3IS2A

2.3 angstrom crystal structure of a cys71 sulfenic acid form of vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Illuminating solution responses of a LOV domain protein with photocoupled small-angle X-ray scattering.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 34
structure length 149
sequence length 150
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3is2A00
4WF0A 1TS7A 2QKPA 3UB9A 2Z6DA 1DP9A 5HD3A 2V1AA 3EEHA 2ZOIA 1P97A 4L9EA 5TBMB 4R38A 4I3AA 3E4OA 2PD8A 1VB6A 5HDDA 1XFQA 2BASA 3C8CA 1BYWA 2QJ5A 5HDSA 1LSVA 5DJTA 3OLOA 4HI4A 3H7WB 2B02A 2VLGA 4YWZA 4JGQA 1OTEA 1Y28A 4KQDA 4LPZA 3K3DA 5F68A 3G6OA 2OOLA 2I9VA 4WLAA 3NOPC 5J3WA 2QHKA 3A0SA 3K3CA 2Z6CA 3LI9A 2J80A 2VV6A 1KOUA 4F3LA 1UWPX 2JN7A 5IS1A 2WKRA 4I39A 2YKHA 5IU1A 2KDKA 1S67L 3E4QA 4BBTA 3B33A 4EETB 1UGUA 5HZHA 3ULFA 4WL9A 4GHIB 4MN5A 3LIDA 4EW7A 2R78A 5HSQA 1S1YA 5J4EA 2JHEA 5HDCA 4XT2B 5HWVA 1LSWA 3A0RA 1OJ5A 3C2WA 4KUOA 3H82B 1OT9A 3IS2B 2L0WA 4DJ2A 2CMNA 2P7JA 3LIBA 1DRMA 1XJ3A 1OTIA 5DKKA 1S4SA 3LIFA 4JGOA 4R3AA 4BBUA 4LRYC 1X0OA 4GS9A 1OTDA 2A24B 3F1OA 3D72A 4E04A 2HV1A 3UB7A 5AVFA 3F1PA 1TS6A 1GSWA 3UMDA 4MN6A 3ZQ5A 2INWA 4I3JA 4HH3A 1DP8A 4HIAA 2L4RA 4NXEA 5AVEA 4LRXC 4H6JA 3LYXA 2ZBBA 3PYPA 5I5LA 4NXGA 4HHDA 3VOLA 5DKLA 3UE6A 3H9WA 4HOIA 4I38A 4K08A 5TBMA 2EA9A 1LT0A 2KX6A 5HWTA 4PKYG 5KIZA 1S4RA 1S1ZA 1T1BA 4HJ3A 3MR0A 3F1NB 1OJGA 3MQQA 4LLOB 1GSVA 3A0VA 3H7WA 3BY8A 1D7EA 1D06A 4HQAA 3VE3A 2K7SA 5HWWA 3HJKA 2PYPA 2L1MA 1N9LA 4B9OA 2V9AA 5G4YA 3MQOA 4EXOA 3EWKA 2W27A 2WKPA 1XFNA 3FC7A 5EFWA 2VV7A 2W0NA 3UB8A 4GCZA 2PDRA 3MXQA 1JNUA 5F5YA 4WUJA 3VE4A 3RTYA 1WA9A 2V1BA 5A8BA 1TS0A 2H28A 4GHIA 1LSXA 2PYRA 1N9NA 4EQ1A 1N9OA 2WKQA 4XT2A 4LRZE 5F69A 4NXBA 4HP9A 4DJ3A 1ODVA 2QWSA 5HD5A 2D01A 4EESA 4KUKA 2PD7A 3H82A 3KX0X 4H6JB 2VV8A 2M1CA 3PHYA 3UB6A 3IS2A 1GSXA 4JGRA 1P0ZA 3BY9A 1V9ZA 3NOTC 5F6AA 1MZUA 1XJ6A 3CAXA 3IBRA 3LIAA 4EEPA 4R70A 4F3LB 3GECA 1V9YA 4HP4A 4I3IA 4EERA 2GJ3A 1S66L 1OTBA 4I5SA 3HJIA 3RH8B 4HH2A 2A24A 3LICA 1G28A 2D02A 1T1CA 2QJ7A 1OTAA 3MFXA 2PR6A 4BBVA 5G4ZA 1T19A 1TS8A 3LIEA 3MJQA 1XJ4A 3T50A 3LI8A 1EW0A 4HJ4A 3NHQA 4JGPA 1T18A 2OWHA 3NOUC 3ICYA 1OT6A 3GDIA 4WN5A 4R6LA 4GW9A 4PKYA 1LL8A 2ZOHA 3CWFA 5J7EA 2V0WA 4M4XA 4RQ9A 4L9GA 3E4PA 3F1NA 4HY8A 3UMEA 4GS9B 1UWNX 1DP6A 3F1OB 2YKFA 5DJUA 2OWJA 4HNBA 1F98A 3F1PB 4HJ6A 2PHYA 2PR5A 3FG8A 3NJAA 1F9IA 3LUQA 1NWZA 4L9FA 4EEUA 3SW1A 1T1AA 2VEAA 4NXFA 2V0UA 3CLOA 3BWLA 3P7NA 1XJ2A
chains in the Genus database with same CATH superfamily
4AFIA 2XRNA 1TS7A 3QNBA 3NECA 1YAXA 3BFDA 3LR5A 4WM9A 3IX8A 4CLCE 2Y2MA 3BLSA 4CLCB 3PBTA 4IVIA 2WGIA 2DMWA 4L9EA 3KYQA 1YLWA 3R7WB 3BFGA 4I3AA 2Y2HA 4WELA 5HDDA 2BASA 4DE2A 2VGJA 3V67A 5E2HA 4PAUA 5HDSA 5DJTA 3BFEA 2ZC4B 3U4LP 1DJCA 3NDGA 2B02A 4Y3IA 3IWIA 4BLMA 4YWZA 5F82A 1DJAA 2WADA 1I2WA 3IF6B 2QZ6A 5JYPA 3C5AA 1K4FA 2ZQAA 5JYOA 2QHKA 2Z6CA 4OQ0A 2XQZA 3CHWP 2WKEA 2JN7A 4I39A 4OLGA 5CERA 4YNRA 2KDKA 1Q2PA 4DDYA 1S67L 1PIOA 3E4QA 1O7EA 1E4DA 3DBAA 3G2ZA 5HZHA 3JPUA 4UA6A 4L0LA 3HLGA 3IXBA 3ZG5A 2EWWA 5J4EA 2JHEA 1W8YA 4ZTKA 4XT2B 3CI6A 4IHQA 4P6ZM 1MKIA 5CGXA 4IVKA 3UPNA 4UHUA 3IS2B 2L0WA 2PBYA 1O07A 2Y4AA 1CEFA 1MWSA 4JXGA 1CI8A 2HDRA 4UAAA 1SKOA 1MY8A 4S2NC 1G68A 1YKDA 3KO6A 1VEUA 2Y2PA 3S7OA 2I72A 4NK3A 5DTKA 1YMXA 1XGJA 5AQBA 1X0OA 4XXRA 3SH8A 1OTDA 2XFSA 1YLJA 3D72A 2JBFA 3F1PA 3C30A 4FTXA 4Q0JA 5CHMA 1ES4A 3UMDA 4P6ZS 1ZHHB 2BG1A 3V50A 3ZQ5A 3TOIA 2INWA 2W1TB 1FCMA 4I3JA 3QP6A 4Y17A 5M19A 1ONGA 1KDSA 4HIAA 4NXEA 4DE1A 1EWZA 4LRXC 4UQIM 3O3VA 2JE5A 4H6JA 1MWRA 2QMIA 2PT7A 3AGFA 3KSGA 4N9LA 4DXBA 3CMZA 4C75A 2ZQ9A 5FI7A 3PYPA 4NXGA 1G5UA 4HHDA 2JKTI 3KSIA 3HUNA 3ZGAB 3T1RA 1KVMA 2Y2KA 5EVIB 5FQMA 4PKYG 2ACGA 3QP5A 4ZRRA 3MR0A 3F1NB 1AWIA 1OJGA 3OOVA 4ZJ2A 1YQSA 4RX3A 3TW8A 1K38A 3C4PA 4S2MA 3HLCA 2W3HA 4KZBA 4LV1A 4LCMA 3H7WA 1C3BA 3LO7A 4HQAA 4HBUA 5HWWA 4IUKA 1CF0A 1N9LA 4B9OA 1SDEA 1G6AA 3C4OA 3PBSA 2ZQ8A 2ZC7A 5HAPA 5FQIA 4BMWA 4EBPA 5MC7A 4B88A 2EXBA 3W4PA 2XA7M 4E3NA 1BLHA 1WE4A 5FA7A 2H0YA 1JNUA 4HBTA 5M18A 4K0WA 2WAEA 3UPOA 4GHIA 2VGLM 1LSXA 3CPTB 1K55C 1N9OA 2WKQA 5FDSA 3GRJA 4OLDA 2QWSA 2D01A 3HL9A 3SH9A 1JTDA 4FOFA 2PD7A 4N1HA 3KX0X 3WS5A 2M1CA 4E3JA 1MBLA 1XKZA 4IEDA 3BY9A 4KENB 5F6AA 1MZUA 2HP9A 4EWFA 2G2WA 2Y2GA 4KQQA 1XJ6A 3IBRA 4N1XA 3MKFA 4R70A 2XA7S 2HGVA 4QU3A 2GJ3A 3ZG9B 2ZQCA 1S66L 3A3DA 2Y55A 5HL1A 4ZDXA 2VGLS 5A91A 1LHYA 3P09A 4U0TA 4FUWA 4EUVA 2QJ7A 1OTAA 1MXOA 2PR6A 4BBVA 4FH4A 5G4ZA 2MJ6A 5KZHA 4S2NA 1OMEA 3MJQA 3FZCA 1W79A 3NDEA 3MXSA 1W8QA 2XH9A 3PBNA 5DF9A 4JXVA 2BLSA 4ETXA 3N8SA 1D1JA 4EBNA 2VJWA 3VP4A 5LBRA 3NY4A 1BLCA 1FSWA 3A3IA 3VP2A 3GDIA 4P6BA 3L7HA 1SKOB 1ZG4A 2JKFA 2C6WB 1LL8A 1S6RA 1VEUB 3R4KA 4JXSA 3MXRA 5TR7A 2FZ0A 5J7EA 1ZKJA 3NCKA 1SDNA 4RQ9A 5CTNA 3ZG0A 2ZMAA 3E4PA 2OAP1 2R9XA 2Y91A 3T4OA 4IBRA 3VFFA 4F94A 1BLPA 3A3FA 2OWJA 4HNBA 3E0YA 2H10A 3F1PB 1Q2QA 2PHYA 1FSYA 3GR2A 3PR6A 5FQ9A 3ZCZA 4R4RA 1BUEA 3ZHHA 1T1AA 3QNCA 4R0QA 1YLZA 2A49A 5DF7A 1GHPA 4WF0A 2JKRM 1P9WA 2UV0E 3LY3A 2HJEA 4RVAA 2PAVP 3EEHA 3ITBA 2V20A 2J3TD 3BW6A 2O99A 2ZD8A 2IWDA 3Q81A 3EQVA 3U2AA 3E4OA 1FCOA 1VB6A 3EGDC 4EQIA 1XFQA 1YMSA 2C5WB 3HCYA 1IELA 3G35A 1K0KA 3GSGA 3H7WB 4KZ8A 1RGZA 1SZVA 5FATA 2VLGA 4JGQA 2J7VA 3K3DA 5F68A 3G6OA 4JKTA 4D60A 2I9VA 4WLAA 2HF6A 1DY6A 2J80A 4R23A 3MF0A 1K55A 4UEYA 4QY5A 2YKHA 5HW3A 4QB8A 3B33A 4ESPA 4EETB 1UGUA 1GA9A 4GHIB 4MN5A 5L09A 4JLFA 4JBFA 1JTGA 3G2YA 4EW7A 1L0FA 1S1YA 1RP5A 5AQAA 3DW0A 4MDZA 1YLPA 4OH0A 2IA2A 4ID4A 3B42A 1LSWA 5EECA 3QP2A 3G30A 1SKFA 3C2WA 5GHYA 1QMEA 2Y2JA 3T12B 4RX2A 4NKPA 3MSHA 1H5XA 2OAQ1 1CI9A 1KGFA 2WGWB 1AXBA 2GNXA 4Y7PA 1XJ3A 4R4SA 4YFMA 3ZVTA 3VSLA 5DKKA 3LIFA 1YSPA 4QY6A 2O9BA 3E98A 3UPPA 2BTFP 3C7VA 3LGOA 4U3TA 2EXAA 4U0XA 1PRQA 3F1OA 4S2IA 1F5MA 2W1RA 4LCLA 3IXGA 2ZQ7A 1LI9A 4JF5A 3FWLA 2RL3A 4FH2A 1BSGA 1NJ4A 1TS6A 4M3KA 3SOIA 3CPTA 2V8CA 4KQRA 2O0YA 4G3KA 4K0XA 3HUOA 4ZBEA 3BLMA 1W5DA 4HH3A 3EGXC 5L07A 2OLUA 2L4RA 3O87A 5AVEA 4HESA 2P08A 3HLWA 2J3WA 2VA0A 3QP4A 1CJFA 2ZBBA 3ISGA 2J9OA 2Z2LB 1ES5A 1PYYA 5DKLA 4OQIA 3UE6A 1IOUA 3VV4A 3T4JA 4HOIA 3P01A 1YLYA 5TBMA 4GDBA 2EA9A 5HWTA 5KIZA 1S4RA 2X71A 2E8JA 3CG5A 5GL9A 3DTIA 5GLCA 5DTSA 2OLVA 1GSVA 5CTMA 3BY8A 3IQAA 1D7EA 3VE3A 1LI0A 1PNEA 4NETA 1SHVA 5GHXA 2HP6A 1JWVA 2PYPA 2L1MA 5AQ9A 4DKIA 2V9AA 3BFCA 3MQOA 3BM6A 4X1LA 2JKRI 2WKPA 1FR1A 2ZL1A 2W3GA 1U60A 2EX6A 2XD1A 3MS6A 3FC7A 3BFFA 2VV7A 3S7QA 3WS4A 3SZTA 4QWOA 2OSUA 3UB8A 3MXQA 5F5YA 2DRWA 4KZ7A 4H8RA 4JXWA 5HAQA 1E25A 3OCNA 1ESIA 4WUJA 3VE4A 2PBDP 2WYXA 4OOYA 3WS2A 3RTYA 5DF8A 1WA9A 2V1BA 5A8BA 4LV2A 3KYZA 3ZNYA 3N8RA 2PYRA 1F2KA 3NULA 4EQ1A 2V2FF 4C3QA 5U47A 5F69A 3LR4A 3C7UA 1YLTA 4E3IA 4BL2A 3ZG7B 3IHBA 3VSKA 3UB6A 1GSXA 5CECA 1P0ZA 1VETA 5FQQA 3EOIA 3NOTC 3Q7VB 1BLSA 2XFTA 3T4QA 5CGSA 1GCEA 4X68A 3CAXA 4DF6A 1KE4A 3G32A 4EEPA 3WRTA 2HDQA 4IJGA 1DJBA 4WEKA 4EERA 3MZFA 3VOZA 3VP1A 5K5BA 1WYCA 3PAGA 1MPLA 3M6HA 5HFOA 2A24A 3UDFA 5CRFA 3W2ZA 3LICA 3MBZA 3T4SA 3MFDA 2HP5A 4WYYA 1CQAA 5E43A 1GHMA 2WAFA 2XR0A 3LIEA 2XK1A 2JC7A 3UDIA 3T50A 3LI8A 1IYQA 2Y2OA 4HJ4A 3NHQA 5FQKA 3T4KA 2EX2A 1T18A 2OWHA 1Y4OA 4KZ4A 5GLDA 4CLCD 4DE3A 1K56D 1OT6A 4WEJA 4WN5A 3IXDA 4D2OA 4KG2A 4MNRA 1H8ZA 1N9BA 3BEBA 4ARZA 2XEPA 4UQIS 2ZOHA 4X1MA 2V0WA 5D3OA 4M4XA 1ERMA 1MWTA 2FFFB 3DTKA 4GNUA 4BWIA 4JF6A 1BT5A 2WZZA 3G31A 3IX4A 4Y15A 1DP6A 3F1OB 2YKFA 5DVAA 3CITA 4B4ZA 3RJUA 3QP8A 5EV0A 1TVFA 1BTLA 4WMCD 3MZDA 1NLZA 3N6IA 4X53A 3BJNA 3D9YA 4L9FA 3VMAA 5CEDA 3GQZA 2V8FA 1JWPA 2WK0A 3CJMA 3VP3A 3BWLA 3JVUA 4P87A 3EQUA 1STZA 5E2EA 5EOOA 1WYBA 2QKPA 4S2JA 2H5SA 1DP9A 5HD3A 4QPRA 1J3WA 5DFYA 4BD0A 5CX7A 2WKHA 2WGWA 5CGWA 2GZAA 5L8MA 3UN7A 1BULA 5TBMB 3PBOA 4GD8A 3KYEA 2W3FA 3E2KA 2JCHA 2FFYA 2ZM0A 1KE0A 1VHMA 3N4IA 1LSVA 3OLOA 4HI4A 2A3UA 4S2OA 3UY6A 4C6YA 1OTEA 4KQDA 4LPZA 2WKIA 2NUTC 2J3TC 3DTMA 3T4TA 2OOLA 3HREA 5EVEA 5CHJA 3K2NA 4OQGA 2ZL1B 3A0SA 3K3CA 1HLUP 3MQ0A 3S1YA 2QYBA 1GHIA 3TRCA 1OPXA 3LI9A 2VV6A 1KOUA 4F3LA 4PM7A 5IS1A 1PI5A 1K25A 4WZ4A 2XF3A 4Y13A 3T1XA 1LL5A 1LLBA 5M1AA 3BQAA 4PM5A 3ULFA 4ETZA 4Y0UA 3LIDA 5HSQA 5GLAA 2VX8A 5HDCA 2NUPC 2EWVA 5AJGA 5HWVA 4DXCA 3ZNTA 4KUOA 3L9KA 4X55A 2X02A 3UE1A 5CXWA 3MKEA 5GLBA 1VETB 3WS1A 4S2PA 4DJ2A 2CMNA 1LL9A 5KSHA 5HPIA 1DRMA 2Y59A 2ZJ9A 4LGWA 4GN2A 2ZC5B 3LFVA 1S4SA 5EVID 3DWZA 1ERQA 1ACFA 3ITAA 4JGOA 1FQGA 4R3AA 4BBUA 3IWOA 2HPBA 2Y79A 3OC2A 2PU2A 3IXHA 3S22A 1A0KA 4LRYC 1IFQA 4PM9A 2DNSA 2XLNA 2A24B 1TEMA 1XPBA 4GDNA 5TJJA 3UB7A 4E04A 2B95A 3V39A 2LB9A 3FPWA 1XX2A 1E3UD 3IBJA 2GDNA 3C38A 4GB7A 3BRMA 4MN6A 4Y2FA 1NZOA 4K91A 3A3JA 4IUHA 2H0TA 4DMZA 2HJ9C 1MC0A 4KZ5A 3RFBA 1H3QA 4GLQA 4Z1WA 2M7VA 3E2LA 2G2UA 3LYXA 1ALQA 3S4XA 3UDXA 5I5LA 2EX8A 3VOLA 3Q7VA 4Z9QA 3H9WA 2OV5A 4NG2A 4ARZB 4UA7A 4LFUA 1Y54A 4I38A 5FAQA 1IYSA 3V3RA 1HTZA 2KX6A 3RXWA 1J9MA 1S1ZA 4OPRA 4HJ3A 4GD6A 1Z09A 3NC8A 1SCWA 3P98A 1L2SA 2Q9MA 2XSSA 4O0PA 5F1GA 4LLOB 1YPRA 5FI2A 3A0VA 3LR3A 1D06A 1RGYA 2K7SA 4II7A 4E6XA 4S2LA 1KE3A 5TFQA 5G4YA 4BD1A 5F83A 4EXOA 3EWKA 1FR6A 2W27A 4KZ6A 3GV9A 4G3WA 3HVFA 2Q0OA 2J9PA 1EI5A 4G3VA 1EROA 1TF1A 2P74A 2DCFA 2B5RA 4BJPA 2W0NA 5HARA 2IWBA 1MWUA 5FL3A 3LCEA 4WBGA 2P04A 1GA0A 1CEGA 4R3JA 4DN0A 4PM8A 4CQHA 4R1GA 4MEZA 2H28A 4EBLA 1PFLA 1PW8A 4X69A 3M2KA 4KQOA 3SS3A 1H8YA 1E3UA 3IT9A 3UNWA 3T1SA 1IEMA 5HD5A 4EESA 4KUKA 3BQ8A 5FDHA 1PZPA 4EU0A 3H82A 2Z2MB 4LENA 3UB5P 3S7PA 4EUZA 3FKWA 1ES2A 1JVJA 4JGRA 2M7UA 3FV7A 1NRFA 1L0GA 1V9ZA 3ZVWA 1IKIA 2VZWA 3G4PA 4F3LB 4PPRA 3WWXA 1V9YA 3T1QB 4HP4A 5L2FA 4KZ9A 2Y2LA 4N9KA 1OTBA 5EOEA 2ZMVA 3HJIA 4ZJ1A 2Y2IA 3BYDA 2K31A 4FD8A 5EE8A 1XXMA 4MN7A 1T1CA 3PTEA 4GKUA 3MFXA 1K54C 1T19A 2HZ5A 1K6SA 2HDUA 4E3MA 1XA1A 2Q9NA 5DFXA 2XDMA 2R9WA 3NOUC 3ICYA 1FOFA 4O7DA 4RYEA 4GW9A 1M6KA 4PKYA 4E3OA 2VKSA 5A90A 3IH8A 1TDLA 2Y2NA 4WZ5C 2VGKA 1FILA 3OPLA 1XGIA 1XP4A 4X6TA 3WS0A 5J8XA 2AVXA 2JKGA 3OPRA 5FAOA 1UWNX 5DJUA 4CLCC 3Q07A 2ZC3B 4KZAA 3TSGA 3HLBA 2W3DA 4HJ6A 4KG6A 2PR5A 1F9IA 3LUQA 1NWZA 2X01A 1NYYA 3JVVA 3KSHA 4MLLA 3GTCA 4UA9A 2VEAA 3T4LA 3HLFA 1L0EA 3P7NA 1XJ2A 5KSCA 4BENA 5FI6A 3UB9A 4OPYA 3HLEA 1N4OA 2Z6DA 1L3LA 4E3LA 3IF6C 2V1AA 4A5RA 2B18A 3PAEA 2ZOIA 2WUQA 4Y0OA 1P97A 4MMNA 1K57C 2W3EA 4R38A 3AGEA 5HX9A 3Q82A 4PMAA 2PD8A 1HD8A 2KLIA 4P0MA 2P9VA 2ZM8A 1H0MA 3O88A 3C8CA 4YOFA 1BYWA 1NYMA 1PWCA 2QJ5A 1G6OA 1JWZA 1NLYA 1ZTUA 5A93A 1Y28A 4ZJ3A 1FCNA 5FSRA 2RCXA 4B4XA 3N7WA 1W7FA 1PZOA 3NOPC 4IBXA 4O8GA 5J3WA 4Y5FA 2LB5A 1PWDA 3IWQA 3PBRA 1UWPX 4ME4A 4Q0HA 1ESUA 1PWGA 2WKRA 1PW1A 2V1ZA 3HBRA 5IU1A 5I94A 1NY0A 4BBTA 4QD4A 4WL9A 3LY4A 3W4OA 5EM1A 3OPPA 2R78A 1KGEA 2O9AA 2HDSA 2A2LA 1W63M 3M2JA 3VOYA 2ZC6B 3A0RA 1OJ5A 5IT5A 3H82B 3V3SA 4EV4A 2UWXA 1IYPA 5IHVA 1OT9A 3DAVA 1H8MA 1YM1A 4XUXA 2Y8HA 1K4EA 5FASA 2P7JA 2WGVA 5GHZA 3LIBA 5DTTA 1OTIA 1IKGA 4LV0A 3VP0A 3WRZA 3Q1FA 3MZEA 3ZYTA 4GJ4A 1XA7A 5EPHA 4MBKA 5HL6A 3VFHA 1K54A 1TD5A 3OZHA 4MBHA 3MMHA 4KZ3A 4OKPA 4X56A 5C5KA 1QMFA 1BZAA 4GS9A 2HV1A 2PRFA 5HPFA 5AVFA 1I5QA 4GZBA 3ZFZA 1GSWA 4JPMA 5F1FA 3M6BA 5CEBA 2QPNA 5EVIC 1VM1A 4B93A 3HUMA 4CPKA 4OP8A 3ZG8B 3IF5A 2ZM2A 4WZ5A 1DP8A 3LEZA 4QHCA 5E2FA 3I7JA 3SH7A 1NXYA 1FIKA 2J8YA 4FCFA 4FSFA 3FYZA 1M40A 5FEGA 2O9CA 2PU4A 5AQ7A 4OOLA 2K2NA 4MCWA 3OBFA 3CUEC 4LV3A 4CLCA 4OPZA 3EEAA 1K56A 3LR0A 1KGGA 2XROA 2ZQDA 4K08A 3R7WA 1LT0A 4OP5A 1CK3A 2CC1A 1T1BA 3N8LA 2G7UA 3TJZC 1HVBA 4OVDA 3MQQA 3B3XA 4Y0TA 4KG5A 4BL3A 1L0DA 4PHTA 4OONA 3W4QA 4NEED 1ES3A 3IF6A 4CJNA 3HJKA 4BQMA 1VQQA 4WMCA 3FKVA 3UE3A 3V5MA 3W8KA 4X25A 3JYIA 1S0WA 2IWCA 5FEFA 2FH5A 1YT4A 1IYOA 1K57A 3Q7ZA 1XFNA 5EFWA 3FPVA 3IH9A 4OQHA 4GCZA 2PDRA 3TG9A 1NRJA 3CZDA 1KDWA 2GX5A 3UO9A 5G18A 1RCJA 1TS0A 4DE0A 3DWKA 4MBFA 2P9VB 2WZXA 4OPQA 1ONHA 3PXPA 1N9NA 3D4FA 3O5YA 4XT2A 4LRZE 4NXBA 4HP9A 4DJ3A 1ODVA 3NBLA 3TE8A 4H6JB 2VV8A 3PHYA 3IS2A 3DTEA 3GMWA 3QHYA 2EFUA 3LIAA 4Q8IA 1ZC2A 4XUZA 5FQJA 4R3BA 3IX3A 3D3OA 3GECA 1PI4A 3RXXA 4I3IA 4YINA 1TDGA 4OOMA 1KVLA 2Y2QA 2ZLYA 3AGDA 3G34A 2XD5A 3OCLA 2E8IA 4I5SA 3RH8B 4HH2A 3NI9A 3LEQA 4RA7A 4N92A 3BECA 5A92A 1G28A 2D02A 2VK3A 4GOGA 3KSFA 1P9RA 4HEFA 1K6RA 5EM0A 5CHUA 4QJGA 4P85A 3HLDA 1TS8A 2EFXA 1XJ4A 5TGFA 2W1TA 3ZDJA 3S7NA 1EW0A 4JF4A 3QP1A 1YSQA 1MKMA 4JGPA 3UE0A 2ZMFA 3GVBA 3SS5A 2EX9A 4E3KA 4R6LA 3IHAA 3O86A 5E2GA 4S2KA 2JKTM 3SS4A 3CWFA 5KMWA 5EVIA 1NZUA 5EVLA 3NIAA 4L9GA 4E6WA 4PM6A 3F1NA 2KOIA 5HAIA 4HY8A 3UMEA 4GS9B 3OPHA 4Q0IA 1F98A 1HZOA 4DRTA 1I2SA 4O01A 3A3EA 3FG8A 3NJAA 2XGNA 1W63Q 5FAPA 3CUEA 5L10A 1Z6FA 4ZAMA 4EEUA 3SW1A 3PBQA 4DDSA 3B47A 4NXFA 5EUAA 2V0UA 3CLOA 1ZG6A 5BOHA
chains in the Genus database with same CATH topology
4WF0A 2JKRM 4AFIA 2XRNA 1TS7A 3EQUA 1STZA 1P9WA 2QKPA 3UB9A 2Z6DA 2HJEA 1YAXA 1DP9A 3LR5A 5HD3A 2V1AA 4CLCE 2B18A 4QPRA 4CLCB 3EEHA 3PBTA 2ZOIA 5DFYA 5CX7A 2J3TD 1P97A 3BW6A 2O99A 2DMWA 4MMNA 2GZAA 4L9EA 5L8MA 5TBMB 3PBOA 3KYQA 3R7WB 2W3EA 3EQVA 4R38A 2W3FA 4I3AA 3U2AA 3E4OA 2PD8A 4WELA 2KLIA 1VB6A 3EGDC 5HDDA 1XFQA 2BASA 3HCYA 3C8CA 1VHMA 3V67A 4YOFA 1BYWA 4PAUA 2QJ5A 5HDSA 1LSVA 5DJTA 1G6OA 3OLOA 4HI4A 3H7WB 1NLYA 1ZTUA 2B02A 2VLGA 4Y3IA 4YWZA 4JGQA 1OTEA 1Y28A 4KQDA 4LPZA 3K3DA 5F68A 3G6OA 2NUTC 2J3TC 3T4TA 2OOLA 2I9VA 4WLAA 3K2NA 2HF6A 3NOPC 4O8GA 5J3WA 4Y5FA 2QHKA 3A0SA 3K3CA 2Z6CA 3MQ0A 2QYBA 2LB5A 3TRCA 1OPXA 3PBRA 3LI9A 2J80A 2VV6A 1KOUA 3MF0A 4UEYA 1UWPX 4ME4A 4F3LA 4Q0HA 2JN7A 5IS1A 2WKRA 4I39A 2YKHA 5IU1A 4YNRA 2KDKA 1S67L 3E4QA 4BBTA 3B33A 4EETB 3DBAA 1UGUA 5HZHA 3BQAA 3ULFA 4WL9A 4ETZA 4GHIB 4L0LA 4MN5A 3LIDA 2EWWA 4EW7A 2R78A 5HSQA 1S1YA 2VX8A 5J4EA 2JHEA 2O9AA 4MDZA 5HDCA 2NUPC 2IA2A 2EWVA 4XT2B 5AJGA 2A2LA 5HWVA 3CI6A 4IHQA 1W63M 4P6ZM 3B42A 1LSWA 3A0RA 1OJ5A 3C2WA 5IT5A 4KUOA 3H82B 1OT9A 3IS2B 1H8MA 2L0WA 4NKPA 4DJ2A 2OAQ1 2Y8HA 2CMNA 2P7JA 3LIBA 2GNXA 5KSHA 5HPIA 1DRMA 1XJ3A 1OTIA 5DKKA 1YKDA 3LFVA 3ZYTA 1S4SA 3KO6A 3LIFA 4GJ4A 4JGOA 1YSPA 4R3AA 3S7OA 4BBUA 2O9BA 5HL6A 3OC2A 2Y79A 1TD5A 3E98A 4LRYC 3MMHA 1IFQA 1X0OA 5C5KA 4GS9A 1OTDA 2A24B 3F1OA 1F5MA 3D72A 2W1RA 4E04A 2HV1A 5TJJA 3UB7A 5HPFA 5AVFA 3F1PA 2LB9A 3C30A 3FPWA 1TS6A 4Q0JA 1GSWA 3IBJA 3UMDA 4P6ZS 3C38A 1ZHHB 4MN6A 4Y2FA 4B93A 3ZQ5A 4IUHA 2O0YA 4G3KA 2INWA 4DMZA 2W1TB 2HJ9C 4I3JA 1MC0A 3RFBA 4HH3A 3EGXC 1H3QA 1DP8A 4GLQA 4Z1WA 4HIAA 2L4RA 4NXEA 2M7VA 5AVEA 2P08A 4LRXC 4UQIM 4FSFA 2J3WA 2VA0A 4H6JA 3LYXA 2O9CA 3KSGA 2K2NA 2PT7A 4OOLA 2ZBBA 4MCWA 3OBFA 3CUEC 3PYPA 5I5LA 4NXGA 4HHDA 4CLCA 3VOLA 2JKTI 3KSIA 5DKLA 3EEAA 3UE6A 3H9WA 3LR0A 4ARZB 1IOUA 3VV4A 3T4JA 4HOIA 4I38A 2XROA 3P01A 4K08A 5TBMA 3R7WA 2EA9A 1LT0A 2KX6A 5HWTA 4PKYG 5KIZA 1S4RA 1S1ZA 1T1BA 4ZRRA 4HJ3A 3MR0A 3F1NB 2G7UA 3TJZC 1OJGA 3OOVA 3TW8A 3MQQA 2W3HA 2XSSA 4O0PA 4LLOB 1GSVA 3A0VA 3LR3A 3H7WA 3BY8A 4PHTA 1D7EA 1D06A 4HQAA 3VE3A 2K7SA 4II7A 4NEED 5HWWA 4IUKA 3HJKA 2PYPA 2L1MA 1N9LA 4B9OA 2V9AA 3UE3A 5G4YA 3MQOA 4EXOA 3EWKA 2W27A 3PBSA 2JKRI 2FH5A 2WKPA 4G3WA 2W3GA 4BMWA 1XFNA 3FC7A 5MC7A 5EFWA 2VV7A 4G3VA 1TF1A 3FPVA 3S7QA 2XA7M 4BJPA 2W0NA 3UB8A 5FL3A 4GCZA 2PDRA 3MXQA 1JNUA 5F5YA 2P04A 1NRJA 3OCNA 4WUJA 3VE4A 2GX5A 4DN0A 3RTYA 1WA9A 2V1BA 4CQHA 5A8BA 1TS0A 3KYZA 2H28A 4GHIA 2VGLM 1LSXA 3PXPA 2PYRA 1N9NA 4EQ1A 1N9OA 3O5YA 2WKQA 4KQOA 4XT2A 4LRZE 3LR4A 4NXBA 4HP9A 5F69A 4DJ3A 1ODVA 2QWSA 5HD5A 2D01A 4EESA 4KUKA 3BQ8A 3TE8A 4FOFA 2PD7A 4EU0A 3H82A 3KX0X 4H6JB 2VV8A 3S7PA 2M1CA 3PHYA 3UB6A 3IS2A 1GSXA 4JGRA 1P0ZA 2M7UA 3BY9A 1V9ZA 3EOIA 3NOTC 5F6AA 3T4QA 1MZUA 1XJ6A 3CAXA 3IBRA 3LIAA 2VZWA 4EEPA 4R70A 2XA7S 4F3LB 2HGVA 4IJGA 3D3OA 3GECA 1V9YA 4HP4A 4WEKA 4I3IA 4EERA 2GJ3A 4OOMA 1S66L 5K5BA 1OTBA 3OCLA 4I5SA 2ZMVA 3HJIA 3RH8B 2VGLS 4HH2A 2A24A 2K31A 4MN7A 3W2ZA 3LICA 1G28A 2D02A 1T1CA 4EUVA 2QJ7A 1OTAA 3T4SA 3KSFA 3MFXA 2PR6A 1P9RA 4BBVA 5G4ZA 2MJ6A 1T19A 1TS8A 3LIEA 3MJQA 1XJ4A 3T50A 2W1TA 3LI8A 3S7NA 1EW0A 4HJ4A 3PBNA 3NHQA 5DFXA 5DF9A 3T4KA 1YSQA 1MKMA 4JGPA 2ZMFA 1T18A 2OWHA 4CLCD 4ETXA 3NOUC 2VJWA 3ICYA 5LBRA 1OT6A 4WEJA 3GDIA 4WN5A 4R6LA 4GW9A 4PKYA 2VKSA 1LL8A 3R4KA 4ARZA 4UQIS 2JKTM 2FZ0A 2ZOHA 3CWFA 5J7EA 2V0WA 4M4XA 4RQ9A 4L9GA 4BWIA 3E4PA 2OAP1 3F1NA 3T4OA 2KOIA 4HY8A 3UMEA 4GS9B 1UWNX 1DP6A 3F1OB 2YKFA 3CITA 2OWJA 5DJUA 4HNBA 4Q0IA 3E0YA 4CLCC 1F98A 3F1PB 4O01A 2W3DA 4HJ6A 2PHYA 2PR5A 3FG8A 3NJAA 1F9IA 3LUQA 1NLZA 1W63Q 1NWZA 3PR6A 3BJNA 3CUEA 4L9FA 3JVVA 3KSHA 4EEUA 3SW1A 1T1AA 3PBQA 2VEAA 3B47A 3T4LA 4NXFA 2V0UA 3CLOA 3BWLA 3JVUA 3P7NA 1XJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF0 A;  1TS7 A;  2QKP A;  3UB9 A;  2Z6D A;  1DP9 A;  5HD3 A;  2V1A A;  3EEH A;  2ZOI A;  1P97 A;  4L9E A;  5TBM B;  4R38 A;  4I3A A;  3E4O A;  2PD8 A;  1VB6 A;  5HDD A;  1XFQ A;  2BAS A;  3C8C A;  1BYW A;  2QJ5 A;  5HDS A;  1LSV A;  5DJT A;  3OLO A;  4HI4 A;  3H7W B;  2B02 A;  2VLG A;  4YWZ A;  4JGQ A;  1OTE A;  1Y28 A;  4KQD A;  4LPZ A;  3K3D A;  5F68 A;  3G6O A;  2OOL A;  2I9V A;  4WLA A;  3NOP C;  5J3W A;  2QHK A;  3A0S A;  3K3C A;  2Z6C A;  3LI9 A;  2J80 A;  2VV6 A;  1KOU A;  4F3L A;  1UWP X;  2JN7 A;  5IS1 A;  2WKR A;  4I39 A;  2YKH A;  5IU1 A;  2KDK A;  1S67 L;  3E4Q A;  4BBT A;  3B33 A;  4EET B;  1UGU A;  5HZH A;  3ULF A;  4WL9 A;  4GHI B;  4MN5 A;  3LID A;  4EW7 A;  2R78 A;  5HSQ A;  1S1Y A;  5J4E A;  2JHE A;  5HDC A;  4XT2 B;  5HWV A;  1LSW A;  3A0R A;  1OJ5 A;  3C2W A;  4KUO A;  3H82 B;  1OT9 A;  3IS2 B;  2L0W A;  4DJ2 A;  2CMN A;  2P7J A;  3LIB A;  1DRM A;  1XJ3 A;  1OTI A;  5DKK A;  1S4S A;  3LIF A;  4JGO A;  4R3A A;  4BBU A;  4LRY C;  1X0O A;  4GS9 A;  1OTD A;  2A24 B;  3F1O A;  3D72 A;  4E04 A;  2HV1 A;  3UB7 A;  5AVF A;  3F1P A;  1TS6 A;  1GSW A;  3UMD A;  4MN6 A;  3ZQ5 A;  2INW A;  4I3J A;  4HH3 A;  1DP8 A;  4HIA A;  2L4R A;  4NXE A;  5AVE A;  4LRX C;  4H6J A;  3LYX A;  2ZBB A;  3PYP A;  5I5L A;  4NXG A;  4HHD A;  3VOL A;  5DKL A;  3UE6 A;  3H9W A;  4HOI A;  4I38 A;  4K08 A;  5TBM A;  2EA9 A;  1LT0 A;  2KX6 A;  5HWT A;  4PKY G;  5KIZ A;  1S4R A;  1S1Z A;  1T1B A;  4HJ3 A;  3MR0 A;  3F1N B;  1OJG A;  3MQQ A;  4LLO B;  1GSV A;  3A0V A;  3H7W A;  3BY8 A;  1D7E A;  1D06 A;  4HQA A;  3VE3 A;  2K7S A;  5HWW A;  3HJK A;  2PYP A;  2L1M A;  1N9L A;  4B9O A;  2V9A A;  5G4Y A;  3MQO A;  4EXO A;  3EWK A;  2W27 A;  2WKP A;  1XFN A;  3FC7 A;  5EFW A;  2VV7 A;  2W0N A;  3UB8 A;  4GCZ A;  2PDR A;  3MXQ A;  1JNU A;  5F5Y A;  4WUJ A;  3VE4 A;  3RTY A;  1WA9 A;  2V1B A;  5A8B A;  1TS0 A;  2H28 A;  4GHI A;  1LSX A;  2PYR A;  1N9N A;  4EQ1 A;  1N9O A;  2WKQ A;  4XT2 A;  4LRZ E;  5F69 A;  4NXB A;  4HP9 A;  4DJ3 A;  1ODV A;  2QWS A;  5HD5 A;  2D01 A;  4EES A;  4KUK A;  2PD7 A;  3H82 A;  3KX0 X;  4H6J B;  2VV8 A;  2M1C A;  3PHY A;  3UB6 A;  3IS2 A;  1GSX A;  4JGR A;  1P0Z A;  3BY9 A;  1V9Z A;  3NOT C;  5F6A A;  1MZU A;  1XJ6 A;  3CAX A;  3IBR A;  3LIA A;  4EEP A;  4R70 A;  4F3L B;  3GEC A;  1V9Y A;  4HP4 A;  4I3I A;  4EER A;  2GJ3 A;  1S66 L;  1OTB A;  4I5S A;  3HJI A;  3RH8 B;  4HH2 A;  2A24 A;  3LIC A;  1G28 A;  2D02 A;  1T1C A;  2QJ7 A;  1OTA A;  3MFX A;  2PR6 A;  4BBV A;  5G4Z A;  1T19 A;  1TS8 A;  3LIE A;  3MJQ A;  1XJ4 A;  3T50 A;  3LI8 A;  1EW0 A;  4HJ4 A;  3NHQ A;  4JGP A;  1T18 A;  2OWH A;  3NOU C;  3ICY A;  1OT6 A;  3GDI A;  4WN5 A;  4R6L A;  4GW9 A;  4PKY A;  1LL8 A;  2ZOH A;  3CWF A;  5J7E A;  2V0W A;  4M4X A;  4RQ9 A;  4L9G A;  3E4P A;  3F1N A;  4HY8 A;  3UME A;  4GS9 B;  1UWN X;  1DP6 A;  3F1O B;  2YKF A;  5DJU A;  2OWJ A;  4HNB A;  1F98 A;  3F1P B;  4HJ6 A;  2PHY A;  2PR5 A;  3FG8 A;  3NJA A;  1F9I A;  3LUQ A;  1NWZ A;  4L9F A;  4EEU A;  3SW1 A;  1T1A A;  2VEA A;  4NXF A;  2V0U A;  3CLO A;  3BWL A;  3P7N A;  1XJ2 A; 
#chains in the Genus database with same CATH topology
 4AFI A;  2XRN A;  1TS7 A;  3QNB A;  3NEC A;  1YAX A;  3BFD A;  3LR5 A;  4WM9 A;  3IX8 A;  4CLC E;  2Y2M A;  3BLS A;  4CLC B;  3PBT A;  4IVI A;  2WGI A;  2DMW A;  4L9E A;  3KYQ A;  1YLW A;  3R7W B;  3BFG A;  4I3A A;  2Y2H A;  4WEL A;  5HDD A;  2BAS A;  4DE2 A;  2VGJ A;  3V67 A;  5E2H A;  4PAU A;  5HDS A;  5DJT A;  3BFE A;  2ZC4 B;  3U4L P;  1DJC A;  3NDG A;  2B02 A;  4Y3I A;  3IWI A;  4BLM A;  4YWZ A;  5F82 A;  1DJA A;  2WAD A;  1I2W A;  3IF6 B;  2QZ6 A;  5JYP A;  3C5A A;  1K4F A;  2ZQA A;  5JYO A;  2QHK A;  2Z6C A;  4OQ0 A;  2XQZ A;  3CHW P;  2WKE A;  2JN7 A;  4I39 A;  4OLG A;  5CER A;  4YNR A;  2KDK A;  1Q2P A;  4DDY A;  1S67 L;  1PIO A;  3E4Q A;  1O7E A;  1E4D A;  3DBA A;  3G2Z A;  5HZH A;  3JPU A;  4UA6 A;  4L0L A;  3HLG A;  3IXB A;  3ZG5 A;  2EWW A;  5J4E A;  2JHE A;  1W8Y A;  4ZTK A;  4XT2 B;  3CI6 A;  4IHQ A;  4P6Z M;  1MKI A;  5CGX A;  4IVK A;  3UPN A;  4UHU A;  3IS2 B;  2L0W A;  2PBY A;  1O07 A;  2Y4A A;  1CEF A;  1MWS A;  4JXG A;  1CI8 A;  2HDR A;  4UAA A;  1SKO A;  1MY8 A;  4S2N C;  1G68 A;  1YKD A;  3KO6 A;  1VEU A;  2Y2P A;  3S7O A;  2I72 A;  4NK3 A;  5DTK A;  1YMX A;  1XGJ A;  5AQB A;  1X0O A;  4XXR A;  3SH8 A;  1OTD A;  2XFS A;  1YLJ A;  3D72 A;  2JBF A;  3F1P A;  3C30 A;  4FTX A;  4Q0J A;  5CHM A;  1ES4 A;  3UMD A;  4P6Z S;  1ZHH B;  2BG1 A;  3V50 A;  3ZQ5 A;  3TOI A;  2INW A;  2W1T B;  1FCM A;  4I3J A;  3QP6 A;  4Y17 A;  5M19 A;  1ONG A;  1KDS A;  4HIA A;  4NXE A;  4DE1 A;  1EWZ A;  4LRX C;  4UQI M;  3O3V A;  2JE5 A;  4H6J A;  1MWR A;  2QMI A;  2PT7 A;  3AGF A;  3KSG A;  4N9L A;  4DXB A;  3CMZ A;  4C75 A;  2ZQ9 A;  5FI7 A;  3PYP A;  4NXG A;  1G5U A;  4HHD A;  2JKT I;  3KSI A;  3HUN A;  3ZGA B;  3T1R A;  1KVM A;  2Y2K A;  5EVI B;  5FQM A;  4PKY G;  2ACG A;  3QP5 A;  4ZRR A;  3MR0 A;  3F1N B;  1AWI A;  1OJG A;  3OOV A;  4ZJ2 A;  1YQS A;  4RX3 A;  3TW8 A;  1K38 A;  3C4P A;  4S2M A;  3HLC A;  2W3H A;  4KZB A;  4LV1 A;  4LCM A;  3H7W A;  1C3B A;  3LO7 A;  4HQA A;  4HBU A;  5HWW A;  4IUK A;  1CF0 A;  1N9L A;  4B9O A;  1SDE A;  1G6A A;  3C4O A;  3PBS A;  2ZQ8 A;  2ZC7 A;  5HAP A;  5FQI A;  4BMW A;  4EBP A;  5MC7 A;  4B88 A;  2EXB A;  3W4P A;  2XA7 M;  4E3N A;  1BLH A;  1WE4 A;  5FA7 A;  2H0Y A;  1JNU A;  4HBT A;  5M18 A;  4K0W A;  2WAE A;  3UPO A;  4GHI A;  2VGL M;  1LSX A;  3CPT B;  1K55 C;  1N9O A;  2WKQ A;  5FDS A;  3GRJ A;  4OLD A;  2QWS A;  2D01 A;  3HL9 A;  3SH9 A;  1JTD A;  4FOF A;  2PD7 A;  4N1H A;  3KX0 X;  3WS5 A;  2M1C A;  4E3J A;  1MBL A;  1XKZ A;  4IED A;  3BY9 A;  4KEN B;  5F6A A;  1MZU A;  2HP9 A;  4EWF A;  2G2W A;  2Y2G A;  4KQQ A;  1XJ6 A;  3IBR A;  4N1X A;  3MKF A;  4R70 A;  2XA7 S;  2HGV A;  4QU3 A;  2GJ3 A;  3ZG9 B;  2ZQC A;  1S66 L;  3A3D A;  2Y55 A;  5HL1 A;  4ZDX A;  2VGL S;  5A91 A;  1LHY A;  3P09 A;  4U0T A;  4FUW A;  4EUV A;  2QJ7 A;  1OTA A;  1MXO A;  2PR6 A;  4BBV A;  4FH4 A;  5G4Z A;  2MJ6 A;  5KZH A;  4S2N A;  1OME A;  3MJQ A;  3FZC A;  1W79 A;  3NDE A;  3MXS A;  1W8Q A;  2XH9 A;  3PBN A;  5DF9 A;  4JXV A;  2BLS A;  4ETX A;  3N8S A;  1D1J A;  4EBN A;  2VJW A;  3VP4 A;  5LBR A;  3NY4 A;  1BLC A;  1FSW A;  3A3I A;  3VP2 A;  3GDI A;  4P6B A;  3L7H A;  1SKO B;  1ZG4 A;  2JKF A;  2C6W B;  1LL8 A;  1S6R A;  1VEU B;  3R4K A;  4JXS A;  3MXR A;  5TR7 A;  2FZ0 A;  5J7E A;  1ZKJ A;  3NCK A;  1SDN A;  4RQ9 A;  5CTN A;  3ZG0 A;  2ZMA A;  3E4P A;  2OAP 1;  2R9X A;  2Y91 A;  3T4O A;  4IBR A;  3VFF A;  4F94 A;  1BLP A;  3A3F A;  2OWJ A;  4HNB A;  3E0Y A;  2H10 A;  3F1P B;  1Q2Q A;  2PHY A;  1FSY A;  3GR2 A;  3PR6 A;  5FQ9 A;  3ZCZ A;  4R4R A;  1BUE A;  3ZHH A;  1T1A A;  3QNC A;  4R0Q A;  1YLZ A;  2A49 A;  5DF7 A;  1GHP A;  4WF0 A;  2JKR M;  1P9W A;  2UV0 E;  3LY3 A;  2HJE A;  4RVA A;  2PAV P;  3EEH A;  3ITB A;  2V20 A;  2J3T D;  3BW6 A;  2O99 A;  2ZD8 A;  2IWD A;  3Q81 A;  3EQV A;  3U2A A;  3E4O A;  1FCO A;  1VB6 A;  3EGD C;  4EQI A;  1XFQ A;  1YMS A;  2C5W B;  3HCY A;  1IEL A;  3G35 A;  1K0K A;  3GSG A;  3H7W B;  4KZ8 A;  1RGZ A;  1SZV A;  5FAT A;  2VLG A;  4JGQ A;  2J7V A;  3K3D A;  5F68 A;  3G6O A;  4JKT A;  4D60 A;  2I9V A;  4WLA A;  2HF6 A;  1DY6 A;  2J80 A;  4R23 A;  3MF0 A;  1K55 A;  4UEY A;  4QY5 A;  2YKH A;  5HW3 A;  4QB8 A;  3B33 A;  4ESP A;  4EET B;  1UGU A;  1GA9 A;  4GHI B;  4MN5 A;  5L09 A;  4JLF A;  4JBF A;  1JTG A;  3G2Y A;  4EW7 A;  1L0F A;  1S1Y A;  1RP5 A;  5AQA A;  3DW0 A;  4MDZ A;  1YLP A;  4OH0 A;  2IA2 A;  4ID4 A;  3B42 A;  1LSW A;  5EEC A;  3QP2 A;  3G30 A;  1SKF A;  3C2W A;  5GHY A;  1QME A;  2Y2J A;  3T12 B;  4RX2 A;  4NKP A;  3MSH A;  1H5X A;  2OAQ 1;  1CI9 A;  1KGF A;  2WGW B;  1AXB A;  2GNX A;  4Y7P A;  1XJ3 A;  4R4S A;  4YFM A;  3ZVT A;  3VSL A;  5DKK A;  3LIF A;  1YSP A;  4QY6 A;  2O9B A;  3E98 A;  3UPP A;  2BTF P;  3C7V A;  3LGO A;  4U3T A;  2EXA A;  4U0X A;  1PRQ A;  3F1O A;  4S2I A;  1F5M A;  2W1R A;  4LCL A;  3IXG A;  2ZQ7 A;  1LI9 A;  4JF5 A;  3FWL A;  2RL3 A;  4FH2 A;  1BSG A;  1NJ4 A;  1TS6 A;  4M3K A;  3SOI A;  3CPT A;  2V8C A;  4KQR A;  2O0Y A;  4G3K A;  4K0X A;  3HUO A;  4ZBE A;  3BLM A;  1W5D A;  4HH3 A;  3EGX C;  5L07 A;  2OLU A;  2L4R A;  3O87 A;  5AVE A;  4HES A;  2P08 A;  3HLW A;  2J3W A;  2VA0 A;  3QP4 A;  1CJF A;  2ZBB A;  3ISG A;  2J9O A;  2Z2L B;  1ES5 A;  1PYY A;  5DKL A;  4OQI A;  3UE6 A;  1IOU A;  3VV4 A;  3T4J A;  4HOI A;  3P01 A;  1YLY A;  5TBM A;  4GDB A;  2EA9 A;  5HWT A;  5KIZ A;  1S4R A;  2X71 A;  2E8J A;  3CG5 A;  5GL9 A;  3DTI A;  5GLC A;  5DTS A;  2OLV A;  1GSV A;  5CTM A;  3BY8 A;  3IQA A;  1D7E A;  3VE3 A;  1LI0 A;  1PNE A;  4NET A;  1SHV A;  5GHX A;  2HP6 A;  1JWV A;  2PYP A;  2L1M A;  5AQ9 A;  4DKI A;  2V9A A;  3BFC A;  3MQO A;  3BM6 A;  4X1L A;  2JKR I;  2WKP A;  1FR1 A;  2ZL1 A;  2W3G A;  1U60 A;  2EX6 A;  2XD1 A;  3MS6 A;  3FC7 A;  3BFF A;  2VV7 A;  3S7Q A;  3WS4 A;  3SZT A;  4QWO A;  2OSU A;  3UB8 A;  3MXQ A;  5F5Y A;  2DRW A;  4KZ7 A;  4H8R A;  4JXW A;  5HAQ A;  1E25 A;  3OCN A;  1ESI A;  4WUJ A;  3VE4 A;  2PBD P;  2WYX A;  4OOY A;  3WS2 A;  3RTY A;  5DF8 A;  1WA9 A;  2V1B A;  5A8B A;  4LV2 A;  3KYZ A;  3ZNY A;  3N8R A;  2PYR A;  1F2K A;  3NUL A;  4EQ1 A;  2V2F F;  4C3Q A;  5U47 A;  5F69 A;  3LR4 A;  3C7U A;  1YLT A;  4E3I A;  4BL2 A;  3ZG7 B;  3IHB A;  3VSK A;  3UB6 A;  1GSX A;  5CEC A;  1P0Z A;  1VET A;  5FQQ A;  3EOI A;  3NOT C;  3Q7V B;  1BLS A;  2XFT A;  3T4Q A;  5CGS A;  1GCE A;  4X68 A;  3CAX A;  4DF6 A;  1KE4 A;  3G32 A;  4EEP A;  3WRT A;  2HDQ A;  4IJG A;  1DJB A;  4WEK A;  4EER A;  3MZF A;  3VOZ A;  3VP1 A;  5K5B A;  1WYC A;  3PAG A;  1MPL A;  3M6H A;  5HFO A;  2A24 A;  3UDF A;  5CRF A;  3W2Z A;  3LIC A;  3MBZ A;  3T4S A;  3MFD A;  2HP5 A;  4WYY A;  1CQA A;  5E43 A;  1GHM A;  2WAF A;  2XR0 A;  3LIE A;  2XK1 A;  2JC7 A;  3UDI A;  3T50 A;  3LI8 A;  1IYQ A;  2Y2O A;  4HJ4 A;  3NHQ A;  5FQK A;  3T4K A;  2EX2 A;  1T18 A;  2OWH A;  1Y4O A;  4KZ4 A;  5GLD A;  4CLC D;  4DE3 A;  1K56 D;  1OT6 A;  4WEJ A;  4WN5 A;  3IXD A;  4D2O A;  4KG2 A;  4MNR A;  1H8Z A;  1N9B A;  3BEB A;  4ARZ A;  2XEP A;  4UQI S;  2ZOH A;  4X1M A;  2V0W A;  5D3O A;  4M4X A;  1ERM A;  1MWT A;  2FFF B;  3DTK A;  4GNU A;  4BWI A;  4JF6 A;  1BT5 A;  2WZZ A;  3G31 A;  3IX4 A;  4Y15 A;  1DP6 A;  3F1O B;  2YKF A;  5DVA A;  3CIT A;  4B4Z A;  3RJU A;  3QP8 A;  5EV0 A;  1TVF A;  1BTL A;  4WMC D;  3MZD A;  1NLZ A;  3N6I A;  4X53 A;  3BJN A;  3D9Y A;  4L9F A;  3VMA A;  5CED A;  3GQZ A;  2V8F A;  1JWP A;  2WK0 A;  3CJM A;  3VP3 A;  3BWL A;  3JVU A;  4P87 A;  3EQU A;  1STZ A;  5E2E A;  5EOO A;  1WYB A;  2QKP A;  4S2J A;  2H5S A;  1DP9 A;  5HD3 A;  4QPR A;  1J3W A;  5DFY A;  4BD0 A;  5CX7 A;  2WKH A;  2WGW A;  5CGW A;  2GZA A;  5L8M A;  3UN7 A;  1BUL A;  5TBM B;  3PBO A;  4GD8 A;  3KYE A;  2W3F A;  3E2K A;  2JCH A;  2FFY A;  2ZM0 A;  1KE0 A;  1VHM A;  3N4I A;  1LSV A;  3OLO A;  4HI4 A;  2A3U A;  4S2O A;  3UY6 A;  4C6Y A;  1OTE A;  4KQD A;  4LPZ A;  2WKI A;  2NUT C;  2J3T C;  3DTM A;  3T4T A;  2OOL A;  3HRE A;  5EVE A;  5CHJ A;  3K2N A;  4OQG A;  2ZL1 B;  3A0S A;  3K3C A;  1HLU P;  3MQ0 A;  3S1Y A;  2QYB A;  1GHI A;  3TRC A;  1OPX A;  3LI9 A;  2VV6 A;  1KOU A;  4F3L A;  4PM7 A;  5IS1 A;  1PI5 A;  1K25 A;  4WZ4 A;  2XF3 A;  4Y13 A;  3T1X A;  1LL5 A;  1LLB A;  5M1A A;  3BQA A;  4PM5 A;  3ULF A;  4ETZ A;  4Y0U A;  3LID A;  5HSQ A;  5GLA A;  2VX8 A;  5HDC A;  2NUP C;  2EWV A;  5AJG A;  5HWV A;  4DXC A;  3ZNT A;  4KUO A;  3L9K A;  4X55 A;  2X02 A;  3UE1 A;  5CXW A;  3MKE A;  5GLB A;  1VET B;  3WS1 A;  4S2P A;  4DJ2 A;  2CMN A;  1LL9 A;  5KSH A;  5HPI A;  1DRM A;  2Y59 A;  2ZJ9 A;  4LGW A;  4GN2 A;  2ZC5 B;  3LFV A;  1S4S A;  5EVI D;  3DWZ A;  1ERQ A;  1ACF A;  3ITA A;  4JGO A;  1FQG A;  4R3A A;  4BBU A;  3IWO A;  2HPB A;  2Y79 A;  3OC2 A;  2PU2 A;  3IXH A;  3S22 A;  1A0K A;  4LRY C;  1IFQ A;  4PM9 A;  2DNS A;  2XLN A;  2A24 B;  1TEM A;  1XPB A;  4GDN A;  5TJJ A;  3UB7 A;  4E04 A;  2B95 A;  3V39 A;  2LB9 A;  3FPW A;  1XX2 A;  1E3U D;  3IBJ A;  2GDN A;  3C38 A;  4GB7 A;  3BRM A;  4MN6 A;  4Y2F A;  1NZO A;  4K91 A;  3A3J A;  4IUH A;  2H0T A;  4DMZ A;  2HJ9 C;  1MC0 A;  4KZ5 A;  3RFB A;  1H3Q A;  4GLQ A;  4Z1W A;  2M7V A;  3E2L A;  2G2U A;  3LYX A;  1ALQ A;  3S4X A;  3UDX A;  5I5L A;  2EX8 A;  3VOL A;  3Q7V A;  4Z9Q A;  3H9W A;  2OV5 A;  4NG2 A;  4ARZ B;  4UA7 A;  4LFU A;  1Y54 A;  4I38 A;  5FAQ A;  1IYS A;  3V3R A;  1HTZ A;  2KX6 A;  3RXW A;  1J9M A;  1S1Z A;  4OPR A;  4HJ3 A;  4GD6 A;  1Z09 A;  3NC8 A;  1SCW A;  3P98 A;  1L2S A;  2Q9M A;  2XSS A;  4O0P A;  5F1G A;  4LLO B;  1YPR A;  5FI2 A;  3A0V A;  3LR3 A;  1D06 A;  1RGY A;  2K7S A;  4II7 A;  4E6X A;  4S2L A;  1KE3 A;  5TFQ A;  5G4Y A;  4BD1 A;  5F83 A;  4EXO A;  3EWK A;  1FR6 A;  2W27 A;  4KZ6 A;  3GV9 A;  4G3W A;  3HVF A;  2Q0O A;  2J9P A;  1EI5 A;  4G3V A;  1ERO A;  1TF1 A;  2P74 A;  2DCF A;  2B5R A;  4BJP A;  2W0N A;  5HAR A;  2IWB A;  1MWU A;  5FL3 A;  3LCE A;  4WBG A;  2P04 A;  1GA0 A;  1CEG A;  4R3J A;  4DN0 A;  4PM8 A;  4CQH A;  4R1G A;  4MEZ A;  2H28 A;  4EBL A;  1PFL A;  1PW8 A;  4X69 A;  3M2K A;  4KQO A;  3SS3 A;  1H8Y A;  1E3U A;  3IT9 A;  3UNW A;  3T1S A;  1IEM A;  5HD5 A;  4EES A;  4KUK A;  3BQ8 A;  5FDH A;  1PZP A;  4EU0 A;  3H82 A;  2Z2M B;  4LEN A;  3UB5 P;  3S7P A;  4EUZ A;  3FKW A;  1ES2 A;  1JVJ A;  4JGR A;  2M7U A;  3FV7 A;  1NRF A;  1L0G A;  1V9Z A;  3ZVW A;  1IKI A;  2VZW A;  3G4P A;  4F3L B;  4PPR A;  3WWX A;  1V9Y A;  3T1Q B;  4HP4 A;  5L2F A;  4KZ9 A;  2Y2L A;  4N9K A;  1OTB A;  5EOE A;  2ZMV A;  3HJI A;  4ZJ1 A;  2Y2I A;  3BYD A;  2K31 A;  4FD8 A;  5EE8 A;  1XXM A;  4MN7 A;  1T1C A;  3PTE A;  4GKU A;  3MFX A;  1K54 C;  1T19 A;  2HZ5 A;  1K6S A;  2HDU A;  4E3M A;  1XA1 A;  2Q9N A;  5DFX A;  2XDM A;  2R9W A;  3NOU C;  3ICY A;  1FOF A;  4O7D A;  4RYE A;  4GW9 A;  1M6K A;  4PKY A;  4E3O A;  2VKS A;  5A90 A;  3IH8 A;  1TDL A;  2Y2N A;  4WZ5 C;  2VGK A;  1FIL A;  3OPL A;  1XGI A;  1XP4 A;  4X6T A;  3WS0 A;  5J8X A;  2AVX A;  2JKG A;  3OPR A;  5FAO A;  1UWN X;  5DJU A;  4CLC C;  3Q07 A;  2ZC3 B;  4KZA A;  3TSG A;  3HLB A;  2W3D A;  4HJ6 A;  4KG6 A;  2PR5 A;  1F9I A;  3LUQ A;  1NWZ A;  2X01 A;  1NYY A;  3JVV A;  3KSH A;  4MLL A;  3GTC A;  4UA9 A;  2VEA A;  3T4L A;  3HLF A;  1L0E A;  3P7N A;  1XJ2 A;  5KSC A;  4BEN A;  5FI6 A;  3UB9 A;  4OPY A;  3HLE A;  1N4O A;  2Z6D A;  1L3L A;  4E3L A;  3IF6 C;  2V1A A;  4A5R A;  2B18 A;  3PAE A;  2ZOI A;  2WUQ A;  4Y0O A;  1P97 A;  4MMN A;  1K57 C;  2W3E A;  4R38 A;  3AGE A;  5HX9 A;  3Q82 A;  4PMA A;  2PD8 A;  1HD8 A;  2KLI A;  4P0M A;  2P9V A;  2ZM8 A;  1H0M A;  3O88 A;  3C8C A;  4YOF A;  1BYW A;  1NYM A;  1PWC A;  2QJ5 A;  1G6O A;  1JWZ A;  1NLY A;  1ZTU A;  5A93 A;  1Y28 A;  4ZJ3 A;  1FCN A;  5FSR A;  2RCX A;  4B4X A;  3N7W A;  1W7F A;  1PZO A;  3NOP C;  4IBX A;  4O8G A;  5J3W A;  4Y5F A;  2LB5 A;  1PWD A;  3IWQ A;  3PBR A;  1UWP X;  4ME4 A;  4Q0H A;  1ESU A;  1PWG A;  2WKR A;  1PW1 A;  2V1Z A;  3HBR A;  5IU1 A;  5I94 A;  1NY0 A;  4BBT A;  4QD4 A;  4WL9 A;  3LY4 A;  3W4O A;  5EM1 A;  3OPP A;  2R78 A;  1KGE A;  2O9A A;  2HDS A;  2A2L A;  1W63 M;  3M2J A;  3VOY A;  2ZC6 B;  3A0R A;  1OJ5 A;  5IT5 A;  3H82 B;  3V3S A;  4EV4 A;  2UWX A;  1IYP A;  5IHV A;  1OT9 A;  3DAV A;  1H8M A;  1YM1 A;  4XUX A;  2Y8H A;  1K4E A;  5FAS A;  2P7J A;  2WGV A;  5GHZ A;  3LIB A;  5DTT A;  1OTI A;  1IKG A;  4LV0 A;  3VP0 A;  3WRZ A;  3Q1F A;  3MZE A;  3ZYT A;  4GJ4 A;  1XA7 A;  5EPH A;  4MBK A;  5HL6 A;  3VFH A;  1K54 A;  1TD5 A;  3OZH A;  4MBH A;  3MMH A;  4KZ3 A;  4OKP A;  4X56 A;  5C5K A;  1QMF A;  1BZA A;  4GS9 A;  2HV1 A;  2PRF A;  5HPF A;  5AVF A;  1I5Q A;  4GZB A;  3ZFZ A;  1GSW A;  4JPM A;  5F1F A;  3M6B A;  5CEB A;  2QPN A;  5EVI C;  1VM1 A;  4B93 A;  3HUM A;  4CPK A;  4OP8 A;  3ZG8 B;  3IF5 A;  2ZM2 A;  4WZ5 A;  1DP8 A;  3LEZ A;  4QHC A;  5E2F A;  3I7J A;  3SH7 A;  1NXY A;  1FIK A;  2J8Y A;  4FCF A;  4FSF A;  3FYZ A;  1M40 A;  5FEG A;  2O9C A;  2PU4 A;  5AQ7 A;  4OOL A;  2K2N A;  4MCW A;  3OBF A;  3CUE C;  4LV3 A;  4CLC A;  4OPZ A;  3EEA A;  1K56 A;  3LR0 A;  1KGG A;  2XRO A;  2ZQD A;  4K08 A;  3R7W A;  1LT0 A;  4OP5 A;  1CK3 A;  2CC1 A;  1T1B A;  3N8L A;  2G7U A;  3TJZ C;  1HVB A;  4OVD A;  3MQQ A;  3B3X A;  4Y0T A;  4KG5 A;  4BL3 A;  1L0D A;  4PHT A;  4OON A;  3W4Q A;  4NEE D;  1ES3 A;  3IF6 A;  4CJN A;  3HJK A;  4BQM A;  1VQQ A;  4WMC A;  3FKV A;  3UE3 A;  3V5M A;  3W8K A;  4X25 A;  3JYI A;  1S0W A;  2IWC A;  5FEF A;  2FH5 A;  1YT4 A;  1IYO A;  1K57 A;  3Q7Z A;  1XFN A;  5EFW A;  3FPV A;  3IH9 A;  4OQH A;  4GCZ A;  2PDR A;  3TG9 A;  1NRJ A;  3CZD A;  1KDW A;  2GX5 A;  3UO9 A;  5G18 A;  1RCJ A;  1TS0 A;  4DE0 A;  3DWK A;  4MBF A;  2P9V B;  2WZX A;  4OPQ A;  1ONH A;  3PXP A;  1N9N A;  3D4F A;  3O5Y A;  4XT2 A;  4LRZ E;  4NXB A;  4HP9 A;  4DJ3 A;  1ODV A;  3NBL A;  3TE8 A;  4H6J B;  2VV8 A;  3PHY A;  3IS2 A;  3DTE A;  3GMW A;  3QHY A;  2EFU A;  3LIA A;  4Q8I A;  1ZC2 A;  4XUZ A;  5FQJ A;  4R3B A;  3IX3 A;  3D3O A;  3GEC A;  1PI4 A;  3RXX A;  4I3I A;  4YIN A;  1TDG A;  4OOM A;  1KVL A;  2Y2Q A;  2ZLY A;  3AGD A;  3G34 A;  2XD5 A;  3OCL A;  2E8I A;  4I5S A;  3RH8 B;  4HH2 A;  3NI9 A;  3LEQ A;  4RA7 A;  4N92 A;  3BEC A;  5A92 A;  1G28 A;  2D02 A;  2VK3 A;  4GOG A;  3KSF A;  1P9R A;  4HEF A;  1K6R A;  5EM0 A;  5CHU A;  4QJG A;  4P85 A;  3HLD A;  1TS8 A;  2EFX A;  1XJ4 A;  5TGF A;  2W1T A;  3ZDJ A;  3S7N A;  1EW0 A;  4JF4 A;  3QP1 A;  1YSQ A;  1MKM A;  4JGP A;  3UE0 A;  2ZMF A;  3GVB A;  3SS5 A;  2EX9 A;  4E3K A;  4R6L A;  3IHA A;  3O86 A;  5E2G A;  4S2K A;  2JKT M;  3SS4 A;  3CWF A;  5KMW A;  5EVI A;  1NZU A;  5EVL A;  3NIA A;  4L9G A;  4E6W A;  4PM6 A;  3F1N A;  2KOI A;  5HAI A;  4HY8 A;  3UME A;  4GS9 B;  3OPH A;  4Q0I A;  1F98 A;  1HZO A;  4DRT A;  1I2S A;  4O01 A;  3A3E A;  3FG8 A;  3NJA A;  2XGN A;  1W63 Q;  5FAP A;  3CUE A;  5L10 A;  1Z6F A;  4ZAM A;  4EEU A;  3SW1 A;  3PBQ A;  4DDS A;  3B47 A;  4NXF A;  5EUA A;  2V0U A;  3CLO A;  1ZG6 A;  5BOH A; 
#chains in the Genus database with same CATH homology
 4WF0 A;  2JKR M;  4AFI A;  2XRN A;  1TS7 A;  3EQU A;  1STZ A;  1P9W A;  2QKP A;  3UB9 A;  2Z6D A;  2HJE A;  1YAX A;  1DP9 A;  3LR5 A;  5HD3 A;  2V1A A;  4CLC E;  2B18 A;  4QPR A;  4CLC B;  3EEH A;  3PBT A;  2ZOI A;  5DFY A;  5CX7 A;  2J3T D;  1P97 A;  3BW6 A;  2O99 A;  2DMW A;  4MMN A;  2GZA A;  4L9E A;  5L8M A;  5TBM B;  3PBO A;  3KYQ A;  3R7W B;  2W3E A;  3EQV A;  4R38 A;  2W3F A;  4I3A A;  3U2A A;  3E4O A;  2PD8 A;  4WEL A;  2KLI A;  1VB6 A;  3EGD C;  5HDD A;  1XFQ A;  2BAS A;  3HCY A;  3C8C A;  1VHM A;  3V67 A;  4YOF A;  1BYW A;  4PAU A;  2QJ5 A;  5HDS A;  1LSV A;  5DJT A;  1G6O A;  3OLO A;  4HI4 A;  3H7W B;  1NLY A;  1ZTU A;  2B02 A;  2VLG A;  4Y3I A;  4YWZ A;  4JGQ A;  1OTE A;  1Y28 A;  4KQD A;  4LPZ A;  3K3D A;  5F68 A;  3G6O A;  2NUT C;  2J3T C;  3T4T A;  2OOL A;  2I9V A;  4WLA A;  3K2N A;  2HF6 A;  3NOP C;  4O8G A;  5J3W A;  4Y5F A;  2QHK A;  3A0S A;  3K3C A;  2Z6C A;  3MQ0 A;  2QYB A;  2LB5 A;  3TRC A;  1OPX A;  3PBR A;  3LI9 A;  2J80 A;  2VV6 A;  1KOU A;  3MF0 A;  4UEY A;  1UWP X;  4ME4 A;  4F3L A;  4Q0H A;  2JN7 A;  5IS1 A;  2WKR A;  4I39 A;  2YKH A;  5IU1 A;  4YNR A;  2KDK A;  1S67 L;  3E4Q A;  4BBT A;  3B33 A;  4EET B;  3DBA A;  1UGU A;  5HZH A;  3BQA A;  3ULF A;  4WL9 A;  4ETZ A;  4GHI B;  4L0L A;  4MN5 A;  3LID A;  2EWW A;  4EW7 A;  2R78 A;  5HSQ A;  1S1Y A;  2VX8 A;  5J4E A;  2JHE A;  2O9A A;  4MDZ A;  5HDC A;  2NUP C;  2IA2 A;  2EWV A;  4XT2 B;  5AJG A;  2A2L A;  5HWV A;  3CI6 A;  4IHQ A;  1W63 M;  4P6Z M;  3B42 A;  1LSW A;  3A0R A;  1OJ5 A;  3C2W A;  5IT5 A;  4KUO A;  3H82 B;  1OT9 A;  3IS2 B;  1H8M A;  2L0W A;  4NKP A;  4DJ2 A;  2OAQ 1;  2Y8H A;  2CMN A;  2P7J A;  3LIB A;  2GNX A;  5KSH A;  5HPI A;  1DRM A;  1XJ3 A;  1OTI A;  5DKK A;  1YKD A;  3LFV A;  3ZYT A;  1S4S A;  3KO6 A;  3LIF A;  4GJ4 A;  4JGO A;  1YSP A;  4R3A A;  3S7O A;  4BBU A;  2O9B A;  5HL6 A;  3OC2 A;  2Y79 A;  1TD5 A;  3E98 A;  4LRY C;  3MMH A;  1IFQ A;  1X0O A;  5C5K A;  4GS9 A;  1OTD A;  2A24 B;  3F1O A;  1F5M A;  3D72 A;  2W1R A;  4E04 A;  2HV1 A;  5TJJ A;  3UB7 A;  5HPF A;  5AVF A;  3F1P A;  2LB9 A;  3C30 A;  3FPW A;  1TS6 A;  4Q0J A;  1GSW A;  3IBJ A;  3UMD A;  4P6Z S;  3C38 A;  1ZHH B;  4MN6 A;  4Y2F A;  4B93 A;  3ZQ5 A;  4IUH A;  2O0Y A;  4G3K A;  2INW A;  4DMZ A;  2W1T B;  2HJ9 C;  4I3J A;  1MC0 A;  3RFB A;  4HH3 A;  3EGX C;  1H3Q A;  1DP8 A;  4GLQ A;  4Z1W A;  4HIA A;  2L4R A;  4NXE A;  2M7V A;  5AVE A;  2P08 A;  4LRX C;  4UQI M;  4FSF A;  2J3W A;  2VA0 A;  4H6J A;  3LYX A;  2O9C A;  3KSG A;  2K2N A;  2PT7 A;  4OOL A;  2ZBB A;  4MCW A;  3OBF A;  3CUE C;  3PYP A;  5I5L A;  4NXG A;  4HHD A;  4CLC A;  3VOL A;  2JKT I;  3KSI A;  5DKL A;  3EEA A;  3UE6 A;  3H9W A;  3LR0 A;  4ARZ B;  1IOU A;  3VV4 A;  3T4J A;  4HOI A;  4I38 A;  2XRO A;  3P01 A;  4K08 A;  5TBM A;  3R7W A;  2EA9 A;  1LT0 A;  2KX6 A;  5HWT A;  4PKY G;  5KIZ A;  1S4R A;  1S1Z A;  1T1B A;  4ZRR A;  4HJ3 A;  3MR0 A;  3F1N B;  2G7U A;  3TJZ C;  1OJG A;  3OOV A;  3TW8 A;  3MQQ A;  2W3H A;  2XSS A;  4O0P A;  4LLO B;  1GSV A;  3A0V A;  3LR3 A;  3H7W A;  3BY8 A;  4PHT A;  1D7E A;  1D06 A;  4HQA A;  3VE3 A;  2K7S A;  4II7 A;  4NEE D;  5HWW A;  4IUK A;  3HJK A;  2PYP A;  2L1M A;  1N9L A;  4B9O A;  2V9A A;  3UE3 A;  5G4Y A;  3MQO A;  4EXO A;  3EWK A;  2W27 A;  3PBS A;  2JKR I;  2FH5 A;  2WKP A;  4G3W A;  2W3G A;  4BMW A;  1XFN A;  3FC7 A;  5MC7 A;  5EFW A;  2VV7 A;  4G3V A;  1TF1 A;  3FPV A;  3S7Q A;  2XA7 M;  4BJP A;  2W0N A;  3UB8 A;  5FL3 A;  4GCZ A;  2PDR A;  3MXQ A;  1JNU A;  5F5Y A;  2P04 A;  1NRJ A;  3OCN A;  4WUJ A;  3VE4 A;  2GX5 A;  4DN0 A;  3RTY A;  1WA9 A;  2V1B A;  4CQH A;  5A8B A;  1TS0 A;  3KYZ A;  2H28 A;  4GHI A;  2VGL M;  1LSX A;  3PXP A;  2PYR A;  1N9N A;  4EQ1 A;  1N9O A;  3O5Y A;  2WKQ A;  4KQO A;  4XT2 A;  4LRZ E;  3LR4 A;  4NXB A;  4HP9 A;  5F69 A;  4DJ3 A;  1ODV A;  2QWS A;  5HD5 A;  2D01 A;  4EES A;  4KUK A;  3BQ8 A;  3TE8 A;  4FOF A;  2PD7 A;  4EU0 A;  3H82 A;  3KX0 X;  4H6J B;  2VV8 A;  3S7P A;  2M1C A;  3PHY A;  3UB6 A;  3IS2 A;  1GSX A;  4JGR A;  1P0Z A;  2M7U A;  3BY9 A;  1V9Z A;  3EOI A;  3NOT C;  5F6A A;  3T4Q A;  1MZU A;  1XJ6 A;  3CAX A;  3IBR A;  3LIA A;  2VZW A;  4EEP A;  4R70 A;  2XA7 S;  4F3L B;  2HGV A;  4IJG A;  3D3O A;  3GEC A;  1V9Y A;  4HP4 A;  4WEK A;  4I3I A;  4EER A;  2GJ3 A;  4OOM A;  1S66 L;  5K5B A;  1OTB A;  3OCL A;  4I5S A;  2ZMV A;  3HJI A;  3RH8 B;  2VGL S;  4HH2 A;  2A24 A;  2K31 A;  4MN7 A;  3W2Z A;  3LIC A;  1G28 A;  2D02 A;  1T1C A;  4EUV A;  2QJ7 A;  1OTA A;  3T4S A;  3KSF A;  3MFX A;  2PR6 A;  1P9R A;  4BBV A;  5G4Z A;  2MJ6 A;  1T19 A;  1TS8 A;  3LIE A;  3MJQ A;  1XJ4 A;  3T50 A;  2W1T A;  3LI8 A;  3S7N A;  1EW0 A;  4HJ4 A;  3PBN A;  3NHQ A;  5DFX A;  5DF9 A;  3T4K A;  1YSQ A;  1MKM A;  4JGP A;  2ZMF A;  1T18 A;  2OWH A;  4CLC D;  4ETX A;  3NOU C;  2VJW A;  3ICY A;  5LBR A;  1OT6 A;  4WEJ A;  3GDI A;  4WN5 A;  4R6L A;  4GW9 A;  4PKY A;  2VKS A;  1LL8 A;  3R4K A;  4ARZ A;  4UQI S;  2JKT M;  2FZ0 A;  2ZOH A;  3CWF A;  5J7E A;  2V0W A;  4M4X A;  4RQ9 A;  4L9G A;  4BWI A;  3E4P A;  2OAP 1;  3F1N A;  3T4O A;  2KOI A;  4HY8 A;  3UME A;  4GS9 B;  1UWN X;  1DP6 A;  3F1O B;  2YKF A;  3CIT A;  2OWJ A;  5DJU A;  4HNB A;  4Q0I A;  3E0Y A;  4CLC C;  1F98 A;  3F1P B;  4O01 A;  2W3D A;  4HJ6 A;  2PHY A;  2PR5 A;  3FG8 A;  3NJA A;  1F9I A;  3LUQ A;  1NLZ A;  1W63 Q;  1NWZ A;  3PR6 A;  3BJN A;  3CUE A;  4L9F A;  3JVV A;  3KSH A;  4EEU A;  3SW1 A;  1T1A A;  3PBQ A;  2VEA A;  3B47 A;  3T4L A;  4NXF A;  2V0U A;  3CLO A;  3BWL A;  3JVU A;  3P7N A;  1XJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...