4ZJ1A

Crystal structure of p-acrylamido-phenylalanine modified tem1 beta-lactamase from escherichia coli : v216acrf mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHWAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Exploring the potential impact of an expanded genetic code on protein function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 94
structure length 265
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zj1A00
3ZG9B 5IHVA 3VP2A 1ZC2A 3HLCA 4S2KA 1KGFA 3G35A 3VSLA 1DJCA 3NDGA 3VMAA 2Y2OA 3LY3A 1AXBA 4HEFA 5HX9A 1K38A 4C3QA 3ZNYA 4WBGA 3HLGA 3MKEA 4BL3A 1BLCA 4IVKA 4KQQA 4DXCA 4EQIA 1PZOA 2Y2HA 5FDHA 1K6SA 1N4OA 2Q9MA 2ZQ8A 3VP1A 1CEGA 4JXSA 1J9MA 4E3LA 4E3OA 1SCWA 1FSYA 3BYDA 3TOIA 3VFFA 4OH0A 1K55A 1TVFA 1IKIA 4EBPA 3HLBA 1IYSA 1IYPA 4UA9A 4RYEA 4XXRA 4WYYA 1S0WA 3GRJA 1K4EA 3IQAA 3W4OA 3A3FA 1NYYA 2XDMA 3N7WA 3UPPA 3FKWA 1NY0A 1IEMA 1YLYA 3Q1FA 3W4PA 4ZDXA 4KQOA 1PWGA 4OLDA 3C4PA 4KZ3A 3WRTA 3N6IA 2X71A 2Y2JA 2ZC4B 1M6KA 4KZ8A 5CECA 3D4FA 3GVBA 1CI9A 3MFDA 3CMZA 4K0XA 4OPRA 4S2JA 2ZM8A 4U0XA 4GDBA 4MBKA 3UE1A 1K4FA 2Z2LB 2H10A 4GB7A 3NBLA 4S2NC 4X69A 1LI9A 3GQZA 5EOOA 3FYZA 3RXXA 4S2PA 3VP0A 1KVLA 2C5WB 4IBXA 3ZG8B 1BSGA 4HESA 4CJNA 5HW3A 1KE3A 5GL9A 1ERMA 3GR2A 3NY4A 5EUAA 3DWKA 2BLSA 4EBNA 3S22A 1MY8A 5AQ7A 1L2SA 1MWUA 1LHYA 4L0LA 1GHMA 2Y2IA 1XA7A 2Y59A 2EX8A 3ZHHA 4LV2A 2H5SA 4E3IA 5E43A 1PWCA 3ZNTA 1RGZA 4NK3A 2IWBA 4EBLA 2OSUA 4GD6A 5E2GA 2JC7A 1MXOA 2HP9A 1KGEA 3C7UA 3UDIA 3C5AA 2XK1A 3PBRA 3PAEA 2UWXA 4P6BA 3MZEA 5CEDA 3O88A 3G30A 3RXWA 1GHIA 3BLSA 1W5DA 3FKVA 1FSWA 3IHAA 4DDSA 1ES2A 3G34A 5CHJA 3V50A 1IYQA 1TDLA 5HAIA 2WK0A 4M3KA 4ZJ2A 4C75A 5EECA 3OPHA 2Y2NA 5F82A 3NI9A 2HP5A 2C6WB 4WEKA 5CHMA 3SH8A 3VSKA 2X02A 5FAQA 1ESIA 2EXBA 5F1GA 1H8ZA 5FI2A 1YLTA 3DTMA 4JF6A 4IVIA 4KG2A 4RVAA 1BUEA 1LI0A 1NZUA 3N8RA 4N1XA 2XFTA 2ZJ9A 4DDYA 2WAEA 1E3UD 1Q2QA 3BLMA 4NETA 3UE0A 2XGNA 3IF6B 3ZG7B 1E3UA 3BFCA 5DTSA 1ES3A 3IF6A 2XQZA 3IH9A 4OP5A 3UPNA 5HFOA 2WGWA 4U0TA 2ZQ9A 1FR6A 2DRWA 2Y2LA 3IXHA 5CGWA 5FATA 1ERQA 4HBUA 4K91A 1EI5A 5CTNA 1IELA 5BOHA 2WKEA 1YLJA 4ZTKA 1KE0A 4PPRA 3FZCA 5M1AA 5HL1A 4Y0OA 3E2LA 2ZQCA 2H0YA 1CI8A 1O7EA 2J9OA 3LEZA 3W8KA 2B5RA 4RA7A 4UHUA 5FI7A 3M2KA 4JPMA 3B3XA 1W8QA 4B4XA 3M2JA 3V5MA 4D2OA 4PMAA 4WMCD 4Y0UA 3BM6A 2WKIA 3BECA 4WMCA 1HZOA 5HAPA 3CG5A 4OP8A 2XH9A 4MBHA 3WRZA 2ZC3B 3IT9A 1PW1A 3A3JA 1IYOA 1K6RA 3M6HA 5FAPA 1K54C 1E25A 4CPKA 4FD8A 1DJAA 4JLFA 2V1ZA 4P0MA 4DE2A 4DRTA 1I5QA 3DWZA 4E3KA 1XGJA 2E8IA 2Z2MB 4A5RA 4E3JA 5FQMA 3VOYA 2XLNA 3PBQA 3SS3A 1I2SA 4ZAMA 2OLUA 3GSGA 1JTDA 3ITAA 3RJUA 1BZAA 5G18A 4OOLA 3MBZA 3PAGA 2V2FF 4DKIA 3IH8A 4QD4A 1HD8A 4GOGA 4R3JA 1PZPA 1JWVA 3NCKA 5FQQA 2WADA 5FA7A 2WUQA 4YINA 2XD5A 4RX2A 4S2NA 1YT4A 1YLZA 5GLAA 2WKHA 3BFFA 5A90A 3CZDA 1DJBA 4BD1A 2Q9NA 1PYYA 3AGEA 4GD8A 4WELA 4HBTA 1XGIA 3IF5A 2FFYA 1SHVA 4OKPA 1G68A 5J8XA 2HP6A 4B4ZA 4H8RA 1GA9A 2DCFA 1WE4A 2HDQA 4R1GA 1QMFA 1NXYA 3WS0A 5FQKA 4KZ6A 4EWFA 2P9VA 3C7VA 2Y2QA 2Y55A 3QHYA 4OPQA 3DW0A 4OOYA 5AQAA 1MBLA 5FQ9A 1L0GA 4XUXA 2GDNA 1ONGA 1K57A 5CTMA 3AGFA 4XUZA 1SDEA 4OOMA 3WS4A 1W79A 2PU4A 1NZOA 2WZXA 1O07A 3W4QA 4MNRA 5D3OA 3HLEA 2EFXA 5DF9A 5DVAA 3HLFA 4Y0TA 2DNSA 1CK3A 2ZC6B 1PI5A 1H5XA 4QJGA 4S2LA 2Y2MA 4OVDA 2QZ6A 1U60A 1K57C 1ZG4A 4IBRA 4LV3A 3SH9A 3IHBA 5M19A 1MKIA 4FH2A 5FAOA 4PM5A 5F83A 2ZM2A 3JYIA 2EFUA 4EV4A 2JCHA 3Q82A 1NJ4A 3HUOA 4LENA 4MEZA 3OPRA 1JTGA 2PBYA 1L0FA 4UAAA 3PBNA 5FASA 1L0EA 3WS2A 5A92A 5CEBA 5I94A 3SH7A 2VGKA 2I72A 1BLPA 4LCLA 1W8YA 2Y91A 1W7FA 5EOEA 1NRFA 2QMIA 3BEBA 1Y54A 2BG1A 5CXWA 1G6AA 3ZG5A 2OLVA 4IEDA 1GHPA 3UY6A 2J9PA 4WM9A 4LCMA 3NDEA 4YFMA 4U3TA 4KENB 4N92A 4QY5A 2JBFA 2Y2KA 5GHXA 1MWTA 4DE1A 1TEMA 1SDNA 2WGWB 2WGVA 3P09A 2X01A 4KG6A 3PBSA 1TDGA 1CEFA 3IXGA 4RX3A 4KQRA 4GZBA 4ZJ1A 3UNWA 3ZG0A 1BT5A 3WS1A 3UE3A 4N9KA 1YMSA 2WYXA 3G2ZA 5CRFA 1BLSA 4DE0A 3FWLA 3HLWA 4MBFA 4QB8A 1XXMA 2OV5A 3LY4A 4EUZA 3MZDA 3IXBA 2ZC7A 5GHYA 1K54A 4WZ5C 1KVMA 4X56A 3PTEA 4WZ4A 5KMWA 4JXVA 1H8YA 3WS5A 4S2IA 2XD1A 4KG5A 2HDRA 4S2MA 4KZBA 2VGJA 1FCOA 2FFFB 1GA0A 4PM8A 1MPLA 5CGSA 1BULA 4K0WA 3HL9A 3ZFZA 4QU3A 4DE3A 1PI4A 2XR0A 4Y7PA 4OPYA 3ZGAB 4LV1A 2ZQ7A 4E6WA 2R9XA 3VFHA 4FH4A 1JVJA 5DF8A 1MWSA 1XA1A 2ZLYA 3G32A 5EE8A 3Q7VA 1C3BA 3GV9A 4QHCA 2J7VA 5TR7A 1RCJA 4FSFA 3VP4A 3EQUA 2CC1A 3HUNA 2G2WA 4P87A 3WWXA 2RCXA 3O3VA 3Q07A 1NYMA 4OQGA 5HARA 3SS5A 2JE5A 3BFGA 4OPZA 2ZM0A 2A49A 4R0QA 5EVIA 5FSRA 3HVFA 4BJPA 1YM1A 3N8SA 5A93A 1K56D 4O7DA 4UA7A 2HDSA 4JF5A 4OQIA 3OPLA 1KE4A 3CJMA 1K56A 5L2FA 1SKFA 4JBFA 3MZFA 3OCNA 4R3BA 3S4XA 3I7JA 3LCEA 4F94A 1S6RA 5KSCA 3IWOA 1LL5A 3A3DA 2ZMAA 4Q8IA 1ZKJA 3HUMA 3LO7A 5EVIC 1LL9A 5TFQA 1VM1A 4MLLA 3EQVA 4E3NA 5F1FA 1IKGA 3ITBA 5DTTA 3OCLA 2Y4AA 1XX2A 1PIOA 4ZJ3A 5E2EA 4PM6A 2P9VB 1YLPA 1FCMA 1BTLA 4R4RA 4JXWA 1JWPA 3O87A 3G2YA 3IXDA 3BFEA 5M18A 2XFSA 3HLDA 4JKTA 4BD0A 4DF6A 5KSHA 2RL3A 3BFDA 1Q2PA 4GKUA 1OMEA 2WGIA 3A3IA 3HREA 1E4DA 1K55C 5GLDA 4KZ5A 3OC2A 3C4OA 2J8YA 3BRMA 2IWDA 3VP3A 3V3RA 1ES5A 5GLCA 1K25A 5FQIA 5U47A 3SOIA 3G31A 3HBRA 1XKZA 4GN2A 5FQJA 1HVBA 4QY6A 5CERA 4N1HA 4PM7A 1ESUA 1RP5A 2IWCA 2WZZA 5AQ9A 1ALQA 1FCNA 4ID4A 4BQMA 1YQSA 5EVLA 3QNCA 4R4SA 1MWRA 5EPHA 3A3EA 3NC8A 3S1YA 1M40A 1YLWA 1FOFA 4S2OA 3UN7A 4R23A 3ZCZA 3M6BA 2WAFA 1BLHA 4WEJA 4JF4A 1FR1A 1KDWA 1JWZA 4C6YA 3GTCA 5DTKA 5JYPA 3V39A 4X68A 5CHUA 4N9LA 2XF3A 4E3MA 2EXAA 3AGDA 3OZHA 1XPBA 4OLGA 1ONHA 1VQQA 2Y2GA 3IWQA 4X55A 5E2FA 2ZQDA 5TGFA 3ZVTA 4BENA 4UA6A 1FQGA 2ZC5B 4X53A 4FCFA 3QNBA 3ISGA 3UDXA 2XEPA 4B88A 4WZ5A 1QMEA 1GCEA 4OONA 1LLBA 1Z6FA 3IWIA 1PW8A 4LV0A 4GNUA 1N9BA 3N8LA 4PM9A 1KDSA 1I2WA 3PBTA 4KZ7A 3ZVWA 4ZBEA 2EX9A 1DY6A 2ZQAA 4DXBA 3ZDJA 4E6XA 2V20A 3MXRA 1EROA 3V3SA 3UPOA 1XP4A 3P98A 3TSGA 5AQBA 3MXSA 3GMWA 5FI6A 1L0DA 1WYCA 3UO9A 1ZG6A 1PWDA 3SS4A 4BLMA 3OPPA 2H0TA 1EWZA 2EX2A 1YMXA 4KZAA 4GDNA 2P74A 3O86A 2R9WA 4P85A 1ES4A 3UDFA 4JXGA 2EX6A 5DF7A 3E2KA 2G2UA 5E2HA 3Q7VB 3N4IA 5A91A 4KZ9A 4X6TA 2ZD8A 5CGXA 4KZ4A 5GLBA 3TG9A 2PU2A 4BL2A 3MKFA 4OQHA 5GHZA 5HAQA 5JYOA 4OQ0A 2HDUA 3IF6C 4Z9QA 2QPNA 2Y2PA 2HPBA 1HTZA 3G4PA 1WYBA 3PBOA 2A3UA 1RGYA 3Q7ZA 5EVIB 3Q81A 3FV7A 3VOZA 5KZHA 3NIAA 5EVID 1KGGA
chains in the Genus database with same CATH superfamily
5IHVA 3BJNA 1KGFA 3VSLA 1AXBA 4C3QA 3ZNYA 4X1MA 2Q9MA 1P0ZA 3F1PA 3A0RA 3VP1A 1SCWA 4JGPA 3BYDA 3QP8A 2VV6A 4NXFA 5HDDA 1IYSA 3A3FA 1NLZA 1NY0A 2V8FA 2JHEA 3Q1FA 4ZDXA 4BBVA 1H0MA 1F9IA 1F5MA 4KZ3A 2Y2JA 3NECA 3D4FA 3CMZA 4OPRA 4S2JA 3OBFA 2Z2LB 3QP5A 3ZG8B 4HESA 2W3DA 4K08A 3NY4A 3F1NB 3S22A 5AQ7A 1L2SA 3ICYA 1PNEA 1SZVA 2CMNA 1RGZA 3CLOA 4NK3A 1CJFA 2QJ7A 1MXOA 3UDIA 3PBRA 3PAEA 3MZEA 3O88A 1GHIA 3FKVA 3IHAA 1FSWA 4DDSA 4LPZA 3V50A 5CHJA 4ZJ2A 4C75A 2VV7A 3NI9A 3V67A 2EXBA 3L7HA 4M4XA 5HDSA 1YLTA 4KG2A 2ZOIA 4IVIA 3C2WA 3N8RA 4N1XA 2ZJ9A 3D9YA 3IF6B 3ZG7B 3A0SA 5DTSA 1ES3A 1KOUA 3PR6A 3UPNA 2ZQ9A 2Y2LA 3IXHA 5FATA 1ERQA 4HBUA 5CTNA 1YLJA 4Y0OA 4HH3A 1UWPX 4UHUA 2PYPA 2OAP1 3V5MA 4RQ9A 5HAPA 2VA0A 1IYOA 3KSGA 4CPKA 4PKYG 2JKGA 4FD8A 4JLFA 4DRTA 1I5QA 2E8IA 3SS3A 1OTIA 1TD5A 1BZAA 1N9OA 4QWOA 3FC7A 3NCKA 2W1TA 3P7NA 2V1BA 1YLZA 4IUHA 2VGLM 5A90A 3NOUC 3AGEA 4GD8A 4WELA 5TBMB 2O9BA 2ZMFA 2HDQA 4R1GA 2VGLS 2V0WA 4G3KA 1L0GA 2GDNA 1ONGA 1K57A 1SDEA 1W79A 1O07A 4Y13A 4MNRA 4GLQA 4UEYA 1LT0A 2EFXA 5DF9A 3HLFA 2DNSA 2KLIA 2QZ6A 4IBRA 4ETZA 5FAOA 1K0KA 3HUOA 4MEZA 3OPRA 3HJIA 5EV0A 4UAAA 5FASA 1L0EA 3WS2A 5A92A 5CEBA 2I72A 4LCLA 2Y91A 2QMIA 2J3TC 4WM9A 4LCMA 3R7WB 4N92A 4QY5A 2G7UA 2JBFA 2Y2KA 3SW1A 1XJ2A 1SDNA 2WGVA 3P09A 4KG6A 3B47A 3IXGA 4ZJ1A 2MJ6A 3UNWA 3CAXA 3NULA 3ZG0A 1BT5A 5IS1A 5L8MA 2YKHA 2WYXA 1BLSA 1J3WA 4GHIB 4X25A 2ZC7A 4WZ5C 4KUKA 1KVMA 4X56A 4WZ4A 3PTEA 3E98A 5KMWA 1H8YA 4S2IA 4KG5A 4KZBA 5EM0A 3JVVA 4YOFA 2ZL1A 3T4JA 3HL9A 1OTEA 1PI4A 4Y7PA 4WN5A 4E6WA 4EEUA 2K7SA 2ZLYA 1C3BA 3CPTA 3EQUA 4OQGA 5HARA 3SS5A 1S4SA 2PD7A 5A93A 1K56D 4FUWA 4BWIA 1K56A 3LR0A 1SKFA 4JBFA 1XFNA 3IWOA 3A3DA 2ZMAA 4UQIM 1P97A 4Q8IA 1LSVA 5EFWA 5EVIC 5TFQA 3ITBA 5DTTA 3RTYA 2Y4AA 4B93A 2VV8A 1YLPA 2KOIA 4H6JB 1V9YA 4ZRRA 2XFSA 2RL3A 1S4RA 1Q2PA 3HCYA 2WGIA 4II7A 3A3IA 1JNUA 3BRMA 3LIFA 3LUQA 3UE6A 4G3VA 1G6OA 1K25A 5FQIA 3SOIA 3HBRA 3T4QA 4Q0HA 3KX0X 1ALQA 4ID4A 4R4SA 1MWRA 3C38A 2WAFA 1BLHA 1LSWA 1OT6A 4GJ4A 3MQOA 3GTCA 3V39A 1ONHA 2PAVP 3MSHA 3ZVTA 4UA6A 4ARZB 5HSQA 3ISGA 3OLOA 2J3WA 5F69A 2QHKA 1LLBA 1AWIA 1HLUP 3N8LA 3CUEC 1I2WA 1IFQA 4E6XA 2V20A 3MXRA 1EROA 3UPOA 1XP4A 3VOLA 2Y79A 3KYQA 2K2NA 1WYCA 2VK3A 2XA7M 1YMXA 4GDNA 2R9WA 3TE8A 1ES4A 3UDFA 5DF7A 3E2KA 4MN5A 1MC0A 3Q7VB 3N4IA 1T1CA 4KZ9A 5CGXA 4P6ZS 2PU2A 5HAQA 5JYOA 4OQ0A 2QPNA 3G4PA 1WYBA 5FDSA 1RGYA 3Q7ZA 4NXEA 3Q81A 5EVIB 2ZMVA 1MKMA 3NIAA 2B02A 4NG2A 3ZG9B 4LLOB 3G35A 3VMAA 5HX9A 4HEFA 3E4PA 4WBGA 4MDZA 4XT2A 3HLGA 3MKEA 1BLCA 1PZOA 2Y2HA 4I3JA 1K6SA 3UB7A 1CEGA 3VE4A 4AFIA 4OH0A 2OOLA 1IYPA 4EQ1A 4WYYA 3GRJA 3IQAA 3GECA 3BWLA 5K5BA 4KQOA 1PWGA 2L1MA 5HPFA 2ZC4B 1M6KA 3L9KA 2PR5A 1CI9A 3MFDA 4K0XA 1UGUA 5LBRA 4GDBA 1T18A 3UE1A 1K4FA 2H10A 3LGOA 3NBLA 2M7UA 3GQZA 5EOOA 4L9FA 1KVLA 1BSGA 1KE3A 3GR2A 5EUAA 2BLSA 4R38A 2XROA 1OTAA 4Q0IA 1MWUA 4Z1WA 4L0LA 1GHMA 4E3IA 1PWCA 1OJ5A 4Y17A 2OSUA 5E2GA 4EESA 1G5UA 4O8GA 2XK1A 2HJEA 4P6BA 3GDIA 1VEUB 3G30A 3RXWA 1W5DA 1IYQA 1SKOB 3MF0A 4PKYA 3OPHA 1GSXA 2HP5A 2C6WB 3SH8A 3F1OA 1S1ZA 1CQAA 4RVAA 2J80A 4I39A 3BLMA 2XGNA 1NRJA 2XQZA 4OP5A 5AVEA 2WGWA 2D02A 3DTEA 1FR6A 4EUVA 4K91A 2WKEA 1KE0A 5M1AA 5HL1A 1CI8A 2J9OA 2B5RA 3M2KA 5C5KA 4B4XA 5DKKA 4I38A 5DJUA 2WKIA 4JGQA 3CHWP 2JKRM 4KUOA 5J7EA 5EVEA 1PW1A 3S7NA 3M6HA 2V1ZA 3CITA 4P0MA 1PRQA 4DE2A 3IS2A 4EETB 4A5RA 4E3JA 2XLNA 4F3LA 3NOPC 1JTDA 2QKPA 3RJUA 2Z6DA 3MBZA 4GOGA 5L07A 1F98A 1IOUA 2WUQA 2XD5A 4L9EA 4S2NA 3KO6A 2KDKA 4GS9B 1YT4A 3EWKA 3CZDA 1DJBA 4BD1A 2DMWA 1PYYA 4HBTA 2FFYA 5IU1A 4HI4A 4B4ZA 4X1LA 2Z6CA 2W3GA 3BY9A 2NUPC 1WE4A 3U4LP 4KZ6A 2P9VA 3QHYA 2Y2QA 5AQAA 5FEFA 4OOMA 2PU4A 2WZXA 1NZOA 1YAXA 3W4QA 5D3OA 2VX8A 5DVAA 3LI8A 4Y0TA 2ZC6B 1PI5A 1H5XA 4OVDA 1ZG4A 2ZOHA 3IHBA 4FH2A 4PM5A 4Y15A 3JYIA 2EFUA 2JCHA 4Y5FA 4BBTA 2PBYA 1XJ4A 3OOVA 1W8YA 1W7FA 1NRFA 1Y54A 3ZG5A 2OLVA 4IEDA 3UY6A 3NDEA 4YFMA 4KENB 3K3CA 4O0PA 3PBSA 1TDGA 4KQRA 3CI6A 1N9NA 2JKTM 4DJ3A 1YKDA 3MS6A 3UE3A 3G2ZA 5CRFA 4MBFA 4QB8A 3IXBA 1K54A 3T1QB 3WS5A 1LSXA 2HDRA 2FFFB 3IBRA 4HNBA 5CGSA 1BULA 4K0WA 4OPYA 4DMZA 2QJ5A 4LV1A 2R9XA 4FH4A 5DF8A 1XA1A 3G32A 4IHQA 2IA2A 2J7VA 5FL3A 2CC1A 3HUNA 2G2WA 4D60A 3Q07A 3BQ8A 1Z09A 2PBDP 2XRNA 3BFGA 4DJ2A 2ZM0A 2HDSA 2HGVA 4OQIA 3CJMA 3S4XA 3OCNA 4R3AA 4R3BA 5KSCA 1LL5A 2L0WA 1ZKJA 4BBUA 3HUMA 2PT7A 1LL9A 3H7WB 3H9WA 3EQVA 4E3NA 5F1FA 1YSQA 3OCLA 3C8CA 3HJKA 1PIOA 5E2EA 3QP4A 1JWPA 2PRFA 5M18A 1UWNX 3E4OA 4BD0A 4DF6A 4GKUA 3HREA 4KZ5A 3C4OA 1ZTUA 3KYEA 3VP3A 5GLCA 3G31A 1D06A 3VV4A 2W3HA 2GZAA 3S7OA 5CERA 1RP5A 2IWCA 4BQMA 4ME4A 3LR5A 3A3EA 4R23A 3F1NA 1FR1A 5DTKA 5CHUA 2XF3A 3EOIA 1XPBA 1VQQA 5E2FA 5TGFA 1FILA 1H8MA 3UDXA 4WL9A 1GSWA 3ZQ5A 2VKSA 4CLCE 2GJ3A 4PM9A 4MN7A 1KDSA 3PBTA 2W3EA 2VJWA 1T1AA 3LI9A 3ZDJA 2JKRI 2W1RA 1TS8A 2YKFA 1PWDA 2P74A 1VETB 4JXGA 4CLCC 3EEHA 1S1YA 4OQHA 1GSVA 2Y2PA 3PBOA 3VOZA 1EW0A 3T4OA 2E8JA 4G3WA 1KGGA 2ACGA 3T4TA 1VHMA 1ZC2A 3HLCA 4S2KA 1DJCA 3NDGA 2PDRA 2Y2OA 3LY3A 1ACFA 4BL3A 3T1XA 4KQQA 4DXCA 5FDHA 2ZQ8A 3KYZA 2O99A 4E3OA 3LR3A 1P9RA 1FSYA 3B33A 1IKIA 1N9LA 3HLBA 4UQIS 2EWVA 4HP9A 1S0WA 2O9AA 3UPPA 3W4OA 2GX5A 1D1JA 3FKWA 1IEMA 4OLDA 3C4PA 3IBJA 2X71A 5HPIA 3LIAA 3T50A 1Y28A 3TRCA 5CECA 3LEQA 4U0XA 2ZM8A 4GB7A 4S2NC 2LB9A 5TBMA 4NXGA 3KSFA 4S2PA 3VP0A 5HW3A 1S66L 3UB5P 4EXOA 4EBNA 2Y59A 1XA7A 2EX8A 4LV2A 2H5SA 5E43A 3ZNTA 2OAQ1 3D72A 4GD6A 2JC7A 3C7UA 1KGEA 1DP6A 2UWXA 2A24B 2R78A 3H82B 2QWSA 5A8BA 1ES2A 3G34A 3K3DA 5KIZA 2JKTI 5HAIA 2WK0A 4M3KA 5EECA 5F82A 1VB6A 2Y2NA 4HP4A 5CHMA 1CF0A 3VSKA 3JPUA 2X02A 5FAQA 2D01A 1H8ZA 3DTMA 4CLCB 1BUEA 4MCWA 4DDYA 2WAEA 1E3UD 1Q2QA 4NETA 3R7WA 1E3UA 3P01A 3BFCA 3MFXA 5HFOA 3DBAA 5CGWA 5BOHA 1IELA 4ZTKA 5J4EA 3FZCA 2ZQCA 1O7EA 2WKRA 3LEZA 3B42A 4RA7A 5FI7A 2O9CA 2XA7S 3VE3A 1W8QA 1D7EA 3M2JA 4GHIA 4PMAA 1A0KA 4WMCD 4Y0UA 5HDCA 3BM6A 4WMCA 1HZOA 4OP8A 4HY8A 3WRZA 3PYPA 2ZC3B 3IT9A 4JGRA 4WF0A 2A2LA 3R4KA 4EERA 5FEGA 1K54C 1E25A 3F1PB 1DJAA 1XGJA 1BYWA 2Z2MB 3PBQA 2OLUA 4Y3IA 2VLGA 5G18A 3PAGA 4R3JA 1PZPA 5FQQA 3SZTA 4RX2A 1XJ3A 2L4RA 1V9ZA 3DTIA 2B95A 1L3LA 1TS0A 2M1CA 5I5LA 4YNRA 1SHVA 1G68A 5J8XA 2HP6A 4H8RA 1GA9A 4FOFA 1QMFA 1NXYA 3WS0A 5FQKA 3C7VA 3TOIA 2Y55A 4H6JA 4OPQA 3DW0A 2XSSA 1T1BA 5G4YA 3WS4A 4HHDA 2W3FA 3S7PA 3KSHA 4QJGA 1U60A 1K57C 4LV3A 4IUKA 5F83A 2FZ0A 3UB8A 3TJZC 4LENA 1JTGA 4LRXC 4QPRA 3PBNA 5I94A 2VGKA 1T19A 1BLPA 3BEBA 5CXWA 2J9PA 4U3TA 2K31A 2P08A 5GHXA 1NLYA 1TEMA 3W2ZA 3EGXC 1PFLA 2X01A 1CEFA 4GZBA 1OT9A 3FWLA 3HLWA 1XXMA 3LY4A 5HZHA 4EUZA 4GW9A 5GHYA 3LIEA 1OTDA 3QP1A 1G28A 4HJ3A 3FG8A 2VGJA 1FCOA 5F5YA 1GA0A 4PM8A 3ZYTA 3ZFZA 5L10A 2XR0A 3ZGAB 2ZQ7A 3VFHA 1MWSA 3LR4A 3Q7VA 3DTKA 3VP4A 4QHCA 5TR7A 1RCJA 4FSFA 4P87A 3WWXA 2RCXA 3O3VA 2BTFP 5G4ZA 3RH8B 2JE5A 5EVIA 5FSRA 2A49A 4R0QA 3T4SA 4BJPA 3HVFA 3BW6A 1YM1A 3N8SA 4EU0A 4JF5A 3LICA 2W1TB 1KE4A 4EEPA 5L2FA 2B18A 4F94A 3I7JA 3LCEA 1S6RA 3LO7A 1VM1A 4MLLA 1IKGA 5DFYA 4ZJ3A 1FCMA 1BTLA 4JXWA 3O87A 3G2YA 3IXDA 3BFEA 3LIBA 4JKTA 5KSHA 1E4DA 1W63Q 5IT5A 3IX3A 2J8YA 2PHYA 2IWDA 1ES5A 3LIDA 5U47A 1XKZA 4GN2A 1YSPA 3QP6A 5AQ9A 2WZZA 5HWTA 5EVLA 4S2OA 3UN7A 5J3WA 4WLAA 4WEJA 4JF4A 1KDWA 1JWZA 4C6YA 5JYPA 2V9AA 4E3MA 2EXAA 5MC7A 2NUTC 4BENA 1FQGA 3UB6A 3CUEA 3O5YA 1VEUA 2XEPA 3FPVA 4B88A 1QMEA 2W0NA 1GCEA 1SKOA 3IWIA 4ETXA 4GNUA 1N9BA 1P9WA 4KZ7A 2EX9A 1DY6A 2ZQAA 2V8CA 1F2KA 3NHQA 3TSGA 3GMWA 1L0DA 2INWA 3UO9A 2ZL1B 4BLMA 3OPPA 1EWZA 2EX2A 4KZAA 4P85A 2EX6A 5HWWA 5E2HA 5A91A 2ZD8A 2AVXA 3TG9A 3CPTB 5GHZA 2HDUA 4Z9QA 4YWZA 2HPBA 3LYXA 1HTZA 3C30A 5HL6A 3FV7A 5KZHA 2EWWA 3VP2A 2OWHA 1K38A 1TF1A 2JN7A 4IVKA 4EQIA 4NXBA 1N4OA 4BMWA 4JXSA 1J9MA 4E3LA 4MN6A 3JVUA 3VFFA 1K55A 1TVFA 4EBPA 5CX7A 4UA9A 3RFBA 4RYEA 4XXRA 1K4EA 3N7WA 1NYYA 2XDMA 3G6OA 3W4PA 1YLYA 4FTXA 1LL8A 3TW8A 3WRTA 3N6IA 1XJ6A 4GS9A 4KZ8A 3GVBA 2H28A 5AVFA 4MBKA 4JGOA 4X69A 1LI9A 3FYZA 3RXXA 4HH2A 4CJNA 4WUJA 2C5WB 4IBXA 1H3QA 3T12B 5GL9A 1ERMA 4HIAA 3DWKA 4PAUA 1MY8A 1NWZA 1LHYA 2P7JA 2Y2IA 3ZHHA 4EBLA 2IWBA 2HF6A 3T1SA 2HP9A 3C5AA 1TS6A 3MR0A 5CEDA 3BLSA 1ODVA 1TDLA 1FIKA 4WEKA 5L09A 1YPRA 4L9GA 1ESIA 5F1GA 5FI2A 2QYBA 4JF6A 4I3AA 2M7VA 1LI0A 1NZUA 2XFTA 1OJGA 3UE0A 3QP2A 2V1AA 2ZBBA 3IF6A 3IH9A 1TS7A 4LFUA 4U0TA 4MMNA 2DRWA 1EI5A 4PPRA 5TJJA 3E2LA 3UMDA 2H0YA 3K2NA 3UB9A 3W8KA 4JPMA 3B3XA 4HJ6A 4D2OA 3MXQA 3BECA 3CG5A 2XH9A 4MBHA 5HWVA 3A3JA 1K6RA 4XT2B 5FAPA 5F6AA 4LRZE 4NEED 4B9OA 3MMHA 3DAVA 4KQDA 3DWZA 4E3KA 3IX8A 5FQMA 3VOYA 1I2SA 4ZAMA 3EGDC 1DP8A 3GSGA 3ITAA 4OOLA 2V2FF 4DKIA 3IH8A 4QD4A 1HD8A 1JWVA 1S67L 2WADA 2PD8A 5FA7A 4YINA 5AJGA 5GLAA 2WKHA 3BFFA 2Q9NA 3T1RA 1XGIA 3MQQA 3IF5A 4OKPA 3H7WA 4Q0JA 3NOTC 2DCFA 4IJGA 2PR6A 4EWFA 4OOYA 1MBLA 5FQ9A 4XUXA 5CTMA 3AGFA 4XUZA 4HOIA 2HJ9C 3HLEA 4ESPA 5F68A 1CK3A 2BASA 1X0OA 4S2LA 2Y2MA 3LFVA 2WKQA 3IX4A 3SH9A 4LRYC 5M19A 1MKIA 2PYRA 2ZM2A 2FH5A 4EV4A 4CQHA 3S7QA 2HV1A 3Q82A 1NJ4A 3T4LA 1L0FA 1OTBA 1WA9A 3F1OB 3SH7A 3D3OA 5EOEA 5DFXA 2BG1A 1G6AA 2P04A 1GHPA 3MQ0A 4HJ4A 2Q0OA 2V0UA 1DP9A 4DN0A 4DE1A 1MWTA 5DJTA 2WGWB 2VZWA 4RX3A 3WS1A 4N9KA 3EEAA 1YMSA 4DE0A 3U2AA 2EA9A 2OV5A 3NJAA 3MZDA 2UV0E 4O01A 3PXPA 4JXVA 5DKLA 2XD1A 4S2MA 4P6ZM 2VEAA 3BY8A 4Y2FA 1MPLA 1MZUA 4I3IA 4QU3A 4DE3A 3IS2B 4GCZA 1VETA 4E04A 2Y8HA 1JVJA 5EE8A 1W63M 3MJQA 4F3LB 3GV9A 3PHYA 1NYMA 5HD3A 4OPZA 4UA7A 4O7DA 2O0YA 3OPLA 3MZFA 1DRMA 1XX2A 4PM6A 2P9VB 3FPWA 4R4RA 3HLDA 3BFDA 1OMEA 1K55C 5GLDA 3OC2A 2JKFA 3V3RA 1OPXA 2GNXA 5FQJA 1HVBA 4QY6A 4N1HA 4PM7A 1ESUA 2J3TD 1FCNA 1YQSA 3QNCA 4LGWA 5EPHA 3KSIA 3NC8A 3S1YA 1M40A 2I9VA 1XFQA 4R6LA 1YLWA 1FOFA 3ZCZA 3M6BA 3A0VA 3CWFA 4X68A 4N9LA 2OWJA 3OZHA 3AGDA 4OLGA 2Y2GA 3IWQA 4X55A 2ZQDA 5HD5A 2ZC5B 4X53A 2A24A 1ZHHB 4FCFA 3H82A 3QNBA 3BQAA 4WZ5A 4ARZA 4OONA 3E0YA 1Z6FA 1PW8A 4LV0A 1STZA 3T4KA 3UMEA 4HQAA 2LB5A 3ZVWA 4ZBEA 4DXBA 2HZ5A 4CLCD 1Y4OA 3V3SA 4NKPA 5EM1A 4CLCA 3P98A 4R70A 5AQBA 3ULFA 3MXSA 5FI6A 3E4QA 1ZG6A 4I5SA 3SS4A 4EW7A 2H0TA 3O86A 2KX6A 2G2UA 4X6TA 4KZ4A 5GLBA 4BL2A 3MKFA 3IF6C 2A3UA 2WKPA 4PHTA 5EVID 2W27A
chains in the Genus database with same CATH topology
3ZG9B 5IHVA 3VP2A 1ZC2A 3HLCA 4S2KA 1KGFA 3G35A 3VSLA 1DJCA 3NDGA 3VMAA 2Y2OA 3LY3A 1AXBA 4HEFA 5HX9A 1K38A 4C3QA 3ZNYA 4WBGA 3HLGA 3MKEA 4BL3A 1BLCA 4IVKA 4KQQA 4DXCA 4EQIA 1PZOA 2Y2HA 5FDHA 1K6SA 1N4OA 2Q9MA 2ZQ8A 3VP1A 1CEGA 4JXSA 1J9MA 4E3LA 4E3OA 1SCWA 1FSYA 3BYDA 3TOIA 3VFFA 4OH0A 1K55A 1TVFA 1IKIA 4EBPA 3HLBA 1IYSA 1IYPA 4UA9A 4RYEA 4XXRA 4WYYA 1S0WA 3GRJA 1K4EA 3IQAA 3W4OA 3A3FA 1NYYA 2XDMA 3N7WA 3UPPA 3FKWA 1NY0A 1IEMA 1YLYA 3Q1FA 3W4PA 4ZDXA 4KQOA 1PWGA 4OLDA 3C4PA 4KZ3A 3WRTA 3N6IA 2X71A 2Y2JA 2ZC4B 1M6KA 4KZ8A 5CECA 3D4FA 3GVBA 1CI9A 3MFDA 3CMZA 4K0XA 4OPRA 4S2JA 2ZM8A 4U0XA 4GDBA 4MBKA 3UE1A 1K4FA 2Z2LB 2H10A 4GB7A 3NBLA 4S2NC 4X69A 1LI9A 3GQZA 5EOOA 3FYZA 3RXXA 4S2PA 3VP0A 1KVLA 2C5WB 4IBXA 3ZG8B 1BSGA 4HESA 4CJNA 5HW3A 1KE3A 5GL9A 1ERMA 3GR2A 3NY4A 5EUAA 3DWKA 2BLSA 4EBNA 3S22A 1MY8A 5AQ7A 1L2SA 1MWUA 1LHYA 4L0LA 1GHMA 2Y2IA 1XA7A 2Y59A 2EX8A 3ZHHA 4LV2A 2H5SA 4E3IA 5E43A 1PWCA 3ZNTA 1RGZA 4NK3A 2IWBA 4EBLA 2OSUA 4GD6A 5E2GA 2JC7A 1MXOA 2HP9A 1KGEA 3C7UA 3UDIA 3C5AA 2XK1A 3PBRA 3PAEA 2UWXA 4P6BA 3MZEA 5CEDA 3O88A 3G30A 3RXWA 1GHIA 3BLSA 1W5DA 3FKVA 1FSWA 3IHAA 4DDSA 1ES2A 3G34A 5CHJA 3V50A 1IYQA 1TDLA 5HAIA 2WK0A 4M3KA 4ZJ2A 4C75A 5EECA 3OPHA 2Y2NA 5F82A 3NI9A 2HP5A 2C6WB 4WEKA 5CHMA 3SH8A 3VSKA 2X02A 5FAQA 1ESIA 2EXBA 5F1GA 1H8ZA 5FI2A 1YLTA 3DTMA 4JF6A 4IVIA 4KG2A 4RVAA 1BUEA 1LI0A 1NZUA 3N8RA 4N1XA 2XFTA 2ZJ9A 4DDYA 2WAEA 1E3UD 1Q2QA 3BLMA 4NETA 3UE0A 2XGNA 3IF6B 3ZG7B 1E3UA 3BFCA 5DTSA 1ES3A 3IF6A 2XQZA 3IH9A 4OP5A 3UPNA 5HFOA 2WGWA 4U0TA 2ZQ9A 1FR6A 2DRWA 2Y2LA 3IXHA 5CGWA 5FATA 1ERQA 4HBUA 4K91A 1EI5A 5CTNA 1IELA 5BOHA 2WKEA 1YLJA 4ZTKA 1KE0A 4PPRA 3FZCA 5M1AA 5HL1A 4Y0OA 3E2LA 2ZQCA 2H0YA 1CI8A 1O7EA 2J9OA 3LEZA 3W8KA 2B5RA 4RA7A 4UHUA 5FI7A 3M2KA 4JPMA 3B3XA 1W8QA 4B4XA 3M2JA 3V5MA 4D2OA 4PMAA 4WMCD 4Y0UA 3BM6A 2WKIA 3BECA 4WMCA 1HZOA 5HAPA 3CG5A 4OP8A 2XH9A 4MBHA 3WRZA 2ZC3B 3IT9A 1PW1A 3A3JA 1IYOA 1K6RA 3M6HA 5FAPA 1K54C 1E25A 4CPKA 4FD8A 1DJAA 4JLFA 2V1ZA 4P0MA 4DE2A 4DRTA 1I5QA 3DWZA 4E3KA 1XGJA 2E8IA 2Z2MB 4A5RA 4E3JA 5FQMA 3VOYA 2XLNA 3PBQA 3SS3A 1I2SA 4ZAMA 2OLUA 3GSGA 1JTDA 3ITAA 3RJUA 1BZAA 5G18A 4OOLA 3MBZA 3PAGA 2V2FF 4DKIA 3IH8A 4QD4A 1HD8A 4GOGA 4R3JA 1PZPA 1JWVA 3NCKA 5FQQA 2WADA 5FA7A 2WUQA 4YINA 2XD5A 4RX2A 4S2NA 1YT4A 1YLZA 5GLAA 2WKHA 3BFFA 5A90A 3CZDA 1DJBA 4BD1A 2Q9NA 1PYYA 3AGEA 4GD8A 4WELA 4HBTA 1XGIA 3IF5A 2FFYA 1SHVA 4OKPA 1G68A 5J8XA 2HP6A 4B4ZA 4H8RA 1GA9A 2DCFA 1WE4A 2HDQA 4R1GA 1QMFA 1NXYA 3WS0A 5FQKA 4KZ6A 4EWFA 2P9VA 3C7VA 2Y2QA 2Y55A 3QHYA 4OPQA 3DW0A 4OOYA 5AQAA 1MBLA 5FQ9A 1L0GA 4XUXA 2GDNA 1ONGA 1K57A 5CTMA 3AGFA 4XUZA 1SDEA 4OOMA 3WS4A 1W79A 2PU4A 1NZOA 2WZXA 1O07A 3W4QA 4MNRA 5D3OA 3HLEA 2EFXA 5DF9A 5DVAA 3HLFA 4Y0TA 2DNSA 1CK3A 2ZC6B 1PI5A 1H5XA 4QJGA 4S2LA 2Y2MA 4OVDA 2QZ6A 1U60A 1K57C 1ZG4A 4IBRA 4LV3A 3SH9A 3IHBA 5M19A 1MKIA 4FH2A 5FAOA 4PM5A 5F83A 2ZM2A 3JYIA 2EFUA 4EV4A 2JCHA 3Q82A 1NJ4A 3HUOA 4LENA 4MEZA 3OPRA 1JTGA 2PBYA 1L0FA 4UAAA 3PBNA 5FASA 1L0EA 3WS2A 5A92A 5CEBA 5I94A 3SH7A 2VGKA 2I72A 1BLPA 4LCLA 1W8YA 2Y91A 1W7FA 5EOEA 1NRFA 2QMIA 3BEBA 1Y54A 2BG1A 5CXWA 1G6AA 3ZG5A 2OLVA 4IEDA 1GHPA 3UY6A 2J9PA 4WM9A 4LCMA 3NDEA 4YFMA 4U3TA 4KENB 4N92A 4QY5A 2JBFA 2Y2KA 5GHXA 1MWTA 4DE1A 1TEMA 1SDNA 2WGWB 2WGVA 3P09A 2X01A 4KG6A 3PBSA 1TDGA 1CEFA 3IXGA 4RX3A 4KQRA 4GZBA 4ZJ1A 3UNWA 3ZG0A 1BT5A 3WS1A 3UE3A 4N9KA 1YMSA 2WYXA 3G2ZA 5CRFA 1BLSA 4DE0A 3FWLA 3HLWA 4MBFA 4QB8A 1XXMA 2OV5A 3LY4A 4EUZA 3MZDA 3IXBA 2ZC7A 5GHYA 1K54A 4WZ5C 1KVMA 4X56A 3PTEA 4WZ4A 5KMWA 4JXVA 1H8YA 3WS5A 4S2IA 2XD1A 4KG5A 2HDRA 4S2MA 4KZBA 2VGJA 1FCOA 2FFFB 1GA0A 4PM8A 1MPLA 5CGSA 1BULA 4K0WA 3HL9A 3ZFZA 4QU3A 4DE3A 1PI4A 2XR0A 4Y7PA 4OPYA 3ZGAB 4LV1A 2ZQ7A 4E6WA 2R9XA 3VFHA 4FH4A 1JVJA 5DF8A 1MWSA 1XA1A 2ZLYA 3G32A 5EE8A 3Q7VA 1C3BA 3GV9A 4QHCA 2J7VA 5TR7A 1RCJA 4FSFA 3VP4A 3EQUA 2CC1A 3HUNA 2G2WA 4P87A 3WWXA 2RCXA 3O3VA 3Q07A 1NYMA 4OQGA 5HARA 3SS5A 2JE5A 3BFGA 4OPZA 2ZM0A 2A49A 4R0QA 5EVIA 5FSRA 3HVFA 4BJPA 1YM1A 3N8SA 5A93A 1K56D 4O7DA 4UA7A 2HDSA 4JF5A 4OQIA 3OPLA 1KE4A 3CJMA 1K56A 5L2FA 1SKFA 4JBFA 3MZFA 3OCNA 4R3BA 3S4XA 3I7JA 3LCEA 4F94A 1S6RA 5KSCA 3IWOA 1LL5A 3A3DA 2ZMAA 4Q8IA 1ZKJA 3HUMA 3LO7A 5EVIC 1LL9A 5TFQA 1VM1A 4MLLA 3EQVA 4E3NA 5F1FA 1IKGA 3ITBA 5DTTA 3OCLA 2Y4AA 1XX2A 1PIOA 4ZJ3A 5E2EA 4PM6A 2P9VB 1YLPA 1FCMA 1BTLA 4R4RA 4JXWA 1JWPA 3O87A 3G2YA 3IXDA 3BFEA 5M18A 2XFSA 3HLDA 4JKTA 4BD0A 4DF6A 5KSHA 2RL3A 3BFDA 1Q2PA 4GKUA 1OMEA 2WGIA 3A3IA 3HREA 1E4DA 1K55C 5GLDA 4KZ5A 3OC2A 3C4OA 2J8YA 3BRMA 2IWDA 3VP3A 3V3RA 1ES5A 5GLCA 1K25A 5FQIA 5U47A 3SOIA 3G31A 3HBRA 1XKZA 4GN2A 5FQJA 1HVBA 4QY6A 5CERA 4N1HA 4PM7A 1ESUA 1RP5A 2IWCA 2WZZA 5AQ9A 1ALQA 1FCNA 4ID4A 4BQMA 1YQSA 5EVLA 3QNCA 4R4SA 1MWRA 5EPHA 3A3EA 3NC8A 3S1YA 1M40A 1YLWA 1FOFA 4S2OA 3UN7A 4R23A 3ZCZA 3M6BA 2WAFA 1BLHA 4WEJA 4JF4A 1FR1A 1KDWA 1JWZA 4C6YA 3GTCA 5DTKA 5JYPA 3V39A 4X68A 5CHUA 4N9LA 2XF3A 4E3MA 2EXAA 3AGDA 3OZHA 1XPBA 4OLGA 1ONHA 1VQQA 2Y2GA 3IWQA 4X55A 5E2FA 2ZQDA 5TGFA 3ZVTA 4BENA 4UA6A 1FQGA 2ZC5B 4X53A 4FCFA 3QNBA 3ISGA 3UDXA 2XEPA 4B88A 4WZ5A 1QMEA 1GCEA 4OONA 1LLBA 1Z6FA 3IWIA 1PW8A 4LV0A 4GNUA 1N9BA 3N8LA 4PM9A 1KDSA 1I2WA 3PBTA 4KZ7A 3ZVWA 4ZBEA 2EX9A 1DY6A 2ZQAA 4DXBA 3ZDJA 4E6XA 2V20A 3MXRA 1EROA 3V3SA 3UPOA 1XP4A 3P98A 3TSGA 5AQBA 3MXSA 3GMWA 5FI6A 1L0DA 1WYCA 3UO9A 1ZG6A 1PWDA 3SS4A 4BLMA 3OPPA 2H0TA 1EWZA 2EX2A 1YMXA 4KZAA 4GDNA 2P74A 3O86A 2R9WA 4P85A 1ES4A 3UDFA 4JXGA 2EX6A 5DF7A 3E2KA 2G2UA 5E2HA 3Q7VB 3N4IA 5A91A 4KZ9A 4X6TA 2ZD8A 5CGXA 4KZ4A 5GLBA 3TG9A 2PU2A 4BL2A 3MKFA 4OQHA 5GHZA 5HAQA 5JYOA 4OQ0A 2HDUA 3IF6C 4Z9QA 2QPNA 2Y2PA 2HPBA 1HTZA 3G4PA 1WYBA 3PBOA 2A3UA 1RGYA 3Q7ZA 5EVIB 3Q81A 3FV7A 3VOZA 5KZHA 3NIAA 5EVID 1KGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZG9 B;  5IHV A;  3VP2 A;  1ZC2 A;  3HLC A;  4S2K A;  1KGF A;  3G35 A;  3VSL A;  1DJC A;  3NDG A;  3VMA A;  2Y2O A;  3LY3 A;  1AXB A;  4HEF A;  5HX9 A;  1K38 A;  4C3Q A;  3ZNY A;  4WBG A;  3HLG A;  3MKE A;  4BL3 A;  1BLC A;  4IVK A;  4KQQ A;  4DXC A;  4EQI A;  1PZO A;  2Y2H A;  5FDH A;  1K6S A;  1N4O A;  2Q9M A;  2ZQ8 A;  3VP1 A;  1CEG A;  4JXS A;  1J9M A;  4E3L A;  4E3O A;  1SCW A;  1FSY A;  3BYD A;  3TOI A;  3VFF A;  4OH0 A;  1K55 A;  1TVF A;  1IKI A;  4EBP A;  3HLB A;  1IYS A;  1IYP A;  4UA9 A;  4RYE A;  4XXR A;  4WYY A;  1S0W A;  3GRJ A;  1K4E A;  3IQA A;  3W4O A;  3A3F A;  1NYY A;  2XDM A;  3N7W A;  3UPP A;  3FKW A;  1NY0 A;  1IEM A;  1YLY A;  3Q1F A;  3W4P A;  4ZDX A;  4KQO A;  1PWG A;  4OLD A;  3C4P A;  4KZ3 A;  3WRT A;  3N6I A;  2X71 A;  2Y2J A;  2ZC4 B;  1M6K A;  4KZ8 A;  5CEC A;  3D4F A;  3GVB A;  1CI9 A;  3MFD A;  3CMZ A;  4K0X A;  4OPR A;  4S2J A;  2ZM8 A;  4U0X A;  4GDB A;  4MBK A;  3UE1 A;  1K4F A;  2Z2L B;  2H10 A;  4GB7 A;  3NBL A;  4S2N C;  4X69 A;  1LI9 A;  3GQZ A;  5EOO A;  3FYZ A;  3RXX A;  4S2P A;  3VP0 A;  1KVL A;  2C5W B;  4IBX A;  3ZG8 B;  1BSG A;  4HES A;  4CJN A;  5HW3 A;  1KE3 A;  5GL9 A;  1ERM A;  3GR2 A;  3NY4 A;  5EUA A;  3DWK A;  2BLS A;  4EBN A;  3S22 A;  1MY8 A;  5AQ7 A;  1L2S A;  1MWU A;  1LHY A;  4L0L A;  1GHM A;  2Y2I A;  1XA7 A;  2Y59 A;  2EX8 A;  3ZHH A;  4LV2 A;  2H5S A;  4E3I A;  5E43 A;  1PWC A;  3ZNT A;  1RGZ A;  4NK3 A;  2IWB A;  4EBL A;  2OSU A;  4GD6 A;  5E2G A;  2JC7 A;  1MXO A;  2HP9 A;  1KGE A;  3C7U A;  3UDI A;  3C5A A;  2XK1 A;  3PBR A;  3PAE A;  2UWX A;  4P6B A;  3MZE A;  5CED A;  3O88 A;  3G30 A;  3RXW A;  1GHI A;  3BLS A;  1W5D A;  3FKV A;  1FSW A;  3IHA A;  4DDS A;  1ES2 A;  3G34 A;  5CHJ A;  3V50 A;  1IYQ A;  1TDL A;  5HAI A;  2WK0 A;  4M3K A;  4ZJ2 A;  4C75 A;  5EEC A;  3OPH A;  2Y2N A;  5F82 A;  3NI9 A;  2HP5 A;  2C6W B;  4WEK A;  5CHM A;  3SH8 A;  3VSK A;  2X02 A;  5FAQ A;  1ESI A;  2EXB A;  5F1G A;  1H8Z A;  5FI2 A;  1YLT A;  3DTM A;  4JF6 A;  4IVI A;  4KG2 A;  4RVA A;  1BUE A;  1LI0 A;  1NZU A;  3N8R A;  4N1X A;  2XFT A;  2ZJ9 A;  4DDY A;  2WAE A;  1E3U D;  1Q2Q A;  3BLM A;  4NET A;  3UE0 A;  2XGN A;  3IF6 B;  3ZG7 B;  1E3U A;  3BFC A;  5DTS A;  1ES3 A;  3IF6 A;  2XQZ A;  3IH9 A;  4OP5 A;  3UPN A;  5HFO A;  2WGW A;  4U0T A;  2ZQ9 A;  1FR6 A;  2DRW A;  2Y2L A;  3IXH A;  5CGW A;  5FAT A;  1ERQ A;  4HBU A;  4K91 A;  1EI5 A;  5CTN A;  1IEL A;  5BOH A;  2WKE A;  1YLJ A;  4ZTK A;  1KE0 A;  4PPR A;  3FZC A;  5M1A A;  5HL1 A;  4Y0O A;  3E2L A;  2ZQC A;  2H0Y A;  1CI8 A;  1O7E A;  2J9O A;  3LEZ A;  3W8K A;  2B5R A;  4RA7 A;  4UHU A;  5FI7 A;  3M2K A;  4JPM A;  3B3X A;  1W8Q A;  4B4X A;  3M2J A;  3V5M A;  4D2O A;  4PMA A;  4WMC D;  4Y0U A;  3BM6 A;  2WKI A;  3BEC A;  4WMC A;  1HZO A;  5HAP A;  3CG5 A;  4OP8 A;  2XH9 A;  4MBH A;  3WRZ A;  2ZC3 B;  3IT9 A;  1PW1 A;  3A3J A;  1IYO A;  1K6R A;  3M6H A;  5FAP A;  1K54 C;  1E25 A;  4CPK A;  4FD8 A;  1DJA A;  4JLF A;  2V1Z A;  4P0M A;  4DE2 A;  4DRT A;  1I5Q A;  3DWZ A;  4E3K A;  1XGJ A;  2E8I A;  2Z2M B;  4A5R A;  4E3J A;  5FQM A;  3VOY A;  2XLN A;  3PBQ A;  3SS3 A;  1I2S A;  4ZAM A;  2OLU A;  3GSG A;  1JTD A;  3ITA A;  3RJU A;  1BZA A;  5G18 A;  4OOL A;  3MBZ A;  3PAG A;  2V2F F;  4DKI A;  3IH8 A;  4QD4 A;  1HD8 A;  4GOG A;  4R3J A;  1PZP A;  1JWV A;  3NCK A;  5FQQ A;  2WAD A;  5FA7 A;  2WUQ A;  4YIN A;  2XD5 A;  4RX2 A;  4S2N A;  1YT4 A;  1YLZ A;  5GLA A;  2WKH A;  3BFF A;  5A90 A;  3CZD A;  1DJB A;  4BD1 A;  2Q9N A;  1PYY A;  3AGE A;  4GD8 A;  4WEL A;  4HBT A;  1XGI A;  3IF5 A;  2FFY A;  1SHV A;  4OKP A;  1G68 A;  5J8X A;  2HP6 A;  4B4Z A;  4H8R A;  1GA9 A;  2DCF A;  1WE4 A;  2HDQ A;  4R1G A;  1QMF A;  1NXY A;  3WS0 A;  5FQK A;  4KZ6 A;  4EWF A;  2P9V A;  3C7V A;  2Y2Q A;  2Y55 A;  3QHY A;  4OPQ A;  3DW0 A;  4OOY A;  5AQA A;  1MBL A;  5FQ9 A;  1L0G A;  4XUX A;  2GDN A;  1ONG A;  1K57 A;  5CTM A;  3AGF A;  4XUZ A;  1SDE A;  4OOM A;  3WS4 A;  1W79 A;  2PU4 A;  1NZO A;  2WZX A;  1O07 A;  3W4Q A;  4MNR A;  5D3O A;  3HLE A;  2EFX A;  5DF9 A;  5DVA A;  3HLF A;  4Y0T A;  2DNS A;  1CK3 A;  2ZC6 B;  1PI5 A;  1H5X A;  4QJG A;  4S2L A;  2Y2M A;  4OVD A;  2QZ6 A;  1U60 A;  1K57 C;  1ZG4 A;  4IBR A;  4LV3 A;  3SH9 A;  3IHB A;  5M19 A;  1MKI A;  4FH2 A;  5FAO A;  4PM5 A;  5F83 A;  2ZM2 A;  3JYI A;  2EFU A;  4EV4 A;  2JCH A;  3Q82 A;  1NJ4 A;  3HUO A;  4LEN A;  4MEZ A;  3OPR A;  1JTG A;  2PBY A;  1L0F A;  4UAA A;  3PBN A;  5FAS A;  1L0E A;  3WS2 A;  5A92 A;  5CEB A;  5I94 A;  3SH7 A;  2VGK A;  2I72 A;  1BLP A;  4LCL A;  1W8Y A;  2Y91 A;  1W7F A;  5EOE A;  1NRF A;  2QMI A;  3BEB A;  1Y54 A;  2BG1 A;  5CXW A;  1G6A A;  3ZG5 A;  2OLV A;  4IED A;  1GHP A;  3UY6 A;  2J9P A;  4WM9 A;  4LCM A;  3NDE A;  4YFM A;  4U3T A;  4KEN B;  4N92 A;  4QY5 A;  2JBF A;  2Y2K A;  5GHX A;  1MWT A;  4DE1 A;  1TEM A;  1SDN A;  2WGW B;  2WGV A;  3P09 A;  2X01 A;  4KG6 A;  3PBS A;  1TDG A;  1CEF A;  3IXG A;  4RX3 A;  4KQR A;  4GZB A;  4ZJ1 A;  3UNW A;  3ZG0 A;  1BT5 A;  3WS1 A;  3UE3 A;  4N9K A;  1YMS A;  2WYX A;  3G2Z A;  5CRF A;  1BLS A;  4DE0 A;  3FWL A;  3HLW A;  4MBF A;  4QB8 A;  1XXM A;  2OV5 A;  3LY4 A;  4EUZ A;  3MZD A;  3IXB A;  2ZC7 A;  5GHY A;  1K54 A;  4WZ5 C;  1KVM A;  4X56 A;  3PTE A;  4WZ4 A;  5KMW A;  4JXV A;  1H8Y A;  3WS5 A;  4S2I A;  2XD1 A;  4KG5 A;  2HDR A;  4S2M A;  4KZB A;  2VGJ A;  1FCO A;  2FFF B;  1GA0 A;  4PM8 A;  1MPL A;  5CGS A;  1BUL A;  4K0W A;  3HL9 A;  3ZFZ A;  4QU3 A;  4DE3 A;  1PI4 A;  2XR0 A;  4Y7P A;  4OPY A;  3ZGA B;  4LV1 A;  2ZQ7 A;  4E6W A;  2R9X A;  3VFH A;  4FH4 A;  1JVJ A;  5DF8 A;  1MWS A;  1XA1 A;  2ZLY A;  3G32 A;  5EE8 A;  3Q7V A;  1C3B A;  3GV9 A;  4QHC A;  2J7V A;  5TR7 A;  1RCJ A;  4FSF A;  3VP4 A;  3EQU A;  2CC1 A;  3HUN A;  2G2W A;  4P87 A;  3WWX A;  2RCX A;  3O3V A;  3Q07 A;  1NYM A;  4OQG A;  5HAR A;  3SS5 A;  2JE5 A;  3BFG A;  4OPZ A;  2ZM0 A;  2A49 A;  4R0Q A;  5EVI A;  5FSR A;  3HVF A;  4BJP A;  1YM1 A;  3N8S A;  5A93 A;  1K56 D;  4O7D A;  4UA7 A;  2HDS A;  4JF5 A;  4OQI A;  3OPL A;  1KE4 A;  3CJM A;  1K56 A;  5L2F A;  1SKF A;  4JBF A;  3MZF A;  3OCN A;  4R3B A;  3S4X A;  3I7J A;  3LCE A;  4F94 A;  1S6R A;  5KSC A;  3IWO A;  1LL5 A;  3A3D A;  2ZMA A;  4Q8I A;  1ZKJ A;  3HUM A;  3LO7 A;  5EVI C;  1LL9 A;  5TFQ A;  1VM1 A;  4MLL A;  3EQV A;  4E3N A;  5F1F A;  1IKG A;  3ITB A;  5DTT A;  3OCL A;  2Y4A A;  1XX2 A;  1PIO A;  4ZJ3 A;  5E2E A;  4PM6 A;  2P9V B;  1YLP A;  1FCM A;  1BTL A;  4R4R A;  4JXW A;  1JWP A;  3O87 A;  3G2Y A;  3IXD A;  3BFE A;  5M18 A;  2XFS A;  3HLD A;  4JKT A;  4BD0 A;  4DF6 A;  5KSH A;  2RL3 A;  3BFD A;  1Q2P A;  4GKU A;  1OME A;  2WGI A;  3A3I A;  3HRE A;  1E4D A;  1K55 C;  5GLD A;  4KZ5 A;  3OC2 A;  3C4O A;  2J8Y A;  3BRM A;  2IWD A;  3VP3 A;  3V3R A;  1ES5 A;  5GLC A;  1K25 A;  5FQI A;  5U47 A;  3SOI A;  3G31 A;  3HBR A;  1XKZ A;  4GN2 A;  5FQJ A;  1HVB A;  4QY6 A;  5CER A;  4N1H A;  4PM7 A;  1ESU A;  1RP5 A;  2IWC A;  2WZZ A;  5AQ9 A;  1ALQ A;  1FCN A;  4ID4 A;  4BQM A;  1YQS A;  5EVL A;  3QNC A;  4R4S A;  1MWR A;  5EPH A;  3A3E A;  3NC8 A;  3S1Y A;  1M40 A;  1YLW A;  1FOF A;  4S2O A;  3UN7 A;  4R23 A;  3ZCZ A;  3M6B A;  2WAF A;  1BLH A;  4WEJ A;  4JF4 A;  1FR1 A;  1KDW A;  1JWZ A;  4C6Y A;  3GTC A;  5DTK A;  5JYP A;  3V39 A;  4X68 A;  5CHU A;  4N9L A;  2XF3 A;  4E3M A;  2EXA A;  3AGD A;  3OZH A;  1XPB A;  4OLG A;  1ONH A;  1VQQ A;  2Y2G A;  3IWQ A;  4X55 A;  5E2F A;  2ZQD A;  5TGF A;  3ZVT A;  4BEN A;  4UA6 A;  1FQG A;  2ZC5 B;  4X53 A;  4FCF A;  3QNB A;  3ISG A;  3UDX A;  2XEP A;  4B88 A;  4WZ5 A;  1QME A;  1GCE A;  4OON A;  1LLB A;  1Z6F A;  3IWI A;  1PW8 A;  4LV0 A;  4GNU A;  1N9B A;  3N8L A;  4PM9 A;  1KDS A;  1I2W A;  3PBT A;  4KZ7 A;  3ZVW A;  4ZBE A;  2EX9 A;  1DY6 A;  2ZQA A;  4DXB A;  3ZDJ A;  4E6X A;  2V20 A;  3MXR A;  1ERO A;  3V3S A;  3UPO A;  1XP4 A;  3P98 A;  3TSG A;  5AQB A;  3MXS A;  3GMW A;  5FI6 A;  1L0D A;  1WYC A;  3UO9 A;  1ZG6 A;  1PWD A;  3SS4 A;  4BLM A;  3OPP A;  2H0T A;  1EWZ A;  2EX2 A;  1YMX A;  4KZA A;  4GDN A;  2P74 A;  3O86 A;  2R9W A;  4P85 A;  1ES4 A;  3UDF A;  4JXG A;  2EX6 A;  5DF7 A;  3E2K A;  2G2U A;  5E2H A;  3Q7V B;  3N4I A;  5A91 A;  4KZ9 A;  4X6T A;  2ZD8 A;  5CGX A;  4KZ4 A;  5GLB A;  3TG9 A;  2PU2 A;  4BL2 A;  3MKF A;  4OQH A;  5GHZ A;  5HAQ A;  5JYO A;  4OQ0 A;  2HDU A;  3IF6 C;  4Z9Q A;  2QPN A;  2Y2P A;  2HPB A;  1HTZ A;  3G4P A;  1WYB A;  3PBO A;  2A3U A;  1RGY A;  3Q7Z A;  5EVI B;  3Q81 A;  3FV7 A;  3VOZ A;  5KZH A;  3NIA A;  5EVI D;  1KGG A; 
#chains in the Genus database with same CATH topology
 5IHV A;  3BJN A;  1KGF A;  3VSL A;  1AXB A;  4C3Q A;  3ZNY A;  4X1M A;  2Q9M A;  1P0Z A;  3F1P A;  3A0R A;  3VP1 A;  1SCW A;  4JGP A;  3BYD A;  3QP8 A;  2VV6 A;  4NXF A;  5HDD A;  1IYS A;  3A3F A;  1NLZ A;  1NY0 A;  2V8F A;  2JHE A;  3Q1F A;  4ZDX A;  4BBV A;  1H0M A;  1F9I A;  1F5M A;  4KZ3 A;  2Y2J A;  3NEC A;  3D4F A;  3CMZ A;  4OPR A;  4S2J A;  3OBF A;  2Z2L B;  3QP5 A;  3ZG8 B;  4HES A;  2W3D A;  4K08 A;  3NY4 A;  3F1N B;  3S22 A;  5AQ7 A;  1L2S A;  3ICY A;  1PNE A;  1SZV A;  2CMN A;  1RGZ A;  3CLO A;  4NK3 A;  1CJF A;  2QJ7 A;  1MXO A;  3UDI A;  3PBR A;  3PAE A;  3MZE A;  3O88 A;  1GHI A;  3FKV A;  3IHA A;  1FSW A;  4DDS A;  4LPZ A;  3V50 A;  5CHJ A;  4ZJ2 A;  4C75 A;  2VV7 A;  3NI9 A;  3V67 A;  2EXB A;  3L7H A;  4M4X A;  5HDS A;  1YLT A;  4KG2 A;  2ZOI A;  4IVI A;  3C2W A;  3N8R A;  4N1X A;  2ZJ9 A;  3D9Y A;  3IF6 B;  3ZG7 B;  3A0S A;  5DTS A;  1ES3 A;  1KOU A;  3PR6 A;  3UPN A;  2ZQ9 A;  2Y2L A;  3IXH A;  5FAT A;  1ERQ A;  4HBU A;  5CTN A;  1YLJ A;  4Y0O A;  4HH3 A;  1UWP X;  4UHU A;  2PYP A;  2OAP 1;  3V5M A;  4RQ9 A;  5HAP A;  2VA0 A;  1IYO A;  3KSG A;  4CPK A;  4PKY G;  2JKG A;  4FD8 A;  4JLF A;  4DRT A;  1I5Q A;  2E8I A;  3SS3 A;  1OTI A;  1TD5 A;  1BZA A;  1N9O A;  4QWO A;  3FC7 A;  3NCK A;  2W1T A;  3P7N A;  2V1B A;  1YLZ A;  4IUH A;  2VGL M;  5A90 A;  3NOU C;  3AGE A;  4GD8 A;  4WEL A;  5TBM B;  2O9B A;  2ZMF A;  2HDQ A;  4R1G A;  2VGL S;  2V0W A;  4G3K A;  1L0G A;  2GDN A;  1ONG A;  1K57 A;  1SDE A;  1W79 A;  1O07 A;  4Y13 A;  4MNR A;  4GLQ A;  4UEY A;  1LT0 A;  2EFX A;  5DF9 A;  3HLF A;  2DNS A;  2KLI A;  2QZ6 A;  4IBR A;  4ETZ A;  5FAO A;  1K0K A;  3HUO A;  4MEZ A;  3OPR A;  3HJI A;  5EV0 A;  4UAA A;  5FAS A;  1L0E A;  3WS2 A;  5A92 A;  5CEB A;  2I72 A;  4LCL A;  2Y91 A;  2QMI A;  2J3T C;  4WM9 A;  4LCM A;  3R7W B;  4N92 A;  4QY5 A;  2G7U A;  2JBF A;  2Y2K A;  3SW1 A;  1XJ2 A;  1SDN A;  2WGV A;  3P09 A;  4KG6 A;  3B47 A;  3IXG A;  4ZJ1 A;  2MJ6 A;  3UNW A;  3CAX A;  3NUL A;  3ZG0 A;  1BT5 A;  5IS1 A;  5L8M A;  2YKH A;  2WYX A;  1BLS A;  1J3W A;  4GHI B;  4X25 A;  2ZC7 A;  4WZ5 C;  4KUK A;  1KVM A;  4X56 A;  4WZ4 A;  3PTE A;  3E98 A;  5KMW A;  1H8Y A;  4S2I A;  4KG5 A;  4KZB A;  5EM0 A;  3JVV A;  4YOF A;  2ZL1 A;  3T4J A;  3HL9 A;  1OTE A;  1PI4 A;  4Y7P A;  4WN5 A;  4E6W A;  4EEU A;  2K7S A;  2ZLY A;  1C3B A;  3CPT A;  3EQU A;  4OQG A;  5HAR A;  3SS5 A;  1S4S A;  2PD7 A;  5A93 A;  1K56 D;  4FUW A;  4BWI A;  1K56 A;  3LR0 A;  1SKF A;  4JBF A;  1XFN A;  3IWO A;  3A3D A;  2ZMA A;  4UQI M;  1P97 A;  4Q8I A;  1LSV A;  5EFW A;  5EVI C;  5TFQ A;  3ITB A;  5DTT A;  3RTY A;  2Y4A A;  4B93 A;  2VV8 A;  1YLP A;  2KOI A;  4H6J B;  1V9Y A;  4ZRR A;  2XFS A;  2RL3 A;  1S4R A;  1Q2P A;  3HCY A;  2WGI A;  4II7 A;  3A3I A;  1JNU A;  3BRM A;  3LIF A;  3LUQ A;  3UE6 A;  4G3V A;  1G6O A;  1K25 A;  5FQI A;  3SOI A;  3HBR A;  3T4Q A;  4Q0H A;  3KX0 X;  1ALQ A;  4ID4 A;  4R4S A;  1MWR A;  3C38 A;  2WAF A;  1BLH A;  1LSW A;  1OT6 A;  4GJ4 A;  3MQO A;  3GTC A;  3V39 A;  1ONH A;  2PAV P;  3MSH A;  3ZVT A;  4UA6 A;  4ARZ B;  5HSQ A;  3ISG A;  3OLO A;  2J3W A;  5F69 A;  2QHK A;  1LLB A;  1AWI A;  1HLU P;  3N8L A;  3CUE C;  1I2W A;  1IFQ A;  4E6X A;  2V20 A;  3MXR A;  1ERO A;  3UPO A;  1XP4 A;  3VOL A;  2Y79 A;  3KYQ A;  2K2N A;  1WYC A;  2VK3 A;  2XA7 M;  1YMX A;  4GDN A;  2R9W A;  3TE8 A;  1ES4 A;  3UDF A;  5DF7 A;  3E2K A;  4MN5 A;  1MC0 A;  3Q7V B;  3N4I A;  1T1C A;  4KZ9 A;  5CGX A;  4P6Z S;  2PU2 A;  5HAQ A;  5JYO A;  4OQ0 A;  2QPN A;  3G4P A;  1WYB A;  5FDS A;  1RGY A;  3Q7Z A;  4NXE A;  3Q81 A;  5EVI B;  2ZMV A;  1MKM A;  3NIA A;  2B02 A;  4NG2 A;  3ZG9 B;  4LLO B;  3G35 A;  3VMA A;  5HX9 A;  4HEF A;  3E4P A;  4WBG A;  4MDZ A;  4XT2 A;  3HLG A;  3MKE A;  1BLC A;  1PZO A;  2Y2H A;  4I3J A;  1K6S A;  3UB7 A;  1CEG A;  3VE4 A;  4AFI A;  4OH0 A;  2OOL A;  1IYP A;  4EQ1 A;  4WYY A;  3GRJ A;  3IQA A;  3GEC A;  3BWL A;  5K5B A;  4KQO A;  1PWG A;  2L1M A;  5HPF A;  2ZC4 B;  1M6K A;  3L9K A;  2PR5 A;  1CI9 A;  3MFD A;  4K0X A;  1UGU A;  5LBR A;  4GDB A;  1T18 A;  3UE1 A;  1K4F A;  2H10 A;  3LGO A;  3NBL A;  2M7U A;  3GQZ A;  5EOO A;  4L9F A;  1KVL A;  1BSG A;  1KE3 A;  3GR2 A;  5EUA A;  2BLS A;  4R38 A;  2XRO A;  1OTA A;  4Q0I A;  1MWU A;  4Z1W A;  4L0L A;  1GHM A;  4E3I A;  1PWC A;  1OJ5 A;  4Y17 A;  2OSU A;  5E2G A;  4EES A;  1G5U A;  4O8G A;  2XK1 A;  2HJE A;  4P6B A;  3GDI A;  1VEU B;  3G30 A;  3RXW A;  1W5D A;  1IYQ A;  1SKO B;  3MF0 A;  4PKY A;  3OPH A;  1GSX A;  2HP5 A;  2C6W B;  3SH8 A;  3F1O A;  1S1Z A;  1CQA A;  4RVA A;  2J80 A;  4I39 A;  3BLM A;  2XGN A;  1NRJ A;  2XQZ A;  4OP5 A;  5AVE A;  2WGW A;  2D02 A;  3DTE A;  1FR6 A;  4EUV A;  4K91 A;  2WKE A;  1KE0 A;  5M1A A;  5HL1 A;  1CI8 A;  2J9O A;  2B5R A;  3M2K A;  5C5K A;  4B4X A;  5DKK A;  4I38 A;  5DJU A;  2WKI A;  4JGQ A;  3CHW P;  2JKR M;  4KUO A;  5J7E A;  5EVE A;  1PW1 A;  3S7N A;  3M6H A;  2V1Z A;  3CIT A;  4P0M A;  1PRQ A;  4DE2 A;  3IS2 A;  4EET B;  4A5R A;  4E3J A;  2XLN A;  4F3L A;  3NOP C;  1JTD A;  2QKP A;  3RJU A;  2Z6D A;  3MBZ A;  4GOG A;  5L07 A;  1F98 A;  1IOU A;  2WUQ A;  2XD5 A;  4L9E A;  4S2N A;  3KO6 A;  2KDK A;  4GS9 B;  1YT4 A;  3EWK A;  3CZD A;  1DJB A;  4BD1 A;  2DMW A;  1PYY A;  4HBT A;  2FFY A;  5IU1 A;  4HI4 A;  4B4Z A;  4X1L A;  2Z6C A;  2W3G A;  3BY9 A;  2NUP C;  1WE4 A;  3U4L P;  4KZ6 A;  2P9V A;  3QHY A;  2Y2Q A;  5AQA A;  5FEF A;  4OOM A;  2PU4 A;  2WZX A;  1NZO A;  1YAX A;  3W4Q A;  5D3O A;  2VX8 A;  5DVA A;  3LI8 A;  4Y0T A;  2ZC6 B;  1PI5 A;  1H5X A;  4OVD A;  1ZG4 A;  2ZOH A;  3IHB A;  4FH2 A;  4PM5 A;  4Y15 A;  3JYI A;  2EFU A;  2JCH A;  4Y5F A;  4BBT A;  2PBY A;  1XJ4 A;  3OOV A;  1W8Y A;  1W7F A;  1NRF A;  1Y54 A;  3ZG5 A;  2OLV A;  4IED A;  3UY6 A;  3NDE A;  4YFM A;  4KEN B;  3K3C A;  4O0P A;  3PBS A;  1TDG A;  4KQR A;  3CI6 A;  1N9N A;  2JKT M;  4DJ3 A;  1YKD A;  3MS6 A;  3UE3 A;  3G2Z A;  5CRF A;  4MBF A;  4QB8 A;  3IXB A;  1K54 A;  3T1Q B;  3WS5 A;  1LSX A;  2HDR A;  2FFF B;  3IBR A;  4HNB A;  5CGS A;  1BUL A;  4K0W A;  4OPY A;  4DMZ A;  2QJ5 A;  4LV1 A;  2R9X A;  4FH4 A;  5DF8 A;  1XA1 A;  3G32 A;  4IHQ A;  2IA2 A;  2J7V A;  5FL3 A;  2CC1 A;  3HUN A;  2G2W A;  4D60 A;  3Q07 A;  3BQ8 A;  1Z09 A;  2PBD P;  2XRN A;  3BFG A;  4DJ2 A;  2ZM0 A;  2HDS A;  2HGV A;  4OQI A;  3CJM A;  3S4X A;  3OCN A;  4R3A A;  4R3B A;  5KSC A;  1LL5 A;  2L0W A;  1ZKJ A;  4BBU A;  3HUM A;  2PT7 A;  1LL9 A;  3H7W B;  3H9W A;  3EQV A;  4E3N A;  5F1F A;  1YSQ A;  3OCL A;  3C8C A;  3HJK A;  1PIO A;  5E2E A;  3QP4 A;  1JWP A;  2PRF A;  5M18 A;  1UWN X;  3E4O A;  4BD0 A;  4DF6 A;  4GKU A;  3HRE A;  4KZ5 A;  3C4O A;  1ZTU A;  3KYE A;  3VP3 A;  5GLC A;  3G31 A;  1D06 A;  3VV4 A;  2W3H A;  2GZA A;  3S7O A;  5CER A;  1RP5 A;  2IWC A;  4BQM A;  4ME4 A;  3LR5 A;  3A3E A;  4R23 A;  3F1N A;  1FR1 A;  5DTK A;  5CHU A;  2XF3 A;  3EOI A;  1XPB A;  1VQQ A;  5E2F A;  5TGF A;  1FIL A;  1H8M A;  3UDX A;  4WL9 A;  1GSW A;  3ZQ5 A;  2VKS A;  4CLC E;  2GJ3 A;  4PM9 A;  4MN7 A;  1KDS A;  3PBT A;  2W3E A;  2VJW A;  1T1A A;  3LI9 A;  3ZDJ A;  2JKR I;  2W1R A;  1TS8 A;  2YKF A;  1PWD A;  2P74 A;  1VET B;  4JXG A;  4CLC C;  3EEH A;  1S1Y A;  4OQH A;  1GSV A;  2Y2P A;  3PBO A;  3VOZ A;  1EW0 A;  3T4O A;  2E8J A;  4G3W A;  1KGG A;  2ACG A;  3T4T A;  1VHM A;  1ZC2 A;  3HLC A;  4S2K A;  1DJC A;  3NDG A;  2PDR A;  2Y2O A;  3LY3 A;  1ACF A;  4BL3 A;  3T1X A;  4KQQ A;  4DXC A;  5FDH A;  2ZQ8 A;  3KYZ A;  2O99 A;  4E3O A;  3LR3 A;  1P9R A;  1FSY A;  3B33 A;  1IKI A;  1N9L A;  3HLB A;  4UQI S;  2EWV A;  4HP9 A;  1S0W A;  2O9A A;  3UPP A;  3W4O A;  2GX5 A;  1D1J A;  3FKW A;  1IEM A;  4OLD A;  3C4P A;  3IBJ A;  2X71 A;  5HPI A;  3LIA A;  3T50 A;  1Y28 A;  3TRC A;  5CEC A;  3LEQ A;  4U0X A;  2ZM8 A;  4GB7 A;  4S2N C;  2LB9 A;  5TBM A;  4NXG A;  3KSF A;  4S2P A;  3VP0 A;  5HW3 A;  1S66 L;  3UB5 P;  4EXO A;  4EBN A;  2Y59 A;  1XA7 A;  2EX8 A;  4LV2 A;  2H5S A;  5E43 A;  3ZNT A;  2OAQ 1;  3D72 A;  4GD6 A;  2JC7 A;  3C7U A;  1KGE A;  1DP6 A;  2UWX A;  2A24 B;  2R78 A;  3H82 B;  2QWS A;  5A8B A;  1ES2 A;  3G34 A;  3K3D A;  5KIZ A;  2JKT I;  5HAI A;  2WK0 A;  4M3K A;  5EEC A;  5F82 A;  1VB6 A;  2Y2N A;  4HP4 A;  5CHM A;  1CF0 A;  3VSK A;  3JPU A;  2X02 A;  5FAQ A;  2D01 A;  1H8Z A;  3DTM A;  4CLC B;  1BUE A;  4MCW A;  4DDY A;  2WAE A;  1E3U D;  1Q2Q A;  4NET A;  3R7W A;  1E3U A;  3P01 A;  3BFC A;  3MFX A;  5HFO A;  3DBA A;  5CGW A;  5BOH A;  1IEL A;  4ZTK A;  5J4E A;  3FZC A;  2ZQC A;  1O7E A;  2WKR A;  3LEZ A;  3B42 A;  4RA7 A;  5FI7 A;  2O9C A;  2XA7 S;  3VE3 A;  1W8Q A;  1D7E A;  3M2J A;  4GHI A;  4PMA A;  1A0K A;  4WMC D;  4Y0U A;  5HDC A;  3BM6 A;  4WMC A;  1HZO A;  4OP8 A;  4HY8 A;  3WRZ A;  3PYP A;  2ZC3 B;  3IT9 A;  4JGR A;  4WF0 A;  2A2L A;  3R4K A;  4EER A;  5FEG A;  1K54 C;  1E25 A;  3F1P B;  1DJA A;  1XGJ A;  1BYW A;  2Z2M B;  3PBQ A;  2OLU A;  4Y3I A;  2VLG A;  5G18 A;  3PAG A;  4R3J A;  1PZP A;  5FQQ A;  3SZT A;  4RX2 A;  1XJ3 A;  2L4R A;  1V9Z A;  3DTI A;  2B95 A;  1L3L A;  1TS0 A;  2M1C A;  5I5L A;  4YNR A;  1SHV A;  1G68 A;  5J8X A;  2HP6 A;  4H8R A;  1GA9 A;  4FOF A;  1QMF A;  1NXY A;  3WS0 A;  5FQK A;  3C7V A;  3TOI A;  2Y55 A;  4H6J A;  4OPQ A;  3DW0 A;  2XSS A;  1T1B A;  5G4Y A;  3WS4 A;  4HHD A;  2W3F A;  3S7P A;  3KSH A;  4QJG A;  1U60 A;  1K57 C;  4LV3 A;  4IUK A;  5F83 A;  2FZ0 A;  3UB8 A;  3TJZ C;  4LEN A;  1JTG A;  4LRX C;  4QPR A;  3PBN A;  5I94 A;  2VGK A;  1T19 A;  1BLP A;  3BEB A;  5CXW A;  2J9P A;  4U3T A;  2K31 A;  2P08 A;  5GHX A;  1NLY A;  1TEM A;  3W2Z A;  3EGX C;  1PFL A;  2X01 A;  1CEF A;  4GZB A;  1OT9 A;  3FWL A;  3HLW A;  1XXM A;  3LY4 A;  5HZH A;  4EUZ A;  4GW9 A;  5GHY A;  3LIE A;  1OTD A;  3QP1 A;  1G28 A;  4HJ3 A;  3FG8 A;  2VGJ A;  1FCO A;  5F5Y A;  1GA0 A;  4PM8 A;  3ZYT A;  3ZFZ A;  5L10 A;  2XR0 A;  3ZGA B;  2ZQ7 A;  3VFH A;  1MWS A;  3LR4 A;  3Q7V A;  3DTK A;  3VP4 A;  4QHC A;  5TR7 A;  1RCJ A;  4FSF A;  4P87 A;  3WWX A;  2RCX A;  3O3V A;  2BTF P;  5G4Z A;  3RH8 B;  2JE5 A;  5EVI A;  5FSR A;  2A49 A;  4R0Q A;  3T4S A;  4BJP A;  3HVF A;  3BW6 A;  1YM1 A;  3N8S A;  4EU0 A;  4JF5 A;  3LIC A;  2W1T B;  1KE4 A;  4EEP A;  5L2F A;  2B18 A;  4F94 A;  3I7J A;  3LCE A;  1S6R A;  3LO7 A;  1VM1 A;  4MLL A;  1IKG A;  5DFY A;  4ZJ3 A;  1FCM A;  1BTL A;  4JXW A;  3O87 A;  3G2Y A;  3IXD A;  3BFE A;  3LIB A;  4JKT A;  5KSH A;  1E4D A;  1W63 Q;  5IT5 A;  3IX3 A;  2J8Y A;  2PHY A;  2IWD A;  1ES5 A;  3LID A;  5U47 A;  1XKZ A;  4GN2 A;  1YSP A;  3QP6 A;  5AQ9 A;  2WZZ A;  5HWT A;  5EVL A;  4S2O A;  3UN7 A;  5J3W A;  4WLA A;  4WEJ A;  4JF4 A;  1KDW A;  1JWZ A;  4C6Y A;  5JYP A;  2V9A A;  4E3M A;  2EXA A;  5MC7 A;  2NUT C;  4BEN A;  1FQG A;  3UB6 A;  3CUE A;  3O5Y A;  1VEU A;  2XEP A;  3FPV A;  4B88 A;  1QME A;  2W0N A;  1GCE A;  1SKO A;  3IWI A;  4ETX A;  4GNU A;  1N9B A;  1P9W A;  4KZ7 A;  2EX9 A;  1DY6 A;  2ZQA A;  2V8C A;  1F2K A;  3NHQ A;  3TSG A;  3GMW A;  1L0D A;  2INW A;  3UO9 A;  2ZL1 B;  4BLM A;  3OPP A;  1EWZ A;  2EX2 A;  4KZA A;  4P85 A;  2EX6 A;  5HWW A;  5E2H A;  5A91 A;  2ZD8 A;  2AVX A;  3TG9 A;  3CPT B;  5GHZ A;  2HDU A;  4Z9Q A;  4YWZ A;  2HPB A;  3LYX A;  1HTZ A;  3C30 A;  5HL6 A;  3FV7 A;  5KZH A;  2EWW A;  3VP2 A;  2OWH A;  1K38 A;  1TF1 A;  2JN7 A;  4IVK A;  4EQI A;  4NXB A;  1N4O A;  4BMW A;  4JXS A;  1J9M A;  4E3L A;  4MN6 A;  3JVU A;  3VFF A;  1K55 A;  1TVF A;  4EBP A;  5CX7 A;  4UA9 A;  3RFB A;  4RYE A;  4XXR A;  1K4E A;  3N7W A;  1NYY A;  2XDM A;  3G6O A;  3W4P A;  1YLY A;  4FTX A;  1LL8 A;  3TW8 A;  3WRT A;  3N6I A;  1XJ6 A;  4GS9 A;  4KZ8 A;  3GVB A;  2H28 A;  5AVF A;  4MBK A;  4JGO A;  4X69 A;  1LI9 A;  3FYZ A;  3RXX A;  4HH2 A;  4CJN A;  4WUJ A;  2C5W B;  4IBX A;  1H3Q A;  3T12 B;  5GL9 A;  1ERM A;  4HIA A;  3DWK A;  4PAU A;  1MY8 A;  1NWZ A;  1LHY A;  2P7J A;  2Y2I A;  3ZHH A;  4EBL A;  2IWB A;  2HF6 A;  3T1S A;  2HP9 A;  3C5A A;  1TS6 A;  3MR0 A;  5CED A;  3BLS A;  1ODV A;  1TDL A;  1FIK A;  4WEK A;  5L09 A;  1YPR A;  4L9G A;  1ESI A;  5F1G A;  5FI2 A;  2QYB A;  4JF6 A;  4I3A A;  2M7V A;  1LI0 A;  1NZU A;  2XFT A;  1OJG A;  3UE0 A;  3QP2 A;  2V1A A;  2ZBB A;  3IF6 A;  3IH9 A;  1TS7 A;  4LFU A;  4U0T A;  4MMN A;  2DRW A;  1EI5 A;  4PPR A;  5TJJ A;  3E2L A;  3UMD A;  2H0Y A;  3K2N A;  3UB9 A;  3W8K A;  4JPM A;  3B3X A;  4HJ6 A;  4D2O A;  3MXQ A;  3BEC A;  3CG5 A;  2XH9 A;  4MBH A;  5HWV A;  3A3J A;  1K6R A;  4XT2 B;  5FAP A;  5F6A A;  4LRZ E;  4NEE D;  4B9O A;  3MMH A;  3DAV A;  4KQD A;  3DWZ A;  4E3K A;  3IX8 A;  5FQM A;  3VOY A;  1I2S A;  4ZAM A;  3EGD C;  1DP8 A;  3GSG A;  3ITA A;  4OOL A;  2V2F F;  4DKI A;  3IH8 A;  4QD4 A;  1HD8 A;  1JWV A;  1S67 L;  2WAD A;  2PD8 A;  5FA7 A;  4YIN A;  5AJG A;  5GLA A;  2WKH A;  3BFF A;  2Q9N A;  3T1R A;  1XGI A;  3MQQ A;  3IF5 A;  4OKP A;  3H7W A;  4Q0J A;  3NOT C;  2DCF A;  4IJG A;  2PR6 A;  4EWF A;  4OOY A;  1MBL A;  5FQ9 A;  4XUX A;  5CTM A;  3AGF A;  4XUZ A;  4HOI A;  2HJ9 C;  3HLE A;  4ESP A;  5F68 A;  1CK3 A;  2BAS A;  1X0O A;  4S2L A;  2Y2M A;  3LFV A;  2WKQ A;  3IX4 A;  3SH9 A;  4LRY C;  5M19 A;  1MKI A;  2PYR A;  2ZM2 A;  2FH5 A;  4EV4 A;  4CQH A;  3S7Q A;  2HV1 A;  3Q82 A;  1NJ4 A;  3T4L A;  1L0F A;  1OTB A;  1WA9 A;  3F1O B;  3SH7 A;  3D3O A;  5EOE A;  5DFX A;  2BG1 A;  1G6A A;  2P04 A;  1GHP A;  3MQ0 A;  4HJ4 A;  2Q0O A;  2V0U A;  1DP9 A;  4DN0 A;  4DE1 A;  1MWT A;  5DJT A;  2WGW B;  2VZW A;  4RX3 A;  3WS1 A;  4N9K A;  3EEA A;  1YMS A;  4DE0 A;  3U2A A;  2EA9 A;  2OV5 A;  3NJA A;  3MZD A;  2UV0 E;  4O01 A;  3PXP A;  4JXV A;  5DKL A;  2XD1 A;  4S2M A;  4P6Z M;  2VEA A;  3BY8 A;  4Y2F A;  1MPL A;  1MZU A;  4I3I A;  4QU3 A;  4DE3 A;  3IS2 B;  4GCZ A;  1VET A;  4E04 A;  2Y8H A;  1JVJ A;  5EE8 A;  1W63 M;  3MJQ A;  4F3L B;  3GV9 A;  3PHY A;  1NYM A;  5HD3 A;  4OPZ A;  4UA7 A;  4O7D A;  2O0Y A;  3OPL A;  3MZF A;  1DRM A;  1XX2 A;  4PM6 A;  2P9V B;  3FPW A;  4R4R A;  3HLD A;  3BFD A;  1OME A;  1K55 C;  5GLD A;  3OC2 A;  2JKF A;  3V3R A;  1OPX A;  2GNX A;  5FQJ A;  1HVB A;  4QY6 A;  4N1H A;  4PM7 A;  1ESU A;  2J3T D;  1FCN A;  1YQS A;  3QNC A;  4LGW A;  5EPH A;  3KSI A;  3NC8 A;  3S1Y A;  1M40 A;  2I9V A;  1XFQ A;  4R6L A;  1YLW A;  1FOF A;  3ZCZ A;  3M6B A;  3A0V A;  3CWF A;  4X68 A;  4N9L A;  2OWJ A;  3OZH A;  3AGD A;  4OLG A;  2Y2G A;  3IWQ A;  4X55 A;  2ZQD A;  5HD5 A;  2ZC5 B;  4X53 A;  2A24 A;  1ZHH B;  4FCF A;  3H82 A;  3QNB A;  3BQA A;  4WZ5 A;  4ARZ A;  4OON A;  3E0Y A;  1Z6F A;  1PW8 A;  4LV0 A;  1STZ A;  3T4K A;  3UME A;  4HQA A;  2LB5 A;  3ZVW A;  4ZBE A;  4DXB A;  2HZ5 A;  4CLC D;  1Y4O A;  3V3S A;  4NKP A;  5EM1 A;  4CLC A;  3P98 A;  4R70 A;  5AQB A;  3ULF A;  3MXS A;  5FI6 A;  3E4Q A;  1ZG6 A;  4I5S A;  3SS4 A;  4EW7 A;  2H0T A;  3O86 A;  2KX6 A;  2G2U A;  4X6T A;  4KZ4 A;  5GLB A;  4BL2 A;  3MKF A;  3IF6 C;  2A3U A;  2WKP A;  4PHT A;  5EVI D;  2W27 A; 
#chains in the Genus database with same CATH homology
 3ZG9 B;  5IHV A;  3VP2 A;  1ZC2 A;  3HLC A;  4S2K A;  1KGF A;  3G35 A;  3VSL A;  1DJC A;  3NDG A;  3VMA A;  2Y2O A;  3LY3 A;  1AXB A;  4HEF A;  5HX9 A;  1K38 A;  4C3Q A;  3ZNY A;  4WBG A;  3HLG A;  3MKE A;  4BL3 A;  1BLC A;  4IVK A;  4KQQ A;  4DXC A;  4EQI A;  1PZO A;  2Y2H A;  5FDH A;  1K6S A;  1N4O A;  2Q9M A;  2ZQ8 A;  3VP1 A;  1CEG A;  4JXS A;  1J9M A;  4E3L A;  4E3O A;  1SCW A;  1FSY A;  3BYD A;  3TOI A;  3VFF A;  4OH0 A;  1K55 A;  1TVF A;  1IKI A;  4EBP A;  3HLB A;  1IYS A;  1IYP A;  4UA9 A;  4RYE A;  4XXR A;  4WYY A;  1S0W A;  3GRJ A;  1K4E A;  3IQA A;  3W4O A;  3A3F A;  1NYY A;  2XDM A;  3N7W A;  3UPP A;  3FKW A;  1NY0 A;  1IEM A;  1YLY A;  3Q1F A;  3W4P A;  4ZDX A;  4KQO A;  1PWG A;  4OLD A;  3C4P A;  4KZ3 A;  3WRT A;  3N6I A;  2X71 A;  2Y2J A;  2ZC4 B;  1M6K A;  4KZ8 A;  5CEC A;  3D4F A;  3GVB A;  1CI9 A;  3MFD A;  3CMZ A;  4K0X A;  4OPR A;  4S2J A;  2ZM8 A;  4U0X A;  4GDB A;  4MBK A;  3UE1 A;  1K4F A;  2Z2L B;  2H10 A;  4GB7 A;  3NBL A;  4S2N C;  4X69 A;  1LI9 A;  3GQZ A;  5EOO A;  3FYZ A;  3RXX A;  4S2P A;  3VP0 A;  1KVL A;  2C5W B;  4IBX A;  3ZG8 B;  1BSG A;  4HES A;  4CJN A;  5HW3 A;  1KE3 A;  5GL9 A;  1ERM A;  3GR2 A;  3NY4 A;  5EUA A;  3DWK A;  2BLS A;  4EBN A;  3S22 A;  1MY8 A;  5AQ7 A;  1L2S A;  1MWU A;  1LHY A;  4L0L A;  1GHM A;  2Y2I A;  1XA7 A;  2Y59 A;  2EX8 A;  3ZHH A;  4LV2 A;  2H5S A;  4E3I A;  5E43 A;  1PWC A;  3ZNT A;  1RGZ A;  4NK3 A;  2IWB A;  4EBL A;  2OSU A;  4GD6 A;  5E2G A;  2JC7 A;  1MXO A;  2HP9 A;  1KGE A;  3C7U A;  3UDI A;  3C5A A;  2XK1 A;  3PBR A;  3PAE A;  2UWX A;  4P6B A;  3MZE A;  5CED A;  3O88 A;  3G30 A;  3RXW A;  1GHI A;  3BLS A;  1W5D A;  3FKV A;  1FSW A;  3IHA A;  4DDS A;  1ES2 A;  3G34 A;  5CHJ A;  3V50 A;  1IYQ A;  1TDL A;  5HAI A;  2WK0 A;  4M3K A;  4ZJ2 A;  4C75 A;  5EEC A;  3OPH A;  2Y2N A;  5F82 A;  3NI9 A;  2HP5 A;  2C6W B;  4WEK A;  5CHM A;  3SH8 A;  3VSK A;  2X02 A;  5FAQ A;  1ESI A;  2EXB A;  5F1G A;  1H8Z A;  5FI2 A;  1YLT A;  3DTM A;  4JF6 A;  4IVI A;  4KG2 A;  4RVA A;  1BUE A;  1LI0 A;  1NZU A;  3N8R A;  4N1X A;  2XFT A;  2ZJ9 A;  4DDY A;  2WAE A;  1E3U D;  1Q2Q A;  3BLM A;  4NET A;  3UE0 A;  2XGN A;  3IF6 B;  3ZG7 B;  1E3U A;  3BFC A;  5DTS A;  1ES3 A;  3IF6 A;  2XQZ A;  3IH9 A;  4OP5 A;  3UPN A;  5HFO A;  2WGW A;  4U0T A;  2ZQ9 A;  1FR6 A;  2DRW A;  2Y2L A;  3IXH A;  5CGW A;  5FAT A;  1ERQ A;  4HBU A;  4K91 A;  1EI5 A;  5CTN A;  1IEL A;  5BOH A;  2WKE A;  1YLJ A;  4ZTK A;  1KE0 A;  4PPR A;  3FZC A;  5M1A A;  5HL1 A;  4Y0O A;  3E2L A;  2ZQC A;  2H0Y A;  1CI8 A;  1O7E A;  2J9O A;  3LEZ A;  3W8K A;  2B5R A;  4RA7 A;  4UHU A;  5FI7 A;  3M2K A;  4JPM A;  3B3X A;  1W8Q A;  4B4X A;  3M2J A;  3V5M A;  4D2O A;  4PMA A;  4WMC D;  4Y0U A;  3BM6 A;  2WKI A;  3BEC A;  4WMC A;  1HZO A;  5HAP A;  3CG5 A;  4OP8 A;  2XH9 A;  4MBH A;  3WRZ A;  2ZC3 B;  3IT9 A;  1PW1 A;  3A3J A;  1IYO A;  1K6R A;  3M6H A;  5FAP A;  1K54 C;  1E25 A;  4CPK A;  4FD8 A;  1DJA A;  4JLF A;  2V1Z A;  4P0M A;  4DE2 A;  4DRT A;  1I5Q A;  3DWZ A;  4E3K A;  1XGJ A;  2E8I A;  2Z2M B;  4A5R A;  4E3J A;  5FQM A;  3VOY A;  2XLN A;  3PBQ A;  3SS3 A;  1I2S A;  4ZAM A;  2OLU A;  3GSG A;  1JTD A;  3ITA A;  3RJU A;  1BZA A;  5G18 A;  4OOL A;  3MBZ A;  3PAG A;  2V2F F;  4DKI A;  3IH8 A;  4QD4 A;  1HD8 A;  4GOG A;  4R3J A;  1PZP A;  1JWV A;  3NCK A;  5FQQ A;  2WAD A;  5FA7 A;  2WUQ A;  4YIN A;  2XD5 A;  4RX2 A;  4S2N A;  1YT4 A;  1YLZ A;  5GLA A;  2WKH A;  3BFF A;  5A90 A;  3CZD A;  1DJB A;  4BD1 A;  2Q9N A;  1PYY A;  3AGE A;  4GD8 A;  4WEL A;  4HBT A;  1XGI A;  3IF5 A;  2FFY A;  1SHV A;  4OKP A;  1G68 A;  5J8X A;  2HP6 A;  4B4Z A;  4H8R A;  1GA9 A;  2DCF A;  1WE4 A;  2HDQ A;  4R1G A;  1QMF A;  1NXY A;  3WS0 A;  5FQK A;  4KZ6 A;  4EWF A;  2P9V A;  3C7V A;  2Y2Q A;  2Y55 A;  3QHY A;  4OPQ A;  3DW0 A;  4OOY A;  5AQA A;  1MBL A;  5FQ9 A;  1L0G A;  4XUX A;  2GDN A;  1ONG A;  1K57 A;  5CTM A;  3AGF A;  4XUZ A;  1SDE A;  4OOM A;  3WS4 A;  1W79 A;  2PU4 A;  1NZO A;  2WZX A;  1O07 A;  3W4Q A;  4MNR A;  5D3O A;  3HLE A;  2EFX A;  5DF9 A;  5DVA A;  3HLF A;  4Y0T A;  2DNS A;  1CK3 A;  2ZC6 B;  1PI5 A;  1H5X A;  4QJG A;  4S2L A;  2Y2M A;  4OVD A;  2QZ6 A;  1U60 A;  1K57 C;  1ZG4 A;  4IBR A;  4LV3 A;  3SH9 A;  3IHB A;  5M19 A;  1MKI A;  4FH2 A;  5FAO A;  4PM5 A;  5F83 A;  2ZM2 A;  3JYI A;  2EFU A;  4EV4 A;  2JCH A;  3Q82 A;  1NJ4 A;  3HUO A;  4LEN A;  4MEZ A;  3OPR A;  1JTG A;  2PBY A;  1L0F A;  4UAA A;  3PBN A;  5FAS A;  1L0E A;  3WS2 A;  5A92 A;  5CEB A;  5I94 A;  3SH7 A;  2VGK A;  2I72 A;  1BLP A;  4LCL A;  1W8Y A;  2Y91 A;  1W7F A;  5EOE A;  1NRF A;  2QMI A;  3BEB A;  1Y54 A;  2BG1 A;  5CXW A;  1G6A A;  3ZG5 A;  2OLV A;  4IED A;  1GHP A;  3UY6 A;  2J9P A;  4WM9 A;  4LCM A;  3NDE A;  4YFM A;  4U3T A;  4KEN B;  4N92 A;  4QY5 A;  2JBF A;  2Y2K A;  5GHX A;  1MWT A;  4DE1 A;  1TEM A;  1SDN A;  2WGW B;  2WGV A;  3P09 A;  2X01 A;  4KG6 A;  3PBS A;  1TDG A;  1CEF A;  3IXG A;  4RX3 A;  4KQR A;  4GZB A;  4ZJ1 A;  3UNW A;  3ZG0 A;  1BT5 A;  3WS1 A;  3UE3 A;  4N9K A;  1YMS A;  2WYX A;  3G2Z A;  5CRF A;  1BLS A;  4DE0 A;  3FWL A;  3HLW A;  4MBF A;  4QB8 A;  1XXM A;  2OV5 A;  3LY4 A;  4EUZ A;  3MZD A;  3IXB A;  2ZC7 A;  5GHY A;  1K54 A;  4WZ5 C;  1KVM A;  4X56 A;  3PTE A;  4WZ4 A;  5KMW A;  4JXV A;  1H8Y A;  3WS5 A;  4S2I A;  2XD1 A;  4KG5 A;  2HDR A;  4S2M A;  4KZB A;  2VGJ A;  1FCO A;  2FFF B;  1GA0 A;  4PM8 A;  1MPL A;  5CGS A;  1BUL A;  4K0W A;  3HL9 A;  3ZFZ A;  4QU3 A;  4DE3 A;  1PI4 A;  2XR0 A;  4Y7P A;  4OPY A;  3ZGA B;  4LV1 A;  2ZQ7 A;  4E6W A;  2R9X A;  3VFH A;  4FH4 A;  1JVJ A;  5DF8 A;  1MWS A;  1XA1 A;  2ZLY A;  3G32 A;  5EE8 A;  3Q7V A;  1C3B A;  3GV9 A;  4QHC A;  2J7V A;  5TR7 A;  1RCJ A;  4FSF A;  3VP4 A;  3EQU A;  2CC1 A;  3HUN A;  2G2W A;  4P87 A;  3WWX A;  2RCX A;  3O3V A;  3Q07 A;  1NYM A;  4OQG A;  5HAR A;  3SS5 A;  2JE5 A;  3BFG A;  4OPZ A;  2ZM0 A;  2A49 A;  4R0Q A;  5EVI A;  5FSR A;  3HVF A;  4BJP A;  1YM1 A;  3N8S A;  5A93 A;  1K56 D;  4O7D A;  4UA7 A;  2HDS A;  4JF5 A;  4OQI A;  3OPL A;  1KE4 A;  3CJM A;  1K56 A;  5L2F A;  1SKF A;  4JBF A;  3MZF A;  3OCN A;  4R3B A;  3S4X A;  3I7J A;  3LCE A;  4F94 A;  1S6R A;  5KSC A;  3IWO A;  1LL5 A;  3A3D A;  2ZMA A;  4Q8I A;  1ZKJ A;  3HUM A;  3LO7 A;  5EVI C;  1LL9 A;  5TFQ A;  1VM1 A;  4MLL A;  3EQV A;  4E3N A;  5F1F A;  1IKG A;  3ITB A;  5DTT A;  3OCL A;  2Y4A A;  1XX2 A;  1PIO A;  4ZJ3 A;  5E2E A;  4PM6 A;  2P9V B;  1YLP A;  1FCM A;  1BTL A;  4R4R A;  4JXW A;  1JWP A;  3O87 A;  3G2Y A;  3IXD A;  3BFE A;  5M18 A;  2XFS A;  3HLD A;  4JKT A;  4BD0 A;  4DF6 A;  5KSH A;  2RL3 A;  3BFD A;  1Q2P A;  4GKU A;  1OME A;  2WGI A;  3A3I A;  3HRE A;  1E4D A;  1K55 C;  5GLD A;  4KZ5 A;  3OC2 A;  3C4O A;  2J8Y A;  3BRM A;  2IWD A;  3VP3 A;  3V3R A;  1ES5 A;  5GLC A;  1K25 A;  5FQI A;  5U47 A;  3SOI A;  3G31 A;  3HBR A;  1XKZ A;  4GN2 A;  5FQJ A;  1HVB A;  4QY6 A;  5CER A;  4N1H A;  4PM7 A;  1ESU A;  1RP5 A;  2IWC A;  2WZZ A;  5AQ9 A;  1ALQ A;  1FCN A;  4ID4 A;  4BQM A;  1YQS A;  5EVL A;  3QNC A;  4R4S A;  1MWR A;  5EPH A;  3A3E A;  3NC8 A;  3S1Y A;  1M40 A;  1YLW A;  1FOF A;  4S2O A;  3UN7 A;  4R23 A;  3ZCZ A;  3M6B A;  2WAF A;  1BLH A;  4WEJ A;  4JF4 A;  1FR1 A;  1KDW A;  1JWZ A;  4C6Y A;  3GTC A;  5DTK A;  5JYP A;  3V39 A;  4X68 A;  5CHU A;  4N9L A;  2XF3 A;  4E3M A;  2EXA A;  3AGD A;  3OZH A;  1XPB A;  4OLG A;  1ONH A;  1VQQ A;  2Y2G A;  3IWQ A;  4X55 A;  5E2F A;  2ZQD A;  5TGF A;  3ZVT A;  4BEN A;  4UA6 A;  1FQG A;  2ZC5 B;  4X53 A;  4FCF A;  3QNB A;  3ISG A;  3UDX A;  2XEP A;  4B88 A;  4WZ5 A;  1QME A;  1GCE A;  4OON A;  1LLB A;  1Z6F A;  3IWI A;  1PW8 A;  4LV0 A;  4GNU A;  1N9B A;  3N8L A;  4PM9 A;  1KDS A;  1I2W A;  3PBT A;  4KZ7 A;  3ZVW A;  4ZBE A;  2EX9 A;  1DY6 A;  2ZQA A;  4DXB A;  3ZDJ A;  4E6X A;  2V20 A;  3MXR A;  1ERO A;  3V3S A;  3UPO A;  1XP4 A;  3P98 A;  3TSG A;  5AQB A;  3MXS A;  3GMW A;  5FI6 A;  1L0D A;  1WYC A;  3UO9 A;  1ZG6 A;  1PWD A;  3SS4 A;  4BLM A;  3OPP A;  2H0T A;  1EWZ A;  2EX2 A;  1YMX A;  4KZA A;  4GDN A;  2P74 A;  3O86 A;  2R9W A;  4P85 A;  1ES4 A;  3UDF A;  4JXG A;  2EX6 A;  5DF7 A;  3E2K A;  2G2U A;  5E2H A;  3Q7V B;  3N4I A;  5A91 A;  4KZ9 A;  4X6T A;  2ZD8 A;  5CGX A;  4KZ4 A;  5GLB A;  3TG9 A;  2PU2 A;  4BL2 A;  3MKF A;  4OQH A;  5GHZ A;  5HAQ A;  5JYO A;  4OQ0 A;  2HDU A;  3IF6 C;  4Z9Q A;  2QPN A;  2Y2P A;  2HPB A;  1HTZ A;  3G4P A;  1WYB A;  3PBO A;  2A3U A;  1RGY A;  3Q7Z A;  5EVI B;  3Q81 A;  3FV7 A;  3VOZ A;  5KZH A;  3NIA A;  5EVI D;  1KGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...