3IS2A

2.3 angstrom crystal structure of a cys71 sulfenic acid form of vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Illuminating solution responses of a LOV domain protein with photocoupled small-angle X-ray scattering.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
total genus 34
structure length 149
sequence length 150
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3is2A00
3P7NA 4R3AA 5G4YA 1T1BA 2KX6A 4LPZA 5F5YA 5DJUA 5IU1A 3A0SA 3MXQA 1BYWA 1S4RA 1T1AA 1TS8A 3FC7A 1WA9A 4NXBA 4JGRA 3UE6A 3NOUC 1S1ZA 4H6JB 4GHIA 4BBVA 3UB6A 4GCZA 4LRZE 3LIFA 4L9EA 2PHYA 4LLOB 3VOLA 2D02A 4R38A 2QKPA 4L9FA 3UB8A 4EW7A 5F69A 3CLOA 1XJ4A 4I3IA 4KUKA 3E4OA 3F1PA 4WN5A 3VE4A 3IS2A 2R78A 3F1PB 1D7EA 3LI9A 2WKRA 1MZUA 4HY8A 5G4ZA 3GECA 1GSVA 3C2WA 3NHQA 4R6LA 3H7WB 2QJ7A 1ODVA 3E4QA 2W0NA 2JN7A 2ZBBA 5HD5A 4EERA 1XFNA 4WLAA 3UB7A 1T18A 2VV8A 2PD8A 1LT0A 1NWZA 1LSXA 1S66L 1TS0A 3BY8A 3MFXA 1OT9A 2L4RA 4HIAA 4E04A 4F3LB 4EQ1A 1GSXA 5DKLA 5HZHA 2V0UA 5HWVA 5HSQA 1OTIA 5AVEA 1P0ZA 1N9OA 4M4XA 2PR6A 3LIAA 4HJ4A 4NXFA 4HH2A 3T50A 2V1AA 4I3AA 1X0OA 2GJ3A 4HH3A 1F98A 4LRYC 3UB9A 4HJ3A 2Z6DA 1DP6A 3VE3A 3D72A 4EEUA 3UMDA 2VV6A 3CAXA 2OWJA 3EEHA 1LSVA 1VB6A 3MR0A 4EETB 3C8CA 4HOIA 3LYXA 2OWHA 1LL8A 3B33A 5HDDA 2PD7A 3EWKA 5HWTA 1V9YA 4JGOA 2WKPA 2PDRA 1UGUA 2PYPA 4LRXC 5J3WA 3RTYA 5HWWA 1Y28A 3GDIA 3G6OA 3NOPC 2J80A 4H6JA 1S1YA 4YWZA 5TBMA 4B9OA 2B02A 3E4PA 5AVFA 5KIZA 3NJAA 1TS7A 3H82A 2W27A 4HHDA 1XJ3A 1N9NA 4JGQA 5EFWA 4EEPA 2BASA 3H82B 2OOLA 3HJIA 2V9AA 3IS2B 3LI8A 4GS9A 4HP9A 5I5LA 4F3LA 2V0WA 5HD3A 3A0VA 3RH8B 4GW9A 3K3DA 4EXOA 3MQQA 3F1OB 4I39A 1OJ5A 2I9VA 2ZOIA 4RQ9A 4BBUA 1OTAA 2PR5A 1OTDA 1F9IA 3MQOA 1GSWA 2VV7A 3LIDA 3OLOA 4NXEA 2A24A 4XT2A 3A0RA 4I5SA 1UWPX 3ULFA 4EESA 5J7EA 4JGPA 5HDSA 4HI4A 1OTEA 4HQAA 4I38A 1UWNX 3SW1A 5DKKA 2QHKA 1KOUA 2M1CA 1D06A 3LIEA 5TBMB 5A8BA 1DRMA 4WUJA 4PKYA 1P97A 4BBTA 3BY9A 3BWLA 2EA9A 2H28A 2P7JA 3CWFA 1T1CA 3LUQA 1XJ6A 1OTBA 1TS6A 2D01A 1LSWA 2QJ5A 2VLGA 2Z6CA 3HJKA 4L9GA 3LIBA 4DJ2A 5J4EA 3ICYA 1XFQA 2PYRA 4GS9B 2L0WA 4KQDA 2KDKA 1S67L 3IBRA 3PYPA 1T19A 1OJGA 3H7WA 3H9WA 2YKHA 2WKQA 4HP4A 2A24B 1DP9A 1OT6A 4GHIB 4KUOA 1DP8A 4MN5A 4XT2B 3UMEA 3ZQ5A 5HDCA 1XJ2A 1JNUA 3K3CA 2QWSA 1V9ZA 2V1BA 4HJ6A 3KX0X 4I3JA 2JHEA 2ZOHA 4K08A 3LICA 3PHYA 4HNBA 4MN6A 3FG8A 4NXGA 4PKYG 4WL9A 5F6AA 4WF0A 1S4SA 2L1MA 2YKFA 3F1NA 4R70A 2INWA 3MJQA 4DJ3A 2VEAA 5DJTA 3F1OA 1G28A 3NOTC 1N9LA 5IS1A 3F1NB 1EW0A 5F68A 2HV1A 2K7SA 2CMNA
chains in the Genus database with same CATH superfamily
4LPZA 1K56D 2EFUA 3A0SA 2DRWA 2EXBA 4O8GA 1YQSA 3U4LP 1GCEA 2Y55A 4XUXA 1YSQA 2QPNA 4L9EA 2JKTM 1JWZA 2P08A 2D02A 1GA0A 4JPMA 4R4SA 4KUKA 4WN5A 3F1PA 4IVKA 3IS2A 4HY8A 2ZQ8A 2XD1A 3MZDA 1SCWA 3VFHA 2WGVA 4WLAA 3BY8A 1OT9A 2FH5A 2LB9A 1VEUB 4G3KA 4FCFA 5TJJA 4JBFA 5A91A 3EGDC 2HF6A 3T4OA 2W3GA 1DP6A 3ZCZA 2OAP1 3EEHA 2OWJA 5CGSA 3C8CA 3BECA 3MKFA 5HDDA 5FAQA 3PBOA 3UE1A 2M7VA 2Y4AA 2B02A 4WZ4A 1P9RA 1XA1A 1K6SA 1FCOA 2BASA 2Y2NA 3IS2B 4FTXA 1IKGA 4ARZA 2RL3A 1ZG4A 4O01A 1GSWA 3LIDA 3ULFA 2B18A 3BQ8A 4ZTKA 3BLMA 1ES5A 5FAPA 2Z6CA 4F3LB 4L9GA 3PBQA 2PYRA 2ZMAA 5GLAA 2XROA 1PWDA 1OT6A 5FATA 3IT9A 2HDSA 4MN6A 2JHEA 4B88A 4OPZA 1MWUA 3W4PA 2L1MA 3F1NA 5BOHA 4JXWA 4ZAMA 1W63Q 3HBRA 3V50A 4GD6A 3F1NB 1LL5A 2BG1A 3VP2A 1SDEA 1WA9A 2P74A 4U0XA 2J9OA 1ESUA 5HPFA 3IF6A 4ZDXA 3SZTA 4OOMA 3SS3A 1T18A 4MBKA 1YM1A 3IWQA 3TG9A 3ZNTA 1F2KA 4LCLA 5DKLA 1JWVA 3GSGA 1LHYA 3GV9A 3V3SA 3HCYA 4E3LA 5F82A 1X0OA 2ZM2A 2PU2A 1IOUA 3CUEA 2JKRM 3UMDA 3CAXA 1LL8A 4RYEA 4U3TA 2ZLYA 4GLQA 3UDIA 3RXWA 1NZUA 2J9PA 3E4PA 3OPRA 2HDRA 5M19A 4I39A 2HGVA 2ZL1A 3PR6A 3CHWP 4JGPA 4S2MA 5EOEA 5DKKA 3S1YA 4WBGA 4DE0A 4KZAA 4E3KA 1ALQA 4ETZA 2H0YA 1XJ6A 3UY6A 3QP1A 4Q0HA 3SH9A 1NZOA 3C5AA 5HW3A 2O99A 3OPHA 3IBRA 2ZMFA 1H8YA 5L8MA 4JKTA 5HDCA 5JYPA 3ITBA 2INWA 3KSIA 2VEAA 1QMEA 4Q0JA 1BTLA 1BLSA 4X56A 4LV3A 4DXBA 4RX2A 3UE6A 4BBVA 5CHJA 2WYXA 4R38A 1VHMA 2X02A 1IYOA 1SZVA 5KZHA 1FR1A 1CQAA 3KYEA 5DFXA 2DMWA 3VOYA 4L0LA 5EOOA 3BFGA 1AWIA 5EE8A 4C6YA 4MN7A 4M4XA 1BSGA 1E3UD 4EETB 3UB5P 1KGGA 3TE8A 5GHZA 2IA2A 4H6JA 1PZOA 3VSKA 3MZFA 2W3DA 1YMXA 2Y2MA 1FCNA 1N9NA 3G2YA 4PM5A 1PW1A 1G5UA 3EOIA 5FQ9A 1YMSA 3IXBA 3MQQA 1NYMA 1IELA 1TD5A 1ZTUA 2HPBA 5M18A 2JBFA 2XRNA 4DKIA 4MLLA 3A0RA 3QP4A 3B3XA 2E8IA 4FH2A 4ZJ1A 1K54A 5AQBA 1OTBA 3LIBA 2L0WA 2MJ6A 1KVLA 1O7EA 1SKOB 3ZG9B 4NKPA 3ZQ5A 2V1BA 4WZ5A 3QP8A 4UQIS 4R70A 1IKIA 4PM6A 2JKFA 2WKHA 5EV0A 1BYWA 5HX9A 3U2AA 2PBYA 3SS5A 4KZ8A 5GL9A 3BFEA 4UA9A 4GDNA 4LLOB 2QKPA 5FASA 1SHVA 5F69A 3LY4A 4E6WA 1PI4A 5CERA 3C2WA 1NYYA 3IHAA 1EROA 5FEFA 5EVIC 2XA7S 3UB7A 3UPPA 3DTIA 2V2FF 3JPUA 2ZQDA 4S2OA 5HWVA 4QD4A 1CEGA 4R3BA 3T50A 3V67A 2GJ3A 4B93A 4GJ4A 3MR0A 1VB6A 1V9YA 4MMNA 1PYYA 3LY3A 5CTMA 5CEBA 3G6OA 3JVVA 1IFQA 3TSGA 1HLUP 4GOGA 1YKDA 3M2JA 3NJAA 1M6KA 3NIAA 4WZ5C 4HP9A 3NCKA 1H3QA 4DDYA 1OJ5A 4KG6A 4EUZA 3IQAA 4I5SA 4IBRA 1ES3A 5EPHA 3CJMA 5FI2A 2JKRI 1D06A 3CITA 3W4QA 3UPOA 1H0MA 4WUJA 4P85A 3W2ZA 4BBTA 3TOIA 1T1CA 4OP8A 5J4EA 1ERQA 1YT4A 3LR3A 4KQDA 4QJGA 4NETA 1T19A 2Y2OA 2YKHA 2A24B 4RVAA 3UMEA 3Q1FA 5EFWA 2K31A 1PRQA 3LICA 5F6AA 2EWWA 4ZJ2A 2W1RA 2YKFA 1EI5A 1CK3A 5IS1A 2ZQ7A 3P7NA 4R3AA 5IU1A 1P9WA 3I7JA 3QP5A 4X1LA 1S4RA 1TS8A 4NXBA 1K55C 2FFFB 4LRZE 4C75A 3HLGA 4CLCD 4NEED 4E3MA 3G4PA 5EECA 2ZL1B 3NHQA 4JF6A 4BWIA 1H5XA 2W0NA 1MWTA 3VP3A 4XXRA 4E04A 5EVEA 1GSXA 2OV5A 4GB7A 3KYZA 4HJ4A 3DWZA 5L10A 4BL2A 4KZ4A 2V1ZA 3LYXA 2XGNA 4JGOA 4Z1WA 4D60A 1VETB 3IWOA 1LLBA 1BLPA 2OOLA 3HJIA 2V9AA 1NLZA 3FZCA 1L2SA 3ZG5A 4BBUA 1XGIA 1F9IA 4LV0A 1VEUA 1Y4OA 2WZXA 3IXHA 4CLCB 4PM7A 2ACGA 5FI6A 2W3EA 1TS6A 2D01A 1XGJA 2ZC7A 4EBLA 3HLFA 1OJGA 2K2NA 2EX2A 3OPLA 3AGFA 1V9ZA 3FG8A 1LL9A 4NG2A 3MJQA 3FWLA 3V5MA 3CPTA 3UDXA 4OVDA 1Z09A 5A93A 4X68A 4S2NC 3O88A 4GDBA 2C6WB 2PBDP 3BRMA 4B4ZA 3PBNA 4KQQA 5G4ZA 3F1PB 4LGWA 4JLFA 5GHYA 2VGKA 3TJZC 3E4QA 2ZBBA 2OAQ1 1XFNA 1Z6FA 5EUAA 3O3VA 4HIAA 3RXXA 1Y54A 4IUKA 1TDLA 5L09A 1TF1A 2CC1A 4NXFA 3UNWA 5K5BA 2ZMVA 2RCXA 3D9YA 1NJ4A 4HJ3A 4HESA 3D72A 4X55A 3LR5A 1BUEA 3LEZA 2PYPA 4GN2A 1PFLA 5FQIA 3HLBA 2Y2JA 5GLBA 4UA7A 1ONHA 4BENA 3T12B 3BLSA 4CQHA 2XLNA 4EQIA 2XFTA 4BQMA 2M1CA 4PM8A 4DMZA 2ZQCA 2G2WA 2EA9A 2NUPC 2P7JA 4CLCA 1VQQA 1PNEA 3AGEA 2VLGA 2J3WA 3CG5A 3K2NA 2KDKA 1BZAA 4MN5A 2JKGA 4GHIB 4KUOA 4ID4A 2EFXA 3C30A 3O5YA 3WS4A 3BEBA 3N6IA 2WGWA 3P01A 3PBRA 3ZG8B 4MDZA 5J8XA 4DE2A 3WRTA 3NDEA 3VP4A 1EW0A 3EGXC 1ES2A 4Y13A 2XR0A 5HL6A 4UQIM 3SH8A 3NOUC 2HP5A 3V39A 3NC8A 5F1GA 3R4KA 4GCZA 1CI8A 3C7UA 2ZQ9A 1XJ4A 1K55A 1IYQA 3VP1A 3IF6B 4QY5A 2DNSA 3G2ZA 2Y59A 5E2EA 5GLDA 3UO9A 4ZBEA 5E2HA 5HD5A 3FPWA 1MWRA 2EWVA 4UA6A 4S2IA 2Y2HA 3KO6A 1K38A 4HH3A 3VE3A 2O9CA 3T1QB 3B42A 4HOIA 3B33A 3VP0A 5LBRA 2R9WA 1D1JA 3P98A 3AGDA 3IX3A 4X1MA 2X01A 1K56A 5TR7A 3MSHA 5I5LA 3SH7A 1FCMA 4LFUA 2Y91A 2Q9NA 3M6HA 2PAVP 5I94A 5EVIB 2H0TA 4MEZA 3LR4A 4Z9QA 4O7DA 4P6ZM 4JF5A 3PBTA 4QU3A 3S7OA 1JTGA 3S22A 2XEPA 4IUHA 1XFQA 2QMIA 2ZJ9A 1JWPA 3IWIA 4WMCD 4JXSA 3L9KA 3R7WA 1E25A 3KX0X 4E3JA 3B47A 2G2UA 2XD5A 3MZEA 2UWXA 2EX6A 4H8RA 3LEQA 3CMZA 3PTEA 3VE4A 5DJUA 1OMEA 1WE4A 3UPNA 4AFIA 4JGRA 2XFSA 3N8SA 3ZG7B 1KE4A 4L9FA 4ETXA 1D7EA 3HREA 4R6LA 4HBUA 5AQ9A 3H7WB 1G6AA 4EERA 3OBFA 1K6RA 1LT0A 1I2WA 3E0YA 3N8LA 5KSHA 5HAPA 5CGXA 1VETA 5AVEA 2A3UA 2E8JA 2XA7M 2M7UA 1GHIA 1LSVA 1MWSA 1CJFA 4UAAA 2B5RA 3KSHA 1HTZA 3JYIA 3MS6A 2BTFP 1Y28A 5HWWA 3NI9A 3G32A 1XP4A 3T4JA 3QNCA 2Y2GA 1K54C 3M2KA 4IBXA 3RH8B 3N8RA 1SKOA 2VKSA 2P9VB 4FSFA 4EESA 4XT2A 3SW1A 4HQAA 3ZVTA 2WAFA 5HFOA 5TBMB 4N1HA 4S2JA 4YOFA 3A3FA 4GS9B 1S67L 2XSSA 2QYBA 1YLTA 1YLYA 4ZJ3A 1SDNA 1L0GA 3HLCA 3PAEA 5L07A 3NOTC 2LB5A 3HUMA 5F68A 1CI9A 3LGOA 2XQZA 3FC7A 1MKMA 3G34A 4KQRA 3T4KA 3BJNA 4E3NA 1FQGA 3FKWA 3LI9A 3P09A 4Y15A 2QJ7A 1ODVA 3ITAA 1KGFA 3SS4A 2X71A 3WRZA 3HL9A 1HVBA 4WMCA 1STZA 2V8FA 3LIAA 3Q82A 5F1FA 4EU0A 3QNBA 1JTDA 2WKIA 4XUZA 1UGUA 2UV0E 3O86A 1E3UA 4P87A 2J80A 2WGIA 3H82A 3C38A 2HJ9C 5HD3A 4GW9A 4GKUA 3WS0A 2PR5A 1OTDA 2HP9A 2O0YA 3MQOA 4NXEA 1MXOA 4ESPA 1K57C 1G6OA 2GZAA 4FD8A 1DRMA 5C5KA 4QHCA 1HZOA 3BY9A 3BWLA 1EWZA 2H28A 1SKFA 1TDGA 3T1XA 5G4YA 4K0XA 3ZNYA 3C4OA 1N4OA 3QP6A 2P04A 4Y0TA 5FA7A 5DTSA 3WS2A 3HLEA 4NXGA 3S4XA 5DTKA 3F1OA 1G28A 2K7SA 2Y2PA 3G30A 1S6RA 1T1BA 1DY6A 3NBLA 1F5MA 2GNXA 3D3OA 3ISGA 1KDSA 4OOLA 2ZC6B 3WS1A 5HL1A 2ZC3B 4Y0OA 1BLCA 1ONGA 2VJWA 3VOLA 5DF8A 3Q07A 3GQZA 3FPVA 3A3DA 3DTMA 4UHUA 2Y2KA 2PU4A 4P6BA 4QWOA 1ZG6A 1CF0A 2P9VA 3EEAA 2J8YA 4CLCC 1W5DA 1KE3A 2GX5A 1DJAA 1S66L 1MPLA 5CTNA 2ZD8A 2L4RA 3E2KA 4X53A 4O0PA 5L2FA 5EM1A 3LR0A 2FFYA 4KG2A 4EWFA 4WEKA 5HWTA 3BQAA 4E3OA 4DE3A 4GD8A 3KYQA 3G35A 3PXPA 1IYSA 5IHVA 1PWGA 2VV7A 4U0TA 3VOZA 4WELA 1HD8A 4CJNA 1XX2A 4RX3A 2OLUA 3LUQA 5CXWA 4OH0A 3DW0A 4KQOA 1A0KA 3ZYTA 1DJCA 3FKVA 4MCWA 4I3JA 2ZOHA 4QB8A 5CX7A 4Y7PA 1S4SA 2VZWA 1PWCA 3E98A 2HV1A 3A3IA 3IH9A 3MKEA 3MFDA 1T1AA 5IT5A 1WYBA 2W3FA 4KZ3A 2WAEA 4CLCE 2WKRA 5EVID 5EVIA 4OPYA 1IYPA 2R9XA 2J3TD 5AJGA 1TS0A 5FEGA 1BT5A 2NUTC 3VSLA 5CEDA 3G31A 1G68A 3IHBA 3CPTB 2W3HA 1W8QA 5CHUA 5GHXA 4OPQA 2ZC5B 5M1AA 3EWKA 3IX8A 3RTYA 4Y3IA 2H10A 3GDIA 1L3LA 3GMWA 2AVXA 2A49A 2O9AA 2V0WA 3WS5A 3TRCA 1XKZA 4EXOA 4OOYA 1FILA 4E6XA 2ZOIA 3PBSA 4DF6A 5KSCA 3UE0A 1H8ZA 5E2GA 3VFFA 3RFBA 4N92A 1QMFA 4E3IA 1FR6A 1K25A 3OCLA 1M40A 3MBZA 4KZ9A 4X25A 1JVJA 3MF0A 3ZVWA 4P6ZS 3NULA 2ZM0A 1JNUA 1RGZA 1ESIA 2WADA 4S2LA 3HLDA 5A90A 1PI5A 1FSYA 5DJTA 3NECA 5MC7A 1W8YA 3H7WA 4Y2FA 4KZ7A 2OLVA 2PT7A 3UB6A 4R1GA 1RP5A 2QZ6A 3A3JA 2R78A 4Y5FA 2Q0OA 3A3EA 3GECA 2OSUA 2Y8HA 3GRJA 1PZPA 3GVBA 1Q2QA 1W7FA 3MFXA 1NWZA 5EM0A 5FQQA 3ZDJA 3HUNA 5HSQA 3HVFA 2XH9A 1N9OA 2PR6A 3IBJA 4HH2A 4DE1A 5FAOA 4FUWA 4KZ5A 4R4RA 1YLPA 2EX9A 4S2NA 5DFYA 5CECA 2PDRA 4HBTA 3RJUA 5TBMA 2EX8A 3GTCA 1NY0A 1XJ3A 1YPRA 3LI8A 3O87A 4OP5A 3A0VA 3E2LA 4YINA 3F1OB 3IX4A 4C3QA 3WWXA 4P0MA 5E2FA 5F83A 4PKYA 5CRFA 3W4OA 2V8CA 4R3JA 2QJ5A 3UN7A 4DJ2A 2IWCA 1TEMA 4IVIA 4GNUA 1NRFA 2IWBA 1DJBA 4XT2B 3S7NA 4HNBA 3VV4A 3ZGAB 3DAVA 2EXAA 3MMHA 1N9BA 4LENA 2CMNA 3W8KA 1K4EA 1S1ZA 4H6JB 3CZDA 4GHIA 4UEYA 3N7WA 4KZ6A 2GDNA 5DF7A 3UB8A 3Q7ZA 4I3IA 5FL3A 3E4OA 4F94A 2HDQA 3ZG0A 3PAGA 1U60A 1ES4A 1NLYA 2PD8A 2Y2QA 1MKIA 5FQKA 5HZHA 2W1TA 3QP2A 2V0UA 2HZ5A 1P0ZA 1OPXA 4M3KA 1MBLA 4S2KA 5AQAA 3UDFA 3KSGA 3LFVA 4IEDA 5DVAA 1ZC2A 3BFFA 2WKEA 1I2SA 5DF9A 4WM9A 1E4DA 4B9OA 4JF4A 2VGJA 4EEPA 2XF3A 4HHDA 5KIZA 4LV2A 3DTEA 5HARA 4F3LA 2Z2MB 3S7PA 3K3DA 5E43A 4QY6A 4DXCA 2Q9MA 3ZFZA 4KG5A 4X6TA 1XPBA 5G18A 1GHPA 4Y17A 5FQMA 1UWNX 1C3BA 4IHQA 2J3TC 1XA7A 4OLDA 3BFCA 5FSRA 2ZQAA 3HJKA 4JXVA 2VGLS 2FZ0A 1AXBA 3PYPA 1DP8A 3V3RA 3OZHA 2QWSA 4R0QA 1NRJA 2Y2LA 4YFMA 2VGLM 4WL9A 1NXYA 4WF0A 4FH4A 2B95A 3FV7A 1VM1A 3LCEA 5F5YA 4PMAA 3BM6A 4OQHA 2ZC4B 4FOFA 2WUQA 3IXGA 5CGWA 3CLOA 2XK1A 3OC2A 4LCMA 2JCHA 5U47A 2HP6A 4QPRA 4N9KA 1ZHHB 2JC7A 2JN7A 5JYOA 1YLJA 4PM9A 4EQ1A 1RCJA 3ZHHA 1Q2PA 1S0WA 5FDSA 1OTIA 2VK3A 4MNRA 3T1SA 4WEJA 1FIKA 3T4QA 2V1AA 4LRYC 3C7VA 2VV6A 4NK3A 2KOIA 1YLZA 3IXDA 3M6BA 1WYCA 1KDWA 4BMWA 1FOFA 3LO7A 4S2PA 3NOPC 5AVFA 4WYYA 2O9BA 4JGQA 5HPIA 2WK0A 3H82B 4GS9A 4YNRA 1YAXA 4BD0A 1K0KA 1OTAA 3Q81A 2DCFA 5A8BA 5EVLA 5HAQA 4X69A 1P97A 1LSWA 1KGEA 3NY4A 4DDSA 2JKTI 3T4LA 2Z2LB 3K3CA 4HJ6A 4PKYG 4PPRA 4OKPA 1LI9A 4ARZB 3IH8A 4D2OA 4Q8IA 5CHMA 1BLHA 4KENB 2IWDA 2PHYA 4B4XA 4EW7A 1I5QA 1L0DA 3MXSA 1KE0A 4EUVA 3GR2A 2XDMA 1J3WA 4IJGA 2VV8A 4Y0UA 3EQVA 4MBFA 4OQIA 4KZBA 1GHMA 3OCNA 3EQUA 4BD1A 2BLSA 2WZZA 1YSPA 2PD7A 3L7HA 4JXGA 1ERMA 2WKPA 1L0FA 4DN0A 4OQGA 1S1YA 4GZBA 1XXMA 1LI0A 5HAIA 5DTTA 2W27A 2J7VA 4N1XA 4ZRRA 3C4PA 3TW8A 1K57A 2I9VA 4A5RA 1RGYA 4ME4A 3JVUA 3T1RA 5HDSA 1MY8A 3OLOA 5J7EA 3MQ0A 1OTEA 4PAUA 4OONA 2WGWB 1KOUA 4OPRA 4PHTA 1KVMA 3LIEA 3SOIA 3HUOA 4R23A 3CWFA 3N4IA 4K91A 3OOVA 3DBAA 4HEFA 4HP4A 1DP9A 2C5WB 2H5SA 1K4FA 1BULA 3BFDA 1MC0A 3BW6A 4K08A 3PHYA 4G3WA 3OPPA 3R7WB 1W63M 1N9LA 4BL3A 3IF5A 2KX6A 3MXRA 4G3VA 3CUEC 3MXQA 3S7QA 3T4TA 5FQJA 1W79A 3LIFA 4EBPA 2HDUA 2A2LA 3HLWA 4BJPA 1MZUA 1GSVA 2KLIA 1TVFA 5GLCA 5D3OA 4BLMA 1LSXA 1H8MA 3DWKA 2V20A 3IF6C 2HJEA 4CPKA 4I3AA 1F98A 3UB9A 2Z6DA 4EEUA 4OQ0A 3T4SA 2Y2IA 4N9LA 4DRTA 3D4FA 4EBNA 4EV4A 5J3WA 4LRXC 5FDHA 4OLGA 4YWZA 4LV1A 3VMAA 1J9MA 3UE3A 1IEMA 2W1TB 1TS7A 5TGFA 1L0EA 1O07A 4RQ9A 1CEFA 3DTKA 2JE5A 2A24A 3Q7VA 1UWPX 1FSWA 2ZM8A 4HI4A 2VX8A 4I38A 2QHKA 2Y79A 3Q7VB 5FI7A 3QHYA 4RA7A 1ACFA 2I72A 4II7A 3ICYA 2VA0A 3BYDA 3KSFA 3H9WA 2WKQA 4MBHA 5AQ7A 1PIOA 2G7UA 1XJ2A 1ZKJA 3CI6A 1YLWA 4Q0IA 1GA9A 3NDGA 4K0WA 3FYZA 4DJ3A 2PRFA 1PW8A 5TFQA 2OWHA 5KMWA 5A92A
chains in the Genus database with same CATH topology
3P7NA 4R3AA 4LPZA 5IU1A 1P9WA 3A0SA 4O8GA 1S4RA 1TS8A 3FC7A 4NXBA 1MKMA 1S1ZA 4H6JB 4GHIA 4UEYA 1YSQA 4LRZE 4L9EA 2JKTM 2P08A 2D02A 3UB8A 3T4KA 4CLCD 3BJNA 4NEED 4I3IA 4KUKA 3E4OA 3F1PA 4WN5A 5FL3A 3IS2A 4HY8A 3LI9A 3NHQA 4BWIA 2QJ7A 1ODVA 2W0NA 4WLAA 1NLYA 2PD8A 3BY8A 4E04A 1OT9A 2FH5A 2LB9A 1GSXA 4G3KA 2W1TA 5HZHA 2V0UA 5TJJA 1STZA 3EGDC 3KYZA 1P0ZA 1OPXA 2HF6A 4HJ4A 3LIAA 3T4OA 2W3GA 1DP6A 4EU0A 3LFVA 2OAP1 3KSGA 3EEHA 2OWJA 3C8CA 3LYXA 5HDDA 4JGOA 1UGUA 5DF9A 3PBOA 4Z1WA 2J80A 2M7VA 4B9OA 2B02A 1P9RA 3H82A 4EEPA 4HHDA 3C38A 5KIZA 2BASA 2OOLA 3HJIA 2V9AA 3IS2B 2HJ9C 4F3LA 1NLZA 5HD3A 3S7PA 4GW9A 3K3DA 4ARZA 4BBUA 2PR5A 3MQOA 1OTDA 1F9IA 2O0YA 1GSWA 3LIDA 4O01A 4NXEA 3ULFA 2B18A 1G6OA 2GZAA 1UWNX 4IHQA 2J3TC 4CLCB 3BQ8A 1DRMA 5C5KA 3BY9A 3BWLA 2H28A 2W3EA 5G4YA 1TS6A 2D01A 2Z6CA 3HJKA 4F3LB 4L9GA 2VGLS 3PBQA 2PYRA 2FZ0A 3PYPA 1OJGA 2K2NA 2XROA 1OT6A 1DP8A 2P04A 2QWSA 1V9ZA 1NRJA 4MN6A 2JHEA 2VGLM 4WL9A 4NXGA 3FG8A 4WF0A 2L1MA 3F1NA 3MJQA 1W63Q 3F1OA 1G28A 3F1NB 2K7SA 1T1BA 5F5YA 1F5MA 2GNXA 3D3OA 1WA9A 4FOFA 4OOLA 2VJWA 3VOLA 5HPFA 3CLOA 3FPVA 3PBNA 3OC2A 5G4ZA 3F1PB 4OOMA 4QPRA 3EEAA 4CLCC 3TJZC 3E4QA 1ZHHB 2JN7A 2ZBBA 2OAQ1 1XFNA 2GX5A 1T18A 1S66L 4HIAA 2L4RA 4O0PA 4EQ1A 5DKLA 4IUKA 1OTIA 1TF1A 4NXFA 3LR0A 4WEJA 3HCYA 5K5BA 3T4QA 2ZMVA 2V1AA 1X0OA 4LRYC 4HJ3A 1IOUA 3D72A 3CUEA 2JKRM 3UMDA 2VV6A 3CAXA 2KOIA 3LR5A 1LL8A 4BMWA 4WEKA 5HWTA 2PYPA 3BQAA 4GLQA 3NOPC 3E4PA 5AVFA 2O9BA 4JGQA 5HPIA 3H82B 4GS9A 3KYQA 4YNRA 3PXPA 1YAXA 4I39A 2HGVA 4CQHA 1OTAA 2VV7A 3PR6A 4JGPA 4WELA 5DKKA 2M1CA 4DMZA 5A8BA 1P97A 2EA9A 2NUPC 2P7JA 4CLCA 3LUQA 4ETZA 1XJ6A 1LSWA 2VLGA 2J3WA 4Q0HA 3K2NA 2KDKA 2O99A 3IBRA 2JKTI 4KQOA 4MN5A 2ZMFA 4GHIB 4KUOA 3ZYTA 3T4LA 4MCWA 5L8MA 5HDCA 3C30A 3O5YA 4I3JA 3K3CA 4HJ6A 3P01A 4PKYG 2ZOHA 5CX7A 3PBRA 4MDZA 1S4SA 2VZWA 2INWA 3KSIA 2VEAA 4ARZB 4Q0JA 3E98A 1EW0A 2HV1A 3EGXC 1T1AA 5HL6A 4UQIM 5IT5A 3UE6A 3NOUC 2W3FA 4BBVA 3R4KA 4GCZA 2PHYA 4R38A 1VHMA 4EW7A 1XJ4A 4CLCE 4EUVA 2WKRA 5HD5A 3FPWA 2DMWA 4IJGA 5DFXA 2EWVA 2VV8A 4L0LA 2J3TD 5AJGA 1TS0A 3EQVA 2NUTC 3OCNA 4MN7A 3KO6A 4M4XA 2W3HA 4HH3A 3EQUA 3VE3A 2O9CA 3B42A 4EETB 4HOIA 3B33A 1YSPA 2PD7A 3EWKA 3RTYA 2WKPA 5LBRA 4Y3IA 3TE8A 4DN0A 2IA2A 3GDIA 4H6JA 1S1YA 2W3DA 2W27A 1N9NA 2O9AA 5I5LA 4ZRRA 3EOIA 2V0WA 3TRCA 4EXOA 3TW8A 3MQQA 2I9VA 1TD5A 1ZTUA 2ZOIA 4ME4A 3JVUA 3PBSA 5HDSA 3OLOA 2XRNA 3A0RA 5J7EA 3MQ0A 3LR4A 1OTEA 4PAUA 4PHTA 1KOUA 3RFBA 3LIEA 4P6ZM 3PBTA 3OCLA 3S7OA 3CWFA 1OTBA 3LIBA 4IUHA 3OOVA 1XFQA 2L0WA 3DBAA 2MJ6A 3MF0A 4NKPA 4HP4A 1DP9A 4P6ZS 3ZQ5A 3R7WA 1JNUA 2V1BA 4K08A 3KX0X 1MC0A 3BW6A 3PHYA 3B47A 4G3WA 4UQIS 3R7WB 4R70A 1W63M 5DJTA 1N9LA 3VE4A 5MC7A 3H7WA 2KX6A 4G3VA 5DJUA 3CUEC 3MXQA 1BYWA 3S7QA 3T4TA 4AFIA 3U2AA 4Y2FA 4JGRA 2PT7A 3UB6A 3LIFA 4LLOB 2QKPA 4L9FA 5F69A 4ETXA 2A2LA 4BJPA 2R78A 1D7EA 4Y5FA 1MZUA 3GECA 1GSVA 3C2WA 4R6LA 2KLIA 3H7WB 2Y8HA 2XA7S 4EERA 3OBFA 3UB7A 1LT0A 1NWZA 1LSXA 3MFXA 1H8MA 3E0YA 5KSHA 5HWVA 5HSQA 2HJEA 5AVEA 1N9OA 2PR6A 3IBJA 4HH2A 3T50A 2XA7M 2M7UA 4I3AA 3V67A 2GJ3A 4B93A 1F98A 3UB9A 2Z6DA 4EEUA 3T4SA 4GJ4A 3MR0A 1LSVA 1VB6A 5DFYA 3KSHA 1V9YA 5J3WA 2PDRA 4LRXC 4MMNA 5HWWA 1Y28A 3G6OA 3JVVA 4YWZA 5TBMA 1IFQA 3UE3A 3T4JA 2W1TB 1YKDA 3NJAA 1TS7A 1XJ3A 3LI8A 4HP9A 3RH8B 3A0VA 1H3QA 3F1OB 1OJ5A 4RQ9A 2VKSA 4FSFA 4EESA 2A24A 4XT2A 4I5SA 1UWPX 4HI4A 4HQAA 3SW1A 2VX8A 4I38A 2QHKA 2Y79A 2JKRI 1D06A 3CITA 5TBMB 4WUJA 3W2ZA 4PKYA 4BBTA 4YOFA 1T1CA 2QJ5A 4II7A 5J4EA 4DJ2A 3ICYA 4KQDA 3LR3A 4GS9B 2VA0A 3KSFA 1S67L 2XSSA 1T19A 2QYBA 3H9WA 2YKHA 2WKQA 2A24B 4XT2B 3UMEA 2G7UA 1XJ2A 3CI6A 3S7NA 4Q0IA 5EFWA 2K31A 3LICA 4HNBA 5F6AA 3VV4A 2EWWA 2W1RA 2YKFA 4DJ3A 3MMHA 3NOTC 2LB5A 5IS1A 5F68A 2OWHA 2CMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7N A;  4R3A A;  5G4Y A;  1T1B A;  2KX6 A;  4LPZ A;  5F5Y A;  5DJU A;  5IU1 A;  3A0S A;  3MXQ A;  1BYW A;  1S4R A;  1T1A A;  1TS8 A;  3FC7 A;  1WA9 A;  4NXB A;  4JGR A;  3UE6 A;  3NOU C;  1S1Z A;  4H6J B;  4GHI A;  4BBV A;  3UB6 A;  4GCZ A;  4LRZ E;  3LIF A;  4L9E A;  2PHY A;  4LLO B;  3VOL A;  2D02 A;  4R38 A;  2QKP A;  4L9F A;  3UB8 A;  4EW7 A;  5F69 A;  3CLO A;  1XJ4 A;  4I3I A;  4KUK A;  3E4O A;  3F1P A;  4WN5 A;  3VE4 A;  3IS2 A;  2R78 A;  3F1P B;  1D7E A;  3LI9 A;  2WKR A;  1MZU A;  4HY8 A;  5G4Z A;  3GEC A;  1GSV A;  3C2W A;  3NHQ A;  4R6L A;  3H7W B;  2QJ7 A;  1ODV A;  3E4Q A;  2W0N A;  2JN7 A;  2ZBB A;  5HD5 A;  4EER A;  1XFN A;  4WLA A;  3UB7 A;  1T18 A;  2VV8 A;  2PD8 A;  1LT0 A;  1NWZ A;  1LSX A;  1S66 L;  1TS0 A;  3BY8 A;  3MFX A;  1OT9 A;  2L4R A;  4HIA A;  4E04 A;  4F3L B;  4EQ1 A;  1GSX A;  5DKL A;  5HZH A;  2V0U A;  5HWV A;  5HSQ A;  1OTI A;  5AVE A;  1P0Z A;  1N9O A;  4M4X A;  2PR6 A;  3LIA A;  4HJ4 A;  4NXF A;  4HH2 A;  3T50 A;  2V1A A;  4I3A A;  1X0O A;  2GJ3 A;  4HH3 A;  1F98 A;  4LRY C;  3UB9 A;  4HJ3 A;  2Z6D A;  1DP6 A;  3VE3 A;  3D72 A;  4EEU A;  3UMD A;  2VV6 A;  3CAX A;  2OWJ A;  3EEH A;  1LSV A;  1VB6 A;  3MR0 A;  4EET B;  3C8C A;  4HOI A;  3LYX A;  2OWH A;  1LL8 A;  3B33 A;  5HDD A;  2PD7 A;  3EWK A;  5HWT A;  1V9Y A;  4JGO A;  2WKP A;  2PDR A;  1UGU A;  2PYP A;  4LRX C;  5J3W A;  3RTY A;  5HWW A;  1Y28 A;  3GDI A;  3G6O A;  3NOP C;  2J80 A;  4H6J A;  1S1Y A;  4YWZ A;  5TBM A;  4B9O A;  2B02 A;  3E4P A;  5AVF A;  5KIZ A;  3NJA A;  1TS7 A;  3H82 A;  2W27 A;  4HHD A;  1XJ3 A;  1N9N A;  4JGQ A;  5EFW A;  4EEP A;  2BAS A;  3H82 B;  2OOL A;  3HJI A;  2V9A A;  3IS2 B;  3LI8 A;  4GS9 A;  4HP9 A;  5I5L A;  4F3L A;  2V0W A;  5HD3 A;  3A0V A;  3RH8 B;  4GW9 A;  3K3D A;  4EXO A;  3MQQ A;  3F1O B;  4I39 A;  1OJ5 A;  2I9V A;  2ZOI A;  4RQ9 A;  4BBU A;  1OTA A;  2PR5 A;  1OTD A;  1F9I A;  3MQO A;  1GSW A;  2VV7 A;  3LID A;  3OLO A;  4NXE A;  2A24 A;  4XT2 A;  3A0R A;  4I5S A;  1UWP X;  3ULF A;  4EES A;  5J7E A;  4JGP A;  5HDS A;  4HI4 A;  1OTE A;  4HQA A;  4I38 A;  1UWN X;  3SW1 A;  5DKK A;  2QHK A;  1KOU A;  2M1C A;  1D06 A;  3LIE A;  5TBM B;  5A8B A;  1DRM A;  4WUJ A;  4PKY A;  1P97 A;  4BBT A;  3BY9 A;  3BWL A;  2EA9 A;  2H28 A;  2P7J A;  3CWF A;  1T1C A;  3LUQ A;  1XJ6 A;  1OTB A;  1TS6 A;  2D01 A;  1LSW A;  2QJ5 A;  2VLG A;  2Z6C A;  3HJK A;  4L9G A;  3LIB A;  4DJ2 A;  5J4E A;  3ICY A;  1XFQ A;  2PYR A;  4GS9 B;  2L0W A;  4KQD A;  2KDK A;  1S67 L;  3IBR A;  3PYP A;  1T19 A;  1OJG A;  3H7W A;  3H9W A;  2YKH A;  2WKQ A;  4HP4 A;  2A24 B;  1DP9 A;  1OT6 A;  4GHI B;  4KUO A;  1DP8 A;  4MN5 A;  4XT2 B;  3UME A;  3ZQ5 A;  5HDC A;  1XJ2 A;  1JNU A;  3K3C A;  2QWS A;  1V9Z A;  2V1B A;  4HJ6 A;  3KX0 X;  4I3J A;  2JHE A;  2ZOH A;  4K08 A;  3LIC A;  3PHY A;  4HNB A;  4MN6 A;  3FG8 A;  4NXG A;  4PKY G;  4WL9 A;  5F6A A;  4WF0 A;  1S4S A;  2L1M A;  2YKF A;  3F1N A;  4R70 A;  2INW A;  3MJQ A;  4DJ3 A;  2VEA A;  5DJT A;  3F1O A;  1G28 A;  3NOT C;  1N9L A;  5IS1 A;  3F1N B;  1EW0 A;  5F68 A;  2HV1 A;  2K7S A;  2CMN A; 
#chains in the Genus database with same CATH topology
 4LPZ A;  1K56 D;  2EFU A;  3A0S A;  2DRW A;  2EXB A;  4O8G A;  1YQS A;  3U4L P;  1GCE A;  2Y55 A;  4XUX A;  1YSQ A;  2QPN A;  4L9E A;  2JKT M;  1JWZ A;  2P08 A;  2D02 A;  1GA0 A;  4JPM A;  4R4S A;  4KUK A;  4WN5 A;  3F1P A;  4IVK A;  3IS2 A;  4HY8 A;  2ZQ8 A;  2XD1 A;  3MZD A;  1SCW A;  3VFH A;  2WGV A;  4WLA A;  3BY8 A;  1OT9 A;  2FH5 A;  2LB9 A;  1VEU B;  4G3K A;  4FCF A;  5TJJ A;  4JBF A;  5A91 A;  3EGD C;  2HF6 A;  3T4O A;  2W3G A;  1DP6 A;  3ZCZ A;  2OAP 1;  3EEH A;  2OWJ A;  5CGS A;  3C8C A;  3BEC A;  3MKF A;  5HDD A;  5FAQ A;  3PBO A;  3UE1 A;  2M7V A;  2Y4A A;  2B02 A;  4WZ4 A;  1P9R A;  1XA1 A;  1K6S A;  1FCO A;  2BAS A;  2Y2N A;  3IS2 B;  4FTX A;  1IKG A;  4ARZ A;  2RL3 A;  1ZG4 A;  4O01 A;  1GSW A;  3LID A;  3ULF A;  2B18 A;  3BQ8 A;  4ZTK A;  3BLM A;  1ES5 A;  5FAP A;  2Z6C A;  4F3L B;  4L9G A;  3PBQ A;  2PYR A;  2ZMA A;  5GLA A;  2XRO A;  1PWD A;  1OT6 A;  5FAT A;  3IT9 A;  2HDS A;  4MN6 A;  2JHE A;  4B88 A;  4OPZ A;  1MWU A;  3W4P A;  2L1M A;  3F1N A;  5BOH A;  4JXW A;  4ZAM A;  1W63 Q;  3HBR A;  3V50 A;  4GD6 A;  3F1N B;  1LL5 A;  2BG1 A;  3VP2 A;  1SDE A;  1WA9 A;  2P74 A;  4U0X A;  2J9O A;  1ESU A;  5HPF A;  3IF6 A;  4ZDX A;  3SZT A;  4OOM A;  3SS3 A;  1T18 A;  4MBK A;  1YM1 A;  3IWQ A;  3TG9 A;  3ZNT A;  1F2K A;  4LCL A;  5DKL A;  1JWV A;  3GSG A;  1LHY A;  3GV9 A;  3V3S A;  3HCY A;  4E3L A;  5F82 A;  1X0O A;  2ZM2 A;  2PU2 A;  1IOU A;  3CUE A;  2JKR M;  3UMD A;  3CAX A;  1LL8 A;  4RYE A;  4U3T A;  2ZLY A;  4GLQ A;  3UDI A;  3RXW A;  1NZU A;  2J9P A;  3E4P A;  3OPR A;  2HDR A;  5M19 A;  4I39 A;  2HGV A;  2ZL1 A;  3PR6 A;  3CHW P;  4JGP A;  4S2M A;  5EOE A;  5DKK A;  3S1Y A;  4WBG A;  4DE0 A;  4KZA A;  4E3K A;  1ALQ A;  4ETZ A;  2H0Y A;  1XJ6 A;  3UY6 A;  3QP1 A;  4Q0H A;  3SH9 A;  1NZO A;  3C5A A;  5HW3 A;  2O99 A;  3OPH A;  3IBR A;  2ZMF A;  1H8Y A;  5L8M A;  4JKT A;  5HDC A;  5JYP A;  3ITB A;  2INW A;  3KSI A;  2VEA A;  1QME A;  4Q0J A;  1BTL A;  1BLS A;  4X56 A;  4LV3 A;  4DXB A;  4RX2 A;  3UE6 A;  4BBV A;  5CHJ A;  2WYX A;  4R38 A;  1VHM A;  2X02 A;  1IYO A;  1SZV A;  5KZH A;  1FR1 A;  1CQA A;  3KYE A;  5DFX A;  2DMW A;  3VOY A;  4L0L A;  5EOO A;  3BFG A;  1AWI A;  5EE8 A;  4C6Y A;  4MN7 A;  4M4X A;  1BSG A;  1E3U D;  4EET B;  3UB5 P;  1KGG A;  3TE8 A;  5GHZ A;  2IA2 A;  4H6J A;  1PZO A;  3VSK A;  3MZF A;  2W3D A;  1YMX A;  2Y2M A;  1FCN A;  1N9N A;  3G2Y A;  4PM5 A;  1PW1 A;  1G5U A;  3EOI A;  5FQ9 A;  1YMS A;  3IXB A;  3MQQ A;  1NYM A;  1IEL A;  1TD5 A;  1ZTU A;  2HPB A;  5M18 A;  2JBF A;  2XRN A;  4DKI A;  4MLL A;  3A0R A;  3QP4 A;  3B3X A;  2E8I A;  4FH2 A;  4ZJ1 A;  1K54 A;  5AQB A;  1OTB A;  3LIB A;  2L0W A;  2MJ6 A;  1KVL A;  1O7E A;  1SKO B;  3ZG9 B;  4NKP A;  3ZQ5 A;  2V1B A;  4WZ5 A;  3QP8 A;  4UQI S;  4R70 A;  1IKI A;  4PM6 A;  2JKF A;  2WKH A;  5EV0 A;  1BYW A;  5HX9 A;  3U2A A;  2PBY A;  3SS5 A;  4KZ8 A;  5GL9 A;  3BFE A;  4UA9 A;  4GDN A;  4LLO B;  2QKP A;  5FAS A;  1SHV A;  5F69 A;  3LY4 A;  4E6W A;  1PI4 A;  5CER A;  3C2W A;  1NYY A;  3IHA A;  1ERO A;  5FEF A;  5EVI C;  2XA7 S;  3UB7 A;  3UPP A;  3DTI A;  2V2F F;  3JPU A;  2ZQD A;  4S2O A;  5HWV A;  4QD4 A;  1CEG A;  4R3B A;  3T50 A;  3V67 A;  2GJ3 A;  4B93 A;  4GJ4 A;  3MR0 A;  1VB6 A;  1V9Y A;  4MMN A;  1PYY A;  3LY3 A;  5CTM A;  5CEB A;  3G6O A;  3JVV A;  1IFQ A;  3TSG A;  1HLU P;  4GOG A;  1YKD A;  3M2J A;  3NJA A;  1M6K A;  3NIA A;  4WZ5 C;  4HP9 A;  3NCK A;  1H3Q A;  4DDY A;  1OJ5 A;  4KG6 A;  4EUZ A;  3IQA A;  4I5S A;  4IBR A;  1ES3 A;  5EPH A;  3CJM A;  5FI2 A;  2JKR I;  1D06 A;  3CIT A;  3W4Q A;  3UPO A;  1H0M A;  4WUJ A;  4P85 A;  3W2Z A;  4BBT A;  3TOI A;  1T1C A;  4OP8 A;  5J4E A;  1ERQ A;  1YT4 A;  3LR3 A;  4KQD A;  4QJG A;  4NET A;  1T19 A;  2Y2O A;  2YKH A;  2A24 B;  4RVA A;  3UME A;  3Q1F A;  5EFW A;  2K31 A;  1PRQ A;  3LIC A;  5F6A A;  2EWW A;  4ZJ2 A;  2W1R A;  2YKF A;  1EI5 A;  1CK3 A;  5IS1 A;  2ZQ7 A;  3P7N A;  4R3A A;  5IU1 A;  1P9W A;  3I7J A;  3QP5 A;  4X1L A;  1S4R A;  1TS8 A;  4NXB A;  1K55 C;  2FFF B;  4LRZ E;  4C75 A;  3HLG A;  4CLC D;  4NEE D;  4E3M A;  3G4P A;  5EEC A;  2ZL1 B;  3NHQ A;  4JF6 A;  4BWI A;  1H5X A;  2W0N A;  1MWT A;  3VP3 A;  4XXR A;  4E04 A;  5EVE A;  1GSX A;  2OV5 A;  4GB7 A;  3KYZ A;  4HJ4 A;  3DWZ A;  5L10 A;  4BL2 A;  4KZ4 A;  2V1Z A;  3LYX A;  2XGN A;  4JGO A;  4Z1W A;  4D60 A;  1VET B;  3IWO A;  1LLB A;  1BLP A;  2OOL A;  3HJI A;  2V9A A;  1NLZ A;  3FZC A;  1L2S A;  3ZG5 A;  4BBU A;  1XGI A;  1F9I A;  4LV0 A;  1VEU A;  1Y4O A;  2WZX A;  3IXH A;  4CLC B;  4PM7 A;  2ACG A;  5FI6 A;  2W3E A;  1TS6 A;  2D01 A;  1XGJ A;  2ZC7 A;  4EBL A;  3HLF A;  1OJG A;  2K2N A;  2EX2 A;  3OPL A;  3AGF A;  1V9Z A;  3FG8 A;  1LL9 A;  4NG2 A;  3MJQ A;  3FWL A;  3V5M A;  3CPT A;  3UDX A;  4OVD A;  1Z09 A;  5A93 A;  4X68 A;  4S2N C;  3O88 A;  4GDB A;  2C6W B;  2PBD P;  3BRM A;  4B4Z A;  3PBN A;  4KQQ A;  5G4Z A;  3F1P B;  4LGW A;  4JLF A;  5GHY A;  2VGK A;  3TJZ C;  3E4Q A;  2ZBB A;  2OAQ 1;  1XFN A;  1Z6F A;  5EUA A;  3O3V A;  4HIA A;  3RXX A;  1Y54 A;  4IUK A;  1TDL A;  5L09 A;  1TF1 A;  2CC1 A;  4NXF A;  3UNW A;  5K5B A;  2ZMV A;  2RCX A;  3D9Y A;  1NJ4 A;  4HJ3 A;  4HES A;  3D72 A;  4X55 A;  3LR5 A;  1BUE A;  3LEZ A;  2PYP A;  4GN2 A;  1PFL A;  5FQI A;  3HLB A;  2Y2J A;  5GLB A;  4UA7 A;  1ONH A;  4BEN A;  3T12 B;  3BLS A;  4CQH A;  2XLN A;  4EQI A;  2XFT A;  4BQM A;  2M1C A;  4PM8 A;  4DMZ A;  2ZQC A;  2G2W A;  2EA9 A;  2NUP C;  2P7J A;  4CLC A;  1VQQ A;  1PNE A;  3AGE A;  2VLG A;  2J3W A;  3CG5 A;  3K2N A;  2KDK A;  1BZA A;  4MN5 A;  2JKG A;  4GHI B;  4KUO A;  4ID4 A;  2EFX A;  3C30 A;  3O5Y A;  3WS4 A;  3BEB A;  3N6I A;  2WGW A;  3P01 A;  3PBR A;  3ZG8 B;  4MDZ A;  5J8X A;  4DE2 A;  3WRT A;  3NDE A;  3VP4 A;  1EW0 A;  3EGX C;  1ES2 A;  4Y13 A;  2XR0 A;  5HL6 A;  4UQI M;  3SH8 A;  3NOU C;  2HP5 A;  3V39 A;  3NC8 A;  5F1G A;  3R4K A;  4GCZ A;  1CI8 A;  3C7U A;  2ZQ9 A;  1XJ4 A;  1K55 A;  1IYQ A;  3VP1 A;  3IF6 B;  4QY5 A;  2DNS A;  3G2Z A;  2Y59 A;  5E2E A;  5GLD A;  3UO9 A;  4ZBE A;  5E2H A;  5HD5 A;  3FPW A;  1MWR A;  2EWV A;  4UA6 A;  4S2I A;  2Y2H A;  3KO6 A;  1K38 A;  4HH3 A;  3VE3 A;  2O9C A;  3T1Q B;  3B42 A;  4HOI A;  3B33 A;  3VP0 A;  5LBR A;  2R9W A;  1D1J A;  3P98 A;  3AGD A;  3IX3 A;  4X1M A;  2X01 A;  1K56 A;  5TR7 A;  3MSH A;  5I5L A;  3SH7 A;  1FCM A;  4LFU A;  2Y91 A;  2Q9N A;  3M6H A;  2PAV P;  5I94 A;  5EVI B;  2H0T A;  4MEZ A;  3LR4 A;  4Z9Q A;  4O7D A;  4P6Z M;  4JF5 A;  3PBT A;  4QU3 A;  3S7O A;  1JTG A;  3S22 A;  2XEP A;  4IUH A;  1XFQ A;  2QMI A;  2ZJ9 A;  1JWP A;  3IWI A;  4WMC D;  4JXS A;  3L9K A;  3R7W A;  1E25 A;  3KX0 X;  4E3J A;  3B47 A;  2G2U A;  2XD5 A;  3MZE A;  2UWX A;  2EX6 A;  4H8R A;  3LEQ A;  3CMZ A;  3PTE A;  3VE4 A;  5DJU A;  1OME A;  1WE4 A;  3UPN A;  4AFI A;  4JGR A;  2XFS A;  3N8S A;  3ZG7 B;  1KE4 A;  4L9F A;  4ETX A;  1D7E A;  3HRE A;  4R6L A;  4HBU A;  5AQ9 A;  3H7W B;  1G6A A;  4EER A;  3OBF A;  1K6R A;  1LT0 A;  1I2W A;  3E0Y A;  3N8L A;  5KSH A;  5HAP A;  5CGX A;  1VET A;  5AVE A;  2A3U A;  2E8J A;  2XA7 M;  2M7U A;  1GHI A;  1LSV A;  1MWS A;  1CJF A;  4UAA A;  2B5R A;  3KSH A;  1HTZ A;  3JYI A;  3MS6 A;  2BTF P;  1Y28 A;  5HWW A;  3NI9 A;  3G32 A;  1XP4 A;  3T4J A;  3QNC A;  2Y2G A;  1K54 C;  3M2K A;  4IBX A;  3RH8 B;  3N8R A;  1SKO A;  2VKS A;  2P9V B;  4FSF A;  4EES A;  4XT2 A;  3SW1 A;  4HQA A;  3ZVT A;  2WAF A;  5HFO A;  5TBM B;  4N1H A;  4S2J A;  4YOF A;  3A3F A;  4GS9 B;  1S67 L;  2XSS A;  2QYB A;  1YLT A;  1YLY A;  4ZJ3 A;  1SDN A;  1L0G A;  3HLC A;  3PAE A;  5L07 A;  3NOT C;  2LB5 A;  3HUM A;  5F68 A;  1CI9 A;  3LGO A;  2XQZ A;  3FC7 A;  1MKM A;  3G34 A;  4KQR A;  3T4K A;  3BJN A;  4E3N A;  1FQG A;  3FKW A;  3LI9 A;  3P09 A;  4Y15 A;  2QJ7 A;  1ODV A;  3ITA A;  1KGF A;  3SS4 A;  2X71 A;  3WRZ A;  3HL9 A;  1HVB A;  4WMC A;  1STZ A;  2V8F A;  3LIA A;  3Q82 A;  5F1F A;  4EU0 A;  3QNB A;  1JTD A;  2WKI A;  4XUZ A;  1UGU A;  2UV0 E;  3O86 A;  1E3U A;  4P87 A;  2J80 A;  2WGI A;  3H82 A;  3C38 A;  2HJ9 C;  5HD3 A;  4GW9 A;  4GKU A;  3WS0 A;  2PR5 A;  1OTD A;  2HP9 A;  2O0Y A;  3MQO A;  4NXE A;  1MXO A;  4ESP A;  1K57 C;  1G6O A;  2GZA A;  4FD8 A;  1DRM A;  5C5K A;  4QHC A;  1HZO A;  3BY9 A;  3BWL A;  1EWZ A;  2H28 A;  1SKF A;  1TDG A;  3T1X A;  5G4Y A;  4K0X A;  3ZNY A;  3C4O A;  1N4O A;  3QP6 A;  2P04 A;  4Y0T A;  5FA7 A;  5DTS A;  3WS2 A;  3HLE A;  4NXG A;  3S4X A;  5DTK A;  3F1O A;  1G28 A;  2K7S A;  2Y2P A;  3G30 A;  1S6R A;  1T1B A;  1DY6 A;  3NBL A;  1F5M A;  2GNX A;  3D3O A;  3ISG A;  1KDS A;  4OOL A;  2ZC6 B;  3WS1 A;  5HL1 A;  2ZC3 B;  4Y0O A;  1BLC A;  1ONG A;  2VJW A;  3VOL A;  5DF8 A;  3Q07 A;  3GQZ A;  3FPV A;  3A3D A;  3DTM A;  4UHU A;  2Y2K A;  2PU4 A;  4P6B A;  4QWO A;  1ZG6 A;  1CF0 A;  2P9V A;  3EEA A;  2J8Y A;  4CLC C;  1W5D A;  1KE3 A;  2GX5 A;  1DJA A;  1S66 L;  1MPL A;  5CTN A;  2ZD8 A;  2L4R A;  3E2K A;  4X53 A;  4O0P A;  5L2F A;  5EM1 A;  3LR0 A;  2FFY A;  4KG2 A;  4EWF A;  4WEK A;  5HWT A;  3BQA A;  4E3O A;  4DE3 A;  4GD8 A;  3KYQ A;  3G35 A;  3PXP A;  1IYS A;  5IHV A;  1PWG A;  2VV7 A;  4U0T A;  3VOZ A;  4WEL A;  1HD8 A;  4CJN A;  1XX2 A;  4RX3 A;  2OLU A;  3LUQ A;  5CXW A;  4OH0 A;  3DW0 A;  4KQO A;  1A0K A;  3ZYT A;  1DJC A;  3FKV A;  4MCW A;  4I3J A;  2ZOH A;  4QB8 A;  5CX7 A;  4Y7P A;  1S4S A;  2VZW A;  1PWC A;  3E98 A;  2HV1 A;  3A3I A;  3IH9 A;  3MKE A;  3MFD A;  1T1A A;  5IT5 A;  1WYB A;  2W3F A;  4KZ3 A;  2WAE A;  4CLC E;  2WKR A;  5EVI D;  5EVI A;  4OPY A;  1IYP A;  2R9X A;  2J3T D;  5AJG A;  1TS0 A;  5FEG A;  1BT5 A;  2NUT C;  3VSL A;  5CED A;  3G31 A;  1G68 A;  3IHB A;  3CPT B;  2W3H A;  1W8Q A;  5CHU A;  5GHX A;  4OPQ A;  2ZC5 B;  5M1A A;  3EWK A;  3IX8 A;  3RTY A;  4Y3I A;  2H10 A;  3GDI A;  1L3L A;  3GMW A;  2AVX A;  2A49 A;  2O9A A;  2V0W A;  3WS5 A;  3TRC A;  1XKZ A;  4EXO A;  4OOY A;  1FIL A;  4E6X A;  2ZOI A;  3PBS A;  4DF6 A;  5KSC A;  3UE0 A;  1H8Z A;  5E2G A;  3VFF A;  3RFB A;  4N92 A;  1QMF A;  4E3I A;  1FR6 A;  1K25 A;  3OCL A;  1M40 A;  3MBZ A;  4KZ9 A;  4X25 A;  1JVJ A;  3MF0 A;  3ZVW A;  4P6Z S;  3NUL A;  2ZM0 A;  1JNU A;  1RGZ A;  1ESI A;  2WAD A;  4S2L A;  3HLD A;  5A90 A;  1PI5 A;  1FSY A;  5DJT A;  3NEC A;  5MC7 A;  1W8Y A;  3H7W A;  4Y2F A;  4KZ7 A;  2OLV A;  2PT7 A;  3UB6 A;  4R1G A;  1RP5 A;  2QZ6 A;  3A3J A;  2R78 A;  4Y5F A;  2Q0O A;  3A3E A;  3GEC A;  2OSU A;  2Y8H A;  3GRJ A;  1PZP A;  3GVB A;  1Q2Q A;  1W7F A;  3MFX A;  1NWZ A;  5EM0 A;  5FQQ A;  3ZDJ A;  3HUN A;  5HSQ A;  3HVF A;  2XH9 A;  1N9O A;  2PR6 A;  3IBJ A;  4HH2 A;  4DE1 A;  5FAO A;  4FUW A;  4KZ5 A;  4R4R A;  1YLP A;  2EX9 A;  4S2N A;  5DFY A;  5CEC A;  2PDR A;  4HBT A;  3RJU A;  5TBM A;  2EX8 A;  3GTC A;  1NY0 A;  1XJ3 A;  1YPR A;  3LI8 A;  3O87 A;  4OP5 A;  3A0V A;  3E2L A;  4YIN A;  3F1O B;  3IX4 A;  4C3Q A;  3WWX A;  4P0M A;  5E2F A;  5F83 A;  4PKY A;  5CRF A;  3W4O A;  2V8C A;  4R3J A;  2QJ5 A;  3UN7 A;  4DJ2 A;  2IWC A;  1TEM A;  4IVI A;  4GNU A;  1NRF A;  2IWB A;  1DJB A;  4XT2 B;  3S7N A;  4HNB A;  3VV4 A;  3ZGA B;  3DAV A;  2EXA A;  3MMH A;  1N9B A;  4LEN A;  2CMN A;  3W8K A;  1K4E A;  1S1Z A;  4H6J B;  3CZD A;  4GHI A;  4UEY A;  3N7W A;  4KZ6 A;  2GDN A;  5DF7 A;  3UB8 A;  3Q7Z A;  4I3I A;  5FL3 A;  3E4O A;  4F94 A;  2HDQ A;  3ZG0 A;  3PAG A;  1U60 A;  1ES4 A;  1NLY A;  2PD8 A;  2Y2Q A;  1MKI A;  5FQK A;  5HZH A;  2W1T A;  3QP2 A;  2V0U A;  2HZ5 A;  1P0Z A;  1OPX A;  4M3K A;  1MBL A;  4S2K A;  5AQA A;  3UDF A;  3KSG A;  3LFV A;  4IED A;  5DVA A;  1ZC2 A;  3BFF A;  2WKE A;  1I2S A;  5DF9 A;  4WM9 A;  1E4D A;  4B9O A;  4JF4 A;  2VGJ A;  4EEP A;  2XF3 A;  4HHD A;  5KIZ A;  4LV2 A;  3DTE A;  5HAR A;  4F3L A;  2Z2M B;  3S7P A;  3K3D A;  5E43 A;  4QY6 A;  4DXC A;  2Q9M A;  3ZFZ A;  4KG5 A;  4X6T A;  1XPB A;  5G18 A;  1GHP A;  4Y17 A;  5FQM A;  1UWN X;  1C3B A;  4IHQ A;  2J3T C;  1XA7 A;  4OLD A;  3BFC A;  5FSR A;  2ZQA A;  3HJK A;  4JXV A;  2VGL S;  2FZ0 A;  1AXB A;  3PYP A;  1DP8 A;  3V3R A;  3OZH A;  2QWS A;  4R0Q A;  1NRJ A;  2Y2L A;  4YFM A;  2VGL M;  4WL9 A;  1NXY A;  4WF0 A;  4FH4 A;  2B95 A;  3FV7 A;  1VM1 A;  3LCE A;  5F5Y A;  4PMA A;  3BM6 A;  4OQH A;  2ZC4 B;  4FOF A;  2WUQ A;  3IXG A;  5CGW A;  3CLO A;  2XK1 A;  3OC2 A;  4LCM A;  2JCH A;  5U47 A;  2HP6 A;  4QPR A;  4N9K A;  1ZHH B;  2JC7 A;  2JN7 A;  5JYO A;  1YLJ A;  4PM9 A;  4EQ1 A;  1RCJ A;  3ZHH A;  1Q2P A;  1S0W A;  5FDS A;  1OTI A;  2VK3 A;  4MNR A;  3T1S A;  4WEJ A;  1FIK A;  3T4Q A;  2V1A A;  4LRY C;  3C7V A;  2VV6 A;  4NK3 A;  2KOI A;  1YLZ A;  3IXD A;  3M6B A;  1WYC A;  1KDW A;  4BMW A;  1FOF A;  3LO7 A;  4S2P A;  3NOP C;  5AVF A;  4WYY A;  2O9B A;  4JGQ A;  5HPI A;  2WK0 A;  3H82 B;  4GS9 A;  4YNR A;  1YAX A;  4BD0 A;  1K0K A;  1OTA A;  3Q81 A;  2DCF A;  5A8B A;  5EVL A;  5HAQ A;  4X69 A;  1P97 A;  1LSW A;  1KGE A;  3NY4 A;  4DDS A;  2JKT I;  3T4L A;  2Z2L B;  3K3C A;  4HJ6 A;  4PKY G;  4PPR A;  4OKP A;  1LI9 A;  4ARZ B;  3IH8 A;  4D2O A;  4Q8I A;  5CHM A;  1BLH A;  4KEN B;  2IWD A;  2PHY A;  4B4X A;  4EW7 A;  1I5Q A;  1L0D A;  3MXS A;  1KE0 A;  4EUV A;  3GR2 A;  2XDM A;  1J3W A;  4IJG A;  2VV8 A;  4Y0U A;  3EQV A;  4MBF A;  4OQI A;  4KZB A;  1GHM A;  3OCN A;  3EQU A;  4BD1 A;  2BLS A;  2WZZ A;  1YSP A;  2PD7 A;  3L7H A;  4JXG A;  1ERM A;  2WKP A;  1L0F A;  4DN0 A;  4OQG A;  1S1Y A;  4GZB A;  1XXM A;  1LI0 A;  5HAI A;  5DTT A;  2W27 A;  2J7V A;  4N1X A;  4ZRR A;  3C4P A;  3TW8 A;  1K57 A;  2I9V A;  4A5R A;  1RGY A;  4ME4 A;  3JVU A;  3T1R A;  5HDS A;  1MY8 A;  3OLO A;  5J7E A;  3MQ0 A;  1OTE A;  4PAU A;  4OON A;  2WGW B;  1KOU A;  4OPR A;  4PHT A;  1KVM A;  3LIE A;  3SOI A;  3HUO A;  4R23 A;  3CWF A;  3N4I A;  4K91 A;  3OOV A;  3DBA A;  4HEF A;  4HP4 A;  1DP9 A;  2C5W B;  2H5S A;  1K4F A;  1BUL A;  3BFD A;  1MC0 A;  3BW6 A;  4K08 A;  3PHY A;  4G3W A;  3OPP A;  3R7W B;  1W63 M;  1N9L A;  4BL3 A;  3IF5 A;  2KX6 A;  3MXR A;  4G3V A;  3CUE C;  3MXQ A;  3S7Q A;  3T4T A;  5FQJ A;  1W79 A;  3LIF A;  4EBP A;  2HDU A;  2A2L A;  3HLW A;  4BJP A;  1MZU A;  1GSV A;  2KLI A;  1TVF A;  5GLC A;  5D3O A;  4BLM A;  1LSX A;  1H8M A;  3DWK A;  2V20 A;  3IF6 C;  2HJE A;  4CPK A;  4I3A A;  1F98 A;  3UB9 A;  2Z6D A;  4EEU A;  4OQ0 A;  3T4S A;  2Y2I A;  4N9L A;  4DRT A;  3D4F A;  4EBN A;  4EV4 A;  5J3W A;  4LRX C;  5FDH A;  4OLG A;  4YWZ A;  4LV1 A;  3VMA A;  1J9M A;  3UE3 A;  1IEM A;  2W1T B;  1TS7 A;  5TGF A;  1L0E A;  1O07 A;  4RQ9 A;  1CEF A;  3DTK A;  2JE5 A;  2A24 A;  3Q7V A;  1UWP X;  1FSW A;  2ZM8 A;  4HI4 A;  2VX8 A;  4I38 A;  2QHK A;  2Y79 A;  3Q7V B;  5FI7 A;  3QHY A;  4RA7 A;  1ACF A;  2I72 A;  4II7 A;  3ICY A;  2VA0 A;  3BYD A;  3KSF A;  3H9W A;  2WKQ A;  4MBH A;  5AQ7 A;  1PIO A;  2G7U A;  1XJ2 A;  1ZKJ A;  3CI6 A;  1YLW A;  4Q0I A;  1GA9 A;  3NDG A;  4K0W A;  3FYZ A;  4DJ3 A;  2PRF A;  1PW8 A;  5TFQ A;  2OWH A;  5KMW A;  5A92 A; 
#chains in the Genus database with same CATH homology
 3P7N A;  4R3A A;  4LPZ A;  5IU1 A;  1P9W A;  3A0S A;  4O8G A;  1S4R A;  1TS8 A;  3FC7 A;  4NXB A;  1MKM A;  1S1Z A;  4H6J B;  4GHI A;  4UEY A;  1YSQ A;  4LRZ E;  4L9E A;  2JKT M;  2P08 A;  2D02 A;  3UB8 A;  3T4K A;  4CLC D;  3BJN A;  4NEE D;  4I3I A;  4KUK A;  3E4O A;  3F1P A;  4WN5 A;  5FL3 A;  3IS2 A;  4HY8 A;  3LI9 A;  3NHQ A;  4BWI A;  2QJ7 A;  1ODV A;  2W0N A;  4WLA A;  1NLY A;  2PD8 A;  3BY8 A;  4E04 A;  1OT9 A;  2FH5 A;  2LB9 A;  1GSX A;  4G3K A;  2W1T A;  5HZH A;  2V0U A;  5TJJ A;  1STZ A;  3EGD C;  3KYZ A;  1P0Z A;  1OPX A;  2HF6 A;  4HJ4 A;  3LIA A;  3T4O A;  2W3G A;  1DP6 A;  4EU0 A;  3LFV A;  2OAP 1;  3KSG A;  3EEH A;  2OWJ A;  3C8C A;  3LYX A;  5HDD A;  4JGO A;  1UGU A;  5DF9 A;  3PBO A;  4Z1W A;  2J80 A;  2M7V A;  4B9O A;  2B02 A;  1P9R A;  3H82 A;  4EEP A;  4HHD A;  3C38 A;  5KIZ A;  2BAS A;  2OOL A;  3HJI A;  2V9A A;  3IS2 B;  2HJ9 C;  4F3L A;  1NLZ A;  5HD3 A;  3S7P A;  4GW9 A;  3K3D A;  4ARZ A;  4BBU A;  2PR5 A;  3MQO A;  1OTD A;  1F9I A;  2O0Y A;  1GSW A;  3LID A;  4O01 A;  4NXE A;  3ULF A;  2B18 A;  1G6O A;  2GZA A;  1UWN X;  4IHQ A;  2J3T C;  4CLC B;  3BQ8 A;  1DRM A;  5C5K A;  3BY9 A;  3BWL A;  2H28 A;  2W3E A;  5G4Y A;  1TS6 A;  2D01 A;  2Z6C A;  3HJK A;  4F3L B;  4L9G A;  2VGL S;  3PBQ A;  2PYR A;  2FZ0 A;  3PYP A;  1OJG A;  2K2N A;  2XRO A;  1OT6 A;  1DP8 A;  2P04 A;  2QWS A;  1V9Z A;  1NRJ A;  4MN6 A;  2JHE A;  2VGL M;  4WL9 A;  4NXG A;  3FG8 A;  4WF0 A;  2L1M A;  3F1N A;  3MJQ A;  1W63 Q;  3F1O A;  1G28 A;  3F1N B;  2K7S A;  1T1B A;  5F5Y A;  1F5M A;  2GNX A;  3D3O A;  1WA9 A;  4FOF A;  4OOL A;  2VJW A;  3VOL A;  5HPF A;  3CLO A;  3FPV A;  3PBN A;  3OC2 A;  5G4Z A;  3F1P B;  4OOM A;  4QPR A;  3EEA A;  4CLC C;  3TJZ C;  3E4Q A;  1ZHH B;  2JN7 A;  2ZBB A;  2OAQ 1;  1XFN A;  2GX5 A;  1T18 A;  1S66 L;  4HIA A;  2L4R A;  4O0P A;  4EQ1 A;  5DKL A;  4IUK A;  1OTI A;  1TF1 A;  4NXF A;  3LR0 A;  4WEJ A;  3HCY A;  5K5B A;  3T4Q A;  2ZMV A;  2V1A A;  1X0O A;  4LRY C;  4HJ3 A;  1IOU A;  3D72 A;  3CUE A;  2JKR M;  3UMD A;  2VV6 A;  3CAX A;  2KOI A;  3LR5 A;  1LL8 A;  4BMW A;  4WEK A;  5HWT A;  2PYP A;  3BQA A;  4GLQ A;  3NOP C;  3E4P A;  5AVF A;  2O9B A;  4JGQ A;  5HPI A;  3H82 B;  4GS9 A;  3KYQ A;  4YNR A;  3PXP A;  1YAX A;  4I39 A;  2HGV A;  4CQH A;  1OTA A;  2VV7 A;  3PR6 A;  4JGP A;  4WEL A;  5DKK A;  2M1C A;  4DMZ A;  5A8B A;  1P97 A;  2EA9 A;  2NUP C;  2P7J A;  4CLC A;  3LUQ A;  4ETZ A;  1XJ6 A;  1LSW A;  2VLG A;  2J3W A;  4Q0H A;  3K2N A;  2KDK A;  2O99 A;  3IBR A;  2JKT I;  4KQO A;  4MN5 A;  2ZMF A;  4GHI B;  4KUO A;  3ZYT A;  3T4L A;  4MCW A;  5L8M A;  5HDC A;  3C30 A;  3O5Y A;  4I3J A;  3K3C A;  4HJ6 A;  3P01 A;  4PKY G;  2ZOH A;  5CX7 A;  3PBR A;  4MDZ A;  1S4S A;  2VZW A;  2INW A;  3KSI A;  2VEA A;  4ARZ B;  4Q0J A;  3E98 A;  1EW0 A;  2HV1 A;  3EGX C;  1T1A A;  5HL6 A;  4UQI M;  5IT5 A;  3UE6 A;  3NOU C;  2W3F A;  4BBV A;  3R4K A;  4GCZ A;  2PHY A;  4R38 A;  1VHM A;  4EW7 A;  1XJ4 A;  4CLC E;  4EUV A;  2WKR A;  5HD5 A;  3FPW A;  2DMW A;  4IJG A;  5DFX A;  2EWV A;  2VV8 A;  4L0L A;  2J3T D;  5AJG A;  1TS0 A;  3EQV A;  2NUT C;  3OCN A;  4MN7 A;  3KO6 A;  4M4X A;  2W3H A;  4HH3 A;  3EQU A;  3VE3 A;  2O9C A;  3B42 A;  4EET B;  4HOI A;  3B33 A;  1YSP A;  2PD7 A;  3EWK A;  3RTY A;  2WKP A;  5LBR A;  4Y3I A;  3TE8 A;  4DN0 A;  2IA2 A;  3GDI A;  4H6J A;  1S1Y A;  2W3D A;  2W27 A;  1N9N A;  2O9A A;  5I5L A;  4ZRR A;  3EOI A;  2V0W A;  3TRC A;  4EXO A;  3TW8 A;  3MQQ A;  2I9V A;  1TD5 A;  1ZTU A;  2ZOI A;  4ME4 A;  3JVU A;  3PBS A;  5HDS A;  3OLO A;  2XRN A;  3A0R A;  5J7E A;  3MQ0 A;  3LR4 A;  1OTE A;  4PAU A;  4PHT A;  1KOU A;  3RFB A;  3LIE A;  4P6Z M;  3PBT A;  3OCL A;  3S7O A;  3CWF A;  1OTB A;  3LIB A;  4IUH A;  3OOV A;  1XFQ A;  2L0W A;  3DBA A;  2MJ6 A;  3MF0 A;  4NKP A;  4HP4 A;  1DP9 A;  4P6Z S;  3ZQ5 A;  3R7W A;  1JNU A;  2V1B A;  4K08 A;  3KX0 X;  1MC0 A;  3BW6 A;  3PHY A;  3B47 A;  4G3W A;  4UQI S;  3R7W B;  4R70 A;  1W63 M;  5DJT A;  1N9L A;  3VE4 A;  5MC7 A;  3H7W A;  2KX6 A;  4G3V A;  5DJU A;  3CUE C;  3MXQ A;  1BYW A;  3S7Q A;  3T4T A;  4AFI A;  3U2A A;  4Y2F A;  4JGR A;  2PT7 A;  3UB6 A;  3LIF A;  4LLO B;  2QKP A;  4L9F A;  5F69 A;  4ETX A;  2A2L A;  4BJP A;  2R78 A;  1D7E A;  4Y5F A;  1MZU A;  3GEC A;  1GSV A;  3C2W A;  4R6L A;  2KLI A;  3H7W B;  2Y8H A;  2XA7 S;  4EER A;  3OBF A;  3UB7 A;  1LT0 A;  1NWZ A;  1LSX A;  3MFX A;  1H8M A;  3E0Y A;  5KSH A;  5HWV A;  5HSQ A;  2HJE A;  5AVE A;  1N9O A;  2PR6 A;  3IBJ A;  4HH2 A;  3T50 A;  2XA7 M;  2M7U A;  4I3A A;  3V67 A;  2GJ3 A;  4B93 A;  1F98 A;  3UB9 A;  2Z6D A;  4EEU A;  3T4S A;  4GJ4 A;  3MR0 A;  1LSV A;  1VB6 A;  5DFY A;  3KSH A;  1V9Y A;  5J3W A;  2PDR A;  4LRX C;  4MMN A;  5HWW A;  1Y28 A;  3G6O A;  3JVV A;  4YWZ A;  5TBM A;  1IFQ A;  3UE3 A;  3T4J A;  2W1T B;  1YKD A;  3NJA A;  1TS7 A;  1XJ3 A;  3LI8 A;  4HP9 A;  3RH8 B;  3A0V A;  1H3Q A;  3F1O B;  1OJ5 A;  4RQ9 A;  2VKS A;  4FSF A;  4EES A;  2A24 A;  4XT2 A;  4I5S A;  1UWP X;  4HI4 A;  4HQA A;  3SW1 A;  2VX8 A;  4I38 A;  2QHK A;  2Y79 A;  2JKR I;  1D06 A;  3CIT A;  5TBM B;  4WUJ A;  3W2Z A;  4PKY A;  4BBT A;  4YOF A;  1T1C A;  2QJ5 A;  4II7 A;  5J4E A;  4DJ2 A;  3ICY A;  4KQD A;  3LR3 A;  4GS9 B;  2VA0 A;  3KSF A;  1S67 L;  2XSS A;  1T19 A;  2QYB A;  3H9W A;  2YKH A;  2WKQ A;  2A24 B;  4XT2 B;  3UME A;  2G7U A;  1XJ2 A;  3CI6 A;  3S7N A;  4Q0I A;  5EFW A;  2K31 A;  3LIC A;  4HNB A;  5F6A A;  3VV4 A;  2EWW A;  2W1R A;  2YKF A;  4DJ3 A;  3MMH A;  3NOT C;  2LB5 A;  5IS1 A;  5F68 A;  2OWH A;  2CMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...