAGA 4OLGA 3NBLA 2Y55A 1MKIA 1XGIA 1ES4A 1LI0A 3OPHA 4MBFA 4OLDA 3WRZA 2Y59A 4OH0A 1CEGA 3GTCA 1K56A 2JE5A 3IXBA 4GZBA 4UA9A 2ZD8A 3FKWA 2ZQ7A 2WAEA 1YQSA 5CEDA 5KMWA 1FR6A 2H0YA 4KG2A 1TVFA 3IH8A 3O88A 4C75A 1ERMA 2RL3A 4KZ4A 3GVBA 2Z2LB 1IYOA 3BFGA 4PMAA 5DF8A 5FATA 5EE8A 3SS4A 1EI5A 2FFFB 2Q9NA 4OOMA 3NCKA 2EFUA 3HLEA 4FCFA 3Q7ZA 4HESA 2WYXA 3C4OA 3VP2A 3PBRA 3V39A 4OQGA 3IF6B 4N9LA 2WADA 3WS2A 3Q82A 3HBRA 2WKHA 4ZTKA 1O07A 3HLDA 4LV1A 3ZCZA 2WGIA 4B4ZA 4BD1A 1ES5A 3C7UA 3MKEA 2ZJ9A 4S2LA 1S0WA 3SH8A 3UDXA 5KSCA 1KE0A 4HBTA 1MWRA 2V20A 3DTMA 1LL9A 4OPYA 2WKEA 5TR7A 1J9MA 2HP6A 4WZ5C 1YMXA 3ZVWA 3BFEA 1WE4A 3UDFA 5JYPA 4C6YA 3B3XA 3N4IA 3N8SA 3C5AA 5HAPA 1XPBA 3N8RA 2Y91A 1PIOA 3SH7A 4UA6A 3Q7VA 5FSRA 4X56A 2V2FF 3BECA 1LHYA 4JF6A 5U47A 1JWPA 1K57A 1W5DA 3HUNA 4FSFA 4E3OA 2Z2MB 4R23A 4H8RA 3HL9A 4RX3A 3E2LA 4OOYA 4ZJ1A 4B88A 3ZVTA 4XUZA 1RGZA 1XA7A 2WZXA 5F1GA 2HDSA 2PU4A 1M6KA 4Q8IA 3HUMA 1BUEA 3Q07A 4R4SA 5KSHA 1K55A 1BLSA 1HVBA 1GHPA 3VOYA 3PBQA 4IBXA 4C3QA 4KZ9A 3VOZA 3PBNA 3IHBA 4DDYA 1ONHA 2XD1A 2Y2MA 2HPBA 5M1AA 2C5WB 4A5RA 1BTLA 1VQQA 4NETA 3M6HA 5TGFA 3JYIA 2EX2A 4JXVA 4BLMA 4OOLA 1Z6FA 4LCLA 4ZJ2A 3V5MA 5FAPA 5CERA 4P6BA 3V50A 4BQMA 3A3FA 3HLWA 1H8ZA 2Y2QA 5FI7A 4MLLA 3ZFZA 4RVAA 2OV5A 5CGXA 3FZCA 4E3LA 4JXSA 1KGEA 4OQHA 5GLAA 3ZGAB 5CRFA 2WZZA 3LEZA 1K54A 3VFFA 2H10A 1CI8A 3GMWA 3PAEA 4LCMA 1BLHA 2C6WB 4E6WA 3G31A 4E3MA 5HW3A 3AGDA 3OPRA 1TDGA 4JF4A 3GQZA 4P87A 4K91A 2UWXA 1GHMA 5DTSA 4MBHA 2Q9MA 2XLNA 3WS5A 3A3DA 1FQGA 2XR0A 4WMCA 3IF6A 1BLPA 3UO9A 3PTEA 3ITBA 1LLBA 1ZKJA 3GR2A 5M18A 2XH9A 1W8YA 1YLJA 2J9OA 1ERQA 4KQRA 1C3BA 1K25A 3MBZA 1KVMA 5EVIB 1E4DA 5FDHA 2Y2IA 4B4XA 5GHXA 3MZFA 4M3KA 1TDLA 1DJAA 2Y2KA 4QB8A 4ZDXA 1YLPA 1PYYA 2Y2JA 5DF9A 5CXWA 1RGYA 1YM1A 2Y2GA 4GOGA 4PPRA 1OMEA 3O86A 3IXGA 3SH9A 5KZHA 1NXYA 2GDNA 5EPHA 4GDNA 5HAQA 2V1ZA 3LY3A 3W8KA 4R3BA 4UAAA 2HP5A 4FD8A 4ID4A 1BSGA 1HZOA 4QY6A 2H0TA 4FH2A 3D4FA 4JLFA 4DE3A 4O7DA 1Q2PA 4OPQA 4DDSA 5F1FA 3BLSA 4YINA 3UPPA 4RA7A 4HBUA 4KZAA 5IHVA 1JWZA 4JXGA 3HUOA 4EBNA 1I5QA 4WZ4A 3RJUA 5AQBA 3QHYA 1FSWA 2ZC5B 3NI9A 3ZG8B 1M40A 4LV2A 5E2HA 2ZMAA 3AGEA 3WS4A 2XK1A 3NDEA 3UPOA 1S6RA 1L2SA 2X02A 3Q81A 2J7VA 2E8IA 3NY4A 2OSUA 4U3TA 5A92A 2XEPA 4KZ5A 4EWFA 1ES2A 4D2OA 5FASA 4S2NC 1FCMA 4GKUA 3WRTA 3EQVA 3NDGA 4X69A 1NYYA 3N6IA 1DY6A 5CGWA 3SOIA 3UY6A 4S2NA 1IYPA 5DTKA 4PM6A 1W7FA 1QMFA 4JKTA 5EOOA 3VP1A 1NRFA 4YFMA 5CTNA 1ONGA 3V3SA 2ZQCA 4KG5A 3ITAA 3OPLA 4PM5A 4GN2A 4MEZA 1KGFA 2EXAA 2ZM2A 4OPZA 3MXRA 5CGSA 2FFYA 3HLGA 2JCHA 3S22A 5AQ7A 1PZPA 2XFTA 1K57C 5J8XA 3WS0A 4EV4A 4PM8A 3UN7A 4GB7A 4MNRA 2XFSA 2ZQDA 4N92A 3MKFA 4RX2A 4CPKA 5HX9A 4DE1A 5CECA 1XP4A 4BJPA 2QZ6A 1PI5A 3BEBA 3O87A 4S2JA 3OPPA 4U0TA 5EUAA 1JTDA 3C7VA 1L0GA 1H8YA 1IKGA 2XD5A 3MFDA 4S2MA 3VSKA 3FV7A 3ZG0A 1E3UA 4QD4A 1K55C 3OCLA 5DF7A 1YLYA 2EX8A 4QHCA 3M2KA 5EVID 4GDBA 4DRTA 4KENB 1ESIA 1XX2A 4GD6A 5FQQA 1FCNA 2ZQ9A 1KVLA 5CHUA 1PZOA 3VFHA 3BYDA 4N1XA 2VGKA 2I72A 1KE4A 2WAFA 3GSGA 1PWCA 3W4QA 1XGJA 3G35A 3WS1A 4R3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNB A;  5CTM A;  3UDI A;  5EVI A;  4E3K A;  3S1Y A;  4WEL A;  1NZO A;  1PW8 A;  4OQI A;  1BT5 A;  5TFQ A;  2P9V B;  2B5R A;  4KZ6 A;  5CHM A;  3DWZ A;  4L0L A;  4N1H A;  5FI6 A;  2ZM0 A;  4EUZ A;  3LO7 A;  1VM1 A;  5HL1 A;  5A90 A;  4QJG A;  2QMI A;  4DE2 A;  1BZA A;  1L0F A;  4P85 A;  4WM9 A;  4GNU A;  1MBL A;  4XUX A;  1K54 C;  1JWV A;  3G30 A;  4ZAM A;  1ES3 A;  2VGJ A;  5AQ9 A;  4WMC D;  3G2Z A;  3RXW A;  4DF6 A;  3CG5 A;  3E2K A;  4KZ7 A;  4BL2 A;  3MZE A;  5A91 A;  3G2Y A;  3IH9 A;  2EX9 A;  3FKV A;  3BM6 A;  1KDW A;  5E2F A;  1Q2Q A;  4F94 A;  5A93 A;  3UNW A;  2R9X A;  3GRJ A;  3UE0 A;  2A3U A;  1N4O A;  4JF5 A;  3IF6 C;  3HLC A;  4BEN A;  3DW0 A;  3EQU A;  1LL5 A;  2G2W A;  3A3I A;  3IXH A;  3FWL A;  4LV3 A;  4KQO A;  4Y0O A;  3LY4 A;  2J8Y A;  5GL9 A;  1TEM A;  2HDQ A;  1KE3 A;  4OKP A;  1K38 A;  2XF3 A;  4Z9Q A;  4GD8 A;  5FQJ A;  3W4P A;  4OPR A;  2QPN A;  5D3O A;  1N9B A;  2G2U A;  1NZU A;  1WYC A;  4S2O A;  5CHJ A;  4ZBE A;  5FAO A;  1K6S A;  3A3J A;  5FQI A;  4DE0 A;  5E43 A;  2WK0 A;  3BRM A;  3CMZ A;  3NC8 A;  4IED A;  4U0X A;  1MWU A;  2ZC3 B;  4R1G A;  3IXD A;  4UHU A;  1LI9 A;  3IHA A;  5FQM A;  4NK3 A;  1YLW A;  4DXC A;  1AXB A;  4EBL A;  4LV0 A;  5FI2 A;  2ZC6 B;  4OQ0 A;  3UE3 A;  1SDE A;  1I2W A;  2ZLY A;  3IQA A;  1MWS A;  3DWK A;  3O3V A;  4E3J A;  1IEM A;  2DRW A;  1PWD A;  3WWX A;  3VMA A;  2PU2 A;  3QNC A;  3VP3 A;  2EFX A;  2EX6 A;  5F82 A;  4KQQ A;  3IWO A;  1HTZ A;  3PBS A;  4Y0U A;  5EVL A;  1XXM A;  3BFF A;  4CJN A;  1ZG6 A;  2EXB A;  1JVJ A;  1Y54 A;  1CI9 A;  1DJC A;  1BUL A;  2BLS A;  3VSL A;  3SS3 A;  5GLD A;  2A49 A;  4S2P A;  2IWC A;  3V3R A;  1FOF A;  1IEL A;  1XKZ A;  5AQA A;  3IF5 A;  4LEN A;  4QU3 A;  4WYY A;  5GHY A;  1MY8 A;  4EQI A;  1RCJ A;  3HLB A;  5EOE A;  2Y2N A;  2WGW B;  1GCE A;  3TSG A;  1GA0 A;  4JXW A;  3RXX A;  3IWI A;  1KDS A;  3C4P A;  2HDR A;  2HDU A;  1GHI A;  4N9K A;  4IBR A;  3FYZ A;  5DVA A;  2P9V A;  1CEF A;  5L2F A;  1E3U D;  3M6B A;  4IVI A;  2OLV A;  2WKI A;  3HRE A;  4EBP A;  1G68 A;  4K0X A;  2WUQ A;  1L0E A;  2Y2H A;  5FQ9 A;  3HVF A;  1E25 A;  3ZG7 B;  3BFC A;  3Q1F A;  1ZG4 A;  3GV9 A;  4X68 A;  4Y7P A;  5HFO A;  4KZB A;  4OVD A;  2ZM8 A;  2X01 A;  4WEJ A;  4OP8 A;  1ALQ A;  1G6A A;  1W8Q A;  1MPL A;  3CJM A;  3MXS A;  1SKF A;  4RYE A;  3TG9 A;  5CEB A;  4HEF A;  1RP5 A;  3PBT A;  1MWT A;  3W4O A;  3VP4 A;  2J9P A;  4WZ5 A;  1YLZ A;  2RCX A;  4PM7 A;  1WYB A;  5FA7 A;  2XDM A;  3ZG9 B;  2DNS A;  4JBF A;  2XQZ A;  4BL3 A;  2DCF A;  3BFD A;  4WEK A;  1PI4 A;  1GA9 A;  2X71 A;  4WBG A;  5DTT A;  4OP5 A;  5FQK A;  4XXR A;  4IVK A;  1ERO A;  5EVI C;  3ZHH A;  3BLM A;  3N7W A;  4P0M A;  1QME A;  1DJB A;  2P74 A;  3ZNY A;  4S2K A;  4DXB A;  5JYO A;  4FH4 A;  3UPN A;  2ZQ8 A;  5HAI A;  3G4P A;  2XGN A;  4K0W A;  3LCE A;  1SCW A;  1FCO A;  2CC1 A;  3IWQ A;  3PBO A;  3OCN A;  3I7J A;  5GLB A;  2Y2O A;  3CZD A;  3M2J A;  3ZDJ A;  3ISG A;  4QY5 A;  5G18 A;  5HAR A;  5I94 A;  4X55 A;  4DKI A;  5FAQ A;  4KZ8 A;  4E3I A;  1FSY A;  2WGV A;  3MZD A;  4R4R A;  3AGF A;  3ZG5 A;  1IYS A;  3UE1 A;  1YMS A;  4MBK A;  4PM9 A;  3G32 A;  4KZ3 A;  1O7E A;  3Q7V B;  1CK3 A;  1K6R A;  1PWG A;  3A3E A;  3P09 A;  2Y4A A;  3G34 A;  5BOH A;  5GHZ A;  1YT4 A;  4X6T A;  1KGG A;  2Y2L A;  5E2G A;  2HP9 A;  2R9W A;  1JTG A;  1K4E A;  1EWZ A;  1NJ4 A;  4UA7 A;  4BD0 A;  2JBF A;  3OC2 A;  1FR1 A;  1SDN A;  4ZJ3 A;  4S2I A;  3SS5 A;  4Y0T A;  1L0D A;  1ESU A;  4KG6 A;  1MXO A;  3OZH A;  2PBY A;  3P98 A;  2ZC4 B;  2ZC7 A;  2IWB A;  3S4X A;  1YLT A;  2WGW A;  2BG1 A;  1W79 A;  4X53 A;  3IT9 A;  3ZNT A;  4E6X A;  5M19 A;  5F83 A;  1I2S A;  4JPM A;  1H5X A;  3N8L A;  3HLF A;  1K56 D;  5E2E A;  4E3N A;  3VP0 A;  4R0Q A;  1NYM A;  1XA1 A;  2H5S A;  1HD8 A;  4OON A;  1IKI A;  5EEC A;  2OLU A;  1SHV A;  1ZC2 A;  1NY0 A;  2Y2P A;  1IYQ A;  1BLC A;  1PW1 A;  2IWD A;  2ZQA A;  3NIA A;  5GLC A;  1U60 A;  3TOI A;  1K4F A;  2JC7 A;  3PAG A;  4OLG A;  3NBL A;  2Y55 A;  1MKI A;  1XGI A;  1ES4 A;  1LI0 A;  3OPH A;  4MBF A;  4OLD A;  3WRZ A;  2Y59 A;  4OH0 A;  1CEG A;  3GTC A;  1K56 A;  2JE5 A;  3IXB A;  4GZB A;  4UA9 A;  2ZD8 A;  3FKW A;  2ZQ7 A;  2WAE A;  1YQS A;  5CED A;  5KMW A;  1FR6 A;  2H0Y A;  4KG2 A;  1TVF A;  3IH8 A;  3O88 A;  4C75 A;  1ERM A;  2RL3 A;  4KZ4 A;  3GVB A;  2Z2L B;  1IYO A;  3BFG A;  4PMA A;  5DF8 A;  5FAT A;  5EE8 A;  3SS4 A;  1EI5 A;  2FFF B;  2Q9N A;  4OOM A;  3NCK A;  2EFU A;  3HLE A;  4FCF A;  3Q7Z A;  4HES A;  2WYX A;  3C4O A;  3VP2 A;  3PBR A;  3V39 A;  4OQG A;  3IF6 B;  4N9L A;  2WAD A;  3WS2 A;  3Q82 A;  3HBR A;  2WKH A;  4ZTK A;  1O07 A;  3HLD A;  4LV1 A;  3ZCZ A;  2WGI A;  4B4Z A;  4BD1 A;  1ES5 A;  3C7U A;  3MKE A;  2ZJ9 A;  4S2L A;  1S0W A;  3SH8 A;  3UDX A;  5KSC A;  1KE0 A;  4HBT A;  1MWR A;  2V20 A;  3DTM A;  1LL9 A;  4OPY A;  2WKE A;  5TR7 A;  1J9M A;  2HP6 A;  4WZ5 C;  1YMX A;  3ZVW A;  3BFE A;  1WE4 A;  3UDF A;  5JYP A;  4C6Y A;  3B3X A;  3N4I A;  3N8S A;  3C5A A;  5HAP A;  1XPB A;  3N8R A;  2Y91 A;  1PIO A;  3SH7 A;  4UA6 A;  3Q7V A;  5FSR A;  4X56 A;  2V2F F;  3BEC A;  1LHY A;  4JF6 A;  5U47 A;  1JWP A;  1K57 A;  1W5D A;  3HUN A;  4FSF A;  4E3O A;  2Z2M B;  4R23 A;  4H8R A;  3HL9 A;  4RX3 A;  3E2L A;  4OOY A;  4ZJ1 A;  4B88 A;  3ZVT A;  4XUZ A;  1RGZ A;  1XA7 A;  2WZX A;  5F1G A;  2HDS A;  2PU4 A;  1M6K A;  4Q8I A;  3HUM A;  1BUE A;  3Q07 A;  4R4S A;  5KSH A;  1K55 A;  1BLS A;  1HVB A;  1GHP A;  3VOY A;  3PBQ A;  4IBX A;  4C3Q A;  4KZ9 A;  3VOZ A;  3PBN A;  3IHB A;  4DDY A;  1ONH A;  2XD1 A;  2Y2M A;  2HPB A;  5M1A A;  2C5W B;  4A5R A;  1BTL A;  1VQQ A;  4NET A;  3M6H A;  5TGF A;  3JYI A;  2EX2 A;  4JXV A;  4BLM A;  4OOL A;  1Z6F A;  4LCL A;  4ZJ2 A;  3V5M A;  5FAP A;  5CER A;  4P6B A;  3V50 A;  4BQM A;  3A3F A;  3HLW A;  1H8Z A;  2Y2Q A;  5FI7 A;  4MLL A;  3ZFZ A;  4RVA A;  2OV5 A;  5CGX A;  3FZC A;  4E3L A;  4JXS A;  1KGE A;  4OQH A;  5GLA A;  3ZGA B;  5CRF A;  2WZZ A;  3LEZ A;  1K54 A;  3VFF A;  2H10 A;  1CI8 A;  3GMW A;  3PAE A;  4LCM A;  1BLH A;  2C6W B;  4E6W A;  3G31 A;  4E3M A;  5HW3 A;  3AGD A;  3OPR A;  1TDG A;  4JF4 A;  3GQZ A;  4P87 A;  4K91 A;  2UWX A;  1GHM A;  5DTS A;  4MBH A;  2Q9M A;  2XLN A;  3WS5 A;  3A3D A;  1FQG A;  2XR0 A;  4WMC A;  3IF6 A;  1BLP A;  3UO9 A;  3PTE A;  3ITB A;  1LLB A;  1ZKJ A;  3GR2 A;  5M18 A;  2XH9 A;  1W8Y A;  1YLJ A;  2J9O A;  1ERQ A;  4KQR A;  1C3B A;  1K25 A;  3MBZ A;  1KVM A;  5EVI B;  1E4D A;  5FDH A;  2Y2I A;  4B4X A;  5GHX A;  3MZF A;  4M3K A;  1TDL A;  1DJA A;  2Y2K A;  4QB8 A;  4ZDX A;  1YLP A;  1PYY A;  2Y2J A;  5DF9 A;  5CXW A;  1RGY A;  1YM1 A;  2Y2G A;  4GOG A;  4PPR A;  1OME A;  3O86 A;  3IXG A;  3SH9 A;  5KZH A;  1NXY A;  2GDN A;  5EPH A;  4GDN A;  5HAQ A;  2V1Z A;  3LY3 A;  3W8K A;  4R3B A;  4UAA A;  2HP5 A;  4FD8 A;  4ID4 A;  1BSG A;  1HZO A;  4QY6 A;  2H0T A;  4FH2 A;  3D4F A;  4JLF A;  4DE3 A;  4O7D A;  1Q2P A;  4OPQ A;  4DDS A;  5F1F A;  3BLS A;  4YIN A;  3UPP A;  4RA7 A;  4HBU A;  4KZA A;  5IHV A;  1JWZ A;  4JXG A;  3HUO A;  4EBN A;  1I5Q A;  4WZ4 A;  3RJU A;  5AQB A;  3QHY A;  1FSW A;  2ZC5 B;  3NI9 A;  3ZG8 B;  1M40 A;  4LV2 A;  5E2H A;  2ZMA A;  3AGE A;  3WS4 A;  2XK1 A;  3NDE A;  3UPO A;  1S6R A;  1L2S A;  2X02 A;  3Q81 A;  2J7V A;  2E8I A;  3NY4 A;  2OSU A;  4U3T A;  5A92 A;  2XEP A;  4KZ5 A;  4EWF A;  1ES2 A;  4D2O A;  5FAS A;  4S2N C;  1FCM A;  4GKU A;  3WRT A;  3EQV A;  3NDG A;  4X69 A;  1NYY A;  3N6I A;  1DY6 A;  5CGW A;  3SOI A;  3UY6 A;  4S2N A;  1IYP A;  5DTK A;  4PM6 A;  1W7F A;  1QMF A;  4JKT A;  5EOO A;  3VP1 A;  1NRF A;  4YFM A;  5CTN A;  1ONG A;  3V3S A;  2ZQC A;  4KG5 A;  3ITA A;  3OPL A;  4PM5 A;  4GN2 A;  4MEZ A;  1KGF A;  2EXA A;  2ZM2 A;  4OPZ A;  3MXR A;  5CGS A;  2FFY A;  3HLG A;  2JCH A;  3S22 A;  5AQ7 A;  1PZP A;  2XFT A;  1K57 C;  5J8X A;  3WS0 A;  4EV4 A;  4PM8 A;  3UN7 A;  4GB7 A;  4MNR A;  2XFS A;  2ZQD A;  4N92 A;  3MKF A;  4RX2 A;  4CPK A;  5HX9 A;  4DE1 A;  5CEC A;  1XP4 A;  4BJP A;  2QZ6 A;  1PI5 A;  3BEB A;  3O87 A;  4S2J A;  3OPP A;  4U0T A;  5EUA A;  1JTD A;  3C7V A;  1L0G A;  1H8Y A;  1IKG A;  2XD5 A;  3MFD A;  4S2M A;  3VSK A;  3FV7 A;  3ZG0 A;  1E3U A;  4QD4 A;  1K55 C;  3OCL A;  5DF7 A;  1YLY A;  2EX8 A;  4QHC A;  3M2K A;  5EVI D;  4GDB A;  4DRT A;  4KEN B;  1ESI A;  1XX2 A;  4GD6 A;  5FQQ A;  1FCN A;  2ZQ9 A;  1KVL A;  5CHU A;  1PZO A;  3VFH A;  3BYD A;  4N1X A;  2VGK A;  2I72 A;  1KE4 A;  2WAF A;  3GSG A;  1PWC A;  3W4Q A;  1XGJ A;  3G35 A;  3WS1 A;  4R3J A; 
#chains in the Genus database with same CATH topology
 3UDI A;  1OJG A;  3S1Y A;  1PW8 A;  4OQI A;  4KZ6 A;  5CHM A;  3DWZ A;  4L0L A;  5FI6 A;  2O9A A;  2L0W A;  2PYR A;  3IX4 A;  4GNU A;  4XUX A;  4BMW A;  1H3Q A;  5L8M A;  4WMC D;  3G2Z A;  3RXW A;  1AWI A;  2VV8 A;  4Y13 A;  3IH9 A;  2EX9 A;  1KDW A;  1Q2Q A;  4WN5 A;  4F94 A;  2R9X A;  3UE0 A;  1N4O A;  4JF5 A;  2J3T D;  4DN0 A;  3V67 A;  3FWL A;  1DP9 A;  3LY4 A;  4KQD A;  2J8Y A;  5CX7 A;  5GL9 A;  2HDQ A;  1KE3 A;  4OKP A;  1OTA A;  3BW6 A;  1N9B A;  1WYC A;  2QWS A;  4NEE D;  5FAO A;  3A3J A;  5E43 A;  4LLO B;  3BRM A;  3NC8 A;  4X25 A;  4R1G A;  3IXD A;  5F68 A;  1I2W A;  3IQA A;  3O3V A;  3WWX A;  3VMA A;  2EX6 A;  4Y0U A;  1HTZ A;  3PBS A;  5EFW A;  2FZ0 A;  1BUL A;  2P7J A;  5GLD A;  2J80 A;  3MFX A;  5GHY A;  3QP8 A;  5L10 A;  2Y2N A;  3O5Y A;  3U4L P;  3TSG A;  4GLQ A;  2XSS A;  3LI9 A;  4N9K A;  4YNR A;  1E3U D;  1CQA A;  1VHM A;  3ZG7 B;  3BFC A;  4FTX A;  1ZG4 A;  4Y7P A;  4KZB A;  2ZM8 A;  2V1B A;  4HY8 A;  4OP8 A;  1ALQ A;  5CEB A;  3CJM A;  3TG9 A;  3F1P A;  3QP1 A;  5IU1 A;  3H9W A;  5FA7 A;  2XDM A;  4JBF A;  3BFD A;  2K7S A;  2W1T B;  5HWT A;  5FQK A;  2VK3 A;  5AJG A;  3MS6 A;  4FH4 A;  5HAI A;  1NLZ A;  2XGN A;  5HPF A;  4D60 A;  2CC1 A;  4GCZ A;  4EES A;  3OCN A;  3I7J A;  2Y2O A;  2Y79 A;  2JN7 A;  4QWO A;  3LIF A;  4E3I A;  4JGP A;  3KSH A;  4MBK A;  2VGL M;  4EEP A;  2BAS A;  3G34 A;  5BOH A;  2Y2L A;  2PR6 A;  2PAV P;  1FR1 A;  1SDN A;  4ZJ3 A;  4GS9 B;  4S2I A;  3SS5 A;  1L0D A;  3S4X A;  2ZC7 A;  5M19 A;  4E6X A;  1I2S A;  3JPU A;  1H5X A;  3N8L A;  1D7E A;  4E3N A;  4MCW A;  5EEC A;  2OWH A;  1NY0 A;  2Y2P A;  3VE3 A;  1BLC A;  1PW1 A;  2JC7 A;  4EUV A;  3OPH A;  4OLD A;  1MKI A;  3D3O A;  4Y17 A;  3IXB A;  1YQS A;  5CED A;  5KMW A;  2VA0 A;  2B95 A;  2Z2L B;  1IYO A;  3H82 B;  3QP4 A;  5EE8 A;  1Y4O A;  3RFB A;  5L09 A;  2Q9N A;  3NCK A;  3NOT C;  4FCF A;  4HES A;  2W3F A;  4Q0I A;  4OQG A;  4N9L A;  2R78 A;  2JKR M;  3IS2 B;  1Z09 A;  1P9R A;  3HLD A;  4LV1 A;  1GSX A;  3SH8 A;  3UDX A;  3LR3 A;  3KO6 A;  1A0K A;  3DTM A;  3LI8 A;  1YSQ A;  2WKE A;  2HJE A;  1YMX A;  3ZVW A;  3BFE A;  5JYP A;  3N8S A;  5HAP A;  1SZV A;  4M4X A;  2V8C A;  2V2F F;  3EEH A;  4JF6 A;  3SZT A;  1W5D A;  3HUN A;  4FSF A;  2LB9 A;  4R23 A;  4H8R A;  4OOY A;  4R70 A;  3FPV A;  5F1G A;  1M6K A;  4R4S A;  5KSH A;  3PBQ A;  2W3H A;  3CLO A;  3CAX A;  2M7U A;  4CLC A;  4NET A;  4BLM A;  2KLI A;  3V5M A;  5CER A;  3V50 A;  4BQM A;  1OTE A;  5HWW A;  5DJU A;  3T4Q A;  5FI7 A;  3ZFZ A;  2OV5 A;  4E3L A;  5DKL A;  3IBJ A;  3LEZ A;  1CI8 A;  3P7N A;  3KSF A;  4BBU A;  4E3M A;  3AGD A;  3OPR A;  2W27 A;  2UWX A;  4FOF A;  3CHW P;  1FQG A;  1LSX A;  1E4D A;  1PYY A;  2JKR I;  2Y2J A;  1OME A;  3S7N A;  3O86 A;  3SH9 A;  2GDN A;  3W8K A;  4QY6 A;  5F5Y A;  2PYP A;  4DDS A;  4OPQ A;  5FEF A;  1PRQ A;  5FDS A;  3H7W A;  4HBU A;  4JXG A;  4EBN A;  5AQB A;  3QHY A;  3MQQ A;  3ZG8 B;  5HZH A;  3C2W A;  4U3T A;  4I5S A;  5A92 A;  4KZ5 A;  1OT6 A;  3LUQ A;  5FAS A;  3EQV A;  1NYY A;  3N6I A;  1DY6 A;  5CGW A;  4KUO A;  3SOI A;  1IYP A;  4PM6 A;  1W7F A;  1QMF A;  1ONG A;  2ZQC A;  4MEZ A;  2ZM2 A;  2EXA A;  5EM0 A;  2JCH A;  3S22 A;  2KDK A;  5AQ7 A;  4PM8 A;  3T4J A;  3F1O A;  4BJP A;  2QZ6 A;  4EU0 A;  3T1R A;  4DMZ A;  2XA7 M;  3ZG0 A;  1K55 C;  5DF7 A;  2EX8 A;  3BY9 A;  4GDB A;  3BYD A;  3NOU C;  4N1X A;  4UQI M;  4HJ6 A;  5DKK A;  3G35 A;  3CUE C;  4E3K A;  5TFQ A;  4N1H A;  1VM1 A;  5A90 A;  3LIC A;  4DE2 A;  3DTK A;  4GJ4 A;  2JHE A;  1ES3 A;  1NLY A;  2VGJ A;  3F1P B;  1LSW A;  3PXP A;  4KZ7 A;  4BL2 A;  3MZE A;  3G2Y A;  3FKV A;  1MC0 A;  4HQA A;  5A93 A;  3UNW A;  3ZQ5 A;  2A3U A;  3HLC A;  1LT0 A;  2YKF A;  1LL5 A;  3IXH A;  4KQO A;  1TEM A;  1S1Y A;  1CF0 A;  2J3T C;  4Z9Q A;  3W4P A;  5D3O A;  1NZU A;  2ZMF A;  4ZBE A;  4DE0 A;  2WK0 A;  2GZA A;  4BWI A;  1MWU A;  3MSH A;  4IUK A;  3IHA A;  1AXB A;  3T4T A;  4OQ0 A;  5HWV A;  3DWK A;  2DRW A;  2PU2 A;  3QNC A;  2EFX A;  4KQQ A;  1XJ4 A;  1XXM A;  3BFF A;  2EXB A;  2P08 A;  1CI9 A;  2A49 A;  2IWC A;  3U2A A;  4QU3 A;  4EQI A;  3HLB A;  5EOE A;  4JXW A;  1VET A;  3RXX A;  4P6Z S;  3C4P A;  2ZOI A;  3RTY A;  2P9V A;  4JGR A;  2A24 A;  4Z1W A;  4AFI A;  4K0X A;  1W63 M;  5FQ9 A;  1S4R A;  3GV9 A;  5HFO A;  4OVD A;  4WEJ A;  1G6A A;  1MPL A;  2V0U A;  5J4E A;  1RP5 A;  3HCY A;  3PBT A;  1MWT A;  2ZL1 A;  2J9P A;  2RCX A;  1WYB A;  2DCF A;  4IJG A;  3E4Q A;  1GA9 A;  2X71 A;  5DTT A;  4OP5 A;  5EVI C;  3LEQ A;  2OAP 1;  3ZNY A;  4DXB A;  4ZRR A;  3LR0 A;  2ZQ8 A;  3UPN A;  4K0W A;  3PBO A;  3MJQ A;  5GLB A;  3CZD A;  3ZDJ A;  5HAR A;  4LRX C;  5FAQ A;  2WGV A;  3MZD A;  3AGF A;  1IYS A;  3UE1 A;  1H0M A;  4PM9 A;  2VJW A;  1F2K A;  1O7E A;  3P09 A;  2DMW A;  4X6T A;  1JTG A;  2XRO A;  1NJ4 A;  4BD0 A;  3OC2 A;  1MXO A;  3P98 A;  2ZC4 B;  2Z6C A;  2IWB A;  1YLT A;  2WGW A;  1BYW A;  4NG2 A;  4X53 A;  3IT9 A;  3EOI A;  5F83 A;  3HLF A;  5E2E A;  4CLC B;  4R0Q A;  2H5S A;  1HD8 A;  1IKI A;  2OLU A;  1SHV A;  2O0Y A;  3NIA A;  5GLC A;  1DRM A;  4KUK A;  1TS6 A;  1N9L A;  3PAG A;  2Y55 A;  4MBF A;  1ES4 A;  1LI0 A;  3WRZ A;  4MN7 A;  2Y59 A;  1CEG A;  3LID A;  3GTC A;  1K56 A;  2JE5 A;  2ZD8 A;  1FR6 A;  2H0Y A;  4PAU A;  3O88 A;  4C75 A;  2D01 A;  2RL3 A;  1G5U A;  4EW7 A;  5EM1 A;  4OOM A;  3MQ0 A;  3C4O A;  2VLG A;  4R6L A;  3WS2 A;  3Q82 A;  3HBR A;  4ZTK A;  4Y5F A;  3MKE A;  2JKT M;  2ZJ9 A;  1KE0 A;  1V9Y A;  4HBT A;  2V20 A;  1LL9 A;  2HP6 A;  4WZ5 C;  2WKQ A;  3UDF A;  2Z6D A;  3BWL A;  2GJ3 A;  4C6Y A;  3N4I A;  1S67 L;  1XPB A;  2Y91 A;  3H7W B;  3Q7V A;  4UA6 A;  5FSR A;  2JKF A;  3BEC A;  2Z2M B;  1VEU A;  3HL9 A;  2GX5 A;  4B88 A;  3ZVT A;  4PHT A;  1RGZ A;  2HJ9 C;  4YWZ A;  2WZX A;  1FIL A;  2PU4 A;  4ETZ A;  2WKP A;  1J3W A;  4Q8I A;  3HUM A;  5G4Y A;  3MR0 A;  1K55 A;  3F1N A;  3VOY A;  4IBX A;  4Y15 A;  4C3Q A;  2OWJ A;  3VOZ A;  3PBN A;  3VOL A;  1ONH A;  2XD1 A;  2HPB A;  5M1A A;  2W3E A;  1V9Z A;  3FPW A;  2HV1 A;  4GW9 A;  2EA9 A;  4JXV A;  3CUE A;  1Z6F A;  4ZJ2 A;  5MC7 A;  3CIT A;  4P6B A;  1PFL A;  3HLW A;  4RVA A;  2V1A A;  3F1O B;  3FZC A;  2ZOH A;  4LRZ E;  4O8G A;  1KGE A;  2Q0O A;  5GLA A;  2AVX A;  3VFF A;  1DP6 A;  4HNB A;  1BLH A;  3R4K A;  4JF4 A;  4P87 A;  4K91 A;  1T1B A;  2XLN A;  3WS5 A;  4R38 A;  3CPT A;  4LGW A;  2VV7 A;  2XR0 A;  4WMC A;  3PTE A;  3ITB A;  3GR2 A;  1ZKJ A;  1YLJ A;  2QYB A;  5HSQ A;  4KQR A;  2MJ6 A;  1C3B A;  3MBZ A;  5FDH A;  4B4X A;  4M3K A;  5LBR A;  5CXW A;  1RGY A;  5KZH A;  1NXY A;  3NUL A;  2G7U A;  2V1Z A;  1MZU A;  2JKT I;  2VKS A;  1XFQ A;  1HZO A;  3D4F A;  4O7D A;  1CJF A;  5HDC A;  5F1F A;  5J7E A;  5DJT A;  3HUO A;  1I5Q A;  2WKR A;  3A0V A;  4LV2 A;  1OTB A;  2ZMA A;  3NDE A;  1S6R A;  3Q81 A;  4X1M A;  4Y2F A;  2E8I A;  5F69 A;  1XJ2 A;  4GKU A;  2YKH A;  2IA2 A;  3E4P A;  2HF6 A;  4S2N A;  5DTK A;  3T4L A;  3L7H A;  3V3S A;  1KGF A;  1TF1 A;  3MXR A;  1EW0 A;  2O99 A;  1WA9 A;  2XFT A;  1K57 C;  2VX8 A;  3R7W A;  3ZYT A;  4EV4 A;  3UN7 A;  4MNR A;  2ZQD A;  4I39 A;  3MKF A;  4CPK A;  4DE1 A;  5CEC A;  1XP4 A;  4B9O A;  1PI5 A;  2JKG A;  3OPP A;  1L0G A;  2VEA A;  1IKG A;  3VSK A;  1E3U A;  3OCL A;  1XX2 A;  4GD6 A;  5FQQ A;  5CHU A;  1PZO A;  1P9W A;  1T1C A;  4WL9 A;  1KE4 A;  2WAF A;  3A0R A;  4BBT A;  4H6J A;  1VET B;  1XFN A;  3OOV A;  3QNB A;  5CTM A;  5EVI A;  4WEL A;  1BT5 A;  4O01 A;  2P9V B;  2B5R A;  4G3K A;  2A24 B;  2ZM0 A;  4EUZ A;  1PNE A;  3LO7 A;  2QJ7 A;  3TW8 A;  1T18 A;  1L0F A;  4WM9 A;  1MBL A;  1Y28 A;  1OT9 A;  5AQ9 A;  1GSW A;  3E2K A;  3HJI A;  5A91 A;  2ZL1 B;  3BM6 A;  2VGL S;  3PHY A;  2EWV A;  3GRJ A;  4BEN A;  3IF6 C;  3DW0 A;  3D72 A;  3EQU A;  3C38 A;  2G2W A;  3A3I A;  4FUW A;  4GD8 A;  2QPN A;  4QPR A;  5FQI A;  4L9E A;  4LFU A;  3B42 A;  1STZ A;  1XJ3 A;  4U0X A;  2ZC3 B;  4UHU A;  5FQM A;  3IBR A;  4EBL A;  2V9A A;  5FI2 A;  3UE3 A;  1SDE A;  3QP2 A;  1MWS A;  3LGO A;  4E3J A;  1PWD A;  3VP3 A;  5F82 A;  2BLS A;  3SS3 A;  3V3R A;  1FOF A;  5AQA A;  1XKZ A;  3B33 A;  4WYY A;  1MY8 A;  1RCJ A;  5F6A A;  4PKY A;  1TS7 A;  4GHI A;  2B18 A;  1GCE A;  2WGW B;  3KX0 X;  5TJJ A;  1GA0 A;  3UE6 A;  1KDS A;  2E8J A;  5IS1 A;  2HDU A;  1GHI A;  5DVA A;  5L2F A;  4IVI A;  2GNX A;  3HRE A;  2WKI A;  3IX8 A;  4P6Z M;  1G68 A;  1L0E A;  2WUQ A;  1E25 A;  2L4R A;  3Q1F A;  4X68 A;  4WF0 A;  2X01 A;  1YKD A;  4HEF A;  1F5M A;  1K0K A;  4HP4 A;  5HDD A;  4ME4 A;  4WZ5 A;  1YLZ A;  3ZG9 B;  2XQZ A;  4BL3 A;  1P97 A;  4WBG A;  2OOL A;  2L1M A;  4XXR A;  2J3W A;  1ERO A;  4I3J A;  3N7W A;  2P74 A;  3K3C A;  2P04 A;  3LCE A;  5G18 A;  1X0O A;  5I94 A;  4DKI A;  4KZ8 A;  5TBM B;  1YMS A;  4DJ2 A;  3G32 A;  3ICY A;  3Q7V B;  1K6R A;  1PWG A;  2Y4A A;  4XT2 A;  2HP9 A;  2R9W A;  3JVU A;  1VEU B;  1EWZ A;  4JGO A;  4UA7 A;  1TS8 A;  3S7O A;  4Y0T A;  4KG6 A;  3MXQ A;  3F1N B;  1W79 A;  5EV0 A;  3ZNT A;  1T1A A;  1K56 D;  3MMH A;  3MQO A;  5AVE A;  3VP0 A;  1NYM A;  1XA1 A;  4OON A;  4L9G A;  3S7P A;  3TOI A;  1U60 A;  1K4F A;  3TJZ C;  4UA9 A;  4GZB A;  2ZQ7 A;  2WAE A;  3ULF A;  1TVF A;  3IH8 A;  1ERM A;  3DBA A;  3BFG A;  3NOP C;  3Q7Z A;  2WYX A;  3PBR A;  3V39 A;  3CPT B;  2WAD A;  5A8B A;  2WKH A;  1O07 A;  3ZCZ A;  3T1S A;  4BD1 A;  1ES5 A;  5KSC A;  3SW1 A;  1ZHH B;  5IT5 A;  4MN6 A;  3EGX C;  3DTI A;  5KIZ A;  2EWW A;  1IOU A;  3D9Y A;  2H28 A;  1PIO A;  5HD3 A;  3SH7 A;  4X56 A;  3BY8 A;  4LPZ A;  2XA7 S;  5U47 A;  1K57 A;  1NRJ A;  1LL8 A;  3CWF A;  4RX3 A;  3E2L A;  3K2N A;  3QP6 A;  4XUZ A;  1W63 Q;  1XA7 A;  5HD5 A;  3K3D A;  2HDS A;  3DTE A;  3KSG A;  3Q07 A;  4UQI S;  1N9N A;  3E4O A;  5FL3 A;  4DDY A;  2Y2M A;  5J3W A;  4A5R A;  2PD8 A;  3M6H A;  3EEA A;  3JYI A;  2EX2 A;  1S4S A;  4LCL A;  1YAX A;  5FAP A;  3UB7 A;  3R7W B;  1H8Z A;  1SKO A;  2M1C A;  4Q0J A;  4MLL A;  5CGX A;  2A2L A;  2FH5 A;  4OQH A;  3ZGA B;  2H10 A;  3PAE A;  3GMW A;  4LCM A;  5HW3 A;  1ACF A;  1TDG A;  3GQZ A;  5DTS A;  2D02 A;  3LIE A;  4ARZ A;  1L3L A;  4MBH A;  4UEY A;  1TD5 A;  3TRC A;  2OAQ 1;  1BLP A;  3IF6 A;  4H6J B;  5M18 A;  2XH9 A;  1W8Y A;  4IHQ A;  3FC7 A;  1ERQ A;  4NXE A;  5EVI B;  1KVM A;  2Y2I A;  5GHX A;  3MZF A;  1TDL A;  2Y2K A;  3T12 B;  2V0W A;  5DF9 A;  3PR6 A;  2Y2G A;  4PPR A;  4GOG A;  1UWP X;  3LY3 A;  1OTD A;  2HP5 A;  4FD8 A;  4ID4 A;  1BSG A;  2CMN A;  4FH2 A;  4JLF A;  2PDR A;  3BLS A;  4YIN A;  3UPP A;  3BQ8 A;  2Y8H A;  4KZA A;  5IHV A;  3RJU A;  2BTF P;  1FSW A;  1M40 A;  5E2H A;  2W3G A;  2XK1 A;  3UPO A;  1L2S A;  2OSU A;  4HOI A;  4EWF A;  1T19 A;  1F9I A;  3WRT A;  3NDG A;  2NUT C;  3UY6 A;  4X1L A;  3LFV A;  4JKT A;  5EOO A;  1TS0 A;  2NUP C;  1NRF A;  4YFM A;  5TBM A;  3TE8 A;  3ITA A;  3OPL A;  4PM5 A;  4OPZ A;  1PZP A;  5I5L A;  3NEC A;  2XFS A;  4N92 A;  4RX2 A;  4NXG A;  1JTD A;  1H8Y A;  3MFD A;  2XD5 A;  1G6O A;  4CLC D;  4QD4 A;  1YLY A;  4QHC A;  5EVI D;  3M2K A;  4DRT A;  3BQA A;  1FCN A;  3VFH A;  4NXB A;  5C5K A;  4I38 A;  4GHI B;  3GSG A;  3W4Q A;  3T1X A;  1XGJ A;  3WS1 A;  1XJ6 A;  1NZO A;  5HL1 A;  4QJG A;  2ZBB A;  4G3V A;  2QMI A;  3HJK A;  1BZA A;  1NWZ A;  4P85 A;  2K31 A;  4RQ9 A;  1K54 C;  1JWV A;  3G30 A;  4ZAM A;  3JVV A;  4DF6 A;  3CG5 A;  4LRY C;  5E2F A;  2B02 A;  3UB5 P;  2I9V A;  3CI6 A;  4LV3 A;  4Y0O A;  5K5B A;  4HJ4 A;  1K38 A;  2XF3 A;  5FQJ A;  4OPR A;  3PYP A;  2KX6 A;  2G2U A;  4S2O A;  5CHJ A;  5HDS A;  5L07 A;  1K6S A;  3LR4 A;  2XRN A;  2PHY A;  3CMZ A;  1JNU A;  4IED A;  1LI9 A;  4NK3 A;  1YLW A;  4DXC A;  4LV0 A;  4WLA A;  2ZC6 B;  2ZLY A;  1FIK A;  3NJA A;  1LSV A;  1UGU A;  1IEM A;  5EVL A;  3IWO A;  4HH2 A;  4CJN A;  1ZG6 A;  4XT2 B;  1JVJ A;  2HZ5 A;  1Y54 A;  1DJC A;  1MKM A;  3VSL A;  4S2P A;  5DFX A;  1IEL A;  4ETX A;  3IF5 A;  4LEN A;  4F3L A;  4HIA A;  3KYZ A;  3UME A;  4NKP A;  3IWI A;  2HDR A;  4IBR A;  3FYZ A;  4MDZ A;  1CEF A;  3M6B A;  2OLV A;  3LIB A;  1S66 L;  2Y2H A;  3HVF A;  3BJN A;  1W8Q A;  4RYE A;  3MXS A;  1SKF A;  2W1R A;  2QJ5 A;  3EGD C;  3W4O A;  3VP4 A;  3KYQ A;  4PM7 A;  2DNS A;  4WEK A;  1PI4 A;  4HH3 A;  2ZMV A;  4HJ3 A;  1YPR A;  4IVK A;  4JGQ A;  3ZHH A;  3BLM A;  4P0M A;  3G6O A;  1QME A;  1DJB A;  4S2K A;  4CLC E;  5JYO A;  3G4P A;  3VE4 A;  1SCW A;  1FCO A;  3QP5 A;  3NHQ A;  3IWQ A;  2KOI A;  3M2J A;  3ISG A;  4QY5 A;  4IUH A;  4WUJ A;  4X55 A;  1FSY A;  3IX3 A;  4R4R A;  3ZG5 A;  5FEG A;  1OPX A;  4EER A;  4KZ3 A;  1CK3 A;  3A3E A;  4YOF A;  3C30 A;  5HPI A;  3T50 A;  5GHZ A;  4B93 A;  1YT4 A;  1KGG A;  5E2G A;  1K4E A;  2JBF A;  1D06 A;  3P01 A;  3DAV A;  4K08 A;  1ESU A;  3OZH A;  2PBY A;  3EWK A;  3RH8 B;  2BG1 A;  3GDI A;  3C8C A;  1IFQ A;  4JPM A;  3UMD A;  1OTI A;  1ZC2 A;  1IYQ A;  1N9O A;  2IWD A;  2ZQA A;  4OLG A;  1S1Z A;  3NBL A;  1XGI A;  2M7V A;  1SKO B;  4OH0 A;  3W2Z A;  4CQH A;  3FKW A;  4HI4 A;  4KG2 A;  1HLU P;  1GSV A;  4KZ4 A;  3GVB A;  1KOU A;  3KSI A;  2W1T A;  4PMA A;  5DF8 A;  5FAT A;  3SS4 A;  1EI5 A;  2FFF B;  2EFU A;  3HLE A;  4ARZ B;  3VP2 A;  1YSP A;  2O9B A;  4E04 A;  3IF6 B;  3FG8 A;  2LB5 A;  2WGI A;  3KYE A;  1UWN X;  3OBF A;  4B4Z A;  1F98 A;  3C7U A;  4MMN A;  4S2L A;  1S0W A;  2INW A;  2HGV A;  1MWR A;  3MF0 A;  2QKP A;  4OPY A;  5TR7 A;  1J9M A;  4G3W A;  1WE4 A;  2V8F A;  4I3I A;  4I3A A;  3B3X A;  3L9K A;  3C5A A;  2UV0 E;  1D1J A;  1ODV A;  3N8R A;  1G28 A;  1LHY A;  1JWP A;  4E3O A;  3GEC A;  4R3A A;  4ZJ1 A;  4BBV A;  4Y3I A;  4GS9 A;  3LYX A;  1BUE A;  1BLS A;  4HP9 A;  1HVB A;  1GHP A;  4EQ1 A;  4KZ9 A;  1DP8 A;  3IHB A;  3T4O A;  4EXO A;  2C5W B;  3E0Y A;  1BTL A;  1VQQ A;  3LR5 A;  5TGF A;  1OJ5 A;  4OOL A;  3E98 A;  4ESP A;  3A3F A;  3OLO A;  2Y2Q A;  3UB9 A;  4JXS A;  4II7 A;  5CRF A;  2WZZ A;  1K54 A;  2W0N A;  3H82 A;  2C6W B;  4DJ3 A;  4E6W A;  3G31 A;  1H8M A;  1GHM A;  2Q9M A;  2VZW A;  3A3D A;  1P0Z A;  3UO9 A;  3IS2 A;  1LLB A;  2O9C A;  4HHD A;  2J9O A;  3S7Q A;  1K25 A;  5HL6 A;  4QB8 A;  1DJA A;  4ZDX A;  1YLP A;  1YM1 A;  3IXG A;  5EPH A;  4GDN A;  5HAQ A;  2PRF A;  4R3B A;  4UAA A;  3LIA A;  3B47 A;  3A0S A;  4L9F A;  1VB6 A;  3T4S A;  2H0T A;  4DE3 A;  2W3D A;  1Q2P A;  4RA7 A;  5AVF A;  1JWZ A;  4WZ4 A;  2VV6 A;  3T4K A;  2ZC5 B;  3NI9 A;  5DFY A;  2PD7 A;  3AGE A;  3WS4 A;  2X02 A;  2QHK A;  2J7V A;  2PT7 A;  3NY4 A;  3UB8 A;  2XEP A;  1ES2 A;  4D2O A;  3VV4 A;  4S2N C;  1FCM A;  4X69 A;  2K2N A;  1ZTU A;  4EEU A;  3VP1 A;  4MN5 A;  5CTN A;  4KG5 A;  4GN2 A;  5EVE A;  5CGS A;  2FFY A;  3HLG A;  5J8X A;  3WS0 A;  3UB6 A;  4GB7 A;  4PKY G;  5HX9 A;  4NXF A;  4EET B;  4S2J A;  5EUA A;  3BEB A;  3O87 A;  4U0T A;  3C7V A;  4Q0H A;  5G4Z A;  4S2M A;  3FV7 A;  4O0P A;  3T1Q B;  2PR5 A;  2PBD P;  4KEN B;  1ESI A;  2ZQ9 A;  4F3L B;  1KVL A;  2VGK A;  4CLC C;  2I72 A;  1PWC A;  4EBP A;  4R3J A;  2ACG A; 
#chains in the Genus database with same CATH homology
 3QNB A;  5CTM A;  3UDI A;  5EVI A;  4E3K A;  3S1Y A;  4WEL A;  1NZO A;  1PW8 A;  4OQI A;  1BT5 A;  5TFQ A;  2P9V B;  2B5R A;  4KZ6 A;  5CHM A;  3DWZ A;  4L0L A;  4N1H A;  5FI6 A;  2ZM0 A;  4EUZ A;  3LO7 A;  1VM1 A;  5HL1 A;  5A90 A;  4QJG A;  2QMI A;  4DE2 A;  1BZA A;  1L0F A;  4P85 A;  4WM9 A;  4GNU A;  1MBL A;  4XUX A;  1K54 C;  1JWV A;  3G30 A;  4ZAM A;  1ES3 A;  2VGJ A;  5AQ9 A;  4WMC D;  3G2Z A;  3RXW A;  4DF6 A;  3CG5 A;  3E2K A;  4KZ7 A;  4BL2 A;  3MZE A;  5A91 A;  3G2Y A;  3IH9 A;  2EX9 A;  3FKV A;  3BM6 A;  1KDW A;  5E2F A;  1Q2Q A;  4F94 A;  5A93 A;  3UNW A;  2R9X A;  3GRJ A;  3UE0 A;  2A3U A;  1N4O A;  4JF5 A;  3IF6 C;  3HLC A;  4BEN A;  3DW0 A;  3EQU A;  1LL5 A;  2G2W A;  3A3I A;  3IXH A;  3FWL A;  4LV3 A;  4KQO A;  4Y0O A;  3LY4 A;  2J8Y A;  5GL9 A;  1TEM A;  2HDQ A;  1KE3 A;  4OKP A;  1K38 A;  2XF3 A;  4Z9Q A;  4GD8 A;  5FQJ A;  3W4P A;  4OPR A;  2QPN A;  5D3O A;  1N9B A;  2G2U A;  1NZU A;  1WYC A;  4S2O A;  5CHJ A;  4ZBE A;  5FAO A;  1K6S A;  3A3J A;  5FQI A;  4DE0 A;  5E43 A;  2WK0 A;  3BRM A;  3CMZ A;  3NC8 A;  4IED A;  4U0X A;  1MWU A;  2ZC3 B;  4R1G A;  3IXD A;  4UHU A;  1LI9 A;  3IHA A;  5FQM A;  4NK3 A;  1YLW A;  4DXC A;  1AXB A;  4EBL A;  4LV0 A;  5FI2 A;  2ZC6 B;  4OQ0 A;  3UE3 A;  1SDE A;  1I2W A;  2ZLY A;  3IQA A;  1MWS A;  3DWK A;  3O3V A;  4E3J A;  1IEM A;  2DRW A;  1PWD A;  3WWX A;  3VMA A;  2PU2 A;  3QNC A;  3VP3 A;  2EFX A;  2EX6 A;  5F82 A;  4KQQ A;  3IWO A;  1HTZ A;  3PBS A;  4Y0U A;  5EVL A;  1XXM A;  3BFF A;  4CJN A;  1ZG6 A;  2EXB A;  1JVJ A;  1Y54 A;  1CI9 A;  1DJC A;  1BUL A;  2BLS A;  3VSL A;  3SS3 A;  5GLD A;  2A49 A;  4S2P A;  2IWC A;  3V3R A;  1FOF A;  1IEL A;  1XKZ A;  5AQA A;  3IF5 A;  4LEN A;  4QU3 A;  4WYY A;  5GHY A;  1MY8 A;  4EQI A;  1RCJ A;  3HLB A;  5EOE A;  2Y2N A;  2WGW B;  1GCE A;  3TSG A;  1GA0 A;  4JXW A;  3RXX A;  3IWI A;  1KDS A;  3C4P A;  2HDR A;  2HDU A;  1GHI A;  4N9K A;  4IBR A;  3FYZ A;  5DVA A;  2P9V A;  1CEF A;  5L2F A;  1E3U D;  3M6B A;  4IVI A;  2OLV A;  2WKI A;  3HRE A;  4EBP A;  1G68 A;  4K0X A;  2WUQ A;  1L0E A;  2Y2H A;  5FQ9 A;  3HVF A;  1E25 A;  3ZG7 B;  3BFC A;  3Q1F A;  1ZG4 A;  3GV9 A;  4X68 A;  4Y7P A;  5HFO A;  4KZB A;  4OVD A;  2ZM8 A;  2X01 A;  4WEJ A;  4OP8 A;  1ALQ A;  1G6A A;  1W8Q A;  1MPL A;  3CJM A;  3MXS A;  1SKF A;  4RYE A;  3TG9 A;  5CEB A;  4HEF A;  1RP5 A;  3PBT A;  1MWT A;  3W4O A;  3VP4 A;  2J9P A;  4WZ5 A;  1YLZ A;  2RCX A;  4PM7 A;  1WYB A;  5FA7 A;  2XDM A;  3ZG9 B;  2DNS A;  4JBF A;  2XQZ A;  4BL3 A;  2DCF A;  3BFD A;  4WEK A;  1PI4 A;  1GA9 A;  2X71 A;  4WBG A;  5DTT A;  4OP5 A;  5FQK A;  4XXR A;  4IVK A;  1ERO A;  5EVI C;  3ZHH A;  3BLM A;  3N7W A;  4P0M A;  1QME A;  1DJB A;  2P74 A;  3ZNY A;  4S2K A;  4DXB A;  5JYO A;  4FH4 A;  3UPN A;  2ZQ8 A;  5HAI A;  3G4P A;  2XGN A;  4K0W A;  3LCE A;  1SCW A;  1FCO A;  2CC1 A;  3IWQ A;  3PBO A;  3OCN A;  3I7J A;  5GLB A;  2Y2O A;  3CZD A;  3M2J A;  3ZDJ A;  3ISG A;  4QY5 A;  5G18 A;  5HAR A;  5I94 A;  4X55 A;  4DKI A;  5FAQ A;  4KZ8 A;  4E3I A;  1FSY A;  2WGV A;  3MZD A;  4R4R A;  3AGF A;  3ZG5 A;  1IYS A;  3UE1 A;  1YMS A;  4MBK A;  4PM9 A;  3G32 A;  4KZ3 A;  1O7E A;  3Q7V B;  1CK3 A;  1K6R A;  1PWG A;  3A3E A;  3P09 A;  2Y4A A;  3G34 A;  5BOH A;  5GHZ A;  1YT4 A;  4X6T A;  1KGG A;  2Y2L A;  5E2G A;  2HP9 A;  2R9W A;  1JTG A;  1K4E A;  1EWZ A;  1NJ4 A;  4UA7 A;  4BD0 A;  2JBF A;  3OC2 A;  1FR1 A;  1SDN A;  4ZJ3 A;  4S2I A;  3SS5 A;  4Y0T A;  1L0D A;  1ESU A;  4KG6 A;  1MXO A;  3OZH A;  2PBY A;  3P98 A;  2ZC4 B;  2ZC7 A;  2IWB A;  3S4X A;  1YLT A;  2WGW A;  2BG1 A;  1W79 A;  4X53 A;  3IT9 A;  3ZNT A;  4E6X A;  5M19 A;  5F83 A;  1I2S A;  4JPM A;  1H5X A;  3N8L A;  3HLF A;  1K56 D;  5E2E A;  4E3N A;  3VP0 A;  4R0Q A;  1NYM A;  1XA1 A;  2H5S A;  1HD8 A;  4OON A;  1IKI A;  5EEC A;  2OLU A;  1SHV A;  1ZC2 A;  1NY0 A;  2Y2P A;  1IYQ A;  1BLC A;  1PW1 A;  2IWD A;  2ZQA A;  3NIA A;  5GLC A;  1U60 A;  3TOI A;  1K4F A;  2JC7 A;  3PAG A;  4OLG A;  3NBL A;  2Y55 A;  1MKI A;  1XGI A;  1ES4 A;  1LI0 A;  3OPH A;  4MBF A;  4OLD A;  3WRZ A;  2Y59 A;  4OH0 A;  1CEG A;  3GTC A;  1K56 A;  2JE5 A;  3IXB A;  4GZB A;  4UA9 A;  2ZD8 A;  3FKW A;  2ZQ7 A;  2WAE A;  1YQS A;  5CED A;  5KMW A;  1FR6 A;  2H0Y A;  4KG2 A;  1TVF A;  3IH8 A;  3O88 A;  4C75 A;  1ERM A;  2RL3 A;  4KZ4 A;  3GVB A;  2Z2L B;  1IYO A;  3BFG A;  4PMA A;  5DF8 A;  5FAT A;  5EE8 A;  3SS4 A;  1EI5 A;  2FFF B;  2Q9N A;  4OOM A;  3NCK A;  2EFU A;  3HLE A;  4FCF A;  3Q7Z A;  4HES A;  2WYX A;  3C4O A;  3VP2 A;  3PBR A;  3V39 A;  4OQG A;  3IF6 B;  4N9L A;  2WAD A;  3WS2 A;  3Q82 A;  3HBR A;  2WKH A;  4ZTK A;  1O07 A;  3HLD A;  4LV1 A;  3ZCZ A;  2WGI A;  4B4Z A;  4BD1 A;  1ES5 A;  3C7U A;  3MKE A;  2ZJ9 A;  4S2L A;  1S0W A;  3SH8 A;  3UDX A;  5KSC A;  1KE0 A;  4HBT A;  1MWR A;  2V20 A;  3DTM A;  1LL9 A;  4OPY A;  2WKE A;  5TR7 A;  1J9M A;  2HP6 A;  4WZ5 C;  1YMX A;  3ZVW A;  3BFE A;  1WE4 A;  3UDF A;  5JYP A;  4C6Y A;  3B3X A;  3N4I A;  3N8S A;  3C5A A;  5HAP A;  1XPB A;  3N8R A;  2Y91 A;  1PIO A;  3SH7 A;  4UA6 A;  3Q7V A;  5FSR A;  4X56 A;  2V2F F;  3BEC A;  1LHY A;  4JF6 A;  5U47 A;  1JWP A;  1K57 A;  1W5D A;  3HUN A;  4FSF A;  4E3O A;  2Z2M B;  4R23 A;  4H8R A;  3HL9 A;  4RX3 A;  3E2L A;  4OOY A;  4ZJ1 A;  4B88 A;  3ZVT A;  4XUZ A;  1RGZ A;  1XA7 A;  2WZX A;  5F1G A;  2HDS A;  2PU4 A;  1M6K A;  4Q8I A;  3HUM A;  1BUE A;  3Q07 A;  4R4S A;  5KSH A;  1K55 A;  1BLS A;  1HVB A;  1GHP A;  3VOY A;  3PBQ A;  4IBX A;  4C3Q A;  4KZ9 A;  3VOZ A;  3PBN A;  3IHB A;  4DDY A;  1ONH A;  2XD1 A;  2Y2M A;  2HPB A;  5M1A A;  2C5W B;  4A5R A;  1BTL A;  1VQQ A;  4NET A;  3M6H A;  5TGF A;  3JYI A;  2EX2 A;  4JXV A;  4BLM A;  4OOL A;  1Z6F A;  4LCL A;  4ZJ2 A;  3V5M A;  5FAP A;  5CER A;  4P6B A;  3V50 A;  4BQM A;  3A3F A;  3HLW A;  1H8Z A;  2Y2Q A;  5FI7 A;  4MLL A;  3ZFZ A;  4RVA A;  2OV5 A;  5CGX A;  3FZC A;  4E3L A;  4JXS A;  1KGE A;  4OQH A;  5GLA A;  3ZGA B;  5CRF A;  2WZZ A;  3LEZ A;  1K54 A;  3VFF A;  2H10 A;  1CI8 A;  3GMW A;  3PAE A;  4LCM A;  1BLH A;  2C6W B;  4E6W A;  3G31 A;  4E3M A;  5HW3 A;  3AGD A;  3OPR A;  1TDG A;  4JF4 A;  3GQZ A;  4P87 A;  4K91 A;  2UWX A;  1GHM A;  5DTS A;  4MBH A;  2Q9M A;  2XLN A;  3WS5 A;  3A3D A;  1FQG A;  2XR0 A;  4WMC A;  3IF6 A;  1BLP A;  3UO9 A;  3PTE A;  3ITB A;  1LLB A;  1ZKJ A;  3GR2 A;  5M18 A;  2XH9 A;  1W8Y A;  1YLJ A;  2J9O A;  1ERQ A;  4KQR A;  1C3B A;  1K25 A;  3MBZ A;  1KVM A;  5EVI B;  1E4D A;  5FDH A;  2Y2I A;  4B4X A;  5GHX A;  3MZF A;  4M3K A;  1TDL A;  1DJA A;  2Y2K A;  4QB8 A;  4ZDX A;  1YLP A;  1PYY A;  2Y2J A;  5DF9 A;  5CXW A;  1RGY A;  1YM1 A;  2Y2G A;  4GOG A;  4PPR A;  1OME A;  3O86 A;  3IXG A;  3SH9 A;  5KZH A;  1NXY A;  2GDN A;  5EPH A;  4GDN A;  5HAQ A;  2V1Z A;  3LY3 A;  3W8K A;  4R3B A;  4UAA A;  2HP5 A;  4FD8 A;  4ID4 A;  1BSG A;  1HZO A;  4QY6 A;  2H0T A;  4FH2 A;  3D4F A;  4JLF A;  4DE3 A;  4O7D A;  1Q2P A;  4OPQ A;  4DDS A;  5F1F A;  3BLS A;  4YIN A;  3UPP A;  4RA7 A;  4HBU A;  4KZA A;  5IHV A;  1JWZ A;  4JXG A;  3HUO A;  4EBN A;  1I5Q A;  4WZ4 A;  3RJU A;  5AQB A;  3QHY A;  1FSW A;  2ZC5 B;  3NI9 A;  3ZG8 B;  1M40 A;  4LV2 A;  5E2H A;  2ZMA A;  3AGE A;  3WS4 A;  2XK1 A;  3NDE A;  3UPO A;  1S6R A;  1L2S A;  2X02 A;  3Q81 A;  2J7V A;  2E8I A;  3NY4 A;  2OSU A;  4U3T A;  5A92 A;  2XEP A;  4KZ5 A;  4EWF A;  1ES2 A;  4D2O A;  5FAS A;  4S2N C;  1FCM A;  4GKU A;  3WRT A;  3EQV A;  3NDG A;  4X69 A;  1NYY A;  3N6I A;  1DY6 A;  5CGW A;  3SOI A;  3UY6 A;  4S2N A;  1IYP A;  5DTK A;  4PM6 A;  1W7F A;  1QMF A;  4JKT A;  5EOO A;  3VP1 A;  1NRF A;  4YFM A;  5CTN A;  1ONG A;  3V3S A;  2ZQC A;  4KG5 A;  3ITA A;  3OPL A;  4PM5 A;  4GN2 A;  4MEZ A;  1KGF A;  2EXA A;  2ZM2 A;  4OPZ A;  3MXR A;  5CGS A;  2FFY A;  3HLG A;  2JCH A;  3S22 A;  5AQ7 A;  1PZP A;  2XFT A;  1K57 C;  5J8X A;  3WS0 A;  4EV4 A;  4PM8 A;  3UN7 A;  4GB7 A;  4MNR A;  2XFS A;  2ZQD A;  4N92 A;  3MKF A;  4RX2 A;  4CPK A;  5HX9 A;  4DE1 A;  5CEC A;  1XP4 A;  4BJP A;  2QZ6 A;  1PI5 A;  3BEB A;  3O87 A;  4S2J A;  3OPP A;  4U0T A;  5EUA A;  1JTD A;  3C7V A;  1L0G A;  1H8Y A;  1IKG A;  2XD5 A;  3MFD A;  4S2M A;  3VSK A;  3FV7 A;  3ZG0 A;  1E3U A;  4QD4 A;  1K55 C;  3OCL A;  5DF7 A;  1YLY A;  2EX8 A;  4QHC A;  3M2K A;  5EVI D;  4GDB A;  4DRT A;  4KEN B;  1ESI A;  1XX2 A;  4GD6 A;  5FQQ A;  1FCN A;  2ZQ9 A;  1KVL A;  5CHU A;  1PZO A;  3VFH A;  3BYD A;  4N1X A;  2VGK A;  2I72 A;  1KE4 A;  2WAF A;  3GSG A;  1PWC A;  3W4Q A;  1XGJ A;  3G35 A;  3WS1 A;  4R3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...