3IS2A

2.3 angstrom crystal structure of a cys71 sulfenic acid form of vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
publication title Illuminating solution responses of a LOV domain protein with photocoupled small-angle X-ray scattering.
pubmed doi rcsb
source organism Neurospora crassa
total genus 34
structure length 149
sequence length 150
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3is2A00
2INWA 1TS8A 3BY8A 3MXQA 3FG8A 1OTBA 3GDIA 3E4PA 4NXFA 2D02A 1Y28A 4L9EA 2YKHA 4E04A 4BBTA 4I39A 3F1NB 1JNUA 4LRYC 2PR5A 4PKYA 3H7WA 3ULFA 3VOLA 3F1PB 4M4XA 2OWJA 2K7SA 2Z6DA 4EXOA 4LPZA 5DJUA 1N9OA 3BWLA 4GW9A 2QJ7A 5IS1A 3IS2A 4NXBA 5J3WA 1S67L 2PR6A 5F69A 5HWTA 3LIBA 4GHIB 2YKFA 1F9IA 2WKRA 4DJ2A 1XJ6A 3EWKA 1OTIA 4RQ9A 1OTDA 2L4RA 4GCZA 1T1BA 3OLOA 3LIEA 1OT9A 1XFQA 4B9OA 4L9FA 2PDRA 2M1CA 3MFXA 1OTEA 1TS0A 4GS9B 1T1AA 1S66L 3PYPA 4GS9A 2HV1A 5TBMA 3CAXA 3PHYA 4HJ6A 2V0UA 1VB6A 3LICA 1TS6A 3A0VA 2KX6A 3C8CA 4EEUA 4K08A 2W0NA 4JGPA 3IBRA 2VV8A 4WN5A 5HD3A 4HI4A 1P0ZA 3EEHA 5IU1A 1BYWA 3LYXA 3MJQA 3K3DA 4HH3A 5DJTA 3ICYA 4HJ4A 5HWWA 4HJ3A 4JGRA 5DKLA 3LI8A 2PHYA 4HH2A 5HD5A 2I9VA 4R38A 3E4OA 3ZQ5A 3UMDA 1S4SA 3H7WB 1EW0A 4NXEA 5F68A 1F98A 2WKQA 4HY8A 5HDDA 4I3IA 3LIFA 2L1MA 3IS2B 3KX0X 4LRXC 1T19A 3T50A 4I5SA 2H28A 3UB9A 1V9YA 4H6JB 5G4ZA 4DJ3A 4EQ1A 3A0SA 4HP4A 1G28A 1NWZA 4H6JA 3C2WA 1LSXA 4WLAA 2P7JA 3B33A 3CLOA 4HQAA 5HDSA 2PYPA 1T1CA 5J4EA 3CWFA 1XFNA 4I3JA 4YWZA 1UGUA 3RH8B 5HDCA 4MN5A 4HOIA 3MQQA 4JGOA 1OJGA 2VV6A 4I38A 5TBMB 1XJ2A 5I5LA 4EW7A 5F6AA 1S1ZA 2J80A 1LT0A 1KOUA 4EERA 1GSXA 3VE3A 1XJ3A 5HZHA 5A8BA 4LRZE 4KUKA 4XT2B 4KQDA 2V9AA 2QJ5A 2A24B 4JGQA 3LUQA 3MQOA 4LLOB 4XT2A 2A24A 3NJAA 1OTAA 1T18A 1D7EA 2QWSA 1DRMA 3GECA 3H9WA 1ODVA 3UE6A 3F1OA 2EA9A 2QKPA 3D72A 5KIZA 1LSWA 2ZOIA 4MN6A 2KDKA 3K3CA 1DP9A 3RTYA 3LIAA 2V0WA 3FC7A 2JN7A 3G6OA 4BBUA 2PD7A 1DP6A 2W27A 4F3LA 1S1YA 3LI9A 5AVFA 4EEPA 5J7EA 2ZOHA 2QHKA 3UB8A 3E4QA 2PD8A 2BASA 1XJ4A 3NOUC 1LL8A 1V9ZA 1TS7A 4WL9A 2B02A 4HP9A 1UWPX 3F1NA 2CMNA 4KUOA 3SW1A 4L9GA 2GJ3A 3UMEA 1N9NA 2L0WA 2WKPA 4BBVA 3NOPC 3F1PA 3NOTC 3UB6A 5EFWA 1N9LA 2JHEA 3HJIA 3MR0A 4R70A 3LIDA 2OWHA 2V1AA 2V1BA 2VEAA 1OT6A 4GHIA 2PYRA 1P97A 2R78A 1OJ5A 4I3AA 4R6LA 2Z6CA 4HHDA 4EESA 1MZUA 2D01A 3P7NA 4WF0A 3NHQA 1S4RA 1D06A 1UWNX 1WA9A 2OOLA 3H82B 5G4YA 5HWVA 3F1OB 3H82A 4PKYG 3UB7A 4HIAA 1LSVA 4R3AA 3A0RA 1GSWA 1X0OA 3HJKA 5AVEA 3VE4A 2VV7A 4EETB 1GSVA 4WUJA 2VLGA 1DP8A 4NXGA 3BY9A 4F3LB 5DKKA 5HSQA 2ZBBA 4HNBA 5F5YA
chains in the Genus database with same CATH superfamily
4X55A 1NZOA 1G6OA 1LL5A 3WRZA 3BQAA 3FG8A 4GOGA 3GDIA 4X68A 4RYEA 3HLFA 1E3UA 2GNXA 4NETA 2VGJA 4P6ZS 2EWVA 4L9EA 4E6WA 4ARZA 4FOFA 4E04A 1EWZA 2EWWA 4LV0A 5EM0A 4RVAA 4LRYC 2PR5A 4PKYA 1GHIA 3ULFA 4LCLA 4P0MA 3OC2A 2EX2A 3ZHHA 5FDSA 2K7SA 1IELA 3G2ZA 4KZ9A 4ETXA 2Y59A 3FV7A 3HVFA 5A93A 3Q7VB 4S2KA 1S67L 1W5DA 3LIBA 4GHIB 4XXRA 2VX8A 2YKFA 3EWKA 4BLMA 5AQBA 2ZQ9A 1T1BA 2ZLYA 1OT9A 5TR7A 4B9OA 2ZQDA 3K2NA 1GA0A 2G7UA 4E3KA 2ZC3B 2HJEA 1TS0A 1ZG4A 3NDEA 1T1AA 5DTKA 1IKGA 3CAXA 3AGFA 3V50A 2M7VA 3PHYA 1IYOA 4X6TA 1YQSA 2NUPC 1VB6A 1CEFA 4GJ4A 5FATA 4X25A 1SZVA 4G3KA 2LB9A 4GN2A 1HTZA 3PBOA 5DFYA 4ZJ3A 5IU1A 3LYXA 3MJQA 5FAQA 2JKRM 4E6XA 3WS0A 4XUZA 3VSKA 5HX9A 3LR4A 4Y17A 4YNRA 3JVUA 4DE2A 3IQAA 5HWWA 2VGLM 1VEUA 1PFLA 4E3NA 4OPRA 3S7QA 1BLCA 1CK3A 2PHYA 2ZMVA 1I5QA 4N1XA 4NG2A 3E4OA 1XA1A 4U0TA 3UMDA 1S4SA 1N9BA 4NXEA 1YKDA 4GD8A 2XEPA 2WKQA 2Y2LA 4HY8A 3NIAA 1YLZA 3LIFA 2FFFB 3IBJA 3C38A 2J9PA 2J3TC 4EU0A 1OMEA 1T19A 1TD5A 4WZ4A 4I5SA 3IF6C 4FH4A 1V9YA 2JKRI 3HLDA 5CX7A 2Y2NA 4YINA 5M1AA 4WLAA 2P7JA 3B33A 3TE8A 3LEQA 3O3VA 2VK3A 1HVBA 3T1SA 3FPWA 2WUQA 4I3JA 3FYZA 4WBGA 4MNRA 2WAEA 2ZD8A 5HDCA 1K6SA 2HDRA 1MKIA 3MQQA 2VV6A 4I38A 1BZAA 3QNCA 2CC1A 5I5LA 4EW7A 1CI8A 5HARA 5I94A 3VV4A 2XF3A 1O7EA 4EERA 5L09A 5EOEA 1NYYA 3VE3A 4BENA 2K2NA 3OZHA 4X1LA 5DF8A 4LRZE 4Y2FA 2QJ5A 4DE0A 4E3JA 4OONA 2WAFA 4BL3A 3EGDC 1FCOA 4IEDA 1FCMA 1OTAA 1AWIA 1D7EA 4S2MA 4QWOA 3H9WA 1NLYA 3N6IA 3UE6A 1Q2QA 4Q0HA 5E2GA 1VEUB 4JXGA 2EA9A 2QKPA 1K25A 5M19A 3D72A 2ZOIA 1TEMA 1ES5A 5CHUA 3RJUA 3ISGA 4K91A 1ES3A 1NLZA 3FC7A 4JPMA 4BBUA 3IF6B 4EEPA 4S2NC 1ZG6A 3PXPA 1KE3A 2ZOHA 4RX3A 3QP2A 4WMCD 4G3VA 2HDSA 4X53A 5FI6A 1CQAA 2H0YA 5FQ9A 3IX3A 1SDEA 1V9ZA 2W1RA 3CI6A 1Q2PA 1RCJA 5DVAA 3SH9A 4BL2A 4OH0A 4Y3IA 3SW1A 4L9GA 3UMEA 3IX8A 2L0WA 1E3UD 4FCFA 2HP6A 4BBVA 1JWZA 2WKHA 3ITAA 3NOTC 3UB6A 3L9KA 3MSHA 2B95A 2WKEA 3DTIA 4OOYA 4UA7A 3MR0A 5EECA 3BECA 1WE4A 2OWHA 3MZEA 1H8ZA 2ZC5B 4BMWA 1LL9A 1XGJA 4E3LA 2XH9A 2W3FA 3W4OA 2PYRA 1P97A 3TG9A 1GCEA 4N9KA 3GMWA 5IHVA 4Y5FA 3UPPA 2FH5A 1MZUA 4O7DA 5CXWA 4E3IA 1XKZA 1WA9A 5CGWA 2WZZA 4DMZA 3MS6A 4Y13A 4D60A 4HIAA 1YT4A 2Z2LB 4X1MA 2MJ6A 2J3WA 3A0RA 1X0OA 1YMSA 4EETB 5F1FA 3LR0A 3NY4A 3T4LA 1GSVA 2FZ0A 2GZAA 2XQZA 3SOIA 2ZBBA 3OPLA 2JCHA 4LENA 4HNBA 2HJ9C 5F5YA 3UO9A 1TS8A 2VJWA 4GB7A 3MXQA 1PI4A 1OTBA 3E4PA 2AVXA 1GHPA 3BEBA 2G2WA 4MMNA 4EBPA 1DJCA 5DF9A 5FQQA 4I39A 1JNUA 1PNEA 4ZDXA 3HBRA 4X56A 4WYYA 3H7WA 3QP6A 4WEJA 3IF5A 3PR6A 2J3TD 4LPZA 5DJUA 4EUVA 5FQKA 5IS1A 2WGVA 1BUEA 4LFUA 2IWCA 2Y2PA 3W8KA 4O8GA 2Y79A 2PR6A 1YLJA 3BRMA 4IBRA 4DJ2A 1XJ6A 3MZFA 4EV4A 1ONGA 1OTDA 3IX4A 2JBFA 4L9FA 2WK0A 4II7A 5CTMA 3OPHA 2OAQ1 2VKSA 4GS9B 4KZ4A 1NZUA 3TOIA 4QB8A 2HV1A 3IXDA 1XGIA 3NULA 4OVDA 3R7WA 3ZNTA 1N4OA 4OPYA 1I2SA 2Q0OA 4E3OA 5HAIA 2P08A 2W0NA 2XA7M 4GNUA 3DTEA 3IH9A 1NY0A 3OPRA 2VV8A 4HI4A 2Y2KA 1JVJA 3EEHA 4HBUA 4L0LA 5FQJA 3EQUA 3ICYA 2KOIA 2W3GA 4HBTA 1BLHA 5EOOA 3VP3A 4PM9A 3LI8A 3PBRA 3QP4A 1YPRA 3H7WB 3GVBA 2W3DA 4OLGA 5F68A 1J9MA 1MWRA 2L1MA 2JKTI 5FEGA 5L8MA 1YSPA 3T4TA 4LRXC 4IHQA 3T50A 3N7WA 5EE8A 4B4ZA 3O87A 3V3RA 5FQIA 4QD4A 2ZMAA 4C3QA 1MC0A 4H6JB 5G4ZA 3A3EA 4PM6A 3UDIA 4C6YA 4HP4A 1G28A 1F5MA 2OV5A 2G2UA 4QJGA 5A90A 1LSXA 2O0YA 1S6RA 3ZGAB 4Q0JA 3BJNA 2ZM2A 3HUNA 2Y2QA 1T1CA 1SCWA 3C7UA 3CWFA 2HDUA 2HPBA 1H0MA 3AGEA 1TDLA 3RH8B 3OCNA 2O9AA 1E25A 4JGOA 2J9OA 4S2LA 3HLWA 3MZDA 4JF5A 2J80A 5HAPA 5E2FA 3GV9A 3R7WB 4P85A 1MWTA 3KSGA 1QMEA 1IYQA 2ZC4B 4KUKA 4XT2B 1PIOA 4JGQA 4LV1A 2XR0A 4LLOB 3QNBA 5FA7A 3EGXC 3P98A 3VP0A 3GECA 4KZ5A 5DTTA 1C3BA 1YLWA 1K54A 3QP8A 1PI5A 3JPUA 3V67A 3BM6A 4KENB 1DJBA 3B47A 4DXCA 3KYZA 3S1YA 4DDSA 5KIZA 4JXSA 3ZVWA 1P9RA 3Q7ZA 1K54C 3EQVA 2V0WA 2R9WA 1SKOB 2VGLS 1BSGA 4F3LA 3IF6A 1GA9A 1M40A 5CRFA 4PHTA 3UDXA 2EX6A 2QHKA 4RX2A 4ZJ1A 4LV2A 2BASA 5LBRA 5HPIA 3O88A 2M7UA 3Q1FA 4MBKA 1NYMA 3HLCA 1YAXA 4UQIM 2A2LA 3VP4A 1U60A 3CHWP 5U47A 1ACFA 3DAVA 3WS2A 2HP5A 3IWOA 4ID4A 3UPNA 1N9LA 4CLCE 4QHCA 2JHEA 5DTSA 1PRQA 2JKFA 4R3BA 1CI9A 4WEKA 3N8LA 2QYBA 5FQMA 3BQ8A 3UN7A 2ACGA 2PRFA 2R78A 5HFOA 4CLCC 4JBFA 5HW3A 4R6LA 5CGXA 1GHMA 2Z6CA 2ZC6B 5FDHA 4EESA 3BLMA 3IXHA 1YSQA 4Y15A 4GLQA 4KG2A 3P7NA 1YLPA 3BYDA 2ZC7A 3JYIA 3MF0A 3UNWA 1MPLA 3H82B 2WYXA 5G4YA 3T1RA 4KG6A 1L0FA 1JTGA 2PAVP 2C5WB 4PKYG 3UB7A 5EM1A 1JWVA 4R3AA 3ZG9B 3L7HA 5FAOA 4JKTA 1GSWA 2XSSA 2XDMA 3T4JA 3GR2A 3HJKA 4MBHA 4S2NA 3HREA 2QMIA 1MBLA 4WUJA 2VLGA 3CMZA 4ZAMA 3G34A 4NXGA 5IT5A 3BY9A 2X71A 3OCLA 4F3LB 3KO6A 1W63M 1IOUA 2X02A 3PAGA 3KSHA 2ZQAA 5D3OA 2UV0E 1PW8A 1F2KA 2XK1A 2INWA 1KGEA 2B18A 4NXFA 3R4KA 5FI2A 5GLCA 3G2YA 3Q07A 3S4XA 2C6WB 4JF4A 2GDNA 4O01A 1JTDA 4EBLA 3VOLA 3T1XA 4PPRA 4CLCB 4R4SA 1J3WA 4KZBA 3BWLA 4GW9A 5GHZA 3DWZA 3WWXA 2P74A 4NXBA 2E8JA 5AQ7A 2Y55A 3TSGA 5BOHA 1NRFA 1PZPA 2R9XA 4PMAA 5F69A 5HWTA 4BWIA 3S7OA 5KMWA 1F9IA 2WKRA 3ZYTA 2W3EA 1NXYA 4RQ9A 3TW8A 2L4RA 4S2JA 2ZQ7A 4GCZA 1A0KA 3D3OA 3IH8A 3LIEA 1XFQA 2PDRA 3ZVTA 3D4FA 3KSFA 4QPRA 2WGWB 4ME4A 2M1CA 3MFXA 4WZ5A 1OTEA 3LFVA 2DMWA 3E2KA 4OLDA 4GS9A 3HUOA 2V8CA 3NI9A 2JE5A 4HJ6A 2V0UA 1FOFA 3IXGA 4PM8A 1H8YA 1K57C 3WS4A 5C5KA 4WZ5C 3T4OA 1TS6A 3A0VA 3VMAA 3C8CA 3IWQA 2PU4A 4K08A 4EEUA 2EX8A 2RCXA 1W79A 5HL6A 3AGDA 3FPVA 2W3HA 2JC7A 1SDNA 2V1ZA 3A3JA 3IBRA 4DN0A 2K31A 1VETA 5HD3A 4KZ3A 1P0ZA 3TRCA 2XFSA 5A92A 1BYWA 5CERA 5GLAA 4A5RA 5GLDA 4ZJ2A 3M6HA 4HH3A 5DJTA 4M3KA 2V20A 4IJGA 1KE4A 4IBXA 3PAEA 1K55C 2IA2A 4BD1A 4BQMA 2DCFA 4FD8A 5L2FA 5DKLA 2FFYA 1NJ4A 5EV0A 5EVIA 3U4LP 5HD5A 3PBTA 4HEFA 4MEZA 3NECA 3C7VA 2I9VA 4PAUA 3SH7A 4IVIA 5FL3A 4PM5A 3CUEA 3ZQ5A 4OQIA 4B4XA 1SHVA 1XA7A 1QMFA 2DRWA 2VGKA 3DTKA 3KYEA 3GQZA 5EVIC 2B5RA 3VOYA 5HDDA 1ZHHB 3HLEA 1ERMA 2WADA 3Q82A 3N4IA 1G68A 2Q9MA 1DY6A 5DFXA 4MBFA 2ZM8A 3CUEC 3KX0X 3OBFA 5AQ9A 3MBZA 3B42A 1Y54A 3VFFA 3UB9A 3UE3A 3G4PA 4LV3A 5EVEA 4H6JA 2IWDA 2EX9A 1FCNA 3O86A 3T1QB 5EUAA 1IKIA 4HQAA 1W63Q 2XRNA 4R1GA 4Y0OA 2PYPA 3A3FA 4UAAA 5J4EA 5GHYA 3UDFA 4Y0TA 1XFNA 4YWZA 4HOIA 1HD8A 4ZBEA 2J8YA 4K0WA 4KQRA 5J8XA 3W4QA 1LT0A 1KOUA 4ZTKA 1GSXA 4DKIA 2XD5A 1XJ3A 5HZHA 2Q9NA 4O0PA 3LR5A 3HL9A 4KQDA 5TJJA 2V9AA 2A24B 3MQOA 3MQ0A 2JKTM 4XT2A 5FEFA 1VETB 3SH8A 3T4QA 3GRJA 3NJAA 3ZG7B 3FWLA 2ZL1B 4KQOA 1DRMA 1LI0A 1D1JA 3E0YA 3OOVA 2XA7S 4P87A 4BD0A 3HLBA 3W2ZA 3ITBA 4NEED 3N8SA 5EVIB 4X69A 4DE1A 3NBLA 2O9CA 5KSHA 3K3CA 3UPOA 1K4EA 1FSWA 3RTYA 3LIAA 3UY6A 3ZG8B 1L2SA 3ZDJA 1IFQA 2JN7A 3G6OA 1PW1A 5F83A 4NK3A 4P6ZM 1SKOA 1S1YA 4Q0IA 2BLSA 5E43A 1WYBA 4JLFA 3GSGA 4LCMA 4CPKA 2QZ6A 3BLSA 5EVLA 4Q8IA 3UB5P 2ZQ8A 1HLUP 1BLSA 4Y7PA 3NOUC 3BFFA 5CEBA 1K4FA 2Y2MA 1ALQA 4OQ0A 4WL9A 3UE1A 4OPZA 1VQQA 2B02A 1PWGA 2Y8HA 3PBSA 4G3WA 3F1NA 3DTMA 2CMNA 3MXSA 4KUOA 3VSLA 1LLBA 2GJ3A 1N9NA 4R3JA 5G18A 3MMHA 1ESUA 3NOPC 5K5BA 3HUMA 3F1PA 3IHAA 2VZWA 2PU2A 5EFWA 3VFHA 3G31A 2HGVA 2UWXA 3LIDA 5FASA 1L0DA 2V1AA 2V1BA 1OT6A 4DXBA 2Y2OA 1Z09A 4OQHA 2J7VA 1I2WA 2I72A 3I7JA 4MDZA 1EI5A 4E3MA 1OJ5A 3V39A 1G6AA 2HP9A 4DF6A 3G35A 4JXWA 3G32A 3C30A 3HLGA 5AJGA 1Z6FA 1YLYA 4N9LA 4GD6A 4GDNA 1L3LA 1FR1A 1NRJA 1S4RA 4FH2A 4KZ8A 3B3XA 3NCKA 3VP1A 2OOLA 4C75A 1KE0A 3VOZA 5HWVA 3BFGA 3H82A 5HAQA 4JXVA 4R23A 3NC8A 2V2FF 1LSVA 4U3TA 1H5XA 2ZMFA 1PYYA 4R0QA 4EWFA 1FQGA 1K56A 4OQGA 2XGNA 4OKPA 4BJPA 1DP8A 3O5YA 3M2JA 3RXXA 1LI9A 4N1HA 3EEAA 1JWPA 1MWSA 1P9WA 2O9BA 2PBYA 4QU3A 1M6KA 3BY8A 3WS1A 3NDGA 3SZTA 1W8QA 3LR3A 3LEZA 2Y2HA 3BFEA 1FR6A 5FSRA 3CPTA 4ARZB 4XUXA 2D02A 1KGFA 1Y28A 4OOMA 2YKHA 3T4SA 4IVKA 4BBTA 5E2HA 3F1NB 1MXOA 3MKFA 2H0TA 5GHXA 5EVID 1BLPA 1HZOA 3F1PB 3FZCA 4M4XA 2OWJA 4KG5A 2Z6DA 3Q81A 1IEMA 4EXOA 1N9OA 4MN7A 4CLCA 4UQIS 3FKVA 3IXBA 2QJ7A 5KZHA 3IS2A 4Y0UA 4HESA 5EPHA 2OLVA 3CG5A 5J3WA 3S7PA 1ESIA 3D9YA 4EQIA 3KYQA 4H8RA 4GZBA 1ONHA 1K6RA 4CQHA 1OTIA 1FIKA 1G5UA 3SS3A 3QP1A 3OLOA 1EROA 1ZKJA 2O99A 2RL3A 3SS5A 4OP5A 5TFQA 5TGFA 1BULA 1ZC2A 5FAPA 1DJAA 1WYCA 1S66L 2WGWA 3PYPA 3T4KA 3LY3A 5TBMA 2EFXA 3LO7A 4S2IA 1LHYA 5MC7A 1YM1A 5GLBA 4DE3A 1IYPA 4FTXA 3LICA 5CGSA 2KX6A 1YLTA 4Z1WA 4UA9A 4PM7A 4KQQA 3C4OA 3WS5A 4S2PA 1AXBA 4JGPA 4KZ6A 5HL1A 3MXRA 2PT7A 4N92A 4KZAA 2HF6A 2OSUA 2QPNA 4UHUA 4WN5A 2A49A 2BG1A 4FUWA 1Y4OA 3ZNYA 1VM1A 4EUZA 3K3DA 5CHJA 4HJ4A 3CJMA 1TDGA 4HJ3A 4JGRA 1TF1A 4ESPA 5F82A 4ETZA 2Y2IA 3CPTB 1H3QA 4B93A 1VHMA 4HH2A 3LY4A 3MKEA 2OAP1 3A3DA 4WM9A 4OOLA 4OP8A 4R38A 4IUHA 4MCWA 3QHYA 3ZG5A 4UEYA 1EW0A 2P04A 2LB5A 1F98A 5CEDA 1MY8A 4MLLA 2Z2MB 1O07A 2X01A 2XD1A 4I3IA 1E4DA 2P9VA 1ES4A 3IS2B 5L07A 4DRTA 1FSYA 4GDBA 3IT9A 2A3UA 2H28A 1KVLA 4DDYA 3LCEA 4DJ3A 1CEGA 3ZCZA 3ZG0A 3A0SA 2IWBA 4EQ1A 1NWZA 2Y91A 5CTNA 2BTFP 3C2WA 4F94A 3JVVA 4CJNA 3LGOA 3CLOA 5HDSA 1FILA 3BFCA 2ZM0A 2H10A 5JYOA 1UGUA 1K57A 4MN5A 3IHBA 3UE0A 4RA7A 1OJGA 4R4RA 5TBMB 1XJ2A 1IYSA 2EFUA 5F6AA 1S1ZA 4D2OA 1XX2A 1PWDA 4YOFA 3EOIA 5A8BA 5E2EA 2XFTA 2PBDP 2E8IA 3ZFZA 3T12B 3LUQA 2VA0A 3MFDA 2A24A 2Y4AA 1K55A 4GKUA 1ZTUA 5CECA 2KLIA 1T18A 2QWSA 3E98A 1CJFA 2ZL1A 1YMXA 3P01A 1ODVA 3F1OA 3BW6A 3PBNA 5AQAA 2W1TA 3FKWA 4AFIA 4NKPA 2H5SA 4ZRRA 1XPBA 2JKGA 1PWCA 1LSWA 3V5MA 3QP5A 4LGWA 4MN6A 2KDKA 1DP9A 1H8MA 5A91A 5L10A 1BT5A 3S7NA 1OPXA 2PD7A 1DP6A 1K56D 2W27A 4UA6A 4EBNA 3PTEA 2Y2GA 3LI9A 5F1GA 5AVFA 2EXBA 5J7EA 1MWUA 3M6BA 1BTLA 3W4PA 1ERQA 2ZQCA 3UB8A 1SKFA 3E4QA 2P9VB 4Z9QA 2PD8A 1XJ4A 3A3IA 1LL8A 3N8RA 2DNSA 3C4PA 1MKMA 2HDQA 4JF6A 1TS7A 3CITA 4WELA 3M2KA 3C5AA 2WZXA 4HP9A 3U2AA 2GX5A 1L0GA 3WRTA 1UWPX 1KDWA 1RP5A 2WKPA 2V8FA 3DWKA 3V3SA 5GL9A 4U0XA 5M18A 1CF0A 3HJIA 2Y2JA 4R70A 3IWIA 4KZ7A 1W7FA 1KGGA 2HZ5A 5FI7A 3VP2A 3S22A 2VEAA 3Q7VA 1XXMA 2XLNA 4GHIA 1S0WA 4IUKA 1W8YA 4FSFA 4CLCD 4S2OA 5KSCA 3E2LA 1PZOA 1XP4A 4OPQA 4I3AA 2WGIA 2XROA 2OLUA 4HHDA 5CHMA 2D01A 3KSIA 4WF0A 3NHQA 1D06A 1UWNX 3TJZC 1KVMA 5DF7A 3BFDA 5JYPA 3DW0A 4P6BA 1L0EA 3F1OB 3GTCA 1STZA 1RGYA 3CZDA 2W1TB 4QY6A 2NUTC 1K38A 4YFMA 1KDSA 3PBQA 1ES2A 1TVFA 2EXAA 2WKIA 3RXWA 1K0KA 5AVEA 3VE4A 2VV7A 4QY5A 1RGZA 4K0XA 4B88A 5HPFA 2ZJ9A 3HCYA 4WMCA 3P09A 3G30A 5DKKA 5HSQA 3SS4A 3OPPA 3RFBA 3DBAA
chains in the Genus database with same CATH topology
2INWA 1TS8A 2VJWA 1G6OA 3BY8A 3MXQA 3BQAA 3LR3A 3FG8A 2B18A 1OTBA 3GDIA 3E4PA 4NXFA 3R4KA 4ARZB 2D02A 2GNXA 1Y28A 4MMNA 4OOMA 4P6ZS 2EWVA 4L9EA 4ARZA 2YKHA 4FOFA 3T4SA 4E04A 5DF9A 2EWWA 4BBTA 4I39A 3F1NB 1JNUA 4O01A 4LRYC 2PR5A 4PKYA 3H7WA 3ULFA 3OC2A 3VOLA 3F1PB 4M4XA 2OWJA 4WEJA 2K7SA 3PR6A 2J3TD 4CLCB 2Z6DA 4EXOA 4LPZA 5DJUA 4EUVA 1N9OA 4ETXA 3BWLA 4MN7A 4GW9A 4UQIS 4CLCA 2QJ7A 5IS1A 3IS2A 4NXBA 4O8GA 5J3WA 3S7PA 1S67L 2Y79A 2PR6A 5F69A 3KYQA 5HWTA 4BWIA 3S7OA 3LIBA 4GHIB 2VX8A 2YKFA 1F9IA 2WKRA 4DJ2A 3ZYTA 1XJ6A 2W3EA 4CQHA 3EWKA 1OTIA 4RQ9A 3TW8A 1OTDA 2L4RA 4GCZA 1T1BA 3D3OA 3LIEA 3OLOA 1OT9A 1XFQA 4B9OA 4L9FA 2O99A 2PDRA 3K2NA 3KSFA 2G7UA 4II7A 4QPRA 4ME4A 2M1CA 3MFXA 2HJEA 2OAQ1 1OTEA 1TS0A 2VKSA 4GS9B 3LFVA 1T1AA 1S66L 2DMWA 3PYPA 3T4KA 4GS9A 2HV1A 5TBMA 3CAXA 2M7VA 3PHYA 4HJ6A 2V0UA 2NUPC 5MC7A 1VB6A 4GJ4A 4G3KA 2LB9A 5C5KA 3R7WA 3LICA 3T4OA 1TS6A 3A0VA 2KX6A 3C8CA 4EEUA 4K08A 3PBOA 5HL6A 2P08A 3FPVA 4Z1WA 5DFYA 2W0NA 2W3HA 2XA7M 4JGPA 2PT7A 2HF6A 3IBRA 4DN0A 2K31A 2VV8A 4WN5A 5HD3A 4HI4A 1P0ZA 3TRCA 3EEHA 5IU1A 1BYWA 3LYXA 3MJQA 2JKRM 3LR4A 3K3DA 4HH3A 5DJTA 4L0LA 4IJGA 3EQUA 3ICYA 4HJ4A 2KOIA 2W3GA 4YNRA 2IA2A 3JVUA 5HWWA 4HJ3A 4JGRA 1TF1A 2VGLM 4ETZA 5DKLA 3S7QA 1H3QA 3LI8A 4B93A 1VHMA 2PHYA 4HH2A 5HD5A 2OAP1 3PBTA 2ZMVA 4PAUA 2I9VA 4OOLA 4R38A 5FL3A 3E4OA 3CUEA 3PBRA 4IUHA 3ZQ5A 4MCWA 3UMDA 1S4SA 3H7WB 4UEYA 1EW0A 2P04A 2W3DA 4NXEA 1YKDA 2LB5A 5F68A 1F98A 2WKQA 4HY8A 5HDDA 1ZHHB 4I3IA 3LIFA 2L1MA 5F5YA 3IBJA 2JKTI 3C38A 5L8MA 2J3TC 4EU0A 5DFXA 1YSPA 3CUEC 3T4TA 3IS2B 3KX0X 3OBFA 4LRXC 1T19A 4IHQA 1TD5A 3T50A 4I5SA 3B42A 2H28A 3UB9A 1V9YA 3UE3A 1MC0A 2JKRI 4H6JB 5G4ZA 5CX7A 4DJ3A 4EQ1A 3A0SA 4HP4A 1G28A 1NWZA 1F5MA 4H6JA 3C2WA 1LSXA 2O0YA 4WLAA 3JVVA 2P7JA 3B33A 3CLOA 4HQAA 1W63Q 3TE8A 5HDSA 4Q0JA 3BJNA 2XRNA 2PYPA 1T1CA 5J4EA 3FPWA 3CWFA 1XFNA 4I3JA 4YWZA 1UGUA 3RH8B 3OCNA 2O9AA 5HDCA 4MN5A 4HOIA 3MQQA 4JGOA 1OJGA 2VV6A 4I38A 5TBMB 1XJ2A 5I5LA 4EW7A 5F6AA 1S1ZA 3VV4A 2J80A 1LT0A 1KOUA 4YOFA 4EERA 1GSXA 3R7WB 3EOIA 3VE3A 1XJ3A 2K2NA 5HZHA 5A8BA 4LRZE 4O0PA 3KSGA 3LR5A 4Y2FA 4KUKA 4XT2B 4KQDA 5TJJA 2V9AA 2QJ5A 2A24B 4JGQA 3LUQA 3MQOA 3MQ0A 2VA0A 2JKTM 4LLOB 4XT2A 3EGDC 2A24A 3T4QA 1ZTUA 3EGXC 2KLIA 3NJAA 1OTAA 1T18A 1D7EA 2QWSA 4KQOA 1DRMA 3GECA 3E98A 3E0YA 3H9WA 1NLYA 3OOVA 3P01A 2XA7S 1ODVA 3UE6A 3F1OA 3BW6A 3PBNA 4Q0HA 3W2ZA 2W1TA 3V67A 2EA9A 4AFIA 2QKPA 4NKPA 4ZRRA 4NEED 3B47A 3KYZA 3D72A 5KIZA 1LSWA 2ZOIA 1P9RA 4MN6A 2KDKA 2O9CA 5KSHA 3K3CA 1DP9A 3EQVA 3RTYA 1H8MA 3LIAA 2V0WA 1IFQA 1NLZA 3FC7A 2JN7A 3S7NA 1OPXA 3G6OA 4BBUA 2VGLS 2PD7A 1DP6A 2W27A 4F3LA 4P6ZM 1S1YA 4Q0IA 3LI9A 5AVFA 4EEPA 5J7EA 3PXPA 2ZOHA 4PHTA 2QHKA 3UB8A 3E4QA 4G3VA 2PD8A 2BASA 1XJ4A 5LBRA 3NOUC 5HPIA 1LL8A 1V9ZA 2W1RA 1MKMA 1TS7A 3CITA 4WL9A 2M7UA 3CI6A 4WELA 2B02A 4HP9A 3U2AA 2GX5A 2Y8HA 3PBSA 1UWPX 3F1NA 1YAXA 4G3WA 2CMNA 4Y3IA 4UQIM 4KUOA 3SW1A 4L9GA 2A2LA 2GJ3A 3UMEA 1N9NA 2L0WA 2WKPA 3MMHA 4BBVA 3NOPC 5K5BA 3F1PA 3NOTC 2VZWA 3UB6A 5EFWA 1N9LA 4CLCE 2JHEA 3HJIA 3MR0A 4R70A 2HGVA 3LIDA 2OWHA 2V1AA 2V1BA 4WEKA 2VEAA 1OT6A 4BMWA 2QYBA 2W3FA 3BQ8A 4GHIA 4IUKA 2PYRA 1P97A 4FSFA 4CLCD 2R78A 4CLCC 4MDZA 1OJ5A 4I3AA 4R6LA 2XROA 2Z6CA 4HHDA 3C30A 4EESA 4Y5FA 5AJGA 1YSQA 2FH5A 1MZUA 2D01A 4GLQA 3KSIA 3P7NA 4WF0A 3NHQA 1NRJA 1S4RA 3MF0A 1D06A 1UWNX 1WA9A 3TJZC 2OOLA 3H82B 4DMZA 5G4YA 5HWVA 3F1OB 1STZA 3H82A 4PKYG 2W1TB 3UB7A 4HIAA 1LSVA 2NUTC 4R3AA 2MJ6A 3PBQA 2J3WA 2ZMFA 2XSSA 1GSWA 3A0RA 1X0OA 3T4JA 3HJKA 5AVEA 3VE4A 2VV7A 4EETB 3LR0A 3T4LA 4BJPA 1GSVA 4WUJA 2VLGA 1DP8A 2FZ0A 3O5YA 2GZAA 4NXGA 5IT5A 5HPFA 3BY9A 3HCYA 3OCLA 4F3LB 3KO6A 1W63M 1IOUA 5DKKA 5HSQA 2ZBBA 3KSHA 3EEAA 4HNBA 3RFBA 1P9WA 2HJ9C 2O9BA 3DBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INW A;  1TS8 A;  3BY8 A;  3MXQ A;  3FG8 A;  1OTB A;  3GDI A;  3E4P A;  4NXF A;  2D02 A;  1Y28 A;  4L9E A;  2YKH A;  4E04 A;  4BBT A;  4I39 A;  3F1N B;  1JNU A;  4LRY C;  2PR5 A;  4PKY A;  3H7W A;  3ULF A;  3VOL A;  3F1P B;  4M4X A;  2OWJ A;  2K7S A;  2Z6D A;  4EXO A;  4LPZ A;  5DJU A;  1N9O A;  3BWL A;  4GW9 A;  2QJ7 A;  5IS1 A;  3IS2 A;  4NXB A;  5J3W A;  1S67 L;  2PR6 A;  5F69 A;  5HWT A;  3LIB A;  4GHI B;  2YKF A;  1F9I A;  2WKR A;  4DJ2 A;  1XJ6 A;  3EWK A;  1OTI A;  4RQ9 A;  1OTD A;  2L4R A;  4GCZ A;  1T1B A;  3OLO A;  3LIE A;  1OT9 A;  1XFQ A;  4B9O A;  4L9F A;  2PDR A;  2M1C A;  3MFX A;  1OTE A;  1TS0 A;  4GS9 B;  1T1A A;  1S66 L;  3PYP A;  4GS9 A;  2HV1 A;  5TBM A;  3CAX A;  3PHY A;  4HJ6 A;  2V0U A;  1VB6 A;  3LIC A;  1TS6 A;  3A0V A;  2KX6 A;  3C8C A;  4EEU A;  4K08 A;  2W0N A;  4JGP A;  3IBR A;  2VV8 A;  4WN5 A;  5HD3 A;  4HI4 A;  1P0Z A;  3EEH A;  5IU1 A;  1BYW A;  3LYX A;  3MJQ A;  3K3D A;  4HH3 A;  5DJT A;  3ICY A;  4HJ4 A;  5HWW A;  4HJ3 A;  4JGR A;  5DKL A;  3LI8 A;  2PHY A;  4HH2 A;  5HD5 A;  2I9V A;  4R38 A;  3E4O A;  3ZQ5 A;  3UMD A;  1S4S A;  3H7W B;  1EW0 A;  4NXE A;  5F68 A;  1F98 A;  2WKQ A;  4HY8 A;  5HDD A;  4I3I A;  3LIF A;  2L1M A;  3IS2 B;  3KX0 X;  4LRX C;  1T19 A;  3T50 A;  4I5S A;  2H28 A;  3UB9 A;  1V9Y A;  4H6J B;  5G4Z A;  4DJ3 A;  4EQ1 A;  3A0S A;  4HP4 A;  1G28 A;  1NWZ A;  4H6J A;  3C2W A;  1LSX A;  4WLA A;  2P7J A;  3B33 A;  3CLO A;  4HQA A;  5HDS A;  2PYP A;  1T1C A;  5J4E A;  3CWF A;  1XFN A;  4I3J A;  4YWZ A;  1UGU A;  3RH8 B;  5HDC A;  4MN5 A;  4HOI A;  3MQQ A;  4JGO A;  1OJG A;  2VV6 A;  4I38 A;  5TBM B;  1XJ2 A;  5I5L A;  4EW7 A;  5F6A A;  1S1Z A;  2J80 A;  1LT0 A;  1KOU A;  4EER A;  1GSX A;  3VE3 A;  1XJ3 A;  5HZH A;  5A8B A;  4LRZ E;  4KUK A;  4XT2 B;  4KQD A;  2V9A A;  2QJ5 A;  2A24 B;  4JGQ A;  3LUQ A;  3MQO A;  4LLO B;  4XT2 A;  2A24 A;  3NJA A;  1OTA A;  1T18 A;  1D7E A;  2QWS A;  1DRM A;  3GEC A;  3H9W A;  1ODV A;  3UE6 A;  3F1O A;  2EA9 A;  2QKP A;  3D72 A;  5KIZ A;  1LSW A;  2ZOI A;  4MN6 A;  2KDK A;  3K3C A;  1DP9 A;  3RTY A;  3LIA A;  2V0W A;  3FC7 A;  2JN7 A;  3G6O A;  4BBU A;  2PD7 A;  1DP6 A;  2W27 A;  4F3L A;  1S1Y A;  3LI9 A;  5AVF A;  4EEP A;  5J7E A;  2ZOH A;  2QHK A;  3UB8 A;  3E4Q A;  2PD8 A;  2BAS A;  1XJ4 A;  3NOU C;  1LL8 A;  1V9Z A;  1TS7 A;  4WL9 A;  2B02 A;  4HP9 A;  1UWP X;  3F1N A;  2CMN A;  4KUO A;  3SW1 A;  4L9G A;  2GJ3 A;  3UME A;  1N9N A;  2L0W A;  2WKP A;  4BBV A;  3NOP C;  3F1P A;  3NOT C;  3UB6 A;  5EFW A;  1N9L A;  2JHE A;  3HJI A;  3MR0 A;  4R70 A;  3LID A;  2OWH A;  2V1A A;  2V1B A;  2VEA A;  1OT6 A;  4GHI A;  2PYR A;  1P97 A;  2R78 A;  1OJ5 A;  4I3A A;  4R6L A;  2Z6C A;  4HHD A;  4EES A;  1MZU A;  2D01 A;  3P7N A;  4WF0 A;  3NHQ A;  1S4R A;  1D06 A;  1UWN X;  1WA9 A;  2OOL A;  3H82 B;  5G4Y A;  5HWV A;  3F1O B;  3H82 A;  4PKY G;  3UB7 A;  4HIA A;  1LSV A;  4R3A A;  3A0R A;  1GSW A;  1X0O A;  3HJK A;  5AVE A;  3VE4 A;  2VV7 A;  4EET B;  1GSV A;  4WUJ A;  2VLG A;  1DP8 A;  4NXG A;  3BY9 A;  4F3L B;  5DKK A;  5HSQ A;  2ZBB A;  4HNB A;  5F5Y A; 
#chains in the Genus database with same CATH topology
 4X55 A;  1NZO A;  1G6O A;  1LL5 A;  3WRZ A;  3BQA A;  3FG8 A;  4GOG A;  3GDI A;  4X68 A;  4RYE A;  3HLF A;  1E3U A;  2GNX A;  4NET A;  2VGJ A;  4P6Z S;  2EWV A;  4L9E A;  4E6W A;  4ARZ A;  4FOF A;  4E04 A;  1EWZ A;  2EWW A;  4LV0 A;  5EM0 A;  4RVA A;  4LRY C;  2PR5 A;  4PKY A;  1GHI A;  3ULF A;  4LCL A;  4P0M A;  3OC2 A;  2EX2 A;  3ZHH A;  5FDS A;  2K7S A;  1IEL A;  3G2Z A;  4KZ9 A;  4ETX A;  2Y59 A;  3FV7 A;  3HVF A;  5A93 A;  3Q7V B;  4S2K A;  1S67 L;  1W5D A;  3LIB A;  4GHI B;  4XXR A;  2VX8 A;  2YKF A;  3EWK A;  4BLM A;  5AQB A;  2ZQ9 A;  1T1B A;  2ZLY A;  1OT9 A;  5TR7 A;  4B9O A;  2ZQD A;  3K2N A;  1GA0 A;  2G7U A;  4E3K A;  2ZC3 B;  2HJE A;  1TS0 A;  1ZG4 A;  3NDE A;  1T1A A;  5DTK A;  1IKG A;  3CAX A;  3AGF A;  3V50 A;  2M7V A;  3PHY A;  1IYO A;  4X6T A;  1YQS A;  2NUP C;  1VB6 A;  1CEF A;  4GJ4 A;  5FAT A;  4X25 A;  1SZV A;  4G3K A;  2LB9 A;  4GN2 A;  1HTZ A;  3PBO A;  5DFY A;  4ZJ3 A;  5IU1 A;  3LYX A;  3MJQ A;  5FAQ A;  2JKR M;  4E6X A;  3WS0 A;  4XUZ A;  3VSK A;  5HX9 A;  3LR4 A;  4Y17 A;  4YNR A;  3JVU A;  4DE2 A;  3IQA A;  5HWW A;  2VGL M;  1VEU A;  1PFL A;  4E3N A;  4OPR A;  3S7Q A;  1BLC A;  1CK3 A;  2PHY A;  2ZMV A;  1I5Q A;  4N1X A;  4NG2 A;  3E4O A;  1XA1 A;  4U0T A;  3UMD A;  1S4S A;  1N9B A;  4NXE A;  1YKD A;  4GD8 A;  2XEP A;  2WKQ A;  2Y2L A;  4HY8 A;  3NIA A;  1YLZ A;  3LIF A;  2FFF B;  3IBJ A;  3C38 A;  2J9P A;  2J3T C;  4EU0 A;  1OME A;  1T19 A;  1TD5 A;  4WZ4 A;  4I5S A;  3IF6 C;  4FH4 A;  1V9Y A;  2JKR I;  3HLD A;  5CX7 A;  2Y2N A;  4YIN A;  5M1A A;  4WLA A;  2P7J A;  3B33 A;  3TE8 A;  3LEQ A;  3O3V A;  2VK3 A;  1HVB A;  3T1S A;  3FPW A;  2WUQ A;  4I3J A;  3FYZ A;  4WBG A;  4MNR A;  2WAE A;  2ZD8 A;  5HDC A;  1K6S A;  2HDR A;  1MKI A;  3MQQ A;  2VV6 A;  4I38 A;  1BZA A;  3QNC A;  2CC1 A;  5I5L A;  4EW7 A;  1CI8 A;  5HAR A;  5I94 A;  3VV4 A;  2XF3 A;  1O7E A;  4EER A;  5L09 A;  5EOE A;  1NYY A;  3VE3 A;  4BEN A;  2K2N A;  3OZH A;  4X1L A;  5DF8 A;  4LRZ E;  4Y2F A;  2QJ5 A;  4DE0 A;  4E3J A;  4OON A;  2WAF A;  4BL3 A;  3EGD C;  1FCO A;  4IED A;  1FCM A;  1OTA A;  1AWI A;  1D7E A;  4S2M A;  4QWO A;  3H9W A;  1NLY A;  3N6I A;  3UE6 A;  1Q2Q A;  4Q0H A;  5E2G A;  1VEU B;  4JXG A;  2EA9 A;  2QKP A;  1K25 A;  5M19 A;  3D72 A;  2ZOI A;  1TEM A;  1ES5 A;  5CHU A;  3RJU A;  3ISG A;  4K91 A;  1ES3 A;  1NLZ A;  3FC7 A;  4JPM A;  4BBU A;  3IF6 B;  4EEP A;  4S2N C;  1ZG6 A;  3PXP A;  1KE3 A;  2ZOH A;  4RX3 A;  3QP2 A;  4WMC D;  4G3V A;  2HDS A;  4X53 A;  5FI6 A;  1CQA A;  2H0Y A;  5FQ9 A;  3IX3 A;  1SDE A;  1V9Z A;  2W1R A;  3CI6 A;  1Q2P A;  1RCJ A;  5DVA A;  3SH9 A;  4BL2 A;  4OH0 A;  4Y3I A;  3SW1 A;  4L9G A;  3UME A;  3IX8 A;  2L0W A;  1E3U D;  4FCF A;  2HP6 A;  4BBV A;  1JWZ A;  2WKH A;  3ITA A;  3NOT C;  3UB6 A;  3L9K A;  3MSH A;  2B95 A;  2WKE A;  3DTI A;  4OOY A;  4UA7 A;  3MR0 A;  5EEC A;  3BEC A;  1WE4 A;  2OWH A;  3MZE A;  1H8Z A;  2ZC5 B;  4BMW A;  1LL9 A;  1XGJ A;  4E3L A;  2XH9 A;  2W3F A;  3W4O A;  2PYR A;  1P97 A;  3TG9 A;  1GCE A;  4N9K A;  3GMW A;  5IHV A;  4Y5F A;  3UPP A;  2FH5 A;  1MZU A;  4O7D A;  5CXW A;  4E3I A;  1XKZ A;  1WA9 A;  5CGW A;  2WZZ A;  4DMZ A;  3MS6 A;  4Y13 A;  4D60 A;  4HIA A;  1YT4 A;  2Z2L B;  4X1M A;  2MJ6 A;  2J3W A;  3A0R A;  1X0O A;  1YMS A;  4EET B;  5F1F A;  3LR0 A;  3NY4 A;  3T4L A;  1GSV A;  2FZ0 A;  2GZA A;  2XQZ A;  3SOI A;  2ZBB A;  3OPL A;  2JCH A;  4LEN A;  4HNB A;  2HJ9 C;  5F5Y A;  3UO9 A;  1TS8 A;  2VJW A;  4GB7 A;  3MXQ A;  1PI4 A;  1OTB A;  3E4P A;  2AVX A;  1GHP A;  3BEB A;  2G2W A;  4MMN A;  4EBP A;  1DJC A;  5DF9 A;  5FQQ A;  4I39 A;  1JNU A;  1PNE A;  4ZDX A;  3HBR A;  4X56 A;  4WYY A;  3H7W A;  3QP6 A;  4WEJ A;  3IF5 A;  3PR6 A;  2J3T D;  4LPZ A;  5DJU A;  4EUV A;  5FQK A;  5IS1 A;  2WGV A;  1BUE A;  4LFU A;  2IWC A;  2Y2P A;  3W8K A;  4O8G A;  2Y79 A;  2PR6 A;  1YLJ A;  3BRM A;  4IBR A;  4DJ2 A;  1XJ6 A;  3MZF A;  4EV4 A;  1ONG A;  1OTD A;  3IX4 A;  2JBF A;  4L9F A;  2WK0 A;  4II7 A;  5CTM A;  3OPH A;  2OAQ 1;  2VKS A;  4GS9 B;  4KZ4 A;  1NZU A;  3TOI A;  4QB8 A;  2HV1 A;  3IXD A;  1XGI A;  3NUL A;  4OVD A;  3R7W A;  3ZNT A;  1N4O A;  4OPY A;  1I2S A;  2Q0O A;  4E3O A;  5HAI A;  2P08 A;  2W0N A;  2XA7 M;  4GNU A;  3DTE A;  3IH9 A;  1NY0 A;  3OPR A;  2VV8 A;  4HI4 A;  2Y2K A;  1JVJ A;  3EEH A;  4HBU A;  4L0L A;  5FQJ A;  3EQU A;  3ICY A;  2KOI A;  2W3G A;  4HBT A;  1BLH A;  5EOO A;  3VP3 A;  4PM9 A;  3LI8 A;  3PBR A;  3QP4 A;  1YPR A;  3H7W B;  3GVB A;  2W3D A;  4OLG A;  5F68 A;  1J9M A;  1MWR A;  2L1M A;  2JKT I;  5FEG A;  5L8M A;  1YSP A;  3T4T A;  4LRX C;  4IHQ A;  3T50 A;  3N7W A;  5EE8 A;  4B4Z A;  3O87 A;  3V3R A;  5FQI A;  4QD4 A;  2ZMA A;  4C3Q A;  1MC0 A;  4H6J B;  5G4Z A;  3A3E A;  4PM6 A;  3UDI A;  4C6Y A;  4HP4 A;  1G28 A;  1F5M A;  2OV5 A;  2G2U A;  4QJG A;  5A90 A;  1LSX A;  2O0Y A;  1S6R A;  3ZGA B;  4Q0J A;  3BJN A;  2ZM2 A;  3HUN A;  2Y2Q A;  1T1C A;  1SCW A;  3C7U A;  3CWF A;  2HDU A;  2HPB A;  1H0M A;  3AGE A;  1TDL A;  3RH8 B;  3OCN A;  2O9A A;  1E25 A;  4JGO A;  2J9O A;  4S2L A;  3HLW A;  3MZD A;  4JF5 A;  2J80 A;  5HAP A;  5E2F A;  3GV9 A;  3R7W B;  4P85 A;  1MWT A;  3KSG A;  1QME A;  1IYQ A;  2ZC4 B;  4KUK A;  4XT2 B;  1PIO A;  4JGQ A;  4LV1 A;  2XR0 A;  4LLO B;  3QNB A;  5FA7 A;  3EGX C;  3P98 A;  3VP0 A;  3GEC A;  4KZ5 A;  5DTT A;  1C3B A;  1YLW A;  1K54 A;  3QP8 A;  1PI5 A;  3JPU A;  3V67 A;  3BM6 A;  4KEN B;  1DJB A;  3B47 A;  4DXC A;  3KYZ A;  3S1Y A;  4DDS A;  5KIZ A;  4JXS A;  3ZVW A;  1P9R A;  3Q7Z A;  1K54 C;  3EQV A;  2V0W A;  2R9W A;  1SKO B;  2VGL S;  1BSG A;  4F3L A;  3IF6 A;  1GA9 A;  1M40 A;  5CRF A;  4PHT A;  3UDX A;  2EX6 A;  2QHK A;  4RX2 A;  4ZJ1 A;  4LV2 A;  2BAS A;  5LBR A;  5HPI A;  3O88 A;  2M7U A;  3Q1F A;  4MBK A;  1NYM A;  3HLC A;  1YAX A;  4UQI M;  2A2L A;  3VP4 A;  1U60 A;  3CHW P;  5U47 A;  1ACF A;  3DAV A;  3WS2 A;  2HP5 A;  3IWO A;  4ID4 A;  3UPN A;  1N9L A;  4CLC E;  4QHC A;  2JHE A;  5DTS A;  1PRQ A;  2JKF A;  4R3B A;  1CI9 A;  4WEK A;  3N8L A;  2QYB A;  5FQM A;  3BQ8 A;  3UN7 A;  2ACG A;  2PRF A;  2R78 A;  5HFO A;  4CLC C;  4JBF A;  5HW3 A;  4R6L A;  5CGX A;  1GHM A;  2Z6C A;  2ZC6 B;  5FDH A;  4EES A;  3BLM A;  3IXH A;  1YSQ A;  4Y15 A;  4GLQ A;  4KG2 A;  3P7N A;  1YLP A;  3BYD A;  2ZC7 A;  3JYI A;  3MF0 A;  3UNW A;  1MPL A;  3H82 B;  2WYX A;  5G4Y A;  3T1R A;  4KG6 A;  1L0F A;  1JTG A;  2PAV P;  2C5W B;  4PKY G;  3UB7 A;  5EM1 A;  1JWV A;  4R3A A;  3ZG9 B;  3L7H A;  5FAO A;  4JKT A;  1GSW A;  2XSS A;  2XDM A;  3T4J A;  3GR2 A;  3HJK A;  4MBH A;  4S2N A;  3HRE A;  2QMI A;  1MBL A;  4WUJ A;  2VLG A;  3CMZ A;  4ZAM A;  3G34 A;  4NXG A;  5IT5 A;  3BY9 A;  2X71 A;  3OCL A;  4F3L B;  3KO6 A;  1W63 M;  1IOU A;  2X02 A;  3PAG A;  3KSH A;  2ZQA A;  5D3O A;  2UV0 E;  1PW8 A;  1F2K A;  2XK1 A;  2INW A;  1KGE A;  2B18 A;  4NXF A;  3R4K A;  5FI2 A;  5GLC A;  3G2Y A;  3Q07 A;  3S4X A;  2C6W B;  4JF4 A;  2GDN A;  4O01 A;  1JTD A;  4EBL A;  3VOL A;  3T1X A;  4PPR A;  4CLC B;  4R4S A;  1J3W A;  4KZB A;  3BWL A;  4GW9 A;  5GHZ A;  3DWZ A;  3WWX A;  2P74 A;  4NXB A;  2E8J A;  5AQ7 A;  2Y55 A;  3TSG A;  5BOH A;  1NRF A;  1PZP A;  2R9X A;  4PMA A;  5F69 A;  5HWT A;  4BWI A;  3S7O A;  5KMW A;  1F9I A;  2WKR A;  3ZYT A;  2W3E A;  1NXY A;  4RQ9 A;  3TW8 A;  2L4R A;  4S2J A;  2ZQ7 A;  4GCZ A;  1A0K A;  3D3O A;  3IH8 A;  3LIE A;  1XFQ A;  2PDR A;  3ZVT A;  3D4F A;  3KSF A;  4QPR A;  2WGW B;  4ME4 A;  2M1C A;  3MFX A;  4WZ5 A;  1OTE A;  3LFV A;  2DMW A;  3E2K A;  4OLD A;  4GS9 A;  3HUO A;  2V8C A;  3NI9 A;  2JE5 A;  4HJ6 A;  2V0U A;  1FOF A;  3IXG A;  4PM8 A;  1H8Y A;  1K57 C;  3WS4 A;  5C5K A;  4WZ5 C;  3T4O A;  1TS6 A;  3A0V A;  3VMA A;  3C8C A;  3IWQ A;  2PU4 A;  4K08 A;  4EEU A;  2EX8 A;  2RCX A;  1W79 A;  5HL6 A;  3AGD A;  3FPV A;  2W3H A;  2JC7 A;  1SDN A;  2V1Z A;  3A3J A;  3IBR A;  4DN0 A;  2K31 A;  1VET A;  5HD3 A;  4KZ3 A;  1P0Z A;  3TRC A;  2XFS A;  5A92 A;  1BYW A;  5CER A;  5GLA A;  4A5R A;  5GLD A;  4ZJ2 A;  3M6H A;  4HH3 A;  5DJT A;  4M3K A;  2V20 A;  4IJG A;  1KE4 A;  4IBX A;  3PAE A;  1K55 C;  2IA2 A;  4BD1 A;  4BQM A;  2DCF A;  4FD8 A;  5L2F A;  5DKL A;  2FFY A;  1NJ4 A;  5EV0 A;  5EVI A;  3U4L P;  5HD5 A;  3PBT A;  4HEF A;  4MEZ A;  3NEC A;  3C7V A;  2I9V A;  4PAU A;  3SH7 A;  4IVI A;  5FL3 A;  4PM5 A;  3CUE A;  3ZQ5 A;  4OQI A;  4B4X A;  1SHV A;  1XA7 A;  1QMF A;  2DRW A;  2VGK A;  3DTK A;  3KYE A;  3GQZ A;  5EVI C;  2B5R A;  3VOY A;  5HDD A;  1ZHH B;  3HLE A;  1ERM A;  2WAD A;  3Q82 A;  3N4I A;  1G68 A;  2Q9M A;  1DY6 A;  5DFX A;  4MBF A;  2ZM8 A;  3CUE C;  3KX0 X;  3OBF A;  5AQ9 A;  3MBZ A;  3B42 A;  1Y54 A;  3VFF A;  3UB9 A;  3UE3 A;  3G4P A;  4LV3 A;  5EVE A;  4H6J A;  2IWD A;  2EX9 A;  1FCN A;  3O86 A;  3T1Q B;  5EUA A;  1IKI A;  4HQA A;  1W63 Q;  2XRN A;  4R1G A;  4Y0O A;  2PYP A;  3A3F A;  4UAA A;  5J4E A;  5GHY A;  3UDF A;  4Y0T A;  1XFN A;  4YWZ A;  4HOI A;  1HD8 A;  4ZBE A;  2J8Y A;  4K0W A;  4KQR A;  5J8X A;  3W4Q A;  1LT0 A;  1KOU A;  4ZTK A;  1GSX A;  4DKI A;  2XD5 A;  1XJ3 A;  5HZH A;  2Q9N A;  4O0P A;  3LR5 A;  3HL9 A;  4KQD A;  5TJJ A;  2V9A A;  2A24 B;  3MQO A;  3MQ0 A;  2JKT M;  4XT2 A;  5FEF A;  1VET B;  3SH8 A;  3T4Q A;  3GRJ A;  3NJA A;  3ZG7 B;  3FWL A;  2ZL1 B;  4KQO A;  1DRM A;  1LI0 A;  1D1J A;  3E0Y A;  3OOV A;  2XA7 S;  4P87 A;  4BD0 A;  3HLB A;  3W2Z A;  3ITB A;  4NEE D;  3N8S A;  5EVI B;  4X69 A;  4DE1 A;  3NBL A;  2O9C A;  5KSH A;  3K3C A;  3UPO A;  1K4E A;  1FSW A;  3RTY A;  3LIA A;  3UY6 A;  3ZG8 B;  1L2S A;  3ZDJ A;  1IFQ A;  2JN7 A;  3G6O A;  1PW1 A;  5F83 A;  4NK3 A;  4P6Z M;  1SKO A;  1S1Y A;  4Q0I A;  2BLS A;  5E43 A;  1WYB A;  4JLF A;  3GSG A;  4LCM A;  4CPK A;  2QZ6 A;  3BLS A;  5EVL A;  4Q8I A;  3UB5 P;  2ZQ8 A;  1HLU P;  1BLS A;  4Y7P A;  3NOU C;  3BFF A;  5CEB A;  1K4F A;  2Y2M A;  1ALQ A;  4OQ0 A;  4WL9 A;  3UE1 A;  4OPZ A;  1VQQ A;  2B02 A;  1PWG A;  2Y8H A;  3PBS A;  4G3W A;  3F1N A;  3DTM A;  2CMN A;  3MXS A;  4KUO A;  3VSL A;  1LLB A;  2GJ3 A;  1N9N A;  4R3J A;  5G18 A;  3MMH A;  1ESU A;  3NOP C;  5K5B A;  3HUM A;  3F1P A;  3IHA A;  2VZW A;  2PU2 A;  5EFW A;  3VFH A;  3G31 A;  2HGV A;  2UWX A;  3LID A;  5FAS A;  1L0D A;  2V1A A;  2V1B A;  1OT6 A;  4DXB A;  2Y2O A;  1Z09 A;  4OQH A;  2J7V A;  1I2W A;  2I72 A;  3I7J A;  4MDZ A;  1EI5 A;  4E3M A;  1OJ5 A;  3V39 A;  1G6A A;  2HP9 A;  4DF6 A;  3G35 A;  4JXW A;  3G32 A;  3C30 A;  3HLG A;  5AJG A;  1Z6F A;  1YLY A;  4N9L A;  4GD6 A;  4GDN A;  1L3L A;  1FR1 A;  1NRJ A;  1S4R A;  4FH2 A;  4KZ8 A;  3B3X A;  3NCK A;  3VP1 A;  2OOL A;  4C75 A;  1KE0 A;  3VOZ A;  5HWV A;  3BFG A;  3H82 A;  5HAQ A;  4JXV A;  4R23 A;  3NC8 A;  2V2F F;  1LSV A;  4U3T A;  1H5X A;  2ZMF A;  1PYY A;  4R0Q A;  4EWF A;  1FQG A;  1K56 A;  4OQG A;  2XGN A;  4OKP A;  4BJP A;  1DP8 A;  3O5Y A;  3M2J A;  3RXX A;  1LI9 A;  4N1H A;  3EEA A;  1JWP A;  1MWS A;  1P9W A;  2O9B A;  2PBY A;  4QU3 A;  1M6K A;  3BY8 A;  3WS1 A;  3NDG A;  3SZT A;  1W8Q A;  3LR3 A;  3LEZ A;  2Y2H A;  3BFE A;  1FR6 A;  5FSR A;  3CPT A;  4ARZ B;  4XUX A;  2D02 A;  1KGF A;  1Y28 A;  4OOM A;  2YKH A;  3T4S A;  4IVK A;  4BBT A;  5E2H A;  3F1N B;  1MXO A;  3MKF A;  2H0T A;  5GHX A;  5EVI D;  1BLP A;  1HZO A;  3F1P B;  3FZC A;  4M4X A;  2OWJ A;  4KG5 A;  2Z6D A;  3Q81 A;  1IEM A;  4EXO A;  1N9O A;  4MN7 A;  4CLC A;  4UQI S;  3FKV A;  3IXB A;  2QJ7 A;  5KZH A;  3IS2 A;  4Y0U A;  4HES A;  5EPH A;  2OLV A;  3CG5 A;  5J3W A;  3S7P A;  1ESI A;  3D9Y A;  4EQI A;  3KYQ A;  4H8R A;  4GZB A;  1ONH A;  1K6R A;  4CQH A;  1OTI A;  1FIK A;  1G5U A;  3SS3 A;  3QP1 A;  3OLO A;  1ERO A;  1ZKJ A;  2O99 A;  2RL3 A;  3SS5 A;  4OP5 A;  5TFQ A;  5TGF A;  1BUL A;  1ZC2 A;  5FAP A;  1DJA A;  1WYC A;  1S66 L;  2WGW A;  3PYP A;  3T4K A;  3LY3 A;  5TBM A;  2EFX A;  3LO7 A;  4S2I A;  1LHY A;  5MC7 A;  1YM1 A;  5GLB A;  4DE3 A;  1IYP A;  4FTX A;  3LIC A;  5CGS A;  2KX6 A;  1YLT A;  4Z1W A;  4UA9 A;  4PM7 A;  4KQQ A;  3C4O A;  3WS5 A;  4S2P A;  1AXB A;  4JGP A;  4KZ6 A;  5HL1 A;  3MXR A;  2PT7 A;  4N92 A;  4KZA A;  2HF6 A;  2OSU A;  2QPN A;  4UHU A;  4WN5 A;  2A49 A;  2BG1 A;  4FUW A;  1Y4O A;  3ZNY A;  1VM1 A;  4EUZ A;  3K3D A;  5CHJ A;  4HJ4 A;  3CJM A;  1TDG A;  4HJ3 A;  4JGR A;  1TF1 A;  4ESP A;  5F82 A;  4ETZ A;  2Y2I A;  3CPT B;  1H3Q A;  4B93 A;  1VHM A;  4HH2 A;  3LY4 A;  3MKE A;  2OAP 1;  3A3D A;  4WM9 A;  4OOL A;  4OP8 A;  4R38 A;  4IUH A;  4MCW A;  3QHY A;  3ZG5 A;  4UEY A;  1EW0 A;  2P04 A;  2LB5 A;  1F98 A;  5CED A;  1MY8 A;  4MLL A;  2Z2M B;  1O07 A;  2X01 A;  2XD1 A;  4I3I A;  1E4D A;  2P9V A;  1ES4 A;  3IS2 B;  5L07 A;  4DRT A;  1FSY A;  4GDB A;  3IT9 A;  2A3U A;  2H28 A;  1KVL A;  4DDY A;  3LCE A;  4DJ3 A;  1CEG A;  3ZCZ A;  3ZG0 A;  3A0S A;  2IWB A;  4EQ1 A;  1NWZ A;  2Y91 A;  5CTN A;  2BTF P;  3C2W A;  4F94 A;  3JVV A;  4CJN A;  3LGO A;  3CLO A;  5HDS A;  1FIL A;  3BFC A;  2ZM0 A;  2H10 A;  5JYO A;  1UGU A;  1K57 A;  4MN5 A;  3IHB A;  3UE0 A;  4RA7 A;  1OJG A;  4R4R A;  5TBM B;  1XJ2 A;  1IYS A;  2EFU A;  5F6A A;  1S1Z A;  4D2O A;  1XX2 A;  1PWD A;  4YOF A;  3EOI A;  5A8B A;  5E2E A;  2XFT A;  2PBD P;  2E8I A;  3ZFZ A;  3T12 B;  3LUQ A;  2VA0 A;  3MFD A;  2A24 A;  2Y4A A;  1K55 A;  4GKU A;  1ZTU A;  5CEC A;  2KLI A;  1T18 A;  2QWS A;  3E98 A;  1CJF A;  2ZL1 A;  1YMX A;  3P01 A;  1ODV A;  3F1O A;  3BW6 A;  3PBN A;  5AQA A;  2W1T A;  3FKW A;  4AFI A;  4NKP A;  2H5S A;  4ZRR A;  1XPB A;  2JKG A;  1PWC A;  1LSW A;  3V5M A;  3QP5 A;  4LGW A;  4MN6 A;  2KDK A;  1DP9 A;  1H8M A;  5A91 A;  5L10 A;  1BT5 A;  3S7N A;  1OPX A;  2PD7 A;  1DP6 A;  1K56 D;  2W27 A;  4UA6 A;  4EBN A;  3PTE A;  2Y2G A;  3LI9 A;  5F1G A;  5AVF A;  2EXB A;  5J7E A;  1MWU A;  3M6B A;  1BTL A;  3W4P A;  1ERQ A;  2ZQC A;  3UB8 A;  1SKF A;  3E4Q A;  2P9V B;  4Z9Q A;  2PD8 A;  1XJ4 A;  3A3I A;  1LL8 A;  3N8R A;  2DNS A;  3C4P A;  1MKM A;  2HDQ A;  4JF6 A;  1TS7 A;  3CIT A;  4WEL A;  3M2K A;  3C5A A;  2WZX A;  4HP9 A;  3U2A A;  2GX5 A;  1L0G A;  3WRT A;  1UWP X;  1KDW A;  1RP5 A;  2WKP A;  2V8F A;  3DWK A;  3V3S A;  5GL9 A;  4U0X A;  5M18 A;  1CF0 A;  3HJI A;  2Y2J A;  4R70 A;  3IWI A;  4KZ7 A;  1W7F A;  1KGG A;  2HZ5 A;  5FI7 A;  3VP2 A;  3S22 A;  2VEA A;  3Q7V A;  1XXM A;  2XLN A;  4GHI A;  1S0W A;  4IUK A;  1W8Y A;  4FSF A;  4CLC D;  4S2O A;  5KSC A;  3E2L A;  1PZO A;  1XP4 A;  4OPQ A;  4I3A A;  2WGI A;  2XRO A;  2OLU A;  4HHD A;  5CHM A;  2D01 A;  3KSI A;  4WF0 A;  3NHQ A;  1D06 A;  1UWN X;  3TJZ C;  1KVM A;  5DF7 A;  3BFD A;  5JYP A;  3DW0 A;  4P6B A;  1L0E A;  3F1O B;  3GTC A;  1STZ A;  1RGY A;  3CZD A;  2W1T B;  4QY6 A;  2NUT C;  1K38 A;  4YFM A;  1KDS A;  3PBQ A;  1ES2 A;  1TVF A;  2EXA A;  2WKI A;  3RXW A;  1K0K A;  5AVE A;  3VE4 A;  2VV7 A;  4QY5 A;  1RGZ A;  4K0X A;  4B88 A;  5HPF A;  2ZJ9 A;  3HCY A;  4WMC A;  3P09 A;  3G30 A;  5DKK A;  5HSQ A;  3SS4 A;  3OPP A;  3RFB A;  3DBA A; 
#chains in the Genus database with same CATH homology
 2INW A;  1TS8 A;  2VJW A;  1G6O A;  3BY8 A;  3MXQ A;  3BQA A;  3LR3 A;  3FG8 A;  2B18 A;  1OTB A;  3GDI A;  3E4P A;  4NXF A;  3R4K A;  4ARZ B;  2D02 A;  2GNX A;  1Y28 A;  4MMN A;  4OOM A;  4P6Z S;  2EWV A;  4L9E A;  4ARZ A;  2YKH A;  4FOF A;  3T4S A;  4E04 A;  5DF9 A;  2EWW A;  4BBT A;  4I39 A;  3F1N B;  1JNU A;  4O01 A;  4LRY C;  2PR5 A;  4PKY A;  3H7W A;  3ULF A;  3OC2 A;  3VOL A;  3F1P B;  4M4X A;  2OWJ A;  4WEJ A;  2K7S A;  3PR6 A;  2J3T D;  4CLC B;  2Z6D A;  4EXO A;  4LPZ A;  5DJU A;  4EUV A;  1N9O A;  4ETX A;  3BWL A;  4MN7 A;  4GW9 A;  4UQI S;  4CLC A;  2QJ7 A;  5IS1 A;  3IS2 A;  4NXB A;  4O8G A;  5J3W A;  3S7P A;  1S67 L;  2Y79 A;  2PR6 A;  5F69 A;  3KYQ A;  5HWT A;  4BWI A;  3S7O A;  3LIB A;  4GHI B;  2VX8 A;  2YKF A;  1F9I A;  2WKR A;  4DJ2 A;  3ZYT A;  1XJ6 A;  2W3E A;  4CQH A;  3EWK A;  1OTI A;  4RQ9 A;  3TW8 A;  1OTD A;  2L4R A;  4GCZ A;  1T1B A;  3D3O A;  3LIE A;  3OLO A;  1OT9 A;  1XFQ A;  4B9O A;  4L9F A;  2O99 A;  2PDR A;  3K2N A;  3KSF A;  2G7U A;  4II7 A;  4QPR A;  4ME4 A;  2M1C A;  3MFX A;  2HJE A;  2OAQ 1;  1OTE A;  1TS0 A;  2VKS A;  4GS9 B;  3LFV A;  1T1A A;  1S66 L;  2DMW A;  3PYP A;  3T4K A;  4GS9 A;  2HV1 A;  5TBM A;  3CAX A;  2M7V A;  3PHY A;  4HJ6 A;  2V0U A;  2NUP C;  5MC7 A;  1VB6 A;  4GJ4 A;  4G3K A;  2LB9 A;  5C5K A;  3R7W A;  3LIC A;  3T4O A;  1TS6 A;  3A0V A;  2KX6 A;  3C8C A;  4EEU A;  4K08 A;  3PBO A;  5HL6 A;  2P08 A;  3FPV A;  4Z1W A;  5DFY A;  2W0N A;  2W3H A;  2XA7 M;  4JGP A;  2PT7 A;  2HF6 A;  3IBR A;  4DN0 A;  2K31 A;  2VV8 A;  4WN5 A;  5HD3 A;  4HI4 A;  1P0Z A;  3TRC A;  3EEH A;  5IU1 A;  1BYW A;  3LYX A;  3MJQ A;  2JKR M;  3LR4 A;  3K3D A;  4HH3 A;  5DJT A;  4L0L A;  4IJG A;  3EQU A;  3ICY A;  4HJ4 A;  2KOI A;  2W3G A;  4YNR A;  2IA2 A;  3JVU A;  5HWW A;  4HJ3 A;  4JGR A;  1TF1 A;  2VGL M;  4ETZ A;  5DKL A;  3S7Q A;  1H3Q A;  3LI8 A;  4B93 A;  1VHM A;  2PHY A;  4HH2 A;  5HD5 A;  2OAP 1;  3PBT A;  2ZMV A;  4PAU A;  2I9V A;  4OOL A;  4R38 A;  5FL3 A;  3E4O A;  3CUE A;  3PBR A;  4IUH A;  3ZQ5 A;  4MCW A;  3UMD A;  1S4S A;  3H7W B;  4UEY A;  1EW0 A;  2P04 A;  2W3D A;  4NXE A;  1YKD A;  2LB5 A;  5F68 A;  1F98 A;  2WKQ A;  4HY8 A;  5HDD A;  1ZHH B;  4I3I A;  3LIF A;  2L1M A;  5F5Y A;  3IBJ A;  2JKT I;  3C38 A;  5L8M A;  2J3T C;  4EU0 A;  5DFX A;  1YSP A;  3CUE C;  3T4T A;  3IS2 B;  3KX0 X;  3OBF A;  4LRX C;  1T19 A;  4IHQ A;  1TD5 A;  3T50 A;  4I5S A;  3B42 A;  2H28 A;  3UB9 A;  1V9Y A;  3UE3 A;  1MC0 A;  2JKR I;  4H6J B;  5G4Z A;  5CX7 A;  4DJ3 A;  4EQ1 A;  3A0S A;  4HP4 A;  1G28 A;  1NWZ A;  1F5M A;  4H6J A;  3C2W A;  1LSX A;  2O0Y A;  4WLA A;  3JVV A;  2P7J A;  3B33 A;  3CLO A;  4HQA A;  1W63 Q;  3TE8 A;  5HDS A;  4Q0J A;  3BJN A;  2XRN A;  2PYP A;  1T1C A;  5J4E A;  3FPW A;  3CWF A;  1XFN A;  4I3J A;  4YWZ A;  1UGU A;  3RH8 B;  3OCN A;  2O9A A;  5HDC A;  4MN5 A;  4HOI A;  3MQQ A;  4JGO A;  1OJG A;  2VV6 A;  4I38 A;  5TBM B;  1XJ2 A;  5I5L A;  4EW7 A;  5F6A A;  1S1Z A;  3VV4 A;  2J80 A;  1LT0 A;  1KOU A;  4YOF A;  4EER A;  1GSX A;  3R7W B;  3EOI A;  3VE3 A;  1XJ3 A;  2K2N A;  5HZH A;  5A8B A;  4LRZ E;  4O0P A;  3KSG A;  3LR5 A;  4Y2F A;  4KUK A;  4XT2 B;  4KQD A;  5TJJ A;  2V9A A;  2QJ5 A;  2A24 B;  4JGQ A;  3LUQ A;  3MQO A;  3MQ0 A;  2VA0 A;  2JKT M;  4LLO B;  4XT2 A;  3EGD C;  2A24 A;  3T4Q A;  1ZTU A;  3EGX C;  2KLI A;  3NJA A;  1OTA A;  1T18 A;  1D7E A;  2QWS A;  4KQO A;  1DRM A;  3GEC A;  3E98 A;  3E0Y A;  3H9W A;  1NLY A;  3OOV A;  3P01 A;  2XA7 S;  1ODV A;  3UE6 A;  3F1O A;  3BW6 A;  3PBN A;  4Q0H A;  3W2Z A;  2W1T A;  3V67 A;  2EA9 A;  4AFI A;  2QKP A;  4NKP A;  4ZRR A;  4NEE D;  3B47 A;  3KYZ A;  3D72 A;  5KIZ A;  1LSW A;  2ZOI A;  1P9R A;  4MN6 A;  2KDK A;  2O9C A;  5KSH A;  3K3C A;  1DP9 A;  3EQV A;  3RTY A;  1H8M A;  3LIA A;  2V0W A;  1IFQ A;  1NLZ A;  3FC7 A;  2JN7 A;  3S7N A;  1OPX A;  3G6O A;  4BBU A;  2VGL S;  2PD7 A;  1DP6 A;  2W27 A;  4F3L A;  4P6Z M;  1S1Y A;  4Q0I A;  3LI9 A;  5AVF A;  4EEP A;  5J7E A;  3PXP A;  2ZOH A;  4PHT A;  2QHK A;  3UB8 A;  3E4Q A;  4G3V A;  2PD8 A;  2BAS A;  1XJ4 A;  5LBR A;  3NOU C;  5HPI A;  1LL8 A;  1V9Z A;  2W1R A;  1MKM A;  1TS7 A;  3CIT A;  4WL9 A;  2M7U A;  3CI6 A;  4WEL A;  2B02 A;  4HP9 A;  3U2A A;  2GX5 A;  2Y8H A;  3PBS A;  1UWP X;  3F1N A;  1YAX A;  4G3W A;  2CMN A;  4Y3I A;  4UQI M;  4KUO A;  3SW1 A;  4L9G A;  2A2L A;  2GJ3 A;  3UME A;  1N9N A;  2L0W A;  2WKP A;  3MMH A;  4BBV A;  3NOP C;  5K5B A;  3F1P A;  3NOT C;  2VZW A;  3UB6 A;  5EFW A;  1N9L A;  4CLC E;  2JHE A;  3HJI A;  3MR0 A;  4R70 A;  2HGV A;  3LID A;  2OWH A;  2V1A A;  2V1B A;  4WEK A;  2VEA A;  1OT6 A;  4BMW A;  2QYB A;  2W3F A;  3BQ8 A;  4GHI A;  4IUK A;  2PYR A;  1P97 A;  4FSF A;  4CLC D;  2R78 A;  4CLC C;  4MDZ A;  1OJ5 A;  4I3A A;  4R6L A;  2XRO A;  2Z6C A;  4HHD A;  3C30 A;  4EES A;  4Y5F A;  5AJG A;  1YSQ A;  2FH5 A;  1MZU A;  2D01 A;  4GLQ A;  3KSI A;  3P7N A;  4WF0 A;  3NHQ A;  1NRJ A;  1S4R A;  3MF0 A;  1D06 A;  1UWN X;  1WA9 A;  3TJZ C;  2OOL A;  3H82 B;  4DMZ A;  5G4Y A;  5HWV A;  3F1O B;  1STZ A;  3H82 A;  4PKY G;  2W1T B;  3UB7 A;  4HIA A;  1LSV A;  2NUT C;  4R3A A;  2MJ6 A;  3PBQ A;  2J3W A;  2ZMF A;  2XSS A;  1GSW A;  3A0R A;  1X0O A;  3T4J A;  3HJK A;  5AVE A;  3VE4 A;  2VV7 A;  4EET B;  3LR0 A;  3T4L A;  4BJP A;  1GSV A;  4WUJ A;  2VLG A;  1DP8 A;  2FZ0 A;  3O5Y A;  2GZA A;  4NXG A;  5IT5 A;  5HPF A;  3BY9 A;  3HCY A;  3OCL A;  4F3L B;  3KO6 A;  1W63 M;  1IOU A;  5DKK A;  5HSQ A;  2ZBB A;  3KSH A;  3EEA A;  4HNB A;  3RFB A;  1P9W A;  2HJ9 C;  2O9B A;  3DBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...