1IELA

Crystal structure of ampc beta-lactamase from e. coli in complex with ceftazidime
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIGSDNIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
publication title Structures of ceftazidime and its transition-state analogue in complex with AmpC beta-lactamase: implications for resistance mutations and inhibitor design.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 116
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ielA00
2WAFA 1IEMA 3WWXA 3O88A 4NK3A 1YLTA 2J9PA 4PMAA 4GOGA 3EQUA 5BOHA 1YLWA 3LO7A 2WK0A 4WMCA 2WKHA 1DY6A 3V3RA 3ZGAB 2BLSA 1BSGA 1QMFA 5TGFA 5FATA 1NYYA 2WAEA 4S2LA 5DF7A 2OLUA 5KZHA 1MWRA 5F82A 3GR2A 3HLDA 4Y7PA 1RP5A 4WEKA 5EOEA 2Y2QA 1IYOA 3G2YA 3SS4A 2HDRA 2J9OA 3VP0A 4DDYA 4LV2A 4B4ZA 4XUZA 5DTKA 4LCLA 3LCEA 5CTNA 2EFUA 5TR7A 4KZ8A 2V2FF 4GD8A 1IYSA 1Y54A 2J8YA 4LV1A 3IF6C 3ZG9B 4N1XA 1VM1A 3W8KA 3UDFA 4OQGA 2Y2LA 5M19A 2P9VB 3W4PA 1YLPA 4JF6A 2ZLYA 3IXBA 5GLDA 2V1ZA 4EBNA 4PM5A 1K57C 1DJBA 1N9BA 2HDQA 3V5MA 2PU4A 3PBSA 4GKUA 5DF9A 3ZHHA 1ES4A 1FR6A 2Y2IA 3N8SA 5J8XA 3G32A 4IEDA 2DRWA 4WELA 1G6AA 1I2SA 2Y4AA 5L2FA 4IBXA 4X69A 3IWOA 3NC8A 1GA0A 1MXOA 3LY3A 3UE3A 1GA9A 3UE1A 4HEFA 1XGIA 3LEZA 3SH9A 1PI4A 4L0LA 4RYEA 1KGFA 1TEMA 3CJMA 1HVBA 3N4IA 3VP3A 4Q8IA 1GHIA 2P9VA 2OV5A 4QB8A 1JTGA 2ZQAA 1ZG6A 4DXCA 4KZ7A 4RA7A 4BL2A 5KSCA 2XGNA 1K4FA 1IYPA 2P74A 3FZCA 4JLFA 5F1FA 3SH7A 2X71A 2Y2KA 3E2KA 3G34A 4FD8A 4K0XA 4OH0A 3MZFA 1JWPA 4JKTA 5FI7A 4CJNA 5A93A 1ES2A 1XX2A 3VMAA 3AGEA 1FOFA 3BFDA 4H8RA 5EUAA 4PM7A 1FSWA 5FQJA 4FSFA 2QMIA 4UA7A 5FQIA 1IELA 1YLZA 3HLCA 3HLEA 4GNUA 5IHVA 4XXRA 3ZVTA 4D2OA 3MZEA 3FKVA 3HVFA 1SDNA 4OOMA 2ZD8A 4R3JA 3CG5A 5E43A 1K55A 5F1GA 2OSUA 2JCHA 3ZG0A 1MY8A 4DKIA 5I94A 1KE0A 2Q9NA 1FCOA 1RGZA 4KG2A 4JF5A 4KZ4A 3WS2A 3OCNA 5DTSA 2UWXA 3WS4A 1CEFA 2Z2MB 3UNWA 5A90A 5E2HA 2J7VA 1BUEA 1PW1A 4E3NA 4M3KA 2A49A 3OPLA 3A3DA 3G31A 3P09A 1YLYA 5CERA 4P87A 4JBFA 4OPZA 3IXGA 2X02A 2ZM0A 3OZHA 3V3SA 4E6XA 1PIOA 4OVDA 3E2LA 1SKFA 3GVBA 3W4OA 2V20A 4U0XA 4WM9A 1ALQA 2Y91A 4RX2A 3M2JA 1LHYA 2HDSA 2JC7A 5FI6A 4C6YA 1ESIA 3VP1A 4E3IA 1YMSA 2HP6A 4P6BA 3GSGA 2WUQA 4X68A 1PWGA 1RGYA 5KSHA 4HBUA 3PTEA 1NRFA 4KQQA 5M18A 4LV3A 3IWQA 2WGIA 5AQ7A 3PBOA 4OQ0A 1KDWA 5E2EA 3N6IA 3ZFZA 2Y55A 1LI0A 3NY4A 1K38A 1YQSA 1ES5A 2WGVA 5EVLA 2ZMAA 4OQIA 1PI5A 4N1HA 1LLBA 3JYIA 4E3KA 4EV4A 1S6RA 4UHUA 2A3UA 5GLAA 3MKFA 4R4RA 1W7FA 2ZC5B 3IHBA 5CGXA 3IF6A 2RL3A 4P0MA 1XXMA 3MXRA 3WRTA 1SHVA 3SOIA 1K57A 3B3XA 2E8IA 3C5AA 3NIAA 5E2FA 4KZ5A 1FCNA 3BFFA 4ID4A 4RVAA 3GV9A 3W4QA 1CK3A 4GN2A 1HZOA 5HL1A 5EVID 5CRFA 5FASA 1YLJA 4ZBEA 1XPBA 1N4OA 1QMEA 4GDNA 3UY6A 3FWLA 2ZQCA 1BT5A 2PU2A 1NJ4A 3DTMA 1BULA 1BLSA 1TDGA 2RCXA 1AXBA 3HREA 4KENB 1K56D 4DRTA 5GLCA 4F94A 2JBFA 4ZJ2A 4Z9QA 3IQAA 1SDEA 1S0WA 4BENA 5FAPA 3C7VA 1PWCA 1HTZA 3G4PA 4NETA 5EPHA 5EVIC 5FDHA 4BJPA 1NYMA 4ZAMA 3O3VA 3N7WA 1KGGA 1K54C 4KG5A 4OP5A 5GHZA 3WRZA 2VGJA 4HBTA 1MKIA 1OMEA 1PWDA 1TVFA 3DWKA 1ERMA 1JWZA 2CC1A 3GRJA 3IXDA 4WBGA 2G2UA 4UA9A 2XR0A 4S2KA 4X56A 4DE0A 4MBFA 1BZAA 4K0WA 1XA7A 4OKPA 1BLCA 2EFXA 3G2ZA 4PPRA 3DW0A 3VFFA 3TG9A 4JXGA 4EWFA 2Y2NA 1YT4A 2Y2HA 4DE1A 5GHXA 3N8RA 3HUNA 3PAEA 3MFDA 3SH8A 2ZQ8A 3N8LA 5M1AA 4QD4A 1HD8A 3QNBA 4X53A 2XFSA 4BD1A 4EBPA 3FKWA 1ERQA 3Q1FA 4N9KA 4Y0UA 4KQRA 1PYYA 4KQOA 4MEZA 4QHCA 3PBRA 4N92A 1CEGA 4LCMA 5FQKA 2IWDA 1ES3A 1Z6FA 3VP4A 1ESUA 2R9WA 4QU3A 3HL9A 5FAOA 3CZDA 5DF8A 1IKGA 3M2KA 2HP9A 1LI9A 3UDXA 4E6WA 3HBRA 1MWTA 1O7EA 1YMXA 2JE5A 5FI2A 1MPLA 1WE4A 4RX3A 3VFHA 4UAAA 2H5SA 3VOYA 1E4DA 4JXSA 4OPYA 2I72A 4FCFA 3EQVA 1M6KA 3RXWA 3Q7VB 4JPMA 4IVIA 1Q2PA 5HX9A 2EXBA 4S2IA 3QHYA 4B4XA 3IXHA 1ZC2A 4ZTKA 1C3BA 3BECA 3V50A 4DE2A 3ZNYA 3FV7A 4OONA 4S2OA 5U47A 4P85A 3UO9A 1L0GA 3MXSA 1WYCA 3BLSA 4OLGA 4WZ5C 5D3OA 3BFEA 2ZJ9A 5HW3A 2FFFB 3FYZA 4K91A 5CEBA 4S2MA 2Q9MA 1I5QA 1K6SA 3GMWA 3MBZA 3TOIA 2H10A 2HP5A 3IF6B 1K55C 3BFGA 3O86A 2Z2LB 5HARA 5HAQA 4DE3A 3BEBA 3Q7VA 1KDSA 4MLLA 1L0DA 4OPQA 4S2NC 5CGSA 5EOOA 4OOYA 5JYOA 1NZOA 1ZKJA 1VQQA 1XA1A 3SS5A 1E3UD 4R4SA 1CI9A 1FSYA 3S4XA 3IT9A 2IWBA 1IKIA 2ZC6B 3NI9A 1NY0A 4KG6A 1BLPA 4E3OA 3OPPA 5HFOA 3UN7A 4FH2A 5CTMA 5FQQA 4DDSA 1KE3A 3OC2A 3PBNA 3MKEA 4CPKA 1EWZA 4QY6A 3HLGA 5E2GA 1G68A 3G30A 1W8QA 5FSRA 3IH9A 1J9MA 3Q07A 2EXAA 2WZZA 2X01A 1L2SA 1ZG4A 3G35A 5DVAA 4MNRA 5CECA 1SCWA 2EX9A 4WMCD 4JF4A 3HLWA 1GHPA 3HUMA 2OLVA 3ZVWA 1MWUA 4DXBA 3C7UA 3ZDJA 1TDLA 3WS0A 3UPOA 1H8YA 3VP2A 3UDIA 2QPNA 3O87A 5EVIA 2DCFA 2IWCA 4GB7A 2Y2MA 3PBQA 1W5DA 1NZUA 1U60A 1NXYA 4LV0A 4O7DA 5EE8A 5EECA 5A91A 4ZJ3A 3ZG8B 1K54A 4DF6A 1KVLA 3A3EA 1BTLA 3BRMA 1O07A 1PZPA 2WZXA 4WEJA 3HLBA 1W8YA 3UPPA 1BLHA 1PZOA 3IHAA 2XDMA 3Q7ZA 4KZ9A 1WYBA 2Y2PA 3OPRA 1K56A 3WS5A 4EUZA 4IVKA 4PM6A 1MBLA 4YINA 4OOLA 2ZC3B 3GQZA 3Q81A 1PW8A 2XFTA 4EBLA 3UE0A 3PBTA 3PAGA 4Y0OA 4OPRA 3VOZA 2VGKA 4KZBA 3NDEA 1KGEA 4R23A 1IYQA 1EI5A 4EQIA 4MBKA 3I7JA 5FA7A 3LY4A 3M6BA 5CHJA 2C5WB 2BG1A 2R9XA 4GD6A 4WZ4A 4BL3A 3C4OA 2XLNA 3A3IA 5CHMA 1JVJA 5TFQA 3BYDA 2ZQDA 1FR1A 5AQBA 5AQAA 4GDBA 2H0YA 3NDGA 1K6RA 2XH9A 5CGWA 1YM1A 5CEDA 1LL9A 2G2WA 3VSLA 3BFCA 3HUOA 3IH8A 2DNSA 3QNCA 4OP8A 1K4EA 5DTTA 5JYPA 2XK1A 4KZ3A 4OLDA 4R3BA 4U0TA 3ISGA 3VSKA 3RJUA 3A3JA 3OPHA 3C4PA 4FH4A 2ZM2A 4LENA 4ZJ1A 1MWSA 1H5XA 5G18A 2WADA 2H0TA 4XUXA 3S22A 3NCKA 1XP4A 3ZCZA 3BM6A 3M6HA 1GHMA 4E3JA 1L0FA 4KZAA 5KMWA 4OQHA 2EX8A 3IWIA 3HLFA 1K25A 5FAQA 1EROA 4X6TA 5CHUA 2HDUA 5CXWA 5FQMA 1W79A 3SS3A 4BD0A 4Y0TA 1I2WA 1GCEA 1FQGA 2HPBA 3OCLA 3P98A 4R0QA 1H8ZA 4WZ5A 5F83A 3ZG7B 2WGWB 4N9LA 2ZC4B 5GHYA 4PM8A 3IF5A 1XKZA 4JXVA 2EX2A 4MBHA 2C6WB 1M40A 2XF3A 3BLMA 4QJGA 4WYYA 2WKEA 2B5RA 4B88A 1E25A 1DJCA 4S2NA 2WYXA 4HESA 5FQ9A 4GZBA 4C3QA 1CI8A 2Y2GA 4BQMA 3WS1A 4PM9A 3AGDA 3ZG5A 1FCMA 1LL5A 1L0EA 5GL9A 2ZQ9A 2ZQ7A 2QZ6A 4KZ6A 3ITBA 2XD1A 1Q2QA 1ONGA 4S2PA 4E3MA 2WGWA 4S2JA 3RXXA 4YFMA 3UPNA 3AGFA 2PBYA 2WKIA 2FFYA 3S1YA 3ITAA 1XGJA 5HAPA 4R1GA 4BLMA 1RCJA 3A3FA 5GLBA 2XEPA 3Q82A 1E3UA 4U3TA 4X55A 3TSGA 4IBRA 4C75A 1ONHA 2Y59A 2GDNA 4QY5A 3CMZA 3ZNTA 4E3LA 5EVIB 3DWZA 5HAIA 1JWVA 2EX6A 4A5RA 4ZDXA 3GTCA 2XD5A 2ZC7A 1DJAA 2ZM8A 2Y2OA 3V39A 4JXWA 5A92A 3D4FA 1KE4A 3NBLA 4UA6A 1KVMA 5AQ9A 1JTDA 2XQZA 2Y2JA 3MZDA
chains in the Genus database with same CATH superfamily
3WWXA 4NK3A 1YLWA 3V3RA 2BLSA 1P9RA 3UMEA 5FATA 1NYYA 3KSHA 4Y7PA 4WEKA 3VP0A 4DDYA 1IYOA 5F5YA 2G7UA 4LCLA 1K0KA 2EFUA 4KZ8A 2K2NA 4GD8A 3SZTA 3IF6C 3ZG9B 1VM1A 3W8KA 4OQGA 1YLPA 2V1ZA 1MC0A 5DKKA 1DJBA 3TW8A 1YSQA 2PU4A 1FR6A 2DRWA 4WELA 1I2SA 3W2ZA 3UE1A 4HEFA 1XGIA 2PD8A 1PI4A 1HVBA 3EOIA 1GHIA 4KZ7A 4RA7A 4BL2A 2XGNA 3F1OB 5FDSA 3E2KA 4OH0A 4ETZA 4QWOA 1JWPA 4CJNA 4BWIA 5FL3A 2A24B 5HPIA 5EUAA 1FSWA 5FQJA 1SKOB 2QMIA 1NRJA 1VETB 3LICA 4Y2FA 3HLEA 4ME4A 4D2OA 3ZVTA 3MZEA 3CWFA 4OOMA 1OTAA 3NECA 2OSUA 2JCHA 5I94A 1KE0A 2Q9NA 4QPRA 1FCOA 2J80A 3QP6A 1T1CA 3WS4A 1CEFA 3FC7A 2J7VA 1BUEA 4EU0A 3SW1A 2A49A 2GZAA 5CERA 4JBFA 3V3SA 1PIOA 2L0WA 1SKFA 5L8MA 2QWSA 3B47A 2HDSA 5FI6A 3MQ0A 1RGYA 2VA0A 4KQQA 1W63M 2WGIA 1OJ5A 3PBOA 4G3VA 4OQ0A 5E2EA 2QYBA 3NY4A 4LRZE 5DJTA 3NOUC 1Y28A 3T4SA 4N1HA 1LLBA 1XJ3A 1SZVA 4EV4A 1S6RA 1IOUA 1W7FA 1WA9A 5CGXA 3IF6A 2RL3A 4P0MA 4HJ6A 3D3OA 3E4PA 3SOIA 3C5AA 2V1BA 4GN2A 5EVID 1BLSA 2B18A 5EM1A 3CHWP 1K56D 4BJPA 1PWCA 1HTZA 5EVIC 3BY8A 1K54C 4KG5A 4OP5A 3WRZA 4HBTA 3LR3A 5FEFA 1JWZA 2CC1A 4X56A 4DN0A 4XT2A 4HQAA 4OKPA 4LGWA 4PPRA 3MF0A 3DW0A 3TG9A 4JXGA 4EWFA 2Y2NA 1YT4A 2Y2HA 3N8LA 3MMHA 3QNBA 4BD1A 3LFVA 3ULFA 3PBRA 1Z6FA 2ZBBA 3MSHA 4LFUA 5FAOA 2K7SA 5DF8A 1ACFA 1O7EA 1VB6A 5IU1A 4OPYA 2I72A 4FCFA 3EQVA 4S2IA 3LR4A 4B4XA 4II7A 2JKTI 3VV4A 4OONA 4S2OA 4P85A 3MXSA 4WZ5C 1YPRA 3BFEA 5HW3A 2FFFB 5CEBA 4S2MA 4B93A 1K6SA 3TOIA 3IF6B 4DE3A 3Q7VA 1KDSA 3UB9A 2W3EA 3ZQ5A 4OOYA 3T4QA 1XA1A 1E3UD 4R4SA 4F3LA 2MJ6A 3LR5A 2Q0OA 4KG6A 3OLOA 1TD5A 3OPPA 4O0PA 5FQQA 4DDSA 4EQ1A 1EWZA 1H0MA 1W8QA 3Q07A 2EXAA 4ETXA 1L2SA 1XFNA 4WMCD 3C7UA 1TDLA 3VP2A 5EVIA 2DCFA 1AWIA 4L9EA 4GB7A 4O7DA 5EE8A 4DF6A 3ZG8B 1K54A 5EFWA 4XT2B 2L4RA 1BTLA 3QP2A 1BLHA 4KZ9A 1F9IA 1WYBA 3OPRA 3F1NA 1K56A 3H7WA 4EUZA 4YINA 3NOTC 3PBTA 3T4TA 1D7EA 2VGKA 3P7NA 4MBKA 3LI9A 5FA7A 1XJ2A 5CHJA 3A0VA 4WZ4A 4MN7A 3C4OA 3A3IA 5F6AA 2ZQDA 3BY9A 4EW7A 5AQAA 1K6RA 3BFCA 2HZ5A 1S1YA 4X1MA 5DTTA 1MZUA 2Y8HA 3QNCA 1F2KA 1GSVA 4KZ3A 4Q0JA 2OWJA 3C8CA 2JKRI 2ZM2A 1MWSA 1H5XA 2WADA 2A2LA 4E3JA 5I5LA 2EX8A 5FAQA 1W79A 1I2WA 1FQGA 4WZ5A 4R0QA 1H8ZA 2ZC4B 5L09A 3DTIA 2J3WA 3R7WB 3DAVA 2C6WB 3IS2B 1M40A 2O9CA 3E4QA 2ACGA 3S7PA 5IT5A 4B88A 3T1RA 4R6LA 2PR5A 3AGDA 3ZG5A 1L0EA 2ZQ7A 2M7UA 2QZ6A 2YKFA 3ICYA 4S2JA 3RXXA 4Y5FA 3LIBA 2NUTC 4R1GA 4JGOA 2XEPA 4HP9A 1E3UA 4C75A 5EVIB 2O0YA 2EX6A 1V9ZA 3V39A 4NEED 3VOLA 5A92A 1JTDA 2XQZA 3MZDA 3H7WB 4PHTA 1IEMA 4PMAA 2JKRM 4WMCA 2WKHA 3FG8A 5DJUA 4S2LA 5DF7A 5KZHA 1MWRA 1LT0A 3HLDA 1RP5A 4B4ZA 4XUZA 3KYEA 3LCEA 4H6JA 4LV1A 4N1XA 3OOVA 2Y2LA 2P9VB 4JF6A 5GLDA 1YKDA 3ZYTA 4PM5A 3FPVA 3V5MA 4GKUA 5DF9A 1T1AA 3N8SA 4IEDA 3H82A 1G6AA 2Y4AA 4L9GA 4X69A 5J7EA 2HF6A 3PYPA 2EWWA 4I5SA 2D02A 3NULA 3SH9A 4L0LA 1TEMA 2OV5A 4QB8A 1ZG6A 3S7NA 2Z6DA 2P74A 4JLFA 5F1FA 2V0WA 3SH7A 4KUKA 2X71A 2Y2KA 3G34A 5FI7A 5DKLA 2VX8A 3QP5A 3BFDA 4H8RA 2R78A 2V9AA 4PM7A 5FQIA 1IELA 2QJ7A 5IHVA 2Z6CA 3HVFA 2INWA 1K55A 5F1GA 3UB6A 4DKIA 4AFIA 2L1MA 3TRCA 3B33A 4KZ4A 3OCNA 5DTSA 2UWXA 2YKHA 2O99A 1PW1A 1VETA 3A3DA 3G31A 4OPZA 2ZM0A 3OZHA 3UMDA 4E6XA 2V8FA 3W4OA 4LLOB 1CJFA 1LHYA 4C6YA 4MDZA 1ESIA 4E3IA 1YMSA 2WUQA 1T19A 1NWZA 4HBUA 3PTEA 4X1LA 1NRFA 3QP4A 2W3GA 4YNRA 1W63Q 1CF0A 3ZFZA 4H6JB 1LI0A 2PBDP 4HJ3A 4HJ4A 2WGVA 1ES5A 2LB9A 5EVLA 1PI5A 3G6OA 4YOFA 3JYIA 4UHUA 3T1QB 3H82B 1XXMA 3MXRA 1SHVA 4NXBA 3B3XA 2E8IA 5E2FA 4KZ5A 1S67L 1XPBA 1N4OA 1QMEA 3FWLA 2ZQCA 1NJ4A 1BULA 1PNEA 2VK3A 1AXBA 5FEGA 4HIAA 4DRTA 5GLCA 2JBFA 4ZJ2A 3IQAA 5FAPA 5FDHA 3TJZC 3EWKA 4ZAMA 1Z09A 1OT6A 1MKIA 1OMEA 5KIZA 1ERMA 4PKYG 2CMNA 3BJNA 2XR0A 4UA9A 1ZTUA 3A0SA 1BLCA 2ZL1A 3E4OA 1OPXA 3PAEA 3MFDA 3SH8A 4QD4A 1ERQA 3Q1FA 4N9KA 4Y0UA 4KQRA 1PYYA 4KQOA 4N92A 1CEGA 4LCMA 1ES3A 4QU3A 4YWZA 1IKGA 3M2KA 2HP9A 1MWTA 1YMXA 4UEYA 2H5SA 4JXSA 3K3DA 2OAP1 3R4KA 2EXBA 3GECA 3BQAA 5HD5A 1C3BA 4DE2A 3V50A 3ZNYA 1L0GA 5D3OA 3BLSA 2PT7A 2ZJ9A 4Q0HA 4MCWA 4G3KA 2Q9MA 2H10A 2WKPA 3VE3A 4CLCD 3O86A 5HL6A 2ZMFA 3BEBA 4MLLA 4OPQA 4S2NC 4M4XA 1ZKJA 1VQQA 3SS5A 5DFXA 3JVUA 3IT9A 3UB8A 1IKIA 4BBUA 4HI4A 4CLCC 4FH2A 1KE3A 1DP9A 2BTFP 4CPKA 5E2GA 3G30A 1TS6A 5FSRA 1CQAA 2WZZA 2X01A 1XFQA 1ZG4A 4MNRA 2EX9A 1YSPA 4HY8A 1GHPA 3ZVWA 1MWUA 4I39A 1UWPX 1H8YA 2IWCA 2VZWA 2QHKA 2Y2MA 1NZUA 4GCZA 1KVLA 1O07A 2ZL1B 4WEJA 1W8YA 4ARZA 3Q7ZA 3MFXA 2LB5A 5AVFA 1MBLA 1G28A 4HP4A 2XFTA 2H28A 3NDEA 1KGEA 4EQIA 3I7JA 4PAUA 2C5WB 2R9XA 4GD6A 3TE8A 3JPUA 1FR1A 5AQBA 2XROA 4GDBA 3OBFA 3LGOA 2PR6A 5CGWA 1LL9A 2G2WA 3HUOA 3CPTA 3IH8A 5HWVA 1GSWA 4OLDA 4NXEA 4FH4A 4LENA 3S7QA 2H0TA 4R38A 1XJ6A 3BQ8A 5KMWA 1K25A 5TJJA 4X6TA 2HDUA 2XSSA 4Y0TA 1OTEA 2HPBA 5F83A 2WGWB 4N9LA 2W1RA 1XKZA 4BMWA 4Y17A 5DFYA 3MJQA 3MQQA 1OT9A 3C2WA 2B5RA 2M7VA 1DJCA 4S2NA 4UQIM 4BQMA 4HOIA 2XD1A 3LIAA 1ONGA 2PAVP 3UB7A 4E3MA 4YFMA 4CLCA 1IFQA 3R7WA 2PBYA 3IS2A 2WKIA 4BLMA 1RCJA 3A3FA 4DXBA 4U3TA 3TSGA 2P04A 3MR0A 3IBRA 4A5RA 3GTCA 1HLUP 1DJAA 2ZM8A 2Y2OA 5HD3A 3DTKA 1KE4A 3NBLA 4ARZB 1KVMA 5AQ9A 2JKFA 3UB5P 2WAFA 3O88A 4EXOA 1YLTA 2J9PA 3EQUA 5BOHA 3LO7A 2WK0A 1BSGA 5F82A 3GR2A 3P01A 2J9OA 2V2FF 1IYSA 3E0YA 5HSQA 3CUEC 2JKTM 3CPTB 5M19A 2B02A 4EBNA 5EM0A 3DBAA 1N9BA 1N9NA 2HDQA 1ES4A 2Y2IA 2V8CA 2HV1A 2PD7A 3IX8A 4MN6A 4IBXA 5G4ZA 1GA0A 3KSFA 3DTEA 4I38A 3VP3A 4Q8IA 2P9VA 4B9OA 4DXCA 3O5YA 1K4FA 2O9AA 4K0XA 3MZFA 1TS0A 5A93A 1D1JA 1FOFA 4FOFA 3L7HA 4FSFA 4UA7A 1YLZA 4GNUA 4XXRA 4Y13A 4CLCB 1H8MA 3FKVA 4DJ3A 1SDNA 3CG5A 3ZG0A 1FIKA 2QKPA 3JVVA 4WL9A 1RGZA 4KG2A 3UNWA 3BWLA 5A90A 5G4YA 2KX6A 3RFBA 1YLYA 4P87A 3IXGA 2X02A 1X0OA 2ZOHA 4OVDA 4ZRRA 3E2LA 3GVBA 3K2NA 4WM9A 1ALQA 2Y91A 4RX2A 3M2JA 4P6BA 4DMZA 3GSGA 2UV0E 2Y79A 3VE4A 4P6ZM 3IX4A 4LV3A 3T4KA 2FZ0A 1KDWA 3N6IA 3B42A 4NKPA 3HCYA 3S7OA 1K38A 2ZMAA 4OQIA 3T12B 2A3UA 3MKFA 1VEUB 2ZC5B 3IHBA 3CUEA 3WRTA 1H3QA 5J3WA 2VKSA 4G3WA 3BFFA 4ID4A 2VV7A 3W4QA 1CK3A 3H9WA 1HZOA 4Q0IA 5HL1A 5CRFA 3LI8A 2PU2A 3DTMA 1TDGA 2RCXA 4KENB 4F94A 1S0WA 3G4PA 4NETA 5EPHA 1NYMA 3O3VA 2VV6A 4BBTA 5K5BA 1PWDA 1TVFA 3GRJA 1V9YA 2JHEA 3IXDA 1STZA 4CLCE 5A8BA 4S2KA 1BYWA 4DE0A 4MBFA 4X25A 4K0WA 3LIEA 2EFXA 3G2ZA 1ZHHB 2W1TB 4DE1A 4BBVA 3MXQA 3HUNA 1YAXA 2M1CA 4LRYC 4EBPA 4K08A 2OAQ1 5AVEA 3KYZA 4GLQA 3KO6A 1ESUA 2EA9A 3VP4A 1F5MA 2R9WA 3CZDA 5CX7A 1DP6A 4E6WA 5FI2A 1WE4A 4RX3A 3VFHA 3T50A 1S4SA 3T4OA 1LL8A 3QHYA 1ZC2A 4ZTKA 5HZHA 3FV7A 5U47A 4R70A 4OLGA 3BW6A 4O01A 2KOIA 1I5QA 3GMWA 3MBZA 4FUWA 3NOPC 2P7JA 1TF1A 2Z2LB 5HARA 5HAQA 5JYOA 2ZOIA 1F98A 1CI9A 1T1BA 1BLPA 5HFOA 2VGLM 1Y4OA 3OC2A 3PBNA 3MKEA 1UWNX 4QY6A 4UQIS 1S1ZA 2ZMVA 3IH9A 1J9MA 2HJ9C 4GS9B 3G35A 5DVAA 5TBMA 5CECA 4RQ9A 2OLVA 3E98A 3V67A 3UPOA 4MMNA 2QPNA 3O87A 3PBQA 5A91A 4CQHA 3A3EA 2HJEA 4JGPA 1PZPA 2HGVA 3UPPA 3HLBA 1D06A 1PZOA 2XDMA 3WS5A 5AJGA 4IVKA 1LSVA 1DP8A 3Q81A 4EBLA 4Y0OA 4NXGA 2NUPC 3VOZA 4KZBA 4R23A 1IYQA 1EI5A 4LPZA 3LY4A 1P97A 3M6BA 2OWHA 2BG1A 2BASA 2XLNA 3KX0X 3PR6A 1N9LA 5CHMA 5TFQA 3RTYA 3C38A 3NDGA 4HHDA 2XH9A 1YM1A 5J4EA 2PDRA 2DNSA 2XK1A 4U0TA 1G5UA 3ISGA 3A3JA 3OPHA 4ZJ1A 2PHYA 3NCKA 2DMWA 3BM6A 3M6HA 1GHMA 1L0FA 2O9BA 4KZAA 4OQHA 5CHUA 5FQMA 3SS3A 4BD0A 3T1XA 1GCEA 2XA7M 3CAXA 4IUHA 4KUOA 4JXVA 2IA2A 1PFLA 3BLMA 3EEAA 4WYYA 2WKEA 1E25A 4GZBA 4C3QA 3C30A 3WS1A 4PM9A 1OTIA 1FCMA 1LL5A 4GJ4A 4JGRA 2WGWA 2JKGA 3UPNA 3FPWA 5TBMB 3S1YA 3EGDC 3ITAA 5HAPA 5GLBA 1ODVA 1TS7A 4X55A 4HNBA 4IBRA 2GDNA 3CMZA 2WKRA 4E3LA 3LR0A 1JWVA 4IHQA 4ZDXA 2XD5A 2ZC7A 4UA6A 2Y2JA 4EERA 3PHYA 3LUQA 4WN5A 4GOGA 4Y15A 4R3AA 3ZGAB 1DY6A 3T4JA 1QMFA 5TGFA 3U4LP 2WAEA 3CLOA 2OLUA 2JN7A 5EOEA 4QJGA 2Y2QA 3G2YA 3SS4A 2HDRA 4LV2A 1J3WA 2W3FA 5DTKA 4P6ZS 5CTNA 5TR7A 3NJAA 3LIFA 2J8YA 1Y54A 3UDFA 3W4PA 4DJ2A 2ZLYA 3IXBA 1VHMA 1K57C 3PBSA 3D9YA 3ZHHA 1KOUA 5J8XA 3G32A 3LIDA 4WUJA 5L2FA 3IWOA 3NC8A 1MXOA 3LY3A 3UE3A 4FTXA 1GA9A 3LEZA 4RYEA 1P0ZA 1KGFA 3CJMA 4Y3IA 3N4IA 1T18A 5EVEA 1JTGA 2ZQAA 1P9WA 5KSCA 1IYPA 3FZCA 4FD8A 4JKTA 1ES2A 1XX2A 3VMAA 3AGEA 2EWVA 4ESPA 3HLCA 1MKMA 4EETB 2ZD8A 4R3JA 5E43A 2I9VA 1MY8A 4WLAA 4I3JA 4JF5A 3WS2A 4NG2A 2Z2MB 4O8GA 5E2HA 3D72A 4M3KA 4E3NA 3OPLA 3P09A 5F69A 2V20A 4U0XA 3T4LA 2QJ5A 3EEHA 2GX5A 2JC7A 4KQDA 3VP1A 4E04A 2HP6A 4X68A 4NXFA 2KLIA 1PWGA 2KDKA 5KSHA 1GSXA 5M18A 3IWQA 3KSIA 5AQ7A 2Y55A 1YQSA 3KYQA 4E3KA 5GLAA 4R4RA 4IUKA 3EGXC 3CI6A 1A0KA 4HH2A 1K57A 3NIAA 5HDDA 1PRQA 1FCNA 2PYRA 4RVAA 3GV9A 4JGQA 5FASA 1YLJA 4ZBEA 4GDNA 1VEUA 3UY6A 1BT5A 2WKQA 2VEAA 3LYXA 5LBRA 3HREA 2VGLS 4Z9QA 1NLYA 1SDEA 4BENA 3C7VA 2P08A 3N7WA 5HWTA 1KGGA 1NLZA 5GHZA 2VGJA 3DWKA 4WBGA 2G2UA 2W3HA 2K31A 1BZAA 1XA7A 4PKYA 3VFFA 2B95A 5GHXA 2V0UA 3N8RA 2ZQ8A 2W0NA 5M1AA 1HD8A 4X53A 2XFSA 3FKWA 4I3AA 1N9OA 4MEZA 4QHCA 2XRNA 5FQKA 2IWDA 1DRMA 3HL9A 3UDXA 1LI9A 3F1PA 3HBRA 3RH8B 2JE5A 1MPLA 2W1TA 4UAAA 3VOYA 1E4DA 2J3TD 3CITA 3RXWA 1M6KA 3IX3A 3Q7VB 4JPMA 4IVIA 1Q2PA 5HX9A 2GNXA 1TS8A 3IXHA 2D01A 5HDSA 4F3LB 3BECA 3UO9A 1WYCA 3U2AA 4EEUA 3FYZA 4K91A 1LSXA 2J3TC 2HP5A 4EEPA 1K55C 1EW0A 1OTDA 3BFGA 1L0DA 5CGSA 5EOOA 1NZOA 4HH3A 2XA7S 1OTBA 1FSYA 3S4XA 3UE6A 2IWBA 2PYPA 2ZC6B 3IBJA 3NI9A 1NY0A 4E3OA 3UN7A 1XJ4A 5EV0A 5CTMA 4IJGA 3QP1A 3LEQA 3NHQA 3HLGA 3MS6A 4GHIA 1G68A 3F1NB 2E8JA 3QP8A 1SCWA 4JF4A 3HLWA 5HPFA 3HUMA 3ZDJA 4D60A 3WS0A 2GJ3A 3UDIA 2VJWA 1W5DA 1U60A 1NXYA 4LV0A 5EECA 5L10A 4ZJ3A 3HJKA 1S66L 3BRMA 2WZXA 3IHAA 5F68A 2VLGA 2Y2PA 1OJGA 4GS9A 4PM6A 4OOLA 2ZC3B 3GQZA 1PW8A 3UE0A 3PAGA 4OPRA 3A0RA 4I3IA 3HJIA 4BL3A 3F1PB 1JVJA 5L07A 3BYDA 2W27A 2H0YA 5CEDA 3VSLA 4OP8A 1K4EA 5JYPA 4R3BA 5C5KA 4WF0A 3VSKA 3RJUA 3C4PA 5G18A 5MC7A 4XUXA 3S22A 1XP4A 3ZCZA 2W3DA 2VV8A 3IWIA 3HLFA 4GW9A 1EROA 5CXWA 2AVXA 3P98A 3OCLA 3ZG7B 5HDCA 3PXPA 3K3CA 5GHYA 1UGUA 4PM8A 3IF5A 2EX2A 4MBHA 1L3LA 3F1OA 1G6OA 2XF3A 3KSGA 2WYXA 4HESA 5FQ9A 1CI8A 2Y2GA 2A24A 1S4RA 3MQOA 2V1AA 3T1SA 4Z1WA 5GL9A 4MN5A 2ZQ9A 4KZ6A 4EESA 4EUVA 3ITBA 1SKOA 1Q2QA 4LRXC 4S2PA 4GHIB 5HWWA 3AGFA 4L9FA 2FFYA 1XGJA 3Q82A 1LSWA 1ONHA 2Y59A 5IS1A 1JNUA 4QY5A 3ZNTA 3DWZA 2FH5A 5HAIA 3GDIA 2PRFA 4JXWA 3L9KA 3D4FA 1FILA 2OOLA
chains in the Genus database with same CATH topology
2WAFA 1IEMA 3WWXA 3O88A 4NK3A 1YLTA 2J9PA 4PMAA 4GOGA 3EQUA 5BOHA 1YLWA 3LO7A 2WK0A 4WMCA 2WKHA 1DY6A 3V3RA 3ZGAB 2BLSA 1BSGA 1QMFA 5TGFA 5FATA 1NYYA 2WAEA 4S2LA 5DF7A 2OLUA 5KZHA 1MWRA 5F82A 3GR2A 3HLDA 4Y7PA 1RP5A 4WEKA 5EOEA 2Y2QA 1IYOA 3G2YA 3SS4A 2HDRA 2J9OA 3VP0A 4DDYA 4LV2A 4B4ZA 4XUZA 5DTKA 4LCLA 3LCEA 5CTNA 2EFUA 5TR7A 4KZ8A 2V2FF 4GD8A 1IYSA 1Y54A 2J8YA 4LV1A 3IF6C 3ZG9B 4N1XA 1VM1A 3W8KA 3UDFA 4OQGA 2Y2LA 5M19A 2P9VB 3W4PA 1YLPA 4JF6A 2ZLYA 3IXBA 5GLDA 2V1ZA 4EBNA 4PM5A 1K57C 1DJBA 1N9BA 2HDQA 3V5MA 2PU4A 3PBSA 4GKUA 5DF9A 3ZHHA 1ES4A 1FR6A 2Y2IA 3N8SA 5J8XA 3G32A 4IEDA 2DRWA 4WELA 1G6AA 1I2SA 2Y4AA 5L2FA 4IBXA 4X69A 3IWOA 3NC8A 1GA0A 1MXOA 3LY3A 3UE3A 1GA9A 3UE1A 4HEFA 1XGIA 3LEZA 3SH9A 1PI4A 4L0LA 4RYEA 1KGFA 1TEMA 3CJMA 1HVBA 3N4IA 3VP3A 4Q8IA 1GHIA 2P9VA 2OV5A 4QB8A 1JTGA 2ZQAA 1ZG6A 4DXCA 4KZ7A 4RA7A 4BL2A 5KSCA 2XGNA 1K4FA 1IYPA 2P74A 3FZCA 4JLFA 5F1FA 3SH7A 2X71A 2Y2KA 3E2KA 3G34A 4FD8A 4K0XA 4OH0A 3MZFA 1JWPA 4JKTA 5FI7A 4CJNA 5A93A 1ES2A 1XX2A 3VMAA 3AGEA 1FOFA 3BFDA 4H8RA 5EUAA 4PM7A 1FSWA 5FQJA 4FSFA 2QMIA 4UA7A 5FQIA 1IELA 1YLZA 3HLCA 3HLEA 4GNUA 5IHVA 4XXRA 3ZVTA 4D2OA 3MZEA 3FKVA 3HVFA 1SDNA 4OOMA 2ZD8A 4R3JA 3CG5A 5E43A 1K55A 5F1GA 2OSUA 2JCHA 3ZG0A 1MY8A 4DKIA 5I94A 1KE0A 2Q9NA 1FCOA 1RGZA 4KG2A 4JF5A 4KZ4A 3WS2A 3OCNA 5DTSA 2UWXA 3WS4A 1CEFA 2Z2MB 3UNWA 5A90A 5E2HA 2J7VA 1BUEA 1PW1A 4E3NA 4M3KA 2A49A 3OPLA 3A3DA 3G31A 3P09A 1YLYA 5CERA 4P87A 4JBFA 4OPZA 3IXGA 2X02A 2ZM0A 3OZHA 3V3SA 4E6XA 1PIOA 4OVDA 3E2LA 1SKFA 3GVBA 3W4OA 2V20A 4U0XA 4WM9A 1ALQA 2Y91A 4RX2A 3M2JA 1LHYA 2HDSA 2JC7A 5FI6A 4C6YA 1ESIA 3VP1A 4E3IA 1YMSA 2HP6A 4P6BA 3GSGA 2WUQA 4X68A 1PWGA 1RGYA 5KSHA 4HBUA 3PTEA 1NRFA 4KQQA 5M18A 4LV3A 3IWQA 2WGIA 5AQ7A 3PBOA 4OQ0A 1KDWA 5E2EA 3N6IA 3ZFZA 2Y55A 1LI0A 3NY4A 1K38A 1YQSA 1ES5A 2WGVA 5EVLA 2ZMAA 4OQIA 1PI5A 4N1HA 1LLBA 3JYIA 4E3KA 4EV4A 1S6RA 4UHUA 2A3UA 5GLAA 3MKFA 4R4RA 1W7FA 2ZC5B 3IHBA 5CGXA 3IF6A 2RL3A 4P0MA 1XXMA 3MXRA 3WRTA 1SHVA 3SOIA 1K57A 3B3XA 2E8IA 3C5AA 3NIAA 5E2FA 4KZ5A 1FCNA 3BFFA 4ID4A 4RVAA 3GV9A 3W4QA 1CK3A 4GN2A 1HZOA 5HL1A 5EVID 5CRFA 5FASA 1YLJA 4ZBEA 1XPBA 1N4OA 1QMEA 4GDNA 3UY6A 3FWLA 2ZQCA 1BT5A 2PU2A 1NJ4A 3DTMA 1BULA 1BLSA 1TDGA 2RCXA 1AXBA 3HREA 4KENB 1K56D 4DRTA 5GLCA 4F94A 2JBFA 4ZJ2A 4Z9QA 3IQAA 1SDEA 1S0WA 4BENA 5FAPA 3C7VA 1PWCA 1HTZA 3G4PA 4NETA 5EPHA 5EVIC 5FDHA 4BJPA 1NYMA 4ZAMA 3O3VA 3N7WA 1KGGA 1K54C 4KG5A 4OP5A 5GHZA 3WRZA 2VGJA 4HBTA 1MKIA 1OMEA 1PWDA 1TVFA 3DWKA 1ERMA 1JWZA 2CC1A 3GRJA 3IXDA 4WBGA 2G2UA 4UA9A 2XR0A 4S2KA 4X56A 4DE0A 4MBFA 1BZAA 4K0WA 1XA7A 4OKPA 1BLCA 2EFXA 3G2ZA 4PPRA 3DW0A 3VFFA 3TG9A 4JXGA 4EWFA 2Y2NA 1YT4A 2Y2HA 4DE1A 5GHXA 3N8RA 3HUNA 3PAEA 3MFDA 3SH8A 2ZQ8A 3N8LA 5M1AA 4QD4A 1HD8A 3QNBA 4X53A 2XFSA 4BD1A 4EBPA 3FKWA 1ERQA 3Q1FA 4N9KA 4Y0UA 4KQRA 1PYYA 4KQOA 4MEZA 4QHCA 3PBRA 4N92A 1CEGA 4LCMA 5FQKA 2IWDA 1ES3A 1Z6FA 3VP4A 1ESUA 2R9WA 4QU3A 3HL9A 5FAOA 3CZDA 5DF8A 1IKGA 3M2KA 2HP9A 1LI9A 3UDXA 4E6WA 3HBRA 1MWTA 1O7EA 1YMXA 2JE5A 5FI2A 1MPLA 1WE4A 4RX3A 3VFHA 4UAAA 2H5SA 3VOYA 1E4DA 4JXSA 4OPYA 2I72A 4FCFA 3EQVA 1M6KA 3RXWA 3Q7VB 4JPMA 4IVIA 1Q2PA 5HX9A 2EXBA 4S2IA 3QHYA 4B4XA 3IXHA 1ZC2A 4ZTKA 1C3BA 3BECA 3V50A 4DE2A 3ZNYA 3FV7A 4OONA 4S2OA 5U47A 4P85A 3UO9A 1L0GA 3MXSA 1WYCA 3BLSA 4OLGA 4WZ5C 5D3OA 3BFEA 2ZJ9A 5HW3A 2FFFB 3FYZA 4K91A 5CEBA 4S2MA 2Q9MA 1I5QA 1K6SA 3GMWA 3MBZA 3TOIA 2H10A 2HP5A 3IF6B 1K55C 3BFGA 3O86A 2Z2LB 5HARA 5HAQA 4DE3A 3BEBA 3Q7VA 1KDSA 4MLLA 1L0DA 4OPQA 4S2NC 5CGSA 5EOOA 4OOYA 5JYOA 1NZOA 1ZKJA 1VQQA 1XA1A 3SS5A 1E3UD 4R4SA 1CI9A 1FSYA 3S4XA 3IT9A 2IWBA 1IKIA 2ZC6B 3NI9A 1NY0A 4KG6A 1BLPA 4E3OA 3OPPA 5HFOA 3UN7A 4FH2A 5CTMA 5FQQA 4DDSA 1KE3A 3OC2A 3PBNA 3MKEA 4CPKA 1EWZA 4QY6A 3HLGA 5E2GA 1G68A 3G30A 1W8QA 5FSRA 3IH9A 1J9MA 3Q07A 2EXAA 2WZZA 2X01A 1L2SA 1ZG4A 3G35A 5DVAA 4MNRA 5CECA 1SCWA 2EX9A 4WMCD 4JF4A 3HLWA 1GHPA 3HUMA 2OLVA 3ZVWA 1MWUA 4DXBA 3C7UA 3ZDJA 1TDLA 3WS0A 3UPOA 1H8YA 3VP2A 3UDIA 2QPNA 3O87A 5EVIA 2DCFA 2IWCA 4GB7A 2Y2MA 3PBQA 1W5DA 1NZUA 1U60A 1NXYA 4LV0A 4O7DA 5EE8A 5EECA 5A91A 4ZJ3A 3ZG8B 1K54A 4DF6A 1KVLA 3A3EA 1BTLA 3BRMA 1O07A 1PZPA 2WZXA 4WEJA 3HLBA 1W8YA 3UPPA 1BLHA 1PZOA 3IHAA 2XDMA 3Q7ZA 4KZ9A 1WYBA 2Y2PA 3OPRA 1K56A 3WS5A 4EUZA 4IVKA 4PM6A 1MBLA 4YINA 4OOLA 2ZC3B 3GQZA 3Q81A 1PW8A 2XFTA 4EBLA 3UE0A 3PBTA 3PAGA 4Y0OA 4OPRA 3VOZA 2VGKA 4KZBA 3NDEA 1KGEA 4R23A 1IYQA 1EI5A 4EQIA 4MBKA 3I7JA 5FA7A 3LY4A 3M6BA 5CHJA 2C5WB 2BG1A 2R9XA 4GD6A 4WZ4A 4BL3A 3C4OA 2XLNA 3A3IA 5CHMA 1JVJA 5TFQA 3BYDA 2ZQDA 1FR1A 5AQBA 5AQAA 4GDBA 2H0YA 3NDGA 1K6RA 2XH9A 5CGWA 1YM1A 5CEDA 1LL9A 2G2WA 3VSLA 3BFCA 3HUOA 3IH8A 2DNSA 3QNCA 4OP8A 1K4EA 5DTTA 5JYPA 2XK1A 4KZ3A 4OLDA 4R3BA 4U0TA 3ISGA 3VSKA 3RJUA 3A3JA 3OPHA 3C4PA 4FH4A 2ZM2A 4LENA 4ZJ1A 1MWSA 1H5XA 5G18A 2WADA 2H0TA 4XUXA 3S22A 3NCKA 1XP4A 3ZCZA 3BM6A 3M6HA 1GHMA 4E3JA 1L0FA 4KZAA 5KMWA 4OQHA 2EX8A 3IWIA 3HLFA 1K25A 5FAQA 1EROA 4X6TA 5CHUA 2HDUA 5CXWA 5FQMA 1W79A 3SS3A 4BD0A 4Y0TA 1I2WA 1GCEA 1FQGA 2HPBA 3OCLA 3P98A 4R0QA 1H8ZA 4WZ5A 5F83A 3ZG7B 2WGWB 4N9LA 2ZC4B 5GHYA 4PM8A 3IF5A 1XKZA 4JXVA 2EX2A 4MBHA 2C6WB 1M40A 2XF3A 3BLMA 4QJGA 4WYYA 2WKEA 2B5RA 4B88A 1E25A 1DJCA 4S2NA 2WYXA 4HESA 5FQ9A 4GZBA 4C3QA 1CI8A 2Y2GA 4BQMA 3WS1A 4PM9A 3AGDA 3ZG5A 1FCMA 1LL5A 1L0EA 5GL9A 2ZQ9A 2ZQ7A 2QZ6A 4KZ6A 3ITBA 2XD1A 1Q2QA 1ONGA 4S2PA 4E3MA 2WGWA 4S2JA 3RXXA 4YFMA 3UPNA 3AGFA 2PBYA 2WKIA 2FFYA 3S1YA 3ITAA 1XGJA 5HAPA 4R1GA 4BLMA 1RCJA 3A3FA 5GLBA 2XEPA 3Q82A 1E3UA 4U3TA 4X55A 3TSGA 4IBRA 4C75A 1ONHA 2Y59A 2GDNA 4QY5A 3CMZA 3ZNTA 4E3LA 5EVIB 3DWZA 5HAIA 1JWVA 2EX6A 4A5RA 4ZDXA 3GTCA 2XD5A 2ZC7A 1DJAA 2ZM8A 2Y2OA 3V39A 4JXWA 5A92A 3D4FA 1KE4A 3NBLA 4UA6A 1KVMA 5AQ9A 1JTDA 2XQZA 2Y2JA 3MZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAF A;  1IEM A;  3WWX A;  3O88 A;  4NK3 A;  1YLT A;  2J9P A;  4PMA A;  4GOG A;  3EQU A;  5BOH A;  1YLW A;  3LO7 A;  2WK0 A;  4WMC A;  2WKH A;  1DY6 A;  3V3R A;  3ZGA B;  2BLS A;  1BSG A;  1QMF A;  5TGF A;  5FAT A;  1NYY A;  2WAE A;  4S2L A;  5DF7 A;  2OLU A;  5KZH A;  1MWR A;  5F82 A;  3GR2 A;  3HLD A;  4Y7P A;  1RP5 A;  4WEK A;  5EOE A;  2Y2Q A;  1IYO A;  3G2Y A;  3SS4 A;  2HDR A;  2J9O A;  3VP0 A;  4DDY A;  4LV2 A;  4B4Z A;  4XUZ A;  5DTK A;  4LCL A;  3LCE A;  5CTN A;  2EFU A;  5TR7 A;  4KZ8 A;  2V2F F;  4GD8 A;  1IYS A;  1Y54 A;  2J8Y A;  4LV1 A;  3IF6 C;  3ZG9 B;  4N1X A;  1VM1 A;  3W8K A;  3UDF A;  4OQG A;  2Y2L A;  5M19 A;  2P9V B;  3W4P A;  1YLP A;  4JF6 A;  2ZLY A;  3IXB A;  5GLD A;  2V1Z A;  4EBN A;  4PM5 A;  1K57 C;  1DJB A;  1N9B A;  2HDQ A;  3V5M A;  2PU4 A;  3PBS A;  4GKU A;  5DF9 A;  3ZHH A;  1ES4 A;  1FR6 A;  2Y2I A;  3N8S A;  5J8X A;  3G32 A;  4IED A;  2DRW A;  4WEL A;  1G6A A;  1I2S A;  2Y4A A;  5L2F A;  4IBX A;  4X69 A;  3IWO A;  3NC8 A;  1GA0 A;  1MXO A;  3LY3 A;  3UE3 A;  1GA9 A;  3UE1 A;  4HEF A;  1XGI A;  3LEZ A;  3SH9 A;  1PI4 A;  4L0L A;  4RYE A;  1KGF A;  1TEM A;  3CJM A;  1HVB A;  3N4I A;  3VP3 A;  4Q8I A;  1GHI A;  2P9V A;  2OV5 A;  4QB8 A;  1JTG A;  2ZQA A;  1ZG6 A;  4DXC A;  4KZ7 A;  4RA7 A;  4BL2 A;  5KSC A;  2XGN A;  1K4F A;  1IYP A;  2P74 A;  3FZC A;  4JLF A;  5F1F A;  3SH7 A;  2X71 A;  2Y2K A;  3E2K A;  3G34 A;  4FD8 A;  4K0X A;  4OH0 A;  3MZF A;  1JWP A;  4JKT A;  5FI7 A;  4CJN A;  5A93 A;  1ES2 A;  1XX2 A;  3VMA A;  3AGE A;  1FOF A;  3BFD A;  4H8R A;  5EUA A;  4PM7 A;  1FSW A;  5FQJ A;  4FSF A;  2QMI A;  4UA7 A;  5FQI A;  1IEL A;  1YLZ A;  3HLC A;  3HLE A;  4GNU A;  5IHV A;  4XXR A;  3ZVT A;  4D2O A;  3MZE A;  3FKV A;  3HVF A;  1SDN A;  4OOM A;  2ZD8 A;  4R3J A;  3CG5 A;  5E43 A;  1K55 A;  5F1G A;  2OSU A;  2JCH A;  3ZG0 A;  1MY8 A;  4DKI A;  5I94 A;  1KE0 A;  2Q9N A;  1FCO A;  1RGZ A;  4KG2 A;  4JF5 A;  4KZ4 A;  3WS2 A;  3OCN A;  5DTS A;  2UWX A;  3WS4 A;  1CEF A;  2Z2M B;  3UNW A;  5A90 A;  5E2H A;  2J7V A;  1BUE A;  1PW1 A;  4E3N A;  4M3K A;  2A49 A;  3OPL A;  3A3D A;  3G31 A;  3P09 A;  1YLY A;  5CER A;  4P87 A;  4JBF A;  4OPZ A;  3IXG A;  2X02 A;  2ZM0 A;  3OZH A;  3V3S A;  4E6X A;  1PIO A;  4OVD A;  3E2L A;  1SKF A;  3GVB A;  3W4O A;  2V20 A;  4U0X A;  4WM9 A;  1ALQ A;  2Y91 A;  4RX2 A;  3M2J A;  1LHY A;  2HDS A;  2JC7 A;  5FI6 A;  4C6Y A;  1ESI A;  3VP1 A;  4E3I A;  1YMS A;  2HP6 A;  4P6B A;  3GSG A;  2WUQ A;  4X68 A;  1PWG A;  1RGY A;  5KSH A;  4HBU A;  3PTE A;  1NRF A;  4KQQ A;  5M18 A;  4LV3 A;  3IWQ A;  2WGI A;  5AQ7 A;  3PBO A;  4OQ0 A;  1KDW A;  5E2E A;  3N6I A;  3ZFZ A;  2Y55 A;  1LI0 A;  3NY4 A;  1K38 A;  1YQS A;  1ES5 A;  2WGV A;  5EVL A;  2ZMA A;  4OQI A;  1PI5 A;  4N1H A;  1LLB A;  3JYI A;  4E3K A;  4EV4 A;  1S6R A;  4UHU A;  2A3U A;  5GLA A;  3MKF A;  4R4R A;  1W7F A;  2ZC5 B;  3IHB A;  5CGX A;  3IF6 A;  2RL3 A;  4P0M A;  1XXM A;  3MXR A;  3WRT A;  1SHV A;  3SOI A;  1K57 A;  3B3X A;  2E8I A;  3C5A A;  3NIA A;  5E2F A;  4KZ5 A;  1FCN A;  3BFF A;  4ID4 A;  4RVA A;  3GV9 A;  3W4Q A;  1CK3 A;  4GN2 A;  1HZO A;  5HL1 A;  5EVI D;  5CRF A;  5FAS A;  1YLJ A;  4ZBE A;  1XPB A;  1N4O A;  1QME A;  4GDN A;  3UY6 A;  3FWL A;  2ZQC A;  1BT5 A;  2PU2 A;  1NJ4 A;  3DTM A;  1BUL A;  1BLS A;  1TDG A;  2RCX A;  1AXB A;  3HRE A;  4KEN B;  1K56 D;  4DRT A;  5GLC A;  4F94 A;  2JBF A;  4ZJ2 A;  4Z9Q A;  3IQA A;  1SDE A;  1S0W A;  4BEN A;  5FAP A;  3C7V A;  1PWC A;  1HTZ A;  3G4P A;  4NET A;  5EPH A;  5EVI C;  5FDH A;  4BJP A;  1NYM A;  4ZAM A;  3O3V A;  3N7W A;  1KGG A;  1K54 C;  4KG5 A;  4OP5 A;  5GHZ A;  3WRZ A;  2VGJ A;  4HBT A;  1MKI A;  1OME A;  1PWD A;  1TVF A;  3DWK A;  1ERM A;  1JWZ A;  2CC1 A;  3GRJ A;  3IXD A;  4WBG A;  2G2U A;  4UA9 A;  2XR0 A;  4S2K A;  4X56 A;  4DE0 A;  4MBF A;  1BZA A;  4K0W A;  1XA7 A;  4OKP A;  1BLC A;  2EFX A;  3G2Z A;  4PPR A;  3DW0 A;  3VFF A;  3TG9 A;  4JXG A;  4EWF A;  2Y2N A;  1YT4 A;  2Y2H A;  4DE1 A;  5GHX A;  3N8R A;  3HUN A;  3PAE A;  3MFD A;  3SH8 A;  2ZQ8 A;  3N8L A;  5M1A A;  4QD4 A;  1HD8 A;  3QNB A;  4X53 A;  2XFS A;  4BD1 A;  4EBP A;  3FKW A;  1ERQ A;  3Q1F A;  4N9K A;  4Y0U A;  4KQR A;  1PYY A;  4KQO A;  4MEZ A;  4QHC A;  3PBR A;  4N92 A;  1CEG A;  4LCM A;  5FQK A;  2IWD A;  1ES3 A;  1Z6F A;  3VP4 A;  1ESU A;  2R9W A;  4QU3 A;  3HL9 A;  5FAO A;  3CZD A;  5DF8 A;  1IKG A;  3M2K A;  2HP9 A;  1LI9 A;  3UDX A;  4E6W A;  3HBR A;  1MWT A;  1O7E A;  1YMX A;  2JE5 A;  5FI2 A;  1MPL A;  1WE4 A;  4RX3 A;  3VFH A;  4UAA A;  2H5S A;  3VOY A;  1E4D A;  4JXS A;  4OPY A;  2I72 A;  4FCF A;  3EQV A;  1M6K A;  3RXW A;  3Q7V B;  4JPM A;  4IVI A;  1Q2P A;  5HX9 A;  2EXB A;  4S2I A;  3QHY A;  4B4X A;  3IXH A;  1ZC2 A;  4ZTK A;  1C3B A;  3BEC A;  3V50 A;  4DE2 A;  3ZNY A;  3FV7 A;  4OON A;  4S2O A;  5U47 A;  4P85 A;  3UO9 A;  1L0G A;  3MXS A;  1WYC A;  3BLS A;  4OLG A;  4WZ5 C;  5D3O A;  3BFE A;  2ZJ9 A;  5HW3 A;  2FFF B;  3FYZ A;  4K91 A;  5CEB A;  4S2M A;  2Q9M A;  1I5Q A;  1K6S A;  3GMW A;  3MBZ A;  3TOI A;  2H10 A;  2HP5 A;  3IF6 B;  1K55 C;  3BFG A;  3O86 A;  2Z2L B;  5HAR A;  5HAQ A;  4DE3 A;  3BEB A;  3Q7V A;  1KDS A;  4MLL A;  1L0D A;  4OPQ A;  4S2N C;  5CGS A;  5EOO A;  4OOY A;  5JYO A;  1NZO A;  1ZKJ A;  1VQQ A;  1XA1 A;  3SS5 A;  1E3U D;  4R4S A;  1CI9 A;  1FSY A;  3S4X A;  3IT9 A;  2IWB A;  1IKI A;  2ZC6 B;  3NI9 A;  1NY0 A;  4KG6 A;  1BLP A;  4E3O A;  3OPP A;  5HFO A;  3UN7 A;  4FH2 A;  5CTM A;  5FQQ A;  4DDS A;  1KE3 A;  3OC2 A;  3PBN A;  3MKE A;  4CPK A;  1EWZ A;  4QY6 A;  3HLG A;  5E2G A;  1G68 A;  3G30 A;  1W8Q A;  5FSR A;  3IH9 A;  1J9M A;  3Q07 A;  2EXA A;  2WZZ A;  2X01 A;  1L2S A;  1ZG4 A;  3G35 A;  5DVA A;  4MNR A;  5CEC A;  1SCW A;  2EX9 A;  4WMC D;  4JF4 A;  3HLW A;  1GHP A;  3HUM A;  2OLV A;  3ZVW A;  1MWU A;  4DXB A;  3C7U A;  3ZDJ A;  1TDL A;  3WS0 A;  3UPO A;  1H8Y A;  3VP2 A;  3UDI A;  2QPN A;  3O87 A;  5EVI A;  2DCF A;  2IWC A;  4GB7 A;  2Y2M A;  3PBQ A;  1W5D A;  1NZU A;  1U60 A;  1NXY A;  4LV0 A;  4O7D A;  5EE8 A;  5EEC A;  5A91 A;  4ZJ3 A;  3ZG8 B;  1K54 A;  4DF6 A;  1KVL A;  3A3E A;  1BTL A;  3BRM A;  1O07 A;  1PZP A;  2WZX A;  4WEJ A;  3HLB A;  1W8Y A;  3UPP A;  1BLH A;  1PZO A;  3IHA A;  2XDM A;  3Q7Z A;  4KZ9 A;  1WYB A;  2Y2P A;  3OPR A;  1K56 A;  3WS5 A;  4EUZ A;  4IVK A;  4PM6 A;  1MBL A;  4YIN A;  4OOL A;  2ZC3 B;  3GQZ A;  3Q81 A;  1PW8 A;  2XFT A;  4EBL A;  3UE0 A;  3PBT A;  3PAG A;  4Y0O A;  4OPR A;  3VOZ A;  2VGK A;  4KZB A;  3NDE A;  1KGE A;  4R23 A;  1IYQ A;  1EI5 A;  4EQI A;  4MBK A;  3I7J A;  5FA7 A;  3LY4 A;  3M6B A;  5CHJ A;  2C5W B;  2BG1 A;  2R9X A;  4GD6 A;  4WZ4 A;  4BL3 A;  3C4O A;  2XLN A;  3A3I A;  5CHM A;  1JVJ A;  5TFQ A;  3BYD A;  2ZQD A;  1FR1 A;  5AQB A;  5AQA A;  4GDB A;  2H0Y A;  3NDG A;  1K6R A;  2XH9 A;  5CGW A;  1YM1 A;  5CED A;  1LL9 A;  2G2W A;  3VSL A;  3BFC A;  3HUO A;  3IH8 A;  2DNS A;  3QNC A;  4OP8 A;  1K4E A;  5DTT A;  5JYP A;  2XK1 A;  4KZ3 A;  4OLD A;  4R3B A;  4U0T A;  3ISG A;  3VSK A;  3RJU A;  3A3J A;  3OPH A;  3C4P A;  4FH4 A;  2ZM2 A;  4LEN A;  4ZJ1 A;  1MWS A;  1H5X A;  5G18 A;  2WAD A;  2H0T A;  4XUX A;  3S22 A;  3NCK A;  1XP4 A;  3ZCZ A;  3BM6 A;  3M6H A;  1GHM A;  4E3J A;  1L0F A;  4KZA A;  5KMW A;  4OQH A;  2EX8 A;  3IWI A;  3HLF A;  1K25 A;  5FAQ A;  1ERO A;  4X6T A;  5CHU A;  2HDU A;  5CXW A;  5FQM A;  1W79 A;  3SS3 A;  4BD0 A;  4Y0T A;  1I2W A;  1GCE A;  1FQG A;  2HPB A;  3OCL A;  3P98 A;  4R0Q A;  1H8Z A;  4WZ5 A;  5F83 A;  3ZG7 B;  2WGW B;  4N9L A;  2ZC4 B;  5GHY A;  4PM8 A;  3IF5 A;  1XKZ A;  4JXV A;  2EX2 A;  4MBH A;  2C6W B;  1M40 A;  2XF3 A;  3BLM A;  4QJG A;  4WYY A;  2WKE A;  2B5R A;  4B88 A;  1E25 A;  1DJC A;  4S2N A;  2WYX A;  4HES A;  5FQ9 A;  4GZB A;  4C3Q A;  1CI8 A;  2Y2G A;  4BQM A;  3WS1 A;  4PM9 A;  3AGD A;  3ZG5 A;  1FCM A;  1LL5 A;  1L0E A;  5GL9 A;  2ZQ9 A;  2ZQ7 A;  2QZ6 A;  4KZ6 A;  3ITB A;  2XD1 A;  1Q2Q A;  1ONG A;  4S2P A;  4E3M A;  2WGW A;  4S2J A;  3RXX A;  4YFM A;  3UPN A;  3AGF A;  2PBY A;  2WKI A;  2FFY A;  3S1Y A;  3ITA A;  1XGJ A;  5HAP A;  4R1G A;  4BLM A;  1RCJ A;  3A3F A;  5GLB A;  2XEP A;  3Q82 A;  1E3U A;  4U3T A;  4X55 A;  3TSG A;  4IBR A;  4C75 A;  1ONH A;  2Y59 A;  2GDN A;  4QY5 A;  3CMZ A;  3ZNT A;  4E3L A;  5EVI B;  3DWZ A;  5HAI A;  1JWV A;  2EX6 A;  4A5R A;  4ZDX A;  3GTC A;  2XD5 A;  2ZC7 A;  1DJA A;  2ZM8 A;  2Y2O A;  3V39 A;  4JXW A;  5A92 A;  3D4F A;  1KE4 A;  3NBL A;  4UA6 A;  1KVM A;  5AQ9 A;  1JTD A;  2XQZ A;  2Y2J A;  3MZD A; 
#chains in the Genus database with same CATH topology
 3WWX A;  4NK3 A;  1YLW A;  3V3R A;  2BLS A;  1P9R A;  3UME A;  5FAT A;  1NYY A;  3KSH A;  4Y7P A;  4WEK A;  3VP0 A;  4DDY A;  1IYO A;  5F5Y A;  2G7U A;  4LCL A;  1K0K A;  2EFU A;  4KZ8 A;  2K2N A;  4GD8 A;  3SZT A;  3IF6 C;  3ZG9 B;  1VM1 A;  3W8K A;  4OQG A;  1YLP A;  2V1Z A;  1MC0 A;  5DKK A;  1DJB A;  3TW8 A;  1YSQ A;  2PU4 A;  1FR6 A;  2DRW A;  4WEL A;  1I2S A;  3W2Z A;  3UE1 A;  4HEF A;  1XGI A;  2PD8 A;  1PI4 A;  1HVB A;  3EOI A;  1GHI A;  4KZ7 A;  4RA7 A;  4BL2 A;  2XGN A;  3F1O B;  5FDS A;  3E2K A;  4OH0 A;  4ETZ A;  4QWO A;  1JWP A;  4CJN A;  4BWI A;  5FL3 A;  2A24 B;  5HPI A;  5EUA A;  1FSW A;  5FQJ A;  1SKO B;  2QMI A;  1NRJ A;  1VET B;  3LIC A;  4Y2F A;  3HLE A;  4ME4 A;  4D2O A;  3ZVT A;  3MZE A;  3CWF A;  4OOM A;  1OTA A;  3NEC A;  2OSU A;  2JCH A;  5I94 A;  1KE0 A;  2Q9N A;  4QPR A;  1FCO A;  2J80 A;  3QP6 A;  1T1C A;  3WS4 A;  1CEF A;  3FC7 A;  2J7V A;  1BUE A;  4EU0 A;  3SW1 A;  2A49 A;  2GZA A;  5CER A;  4JBF A;  3V3S A;  1PIO A;  2L0W A;  1SKF A;  5L8M A;  2QWS A;  3B47 A;  2HDS A;  5FI6 A;  3MQ0 A;  1RGY A;  2VA0 A;  4KQQ A;  1W63 M;  2WGI A;  1OJ5 A;  3PBO A;  4G3V A;  4OQ0 A;  5E2E A;  2QYB A;  3NY4 A;  4LRZ E;  5DJT A;  3NOU C;  1Y28 A;  3T4S A;  4N1H A;  1LLB A;  1XJ3 A;  1SZV A;  4EV4 A;  1S6R A;  1IOU A;  1W7F A;  1WA9 A;  5CGX A;  3IF6 A;  2RL3 A;  4P0M A;  4HJ6 A;  3D3O A;  3E4P A;  3SOI A;  3C5A A;  2V1B A;  4GN2 A;  5EVI D;  1BLS A;  2B18 A;  5EM1 A;  3CHW P;  1K56 D;  4BJP A;  1PWC A;  1HTZ A;  5EVI C;  3BY8 A;  1K54 C;  4KG5 A;  4OP5 A;  3WRZ A;  4HBT A;  3LR3 A;  5FEF A;  1JWZ A;  2CC1 A;  4X56 A;  4DN0 A;  4XT2 A;  4HQA A;  4OKP A;  4LGW A;  4PPR A;  3MF0 A;  3DW0 A;  3TG9 A;  4JXG A;  4EWF A;  2Y2N A;  1YT4 A;  2Y2H A;  3N8L A;  3MMH A;  3QNB A;  4BD1 A;  3LFV A;  3ULF A;  3PBR A;  1Z6F A;  2ZBB A;  3MSH A;  4LFU A;  5FAO A;  2K7S A;  5DF8 A;  1ACF A;  1O7E A;  1VB6 A;  5IU1 A;  4OPY A;  2I72 A;  4FCF A;  3EQV A;  4S2I A;  3LR4 A;  4B4X A;  4II7 A;  2JKT I;  3VV4 A;  4OON A;  4S2O A;  4P85 A;  3MXS A;  4WZ5 C;  1YPR A;  3BFE A;  5HW3 A;  2FFF B;  5CEB A;  4S2M A;  4B93 A;  1K6S A;  3TOI A;  3IF6 B;  4DE3 A;  3Q7V A;  1KDS A;  3UB9 A;  2W3E A;  3ZQ5 A;  4OOY A;  3T4Q A;  1XA1 A;  1E3U D;  4R4S A;  4F3L A;  2MJ6 A;  3LR5 A;  2Q0O A;  4KG6 A;  3OLO A;  1TD5 A;  3OPP A;  4O0P A;  5FQQ A;  4DDS A;  4EQ1 A;  1EWZ A;  1H0M A;  1W8Q A;  3Q07 A;  2EXA A;  4ETX A;  1L2S A;  1XFN A;  4WMC D;  3C7U A;  1TDL A;  3VP2 A;  5EVI A;  2DCF A;  1AWI A;  4L9E A;  4GB7 A;  4O7D A;  5EE8 A;  4DF6 A;  3ZG8 B;  1K54 A;  5EFW A;  4XT2 B;  2L4R A;  1BTL A;  3QP2 A;  1BLH A;  4KZ9 A;  1F9I A;  1WYB A;  3OPR A;  3F1N A;  1K56 A;  3H7W A;  4EUZ A;  4YIN A;  3NOT C;  3PBT A;  3T4T A;  1D7E A;  2VGK A;  3P7N A;  4MBK A;  3LI9 A;  5FA7 A;  1XJ2 A;  5CHJ A;  3A0V A;  4WZ4 A;  4MN7 A;  3C4O A;  3A3I A;  5F6A A;  2ZQD A;  3BY9 A;  4EW7 A;  5AQA A;  1K6R A;  3BFC A;  2HZ5 A;  1S1Y A;  4X1M A;  5DTT A;  1MZU A;  2Y8H A;  3QNC A;  1F2K A;  1GSV A;  4KZ3 A;  4Q0J A;  2OWJ A;  3C8C A;  2JKR I;  2ZM2 A;  1MWS A;  1H5X A;  2WAD A;  2A2L A;  4E3J A;  5I5L A;  2EX8 A;  5FAQ A;  1W79 A;  1I2W A;  1FQG A;  4WZ5 A;  4R0Q A;  1H8Z A;  2ZC4 B;  5L09 A;  3DTI A;  2J3W A;  3R7W B;  3DAV A;  2C6W B;  3IS2 B;  1M40 A;  2O9C A;  3E4Q A;  2ACG A;  3S7P A;  5IT5 A;  4B88 A;  3T1R A;  4R6L A;  2PR5 A;  3AGD A;  3ZG5 A;  1L0E A;  2ZQ7 A;  2M7U A;  2QZ6 A;  2YKF A;  3ICY A;  4S2J A;  3RXX A;  4Y5F A;  3LIB A;  2NUT C;  4R1G A;  4JGO A;  2XEP A;  4HP9 A;  1E3U A;  4C75 A;  5EVI B;  2O0Y A;  2EX6 A;  1V9Z A;  3V39 A;  4NEE D;  3VOL A;  5A92 A;  1JTD A;  2XQZ A;  3MZD A;  3H7W B;  4PHT A;  1IEM A;  4PMA A;  2JKR M;  4WMC A;  2WKH A;  3FG8 A;  5DJU A;  4S2L A;  5DF7 A;  5KZH A;  1MWR A;  1LT0 A;  3HLD A;  1RP5 A;  4B4Z A;  4XUZ A;  3KYE A;  3LCE A;  4H6J A;  4LV1 A;  4N1X A;  3OOV A;  2Y2L A;  2P9V B;  4JF6 A;  5GLD A;  1YKD A;  3ZYT A;  4PM5 A;  3FPV A;  3V5M A;  4GKU A;  5DF9 A;  1T1A A;  3N8S A;  4IED A;  3H82 A;  1G6A A;  2Y4A A;  4L9G A;  4X69 A;  5J7E A;  2HF6 A;  3PYP A;  2EWW A;  4I5S A;  2D02 A;  3NUL A;  3SH9 A;  4L0L A;  1TEM A;  2OV5 A;  4QB8 A;  1ZG6 A;  3S7N A;  2Z6D A;  2P74 A;  4JLF A;  5F1F A;  2V0W A;  3SH7 A;  4KUK A;  2X71 A;  2Y2K A;  3G34 A;  5FI7 A;  5DKL A;  2VX8 A;  3QP5 A;  3BFD A;  4H8R A;  2R78 A;  2V9A A;  4PM7 A;  5FQI A;  1IEL A;  2QJ7 A;  5IHV A;  2Z6C A;  3HVF A;  2INW A;  1K55 A;  5F1G A;  3UB6 A;  4DKI A;  4AFI A;  2L1M A;  3TRC A;  3B33 A;  4KZ4 A;  3OCN A;  5DTS A;  2UWX A;  2YKH A;  2O99 A;  1PW1 A;  1VET A;  3A3D A;  3G31 A;  4OPZ A;  2ZM0 A;  3OZH A;  3UMD A;  4E6X A;  2V8F A;  3W4O A;  4LLO B;  1CJF A;  1LHY A;  4C6Y A;  4MDZ A;  1ESI A;  4E3I A;  1YMS A;  2WUQ A;  1T19 A;  1NWZ A;  4HBU A;  3PTE A;  4X1L A;  1NRF A;  3QP4 A;  2W3G A;  4YNR A;  1W63 Q;  1CF0 A;  3ZFZ A;  4H6J B;  1LI0 A;  2PBD P;  4HJ3 A;  4HJ4 A;  2WGV A;  1ES5 A;  2LB9 A;  5EVL A;  1PI5 A;  3G6O A;  4YOF A;  3JYI A;  4UHU A;  3T1Q B;  3H82 B;  1XXM A;  3MXR A;  1SHV A;  4NXB A;  3B3X A;  2E8I A;  5E2F A;  4KZ5 A;  1S67 L;  1XPB A;  1N4O A;  1QME A;  3FWL A;  2ZQC A;  1NJ4 A;  1BUL A;  1PNE A;  2VK3 A;  1AXB A;  5FEG A;  4HIA A;  4DRT A;  5GLC A;  2JBF A;  4ZJ2 A;  3IQA A;  5FAP A;  5FDH A;  3TJZ C;  3EWK A;  4ZAM A;  1Z09 A;  1OT6 A;  1MKI A;  1OME A;  5KIZ A;  1ERM A;  4PKY G;  2CMN A;  3BJN A;  2XR0 A;  4UA9 A;  1ZTU A;  3A0S A;  1BLC A;  2ZL1 A;  3E4O A;  1OPX A;  3PAE A;  3MFD A;  3SH8 A;  4QD4 A;  1ERQ A;  3Q1F A;  4N9K A;  4Y0U A;  4KQR A;  1PYY A;  4KQO A;  4N92 A;  1CEG A;  4LCM A;  1ES3 A;  4QU3 A;  4YWZ A;  1IKG A;  3M2K A;  2HP9 A;  1MWT A;  1YMX A;  4UEY A;  2H5S A;  4JXS A;  3K3D A;  2OAP 1;  3R4K A;  2EXB A;  3GEC A;  3BQA A;  5HD5 A;  1C3B A;  4DE2 A;  3V50 A;  3ZNY A;  1L0G A;  5D3O A;  3BLS A;  2PT7 A;  2ZJ9 A;  4Q0H A;  4MCW A;  4G3K A;  2Q9M A;  2H10 A;  2WKP A;  3VE3 A;  4CLC D;  3O86 A;  5HL6 A;  2ZMF A;  3BEB A;  4MLL A;  4OPQ A;  4S2N C;  4M4X A;  1ZKJ A;  1VQQ A;  3SS5 A;  5DFX A;  3JVU A;  3IT9 A;  3UB8 A;  1IKI A;  4BBU A;  4HI4 A;  4CLC C;  4FH2 A;  1KE3 A;  1DP9 A;  2BTF P;  4CPK A;  5E2G A;  3G30 A;  1TS6 A;  5FSR A;  1CQA A;  2WZZ A;  2X01 A;  1XFQ A;  1ZG4 A;  4MNR A;  2EX9 A;  1YSP A;  4HY8 A;  1GHP A;  3ZVW A;  1MWU A;  4I39 A;  1UWP X;  1H8Y A;  2IWC A;  2VZW A;  2QHK A;  2Y2M A;  1NZU A;  4GCZ A;  1KVL A;  1O07 A;  2ZL1 B;  4WEJ A;  1W8Y A;  4ARZ A;  3Q7Z A;  3MFX A;  2LB5 A;  5AVF A;  1MBL A;  1G28 A;  4HP4 A;  2XFT A;  2H28 A;  3NDE A;  1KGE A;  4EQI A;  3I7J A;  4PAU A;  2C5W B;  2R9X A;  4GD6 A;  3TE8 A;  3JPU A;  1FR1 A;  5AQB A;  2XRO A;  4GDB A;  3OBF A;  3LGO A;  2PR6 A;  5CGW A;  1LL9 A;  2G2W A;  3HUO A;  3CPT A;  3IH8 A;  5HWV A;  1GSW A;  4OLD A;  4NXE A;  4FH4 A;  4LEN A;  3S7Q A;  2H0T A;  4R38 A;  1XJ6 A;  3BQ8 A;  5KMW A;  1K25 A;  5TJJ A;  4X6T A;  2HDU A;  2XSS A;  4Y0T A;  1OTE A;  2HPB A;  5F83 A;  2WGW B;  4N9L A;  2W1R A;  1XKZ A;  4BMW A;  4Y17 A;  5DFY A;  3MJQ A;  3MQQ A;  1OT9 A;  3C2W A;  2B5R A;  2M7V A;  1DJC A;  4S2N A;  4UQI M;  4BQM A;  4HOI A;  2XD1 A;  3LIA A;  1ONG A;  2PAV P;  3UB7 A;  4E3M A;  4YFM A;  4CLC A;  1IFQ A;  3R7W A;  2PBY A;  3IS2 A;  2WKI A;  4BLM A;  1RCJ A;  3A3F A;  4DXB A;  4U3T A;  3TSG A;  2P04 A;  3MR0 A;  3IBR A;  4A5R A;  3GTC A;  1HLU P;  1DJA A;  2ZM8 A;  2Y2O A;  5HD3 A;  3DTK A;  1KE4 A;  3NBL A;  4ARZ B;  1KVM A;  5AQ9 A;  2JKF A;  3UB5 P;  2WAF A;  3O88 A;  4EXO A;  1YLT A;  2J9P A;  3EQU A;  5BOH A;  3LO7 A;  2WK0 A;  1BSG A;  5F82 A;  3GR2 A;  3P01 A;  2J9O A;  2V2F F;  1IYS A;  3E0Y A;  5HSQ A;  3CUE C;  2JKT M;  3CPT B;  5M19 A;  2B02 A;  4EBN A;  5EM0 A;  3DBA A;  1N9B A;  1N9N A;  2HDQ A;  1ES4 A;  2Y2I A;  2V8C A;  2HV1 A;  2PD7 A;  3IX8 A;  4MN6 A;  4IBX A;  5G4Z A;  1GA0 A;  3KSF A;  3DTE A;  4I38 A;  3VP3 A;  4Q8I A;  2P9V A;  4B9O A;  4DXC A;  3O5Y A;  1K4F A;  2O9A A;  4K0X A;  3MZF A;  1TS0 A;  5A93 A;  1D1J A;  1FOF A;  4FOF A;  3L7H A;  4FSF A;  4UA7 A;  1YLZ A;  4GNU A;  4XXR A;  4Y13 A;  4CLC B;  1H8M A;  3FKV A;  4DJ3 A;  1SDN A;  3CG5 A;  3ZG0 A;  1FIK A;  2QKP A;  3JVV A;  4WL9 A;  1RGZ A;  4KG2 A;  3UNW A;  3BWL A;  5A90 A;  5G4Y A;  2KX6 A;  3RFB A;  1YLY A;  4P87 A;  3IXG A;  2X02 A;  1X0O A;  2ZOH A;  4OVD A;  4ZRR A;  3E2L A;  3GVB A;  3K2N A;  4WM9 A;  1ALQ A;  2Y91 A;  4RX2 A;  3M2J A;  4P6B A;  4DMZ A;  3GSG A;  2UV0 E;  2Y79 A;  3VE4 A;  4P6Z M;  3IX4 A;  4LV3 A;  3T4K A;  2FZ0 A;  1KDW A;  3N6I A;  3B42 A;  4NKP A;  3HCY A;  3S7O A;  1K38 A;  2ZMA A;  4OQI A;  3T12 B;  2A3U A;  3MKF A;  1VEU B;  2ZC5 B;  3IHB A;  3CUE A;  3WRT A;  1H3Q A;  5J3W A;  2VKS A;  4G3W A;  3BFF A;  4ID4 A;  2VV7 A;  3W4Q A;  1CK3 A;  3H9W A;  1HZO A;  4Q0I A;  5HL1 A;  5CRF A;  3LI8 A;  2PU2 A;  3DTM A;  1TDG A;  2RCX A;  4KEN B;  4F94 A;  1S0W A;  3G4P A;  4NET A;  5EPH A;  1NYM A;  3O3V A;  2VV6 A;  4BBT A;  5K5B A;  1PWD A;  1TVF A;  3GRJ A;  1V9Y A;  2JHE A;  3IXD A;  1STZ A;  4CLC E;  5A8B A;  4S2K A;  1BYW A;  4DE0 A;  4MBF A;  4X25 A;  4K0W A;  3LIE A;  2EFX A;  3G2Z A;  1ZHH B;  2W1T B;  4DE1 A;  4BBV A;  3MXQ A;  3HUN A;  1YAX A;  2M1C A;  4LRY C;  4EBP A;  4K08 A;  2OAQ 1;  5AVE A;  3KYZ A;  4GLQ A;  3KO6 A;  1ESU A;  2EA9 A;  3VP4 A;  1F5M A;  2R9W A;  3CZD A;  5CX7 A;  1DP6 A;  4E6W A;  5FI2 A;  1WE4 A;  4RX3 A;  3VFH A;  3T50 A;  1S4S A;  3T4O A;  1LL8 A;  3QHY A;  1ZC2 A;  4ZTK A;  5HZH A;  3FV7 A;  5U47 A;  4R70 A;  4OLG A;  3BW6 A;  4O01 A;  2KOI A;  1I5Q A;  3GMW A;  3MBZ A;  4FUW A;  3NOP C;  2P7J A;  1TF1 A;  2Z2L B;  5HAR A;  5HAQ A;  5JYO A;  2ZOI A;  1F98 A;  1CI9 A;  1T1B A;  1BLP A;  5HFO A;  2VGL M;  1Y4O A;  3OC2 A;  3PBN A;  3MKE A;  1UWN X;  4QY6 A;  4UQI S;  1S1Z A;  2ZMV A;  3IH9 A;  1J9M A;  2HJ9 C;  4GS9 B;  3G35 A;  5DVA A;  5TBM A;  5CEC A;  4RQ9 A;  2OLV A;  3E98 A;  3V67 A;  3UPO A;  4MMN A;  2QPN A;  3O87 A;  3PBQ A;  5A91 A;  4CQH A;  3A3E A;  2HJE A;  4JGP A;  1PZP A;  2HGV A;  3UPP A;  3HLB A;  1D06 A;  1PZO A;  2XDM A;  3WS5 A;  5AJG A;  4IVK A;  1LSV A;  1DP8 A;  3Q81 A;  4EBL A;  4Y0O A;  4NXG A;  2NUP C;  3VOZ A;  4KZB A;  4R23 A;  1IYQ A;  1EI5 A;  4LPZ A;  3LY4 A;  1P97 A;  3M6B A;  2OWH A;  2BG1 A;  2BAS A;  2XLN A;  3KX0 X;  3PR6 A;  1N9L A;  5CHM A;  5TFQ A;  3RTY A;  3C38 A;  3NDG A;  4HHD A;  2XH9 A;  1YM1 A;  5J4E A;  2PDR A;  2DNS A;  2XK1 A;  4U0T A;  1G5U A;  3ISG A;  3A3J A;  3OPH A;  4ZJ1 A;  2PHY A;  3NCK A;  2DMW A;  3BM6 A;  3M6H A;  1GHM A;  1L0F A;  2O9B A;  4KZA A;  4OQH A;  5CHU A;  5FQM A;  3SS3 A;  4BD0 A;  3T1X A;  1GCE A;  2XA7 M;  3CAX A;  4IUH A;  4KUO A;  4JXV A;  2IA2 A;  1PFL A;  3BLM A;  3EEA A;  4WYY A;  2WKE A;  1E25 A;  4GZB A;  4C3Q A;  3C30 A;  3WS1 A;  4PM9 A;  1OTI A;  1FCM A;  1LL5 A;  4GJ4 A;  4JGR A;  2WGW A;  2JKG A;  3UPN A;  3FPW A;  5TBM B;  3S1Y A;  3EGD C;  3ITA A;  5HAP A;  5GLB A;  1ODV A;  1TS7 A;  4X55 A;  4HNB A;  4IBR A;  2GDN A;  3CMZ A;  2WKR A;  4E3L A;  3LR0 A;  1JWV A;  4IHQ A;  4ZDX A;  2XD5 A;  2ZC7 A;  4UA6 A;  2Y2J A;  4EER A;  3PHY A;  3LUQ A;  4WN5 A;  4GOG A;  4Y15 A;  4R3A A;  3ZGA B;  1DY6 A;  3T4J A;  1QMF A;  5TGF A;  3U4L P;  2WAE A;  3CLO A;  2OLU A;  2JN7 A;  5EOE A;  4QJG A;  2Y2Q A;  3G2Y A;  3SS4 A;  2HDR A;  4LV2 A;  1J3W A;  2W3F A;  5DTK A;  4P6Z S;  5CTN A;  5TR7 A;  3NJA A;  3LIF A;  2J8Y A;  1Y54 A;  3UDF A;  3W4P A;  4DJ2 A;  2ZLY A;  3IXB A;  1VHM A;  1K57 C;  3PBS A;  3D9Y A;  3ZHH A;  1KOU A;  5J8X A;  3G32 A;  3LID A;  4WUJ A;  5L2F A;  3IWO A;  3NC8 A;  1MXO A;  3LY3 A;  3UE3 A;  4FTX A;  1GA9 A;  3LEZ A;  4RYE A;  1P0Z A;  1KGF A;  3CJM A;  4Y3I A;  3N4I A;  1T18 A;  5EVE A;  1JTG A;  2ZQA A;  1P9W A;  5KSC A;  1IYP A;  3FZC A;  4FD8 A;  4JKT A;  1ES2 A;  1XX2 A;  3VMA A;  3AGE A;  2EWV A;  4ESP A;  3HLC A;  1MKM A;  4EET B;  2ZD8 A;  4R3J A;  5E43 A;  2I9V A;  1MY8 A;  4WLA A;  4I3J A;  4JF5 A;  3WS2 A;  4NG2 A;  2Z2M B;  4O8G A;  5E2H A;  3D72 A;  4M3K A;  4E3N A;  3OPL A;  3P09 A;  5F69 A;  2V20 A;  4U0X A;  3T4L A;  2QJ5 A;  3EEH A;  2GX5 A;  2JC7 A;  4KQD A;  3VP1 A;  4E04 A;  2HP6 A;  4X68 A;  4NXF A;  2KLI A;  1PWG A;  2KDK A;  5KSH A;  1GSX A;  5M18 A;  3IWQ A;  3KSI A;  5AQ7 A;  2Y55 A;  1YQS A;  3KYQ A;  4E3K A;  5GLA A;  4R4R A;  4IUK A;  3EGX C;  3CI6 A;  1A0K A;  4HH2 A;  1K57 A;  3NIA A;  5HDD A;  1PRQ A;  1FCN A;  2PYR A;  4RVA A;  3GV9 A;  4JGQ A;  5FAS A;  1YLJ A;  4ZBE A;  4GDN A;  1VEU A;  3UY6 A;  1BT5 A;  2WKQ A;  2VEA A;  3LYX A;  5LBR A;  3HRE A;  2VGL S;  4Z9Q A;  1NLY A;  1SDE A;  4BEN A;  3C7V A;  2P08 A;  3N7W A;  5HWT A;  1KGG A;  1NLZ A;  5GHZ A;  2VGJ A;  3DWK A;  4WBG A;  2G2U A;  2W3H A;  2K31 A;  1BZA A;  1XA7 A;  4PKY A;  3VFF A;  2B95 A;  5GHX A;  2V0U A;  3N8R A;  2ZQ8 A;  2W0N A;  5M1A A;  1HD8 A;  4X53 A;  2XFS A;  3FKW A;  4I3A A;  1N9O A;  4MEZ A;  4QHC A;  2XRN A;  5FQK A;  2IWD A;  1DRM A;  3HL9 A;  3UDX A;  1LI9 A;  3F1P A;  3HBR A;  3RH8 B;  2JE5 A;  1MPL A;  2W1T A;  4UAA A;  3VOY A;  1E4D A;  2J3T D;  3CIT A;  3RXW A;  1M6K A;  3IX3 A;  3Q7V B;  4JPM A;  4IVI A;  1Q2P A;  5HX9 A;  2GNX A;  1TS8 A;  3IXH A;  2D01 A;  5HDS A;  4F3L B;  3BEC A;  3UO9 A;  1WYC A;  3U2A A;  4EEU A;  3FYZ A;  4K91 A;  1LSX A;  2J3T C;  2HP5 A;  4EEP A;  1K55 C;  1EW0 A;  1OTD A;  3BFG A;  1L0D A;  5CGS A;  5EOO A;  1NZO A;  4HH3 A;  2XA7 S;  1OTB A;  1FSY A;  3S4X A;  3UE6 A;  2IWB A;  2PYP A;  2ZC6 B;  3IBJ A;  3NI9 A;  1NY0 A;  4E3O A;  3UN7 A;  1XJ4 A;  5EV0 A;  5CTM A;  4IJG A;  3QP1 A;  3LEQ A;  3NHQ A;  3HLG A;  3MS6 A;  4GHI A;  1G68 A;  3F1N B;  2E8J A;  3QP8 A;  1SCW A;  4JF4 A;  3HLW A;  5HPF A;  3HUM A;  3ZDJ A;  4D60 A;  3WS0 A;  2GJ3 A;  3UDI A;  2VJW A;  1W5D A;  1U60 A;  1NXY A;  4LV0 A;  5EEC A;  5L10 A;  4ZJ3 A;  3HJK A;  1S66 L;  3BRM A;  2WZX A;  3IHA A;  5F68 A;  2VLG A;  2Y2P A;  1OJG A;  4GS9 A;  4PM6 A;  4OOL A;  2ZC3 B;  3GQZ A;  1PW8 A;  3UE0 A;  3PAG A;  4OPR A;  3A0R A;  4I3I A;  3HJI A;  4BL3 A;  3F1P B;  1JVJ A;  5L07 A;  3BYD A;  2W27 A;  2H0Y A;  5CED A;  3VSL A;  4OP8 A;  1K4E A;  5JYP A;  4R3B A;  5C5K A;  4WF0 A;  3VSK A;  3RJU A;  3C4P A;  5G18 A;  5MC7 A;  4XUX A;  3S22 A;  1XP4 A;  3ZCZ A;  2W3D A;  2VV8 A;  3IWI A;  3HLF A;  4GW9 A;  1ERO A;  5CXW A;  2AVX A;  3P98 A;  3OCL A;  3ZG7 B;  5HDC A;  3PXP A;  3K3C A;  5GHY A;  1UGU A;  4PM8 A;  3IF5 A;  2EX2 A;  4MBH A;  1L3L A;  3F1O A;  1G6O A;  2XF3 A;  3KSG A;  2WYX A;  4HES A;  5FQ9 A;  1CI8 A;  2Y2G A;  2A24 A;  1S4R A;  3MQO A;  2V1A A;  3T1S A;  4Z1W A;  5GL9 A;  4MN5 A;  2ZQ9 A;  4KZ6 A;  4EES A;  4EUV A;  3ITB A;  1SKO A;  1Q2Q A;  4LRX C;  4S2P A;  4GHI B;  5HWW A;  3AGF A;  4L9F A;  2FFY A;  1XGJ A;  3Q82 A;  1LSW A;  1ONH A;  2Y59 A;  5IS1 A;  1JNU A;  4QY5 A;  3ZNT A;  3DWZ A;  2FH5 A;  5HAI A;  3GDI A;  2PRF A;  4JXW A;  3L9K A;  3D4F A;  1FIL A;  2OOL A; 
#chains in the Genus database with same CATH homology
 2WAF A;  1IEM A;  3WWX A;  3O88 A;  4NK3 A;  1YLT A;  2J9P A;  4PMA A;  4GOG A;  3EQU A;  5BOH A;  1YLW A;  3LO7 A;  2WK0 A;  4WMC A;  2WKH A;  1DY6 A;  3V3R A;  3ZGA B;  2BLS A;  1BSG A;  1QMF A;  5TGF A;  5FAT A;  1NYY A;  2WAE A;  4S2L A;  5DF7 A;  2OLU A;  5KZH A;  1MWR A;  5F82 A;  3GR2 A;  3HLD A;  4Y7P A;  1RP5 A;  4WEK A;  5EOE A;  2Y2Q A;  1IYO A;  3G2Y A;  3SS4 A;  2HDR A;  2J9O A;  3VP0 A;  4DDY A;  4LV2 A;  4B4Z A;  4XUZ A;  5DTK A;  4LCL A;  3LCE A;  5CTN A;  2EFU A;  5TR7 A;  4KZ8 A;  2V2F F;  4GD8 A;  1IYS A;  1Y54 A;  2J8Y A;  4LV1 A;  3IF6 C;  3ZG9 B;  4N1X A;  1VM1 A;  3W8K A;  3UDF A;  4OQG A;  2Y2L A;  5M19 A;  2P9V B;  3W4P A;  1YLP A;  4JF6 A;  2ZLY A;  3IXB A;  5GLD A;  2V1Z A;  4EBN A;  4PM5 A;  1K57 C;  1DJB A;  1N9B A;  2HDQ A;  3V5M A;  2PU4 A;  3PBS A;  4GKU A;  5DF9 A;  3ZHH A;  1ES4 A;  1FR6 A;  2Y2I A;  3N8S A;  5J8X A;  3G32 A;  4IED A;  2DRW A;  4WEL A;  1G6A A;  1I2S A;  2Y4A A;  5L2F A;  4IBX A;  4X69 A;  3IWO A;  3NC8 A;  1GA0 A;  1MXO A;  3LY3 A;  3UE3 A;  1GA9 A;  3UE1 A;  4HEF A;  1XGI A;  3LEZ A;  3SH9 A;  1PI4 A;  4L0L A;  4RYE A;  1KGF A;  1TEM A;  3CJM A;  1HVB A;  3N4I A;  3VP3 A;  4Q8I A;  1GHI A;  2P9V A;  2OV5 A;  4QB8 A;  1JTG A;  2ZQA A;  1ZG6 A;  4DXC A;  4KZ7 A;  4RA7 A;  4BL2 A;  5KSC A;  2XGN A;  1K4F A;  1IYP A;  2P74 A;  3FZC A;  4JLF A;  5F1F A;  3SH7 A;  2X71 A;  2Y2K A;  3E2K A;  3G34 A;  4FD8 A;  4K0X A;  4OH0 A;  3MZF A;  1JWP A;  4JKT A;  5FI7 A;  4CJN A;  5A93 A;  1ES2 A;  1XX2 A;  3VMA A;  3AGE A;  1FOF A;  3BFD A;  4H8R A;  5EUA A;  4PM7 A;  1FSW A;  5FQJ A;  4FSF A;  2QMI A;  4UA7 A;  5FQI A;  1IEL A;  1YLZ A;  3HLC A;  3HLE A;  4GNU A;  5IHV A;  4XXR A;  3ZVT A;  4D2O A;  3MZE A;  3FKV A;  3HVF A;  1SDN A;  4OOM A;  2ZD8 A;  4R3J A;  3CG5 A;  5E43 A;  1K55 A;  5F1G A;  2OSU A;  2JCH A;  3ZG0 A;  1MY8 A;  4DKI A;  5I94 A;  1KE0 A;  2Q9N A;  1FCO A;  1RGZ A;  4KG2 A;  4JF5 A;  4KZ4 A;  3WS2 A;  3OCN A;  5DTS A;  2UWX A;  3WS4 A;  1CEF A;  2Z2M B;  3UNW A;  5A90 A;  5E2H A;  2J7V A;  1BUE A;  1PW1 A;  4E3N A;  4M3K A;  2A49 A;  3OPL A;  3A3D A;  3G31 A;  3P09 A;  1YLY A;  5CER A;  4P87 A;  4JBF A;  4OPZ A;  3IXG A;  2X02 A;  2ZM0 A;  3OZH A;  3V3S A;  4E6X A;  1PIO A;  4OVD A;  3E2L A;  1SKF A;  3GVB A;  3W4O A;  2V20 A;  4U0X A;  4WM9 A;  1ALQ A;  2Y91 A;  4RX2 A;  3M2J A;  1LHY A;  2HDS A;  2JC7 A;  5FI6 A;  4C6Y A;  1ESI A;  3VP1 A;  4E3I A;  1YMS A;  2HP6 A;  4P6B A;  3GSG A;  2WUQ A;  4X68 A;  1PWG A;  1RGY A;  5KSH A;  4HBU A;  3PTE A;  1NRF A;  4KQQ A;  5M18 A;  4LV3 A;  3IWQ A;  2WGI A;  5AQ7 A;  3PBO A;  4OQ0 A;  1KDW A;  5E2E A;  3N6I A;  3ZFZ A;  2Y55 A;  1LI0 A;  3NY4 A;  1K38 A;  1YQS A;  1ES5 A;  2WGV A;  5EVL A;  2ZMA A;  4OQI A;  1PI5 A;  4N1H A;  1LLB A;  3JYI A;  4E3K A;  4EV4 A;  1S6R A;  4UHU A;  2A3U A;  5GLA A;  3MKF A;  4R4R A;  1W7F A;  2ZC5 B;  3IHB A;  5CGX A;  3IF6 A;  2RL3 A;  4P0M A;  1XXM A;  3MXR A;  3WRT A;  1SHV A;  3SOI A;  1K57 A;  3B3X A;  2E8I A;  3C5A A;  3NIA A;  5E2F A;  4KZ5 A;  1FCN A;  3BFF A;  4ID4 A;  4RVA A;  3GV9 A;  3W4Q A;  1CK3 A;  4GN2 A;  1HZO A;  5HL1 A;  5EVI D;  5CRF A;  5FAS A;  1YLJ A;  4ZBE A;  1XPB A;  1N4O A;  1QME A;  4GDN A;  3UY6 A;  3FWL A;  2ZQC A;  1BT5 A;  2PU2 A;  1NJ4 A;  3DTM A;  1BUL A;  1BLS A;  1TDG A;  2RCX A;  1AXB A;  3HRE A;  4KEN B;  1K56 D;  4DRT A;  5GLC A;  4F94 A;  2JBF A;  4ZJ2 A;  4Z9Q A;  3IQA A;  1SDE A;  1S0W A;  4BEN A;  5FAP A;  3C7V A;  1PWC A;  1HTZ A;  3G4P A;  4NET A;  5EPH A;  5EVI C;  5FDH A;  4BJP A;  1NYM A;  4ZAM A;  3O3V A;  3N7W A;  1KGG A;  1K54 C;  4KG5 A;  4OP5 A;  5GHZ A;  3WRZ A;  2VGJ A;  4HBT A;  1MKI A;  1OME A;  1PWD A;  1TVF A;  3DWK A;  1ERM A;  1JWZ A;  2CC1 A;  3GRJ A;  3IXD A;  4WBG A;  2G2U A;  4UA9 A;  2XR0 A;  4S2K A;  4X56 A;  4DE0 A;  4MBF A;  1BZA A;  4K0W A;  1XA7 A;  4OKP A;  1BLC A;  2EFX A;  3G2Z A;  4PPR A;  3DW0 A;  3VFF A;  3TG9 A;  4JXG A;  4EWF A;  2Y2N A;  1YT4 A;  2Y2H A;  4DE1 A;  5GHX A;  3N8R A;  3HUN A;  3PAE A;  3MFD A;  3SH8 A;  2ZQ8 A;  3N8L A;  5M1A A;  4QD4 A;  1HD8 A;  3QNB A;  4X53 A;  2XFS A;  4BD1 A;  4EBP A;  3FKW A;  1ERQ A;  3Q1F A;  4N9K A;  4Y0U A;  4KQR A;  1PYY A;  4KQO A;  4MEZ A;  4QHC A;  3PBR A;  4N92 A;  1CEG A;  4LCM A;  5FQK A;  2IWD A;  1ES3 A;  1Z6F A;  3VP4 A;  1ESU A;  2R9W A;  4QU3 A;  3HL9 A;  5FAO A;  3CZD A;  5DF8 A;  1IKG A;  3M2K A;  2HP9 A;  1LI9 A;  3UDX A;  4E6W A;  3HBR A;  1MWT A;  1O7E A;  1YMX A;  2JE5 A;  5FI2 A;  1MPL A;  1WE4 A;  4RX3 A;  3VFH A;  4UAA A;  2H5S A;  3VOY A;  1E4D A;  4JXS A;  4OPY A;  2I72 A;  4FCF A;  3EQV A;  1M6K A;  3RXW A;  3Q7V B;  4JPM A;  4IVI A;  1Q2P A;  5HX9 A;  2EXB A;  4S2I A;  3QHY A;  4B4X A;  3IXH A;  1ZC2 A;  4ZTK A;  1C3B A;  3BEC A;  3V50 A;  4DE2 A;  3ZNY A;  3FV7 A;  4OON A;  4S2O A;  5U47 A;  4P85 A;  3UO9 A;  1L0G A;  3MXS A;  1WYC A;  3BLS A;  4OLG A;  4WZ5 C;  5D3O A;  3BFE A;  2ZJ9 A;  5HW3 A;  2FFF B;  3FYZ A;  4K91 A;  5CEB A;  4S2M A;  2Q9M A;  1I5Q A;  1K6S A;  3GMW A;  3MBZ A;  3TOI A;  2H10 A;  2HP5 A;  3IF6 B;  1K55 C;  3BFG A;  3O86 A;  2Z2L B;  5HAR A;  5HAQ A;  4DE3 A;  3BEB A;  3Q7V A;  1KDS A;  4MLL A;  1L0D A;  4OPQ A;  4S2N C;  5CGS A;  5EOO A;  4OOY A;  5JYO A;  1NZO A;  1ZKJ A;  1VQQ A;  1XA1 A;  3SS5 A;  1E3U D;  4R4S A;  1CI9 A;  1FSY A;  3S4X A;  3IT9 A;  2IWB A;  1IKI A;  2ZC6 B;  3NI9 A;  1NY0 A;  4KG6 A;  1BLP A;  4E3O A;  3OPP A;  5HFO A;  3UN7 A;  4FH2 A;  5CTM A;  5FQQ A;  4DDS A;  1KE3 A;  3OC2 A;  3PBN A;  3MKE A;  4CPK A;  1EWZ A;  4QY6 A;  3HLG A;  5E2G A;  1G68 A;  3G30 A;  1W8Q A;  5FSR A;  3IH9 A;  1J9M A;  3Q07 A;  2EXA A;  2WZZ A;  2X01 A;  1L2S A;  1ZG4 A;  3G35 A;  5DVA A;  4MNR A;  5CEC A;  1SCW A;  2EX9 A;  4WMC D;  4JF4 A;  3HLW A;  1GHP A;  3HUM A;  2OLV A;  3ZVW A;  1MWU A;  4DXB A;  3C7U A;  3ZDJ A;  1TDL A;  3WS0 A;  3UPO A;  1H8Y A;  3VP2 A;  3UDI A;  2QPN A;  3O87 A;  5EVI A;  2DCF A;  2IWC A;  4GB7 A;  2Y2M A;  3PBQ A;  1W5D A;  1NZU A;  1U60 A;  1NXY A;  4LV0 A;  4O7D A;  5EE8 A;  5EEC A;  5A91 A;  4ZJ3 A;  3ZG8 B;  1K54 A;  4DF6 A;  1KVL A;  3A3E A;  1BTL A;  3BRM A;  1O07 A;  1PZP A;  2WZX A;  4WEJ A;  3HLB A;  1W8Y A;  3UPP A;  1BLH A;  1PZO A;  3IHA A;  2XDM A;  3Q7Z A;  4KZ9 A;  1WYB A;  2Y2P A;  3OPR A;  1K56 A;  3WS5 A;  4EUZ A;  4IVK A;  4PM6 A;  1MBL A;  4YIN A;  4OOL A;  2ZC3 B;  3GQZ A;  3Q81 A;  1PW8 A;  2XFT A;  4EBL A;  3UE0 A;  3PBT A;  3PAG A;  4Y0O A;  4OPR A;  3VOZ A;  2VGK A;  4KZB A;  3NDE A;  1KGE A;  4R23 A;  1IYQ A;  1EI5 A;  4EQI A;  4MBK A;  3I7J A;  5FA7 A;  3LY4 A;  3M6B A;  5CHJ A;  2C5W B;  2BG1 A;  2R9X A;  4GD6 A;  4WZ4 A;  4BL3 A;  3C4O A;  2XLN A;  3A3I A;  5CHM A;  1JVJ A;  5TFQ A;  3BYD A;  2ZQD A;  1FR1 A;  5AQB A;  5AQA A;  4GDB A;  2H0Y A;  3NDG A;  1K6R A;  2XH9 A;  5CGW A;  1YM1 A;  5CED A;  1LL9 A;  2G2W A;  3VSL A;  3BFC A;  3HUO A;  3IH8 A;  2DNS A;  3QNC A;  4OP8 A;  1K4E A;  5DTT A;  5JYP A;  2XK1 A;  4KZ3 A;  4OLD A;  4R3B A;  4U0T A;  3ISG A;  3VSK A;  3RJU A;  3A3J A;  3OPH A;  3C4P A;  4FH4 A;  2ZM2 A;  4LEN A;  4ZJ1 A;  1MWS A;  1H5X A;  5G18 A;  2WAD A;  2H0T A;  4XUX A;  3S22 A;  3NCK A;  1XP4 A;  3ZCZ A;  3BM6 A;  3M6H A;  1GHM A;  4E3J A;  1L0F A;  4KZA A;  5KMW A;  4OQH A;  2EX8 A;  3IWI A;  3HLF A;  1K25 A;  5FAQ A;  1ERO A;  4X6T A;  5CHU A;  2HDU A;  5CXW A;  5FQM A;  1W79 A;  3SS3 A;  4BD0 A;  4Y0T A;  1I2W A;  1GCE A;  1FQG A;  2HPB A;  3OCL A;  3P98 A;  4R0Q A;  1H8Z A;  4WZ5 A;  5F83 A;  3ZG7 B;  2WGW B;  4N9L A;  2ZC4 B;  5GHY A;  4PM8 A;  3IF5 A;  1XKZ A;  4JXV A;  2EX2 A;  4MBH A;  2C6W B;  1M40 A;  2XF3 A;  3BLM A;  4QJG A;  4WYY A;  2WKE A;  2B5R A;  4B88 A;  1E25 A;  1DJC A;  4S2N A;  2WYX A;  4HES A;  5FQ9 A;  4GZB A;  4C3Q A;  1CI8 A;  2Y2G A;  4BQM A;  3WS1 A;  4PM9 A;  3AGD A;  3ZG5 A;  1FCM A;  1LL5 A;  1L0E A;  5GL9 A;  2ZQ9 A;  2ZQ7 A;  2QZ6 A;  4KZ6 A;  3ITB A;  2XD1 A;  1Q2Q A;  1ONG A;  4S2P A;  4E3M A;  2WGW A;  4S2J A;  3RXX A;  4YFM A;  3UPN A;  3AGF A;  2PBY A;  2WKI A;  2FFY A;  3S1Y A;  3ITA A;  1XGJ A;  5HAP A;  4R1G A;  4BLM A;  1RCJ A;  3A3F A;  5GLB A;  2XEP A;  3Q82 A;  1E3U A;  4U3T A;  4X55 A;  3TSG A;  4IBR A;  4C75 A;  1ONH A;  2Y59 A;  2GDN A;  4QY5 A;  3CMZ A;  3ZNT A;  4E3L A;  5EVI B;  3DWZ A;  5HAI A;  1JWV A;  2EX6 A;  4A5R A;  4ZDX A;  3GTC A;  2XD5 A;  2ZC7 A;  1DJA A;  2ZM8 A;  2Y2O A;  3V39 A;  4JXW A;  5A92 A;  3D4F A;  1KE4 A;  3NBL A;  4UA6 A;  1KVM A;  5AQ9 A;  1JTD A;  2XQZ A;  2Y2J A;  3MZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...