4ZJ1A

Crystal structure of p-acrylamido-phenylalanine modified tem1 beta-lactamase from escherichia coli : v216acrf mutant
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
265
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHWAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Exploring the potential impact of an expanded genetic code on protein function.
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 265
sequence length 266
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zj1A00
2Y2IA 4R3BA 4S2LA 3OPRA 3SH9A 1I2WA 1L0GA 2HP5A 4X56A 4EUZA 3FYZA 1WYBA 4GDBA 4ZJ3A 2H0YA 2JC7A 4GDNA 1KE3A 1E25A 2A49A 1XXMA 4MLLA 4S2KA 3CG5A 1BSGA 4ZAMA 3HL9A 3LY4A 4EQIA 1KGGA 3ZFZA 4R23A 2WUQA 4P0MA 5GHYA 1YLTA 3ITAA 3G35A 2ZQDA 3N4IA 4C3QA 3HLBA 3M2KA 3MKFA 3P98A 1H8ZA 3BEBA 3BFEA 5CEBA 4E3OA 2Y2NA 1DY6A 1JWZA 1KDSA 2HDRA 3EQUA 1RGZA 1JVJA 3Q7ZA 4WZ4A 5M1AA 3W8KA 1FCOA 5E2HA 1C3BA 3S1YA 4K0WA 3IT9A 4OOMA 2H5SA 3A3DA 4UHUA 5CRFA 3Q1FA 1RCJA 3FZCA 4JPMA 5FQ9A 3BLMA 5FASA 4JKTA 1TDGA 1NYYA 4WZ5C 4E3KA 2OLVA 5FAQA 3EQVA 1ONHA 2Y2QA 2ZQAA 3O3VA 5IHVA 3WRTA 1GHIA 1HZOA 2R9WA 4KQRA 2PU4A 3IXDA 4KZ5A 1ZG4A 4U0TA 3P09A 3HLCA 4Z9QA 4O7DA 3QHYA 1PWCA 3G32A 3PBRA 4LV0A 3HUMA 5HARA 3BLSA 4GOGA 4NETA 3S4XA 1NXYA 3FWLA 3VFHA 2HDSA 1IYQA 3HREA 3GRJA 4GNUA 5FI6A 3CJMA 2ZQ8A 1TVFA 5GHZA 4U0XA 5AQ9A 2EXBA 4WZ5A 4WEJA 1PW8A 4N9LA 3DWZA 4UAAA 1PI5A 3RXWA 3I7JA 3C4PA 3E2KA 3PBOA 2ZC7A 5HW3A 4MBFA 4HEFA 4P87A 5DTTA 1MY8A 4DE0A 5CGXA 4BD1A 3M2JA 4JBFA 4WYYA 1ONGA 2QPNA 3MXSA 5GHXA 3WS2A 2XLNA 2H0TA 1EWZA 3GMWA 3A3JA 3UNWA 2XEPA 4KZ8A 3IWIA 2X01A 1PWDA 2HPBA 4JF5A 3UPOA 1ZKJA 5JYOA 2ZM2A 3A3EA 4K91A 5DF8A 4PM8A 1KVMA 3Q07A 4HESA 5E2EA 5CERA 2ZQ9A 4WEKA 4UA6A 1FSWA 4DE3A 1CI8A 4S2NC 4F94A 1JTGA 4DE2A 2Y2MA 1IKGA 4WMCD 4E3JA 1MKIA 4Y7PA 3MKEA 4OQIA 1LHYA 3PAEA 5CGWA 4KZ3A 3VFFA 1RP5A 1ALQA 4FSFA 4PM9A 3HUNA 1L2SA 4XUZA 5EOEA 5F82A 1HTZA 5CGSA 3SS4A 5HL1A 1YQSA 1E3UD 4FH2A 1FSYA 4E3LA 1BULA 2WGWB 1YMSA 4S2JA 1O7EA 4OPQA 4RVAA 3B3XA 4KG6A 3UO9A 2EX9A 2VGKA 4KZ6A 4S2OA 1VM1A 3GTCA 5FQIA 4N9KA 3Q81A 3VP0A 3NBLA 4S2NA 3BECA 3NDEA 4H8RA 1NY0A 2WK0A 3HLDA 4OKPA 5EVIB 1Z6FA 1YMXA 4RYEA 4RA7A 2XK1A 3N8LA 4GB7A 2Y2OA 4FD8A 3OC2A 3WRZA 1XGIA 1PIOA 1VQQA 2Q9MA 4KG5A 3FV7A 1K56D 3BM6A 3NI9A 4JF6A 1N4OA 4JF4A 1BT5A 1L0DA 1BUEA 3PBTA 2J9PA 2WYXA 3IXHA 5FSRA 5E2GA 2CC1A 1ESUA 1KVLA 1K54A 2V20A 3G2YA 3UE1A 3HBRA 4BQMA 1ES4A 1L0FA 1M6KA 3NCKA 2I72A 2XFTA 3BYDA 4P85A 3UDFA 3HVFA 3G31A 1BLPA 2Y2GA 2P9VB 1XA1A 1BLHA 3M6BA 3VMAA 1PZOA 1FQGA 3IWQA 1O07A 1MWUA 3AGEA 3G2ZA 3W4QA 4HBTA 5CHUA 4JXWA 5TGFA 1FR6A 2ZMAA 4OPYA 5AQBA 1JTDA 1JWVA 3MZDA 5KSHA 2Y55A 2PBYA 2V2FF 3ZNTA 3HLGA 3VP1A 5FAOA 3VOYA 1MPLA 1FR1A 5A92A 5EVIA 5KZHA 4EBNA 3C7VA 3LY3A 4P6BA 3GQZA 5TR7A 3G34A 4OVDA 4ID4A 2WADA 3C5AA 4QHCA 5I94A 5FQQA 3MFDA 2V1ZA 1CEGA 1QMFA 4QD4A 4EBLA 1XPBA 4KZ4A 2XDMA 1YT4A 4R4RA 1J9MA 2XQZA 5EUAA 1LL5A 2ZM0A 3WS1A 1ERQA 3ITBA 4DF6A 5FDHA 2DCFA 3QNBA 2RL3A 4GN2A 3TG9A 4DKIA 1IEMA 3IWOA 1G68A 3IHAA 4WBGA 1N9BA 4WM9A 4GKUA 1ES2A 3O88A 1W8QA 1S6RA 2XR0A 4ZDXA 2DNSA 3LEZA 4ZTKA 1K55C 4OONA 1HD8A 4B4ZA 1PZPA 1RGYA 4XXRA 5KSCA 4R0QA 3UE0A 3ISGA 3OZHA 5J8XA 5M18A 3PBNA 1PYYA 2FFFB 4MNRA 1MWRA 2WZXA 1W79A 1NRFA 1WYCA 3Q82A 4GD6A 1NZOA 2OV5A 4KG2A 4QU3A 2WKIA 2Y4AA 5A91A 3SH7A 4CPKA 3LO7A 4IVIA 2Y2LA 3VSLA 1FCNA 2ZLYA 4LENA 2Y2KA 5EECA 2WAEA 4Y0OA 1Q2PA 4N92A 3HLWA 5D3OA 4BL2A 3DW0A 3AGDA 3IH8A 4E6XA 4DXBA 1K55A 3A3FA 5KMWA 1SDEA 5EPHA 2Z2LB 3OCNA 2HP9A 1E4DA 2XF3A 3CZDA 3PTEA 1BLCA 3NIAA 3N8SA 3V5MA 5BOHA 3WS5A 4NK3A 3PAGA 4XUXA 5CXWA 2IWBA 4IVKA 5HX9A 3SOIA 4DDYA 3PBSA 3MBZA 3Q7VB 2IWCA 4GZBA 2P74A 4C6YA 1KDWA 1NZUA 2PU2A 4QJGA 5A90A 5CECA 3C7UA 5E43A 5FQKA 1TEMA 3GSGA 4MBHA 4E6WA 4PM6A 2ZQ7A 1E3UA 3N6IA 4X53A 4X69A 1LLBA 5HAIA 4S2MA 4B88A 3GV9A 2Y2JA 1H5XA 1PI4A 3V39A 5DF7A 1PWGA 1XKZA 1K38A 4DDSA 3OPPA 4E3IA 3MZEA 2Q9NA 1ES5A 3IF5A 4UA7A 1MXOA 4MEZA 4Q8IA 1IYOA 4OQ0A 4JXSA 3N8RA 1S0WA 3BFDA 3UPPA 1EI5A 1K56A 1YLYA 3IXGA 4QB8A 4OLGA 4A5RA 4JXGA 3ZVTA 2J7VA 1XX2A 3D4FA 1MWSA 3OPLA 3V3RA 2G2UA 4QY6A 5G18A 2QZ6A 2Y2HA 4Y0UA 3HUOA 4DXCA 4PM7A 1GHPA 4KZ9A 3Q7VA 1NYMA 2EXAA 1TDLA 1KE0A 3TOIA 3ZG9B 1PW1A 1SHVA 3FKWA 5L2FA 5FI7A 2JE5A 4FH4A 3QNCA 5GLDA 1DJCA 5HFOA 4DRTA 1K4FA 4Y0TA 5U47A 4GD8A 2EFXA 5M19A 5GL9A 3ZG5A 1OMEA 2WGWA 4KQQA 1Y54A 3RXXA 4BL3A 1XP4A 3A3IA 3ZGAB 1M40A 4M3KA 1K6SA 4K0XA 4QY5A 1L0EA 3W4PA 3ZHHA 4OOYA 1GCEA 3OPHA 3CMZA 4U3TA 5FI2A 4OQGA 1AXBA 3BFCA 1ZC2A 2JBFA 2BG1A 5CTMA 3ZCZA 4HBUA 2IWDA 2OLUA 4S2PA 2UWXA 3VP4A 5F1FA 1KGEA 5AQ7A 4N1XA 3VP3A 2ZC6B 3C4OA 5HAQA 1IYPA 1W5DA 3DWKA 2VGJA 1SKFA 5GLBA 4EWFA 2ZD8A 4EV4A 2JCHA 5EE8A 2P9VA 3UE3A 4PMAA 1CK3A 4OLDA 5EVID 4JLFA 5A93A 1YLZA 1H8YA 2ZC5B 4FCFA 3FKVA 5FA7A 3VOZA 2WAFA 4UA9A 1JWPA 1GA0A 3MZFA 3W4OA 1IKIA 1KGFA 3WS4A 5EOOA 2ZM8A 1W8YA 3M6HA 5DVAA 3SS5A 4KZ7A 3UPNA 2ZC3B 5AQAA 1IYSA 2RCXA 1BTLA 2HP6A 4KQOA 3G4PA 5CHJA 1XGJA 3SS3A 4R4SA 3ZNYA 2WKHA 5GLCA 3BRMA 3GR2A 4OPZA 3V50A 4MBKA 3PBQA 4OQHA 4X6TA 2Y91A 3IQAA 2ZJ9A 3ZG8B 4BD0A 1EROA 3S22A 2GDNA 1YLJA 2XGNA 4R1GA 5DF9A 3IF6B 3ZG7B 4LCMA 4LV1A 5HAPA 1U60A 4JXVA 3RJUA 3E2LA 4OOLA 5EVLA 2XD5A 1NJ4A 4L0LA 3WWXA 1FCMA 1LI9A 3NDGA 1GA9A 3JYIA 2ZQCA 4PPRA 1K57C 4OH0A 5JYPA 1LI0A 1SDNA 4C75A 4WMCA 3OCLA 2WKEA 2EX8A 3NY4A 4B4XA 4BLMA 1ESIA 1FOFA 1IELA 2R9XA 4R3JA 1CI9A 2DRWA 5F1GA 4LCLA 2OSUA 3IXBA 4ZJ2A 2Y2PA 3IF6C 3UDIA 3SH8A 4YFMA 1HVBA 3BFGA 4EBPA 4KENB 4RX3A 2XD1A 1YLPA 4PM5A 4IBXA 3O86A 1W7FA 4X68A 2XFSA 1K57A 2HDUA 2WGIA 3ZG0A 2A3UA 4IBRA 5CHMA 3LCEA 5E2FA 1BZAA 3BFFA 2WZZA 2X02A 3AGFA 2XH9A 4OPRA 4BENA 1MBLA 4N1HA 4KZAA 4OP5A 5FQMA 1MWTA 3VP2A 1ZG6A 1XA7A 2HDQA 3IF6A 3MXRA 1I2SA 2Z2MB 1LL9A 2J9OA 1DJBA 4LV3A 4CJNA 1K4EA 2QMIA 4WELA 2EX6A 4ZBEA 4DE1A 4LV2A 2C6WB 1ERMA 1G6AA 4KZBA 5CEDA 3N7WA 3HLEA 1DJAA 5F83A 1K54C 2ZC4B 1I5QA 3WS0A 2H10A 3UDXA 1QMEA 5DTSA 3O87A 3ZVWA 1BLSA 2E8IA 3G30A 1Q2QA 1YM1A 3GVBA 5FQJA 3NC8A 3V3SA 1K25A 4X55A 2Y59A 1SCWA 3DTMA 4IEDA 3IHBA 4ZJ1A 3UN7A 3ZDJA 1K6RA 2X71A 5FAPA 5TFQA 2G2WA 2BLSA 2WGVA 2EFUA 5CTNA 3UY6A 4D2OA 5FATA 3HLFA 3IH9A 4S2IA 4RX2A 1GHMA 1YLWA 3VSKA 1KE4A 1WE4A 4E3MA 4YINA 3TSGA 4BJPA 2B5RA 5DTKA 4E3NA 2EX2A 1ES3A 2FFYA 5EVIC 4OP8A 5GLAA 2J8YA 2C5WB 1CEFA
chains in the Genus database with same CATH superfamily
5HWTA 2HP5A 3LYXA 1CF0A 4S2KA 2PR6A 1BSGA 1F2KA 1OTAA 3IX3A 3UMDA 3LY4A 1KGGA 1OT9A 1YLTA 3ITAA 1NRJA 4C3QA 4CLCE 3MKFA 1H8ZA 2Y2NA 1DY6A 1RGZA 1FCOA 4GS9A 3FG8A 4OOMA 1TDGA 3S7QA 1ONHA 3O3VA 3WRTA 1GHIA 1HZOA 3KYQA 4U0TA 1ZG4A 3P09A 1VB6A 4O7DA 3QHYA 4LV0A 5HARA 4GOGA 4IUKA 5FL3A 3FWLA 1IYQA 1YKDA 3HREA 3GRJA 3EEAA 1TVFA 4U0XA 2EXBA 4WZ5A 2VA0A 4N9LA 3R7WB 3T4KA 5DTTA 2CMNA 3TJZC 4BD1A 4JBFA 4HJ6A 1ONGA 2J80A 3LICA 1EWZA 3GMWA 3A3JA 4KZ8A 1LSXA 2ZM2A 3NHQA 1XJ4A 2P7JA 2ZQ9A 3BQ8A 1STZA 4GW9A 3LI8A 1LHYA 4UEYA 3VV4A 1ALQA 3F1PB 3HUNA 4XUZA 3JPUA 5F82A 4CLCB 2XROA 1YQSA 4E3LA 4F3LA 1BULA 4S2JA 4QWOA 4RVAA 1VM1A 3NBLA 4S2NA 4H8RA 3NDEA 1D06A 4EERA 4RA7A 4PKYG 3OC2A 1H0MA 4Y13A 2OAQ1 5IT5A 1BT5A 1L0DA 3PBTA 2J9PA 2J3TD 2WYXA 3IXHA 4BQMA 5C5KA 2D01A 3C2WA 2I72A 2NUPC 1BLHA 1PZOA 4LRYC 1O07A 1VHMA 5TGFA 1FR6A 1MPLA 5KZHA 5EVIA 3C38A 2Z6CA 2W3HA 3G34A 4OVDA 4QD4A 3IX8A 4KZ4A 2XDMA 3BW6A 4HJ3A 1OJ5A 1J9MA 2WKPA 4P6ZM 1LL5A 2PHYA 2LB5A 4DKIA 1GSWA 1IEMA 1G68A 4WBGA 1N9BA 4WM9A 3O88A 4AFIA 4ZTKA 4OONA 4FTXA 3G6OA 5KSCA 1PZPA 1RGYA 3SW1A 2K7SA 3H7WA 5M18A 3PBNA 1VEUA 2KDKA 3MQOA 5F69A 2Y4AA 3SH7A 3LO7A 4IVIA 2Y2LA 4LENA 4Y0OA 5D3OA 4N92A 4E6XA 2FZ0A 5KMWA 3A3FA 1V9ZA 3CZDA 4NK3A 1ODVA 2A24B 3PAGA 4XUXA 5CXWA 3PBSA 3MBZA 4GZBA 2W3DA 1KDWA 4HP4A 1T18A 4X69A 1LLBA 3NJAA 2Y2JA 1PI4A 2EWWA 2PYRA 1K38A 3MZEA 3UMEA 1Z09A 4Q8IA 1IYOA 1S0WA 3LFVA 1K56A 2J7VA 2GX5A 1XX2A 1MWSA 3LR3A 2QZ6A 2Y2HA 4ESPA 2J3WA 3HUOA 3B47A 1KE0A 4LPZA 4GLQA 3QNCA 5GLDA 4I3AA 4Y0TA 1A0KA 1K4FA 4ARZB 5M19A 5GL9A 1OMEA 3RXXA 1Y54A 2L1MA 3QP1A 3ZHHA 1L0EA 3W4PA 1GCEA 4XT2A 4OQGA 5FI2A 1TS0A 1AXBA 2VEAA 2JBFA 2PR5A 2BG1A 1TS7A 5K5BA 2JKTI 5AQ7A 3NOPC 3CLOA 3VP3A 3DAVA 4EUVA 1PNEA 2ZL1A 1OPXA 4EV4A 2B02A 1K0KA 2JKRI 1CK3A 4JLFA 2ZC5B 4UA9A 1JWPA 3MZFA 1IKIA 3SS5A 5DVAA 3UPNA 5F5YA 3G4PA 1XGJA 3SS3A 4R4SA 4OPZA 3GR2A 3V50A 4KUOA 2Y91A 3MQ0A 3S22A 3ZG7B 5HAPA 3RJUA 1NJ4A 3WWXA 3F1NB 1LI9A 4MMNA 1JNUA 3TRCA 4M4XA 3KSIA 4BLMA 2HJEA 3T4SA 5F1GA 3IXBA 3P01A 3NULA 2R78A 3T4TA 2PAVP 1TS8A 4CQHA 2HDUA 4IBRA 3LR4A 1TF1A 3D9YA 2XH9A 4N1HA 3EGXC 3UE6A 2UV0E 2HDQA 3IF6A 4L9EA 2Q0OA 1AWIA 3CUEC 4ZBEA 4G3VA 3B33A 3H82B 2V0UA 1W63Q 4ME4A 1DJAA 3MFXA 1YAXA 5IS1A 1K54C 2EWVA 3WS0A 2H10A 5F6AA 2QHKA 3ZVWA 1Q2QA 1YM1A 3V3SA 2Y59A 1SCWA 3UN7A 5HD5A 3R4KA 5TFQA 2G2WA 2KOIA 2BLSA 2WGVA 2EFUA 5FATA 4RX2A 1GHMA 3VSKA 1KE4A 4E3MA 2W1TB 2ZBBA 4EQ1A 5GLAA 5HW3A 2C5WB 3E98A 1CEFA 2Y2IA 4R3BA 3SH9A 4EUZA 1I2WA 4X56A 1WYBA 2W3FA 2H0YA 2VV6A 2YKHA 3D72A 3OBFA 3T1RA 3S7OA 4ZAMA 4EQIA 1D1JA 2ZQDA 3N4IA 3M2KA 3P98A 5CEBA 2PYPA 1JWZA 1KDSA 3DTKA 3EQUA 3LIBA 5M1AA 1C3BA 4UQIS 2DMWA 4K0WA 2H5SA 4UHUA 5FQ9A 3Q1FA 2G7UA 2INWA 2W3EA 3BLMA 5FASA 1NYYA 4WZ5C 4II7A 4KQRA 2PU4A 2VK3A 4Z9QA 1PWCA 4HIAA 1IFQA 4I5SA 1NXYA 2K31A 5FI6A 1V9YA 5J3WA 4WEJA 2GZAA 3BY9A 2O9BA 4DE0A 5CGXA 3M2JA 2QPNA 3MXSA 1OTEA 2H0TA 1NLYA 4MN6A 2XEPA 3IWIA 4JF5A 3UPOA 5G4YA 5JYOA 4DJ3A 1S1YA 5DF8A 5CERA 3LR0A 4WEKA 2PD7A 4UA6A 4S2NC 4F94A 2Y2MA 1IKGA 5CGWA 1RP5A 4FSFA 1L2SA 3IX4A 4WN5A 3R7WA 4DMZA 4FH2A 1FSYA 3UO9A 2VGKA 4NXGA 3VP0A 4N9KA 3MS6A 3BECA 1NY0A 2WK0A 3QP8A 4OKPA 1Z6FA 2XK1A 5HD3A 4FD8A 4GHIB 3CUEA 1XGIA 3FPVA 4KG5A 1K56D 3ICYA 4G3WA 5FSRA 1K54A 3UE1A 3IBRA 4I38A 4P85A 1X0OA 3BWLA 3HVFA 3F1PA 2P9VB 3M6BA 1L3LA 2VZWA 4CLCA 2ACGA 3AGEA 3G2ZA 4HI4A 4HH3A 5CHUA 1DP6A 4JXWA 2ZMAA 1JTDA 2Y55A 4Q0JA 1BYWA 5CX7A 3ZNTA 3HLGA 3VOYA 5A92A 4EBNA 3KYZA 4P6BA 2JHEA 3GQZA 2HGVA 3IS2B 4ID4A 4Y15A 2WADA 3C5AA 1T1CA 1CEGA 3TW8A 1QMFA 1J3WA 1XPBA 1YT4A 2XQZA 2ZM0A 4DF6A 1ERQA 5FDHA 2DCFA 3NOTC 4GN2A 2K2NA 3IWOA 3IHAA 4HP9A 2OOLA 1UWNX 2DNSA 4B4ZA 4R0QA 1MKMA 1OTBA 1S4SA 2W0NA 3ISGA 5J8XA 5MC7A 1PYYA 2FFFB 4Y17A 1MC0A 4GD6A 1NRFA 1WYCA 4KG2A 4B93A 4QU3A 2WKIA 5A91A 4GCZA 2XA7S 2Y2KA 4BL2A 3CITA 3IH8A 2EA9A 1YSQA 1K55A 2VJWA 4LRXC 5EPHA 2Z2LB 4NG2A 2HP9A 3LUQA 3WS5A 1PRQA 2IWBA 2VGLS 3PHYA 4IVKA 5AVEA 1T19A 3U4LP 1SKOB 1ZTUA 3W2ZA 2IWCA 2P74A 1NZUA 1IOUA 5CECA 5A90A 3C7UA 1TEMA 4PM6A 2ZQ7A 3NOUC 1H8MA 5HAIA 4B88A 3GV9A 5EVEA 4DDSA 2AVXA 5LBRA 3OPPA 1S4RA 5L09A 1ES5A 1MXOA 4QB8A 4OLGA 4JXGA 3D4FA 2A24A 4HQAA 3F1OB 2XRNA 4KZ9A 5J7EA 1NYMA 2QKPA 1TDLA 1SHVA 3FKWA 5L2FA 5FI7A 2JE5A 4FH4A 3MMHA 3MJQA 1DJCA 4GS9B 4DRTA 4FOFA 4HHDA 2WGWA 4KQQA 4NXFA 3A3IA 3PXPA 3OPHA 3CMZA 2B18A 3LIFA 3BFCA 1SZVA 3QP6A 4X25A 5FEGA 4HBUA 2IWDA 4S2PA 2UWXA 5HAQA 3JVUA 5HPIA 2M1CA 5HWVA 4EWFA 1FILA 1XJ6A 1MZUA 5EV0A 5TBMB 3UE3A 1VETA 4OLDA 4BMWA 1KGFA 5EOOA 3M6HA 1IYSA 3ZNYA 1S66L 2W27A 4YOFA 4JGQA 1UGUA 4X1MA 4BD0A 5DF9A 2BTFP 4JXVA 4OOLA 5EVLA 4L0LA 5HL6A 4L9FA 5JYPA 1SDNA 2LB9A 2OWJA 4YNRA 3PR6A 4B4XA 1ESIA 1FOFA 2PRFA 2R9XA 2PD8A 2OSUA 3IF6C 3EEHA 2O99A 4YFMA 5F68A 1HVBA 2XD1A 3UB7A 4PM5A 5EM0A 4X68A 2XFSA 1K57A 3P7NA 2A3UA 4MDZA 1N9NA 3AGFA 4OPRA 1T1AA 3E4QA 5FQMA 1ZG6A 1XA7A 4LV3A 2JN7A 2J9OA 1EW0A 4WELA 2EX6A 3O5YA 1ERMA 4H6JB 3KX0X 4HY8A 5HDCA 2ZC4B 5HDDA 2E8JA 3O87A 2E8IA 3G30A 3GVBA 5FQJA 3T4OA 2WKRA 3DTMA 3T50A 1K6RA 1HLUP 2O0YA 4BWIA 5CTNA 3UY6A 3HLFA 3IH9A 1G28A 4Y2FA 1WE4A 3TSGA 1DP9A 4E3NA 3OLOA 2QWSA 4OP8A 5DJUA 4S2LA 3OPRA 1L0GA 3FYZA 3PYPA 4GDBA 4ZJ3A 1KE3A 1E25A 1XXMA 4MLLA 3CG5A 3H82A 3H7WB 4R23A 2WUQA 4CLCD 5HWWA 3G35A 1VEUB 3HLBA 3BFEA 3Q7ZA 1JVJA 4WZ4A 5E2HA 3S1YA 3IT9A 3A3DA 3UB9A 4JKTA 4E3KA 3QP5A 3EQVA 2Y2QA 1YSPA 2JKGA 5IHVA 2R9WA 2L0WA 2QYBA 3B42A 3G32A 3HUMA 1NLZA 3VFHA 2HDSA 3MSHA 5IU1A 5HZHA 4BBTA 4IUHA 2ZQ8A 5AQ9A 3DWZA 5AJGA 1PI5A 3RXWA 4R38A 4EXOA 3PBOA 2ZC7A 4MBFA 3VOLA 4HEFA 1MY8A 1S1ZA 3KSHA 1YPRA 4GJ4A 4WYYA 3WS2A 3EWKA 2XLNA 4IHQA 2VX8A 2X01A 1ZKJA 1XJ2A 3A3EA 3HCYA 1KVMA 3Q07A 4HESA 5HSQA 3MF0A 1CI8A 1JTGA 4E3JA 3MKEA 3PAEA 4KZ3A 3VFFA 4PM9A 4D60A 1F9IA 1TD5A 4MN7A 1Y28A 1YMSA 1O7EA 4OPQA 4KZ6A 3GTCA 5FQIA 4XT2B 4RYEA 4YWZA 4G3KA 4Q0HA 4CLCC 4BBUA 5KIZA 2XSSA 3BM6A 5J4EA 2GJ3A 1F98A 1N4OA 3LR5A 1H3QA 3E0YA 5FDSA 1ESUA 1KVLA 3G2YA 1L0FA 3BYDA 1BLPA 2Y2GA 3JVVA 4WLAA 3VMAA 1FQGA 3IWQA 4KUKA 3W4QA 5I5LA 4ETZA 4OPYA 5AQBA 3T4QA 1JWVA 5KSHA 3LIDA 2PBYA 3L7HA 3VP1A 5FAOA 3LY3A 5TR7A 3GDIA 2W3GA 4EEUA 4EBLA 4R4RA 5EUAA 3T1QB 3WS1A 3VE4A 3C30A 3TG9A 1OTDA 1S6RA 2QJ7A 3A0VA 5AVFA 3D3OA 1K55C 3MXQA 1HD8A 2M7UA 3UE0A 3OZHA 4RQ9A 3K2NA 4MNRA 1MWRA 5L10A 3Q82A 4EETB 1NZOA 2Y8HA 4R3AA 4CPKA 3SZTA 3VSLA 2ZLYA 1Q2PA 4JGRA 1SDEA 3OCNA 1LT0A 3PTEA 3N8SA 5BOHA 1P9RA 3KO6A 3SOIA 4DDYA 3Q7VB 1N9LA 4C6YA 4QJGA 5E43A 5FQKA 5DJTA 4MBHA 1E3UA 3N6IA 1OT6A 2KLIA 4R70A 1DRMA 4S2MA 5DFXA 1H5XA 3V39A 1P9WA 2HV1A 4PKYA 3FC7A 4UQIM 5L8MA 2Q9NA 3IF5A 4OQ0A 4JXSA 3BFDA 3UPPA 4LRZE 1EI5A 3IXGA 1CJFA 3OPLA 3V3RA 2G2UA 4QY6A 5G18A 4DXCA 5A8BA 4Y3IA 3A0RA 3CPTB 1SKOA 3ZG9B 1PW1A 4WL9A 2MJ6A 5HFOA 3ZG5A 2QJ5A 2P04A 4BL3A 2JKFA 1XP4A 1M40A 2Z6DA 1K6SA 4K0XA 4QY5A 4LFUA 4OOYA 4U3TA 3C8CA 4K08A 1ZC2A 4EEPA 3ZCZA 1T1BA 4EESA 3VP4A 1KGEA 3F1OA 1IYPA 3DWKA 1SKFA 2ZD8A 2JCHA 2V8FA 3LGOA 3NECA 5FA7A 4Q0IA 3ZQ5A 2WAFA 3W4OA 2VV8A 3WS4A 1W8YA 4KZ7A 2ZC3B 5AQAA 2RCXA 4KQOA 3BQAA 4FUWA 5GLCA 3BRMA 3PBQA 4OQHA 4X6TA 3IQAA 2ZJ9A 3ZG8B 1EROA 1YLJA 2XGNA 3LIEA 4LV1A 2VKSA 3E2LA 2XD5A 4O8GA 1GA9A 3HJIA 1K57C 1LI0A 4C75A 2I9VA 3OCLA 2WKEA 4L9GA 3NY4A 5HPFA 4NXEA 4R3JA 3GECA 1CI9A 1KOUA 2DRWA 5L07A 5TBMA 2OAP1 2Y2PA 3SH8A 3BFGA 2HZ5A 1S67L 4KENB 4RX3A 3LIAA 3S7PA 2WGIA 4ETXA 1ACFA 4P6ZS 3LCEA 4PHTA 5EFWA 2WKQA 4BENA 3V67A 4KZAA 4OP5A 1MWTA 1N9OA 5FEFA 1XFNA 1I2SA 4CJNA 1DJBA 1K4EA 2QMIA 2FH5A 2ZMFA 4LV2A 5HDSA 2C6WB 4JGOA 1G6AA 4KZBA 5CEDA 1G6OA 3N7WA 1LL8A 3VE3A 2X71A 5FAPA 3MR0A 4ZRRA 2P08A 4D2OA 4S2IA 1YLWA 4YINA 4BJPA 2B5RA 2XA7M 2EX2A 1DP8A 2FFYA 2KX6A 2J8YA 3UB8A 2VLGA 2JC7A 4GDNA 5DKLA 2A49A 1XFQA 3HL9A 4H6JA 2VGLM 2NUTC 4JGPA 3ZFZA 5GHYA 4P0MA 1G5UA 4I39A 1UWPX 3BEBA 2V1AA 4E3OA 1GSVA 2HDRA 3W8KA 5CRFA 4ARZA 4JPMA 1RCJA 3FZCA 4LLOB 2OLVA 5FAQA 2ZQAA 4MN5A 3FPWA 3IXDA 2V1BA 2L4RA 4KZ5A 3HLCA 4I3IA 4Y5FA 3PBRA 3BLSA 4R6LA 4NETA 3S4XA 3QP4A 4GNUA 3RTYA 3CJMA 5GHZA 4HOIA 1PW8A 2M7VA 5TJJA 3H9WA 3K3CA 4UAAA 2PT7A 2OWHA 4F3LB 3I7JA 3C4PA 3E2KA 3T4JA 4P87A 5DFYA 1D7EA 5GHXA 4LGWA 3UNWA 1PWDA 2HPBA 4K91A 1Y4OA 4PM8A 4EU0A 5E2EA 3S7NA 4E04A 2PBDP 1FSWA 3CHWP 4DE3A 4DE2A 4DJ2A 4NKPA 4WMCD 1MKIA 4Y7PA 4OQIA 1ZHHB 3UB6A 5EOEA 3F1NA 2B95A 2J3TC 1HTZA 5CGSA 3SS4A 4O0PA 5HL1A 1E3UD 1TS6A 2WGWB 4I3JA 3B3XA 4KG6A 2EX9A 4S2OA 1LSVA 3Q81A 3HLDA 5EVIB 1YMXA 3E4OA 3KSFA 3N8LA 4GB7A 2Y2OA 3WRZA 1PIOA 1VQQA 2Q9MA 3FV7A 3NI9A 4JF6A 4JF4A 1BUEA 1FIKA 3DTEA 5E2GA 2CC1A 3LI9A 2V20A 3HBRA 1ES4A 5EM1A 4HNBA 1M6KA 3NCKA 2XFTA 2D02A 3UDFA 3G31A 4NXBA 2V8CA 2JKTM 2V9AA 3IBJA 1VETB 1XA1A 2YKFA 1P0ZA 3QP2A 1MWUA 4HBTA 3CWFA 3MZDA 2JKRM 2V2FF 3UB5P 1FR1A 2GNXA 3C7VA 2IA2A 5I94A 4QHCA 5FQQA 3MFDA 5DKKA 2V1ZA 3ITBA 2W1TA 3QNBA 2RL3A 2HJ9C 4GKUA 1ES2A 1W8QA 2XR0A 4ZDXA 3LEZA 4XXRA 3DTIA 2WZXA 1W79A 2OV5A 1LSWA 1OJGA 1FCNA 5EECA 2WAEA 3HLWA 3DW0A 3AGDA 4DXBA 1E4DA 2XF3A 1BLCA 3NIAA 4Z1WA 3V5MA 3EGDC 3T4LA 5HX9A 2PU2A 1PFLA 3KYEA 3CI6A 3KSGA 2O9AA 3GSGA 4E6WA 4X53A 2ZMVA 4B9OA 1P97A 5DF7A 1PWGA 3E4PA 1XKZA 1GSXA 2ZOIA 4E3IA 3DBAA 3T12B 4UA7A 4MEZA 2O9CA 4HH2A 3N8RA 1YLYA 4A5RA 2PDRA 3ZVTA 3MQQA 4Y0UA 4PM7A 1GHPA 3L9KA 3Q7VA 2EXAA 3TOIA 2ZL1B 2H28A 4HJ4A 4KQDA 4QPRA 4BBVA 5U47A 4WF0A 4GD8A 2EFXA 4O01A 3ZGAB 3LEQA 2HF6A 4M3KA 4X1LA 4GHIA 5CTMA 2OLUA 3ULFA 4NEED 3K3DA 5F1FA 4N1XA 3CPTA 2ZC6B 3C4OA 3ZYTA 1W5DA 2VGJA 5GLBA 5EE8A 2P9VA 4PMAA 1NWZA 5EVID 5A93A 1YLZA 1H8YA 4FCFA 3FKVA 3HJKA 3VOZA 1WA9A 1GA0A 3A0SA 4PAUA 2ZM8A 2BASA 1BTLA 2HP6A 5CHJA 2V0WA 2WKHA 4MBKA 3IS2A 3U2AA 3EOIA 2GDNA 4R1GA 3IF6B 4LCMA 1U60A 4EW7A 1FCMA 2Y79A 4IJGA 3NDGA 3JYIA 5G4ZA 1F5MA 2ZQCA 4PPRA 4OH0A 4WMCA 2EX8A 1IELA 2VV7A 3RH8B 4LCLA 4ZJ2A 3UDIA 4EBPA 4WUJA 1YLPA 4IBXA 3O86A 1CQAA 1W7FA 3OOVA 3ZG0A 3RFBA 5CHMA 2W1RA 5E2FA 3T1XA 1BZAA 3BFFA 2WZZA 2X02A 4DN0A 1MBLA 3VP2A 3MXRA 1XJ3A 2Z2MB 1LL9A 1OTIA 2A2LA 1W63M 3BY8A 3BJNA 4DE1A 3HLEA 5F83A 1I5QA 3UDXA 1QMEA 5DTSA 1BLSA 3NC8A 1K25A 4X55A 4IEDA 3IHBA 4MCWA 4ZJ1A 3ZDJA 3TE8A 3T1SA 2ZOHA 5DTKA 1ES3A 5EVIC 3CAXA
chains in the Genus database with same CATH topology
2Y2IA 4R3BA 4S2LA 3OPRA 3SH9A 1I2WA 1L0GA 2HP5A 4X56A 4EUZA 3FYZA 1WYBA 4GDBA 4ZJ3A 2H0YA 2JC7A 4GDNA 1KE3A 1E25A 2A49A 1XXMA 4MLLA 4S2KA 3CG5A 1BSGA 4ZAMA 3HL9A 3LY4A 4EQIA 1KGGA 3ZFZA 4R23A 2WUQA 4P0MA 5GHYA 1YLTA 3ITAA 3G35A 2ZQDA 3N4IA 4C3QA 3HLBA 3M2KA 3MKFA 3P98A 1H8ZA 3BEBA 3BFEA 5CEBA 4E3OA 2Y2NA 1DY6A 1JWZA 1KDSA 2HDRA 3EQUA 1RGZA 1JVJA 3Q7ZA 4WZ4A 5M1AA 3W8KA 1FCOA 5E2HA 1C3BA 3S1YA 4K0WA 3IT9A 4OOMA 2H5SA 3A3DA 4UHUA 5CRFA 3Q1FA 1RCJA 3FZCA 4JPMA 5FQ9A 3BLMA 5FASA 4JKTA 1TDGA 1NYYA 4WZ5C 4E3KA 2OLVA 5FAQA 3EQVA 1ONHA 2Y2QA 2ZQAA 3O3VA 5IHVA 3WRTA 1GHIA 1HZOA 2R9WA 4KQRA 2PU4A 3IXDA 4KZ5A 1ZG4A 4U0TA 3P09A 3HLCA 4Z9QA 4O7DA 3QHYA 1PWCA 3G32A 3PBRA 4LV0A 3HUMA 5HARA 3BLSA 4GOGA 4NETA 3S4XA 1NXYA 3FWLA 3VFHA 2HDSA 1IYQA 3HREA 3GRJA 4GNUA 5FI6A 3CJMA 2ZQ8A 1TVFA 5GHZA 4U0XA 5AQ9A 2EXBA 4WZ5A 4WEJA 1PW8A 4N9LA 3DWZA 4UAAA 1PI5A 3RXWA 3I7JA 3C4PA 3E2KA 3PBOA 2ZC7A 5HW3A 4MBFA 4HEFA 4P87A 5DTTA 1MY8A 4DE0A 5CGXA 4BD1A 3M2JA 4JBFA 4WYYA 1ONGA 2QPNA 3MXSA 5GHXA 3WS2A 2XLNA 2H0TA 1EWZA 3GMWA 3A3JA 3UNWA 2XEPA 4KZ8A 3IWIA 2X01A 1PWDA 2HPBA 4JF5A 3UPOA 1ZKJA 5JYOA 2ZM2A 3A3EA 4K91A 5DF8A 4PM8A 1KVMA 3Q07A 4HESA 5E2EA 5CERA 2ZQ9A 4WEKA 4UA6A 1FSWA 4DE3A 1CI8A 4S2NC 4F94A 1JTGA 4DE2A 2Y2MA 1IKGA 4WMCD 4E3JA 1MKIA 4Y7PA 3MKEA 4OQIA 1LHYA 3PAEA 5CGWA 4KZ3A 3VFFA 1RP5A 1ALQA 4FSFA 4PM9A 3HUNA 1L2SA 4XUZA 5EOEA 5F82A 1HTZA 5CGSA 3SS4A 5HL1A 1YQSA 1E3UD 4FH2A 1FSYA 4E3LA 1BULA 2WGWB 1YMSA 4S2JA 1O7EA 4OPQA 4RVAA 3B3XA 4KG6A 3UO9A 2EX9A 2VGKA 4KZ6A 4S2OA 1VM1A 3GTCA 5FQIA 4N9KA 3Q81A 3VP0A 3NBLA 4S2NA 3BECA 3NDEA 4H8RA 1NY0A 2WK0A 3HLDA 4OKPA 5EVIB 1Z6FA 1YMXA 4RYEA 4RA7A 2XK1A 3N8LA 4GB7A 2Y2OA 4FD8A 3OC2A 3WRZA 1XGIA 1PIOA 1VQQA 2Q9MA 4KG5A 3FV7A 1K56D 3BM6A 3NI9A 4JF6A 1N4OA 4JF4A 1BT5A 1L0DA 1BUEA 3PBTA 2J9PA 2WYXA 3IXHA 5FSRA 5E2GA 2CC1A 1ESUA 1KVLA 1K54A 2V20A 3G2YA 3UE1A 3HBRA 4BQMA 1ES4A 1L0FA 1M6KA 3NCKA 2I72A 2XFTA 3BYDA 4P85A 3UDFA 3HVFA 3G31A 1BLPA 2Y2GA 2P9VB 1XA1A 1BLHA 3M6BA 3VMAA 1PZOA 1FQGA 3IWQA 1O07A 1MWUA 3AGEA 3G2ZA 3W4QA 4HBTA 5CHUA 4JXWA 5TGFA 1FR6A 2ZMAA 4OPYA 5AQBA 1JTDA 1JWVA 3MZDA 5KSHA 2Y55A 2PBYA 2V2FF 3ZNTA 3HLGA 3VP1A 5FAOA 3VOYA 1MPLA 1FR1A 5A92A 5EVIA 5KZHA 4EBNA 3C7VA 3LY3A 4P6BA 3GQZA 5TR7A 3G34A 4OVDA 4ID4A 2WADA 3C5AA 4QHCA 5I94A 5FQQA 3MFDA 2V1ZA 1CEGA 1QMFA 4QD4A 4EBLA 1XPBA 4KZ4A 2XDMA 1YT4A 4R4RA 1J9MA 2XQZA 5EUAA 1LL5A 2ZM0A 3WS1A 1ERQA 3ITBA 4DF6A 5FDHA 2DCFA 3QNBA 2RL3A 4GN2A 3TG9A 4DKIA 1IEMA 3IWOA 1G68A 3IHAA 4WBGA 1N9BA 4WM9A 4GKUA 1ES2A 3O88A 1W8QA 1S6RA 2XR0A 4ZDXA 2DNSA 3LEZA 4ZTKA 1K55C 4OONA 1HD8A 4B4ZA 1PZPA 1RGYA 4XXRA 5KSCA 4R0QA 3UE0A 3ISGA 3OZHA 5J8XA 5M18A 3PBNA 1PYYA 2FFFB 4MNRA 1MWRA 2WZXA 1W79A 1NRFA 1WYCA 3Q82A 4GD6A 1NZOA 2OV5A 4KG2A 4QU3A 2WKIA 2Y4AA 5A91A 3SH7A 4CPKA 3LO7A 4IVIA 2Y2LA 3VSLA 1FCNA 2ZLYA 4LENA 2Y2KA 5EECA 2WAEA 4Y0OA 1Q2PA 4N92A 3HLWA 5D3OA 4BL2A 3DW0A 3AGDA 3IH8A 4E6XA 4DXBA 1K55A 3A3FA 5KMWA 1SDEA 5EPHA 2Z2LB 3OCNA 2HP9A 1E4DA 2XF3A 3CZDA 3PTEA 1BLCA 3NIAA 3N8SA 3V5MA 5BOHA 3WS5A 4NK3A 3PAGA 4XUXA 5CXWA 2IWBA 4IVKA 5HX9A 3SOIA 4DDYA 3PBSA 3MBZA 3Q7VB 2IWCA 4GZBA 2P74A 4C6YA 1KDWA 1NZUA 2PU2A 4QJGA 5A90A 5CECA 3C7UA 5E43A 5FQKA 1TEMA 3GSGA 4MBHA 4E6WA 4PM6A 2ZQ7A 1E3UA 3N6IA 4X53A 4X69A 1LLBA 5HAIA 4S2MA 4B88A 3GV9A 2Y2JA 1H5XA 1PI4A 3V39A 5DF7A 1PWGA 1XKZA 1K38A 4DDSA 3OPPA 4E3IA 3MZEA 2Q9NA 1ES5A 3IF5A 4UA7A 1MXOA 4MEZA 4Q8IA 1IYOA 4OQ0A 4JXSA 3N8RA 1S0WA 3BFDA 3UPPA 1EI5A 1K56A 1YLYA 3IXGA 4QB8A 4OLGA 4A5RA 4JXGA 3ZVTA 2J7VA 1XX2A 3D4FA 1MWSA 3OPLA 3V3RA 2G2UA 4QY6A 5G18A 2QZ6A 2Y2HA 4Y0UA 3HUOA 4DXCA 4PM7A 1GHPA 4KZ9A 3Q7VA 1NYMA 2EXAA 1TDLA 1KE0A 3TOIA 3ZG9B 1PW1A 1SHVA 3FKWA 5L2FA 5FI7A 2JE5A 4FH4A 3QNCA 5GLDA 1DJCA 5HFOA 4DRTA 1K4FA 4Y0TA 5U47A 4GD8A 2EFXA 5M19A 5GL9A 3ZG5A 1OMEA 2WGWA 4KQQA 1Y54A 3RXXA 4BL3A 1XP4A 3A3IA 3ZGAB 1M40A 4M3KA 1K6SA 4K0XA 4QY5A 1L0EA 3W4PA 3ZHHA 4OOYA 1GCEA 3OPHA 3CMZA 4U3TA 5FI2A 4OQGA 1AXBA 3BFCA 1ZC2A 2JBFA 2BG1A 5CTMA 3ZCZA 4HBUA 2IWDA 2OLUA 4S2PA 2UWXA 3VP4A 5F1FA 1KGEA 5AQ7A 4N1XA 3VP3A 2ZC6B 3C4OA 5HAQA 1IYPA 1W5DA 3DWKA 2VGJA 1SKFA 5GLBA 4EWFA 2ZD8A 4EV4A 2JCHA 5EE8A 2P9VA 3UE3A 4PMAA 1CK3A 4OLDA 5EVID 4JLFA 5A93A 1YLZA 1H8YA 2ZC5B 4FCFA 3FKVA 5FA7A 3VOZA 2WAFA 4UA9A 1JWPA 1GA0A 3MZFA 3W4OA 1IKIA 1KGFA 3WS4A 5EOOA 2ZM8A 1W8YA 3M6HA 5DVAA 3SS5A 4KZ7A 3UPNA 2ZC3B 5AQAA 1IYSA 2RCXA 1BTLA 2HP6A 4KQOA 3G4PA 5CHJA 1XGJA 3SS3A 4R4SA 3ZNYA 2WKHA 5GLCA 3BRMA 3GR2A 4OPZA 3V50A 4MBKA 3PBQA 4OQHA 4X6TA 2Y91A 3IQAA 2ZJ9A 3ZG8B 4BD0A 1EROA 3S22A 2GDNA 1YLJA 2XGNA 4R1GA 5DF9A 3IF6B 3ZG7B 4LCMA 4LV1A 5HAPA 1U60A 4JXVA 3RJUA 3E2LA 4OOLA 5EVLA 2XD5A 1NJ4A 4L0LA 3WWXA 1FCMA 1LI9A 3NDGA 1GA9A 3JYIA 2ZQCA 4PPRA 1K57C 4OH0A 5JYPA 1LI0A 1SDNA 4C75A 4WMCA 3OCLA 2WKEA 2EX8A 3NY4A 4B4XA 4BLMA 1ESIA 1FOFA 1IELA 2R9XA 4R3JA 1CI9A 2DRWA 5F1GA 4LCLA 2OSUA 3IXBA 4ZJ2A 2Y2PA 3IF6C 3UDIA 3SH8A 4YFMA 1HVBA 3BFGA 4EBPA 4KENB 4RX3A 2XD1A 1YLPA 4PM5A 4IBXA 3O86A 1W7FA 4X68A 2XFSA 1K57A 2HDUA 2WGIA 3ZG0A 2A3UA 4IBRA 5CHMA 3LCEA 5E2FA 1BZAA 3BFFA 2WZZA 2X02A 3AGFA 2XH9A 4OPRA 4BENA 1MBLA 4N1HA 4KZAA 4OP5A 5FQMA 1MWTA 3VP2A 1ZG6A 1XA7A 2HDQA 3IF6A 3MXRA 1I2SA 2Z2MB 1LL9A 2J9OA 1DJBA 4LV3A 4CJNA 1K4EA 2QMIA 4WELA 2EX6A 4ZBEA 4DE1A 4LV2A 2C6WB 1ERMA 1G6AA 4KZBA 5CEDA 3N7WA 3HLEA 1DJAA 5F83A 1K54C 2ZC4B 1I5QA 3WS0A 2H10A 3UDXA 1QMEA 5DTSA 3O87A 3ZVWA 1BLSA 2E8IA 3G30A 1Q2QA 1YM1A 3GVBA 5FQJA 3NC8A 3V3SA 1K25A 4X55A 2Y59A 1SCWA 3DTMA 4IEDA 3IHBA 4ZJ1A 3UN7A 3ZDJA 1K6RA 2X71A 5FAPA 5TFQA 2G2WA 2BLSA 2WGVA 2EFUA 5CTNA 3UY6A 4D2OA 5FATA 3HLFA 3IH9A 4S2IA 4RX2A 1GHMA 1YLWA 3VSKA 1KE4A 1WE4A 4E3MA 4YINA 3TSGA 4BJPA 2B5RA 5DTKA 4E3NA 2EX2A 1ES3A 2FFYA 5EVIC 4OP8A 5GLAA 2J8YA 2C5WB 1CEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2I A;  4R3B A;  4S2L A;  3OPR A;  3SH9 A;  1I2W A;  1L0G A;  2HP5 A;  4X56 A;  4EUZ A;  3FYZ A;  1WYB A;  4GDB A;  4ZJ3 A;  2H0Y A;  2JC7 A;  4GDN A;  1KE3 A;  1E25 A;  2A49 A;  1XXM A;  4MLL A;  4S2K A;  3CG5 A;  1BSG A;  4ZAM A;  3HL9 A;  3LY4 A;  4EQI A;  1KGG A;  3ZFZ A;  4R23 A;  2WUQ A;  4P0M A;  5GHY A;  1YLT A;  3ITA A;  3G35 A;  2ZQD A;  3N4I A;  4C3Q A;  3HLB A;  3M2K A;  3MKF A;  3P98 A;  1H8Z A;  3BEB A;  3BFE A;  5CEB A;  4E3O A;  2Y2N A;  1DY6 A;  1JWZ A;  1KDS A;  2HDR A;  3EQU A;  1RGZ A;  1JVJ A;  3Q7Z A;  4WZ4 A;  5M1A A;  3W8K A;  1FCO A;  5E2H A;  1C3B A;  3S1Y A;  4K0W A;  3IT9 A;  4OOM A;  2H5S A;  3A3D A;  4UHU A;  5CRF A;  3Q1F A;  1RCJ A;  3FZC A;  4JPM A;  5FQ9 A;  3BLM A;  5FAS A;  4JKT A;  1TDG A;  1NYY A;  4WZ5 C;  4E3K A;  2OLV A;  5FAQ A;  3EQV A;  1ONH A;  2Y2Q A;  2ZQA A;  3O3V A;  5IHV A;  3WRT A;  1GHI A;  1HZO A;  2R9W A;  4KQR A;  2PU4 A;  3IXD A;  4KZ5 A;  1ZG4 A;  4U0T A;  3P09 A;  3HLC A;  4Z9Q A;  4O7D A;  3QHY A;  1PWC A;  3G32 A;  3PBR A;  4LV0 A;  3HUM A;  5HAR A;  3BLS A;  4GOG A;  4NET A;  3S4X A;  1NXY A;  3FWL A;  3VFH A;  2HDS A;  1IYQ A;  3HRE A;  3GRJ A;  4GNU A;  5FI6 A;  3CJM A;  2ZQ8 A;  1TVF A;  5GHZ A;  4U0X A;  5AQ9 A;  2EXB A;  4WZ5 A;  4WEJ A;  1PW8 A;  4N9L A;  3DWZ A;  4UAA A;  1PI5 A;  3RXW A;  3I7J A;  3C4P A;  3E2K A;  3PBO A;  2ZC7 A;  5HW3 A;  4MBF A;  4HEF A;  4P87 A;  5DTT A;  1MY8 A;  4DE0 A;  5CGX A;  4BD1 A;  3M2J A;  4JBF A;  4WYY A;  1ONG A;  2QPN A;  3MXS A;  5GHX A;  3WS2 A;  2XLN A;  2H0T A;  1EWZ A;  3GMW A;  3A3J A;  3UNW A;  2XEP A;  4KZ8 A;  3IWI A;  2X01 A;  1PWD A;  2HPB A;  4JF5 A;  3UPO A;  1ZKJ A;  5JYO A;  2ZM2 A;  3A3E A;  4K91 A;  5DF8 A;  4PM8 A;  1KVM A;  3Q07 A;  4HES A;  5E2E A;  5CER A;  2ZQ9 A;  4WEK A;  4UA6 A;  1FSW A;  4DE3 A;  1CI8 A;  4S2N C;  4F94 A;  1JTG A;  4DE2 A;  2Y2M A;  1IKG A;  4WMC D;  4E3J A;  1MKI A;  4Y7P A;  3MKE A;  4OQI A;  1LHY A;  3PAE A;  5CGW A;  4KZ3 A;  3VFF A;  1RP5 A;  1ALQ A;  4FSF A;  4PM9 A;  3HUN A;  1L2S A;  4XUZ A;  5EOE A;  5F82 A;  1HTZ A;  5CGS A;  3SS4 A;  5HL1 A;  1YQS A;  1E3U D;  4FH2 A;  1FSY A;  4E3L A;  1BUL A;  2WGW B;  1YMS A;  4S2J A;  1O7E A;  4OPQ A;  4RVA A;  3B3X A;  4KG6 A;  3UO9 A;  2EX9 A;  2VGK A;  4KZ6 A;  4S2O A;  1VM1 A;  3GTC A;  5FQI A;  4N9K A;  3Q81 A;  3VP0 A;  3NBL A;  4S2N A;  3BEC A;  3NDE A;  4H8R A;  1NY0 A;  2WK0 A;  3HLD A;  4OKP A;  5EVI B;  1Z6F A;  1YMX A;  4RYE A;  4RA7 A;  2XK1 A;  3N8L A;  4GB7 A;  2Y2O A;  4FD8 A;  3OC2 A;  3WRZ A;  1XGI A;  1PIO A;  1VQQ A;  2Q9M A;  4KG5 A;  3FV7 A;  1K56 D;  3BM6 A;  3NI9 A;  4JF6 A;  1N4O A;  4JF4 A;  1BT5 A;  1L0D A;  1BUE A;  3PBT A;  2J9P A;  2WYX A;  3IXH A;  5FSR A;  5E2G A;  2CC1 A;  1ESU A;  1KVL A;  1K54 A;  2V20 A;  3G2Y A;  3UE1 A;  3HBR A;  4BQM A;  1ES4 A;  1L0F A;  1M6K A;  3NCK A;  2I72 A;  2XFT A;  3BYD A;  4P85 A;  3UDF A;  3HVF A;  3G31 A;  1BLP A;  2Y2G A;  2P9V B;  1XA1 A;  1BLH A;  3M6B A;  3VMA A;  1PZO A;  1FQG A;  3IWQ A;  1O07 A;  1MWU A;  3AGE A;  3G2Z A;  3W4Q A;  4HBT A;  5CHU A;  4JXW A;  5TGF A;  1FR6 A;  2ZMA A;  4OPY A;  5AQB A;  1JTD A;  1JWV A;  3MZD A;  5KSH A;  2Y55 A;  2PBY A;  2V2F F;  3ZNT A;  3HLG A;  3VP1 A;  5FAO A;  3VOY A;  1MPL A;  1FR1 A;  5A92 A;  5EVI A;  5KZH A;  4EBN A;  3C7V A;  3LY3 A;  4P6B A;  3GQZ A;  5TR7 A;  3G34 A;  4OVD A;  4ID4 A;  2WAD A;  3C5A A;  4QHC A;  5I94 A;  5FQQ A;  3MFD A;  2V1Z A;  1CEG A;  1QMF A;  4QD4 A;  4EBL A;  1XPB A;  4KZ4 A;  2XDM A;  1YT4 A;  4R4R A;  1J9M A;  2XQZ A;  5EUA A;  1LL5 A;  2ZM0 A;  3WS1 A;  1ERQ A;  3ITB A;  4DF6 A;  5FDH A;  2DCF A;  3QNB A;  2RL3 A;  4GN2 A;  3TG9 A;  4DKI A;  1IEM A;  3IWO A;  1G68 A;  3IHA A;  4WBG A;  1N9B A;  4WM9 A;  4GKU A;  1ES2 A;  3O88 A;  1W8Q A;  1S6R A;  2XR0 A;  4ZDX A;  2DNS A;  3LEZ A;  4ZTK A;  1K55 C;  4OON A;  1HD8 A;  4B4Z A;  1PZP A;  1RGY A;  4XXR A;  5KSC A;  4R0Q A;  3UE0 A;  3ISG A;  3OZH A;  5J8X A;  5M18 A;  3PBN A;  1PYY A;  2FFF B;  4MNR A;  1MWR A;  2WZX A;  1W79 A;  1NRF A;  1WYC A;  3Q82 A;  4GD6 A;  1NZO A;  2OV5 A;  4KG2 A;  4QU3 A;  2WKI A;  2Y4A A;  5A91 A;  3SH7 A;  4CPK A;  3LO7 A;  4IVI A;  2Y2L A;  3VSL A;  1FCN A;  2ZLY A;  4LEN A;  2Y2K A;  5EEC A;  2WAE A;  4Y0O A;  1Q2P A;  4N92 A;  3HLW A;  5D3O A;  4BL2 A;  3DW0 A;  3AGD A;  3IH8 A;  4E6X A;  4DXB A;  1K55 A;  3A3F A;  5KMW A;  1SDE A;  5EPH A;  2Z2L B;  3OCN A;  2HP9 A;  1E4D A;  2XF3 A;  3CZD A;  3PTE A;  1BLC A;  3NIA A;  3N8S A;  3V5M A;  5BOH A;  3WS5 A;  4NK3 A;  3PAG A;  4XUX A;  5CXW A;  2IWB A;  4IVK A;  5HX9 A;  3SOI A;  4DDY A;  3PBS A;  3MBZ A;  3Q7V B;  2IWC A;  4GZB A;  2P74 A;  4C6Y A;  1KDW A;  1NZU A;  2PU2 A;  4QJG A;  5A90 A;  5CEC A;  3C7U A;  5E43 A;  5FQK A;  1TEM A;  3GSG A;  4MBH A;  4E6W A;  4PM6 A;  2ZQ7 A;  1E3U A;  3N6I A;  4X53 A;  4X69 A;  1LLB A;  5HAI A;  4S2M A;  4B88 A;  3GV9 A;  2Y2J A;  1H5X A;  1PI4 A;  3V39 A;  5DF7 A;  1PWG A;  1XKZ A;  1K38 A;  4DDS A;  3OPP A;  4E3I A;  3MZE A;  2Q9N A;  1ES5 A;  3IF5 A;  4UA7 A;  1MXO A;  4MEZ A;  4Q8I A;  1IYO A;  4OQ0 A;  4JXS A;  3N8R A;  1S0W A;  3BFD A;  3UPP A;  1EI5 A;  1K56 A;  1YLY A;  3IXG A;  4QB8 A;  4OLG A;  4A5R A;  4JXG A;  3ZVT A;  2J7V A;  1XX2 A;  3D4F A;  1MWS A;  3OPL A;  3V3R A;  2G2U A;  4QY6 A;  5G18 A;  2QZ6 A;  2Y2H A;  4Y0U A;  3HUO A;  4DXC A;  4PM7 A;  1GHP A;  4KZ9 A;  3Q7V A;  1NYM A;  2EXA A;  1TDL A;  1KE0 A;  3TOI A;  3ZG9 B;  1PW1 A;  1SHV A;  3FKW A;  5L2F A;  5FI7 A;  2JE5 A;  4FH4 A;  3QNC A;  5GLD A;  1DJC A;  5HFO A;  4DRT A;  1K4F A;  4Y0T A;  5U47 A;  4GD8 A;  2EFX A;  5M19 A;  5GL9 A;  3ZG5 A;  1OME A;  2WGW A;  4KQQ A;  1Y54 A;  3RXX A;  4BL3 A;  1XP4 A;  3A3I A;  3ZGA B;  1M40 A;  4M3K A;  1K6S A;  4K0X A;  4QY5 A;  1L0E A;  3W4P A;  3ZHH A;  4OOY A;  1GCE A;  3OPH A;  3CMZ A;  4U3T A;  5FI2 A;  4OQG A;  1AXB A;  3BFC A;  1ZC2 A;  2JBF A;  2BG1 A;  5CTM A;  3ZCZ A;  4HBU A;  2IWD A;  2OLU A;  4S2P A;  2UWX A;  3VP4 A;  5F1F A;  1KGE A;  5AQ7 A;  4N1X A;  3VP3 A;  2ZC6 B;  3C4O A;  5HAQ A;  1IYP A;  1W5D A;  3DWK A;  2VGJ A;  1SKF A;  5GLB A;  4EWF A;  2ZD8 A;  4EV4 A;  2JCH A;  5EE8 A;  2P9V A;  3UE3 A;  4PMA A;  1CK3 A;  4OLD A;  5EVI D;  4JLF A;  5A93 A;  1YLZ A;  1H8Y A;  2ZC5 B;  4FCF A;  3FKV A;  5FA7 A;  3VOZ A;  2WAF A;  4UA9 A;  1JWP A;  1GA0 A;  3MZF A;  3W4O A;  1IKI A;  1KGF A;  3WS4 A;  5EOO A;  2ZM8 A;  1W8Y A;  3M6H A;  5DVA A;  3SS5 A;  4KZ7 A;  3UPN A;  2ZC3 B;  5AQA A;  1IYS A;  2RCX A;  1BTL A;  2HP6 A;  4KQO A;  3G4P A;  5CHJ A;  1XGJ A;  3SS3 A;  4R4S A;  3ZNY A;  2WKH A;  5GLC A;  3BRM A;  3GR2 A;  4OPZ A;  3V50 A;  4MBK A;  3PBQ A;  4OQH A;  4X6T A;  2Y91 A;  3IQA A;  2ZJ9 A;  3ZG8 B;  4BD0 A;  1ERO A;  3S22 A;  2GDN A;  1YLJ A;  2XGN A;  4R1G A;  5DF9 A;  3IF6 B;  3ZG7 B;  4LCM A;  4LV1 A;  5HAP A;  1U60 A;  4JXV A;  3RJU A;  3E2L A;  4OOL A;  5EVL A;  2XD5 A;  1NJ4 A;  4L0L A;  3WWX A;  1FCM A;  1LI9 A;  3NDG A;  1GA9 A;  3JYI A;  2ZQC A;  4PPR A;  1K57 C;  4OH0 A;  5JYP A;  1LI0 A;  1SDN A;  4C75 A;  4WMC A;  3OCL A;  2WKE A;  2EX8 A;  3NY4 A;  4B4X A;  4BLM A;  1ESI A;  1FOF A;  1IEL A;  2R9X A;  4R3J A;  1CI9 A;  2DRW A;  5F1G A;  4LCL A;  2OSU A;  3IXB A;  4ZJ2 A;  2Y2P A;  3IF6 C;  3UDI A;  3SH8 A;  4YFM A;  1HVB A;  3BFG A;  4EBP A;  4KEN B;  4RX3 A;  2XD1 A;  1YLP A;  4PM5 A;  4IBX A;  3O86 A;  1W7F A;  4X68 A;  2XFS A;  1K57 A;  2HDU A;  2WGI A;  3ZG0 A;  2A3U A;  4IBR A;  5CHM A;  3LCE A;  5E2F A;  1BZA A;  3BFF A;  2WZZ A;  2X02 A;  3AGF A;  2XH9 A;  4OPR A;  4BEN A;  1MBL A;  4N1H A;  4KZA A;  4OP5 A;  5FQM A;  1MWT A;  3VP2 A;  1ZG6 A;  1XA7 A;  2HDQ A;  3IF6 A;  3MXR A;  1I2S A;  2Z2M B;  1LL9 A;  2J9O A;  1DJB A;  4LV3 A;  4CJN A;  1K4E A;  2QMI A;  4WEL A;  2EX6 A;  4ZBE A;  4DE1 A;  4LV2 A;  2C6W B;  1ERM A;  1G6A A;  4KZB A;  5CED A;  3N7W A;  3HLE A;  1DJA A;  5F83 A;  1K54 C;  2ZC4 B;  1I5Q A;  3WS0 A;  2H10 A;  3UDX A;  1QME A;  5DTS A;  3O87 A;  3ZVW A;  1BLS A;  2E8I A;  3G30 A;  1Q2Q A;  1YM1 A;  3GVB A;  5FQJ A;  3NC8 A;  3V3S A;  1K25 A;  4X55 A;  2Y59 A;  1SCW A;  3DTM A;  4IED A;  3IHB A;  4ZJ1 A;  3UN7 A;  3ZDJ A;  1K6R A;  2X71 A;  5FAP A;  5TFQ A;  2G2W A;  2BLS A;  2WGV A;  2EFU A;  5CTN A;  3UY6 A;  4D2O A;  5FAT A;  3HLF A;  3IH9 A;  4S2I A;  4RX2 A;  1GHM A;  1YLW A;  3VSK A;  1KE4 A;  1WE4 A;  4E3M A;  4YIN A;  3TSG A;  4BJP A;  2B5R A;  5DTK A;  4E3N A;  2EX2 A;  1ES3 A;  2FFY A;  5EVI C;  4OP8 A;  5GLA A;  2J8Y A;  2C5W B;  1CEF A; 
#chains in the Genus database with same CATH topology
 5HWT A;  2HP5 A;  3LYX A;  1CF0 A;  4S2K A;  2PR6 A;  1BSG A;  1F2K A;  1OTA A;  3IX3 A;  3UMD A;  3LY4 A;  1KGG A;  1OT9 A;  1YLT A;  3ITA A;  1NRJ A;  4C3Q A;  4CLC E;  3MKF A;  1H8Z A;  2Y2N A;  1DY6 A;  1RGZ A;  1FCO A;  4GS9 A;  3FG8 A;  4OOM A;  1TDG A;  3S7Q A;  1ONH A;  3O3V A;  3WRT A;  1GHI A;  1HZO A;  3KYQ A;  4U0T A;  1ZG4 A;  3P09 A;  1VB6 A;  4O7D A;  3QHY A;  4LV0 A;  5HAR A;  4GOG A;  4IUK A;  5FL3 A;  3FWL A;  1IYQ A;  1YKD A;  3HRE A;  3GRJ A;  3EEA A;  1TVF A;  4U0X A;  2EXB A;  4WZ5 A;  2VA0 A;  4N9L A;  3R7W B;  3T4K A;  5DTT A;  2CMN A;  3TJZ C;  4BD1 A;  4JBF A;  4HJ6 A;  1ONG A;  2J80 A;  3LIC A;  1EWZ A;  3GMW A;  3A3J A;  4KZ8 A;  1LSX A;  2ZM2 A;  3NHQ A;  1XJ4 A;  2P7J A;  2ZQ9 A;  3BQ8 A;  1STZ A;  4GW9 A;  3LI8 A;  1LHY A;  4UEY A;  3VV4 A;  1ALQ A;  3F1P B;  3HUN A;  4XUZ A;  3JPU A;  5F82 A;  4CLC B;  2XRO A;  1YQS A;  4E3L A;  4F3L A;  1BUL A;  4S2J A;  4QWO A;  4RVA A;  1VM1 A;  3NBL A;  4S2N A;  4H8R A;  3NDE A;  1D06 A;  4EER A;  4RA7 A;  4PKY G;  3OC2 A;  1H0M A;  4Y13 A;  2OAQ 1;  5IT5 A;  1BT5 A;  1L0D A;  3PBT A;  2J9P A;  2J3T D;  2WYX A;  3IXH A;  4BQM A;  5C5K A;  2D01 A;  3C2W A;  2I72 A;  2NUP C;  1BLH A;  1PZO A;  4LRY C;  1O07 A;  1VHM A;  5TGF A;  1FR6 A;  1MPL A;  5KZH A;  5EVI A;  3C38 A;  2Z6C A;  2W3H A;  3G34 A;  4OVD A;  4QD4 A;  3IX8 A;  4KZ4 A;  2XDM A;  3BW6 A;  4HJ3 A;  1OJ5 A;  1J9M A;  2WKP A;  4P6Z M;  1LL5 A;  2PHY A;  2LB5 A;  4DKI A;  1GSW A;  1IEM A;  1G68 A;  4WBG A;  1N9B A;  4WM9 A;  3O88 A;  4AFI A;  4ZTK A;  4OON A;  4FTX A;  3G6O A;  5KSC A;  1PZP A;  1RGY A;  3SW1 A;  2K7S A;  3H7W A;  5M18 A;  3PBN A;  1VEU A;  2KDK A;  3MQO A;  5F69 A;  2Y4A A;  3SH7 A;  3LO7 A;  4IVI A;  2Y2L A;  4LEN A;  4Y0O A;  5D3O A;  4N92 A;  4E6X A;  2FZ0 A;  5KMW A;  3A3F A;  1V9Z A;  3CZD A;  4NK3 A;  1ODV A;  2A24 B;  3PAG A;  4XUX A;  5CXW A;  3PBS A;  3MBZ A;  4GZB A;  2W3D A;  1KDW A;  4HP4 A;  1T18 A;  4X69 A;  1LLB A;  3NJA A;  2Y2J A;  1PI4 A;  2EWW A;  2PYR A;  1K38 A;  3MZE A;  3UME A;  1Z09 A;  4Q8I A;  1IYO A;  1S0W A;  3LFV A;  1K56 A;  2J7V A;  2GX5 A;  1XX2 A;  1MWS A;  3LR3 A;  2QZ6 A;  2Y2H A;  4ESP A;  2J3W A;  3HUO A;  3B47 A;  1KE0 A;  4LPZ A;  4GLQ A;  3QNC A;  5GLD A;  4I3A A;  4Y0T A;  1A0K A;  1K4F A;  4ARZ B;  5M19 A;  5GL9 A;  1OME A;  3RXX A;  1Y54 A;  2L1M A;  3QP1 A;  3ZHH A;  1L0E A;  3W4P A;  1GCE A;  4XT2 A;  4OQG A;  5FI2 A;  1TS0 A;  1AXB A;  2VEA A;  2JBF A;  2PR5 A;  2BG1 A;  1TS7 A;  5K5B A;  2JKT I;  5AQ7 A;  3NOP C;  3CLO A;  3VP3 A;  3DAV A;  4EUV A;  1PNE A;  2ZL1 A;  1OPX A;  4EV4 A;  2B02 A;  1K0K A;  2JKR I;  1CK3 A;  4JLF A;  2ZC5 B;  4UA9 A;  1JWP A;  3MZF A;  1IKI A;  3SS5 A;  5DVA A;  3UPN A;  5F5Y A;  3G4P A;  1XGJ A;  3SS3 A;  4R4S A;  4OPZ A;  3GR2 A;  3V50 A;  4KUO A;  2Y91 A;  3MQ0 A;  3S22 A;  3ZG7 B;  5HAP A;  3RJU A;  1NJ4 A;  3WWX A;  3F1N B;  1LI9 A;  4MMN A;  1JNU A;  3TRC A;  4M4X A;  3KSI A;  4BLM A;  2HJE A;  3T4S A;  5F1G A;  3IXB A;  3P01 A;  3NUL A;  2R78 A;  3T4T A;  2PAV P;  1TS8 A;  4CQH A;  2HDU A;  4IBR A;  3LR4 A;  1TF1 A;  3D9Y A;  2XH9 A;  4N1H A;  3EGX C;  3UE6 A;  2UV0 E;  2HDQ A;  3IF6 A;  4L9E A;  2Q0O A;  1AWI A;  3CUE C;  4ZBE A;  4G3V A;  3B33 A;  3H82 B;  2V0U A;  1W63 Q;  4ME4 A;  1DJA A;  3MFX A;  1YAX A;  5IS1 A;  1K54 C;  2EWV A;  3WS0 A;  2H10 A;  5F6A A;  2QHK A;  3ZVW A;  1Q2Q A;  1YM1 A;  3V3S A;  2Y59 A;  1SCW A;  3UN7 A;  5HD5 A;  3R4K A;  5TFQ A;  2G2W A;  2KOI A;  2BLS A;  2WGV A;  2EFU A;  5FAT A;  4RX2 A;  1GHM A;  3VSK A;  1KE4 A;  4E3M A;  2W1T B;  2ZBB A;  4EQ1 A;  5GLA A;  5HW3 A;  2C5W B;  3E98 A;  1CEF A;  2Y2I A;  4R3B A;  3SH9 A;  4EUZ A;  1I2W A;  4X56 A;  1WYB A;  2W3F A;  2H0Y A;  2VV6 A;  2YKH A;  3D72 A;  3OBF A;  3T1R A;  3S7O A;  4ZAM A;  4EQI A;  1D1J A;  2ZQD A;  3N4I A;  3M2K A;  3P98 A;  5CEB A;  2PYP A;  1JWZ A;  1KDS A;  3DTK A;  3EQU A;  3LIB A;  5M1A A;  1C3B A;  4UQI S;  2DMW A;  4K0W A;  2H5S A;  4UHU A;  5FQ9 A;  3Q1F A;  2G7U A;  2INW A;  2W3E A;  3BLM A;  5FAS A;  1NYY A;  4WZ5 C;  4II7 A;  4KQR A;  2PU4 A;  2VK3 A;  4Z9Q A;  1PWC A;  4HIA A;  1IFQ A;  4I5S A;  1NXY A;  2K31 A;  5FI6 A;  1V9Y A;  5J3W A;  4WEJ A;  2GZA A;  3BY9 A;  2O9B A;  4DE0 A;  5CGX A;  3M2J A;  2QPN A;  3MXS A;  1OTE A;  2H0T A;  1NLY A;  4MN6 A;  2XEP A;  3IWI A;  4JF5 A;  3UPO A;  5G4Y A;  5JYO A;  4DJ3 A;  1S1Y A;  5DF8 A;  5CER A;  3LR0 A;  4WEK A;  2PD7 A;  4UA6 A;  4S2N C;  4F94 A;  2Y2M A;  1IKG A;  5CGW A;  1RP5 A;  4FSF A;  1L2S A;  3IX4 A;  4WN5 A;  3R7W A;  4DMZ A;  4FH2 A;  1FSY A;  3UO9 A;  2VGK A;  4NXG A;  3VP0 A;  4N9K A;  3MS6 A;  3BEC A;  1NY0 A;  2WK0 A;  3QP8 A;  4OKP A;  1Z6F A;  2XK1 A;  5HD3 A;  4FD8 A;  4GHI B;  3CUE A;  1XGI A;  3FPV A;  4KG5 A;  1K56 D;  3ICY A;  4G3W A;  5FSR A;  1K54 A;  3UE1 A;  3IBR A;  4I38 A;  4P85 A;  1X0O A;  3BWL A;  3HVF A;  3F1P A;  2P9V B;  3M6B A;  1L3L A;  2VZW A;  4CLC A;  2ACG A;  3AGE A;  3G2Z A;  4HI4 A;  4HH3 A;  5CHU A;  1DP6 A;  4JXW A;  2ZMA A;  1JTD A;  2Y55 A;  4Q0J A;  1BYW A;  5CX7 A;  3ZNT A;  3HLG A;  3VOY A;  5A92 A;  4EBN A;  3KYZ A;  4P6B A;  2JHE A;  3GQZ A;  2HGV A;  3IS2 B;  4ID4 A;  4Y15 A;  2WAD A;  3C5A A;  1T1C A;  1CEG A;  3TW8 A;  1QMF A;  1J3W A;  1XPB A;  1YT4 A;  2XQZ A;  2ZM0 A;  4DF6 A;  1ERQ A;  5FDH A;  2DCF A;  3NOT C;  4GN2 A;  2K2N A;  3IWO A;  3IHA A;  4HP9 A;  2OOL A;  1UWN X;  2DNS A;  4B4Z A;  4R0Q A;  1MKM A;  1OTB A;  1S4S A;  2W0N A;  3ISG A;  5J8X A;  5MC7 A;  1PYY A;  2FFF B;  4Y17 A;  1MC0 A;  4GD6 A;  1NRF A;  1WYC A;  4KG2 A;  4B93 A;  4QU3 A;  2WKI A;  5A91 A;  4GCZ A;  2XA7 S;  2Y2K A;  4BL2 A;  3CIT A;  3IH8 A;  2EA9 A;  1YSQ A;  1K55 A;  2VJW A;  4LRX C;  5EPH A;  2Z2L B;  4NG2 A;  2HP9 A;  3LUQ A;  3WS5 A;  1PRQ A;  2IWB A;  2VGL S;  3PHY A;  4IVK A;  5AVE A;  1T19 A;  3U4L P;  1SKO B;  1ZTU A;  3W2Z A;  2IWC A;  2P74 A;  1NZU A;  1IOU A;  5CEC A;  5A90 A;  3C7U A;  1TEM A;  4PM6 A;  2ZQ7 A;  3NOU C;  1H8M A;  5HAI A;  4B88 A;  3GV9 A;  5EVE A;  4DDS A;  2AVX A;  5LBR A;  3OPP A;  1S4R A;  5L09 A;  1ES5 A;  1MXO A;  4QB8 A;  4OLG A;  4JXG A;  3D4F A;  2A24 A;  4HQA A;  3F1O B;  2XRN A;  4KZ9 A;  5J7E A;  1NYM A;  2QKP A;  1TDL A;  1SHV A;  3FKW A;  5L2F A;  5FI7 A;  2JE5 A;  4FH4 A;  3MMH A;  3MJQ A;  1DJC A;  4GS9 B;  4DRT A;  4FOF A;  4HHD A;  2WGW A;  4KQQ A;  4NXF A;  3A3I A;  3PXP A;  3OPH A;  3CMZ A;  2B18 A;  3LIF A;  3BFC A;  1SZV A;  3QP6 A;  4X25 A;  5FEG A;  4HBU A;  2IWD A;  4S2P A;  2UWX A;  5HAQ A;  3JVU A;  5HPI A;  2M1C A;  5HWV A;  4EWF A;  1FIL A;  1XJ6 A;  1MZU A;  5EV0 A;  5TBM B;  3UE3 A;  1VET A;  4OLD A;  4BMW A;  1KGF A;  5EOO A;  3M6H A;  1IYS A;  3ZNY A;  1S66 L;  2W27 A;  4YOF A;  4JGQ A;  1UGU A;  4X1M A;  4BD0 A;  5DF9 A;  2BTF P;  4JXV A;  4OOL A;  5EVL A;  4L0L A;  5HL6 A;  4L9F A;  5JYP A;  1SDN A;  2LB9 A;  2OWJ A;  4YNR A;  3PR6 A;  4B4X A;  1ESI A;  1FOF A;  2PRF A;  2R9X A;  2PD8 A;  2OSU A;  3IF6 C;  3EEH A;  2O99 A;  4YFM A;  5F68 A;  1HVB A;  2XD1 A;  3UB7 A;  4PM5 A;  5EM0 A;  4X68 A;  2XFS A;  1K57 A;  3P7N A;  2A3U A;  4MDZ A;  1N9N A;  3AGF A;  4OPR A;  1T1A A;  3E4Q A;  5FQM A;  1ZG6 A;  1XA7 A;  4LV3 A;  2JN7 A;  2J9O A;  1EW0 A;  4WEL A;  2EX6 A;  3O5Y A;  1ERM A;  4H6J B;  3KX0 X;  4HY8 A;  5HDC A;  2ZC4 B;  5HDD A;  2E8J A;  3O87 A;  2E8I A;  3G30 A;  3GVB A;  5FQJ A;  3T4O A;  2WKR A;  3DTM A;  3T50 A;  1K6R A;  1HLU P;  2O0Y A;  4BWI A;  5CTN A;  3UY6 A;  3HLF A;  3IH9 A;  1G28 A;  4Y2F A;  1WE4 A;  3TSG A;  1DP9 A;  4E3N A;  3OLO A;  2QWS A;  4OP8 A;  5DJU A;  4S2L A;  3OPR A;  1L0G A;  3FYZ A;  3PYP A;  4GDB A;  4ZJ3 A;  1KE3 A;  1E25 A;  1XXM A;  4MLL A;  3CG5 A;  3H82 A;  3H7W B;  4R23 A;  2WUQ A;  4CLC D;  5HWW A;  3G35 A;  1VEU B;  3HLB A;  3BFE A;  3Q7Z A;  1JVJ A;  4WZ4 A;  5E2H A;  3S1Y A;  3IT9 A;  3A3D A;  3UB9 A;  4JKT A;  4E3K A;  3QP5 A;  3EQV A;  2Y2Q A;  1YSP A;  2JKG A;  5IHV A;  2R9W A;  2L0W A;  2QYB A;  3B42 A;  3G32 A;  3HUM A;  1NLZ A;  3VFH A;  2HDS A;  3MSH A;  5IU1 A;  5HZH A;  4BBT A;  4IUH A;  2ZQ8 A;  5AQ9 A;  3DWZ A;  5AJG A;  1PI5 A;  3RXW A;  4R38 A;  4EXO A;  3PBO A;  2ZC7 A;  4MBF A;  3VOL A;  4HEF A;  1MY8 A;  1S1Z A;  3KSH A;  1YPR A;  4GJ4 A;  4WYY A;  3WS2 A;  3EWK A;  2XLN A;  4IHQ A;  2VX8 A;  2X01 A;  1ZKJ A;  1XJ2 A;  3A3E A;  3HCY A;  1KVM A;  3Q07 A;  4HES A;  5HSQ A;  3MF0 A;  1CI8 A;  1JTG A;  4E3J A;  3MKE A;  3PAE A;  4KZ3 A;  3VFF A;  4PM9 A;  4D60 A;  1F9I A;  1TD5 A;  4MN7 A;  1Y28 A;  1YMS A;  1O7E A;  4OPQ A;  4KZ6 A;  3GTC A;  5FQI A;  4XT2 B;  4RYE A;  4YWZ A;  4G3K A;  4Q0H A;  4CLC C;  4BBU A;  5KIZ A;  2XSS A;  3BM6 A;  5J4E A;  2GJ3 A;  1F98 A;  1N4O A;  3LR5 A;  1H3Q A;  3E0Y A;  5FDS A;  1ESU A;  1KVL A;  3G2Y A;  1L0F A;  3BYD A;  1BLP A;  2Y2G A;  3JVV A;  4WLA A;  3VMA A;  1FQG A;  3IWQ A;  4KUK A;  3W4Q A;  5I5L A;  4ETZ A;  4OPY A;  5AQB A;  3T4Q A;  1JWV A;  5KSH A;  3LID A;  2PBY A;  3L7H A;  3VP1 A;  5FAO A;  3LY3 A;  5TR7 A;  3GDI A;  2W3G A;  4EEU A;  4EBL A;  4R4R A;  5EUA A;  3T1Q B;  3WS1 A;  3VE4 A;  3C30 A;  3TG9 A;  1OTD A;  1S6R A;  2QJ7 A;  3A0V A;  5AVF A;  3D3O A;  1K55 C;  3MXQ A;  1HD8 A;  2M7U A;  3UE0 A;  3OZH A;  4RQ9 A;  3K2N A;  4MNR A;  1MWR A;  5L10 A;  3Q82 A;  4EET B;  1NZO A;  2Y8H A;  4R3A A;  4CPK A;  3SZT A;  3VSL A;  2ZLY A;  1Q2P A;  4JGR A;  1SDE A;  3OCN A;  1LT0 A;  3PTE A;  3N8S A;  5BOH A;  1P9R A;  3KO6 A;  3SOI A;  4DDY A;  3Q7V B;  1N9L A;  4C6Y A;  4QJG A;  5E43 A;  5FQK A;  5DJT A;  4MBH A;  1E3U A;  3N6I A;  1OT6 A;  2KLI A;  4R70 A;  1DRM A;  4S2M A;  5DFX A;  1H5X A;  3V39 A;  1P9W A;  2HV1 A;  4PKY A;  3FC7 A;  4UQI M;  5L8M A;  2Q9N A;  3IF5 A;  4OQ0 A;  4JXS A;  3BFD A;  3UPP A;  4LRZ E;  1EI5 A;  3IXG A;  1CJF A;  3OPL A;  3V3R A;  2G2U A;  4QY6 A;  5G18 A;  4DXC A;  5A8B A;  4Y3I A;  3A0R A;  3CPT B;  1SKO A;  3ZG9 B;  1PW1 A;  4WL9 A;  2MJ6 A;  5HFO A;  3ZG5 A;  2QJ5 A;  2P04 A;  4BL3 A;  2JKF A;  1XP4 A;  1M40 A;  2Z6D A;  1K6S A;  4K0X A;  4QY5 A;  4LFU A;  4OOY A;  4U3T A;  3C8C A;  4K08 A;  1ZC2 A;  4EEP A;  3ZCZ A;  1T1B A;  4EES A;  3VP4 A;  1KGE A;  3F1O A;  1IYP A;  3DWK A;  1SKF A;  2ZD8 A;  2JCH A;  2V8F A;  3LGO A;  3NEC A;  5FA7 A;  4Q0I A;  3ZQ5 A;  2WAF A;  3W4O A;  2VV8 A;  3WS4 A;  1W8Y A;  4KZ7 A;  2ZC3 B;  5AQA A;  2RCX A;  4KQO A;  3BQA A;  4FUW A;  5GLC A;  3BRM A;  3PBQ A;  4OQH A;  4X6T A;  3IQA A;  2ZJ9 A;  3ZG8 B;  1ERO A;  1YLJ A;  2XGN A;  3LIE A;  4LV1 A;  2VKS A;  3E2L A;  2XD5 A;  4O8G A;  1GA9 A;  3HJI A;  1K57 C;  1LI0 A;  4C75 A;  2I9V A;  3OCL A;  2WKE A;  4L9G A;  3NY4 A;  5HPF A;  4NXE A;  4R3J A;  3GEC A;  1CI9 A;  1KOU A;  2DRW A;  5L07 A;  5TBM A;  2OAP 1;  2Y2P A;  3SH8 A;  3BFG A;  2HZ5 A;  1S67 L;  4KEN B;  4RX3 A;  3LIA A;  3S7P A;  2WGI A;  4ETX A;  1ACF A;  4P6Z S;  3LCE A;  4PHT A;  5EFW A;  2WKQ A;  4BEN A;  3V67 A;  4KZA A;  4OP5 A;  1MWT A;  1N9O A;  5FEF A;  1XFN A;  1I2S A;  4CJN A;  1DJB A;  1K4E A;  2QMI A;  2FH5 A;  2ZMF A;  4LV2 A;  5HDS A;  2C6W B;  4JGO A;  1G6A A;  4KZB A;  5CED A;  1G6O A;  3N7W A;  1LL8 A;  3VE3 A;  2X71 A;  5FAP A;  3MR0 A;  4ZRR A;  2P08 A;  4D2O A;  4S2I A;  1YLW A;  4YIN A;  4BJP A;  2B5R A;  2XA7 M;  2EX2 A;  1DP8 A;  2FFY A;  2KX6 A;  2J8Y A;  3UB8 A;  2VLG A;  2JC7 A;  4GDN A;  5DKL A;  2A49 A;  1XFQ A;  3HL9 A;  4H6J A;  2VGL M;  2NUT C;  4JGP A;  3ZFZ A;  5GHY A;  4P0M A;  1G5U A;  4I39 A;  1UWP X;  3BEB A;  2V1A A;  4E3O A;  1GSV A;  2HDR A;  3W8K A;  5CRF A;  4ARZ A;  4JPM A;  1RCJ A;  3FZC A;  4LLO B;  2OLV A;  5FAQ A;  2ZQA A;  4MN5 A;  3FPW A;  3IXD A;  2V1B A;  2L4R A;  4KZ5 A;  3HLC A;  4I3I A;  4Y5F A;  3PBR A;  3BLS A;  4R6L A;  4NET A;  3S4X A;  3QP4 A;  4GNU A;  3RTY A;  3CJM A;  5GHZ A;  4HOI A;  1PW8 A;  2M7V A;  5TJJ A;  3H9W A;  3K3C A;  4UAA A;  2PT7 A;  2OWH A;  4F3L B;  3I7J A;  3C4P A;  3E2K A;  3T4J A;  4P87 A;  5DFY A;  1D7E A;  5GHX A;  4LGW A;  3UNW A;  1PWD A;  2HPB A;  4K91 A;  1Y4O A;  4PM8 A;  4EU0 A;  5E2E A;  3S7N A;  4E04 A;  2PBD P;  1FSW A;  3CHW P;  4DE3 A;  4DE2 A;  4DJ2 A;  4NKP A;  4WMC D;  1MKI A;  4Y7P A;  4OQI A;  1ZHH B;  3UB6 A;  5EOE A;  3F1N A;  2B95 A;  2J3T C;  1HTZ A;  5CGS A;  3SS4 A;  4O0P A;  5HL1 A;  1E3U D;  1TS6 A;  2WGW B;  4I3J A;  3B3X A;  4KG6 A;  2EX9 A;  4S2O A;  1LSV A;  3Q81 A;  3HLD A;  5EVI B;  1YMX A;  3E4O A;  3KSF A;  3N8L A;  4GB7 A;  2Y2O A;  3WRZ A;  1PIO A;  1VQQ A;  2Q9M A;  3FV7 A;  3NI9 A;  4JF6 A;  4JF4 A;  1BUE A;  1FIK A;  3DTE A;  5E2G A;  2CC1 A;  3LI9 A;  2V20 A;  3HBR A;  1ES4 A;  5EM1 A;  4HNB A;  1M6K A;  3NCK A;  2XFT A;  2D02 A;  3UDF A;  3G31 A;  4NXB A;  2V8C A;  2JKT M;  2V9A A;  3IBJ A;  1VET B;  1XA1 A;  2YKF A;  1P0Z A;  3QP2 A;  1MWU A;  4HBT A;  3CWF A;  3MZD A;  2JKR M;  2V2F F;  3UB5 P;  1FR1 A;  2GNX A;  3C7V A;  2IA2 A;  5I94 A;  4QHC A;  5FQQ A;  3MFD A;  5DKK A;  2V1Z A;  3ITB A;  2W1T A;  3QNB A;  2RL3 A;  2HJ9 C;  4GKU A;  1ES2 A;  1W8Q A;  2XR0 A;  4ZDX A;  3LEZ A;  4XXR A;  3DTI A;  2WZX A;  1W79 A;  2OV5 A;  1LSW A;  1OJG A;  1FCN A;  5EEC A;  2WAE A;  3HLW A;  3DW0 A;  3AGD A;  4DXB A;  1E4D A;  2XF3 A;  1BLC A;  3NIA A;  4Z1W A;  3V5M A;  3EGD C;  3T4L A;  5HX9 A;  2PU2 A;  1PFL A;  3KYE A;  3CI6 A;  3KSG A;  2O9A A;  3GSG A;  4E6W A;  4X53 A;  2ZMV A;  4B9O A;  1P97 A;  5DF7 A;  1PWG A;  3E4P A;  1XKZ A;  1GSX A;  2ZOI A;  4E3I A;  3DBA A;  3T12 B;  4UA7 A;  4MEZ A;  2O9C A;  4HH2 A;  3N8R A;  1YLY A;  4A5R A;  2PDR A;  3ZVT A;  3MQQ A;  4Y0U A;  4PM7 A;  1GHP A;  3L9K A;  3Q7V A;  2EXA A;  3TOI A;  2ZL1 B;  2H28 A;  4HJ4 A;  4KQD A;  4QPR A;  4BBV A;  5U47 A;  4WF0 A;  4GD8 A;  2EFX A;  4O01 A;  3ZGA B;  3LEQ A;  2HF6 A;  4M3K A;  4X1L A;  4GHI A;  5CTM A;  2OLU A;  3ULF A;  4NEE D;  3K3D A;  5F1F A;  4N1X A;  3CPT A;  2ZC6 B;  3C4O A;  3ZYT A;  1W5D A;  2VGJ A;  5GLB A;  5EE8 A;  2P9V A;  4PMA A;  1NWZ A;  5EVI D;  5A93 A;  1YLZ A;  1H8Y A;  4FCF A;  3FKV A;  3HJK A;  3VOZ A;  1WA9 A;  1GA0 A;  3A0S A;  4PAU A;  2ZM8 A;  2BAS A;  1BTL A;  2HP6 A;  5CHJ A;  2V0W A;  2WKH A;  4MBK A;  3IS2 A;  3U2A A;  3EOI A;  2GDN A;  4R1G A;  3IF6 B;  4LCM A;  1U60 A;  4EW7 A;  1FCM A;  2Y79 A;  4IJG A;  3NDG A;  3JYI A;  5G4Z A;  1F5M A;  2ZQC A;  4PPR A;  4OH0 A;  4WMC A;  2EX8 A;  1IEL A;  2VV7 A;  3RH8 B;  4LCL A;  4ZJ2 A;  3UDI A;  4EBP A;  4WUJ A;  1YLP A;  4IBX A;  3O86 A;  1CQA A;  1W7F A;  3OOV A;  3ZG0 A;  3RFB A;  5CHM A;  2W1R A;  5E2F A;  3T1X A;  1BZA A;  3BFF A;  2WZZ A;  2X02 A;  4DN0 A;  1MBL A;  3VP2 A;  3MXR A;  1XJ3 A;  2Z2M B;  1LL9 A;  1OTI A;  2A2L A;  1W63 M;  3BY8 A;  3BJN A;  4DE1 A;  3HLE A;  5F83 A;  1I5Q A;  3UDX A;  1QME A;  5DTS A;  1BLS A;  3NC8 A;  1K25 A;  4X55 A;  4IED A;  3IHB A;  4MCW A;  4ZJ1 A;  3ZDJ A;  3TE8 A;  3T1S A;  2ZOH A;  5DTK A;  1ES3 A;  5EVI C;  3CAX A; 
#chains in the Genus database with same CATH homology
 2Y2I A;  4R3B A;  4S2L A;  3OPR A;  3SH9 A;  1I2W A;  1L0G A;  2HP5 A;  4X56 A;  4EUZ A;  3FYZ A;  1WYB A;  4GDB A;  4ZJ3 A;  2H0Y A;  2JC7 A;  4GDN A;  1KE3 A;  1E25 A;  2A49 A;  1XXM A;  4MLL A;  4S2K A;  3CG5 A;  1BSG A;  4ZAM A;  3HL9 A;  3LY4 A;  4EQI A;  1KGG A;  3ZFZ A;  4R23 A;  2WUQ A;  4P0M A;  5GHY A;  1YLT A;  3ITA A;  3G35 A;  2ZQD A;  3N4I A;  4C3Q A;  3HLB A;  3M2K A;  3MKF A;  3P98 A;  1H8Z A;  3BEB A;  3BFE A;  5CEB A;  4E3O A;  2Y2N A;  1DY6 A;  1JWZ A;  1KDS A;  2HDR A;  3EQU A;  1RGZ A;  1JVJ A;  3Q7Z A;  4WZ4 A;  5M1A A;  3W8K A;  1FCO A;  5E2H A;  1C3B A;  3S1Y A;  4K0W A;  3IT9 A;  4OOM A;  2H5S A;  3A3D A;  4UHU A;  5CRF A;  3Q1F A;  1RCJ A;  3FZC A;  4JPM A;  5FQ9 A;  3BLM A;  5FAS A;  4JKT A;  1TDG A;  1NYY A;  4WZ5 C;  4E3K A;  2OLV A;  5FAQ A;  3EQV A;  1ONH A;  2Y2Q A;  2ZQA A;  3O3V A;  5IHV A;  3WRT A;  1GHI A;  1HZO A;  2R9W A;  4KQR A;  2PU4 A;  3IXD A;  4KZ5 A;  1ZG4 A;  4U0T A;  3P09 A;  3HLC A;  4Z9Q A;  4O7D A;  3QHY A;  1PWC A;  3G32 A;  3PBR A;  4LV0 A;  3HUM A;  5HAR A;  3BLS A;  4GOG A;  4NET A;  3S4X A;  1NXY A;  3FWL A;  3VFH A;  2HDS A;  1IYQ A;  3HRE A;  3GRJ A;  4GNU A;  5FI6 A;  3CJM A;  2ZQ8 A;  1TVF A;  5GHZ A;  4U0X A;  5AQ9 A;  2EXB A;  4WZ5 A;  4WEJ A;  1PW8 A;  4N9L A;  3DWZ A;  4UAA A;  1PI5 A;  3RXW A;  3I7J A;  3C4P A;  3E2K A;  3PBO A;  2ZC7 A;  5HW3 A;  4MBF A;  4HEF A;  4P87 A;  5DTT A;  1MY8 A;  4DE0 A;  5CGX A;  4BD1 A;  3M2J A;  4JBF A;  4WYY A;  1ONG A;  2QPN A;  3MXS A;  5GHX A;  3WS2 A;  2XLN A;  2H0T A;  1EWZ A;  3GMW A;  3A3J A;  3UNW A;  2XEP A;  4KZ8 A;  3IWI A;  2X01 A;  1PWD A;  2HPB A;  4JF5 A;  3UPO A;  1ZKJ A;  5JYO A;  2ZM2 A;  3A3E A;  4K91 A;  5DF8 A;  4PM8 A;  1KVM A;  3Q07 A;  4HES A;  5E2E A;  5CER A;  2ZQ9 A;  4WEK A;  4UA6 A;  1FSW A;  4DE3 A;  1CI8 A;  4S2N C;  4F94 A;  1JTG A;  4DE2 A;  2Y2M A;  1IKG A;  4WMC D;  4E3J A;  1MKI A;  4Y7P A;  3MKE A;  4OQI A;  1LHY A;  3PAE A;  5CGW A;  4KZ3 A;  3VFF A;  1RP5 A;  1ALQ A;  4FSF A;  4PM9 A;  3HUN A;  1L2S A;  4XUZ A;  5EOE A;  5F82 A;  1HTZ A;  5CGS A;  3SS4 A;  5HL1 A;  1YQS A;  1E3U D;  4FH2 A;  1FSY A;  4E3L A;  1BUL A;  2WGW B;  1YMS A;  4S2J A;  1O7E A;  4OPQ A;  4RVA A;  3B3X A;  4KG6 A;  3UO9 A;  2EX9 A;  2VGK A;  4KZ6 A;  4S2O A;  1VM1 A;  3GTC A;  5FQI A;  4N9K A;  3Q81 A;  3VP0 A;  3NBL A;  4S2N A;  3BEC A;  3NDE A;  4H8R A;  1NY0 A;  2WK0 A;  3HLD A;  4OKP A;  5EVI B;  1Z6F A;  1YMX A;  4RYE A;  4RA7 A;  2XK1 A;  3N8L A;  4GB7 A;  2Y2O A;  4FD8 A;  3OC2 A;  3WRZ A;  1XGI A;  1PIO A;  1VQQ A;  2Q9M A;  4KG5 A;  3FV7 A;  1K56 D;  3BM6 A;  3NI9 A;  4JF6 A;  1N4O A;  4JF4 A;  1BT5 A;  1L0D A;  1BUE A;  3PBT A;  2J9P A;  2WYX A;  3IXH A;  5FSR A;  5E2G A;  2CC1 A;  1ESU A;  1KVL A;  1K54 A;  2V20 A;  3G2Y A;  3UE1 A;  3HBR A;  4BQM A;  1ES4 A;  1L0F A;  1M6K A;  3NCK A;  2I72 A;  2XFT A;  3BYD A;  4P85 A;  3UDF A;  3HVF A;  3G31 A;  1BLP A;  2Y2G A;  2P9V B;  1XA1 A;  1BLH A;  3M6B A;  3VMA A;  1PZO A;  1FQG A;  3IWQ A;  1O07 A;  1MWU A;  3AGE A;  3G2Z A;  3W4Q A;  4HBT A;  5CHU A;  4JXW A;  5TGF A;  1FR6 A;  2ZMA A;  4OPY A;  5AQB A;  1JTD A;  1JWV A;  3MZD A;  5KSH A;  2Y55 A;  2PBY A;  2V2F F;  3ZNT A;  3HLG A;  3VP1 A;  5FAO A;  3VOY A;  1MPL A;  1FR1 A;  5A92 A;  5EVI A;  5KZH A;  4EBN A;  3C7V A;  3LY3 A;  4P6B A;  3GQZ A;  5TR7 A;  3G34 A;  4OVD A;  4ID4 A;  2WAD A;  3C5A A;  4QHC A;  5I94 A;  5FQQ A;  3MFD A;  2V1Z A;  1CEG A;  1QMF A;  4QD4 A;  4EBL A;  1XPB A;  4KZ4 A;  2XDM A;  1YT4 A;  4R4R A;  1J9M A;  2XQZ A;  5EUA A;  1LL5 A;  2ZM0 A;  3WS1 A;  1ERQ A;  3ITB A;  4DF6 A;  5FDH A;  2DCF A;  3QNB A;  2RL3 A;  4GN2 A;  3TG9 A;  4DKI A;  1IEM A;  3IWO A;  1G68 A;  3IHA A;  4WBG A;  1N9B A;  4WM9 A;  4GKU A;  1ES2 A;  3O88 A;  1W8Q A;  1S6R A;  2XR0 A;  4ZDX A;  2DNS A;  3LEZ A;  4ZTK A;  1K55 C;  4OON A;  1HD8 A;  4B4Z A;  1PZP A;  1RGY A;  4XXR A;  5KSC A;  4R0Q A;  3UE0 A;  3ISG A;  3OZH A;  5J8X A;  5M18 A;  3PBN A;  1PYY A;  2FFF B;  4MNR A;  1MWR A;  2WZX A;  1W79 A;  1NRF A;  1WYC A;  3Q82 A;  4GD6 A;  1NZO A;  2OV5 A;  4KG2 A;  4QU3 A;  2WKI A;  2Y4A A;  5A91 A;  3SH7 A;  4CPK A;  3LO7 A;  4IVI A;  2Y2L A;  3VSL A;  1FCN A;  2ZLY A;  4LEN A;  2Y2K A;  5EEC A;  2WAE A;  4Y0O A;  1Q2P A;  4N92 A;  3HLW A;  5D3O A;  4BL2 A;  3DW0 A;  3AGD A;  3IH8 A;  4E6X A;  4DXB A;  1K55 A;  3A3F A;  5KMW A;  1SDE A;  5EPH A;  2Z2L B;  3OCN A;  2HP9 A;  1E4D A;  2XF3 A;  3CZD A;  3PTE A;  1BLC A;  3NIA A;  3N8S A;  3V5M A;  5BOH A;  3WS5 A;  4NK3 A;  3PAG A;  4XUX A;  5CXW A;  2IWB A;  4IVK A;  5HX9 A;  3SOI A;  4DDY A;  3PBS A;  3MBZ A;  3Q7V B;  2IWC A;  4GZB A;  2P74 A;  4C6Y A;  1KDW A;  1NZU A;  2PU2 A;  4QJG A;  5A90 A;  5CEC A;  3C7U A;  5E43 A;  5FQK A;  1TEM A;  3GSG A;  4MBH A;  4E6W A;  4PM6 A;  2ZQ7 A;  1E3U A;  3N6I A;  4X53 A;  4X69 A;  1LLB A;  5HAI A;  4S2M A;  4B88 A;  3GV9 A;  2Y2J A;  1H5X A;  1PI4 A;  3V39 A;  5DF7 A;  1PWG A;  1XKZ A;  1K38 A;  4DDS A;  3OPP A;  4E3I A;  3MZE A;  2Q9N A;  1ES5 A;  3IF5 A;  4UA7 A;  1MXO A;  4MEZ A;  4Q8I A;  1IYO A;  4OQ0 A;  4JXS A;  3N8R A;  1S0W A;  3BFD A;  3UPP A;  1EI5 A;  1K56 A;  1YLY A;  3IXG A;  4QB8 A;  4OLG A;  4A5R A;  4JXG A;  3ZVT A;  2J7V A;  1XX2 A;  3D4F A;  1MWS A;  3OPL A;  3V3R A;  2G2U A;  4QY6 A;  5G18 A;  2QZ6 A;  2Y2H A;  4Y0U A;  3HUO A;  4DXC A;  4PM7 A;  1GHP A;  4KZ9 A;  3Q7V A;  1NYM A;  2EXA A;  1TDL A;  1KE0 A;  3TOI A;  3ZG9 B;  1PW1 A;  1SHV A;  3FKW A;  5L2F A;  5FI7 A;  2JE5 A;  4FH4 A;  3QNC A;  5GLD A;  1DJC A;  5HFO A;  4DRT A;  1K4F A;  4Y0T A;  5U47 A;  4GD8 A;  2EFX A;  5M19 A;  5GL9 A;  3ZG5 A;  1OME A;  2WGW A;  4KQQ A;  1Y54 A;  3RXX A;  4BL3 A;  1XP4 A;  3A3I A;  3ZGA B;  1M40 A;  4M3K A;  1K6S A;  4K0X A;  4QY5 A;  1L0E A;  3W4P A;  3ZHH A;  4OOY A;  1GCE A;  3OPH A;  3CMZ A;  4U3T A;  5FI2 A;  4OQG A;  1AXB A;  3BFC A;  1ZC2 A;  2JBF A;  2BG1 A;  5CTM A;  3ZCZ A;  4HBU A;  2IWD A;  2OLU A;  4S2P A;  2UWX A;  3VP4 A;  5F1F A;  1KGE A;  5AQ7 A;  4N1X A;  3VP3 A;  2ZC6 B;  3C4O A;  5HAQ A;  1IYP A;  1W5D A;  3DWK A;  2VGJ A;  1SKF A;  5GLB A;  4EWF A;  2ZD8 A;  4EV4 A;  2JCH A;  5EE8 A;  2P9V A;  3UE3 A;  4PMA A;  1CK3 A;  4OLD A;  5EVI D;  4JLF A;  5A93 A;  1YLZ A;  1H8Y A;  2ZC5 B;  4FCF A;  3FKV A;  5FA7 A;  3VOZ A;  2WAF A;  4UA9 A;  1JWP A;  1GA0 A;  3MZF A;  3W4O A;  1IKI A;  1KGF A;  3WS4 A;  5EOO A;  2ZM8 A;  1W8Y A;  3M6H A;  5DVA A;  3SS5 A;  4KZ7 A;  3UPN A;  2ZC3 B;  5AQA A;  1IYS A;  2RCX A;  1BTL A;  2HP6 A;  4KQO A;  3G4P A;  5CHJ A;  1XGJ A;  3SS3 A;  4R4S A;  3ZNY A;  2WKH A;  5GLC A;  3BRM A;  3GR2 A;  4OPZ A;  3V50 A;  4MBK A;  3PBQ A;  4OQH A;  4X6T A;  2Y91 A;  3IQA A;  2ZJ9 A;  3ZG8 B;  4BD0 A;  1ERO A;  3S22 A;  2GDN A;  1YLJ A;  2XGN A;  4R1G A;  5DF9 A;  3IF6 B;  3ZG7 B;  4LCM A;  4LV1 A;  5HAP A;  1U60 A;  4JXV A;  3RJU A;  3E2L A;  4OOL A;  5EVL A;  2XD5 A;  1NJ4 A;  4L0L A;  3WWX A;  1FCM A;  1LI9 A;  3NDG A;  1GA9 A;  3JYI A;  2ZQC A;  4PPR A;  1K57 C;  4OH0 A;  5JYP A;  1LI0 A;  1SDN A;  4C75 A;  4WMC A;  3OCL A;  2WKE A;  2EX8 A;  3NY4 A;  4B4X A;  4BLM A;  1ESI A;  1FOF A;  1IEL A;  2R9X A;  4R3J A;  1CI9 A;  2DRW A;  5F1G A;  4LCL A;  2OSU A;  3IXB A;  4ZJ2 A;  2Y2P A;  3IF6 C;  3UDI A;  3SH8 A;  4YFM A;  1HVB A;  3BFG A;  4EBP A;  4KEN B;  4RX3 A;  2XD1 A;  1YLP A;  4PM5 A;  4IBX A;  3O86 A;  1W7F A;  4X68 A;  2XFS A;  1K57 A;  2HDU A;  2WGI A;  3ZG0 A;  2A3U A;  4IBR A;  5CHM A;  3LCE A;  5E2F A;  1BZA A;  3BFF A;  2WZZ A;  2X02 A;  3AGF A;  2XH9 A;  4OPR A;  4BEN A;  1MBL A;  4N1H A;  4KZA A;  4OP5 A;  5FQM A;  1MWT A;  3VP2 A;  1ZG6 A;  1XA7 A;  2HDQ A;  3IF6 A;  3MXR A;  1I2S A;  2Z2M B;  1LL9 A;  2J9O A;  1DJB A;  4LV3 A;  4CJN A;  1K4E A;  2QMI A;  4WEL A;  2EX6 A;  4ZBE A;  4DE1 A;  4LV2 A;  2C6W B;  1ERM A;  1G6A A;  4KZB A;  5CED A;  3N7W A;  3HLE A;  1DJA A;  5F83 A;  1K54 C;  2ZC4 B;  1I5Q A;  3WS0 A;  2H10 A;  3UDX A;  1QME A;  5DTS A;  3O87 A;  3ZVW A;  1BLS A;  2E8I A;  3G30 A;  1Q2Q A;  1YM1 A;  3GVB A;  5FQJ A;  3NC8 A;  3V3S A;  1K25 A;  4X55 A;  2Y59 A;  1SCW A;  3DTM A;  4IED A;  3IHB A;  4ZJ1 A;  3UN7 A;  3ZDJ A;  1K6R A;  2X71 A;  5FAP A;  5TFQ A;  2G2W A;  2BLS A;  2WGV A;  2EFU A;  5CTN A;  3UY6 A;  4D2O A;  5FAT A;  3HLF A;  3IH9 A;  4S2I A;  4RX2 A;  1GHM A;  1YLW A;  3VSK A;  1KE4 A;  1WE4 A;  4E3M A;  4YIN A;  3TSG A;  4BJP A;  2B5R A;  5DTK A;  4E3N A;  2EX2 A;  1ES3 A;  2FFY A;  5EVI C;  4OP8 A;  5GLA A;  2J8Y A;  2C5W B;  1CEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...