1IELA

Crystal structure of ampc beta-lactamase from e. coli in complex with ceftazidime
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
355
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIGSDNIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structures of ceftazidime and its transition-state analogue in complex with AmpC beta-lactamase: implications for resistance mutations and inhibitor design.
pubmed doi rcsb
total genus 116
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ielA00
5EE8A 5FI7A 3HUMA 2J9OA 3C7UA 4KZ9A 4OONA 1XA1A 5FAOA 1ONHA 4LCLA 3HLEA 4E3JA 1NXYA 4P0MA 1MPLA 1MKIA 4OPYA 1LI9A 1NZOA 2X01A 1NYYA 4E6WA 4DXBA 2XH9A 3NY4A 3FWLA 5D3OA 3MZFA 5HX9A 3IHAA 1BTLA 2XD1A 3A3EA 4IVKA 5DF9A 5EVIA 3ZNYA 3M6BA 5FQQA 3HLWA 1SDNA 2PU4A 2Y2PA 1KVMA 4BENA 3SS3A 1FR1A 2Y2IA 2BLSA 3OPHA 4OVDA 4EQIA 4OOYA 2PBYA 4HESA 5GLAA 1PW1A 3IH8A 4RX3A 2WAEA 3W4OA 3W4QA 3C4PA 2Y2LA 2V20A 1N4OA 1E3UD 3VSLA 1U60A 2XFSA 2Y2HA 1FQGA 2QMIA 4NETA 1Z6FA 4FCFA 3PBTA 1OMEA 1W8QA 4BD0A 5CRFA 5E2FA 4S2NC 4U0XA 5EECA 1HTZA 3W4PA 4XXRA 3I7JA 4H8RA 4ZTKA 2XEPA 3FYZA 4EBLA 2ZC3B 1Q2PA 3BYDA 3C5AA 5E2HA 1HVBA 4GDNA 4UA7A 4M3KA 4F94A 1ZG6A 1BUEA 3IF6A 1FOFA 3TSGA 3WS5A 3O88A 2V2FF 4PM5A 3HLBA 3HLDA 4OQIA 4S2PA 4JPMA 1XGJA 3UPOA 3VOYA 5CECA 4C75A 4BD1A 5FASA 4BLMA 2P9VB 1PI4A 4P6BA 4PMAA 4DKIA 5DF7A 1FCNA 4S2LA 3LEZA 5FQKA 3BLSA 4LCMA 3IXHA 1CI9A 5KMWA 5DVAA 2WYXA 5KZHA 3ZHHA 1ZG4A 3NBLA 4R4SA 5FAPA 4OOMA 2ZQ7A 4ID4A 2X71A 3FZCA 5G18A 1JWVA 1BLSA 2HP9A 4DXCA 3ITAA 4OQGA 2XLNA 5AQBA 1JVJA 2ZLYA 3V39A 3UY6A 2J8YA 3G4PA 3MBZA 5GLDA 2EX8A 1YT4A 1O7EA 1YLJA 4B88A 3S4XA 1KDSA 2ZJ9A 2FFFB 2PU2A 1CI8A 2RCXA 4FSFA 1KGFA 2JE5A 2JBFA 4UHUA 2WKEA 3WS2A 1PWCA 4DE1A 3HLFA 1K54C 1L2SA 2XR0A 3QHYA 1YM1A 5CEDA 3FKVA 2J9PA 4E3NA 2E8IA 1YQSA 4KZBA 5FATA 1IKIA 3P98A 3G34A 3UPPA 2HP5A 4BJPA 3PBOA 3GV9A 1KVLA 1MWSA 2X02A 1BZAA 3UE0A 2H10A 4B4ZA 4C6YA 4X69A 4BQMA 3GMWA 2DRWA 4ZJ3A 3IQAA 2EX2A 3G35A 3HUOA 4CJNA 1RCJA 2I72A 2VGJA 1H8YA 4MNRA 4IEDA 1ES3A 1SKFA 4EBPA 3A3DA 5M18A 4OOLA 1KE4A 3B3XA 4MBHA 2WKIA 5BOHA 5EOEA 2OV5A 3OPLA 1O07A 1W79A 2WKHA 2Q9MA 1IYSA 2ZC5B 3M2KA 3N8LA 2Y2GA 4KG2A 2HDRA 4X53A 4DE0A 4EUZA 3BFDA 1KGGA 4X6TA 4UAAA 1WE4A 1YLYA 5F82A 4FH2A 1G6AA 3S1YA 5EUAA 5JYPA 3LY4A 1QMEA 4QY6A 5CHUA 1GHIA 1QMFA 5GHYA 1XX2A 3IWQA 4K0XA 1IYPA 2IWCA 4QB8A 1MXOA 4DF6A 1E4DA 2EXAA 2XD5A 2G2WA 4KG6A 1RP5A 3ZDJA 4R0QA 3G2YA 3IXGA 4GDBA 2ZQAA 3AGFA 1YLWA 2Y2NA 3IHBA 1NY0A 1W5DA 2EX6A 4OLGA 2H0YA 5EPHA 1KGEA 1EI5A 1RGYA 1ES2A 4LV2A 2XDMA 2FFYA 1IEMA 1CEGA 2Y2QA 2XF3A 5GHZA 4L0LA 3VP2A 2EFUA 1PIOA 2QZ6A 4N1XA 2ZC6B 4ZDXA 1CEFA 1JTDA 4WZ5A 5HAPA 1W8YA 2HDUA 2R9XA 4ZBEA 3PBRA 4Y7PA 3BLMA 1GCEA 5JYOA 2WGVA 2DNSA 5E2GA 3OPPA 3VMAA 2Q9NA 3HL9A 4P87A 4E3KA 4GD8A 4KG5A 4OP8A 5EVIC 5J8XA 5A93A 1N9BA 3Q1FA 4CPKA 1DY6A 3RXXA 1GA9A 3Q7ZA 2Y2JA 4PM9A 4E3LA 4WEKA 4Y0TA 4WELA 2A49A 1HD8A 3N7WA 2ZC7A 5IHVA 3VP4A 3VP1A 2XFTA 3UDXA 3UDIA 2R9WA 3Q7VA 1GHMA 2ZM0A 2ZM8A 3LY3A 2WGIA 2C6WB 1MWRA 4XUXA 4DRTA 3MZDA 1ALQA 4WM9A 4OQ0A 2P74A 4KZ8A 4U3TA 1PWGA 2Y91A 1Q2QA 3ZVTA 3EQVA 4Y0UA 2ZMAA 1HZOA 1WYCA 2EXBA 3A3FA 3GRJA 1JTGA 3WS0A 3OPRA 3AGDA 1DJCA 2JC7A 3MKFA 1XGIA 2ZQ9A 1K55C 3N8SA 2IWBA 4R23A 3Q82A 1E25A 5CHJA 1MWUA 5AQ7A 4S2NA 4NK3A 3ITBA 4KZ4A 4S2JA 2WZXA 1NYMA 5CERA 4S2OA 4PM7A 3G32A 3AGEA 3OC2A 3ZGAB 4QD4A 3BFEA 4OPQA 1K54A 5A90A 1LL9A 1VM1A 4N9LA 3VFHA 1TVFA 4RA7A 3LCEA 5EVLA 3DWKA 3MXSA 4S2MA 5A92A 4QY5A 3MXRA 4JXGA 1LLBA 5FQIA 3NI9A 1W7FA 4RX2A 4X56A 5FI2A 4YINA 3A3JA 4JXWA 5TR7A 4EV4A 3SS4A 4HBUA 1ESUA 3IH9A 4KZ5A 3UN7A 3IF6B 1WYBA 4PPRA 5TFQA 3HLCA 4MLLA 3IXBA 3ZNTA 4D2OA 2CC1A 4R3JA 4EBNA 5U47A 1K57C 3PBSA 5FQMA 2EX9A 4OKPA 2Y4AA 1I2SA 5M1AA 3BFGA 5HAIA 2WADA 1EROA 2ZD8A 3C4OA 3HLGA 3VP0A 4MBFA 3BM6A 5CGXA 3FV7A 4S2KA 1G68A 1ZC2A 2ZC4B 2RL3A 3GTCA 4JF5A 4OPRA 1K56D 4RYEA 3PAEA 3OCLA 3P09A 5E2EA 3ZCZA 3BFCA 2WZZA 1ZKJA 3Q81A 3GSGA 3HBRA 3Q7VB 1XP4A 1H5XA 4JLFA 1YMXA 2V1ZA 3CJMA 1ES5A 3CG5A 5FA7A 2OSUA 2WAFA 5EVIB 3EQUA 1ERQA 3ZG8B 4X68A 5FQ9A 5FAQA 5HW3A 5FQJA 3HVFA 1PWDA 2WUQA 1K57A 3BRMA 5HFOA 4QJGA 3GVBA 3PTEA 3UDFA 1YLPA 2Y55A 3S22A 3E2LA 2HP6A 1BULA 4WZ4A 3VFFA 1YLZA 1AXBA 1M40A 1SHVA 2DCFA 3N8RA 2GDNA 4E3IA 3VSKA 3RXWA 3PAGA 4KQQA 3NC8A 3UO9A 4KQOA 4GB7A 1IELA 1PI5A 4WMCD 1IKGA 3V5MA 1KE0A 4E6XA 2OLUA 4RVAA 5KSHA 5DTTA 3M6HA 3IWOA 3WWXA 2ZQ8A 1MWTA 2WGWB 4IBRA 4R4RA 4WBGA 4R3BA 1NRFA 3V3RA 1TDLA 2QPNA 1BSGA 1BLCA 4HBTA 2Y59A 2WGWA 3V3SA 1ERMA 1BLPA 1KDWA 3N6IA 1SCWA 5CTMA 3BECA 5CEBA 2H5SA 3BEBA 4O7DA 5GHXA 3SH7A 3SS5A 4QU3A 5DTKA 4HEFA 3WS1A 4KQRA 3CZDA 1XA7A 1PYYA 5EVID 1MY8A 5F1GA 4IBXA 2J7VA 1K55A 5HARA 4KZ3A 1L0GA 3NIAA 5CGSA 4GD6A 1K38A 1NJ4A 2BG1A 3IF5A 4X55A 1BT5A 1GA0A 5CTNA 5AQ9A 3QNCA 1IYQA 1XKZA 4KZ6A 4XUZA 3IF6C 4E3MA 5DF8A 4KZ7A 3UE1A 1SDEA 1CK3A 1FCMA 3M2JA 1TDGA 1J9MA 1YMSA 5FDHA 5M19A 4C3QA 4WYYA 4EWFA 1E3UA 3CMZA 5CHMA 4GZBA 4JBFA 4DDSA 2ZQDA 2B5RA 1K6RA 1K25A 1S0WA 4N9KA 3WRZA 3V50A 2HPBA 3HREA 1JWPA 4U0TA 4OLDA 4ZAMA 3E2KA 3ZG0A 3DTMA 3ZFZA 2UWXA 4B4XA 1L0EA 3C7VA 4JF6A 1LL5A 1I5QA 2ZQCA 5HAQA 1K4FA 1PW8A 2H0TA 1DJAA 1JWZA 5EOOA 1K6SA 4OH0A 5CXWA 1RGZA 3DW0A 1H8ZA 4LV3A 3ZG5A 3MZEA 4ZJ1A 3O87A 1S6RA 2Y2OA 3IWIA 4S2IA 4Y0OA 3SH8A 3SOIA 4DE2A 4Q8IA 4WEJA 4YFMA 1L0FA 5TGFA 3UPNA 1XXMA 4PM6A 4K91A 3LO7A 2Y2KA 2OLVA 4GOGA 4MBKA 3OCNA 5CGWA 4GKUA 3G31A 3NCKA 3OZHA 1FSYA 1ES4A 2VGKA 4Z9QA 1BLHA 3NDGA 4N1HA 3TG9A 1GHPA 5FSRA 4UA6A 4A5RA 2P9VA 3WS4A 5HL1A 4JF4A 1IYOA 2A3UA 1K56A 4IVIA 1C3BA 3ZVWA 1PZOA 3D4FA 4DE3A 2WK0A 5L2FA 1TEMA 1FCOA 4OQHA 5GLBA 1M6KA 1L0DA 4JXVA 4R1GA 3RJUA 4KZAA 3ZG7B 4KENB 2IWDA 4JXSA 3VP3A 3IT9A 3NDEA 3VOZA 1YLTA 2JCHA 2HDQA 4E3OA 3TOIA 2XK1A 3N4IA 4GN2A 4GNUA 1LI0A 3MFDA 3Q07A 4OPZA 3GR2A 1I2WA 1FR6A 2HDSA 3PBNA 2XQZA 1KE3A 4P85A 1VQQA 3JYIA 3QNBA 3DWZA 4LENA 3G30A 5AQAA 5GLCA 5KSCA 3UE3A 4QHCA 4N92A 1Y54A 5F83A 3IXDA 3O86A 4ZJ2A 3UNWA 2C5WB 3WRTA 3SH9A 4FD8A 4FH4A 3ISGA 5F1FA 5DTSA 1LHYA 3G2ZA 4LV1A 3W8KA 4JKTA 2XGNA 3PBQA 1ONGA 2ZM2A 1XPBA 5E43A 4K0WA 1EWZA 2Z2MB 1ESIA 1FSWA 1PZPA 4PM8A 3FKWA 3BFFA 2Z2LB 3A3IA 4WMCA 5I94A 4OP5A 2EFXA 4WZ5C 5FI6A 4MEZA 4BL3A 4LV0A 3HUNA 4BL2A 5GL9A 1MBLA 2G2UA 2Y2MA 3O3VA 5A91A 1NZUA 4UA9A 3MKEA 3GQZA 3ZG9B 4DDYA 1DJBA 1K4EA
chains in the Genus database with same CATH superfamily
2VGLM 1ONHA 3U4LP 2WKRA 1MPLA 2JN7A 1MKIA 4OPYA 2X01A 3FWLA 5EVIA 5FQQA 3HLWA 4QWOA 2PR5A 3UMDA 5HWTA 1ACFA 3SS3A 2D01A 5EVEA 4EQIA 4OVDA 1OT6A 3MQOA 1SKOB 3W4OA 3NOTC 2HGVA 3A0SA 3KYEA 1E3UD 1U60A 2INWA 1Z6FA 4FCFA 4NXGA 4BD0A 5EECA 4CLCA 2BTFP 2PBDP 2XEPA 3FYZA 4EBLA 3C5AA 1P9RA 4GDNA 3UE6A 2HF6A 3IF6A 3TSGA 2OWJA 2V2FF 4PM5A 3EWKA 4S2PA 3P7NA 3UPOA 5CECA 2EA9A 2XSSA 4P6BA 3B33A 3BLSA 4LCMA 3NBLA 5FAPA 2W0NA 2ZQ7A 2X71A 3FZCA 1JWVA 3ITAA 4KUOA 2ZLYA 3UY6A 3NULA 1UGUA 1YLJA 3S4XA 2FFFB 2RCXA 2K7SA 2JE5A 3PR6A 3C38A 1SKOA 2P7JA 2OOLA 3MF0A 5DJUA 1K54C 2XR0A 2ZMVA 4E3NA 1YQSA 4KZBA 3P98A 3UPPA 4Y2FA 2HP5A 2JKRM 3PBOA 3GV9A 1KVLA 1BZAA 3GMWA 2DRWA 3IQAA 2EX2A 3HUOA 4CJNA 3IX8A 2O9CA 1H8YA 5L09A 4OOLA 1MKMA 1KE4A 2FH5A 2WKIA 4XT2A 2WKHA 3N8LA 3CLOA 4DE0A 3SW1A 4G3WA 1G6AA 3S1YA 5EUAA 1XJ4A 3S7PA 4GJ4A 3IWQA 3RH8B 1IYPA 1L3LA 4DF6A 3LIDA 1E4DA 3KYZA 3G2YA 3IXGA 4I3AA 2DMWA 5EPHA 4OLGA 2H0YA 1EI5A 1RGYA 2QHKA 2NUPC 2O0YA 2FFYA 3E98A 4L9FA 1CEFA 1W8YA 2HDUA 2R9XA 4G3KA 2DNSA 4GD8A 2ZOIA 3K3CA 5J8XA 3Q1FA 3EEAA 1JNUA 2V1BA 4PM9A 3H82A 1T1BA 3N7WA 3VP4A 3EGXC 4HY8A 1GHMA 2ZM0A 3LY3A 3H7WB 1MWRA 4XUXA 3MZDA 3PYPA 4WM9A 4OQ0A 4U3TA 3ZVTA 1Y4OA 4E04A 1P0ZA 3FG8A 3CI6A 3MKFA 1XGIA 1N9OA 3N8SA 2Z6CA 1MWUA 4G3VA 5AQ7A 3EOIA 4I5SA 5CERA 4PM7A 3ZGAB 3OC2A 3LR3A 4EETB 1P9WA 1LL9A 1VM1A 3F1PB 4GHIA 1TS7A 4QY5A 1D06A 3MXRA 4RX2A 5FI2A 3PXPA 3F1PA 3IH9A 4KZ5A 2HJ9C 3IF6B 2M1CA 5EM0A 4MLLA 3ZNTA 3V67A 5U47A 5FQMA 4PAUA 5HAIA 2ZD8A 4Y3IA 3HLGA 3BM6A 4B93A 1LT0A 1G68A 1ZC2A 1XJ6A 4I3JA 4H6JA 2XA7M 3DTKA 2WZZA 3Q81A 3UB9A 1D1JA 3GSGA 3HBRA 1XP4A 3BQ8A 2VLGA 4JLFA 3T4OA 1YMXA 1SZVA 3CG5A 1FIKA 3W2ZA 2OSUA 5EVIB 1ERQA 4IJGA 1PWDA 4QJGA 1OTBA 1YLPA 4YWZA 3QP5A 4WZ4A 2JKFA 3VFFA 1A0KA 4EXOA 4E3IA 3PAGA 4KQQA 3PHYA 1PI5A 3NOUC 3V5MA 1ODVA 4E6XA 5KSHA 5DTTA 2O9AA 3LYXA 3WWXA 4WBGA 3U2AA 3ZQ5A 4R3BA 3V3RA 1BSGA 1VHMA 1LSXA 4HBTA 1ERMA 3LIAA 2O9BA 3SH7A 4QU3A 3TE8A 4HEFA 4KQRA 2W1RA 3P01A 1L0GA 4MCWA 2BG1A 3QP8A 4C3QA 5AVFA 2PT7A 1S0WA 3T4JA 2EWWA 4HH3A 3DTMA 2UWXA 1G5UA 4JF6A 2J80A 1PW8A 2H0TA 5F69A 1DJAA 2L0WA 4WLAA 1K6SA 2J3TD 3BY9A 1RGZA 4LV3A 3EGDC 4ZJ1A 4Y0OA 3UPNA 3LO7A 2OLVA 3H7WA 4GOGA 1PFLA 5CGWA 4GKUA 4LRXC 4Z9QA 1GHPA 3H82B 5FSRA 2P9VA 5HL1A 4JF4A 4QPRA 1C3BA 1PZOA 5GLBA 4JXVA 4KZAA 3ZG7B 1PNEA 3IT9A 3NDEA 4E3OA 3N4IA 4GNUA 1LI0A 3MFDA 4GCZA 1UWPX 3DWZA 4BBVA 3IS2B 3IXDA 4HP9A 3O86A 3UNWA 4LGWA 2C5WB 3WRTA 4B9OA 5KIZA 5DTSA 3W8KA 4JKTA 5E43A 4K0WA 4PM8A 3LIBA 3B47A 3BFFA 3A3IA 4OP5A 3O3VA 5A91A 3GQZA 1F9IA 2G7UA 1S4SA 4KZ9A 1YSQA 4DMZA 4LCLA 1VB6A 1GSVA 1NYYA 4II7A 4DXBA 2XH9A 4Z1WA 3A3EA 4R70A 4DJ2A 2Y2PA 1KVMA 3DBAA 1FR1A 2BLSA 5GLAA 2VV8A 4I38A 2WAEA 4P6ZM 3VSLA 2O99A 3UB6A 3OLOA 2QMIA 2KX6A 4JGPA 1W8QA 5CRFA 5E2FA 4U0XA 2JKRI 1LL8A 3I7JA 3A0RA 1HVBA 2W1TA 5DJTA 1GSWA 1ZG6A 1FOFA 3QP4A 3HLBA 3HLDA 4BBTA 2HZ5A 3SZTA 4C75A 4BD1A 2P9VB 4DKIA 5DF7A 5DVAA 3ZHHA 1ZG4A 4AFIA 3D9YA 1YSPA 5G18A 2HP9A 3B42A 5AQBA 1JVJA 2L1MA 3V39A 3MBZA 5GLDA 3T1RA 1YT4A 4ME4A 1OJ5A 1O7EA 2BASA 1T1CA 1KDSA 2PU2A 1OTIA 2B95A 2JBFA 4UHUA 2WKEA 2OAP1 1PWCA 4PKYA 3HLFA 5CEDA 1L2SA 5F68A 3FKVA 3OBFA 1IKIA 3F1NA 5DKKA 1MWSA 2X02A 4B4ZA 4ZJ3A 4MNRA 4IEDA 4ESPA 4EBPA 2OV5A 1W79A 4KG2A 1IYSA 5LBRA 2GX5A 4UAAA 5F82A 4FH2A 5JYPA 3KSGA 4QY6A 2ZL1A 2PHYA 3F1OA 5GHYA 4ETXA 4K0XA 2M7UA 3VE4A 1MXOA 2EXAA 2XD5A 4PKYG 4KG6A 1RP5A 3ZDJA 4MN7A 5CX7A 5HDSA 1NY0A 1KGEA 1ES2A 1H3QA 4LV2A 1IEMA 1CEGA 4L0LA 3VP2A 2EFUA 4N1XA 2QZ6A 4WZ5A 3KSFA 3OPPA 3VMAA 2Q9NA 4E3KA 4OP8A 5EVIC 2P08A 1DY6A 1V9YA 3LR4A 1GA9A 4GS9A 4Y0TA 4Q0HA 2A49A 3VP1A 3UDIA 3Q7VA 3UMEA 4FTXA 2PRFA 1MC0A 2Y91A 2VX8A 2V8CA 1WYCA 4NKPA 1CF0A 3WS0A 3AGDA 3L9KA 1K55C 4R23A 1E25A 5K5BA 4NXEA 3ITBA 2PYPA 2D02A 2QJ5A 4S2JA 3G32A 4IUKA 2I9VA 1AWIA 2Y79A 1K54A 3VFHA 1TVFA 5FEGA 4BWIA 5DKLA 4L9GA 3DWKA 4GHIB 1LLBA 4F3LB 4HBUA 4HP4A 3UN7A 3IXBA 4WF0A 4CLCC 3PBSA 3T1XA 3OOVA 1GSXA 2WADA 3VP0A 2H28A 2ZC4B 4OPRA 3GTCA 3LI9A 1K56D 2JKTI 4RYEA 3OCLA 5E2EA 3ZCZA 1ZKJA 1OT9A 1LSVA 4EW7A 2ZOHA 3CITA 4FUWA 1WA9A 3BW6A 1MZUA 5FQJA 2WUQA 5EFWA 1OTAA 5HFOA 3PTEA 3S22A 2HP6A 1Z09A 5J7EA 1SHVA 3MS6A 3MR0A 3O5YA 2QWSA 4LRYC 3NC8A 1T19A 3TJZC 4GB7A 1IKGA 1T18A 1CJFA 3K3DA 3M6HA 2WGWB 4IBRA 2A24B 2PD7A 2QPNA 1BLCA 3T12B 2Y59A 3MQQA 2V0UA 5HWVA 3BECA 3BEBA 4O7DA 1DRMA 5IU1A 1XA7A 1PYYA 5F1GA 4IBXA 3CPTA 4IUHA 1K38A 3IF5A 1GA0A 1YAXA 2YKFA 5AQ9A 5L10A 1IYQA 3UE1A 1SDEA 1CK3A 3NECA 2KOIA 2NUTC 5M19A 4Y13A 5J3WA 5CHMA 4GZBA 4DDSA 2B5RA 3V50A 3HREA 4U0TA 5DFXA 4OLDA 4ZAMA 3E2KA 1VEUA 3ZFZA 1TS6A 3LI8A 1VETA 1LL5A 2ZQCA 4CLCE 4EU0A 3JVVA 3UB8A 5EOOA 5G4ZA 1H8ZA 4P6ZS 1S6RA 3IWIA 4S2IA 4R6LA 2YKHA 4Q8IA 3JPUA 1XFQA 4YFMA 1L0FA 4K91A 2Y2KA 4WUJA 3MSHA 3OCNA 4ARZA 3CAXA 3OZHA 2VGKA 5TBMB 3NDGA 5HWWA 1K56A 3D4FA 2WK0A 1TEMA 1M6KA 1L0DA 3RJUA 4JGQA 3VP3A 4JXSA 4PHTA 5F6AA 1YLTA 3TOIA 2XA7S 2XK1A 3Q07A 4OPZA 3GR2A 4EEPA 1I2WA 1N9NA 1FR6A 3E4PA 2XQZA 1VQQA 5GLCA 5KSCA 3UE3A 4ZJ2A 3SH9A 2PAVP 3UB5P 5HPIA 1ONGA 3LIEA 2W3GA 1EWZA 2Z2MB 1PZPA 5I94A 5HPFA 2V9AA 5HZHA 4Y5FA 4MEZA 3HUNA 2Y2MA 1J3WA 1DJBA 1K4EA 5FI7A 3C7UA 4Y17A 1XA1A 4E3JA 1NXYA 5IT5A 1STZA 3T4QA 1LI9A 1NLYA 3NY4A 2ZMFA 3MZFA 5D3OA 1BTLA 2XD1A 4IVKA 3ZNYA 3M6BA 1S67L 1SDNA 3H9WA 4BENA 2Y2IA 2PBYA 4HESA 1PW1A 2GNXA 4IHQA 3IH8A 3TRCA 2V20A 1F2KA 3C8CA 2VV7A 5HD3A 3IX4A 1FQGA 3PBTA 1HTZA 3FC7A 4HNBA 4H8RA 4RQ9A 1S1ZA 4UA7A 4M3KA 4F94A 3G6OA 4DN0A 3LGOA 3C30A 4UQIM 2P04A 4EESA 2E8JA 3ULFA 2J3TC 3VOYA 4BLMA 5C5KA 5HD5A 5FQKA 1CI9A 3RTYA 5KZHA 4OOMA 2V1AA 3T4LA 4DXCA 2XLNA 3G4PA 4YOFA 2W3EA 2ZJ9A 1G28A 2A2LA 1KGFA 1DP9A 4DE1A 1W63M 2LB5A 2HV1A 3QHYA 2E8IA 1VETB 3G34A 4BJPA 4BQMA 3G35A 1RCJA 2W27A 4NXFA 1P97A 3A3DA 1LSWA 4LPZA 3B3XA 5BOHA 5EOEA 3OPLA 1O07A 3M2KA 2Q9MA 4HOIA 2Y2GA 2HDRA 4EUZA 3BFDA 1KGGA 1YLYA 2W3DA 1YKDA 3EEHA 3NJAA 1GHIA 3BJNA 1QMFA 3T50A 4HIAA 4QB8A 5G4YA 4R0QA 4BMWA 4GDBA 2ZQAA 2Y2NA 1W5DA 2EX6A 4HQAA 2Y2QA 5GHZA 2ACGA 5HAPA 3BQAA 2B02A 2K2NA 4Y7PA 1GCEA 2WKQA 4O0PA 4KG5A 5A93A 3IBJA 4CPKA 3RXXA 3Q7ZA 2Y2JA 4E3LA 1BYWA 4NEED 2ZC7A 3BY8A 1OTEA 2R9WA 4MN6A 2L4RA 3MJQA 3LUQA 4KZ8A 1PWGA 4Y0UA 2EXBA 4KQDA 3GRJA 4Q0IA 2IWBA 1S1YA 3Q82A 5MC7A 4NK3A 4KZ4A 2WZXA 1VEUB 5L07A 4GS9B 2VZWA 4L9EA 3BFEA 4OPQA 3DTEA 3A0VA 4N9LA 4RA7A 3R4KA 5EVLA 4EERA 1W63Q 4S2MA 4JXGA 5FQIA 1W7FA 4EV4A 4YINA 4JXWA 5TR7A 1ESUA 1K0KA 4NXBA 3HLCA 4KUKA 2LB9A 2CC1A 1V9ZA 4R3JA 1I2SA 3CUEA 5M1AA 5AJGA 1EROA 2A24A 3C4OA 4MBFA 3FV7A 2RL3A 4JF5A 3S7QA 2V1ZA 1ES5A 5FA7A 3R7WB 1OTDA 2WAFA 3ZG8B 3HCYA 4X68A 2V0WA 5FQ9A 5FAQA 5HW3A 3DAVA 4O8GA 1OJGA 2PD8A 2Y8HA 3GVBA 3UDFA 2Y55A 1DP6A 1HLUP 3E2LA 1AXBA 3ZYTA 4HHDA 3VSKA 2V8FA 3HJKA 3RXWA 3UO9A 4KQOA 1IELA 1DP8A 5HSQA 3IX3A 2JKGA 3IWOA 2ZQ8A 1MWTA 4R4RA 1NRFA 2WGWA 3N6IA 3K2NA 1SCWA 5CTMA 4ETZA 5CEBA 2H5SA 3SS5A 4I39A 4LRZE 2J7VA 4KZ3A 4GD6A 1IOUA 1TF1A 3QNCA 4KZ6A 4XUZA 3IF6C 2XROA 4KZ7A 1YMSA 5FDHA 3CMZA 3LFVA 4JBFA 4N9KA 5TBMA 1JWPA 5L8MA 5I5LA 4EEUA 4B4XA 3C7VA 3QP2A 1Y28A 4OH0A 3TW8A 3MZEA 3O87A 4JGRA 3MXQA 3SH8A 4DE2A 4WEJA 3T4KA 2Z6DA 3VV4A 1XXMA 4CQHA 4MBKA 2W3FA 1EW0A 3CUEC 1FSYA 3TG9A 5FEFA 3WS4A 4IVIA 2JKTM 4DE3A 5L2FA 2OWHA 2AVXA 4OQHA 5A8BA 4R3AA 4KENB 2FZ0A 3VOZA 2JCHA 2PR6A 2HDQA 3KO6A 4GN2A 3KSHA 3T1SA 2VGLS 3C2WA 1XFNA 2HDSA 1KE3A 4P85A 3JVUA 4X1MA 3QNBA 3G30A 5AQAA 2UV0E 1H8MA 1XJ2A 3ISGA 5F1FA 3QP1A 3G2ZA 3PBQA 1XPBA 2IA2A 1ESIA 1FSWA 3FKWA 2EFXA 5FI6A 4LV0A 5GL9A 1MBLA 2G2UA 1NZUA 4UA9A 1N9LA 3LICA 3MKEA 3ZG9B 5EE8A 3HUMA 2J9OA 4OONA 5FAOA 3HLEA 4P0MA 4XT2B 1NZOA 2HJEA 4E6WA 5FDSA 5HX9A 3IHAA 5DF9A 1TS8A 4HJ6A 3R7WA 4BBUA 2PU4A 5EM1A 1XJ3A 3OPHA 4ARZB 4OOYA 3LIFA 4JGOA 4RX3A 3W4QA 3C4PA 2VEAA 2Y2LA 1N4OA 1FILA 1IFQA 1X0OA 4UQIS 2XFSA 3LR5A 2Y2HA 4MDZA 4NETA 1OMEA 4Y15A 4S2NC 3IS2A 3W4PA 4XXRA 3LR0A 4ZTKA 4ZRRA 2ZC3B 1Q2PA 3BYDA 5E2HA 3D3OA 1BUEA 3WS5A 3O88A 4OQIA 4JPMA 1XGJA 3CWFA 3KSIA 5FASA 1PI4A 4PMAA 4K08A 1FCNA 4S2LA 3LEZA 3S7NA 3FPWA 3IXHA 5KMWA 1TS0A 4HJ4A 2WYXA 2W1TB 4R4SA 4ID4A 1S66L 1BLSA 4OQGA 3CHWP 2J8YA 2EX8A 4B88A 3IBRA 1CI8A 4GLQA 4FSFA 2QJ7A 3WS2A 1YM1A 3E4QA 2J9PA 5FATA 5FL3A 3UE0A 2H10A 4C6YA 4X69A 2I72A 4MMNA 2VGJA 1ES3A 1SKFA 5M18A 5IS1A 3HJIA 4MBHA 4X53A 4MN5A 2ZC5B 3CPTB 5TJJA 4X6TA 1WE4A 2PYRA 3LY4A 4YNRA 1QMEA 5EV0A 5CHUA 3KYQA 1XX2A 2IWCA 2VK3A 5HL6A 2OAQ1 2G2WA 3NOPC 2MJ6A 5AVEA 3AGFA 1YLWA 3IHBA 4X1LA 2XDMA 2K31A 2ZL1B 4UEYA 2XF3A 1PIOA 2ZC6B 4ZDXA 2M7VA 1JTDA 1OPXA 4ZBEA 3PBRA 3BLMA 5JYOA 2WGVA 5E2GA 3HL9A 4P87A 3QP6A 2Q0OA 1N9BA 1F98A 3E0YA 4LFUA 4WEKA 3LEQA 4WELA 1HD8A 5IHVA 2XFTA 3UDXA 3KX0X 3D72A 4X25A 4NG2A 2ZM8A 2WKPA 2C6WB 2WGIA 1S4RA 2QYBA 4DRTA 1ALQA 2GZAA 3T4TA 2P74A 1Q2QA 3EQVA 4H6JB 2ZMAA 1HZOA 3A3FA 1JTGA 3OPRA 1DJCA 2JC7A 1TD5A 2ZQ9A 1F5MA 5CHJA 4S2NA 4CLCD 4HJ3A 1NYMA 4S2OA 3AGEA 4QD4A 5DFYA 4F3LA 5A90A 3LCEA 3S7OA 3MXSA 5HDDA 5A92A 3NI9A 4X56A 3A3JA 3SS4A 2B18A 3MFXA 4HH2A 1NRJA 1WYBA 5HDCA 4PPRA 5TFQA 3GECA 4D2OA 4EBNA 1K57C 2EX9A 4OKPA 2Y4AA 1KOUA 3BFGA 2QKPA 2CMNA 4CLCB 2JHEA 1ZTUA 5CGXA 4S2KA 3MMHA 4HI4A 3PAEA 3P09A 3BFCA 3Q7VB 4GW9A 1H5XA 2KDKA 3CJMA 3EQUA 1D7EA 4R38A 3HVFA 1K57A 3BRMA 2W3HA 1BULA 1YLZA 1M40A 2DCFA 3ICYA 3N8RA 2GDNA 5J4EA 4WMCD 1KE0A 2OLUA 4RVAA 2PDRA 3T1QB 1TDLA 3V3SA 1BLPA 1KDWA 4FOFA 2J3WA 5GHXA 2KLIA 5DTKA 3WS1A 3CZDA 1H0MA 5EVID 1MY8A 1K55A 5HARA 3NIAA 5CGSA 1UWNX 1NJ4A 4X55A 1BT5A 5CTNA 1XKZA 2ZBBA 4E3MA 4DJ3A 5DF8A 4LLOB 1G6OA 1FCMA 1NWZA 3M2JA 1TDGA 1J9MA 1NLZA 4WYYA 4EWFA 1E3UA 3T4SA 2ZQDA 1K6RA 1K25A 3WRZA 1T1AA 3F1NB 2HPBA 3FPVA 3ZG0A 2R78A 1L0EA 3VE3A 2VA0A 1I5QA 4EQ1A 5HAQA 1K4FA 3DTIA 1JWZA 5CXWA 3DW0A 3ZG5A 4I3IA 2VV6A 2Y2OA 3SOIA 3GDIA 5TGFA 4PM6A 3E4OA 4O01A 3G31A 3NCKA 5F5YA 1ES4A 1ZHHB 1BLHA 3NHQA 4N1HA 1CQAA 4UA6A 4A5RA 4WN5A 1IYOA 2A3UA 3ZVWA 1FCOA 4Q0JA 4R1GA 2XRNA 2IWDA 1YPRA 4D60A 1PRQA 3MQ0A 4EUVA 2VJWA 3PBNA 2EWVA 3BWLA 3JYIA 4LENA 4QHCA 4N92A 1Y54A 5F83A 4FD8A 4FH4A 1LHYA 4LV1A 2XGNA 2ZM2A 3UB7A 4WL9A 2VKSA 3F1OB 4WMCA 3RFBA 2Z2LB 4WZ5C 3L7HA 3VOLA 4BL3A 4M4XA 4BL2A 2GJ3A 4DDYA
chains in the Genus database with same CATH topology
5EE8A 5FI7A 3HUMA 2J9OA 3C7UA 4KZ9A 4OONA 1XA1A 5FAOA 1ONHA 4LCLA 3HLEA 4E3JA 1NXYA 4P0MA 1MPLA 1MKIA 4OPYA 1LI9A 1NZOA 2X01A 1NYYA 4E6WA 4DXBA 2XH9A 3NY4A 3FWLA 5D3OA 3MZFA 5HX9A 3IHAA 1BTLA 2XD1A 3A3EA 4IVKA 5DF9A 5EVIA 3ZNYA 3M6BA 5FQQA 3HLWA 1SDNA 2PU4A 2Y2PA 1KVMA 4BENA 3SS3A 1FR1A 2Y2IA 2BLSA 3OPHA 4OVDA 4EQIA 4OOYA 2PBYA 4HESA 5GLAA 1PW1A 3IH8A 4RX3A 2WAEA 3W4OA 3W4QA 3C4PA 2Y2LA 2V20A 1N4OA 1E3UD 3VSLA 1U60A 2XFSA 2Y2HA 1FQGA 2QMIA 4NETA 1Z6FA 4FCFA 3PBTA 1OMEA 1W8QA 4BD0A 5CRFA 5E2FA 4S2NC 4U0XA 5EECA 1HTZA 3W4PA 4XXRA 3I7JA 4H8RA 4ZTKA 2XEPA 3FYZA 4EBLA 2ZC3B 1Q2PA 3BYDA 3C5AA 5E2HA 1HVBA 4GDNA 4UA7A 4M3KA 4F94A 1ZG6A 1BUEA 3IF6A 1FOFA 3TSGA 3WS5A 3O88A 2V2FF 4PM5A 3HLBA 3HLDA 4OQIA 4S2PA 4JPMA 1XGJA 3UPOA 3VOYA 5CECA 4C75A 4BD1A 5FASA 4BLMA 2P9VB 1PI4A 4P6BA 4PMAA 4DKIA 5DF7A 1FCNA 4S2LA 3LEZA 5FQKA 3BLSA 4LCMA 3IXHA 1CI9A 5KMWA 5DVAA 2WYXA 5KZHA 3ZHHA 1ZG4A 3NBLA 4R4SA 5FAPA 4OOMA 2ZQ7A 4ID4A 2X71A 3FZCA 5G18A 1JWVA 1BLSA 2HP9A 4DXCA 3ITAA 4OQGA 2XLNA 5AQBA 1JVJA 2ZLYA 3V39A 3UY6A 2J8YA 3G4PA 3MBZA 5GLDA 2EX8A 1YT4A 1O7EA 1YLJA 4B88A 3S4XA 1KDSA 2ZJ9A 2FFFB 2PU2A 1CI8A 2RCXA 4FSFA 1KGFA 2JE5A 2JBFA 4UHUA 2WKEA 3WS2A 1PWCA 4DE1A 3HLFA 1K54C 1L2SA 2XR0A 3QHYA 1YM1A 5CEDA 3FKVA 2J9PA 4E3NA 2E8IA 1YQSA 4KZBA 5FATA 1IKIA 3P98A 3G34A 3UPPA 2HP5A 4BJPA 3PBOA 3GV9A 1KVLA 1MWSA 2X02A 1BZAA 3UE0A 2H10A 4B4ZA 4C6YA 4X69A 4BQMA 3GMWA 2DRWA 4ZJ3A 3IQAA 2EX2A 3G35A 3HUOA 4CJNA 1RCJA 2I72A 2VGJA 1H8YA 4MNRA 4IEDA 1ES3A 1SKFA 4EBPA 3A3DA 5M18A 4OOLA 1KE4A 3B3XA 4MBHA 2WKIA 5BOHA 5EOEA 2OV5A 3OPLA 1O07A 1W79A 2WKHA 2Q9MA 1IYSA 2ZC5B 3M2KA 3N8LA 2Y2GA 4KG2A 2HDRA 4X53A 4DE0A 4EUZA 3BFDA 1KGGA 4X6TA 4UAAA 1WE4A 1YLYA 5F82A 4FH2A 1G6AA 3S1YA 5EUAA 5JYPA 3LY4A 1QMEA 4QY6A 5CHUA 1GHIA 1QMFA 5GHYA 1XX2A 3IWQA 4K0XA 1IYPA 2IWCA 4QB8A 1MXOA 4DF6A 1E4DA 2EXAA 2XD5A 2G2WA 4KG6A 1RP5A 3ZDJA 4R0QA 3G2YA 3IXGA 4GDBA 2ZQAA 3AGFA 1YLWA 2Y2NA 3IHBA 1NY0A 1W5DA 2EX6A 4OLGA 2H0YA 5EPHA 1KGEA 1EI5A 1RGYA 1ES2A 4LV2A 2XDMA 2FFYA 1IEMA 1CEGA 2Y2QA 2XF3A 5GHZA 4L0LA 3VP2A 2EFUA 1PIOA 2QZ6A 4N1XA 2ZC6B 4ZDXA 1CEFA 1JTDA 4WZ5A 5HAPA 1W8YA 2HDUA 2R9XA 4ZBEA 3PBRA 4Y7PA 3BLMA 1GCEA 5JYOA 2WGVA 2DNSA 5E2GA 3OPPA 3VMAA 2Q9NA 3HL9A 4P87A 4E3KA 4GD8A 4KG5A 4OP8A 5EVIC 5J8XA 5A93A 1N9BA 3Q1FA 4CPKA 1DY6A 3RXXA 1GA9A 3Q7ZA 2Y2JA 4PM9A 4E3LA 4WEKA 4Y0TA 4WELA 2A49A 1HD8A 3N7WA 2ZC7A 5IHVA 3VP4A 3VP1A 2XFTA 3UDXA 3UDIA 2R9WA 3Q7VA 1GHMA 2ZM0A 2ZM8A 3LY3A 2WGIA 2C6WB 1MWRA 4XUXA 4DRTA 3MZDA 1ALQA 4WM9A 4OQ0A 2P74A 4KZ8A 4U3TA 1PWGA 2Y91A 1Q2QA 3ZVTA 3EQVA 4Y0UA 2ZMAA 1HZOA 1WYCA 2EXBA 3A3FA 3GRJA 1JTGA 3WS0A 3OPRA 3AGDA 1DJCA 2JC7A 3MKFA 1XGIA 2ZQ9A 1K55C 3N8SA 2IWBA 4R23A 3Q82A 1E25A 5CHJA 1MWUA 5AQ7A 4S2NA 4NK3A 3ITBA 4KZ4A 4S2JA 2WZXA 1NYMA 5CERA 4S2OA 4PM7A 3G32A 3AGEA 3OC2A 3ZGAB 4QD4A 3BFEA 4OPQA 1K54A 5A90A 1LL9A 1VM1A 4N9LA 3VFHA 1TVFA 4RA7A 3LCEA 5EVLA 3DWKA 3MXSA 4S2MA 5A92A 4QY5A 3MXRA 4JXGA 1LLBA 5FQIA 3NI9A 1W7FA 4RX2A 4X56A 5FI2A 4YINA 3A3JA 4JXWA 5TR7A 4EV4A 3SS4A 4HBUA 1ESUA 3IH9A 4KZ5A 3UN7A 3IF6B 1WYBA 4PPRA 5TFQA 3HLCA 4MLLA 3IXBA 3ZNTA 4D2OA 2CC1A 4R3JA 4EBNA 5U47A 1K57C 3PBSA 5FQMA 2EX9A 4OKPA 2Y4AA 1I2SA 5M1AA 3BFGA 5HAIA 2WADA 1EROA 2ZD8A 3C4OA 3HLGA 3VP0A 4MBFA 3BM6A 5CGXA 3FV7A 4S2KA 1G68A 1ZC2A 2ZC4B 2RL3A 3GTCA 4JF5A 4OPRA 1K56D 4RYEA 3PAEA 3OCLA 3P09A 5E2EA 3ZCZA 3BFCA 2WZZA 1ZKJA 3Q81A 3GSGA 3HBRA 3Q7VB 1XP4A 1H5XA 4JLFA 1YMXA 2V1ZA 3CJMA 1ES5A 3CG5A 5FA7A 2OSUA 2WAFA 5EVIB 3EQUA 1ERQA 3ZG8B 4X68A 5FQ9A 5FAQA 5HW3A 5FQJA 3HVFA 1PWDA 2WUQA 1K57A 3BRMA 5HFOA 4QJGA 3GVBA 3PTEA 3UDFA 1YLPA 2Y55A 3S22A 3E2LA 2HP6A 1BULA 4WZ4A 3VFFA 1YLZA 1AXBA 1M40A 1SHVA 2DCFA 3N8RA 2GDNA 4E3IA 3VSKA 3RXWA 3PAGA 4KQQA 3NC8A 3UO9A 4KQOA 4GB7A 1IELA 1PI5A 4WMCD 1IKGA 3V5MA 1KE0A 4E6XA 2OLUA 4RVAA 5KSHA 5DTTA 3M6HA 3IWOA 3WWXA 2ZQ8A 1MWTA 2WGWB 4IBRA 4R4RA 4WBGA 4R3BA 1NRFA 3V3RA 1TDLA 2QPNA 1BSGA 1BLCA 4HBTA 2Y59A 2WGWA 3V3SA 1ERMA 1BLPA 1KDWA 3N6IA 1SCWA 5CTMA 3BECA 5CEBA 2H5SA 3BEBA 4O7DA 5GHXA 3SH7A 3SS5A 4QU3A 5DTKA 4HEFA 3WS1A 4KQRA 3CZDA 1XA7A 1PYYA 5EVID 1MY8A 5F1GA 4IBXA 2J7VA 1K55A 5HARA 4KZ3A 1L0GA 3NIAA 5CGSA 4GD6A 1K38A 1NJ4A 2BG1A 3IF5A 4X55A 1BT5A 1GA0A 5CTNA 5AQ9A 3QNCA 1IYQA 1XKZA 4KZ6A 4XUZA 3IF6C 4E3MA 5DF8A 4KZ7A 3UE1A 1SDEA 1CK3A 1FCMA 3M2JA 1TDGA 1J9MA 1YMSA 5FDHA 5M19A 4C3QA 4WYYA 4EWFA 1E3UA 3CMZA 5CHMA 4GZBA 4JBFA 4DDSA 2ZQDA 2B5RA 1K6RA 1K25A 1S0WA 4N9KA 3WRZA 3V50A 2HPBA 3HREA 1JWPA 4U0TA 4OLDA 4ZAMA 3E2KA 3ZG0A 3DTMA 3ZFZA 2UWXA 4B4XA 1L0EA 3C7VA 4JF6A 1LL5A 1I5QA 2ZQCA 5HAQA 1K4FA 1PW8A 2H0TA 1DJAA 1JWZA 5EOOA 1K6SA 4OH0A 5CXWA 1RGZA 3DW0A 1H8ZA 4LV3A 3ZG5A 3MZEA 4ZJ1A 3O87A 1S6RA 2Y2OA 3IWIA 4S2IA 4Y0OA 3SH8A 3SOIA 4DE2A 4Q8IA 4WEJA 4YFMA 1L0FA 5TGFA 3UPNA 1XXMA 4PM6A 4K91A 3LO7A 2Y2KA 2OLVA 4GOGA 4MBKA 3OCNA 5CGWA 4GKUA 3G31A 3NCKA 3OZHA 1FSYA 1ES4A 2VGKA 4Z9QA 1BLHA 3NDGA 4N1HA 3TG9A 1GHPA 5FSRA 4UA6A 4A5RA 2P9VA 3WS4A 5HL1A 4JF4A 1IYOA 2A3UA 1K56A 4IVIA 1C3BA 3ZVWA 1PZOA 3D4FA 4DE3A 2WK0A 5L2FA 1TEMA 1FCOA 4OQHA 5GLBA 1M6KA 1L0DA 4JXVA 4R1GA 3RJUA 4KZAA 3ZG7B 4KENB 2IWDA 4JXSA 3VP3A 3IT9A 3NDEA 3VOZA 1YLTA 2JCHA 2HDQA 4E3OA 3TOIA 2XK1A 3N4IA 4GN2A 4GNUA 1LI0A 3MFDA 3Q07A 4OPZA 3GR2A 1I2WA 1FR6A 2HDSA 3PBNA 2XQZA 1KE3A 4P85A 1VQQA 3JYIA 3QNBA 3DWZA 4LENA 3G30A 5AQAA 5GLCA 5KSCA 3UE3A 4QHCA 4N92A 1Y54A 5F83A 3IXDA 3O86A 4ZJ2A 3UNWA 2C5WB 3WRTA 3SH9A 4FD8A 4FH4A 3ISGA 5F1FA 5DTSA 1LHYA 3G2ZA 4LV1A 3W8KA 4JKTA 2XGNA 3PBQA 1ONGA 2ZM2A 1XPBA 5E43A 4K0WA 1EWZA 2Z2MB 1ESIA 1FSWA 1PZPA 4PM8A 3FKWA 3BFFA 2Z2LB 3A3IA 4WMCA 5I94A 4OP5A 2EFXA 4WZ5C 5FI6A 4MEZA 4BL3A 4LV0A 3HUNA 4BL2A 5GL9A 1MBLA 2G2UA 2Y2MA 3O3VA 5A91A 1NZUA 4UA9A 3MKEA 3GQZA 3ZG9B 4DDYA 1DJBA 1K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE8 A;  5FI7 A;  3HUM A;  2J9O A;  3C7U A;  4KZ9 A;  4OON A;  1XA1 A;  5FAO A;  1ONH A;  4LCL A;  3HLE A;  4E3J A;  1NXY A;  4P0M A;  1MPL A;  1MKI A;  4OPY A;  1LI9 A;  1NZO A;  2X01 A;  1NYY A;  4E6W A;  4DXB A;  2XH9 A;  3NY4 A;  3FWL A;  5D3O A;  3MZF A;  5HX9 A;  3IHA A;  1BTL A;  2XD1 A;  3A3E A;  4IVK A;  5DF9 A;  5EVI A;  3ZNY A;  3M6B A;  5FQQ A;  3HLW A;  1SDN A;  2PU4 A;  2Y2P A;  1KVM A;  4BEN A;  3SS3 A;  1FR1 A;  2Y2I A;  2BLS A;  3OPH A;  4OVD A;  4EQI A;  4OOY A;  2PBY A;  4HES A;  5GLA A;  1PW1 A;  3IH8 A;  4RX3 A;  2WAE A;  3W4O A;  3W4Q A;  3C4P A;  2Y2L A;  2V20 A;  1N4O A;  1E3U D;  3VSL A;  1U60 A;  2XFS A;  2Y2H A;  1FQG A;  2QMI A;  4NET A;  1Z6F A;  4FCF A;  3PBT A;  1OME A;  1W8Q A;  4BD0 A;  5CRF A;  5E2F A;  4S2N C;  4U0X A;  5EEC A;  1HTZ A;  3W4P A;  4XXR A;  3I7J A;  4H8R A;  4ZTK A;  2XEP A;  3FYZ A;  4EBL A;  2ZC3 B;  1Q2P A;  3BYD A;  3C5A A;  5E2H A;  1HVB A;  4GDN A;  4UA7 A;  4M3K A;  4F94 A;  1ZG6 A;  1BUE A;  3IF6 A;  1FOF A;  3TSG A;  3WS5 A;  3O88 A;  2V2F F;  4PM5 A;  3HLB A;  3HLD A;  4OQI A;  4S2P A;  4JPM A;  1XGJ A;  3UPO A;  3VOY A;  5CEC A;  4C75 A;  4BD1 A;  5FAS A;  4BLM A;  2P9V B;  1PI4 A;  4P6B A;  4PMA A;  4DKI A;  5DF7 A;  1FCN A;  4S2L A;  3LEZ A;  5FQK A;  3BLS A;  4LCM A;  3IXH A;  1CI9 A;  5KMW A;  5DVA A;  2WYX A;  5KZH A;  3ZHH A;  1ZG4 A;  3NBL A;  4R4S A;  5FAP A;  4OOM A;  2ZQ7 A;  4ID4 A;  2X71 A;  3FZC A;  5G18 A;  1JWV A;  1BLS A;  2HP9 A;  4DXC A;  3ITA A;  4OQG A;  2XLN A;  5AQB A;  1JVJ A;  2ZLY A;  3V39 A;  3UY6 A;  2J8Y A;  3G4P A;  3MBZ A;  5GLD A;  2EX8 A;  1YT4 A;  1O7E A;  1YLJ A;  4B88 A;  3S4X A;  1KDS A;  2ZJ9 A;  2FFF B;  2PU2 A;  1CI8 A;  2RCX A;  4FSF A;  1KGF A;  2JE5 A;  2JBF A;  4UHU A;  2WKE A;  3WS2 A;  1PWC A;  4DE1 A;  3HLF A;  1K54 C;  1L2S A;  2XR0 A;  3QHY A;  1YM1 A;  5CED A;  3FKV A;  2J9P A;  4E3N A;  2E8I A;  1YQS A;  4KZB A;  5FAT A;  1IKI A;  3P98 A;  3G34 A;  3UPP A;  2HP5 A;  4BJP A;  3PBO A;  3GV9 A;  1KVL A;  1MWS A;  2X02 A;  1BZA A;  3UE0 A;  2H10 A;  4B4Z A;  4C6Y A;  4X69 A;  4BQM A;  3GMW A;  2DRW A;  4ZJ3 A;  3IQA A;  2EX2 A;  3G35 A;  3HUO A;  4CJN A;  1RCJ A;  2I72 A;  2VGJ A;  1H8Y A;  4MNR A;  4IED A;  1ES3 A;  1SKF A;  4EBP A;  3A3D A;  5M18 A;  4OOL A;  1KE4 A;  3B3X A;  4MBH A;  2WKI A;  5BOH A;  5EOE A;  2OV5 A;  3OPL A;  1O07 A;  1W79 A;  2WKH A;  2Q9M A;  1IYS A;  2ZC5 B;  3M2K A;  3N8L A;  2Y2G A;  4KG2 A;  2HDR A;  4X53 A;  4DE0 A;  4EUZ A;  3BFD A;  1KGG A;  4X6T A;  4UAA A;  1WE4 A;  1YLY A;  5F82 A;  4FH2 A;  1G6A A;  3S1Y A;  5EUA A;  5JYP A;  3LY4 A;  1QME A;  4QY6 A;  5CHU A;  1GHI A;  1QMF A;  5GHY A;  1XX2 A;  3IWQ A;  4K0X A;  1IYP A;  2IWC A;  4QB8 A;  1MXO A;  4DF6 A;  1E4D A;  2EXA A;  2XD5 A;  2G2W A;  4KG6 A;  1RP5 A;  3ZDJ A;  4R0Q A;  3G2Y A;  3IXG A;  4GDB A;  2ZQA A;  3AGF A;  1YLW A;  2Y2N A;  3IHB A;  1NY0 A;  1W5D A;  2EX6 A;  4OLG A;  2H0Y A;  5EPH A;  1KGE A;  1EI5 A;  1RGY A;  1ES2 A;  4LV2 A;  2XDM A;  2FFY A;  1IEM A;  1CEG A;  2Y2Q A;  2XF3 A;  5GHZ A;  4L0L A;  3VP2 A;  2EFU A;  1PIO A;  2QZ6 A;  4N1X A;  2ZC6 B;  4ZDX A;  1CEF A;  1JTD A;  4WZ5 A;  5HAP A;  1W8Y A;  2HDU A;  2R9X A;  4ZBE A;  3PBR A;  4Y7P A;  3BLM A;  1GCE A;  5JYO A;  2WGV A;  2DNS A;  5E2G A;  3OPP A;  3VMA A;  2Q9N A;  3HL9 A;  4P87 A;  4E3K A;  4GD8 A;  4KG5 A;  4OP8 A;  5EVI C;  5J8X A;  5A93 A;  1N9B A;  3Q1F A;  4CPK A;  1DY6 A;  3RXX A;  1GA9 A;  3Q7Z A;  2Y2J A;  4PM9 A;  4E3L A;  4WEK A;  4Y0T A;  4WEL A;  2A49 A;  1HD8 A;  3N7W A;  2ZC7 A;  5IHV A;  3VP4 A;  3VP1 A;  2XFT A;  3UDX A;  3UDI A;  2R9W A;  3Q7V A;  1GHM A;  2ZM0 A;  2ZM8 A;  3LY3 A;  2WGI A;  2C6W B;  1MWR A;  4XUX A;  4DRT A;  3MZD A;  1ALQ A;  4WM9 A;  4OQ0 A;  2P74 A;  4KZ8 A;  4U3T A;  1PWG A;  2Y91 A;  1Q2Q A;  3ZVT A;  3EQV A;  4Y0U A;  2ZMA A;  1HZO A;  1WYC A;  2EXB A;  3A3F A;  3GRJ A;  1JTG A;  3WS0 A;  3OPR A;  3AGD A;  1DJC A;  2JC7 A;  3MKF A;  1XGI A;  2ZQ9 A;  1K55 C;  3N8S A;  2IWB A;  4R23 A;  3Q82 A;  1E25 A;  5CHJ A;  1MWU A;  5AQ7 A;  4S2N A;  4NK3 A;  3ITB A;  4KZ4 A;  4S2J A;  2WZX A;  1NYM A;  5CER A;  4S2O A;  4PM7 A;  3G32 A;  3AGE A;  3OC2 A;  3ZGA B;  4QD4 A;  3BFE A;  4OPQ A;  1K54 A;  5A90 A;  1LL9 A;  1VM1 A;  4N9L A;  3VFH A;  1TVF A;  4RA7 A;  3LCE A;  5EVL A;  3DWK A;  3MXS A;  4S2M A;  5A92 A;  4QY5 A;  3MXR A;  4JXG A;  1LLB A;  5FQI A;  3NI9 A;  1W7F A;  4RX2 A;  4X56 A;  5FI2 A;  4YIN A;  3A3J A;  4JXW A;  5TR7 A;  4EV4 A;  3SS4 A;  4HBU A;  1ESU A;  3IH9 A;  4KZ5 A;  3UN7 A;  3IF6 B;  1WYB A;  4PPR A;  5TFQ A;  3HLC A;  4MLL A;  3IXB A;  3ZNT A;  4D2O A;  2CC1 A;  4R3J A;  4EBN A;  5U47 A;  1K57 C;  3PBS A;  5FQM A;  2EX9 A;  4OKP A;  2Y4A A;  1I2S A;  5M1A A;  3BFG A;  5HAI A;  2WAD A;  1ERO A;  2ZD8 A;  3C4O A;  3HLG A;  3VP0 A;  4MBF A;  3BM6 A;  5CGX A;  3FV7 A;  4S2K A;  1G68 A;  1ZC2 A;  2ZC4 B;  2RL3 A;  3GTC A;  4JF5 A;  4OPR A;  1K56 D;  4RYE A;  3PAE A;  3OCL A;  3P09 A;  5E2E A;  3ZCZ A;  3BFC A;  2WZZ A;  1ZKJ A;  3Q81 A;  3GSG A;  3HBR A;  3Q7V B;  1XP4 A;  1H5X A;  4JLF A;  1YMX A;  2V1Z A;  3CJM A;  1ES5 A;  3CG5 A;  5FA7 A;  2OSU A;  2WAF A;  5EVI B;  3EQU A;  1ERQ A;  3ZG8 B;  4X68 A;  5FQ9 A;  5FAQ A;  5HW3 A;  5FQJ A;  3HVF A;  1PWD A;  2WUQ A;  1K57 A;  3BRM A;  5HFO A;  4QJG A;  3GVB A;  3PTE A;  3UDF A;  1YLP A;  2Y55 A;  3S22 A;  3E2L A;  2HP6 A;  1BUL A;  4WZ4 A;  3VFF A;  1YLZ A;  1AXB A;  1M40 A;  1SHV A;  2DCF A;  3N8R A;  2GDN A;  4E3I A;  3VSK A;  3RXW A;  3PAG A;  4KQQ A;  3NC8 A;  3UO9 A;  4KQO A;  4GB7 A;  1IEL A;  1PI5 A;  4WMC D;  1IKG A;  3V5M A;  1KE0 A;  4E6X A;  2OLU A;  4RVA A;  5KSH A;  5DTT A;  3M6H A;  3IWO A;  3WWX A;  2ZQ8 A;  1MWT A;  2WGW B;  4IBR A;  4R4R A;  4WBG A;  4R3B A;  1NRF A;  3V3R A;  1TDL A;  2QPN A;  1BSG A;  1BLC A;  4HBT A;  2Y59 A;  2WGW A;  3V3S A;  1ERM A;  1BLP A;  1KDW A;  3N6I A;  1SCW A;  5CTM A;  3BEC A;  5CEB A;  2H5S A;  3BEB A;  4O7D A;  5GHX A;  3SH7 A;  3SS5 A;  4QU3 A;  5DTK A;  4HEF A;  3WS1 A;  4KQR A;  3CZD A;  1XA7 A;  1PYY A;  5EVI D;  1MY8 A;  5F1G A;  4IBX A;  2J7V A;  1K55 A;  5HAR A;  4KZ3 A;  1L0G A;  3NIA A;  5CGS A;  4GD6 A;  1K38 A;  1NJ4 A;  2BG1 A;  3IF5 A;  4X55 A;  1BT5 A;  1GA0 A;  5CTN A;  5AQ9 A;  3QNC A;  1IYQ A;  1XKZ A;  4KZ6 A;  4XUZ A;  3IF6 C;  4E3M A;  5DF8 A;  4KZ7 A;  3UE1 A;  1SDE A;  1CK3 A;  1FCM A;  3M2J A;  1TDG A;  1J9M A;  1YMS A;  5FDH A;  5M19 A;  4C3Q A;  4WYY A;  4EWF A;  1E3U A;  3CMZ A;  5CHM A;  4GZB A;  4JBF A;  4DDS A;  2ZQD A;  2B5R A;  1K6R A;  1K25 A;  1S0W A;  4N9K A;  3WRZ A;  3V50 A;  2HPB A;  3HRE A;  1JWP A;  4U0T A;  4OLD A;  4ZAM A;  3E2K A;  3ZG0 A;  3DTM A;  3ZFZ A;  2UWX A;  4B4X A;  1L0E A;  3C7V A;  4JF6 A;  1LL5 A;  1I5Q A;  2ZQC A;  5HAQ A;  1K4F A;  1PW8 A;  2H0T A;  1DJA A;  1JWZ A;  5EOO A;  1K6S A;  4OH0 A;  5CXW A;  1RGZ A;  3DW0 A;  1H8Z A;  4LV3 A;  3ZG5 A;  3MZE A;  4ZJ1 A;  3O87 A;  1S6R A;  2Y2O A;  3IWI A;  4S2I A;  4Y0O A;  3SH8 A;  3SOI A;  4DE2 A;  4Q8I A;  4WEJ A;  4YFM A;  1L0F A;  5TGF A;  3UPN A;  1XXM A;  4PM6 A;  4K91 A;  3LO7 A;  2Y2K A;  2OLV A;  4GOG A;  4MBK A;  3OCN A;  5CGW A;  4GKU A;  3G31 A;  3NCK A;  3OZH A;  1FSY A;  1ES4 A;  2VGK A;  4Z9Q A;  1BLH A;  3NDG A;  4N1H A;  3TG9 A;  1GHP A;  5FSR A;  4UA6 A;  4A5R A;  2P9V A;  3WS4 A;  5HL1 A;  4JF4 A;  1IYO A;  2A3U A;  1K56 A;  4IVI A;  1C3B A;  3ZVW A;  1PZO A;  3D4F A;  4DE3 A;  2WK0 A;  5L2F A;  1TEM A;  1FCO A;  4OQH A;  5GLB A;  1M6K A;  1L0D A;  4JXV A;  4R1G A;  3RJU A;  4KZA A;  3ZG7 B;  4KEN B;  2IWD A;  4JXS A;  3VP3 A;  3IT9 A;  3NDE A;  3VOZ A;  1YLT A;  2JCH A;  2HDQ A;  4E3O A;  3TOI A;  2XK1 A;  3N4I A;  4GN2 A;  4GNU A;  1LI0 A;  3MFD A;  3Q07 A;  4OPZ A;  3GR2 A;  1I2W A;  1FR6 A;  2HDS A;  3PBN A;  2XQZ A;  1KE3 A;  4P85 A;  1VQQ A;  3JYI A;  3QNB A;  3DWZ A;  4LEN A;  3G30 A;  5AQA A;  5GLC A;  5KSC A;  3UE3 A;  4QHC A;  4N92 A;  1Y54 A;  5F83 A;  3IXD A;  3O86 A;  4ZJ2 A;  3UNW A;  2C5W B;  3WRT A;  3SH9 A;  4FD8 A;  4FH4 A;  3ISG A;  5F1F A;  5DTS A;  1LHY A;  3G2Z A;  4LV1 A;  3W8K A;  4JKT A;  2XGN A;  3PBQ A;  1ONG A;  2ZM2 A;  1XPB A;  5E43 A;  4K0W A;  1EWZ A;  2Z2M B;  1ESI A;  1FSW A;  1PZP A;  4PM8 A;  3FKW A;  3BFF A;  2Z2L B;  3A3I A;  4WMC A;  5I94 A;  4OP5 A;  2EFX A;  4WZ5 C;  5FI6 A;  4MEZ A;  4BL3 A;  4LV0 A;  3HUN A;  4BL2 A;  5GL9 A;  1MBL A;  2G2U A;  2Y2M A;  3O3V A;  5A91 A;  1NZU A;  4UA9 A;  3MKE A;  3GQZ A;  3ZG9 B;  4DDY A;  1DJB A;  1K4E A; 
#chains in the Genus database with same CATH topology
 2VGL M;  1ONH A;  3U4L P;  2WKR A;  1MPL A;  2JN7 A;  1MKI A;  4OPY A;  2X01 A;  3FWL A;  5EVI A;  5FQQ A;  3HLW A;  4QWO A;  2PR5 A;  3UMD A;  5HWT A;  1ACF A;  3SS3 A;  2D01 A;  5EVE A;  4EQI A;  4OVD A;  1OT6 A;  3MQO A;  1SKO B;  3W4O A;  3NOT C;  2HGV A;  3A0S A;  3KYE A;  1E3U D;  1U60 A;  2INW A;  1Z6F A;  4FCF A;  4NXG A;  4BD0 A;  5EEC A;  4CLC A;  2BTF P;  2PBD P;  2XEP A;  3FYZ A;  4EBL A;  3C5A A;  1P9R A;  4GDN A;  3UE6 A;  2HF6 A;  3IF6 A;  3TSG A;  2OWJ A;  2V2F F;  4PM5 A;  3EWK A;  4S2P A;  3P7N A;  3UPO A;  5CEC A;  2EA9 A;  2XSS A;  4P6B A;  3B33 A;  3BLS A;  4LCM A;  3NBL A;  5FAP A;  2W0N A;  2ZQ7 A;  2X71 A;  3FZC A;  1JWV A;  3ITA A;  4KUO A;  2ZLY A;  3UY6 A;  3NUL A;  1UGU A;  1YLJ A;  3S4X A;  2FFF B;  2RCX A;  2K7S A;  2JE5 A;  3PR6 A;  3C38 A;  1SKO A;  2P7J A;  2OOL A;  3MF0 A;  5DJU A;  1K54 C;  2XR0 A;  2ZMV A;  4E3N A;  1YQS A;  4KZB A;  3P98 A;  3UPP A;  4Y2F A;  2HP5 A;  2JKR M;  3PBO A;  3GV9 A;  1KVL A;  1BZA A;  3GMW A;  2DRW A;  3IQA A;  2EX2 A;  3HUO A;  4CJN A;  3IX8 A;  2O9C A;  1H8Y A;  5L09 A;  4OOL A;  1MKM A;  1KE4 A;  2FH5 A;  2WKI A;  4XT2 A;  2WKH A;  3N8L A;  3CLO A;  4DE0 A;  3SW1 A;  4G3W A;  1G6A A;  3S1Y A;  5EUA A;  1XJ4 A;  3S7P A;  4GJ4 A;  3IWQ A;  3RH8 B;  1IYP A;  1L3L A;  4DF6 A;  3LID A;  1E4D A;  3KYZ A;  3G2Y A;  3IXG A;  4I3A A;  2DMW A;  5EPH A;  4OLG A;  2H0Y A;  1EI5 A;  1RGY A;  2QHK A;  2NUP C;  2O0Y A;  2FFY A;  3E98 A;  4L9F A;  1CEF A;  1W8Y A;  2HDU A;  2R9X A;  4G3K A;  2DNS A;  4GD8 A;  2ZOI A;  3K3C A;  5J8X A;  3Q1F A;  3EEA A;  1JNU A;  2V1B A;  4PM9 A;  3H82 A;  1T1B A;  3N7W A;  3VP4 A;  3EGX C;  4HY8 A;  1GHM A;  2ZM0 A;  3LY3 A;  3H7W B;  1MWR A;  4XUX A;  3MZD A;  3PYP A;  4WM9 A;  4OQ0 A;  4U3T A;  3ZVT A;  1Y4O A;  4E04 A;  1P0Z A;  3FG8 A;  3CI6 A;  3MKF A;  1XGI A;  1N9O A;  3N8S A;  2Z6C A;  1MWU A;  4G3V A;  5AQ7 A;  3EOI A;  4I5S A;  5CER A;  4PM7 A;  3ZGA B;  3OC2 A;  3LR3 A;  4EET B;  1P9W A;  1LL9 A;  1VM1 A;  3F1P B;  4GHI A;  1TS7 A;  4QY5 A;  1D06 A;  3MXR A;  4RX2 A;  5FI2 A;  3PXP A;  3F1P A;  3IH9 A;  4KZ5 A;  2HJ9 C;  3IF6 B;  2M1C A;  5EM0 A;  4MLL A;  3ZNT A;  3V67 A;  5U47 A;  5FQM A;  4PAU A;  5HAI A;  2ZD8 A;  4Y3I A;  3HLG A;  3BM6 A;  4B93 A;  1LT0 A;  1G68 A;  1ZC2 A;  1XJ6 A;  4I3J A;  4H6J A;  2XA7 M;  3DTK A;  2WZZ A;  3Q81 A;  3UB9 A;  1D1J A;  3GSG A;  3HBR A;  1XP4 A;  3BQ8 A;  2VLG A;  4JLF A;  3T4O A;  1YMX A;  1SZV A;  3CG5 A;  1FIK A;  3W2Z A;  2OSU A;  5EVI B;  1ERQ A;  4IJG A;  1PWD A;  4QJG A;  1OTB A;  1YLP A;  4YWZ A;  3QP5 A;  4WZ4 A;  2JKF A;  3VFF A;  1A0K A;  4EXO A;  4E3I A;  3PAG A;  4KQQ A;  3PHY A;  1PI5 A;  3NOU C;  3V5M A;  1ODV A;  4E6X A;  5KSH A;  5DTT A;  2O9A A;  3LYX A;  3WWX A;  4WBG A;  3U2A A;  3ZQ5 A;  4R3B A;  3V3R A;  1BSG A;  1VHM A;  1LSX A;  4HBT A;  1ERM A;  3LIA A;  2O9B A;  3SH7 A;  4QU3 A;  3TE8 A;  4HEF A;  4KQR A;  2W1R A;  3P01 A;  1L0G A;  4MCW A;  2BG1 A;  3QP8 A;  4C3Q A;  5AVF A;  2PT7 A;  1S0W A;  3T4J A;  2EWW A;  4HH3 A;  3DTM A;  2UWX A;  1G5U A;  4JF6 A;  2J80 A;  1PW8 A;  2H0T A;  5F69 A;  1DJA A;  2L0W A;  4WLA A;  1K6S A;  2J3T D;  3BY9 A;  1RGZ A;  4LV3 A;  3EGD C;  4ZJ1 A;  4Y0O A;  3UPN A;  3LO7 A;  2OLV A;  3H7W A;  4GOG A;  1PFL A;  5CGW A;  4GKU A;  4LRX C;  4Z9Q A;  1GHP A;  3H82 B;  5FSR A;  2P9V A;  5HL1 A;  4JF4 A;  4QPR A;  1C3B A;  1PZO A;  5GLB A;  4JXV A;  4KZA A;  3ZG7 B;  1PNE A;  3IT9 A;  3NDE A;  4E3O A;  3N4I A;  4GNU A;  1LI0 A;  3MFD A;  4GCZ A;  1UWP X;  3DWZ A;  4BBV A;  3IS2 B;  3IXD A;  4HP9 A;  3O86 A;  3UNW A;  4LGW A;  2C5W B;  3WRT A;  4B9O A;  5KIZ A;  5DTS A;  3W8K A;  4JKT A;  5E43 A;  4K0W A;  4PM8 A;  3LIB A;  3B47 A;  3BFF A;  3A3I A;  4OP5 A;  3O3V A;  5A91 A;  3GQZ A;  1F9I A;  2G7U A;  1S4S A;  4KZ9 A;  1YSQ A;  4DMZ A;  4LCL A;  1VB6 A;  1GSV A;  1NYY A;  4II7 A;  4DXB A;  2XH9 A;  4Z1W A;  3A3E A;  4R70 A;  4DJ2 A;  2Y2P A;  1KVM A;  3DBA A;  1FR1 A;  2BLS A;  5GLA A;  2VV8 A;  4I38 A;  2WAE A;  4P6Z M;  3VSL A;  2O99 A;  3UB6 A;  3OLO A;  2QMI A;  2KX6 A;  4JGP A;  1W8Q A;  5CRF A;  5E2F A;  4U0X A;  2JKR I;  1LL8 A;  3I7J A;  3A0R A;  1HVB A;  2W1T A;  5DJT A;  1GSW A;  1ZG6 A;  1FOF A;  3QP4 A;  3HLB A;  3HLD A;  4BBT A;  2HZ5 A;  3SZT A;  4C75 A;  4BD1 A;  2P9V B;  4DKI A;  5DF7 A;  5DVA A;  3ZHH A;  1ZG4 A;  4AFI A;  3D9Y A;  1YSP A;  5G18 A;  2HP9 A;  3B42 A;  5AQB A;  1JVJ A;  2L1M A;  3V39 A;  3MBZ A;  5GLD A;  3T1R A;  1YT4 A;  4ME4 A;  1OJ5 A;  1O7E A;  2BAS A;  1T1C A;  1KDS A;  2PU2 A;  1OTI A;  2B95 A;  2JBF A;  4UHU A;  2WKE A;  2OAP 1;  1PWC A;  4PKY A;  3HLF A;  5CED A;  1L2S A;  5F68 A;  3FKV A;  3OBF A;  1IKI A;  3F1N A;  5DKK A;  1MWS A;  2X02 A;  4B4Z A;  4ZJ3 A;  4MNR A;  4IED A;  4ESP A;  4EBP A;  2OV5 A;  1W79 A;  4KG2 A;  1IYS A;  5LBR A;  2GX5 A;  4UAA A;  5F82 A;  4FH2 A;  5JYP A;  3KSG A;  4QY6 A;  2ZL1 A;  2PHY A;  3F1O A;  5GHY A;  4ETX A;  4K0X A;  2M7U A;  3VE4 A;  1MXO A;  2EXA A;  2XD5 A;  4PKY G;  4KG6 A;  1RP5 A;  3ZDJ A;  4MN7 A;  5CX7 A;  5HDS A;  1NY0 A;  1KGE A;  1ES2 A;  1H3Q A;  4LV2 A;  1IEM A;  1CEG A;  4L0L A;  3VP2 A;  2EFU A;  4N1X A;  2QZ6 A;  4WZ5 A;  3KSF A;  3OPP A;  3VMA A;  2Q9N A;  4E3K A;  4OP8 A;  5EVI C;  2P08 A;  1DY6 A;  1V9Y A;  3LR4 A;  1GA9 A;  4GS9 A;  4Y0T A;  4Q0H A;  2A49 A;  3VP1 A;  3UDI A;  3Q7V A;  3UME A;  4FTX A;  2PRF A;  1MC0 A;  2Y91 A;  2VX8 A;  2V8C A;  1WYC A;  4NKP A;  1CF0 A;  3WS0 A;  3AGD A;  3L9K A;  1K55 C;  4R23 A;  1E25 A;  5K5B A;  4NXE A;  3ITB A;  2PYP A;  2D02 A;  2QJ5 A;  4S2J A;  3G32 A;  4IUK A;  2I9V A;  1AWI A;  2Y79 A;  1K54 A;  3VFH A;  1TVF A;  5FEG A;  4BWI A;  5DKL A;  4L9G A;  3DWK A;  4GHI B;  1LLB A;  4F3L B;  4HBU A;  4HP4 A;  3UN7 A;  3IXB A;  4WF0 A;  4CLC C;  3PBS A;  3T1X A;  3OOV A;  1GSX A;  2WAD A;  3VP0 A;  2H28 A;  2ZC4 B;  4OPR A;  3GTC A;  3LI9 A;  1K56 D;  2JKT I;  4RYE A;  3OCL A;  5E2E A;  3ZCZ A;  1ZKJ A;  1OT9 A;  1LSV A;  4EW7 A;  2ZOH A;  3CIT A;  4FUW A;  1WA9 A;  3BW6 A;  1MZU A;  5FQJ A;  2WUQ A;  5EFW A;  1OTA A;  5HFO A;  3PTE A;  3S22 A;  2HP6 A;  1Z09 A;  5J7E A;  1SHV A;  3MS6 A;  3MR0 A;  3O5Y A;  2QWS A;  4LRY C;  3NC8 A;  1T19 A;  3TJZ C;  4GB7 A;  1IKG A;  1T18 A;  1CJF A;  3K3D A;  3M6H A;  2WGW B;  4IBR A;  2A24 B;  2PD7 A;  2QPN A;  1BLC A;  3T12 B;  2Y59 A;  3MQQ A;  2V0U A;  5HWV A;  3BEC A;  3BEB A;  4O7D A;  1DRM A;  5IU1 A;  1XA7 A;  1PYY A;  5F1G A;  4IBX A;  3CPT A;  4IUH A;  1K38 A;  3IF5 A;  1GA0 A;  1YAX A;  2YKF A;  5AQ9 A;  5L10 A;  1IYQ A;  3UE1 A;  1SDE A;  1CK3 A;  3NEC A;  2KOI A;  2NUT C;  5M19 A;  4Y13 A;  5J3W A;  5CHM A;  4GZB A;  4DDS A;  2B5R A;  3V50 A;  3HRE A;  4U0T A;  5DFX A;  4OLD A;  4ZAM A;  3E2K A;  1VEU A;  3ZFZ A;  1TS6 A;  3LI8 A;  1VET A;  1LL5 A;  2ZQC A;  4CLC E;  4EU0 A;  3JVV A;  3UB8 A;  5EOO A;  5G4Z A;  1H8Z A;  4P6Z S;  1S6R A;  3IWI A;  4S2I A;  4R6L A;  2YKH A;  4Q8I A;  3JPU A;  1XFQ A;  4YFM A;  1L0F A;  4K91 A;  2Y2K A;  4WUJ A;  3MSH A;  3OCN A;  4ARZ A;  3CAX A;  3OZH A;  2VGK A;  5TBM B;  3NDG A;  5HWW A;  1K56 A;  3D4F A;  2WK0 A;  1TEM A;  1M6K A;  1L0D A;  3RJU A;  4JGQ A;  3VP3 A;  4JXS A;  4PHT A;  5F6A A;  1YLT A;  3TOI A;  2XA7 S;  2XK1 A;  3Q07 A;  4OPZ A;  3GR2 A;  4EEP A;  1I2W A;  1N9N A;  1FR6 A;  3E4P A;  2XQZ A;  1VQQ A;  5GLC A;  5KSC A;  3UE3 A;  4ZJ2 A;  3SH9 A;  2PAV P;  3UB5 P;  5HPI A;  1ONG A;  3LIE A;  2W3G A;  1EWZ A;  2Z2M B;  1PZP A;  5I94 A;  5HPF A;  2V9A A;  5HZH A;  4Y5F A;  4MEZ A;  3HUN A;  2Y2M A;  1J3W A;  1DJB A;  1K4E A;  5FI7 A;  3C7U A;  4Y17 A;  1XA1 A;  4E3J A;  1NXY A;  5IT5 A;  1STZ A;  3T4Q A;  1LI9 A;  1NLY A;  3NY4 A;  2ZMF A;  3MZF A;  5D3O A;  1BTL A;  2XD1 A;  4IVK A;  3ZNY A;  3M6B A;  1S67 L;  1SDN A;  3H9W A;  4BEN A;  2Y2I A;  2PBY A;  4HES A;  1PW1 A;  2GNX A;  4IHQ A;  3IH8 A;  3TRC A;  2V20 A;  1F2K A;  3C8C A;  2VV7 A;  5HD3 A;  3IX4 A;  1FQG A;  3PBT A;  1HTZ A;  3FC7 A;  4HNB A;  4H8R A;  4RQ9 A;  1S1Z A;  4UA7 A;  4M3K A;  4F94 A;  3G6O A;  4DN0 A;  3LGO A;  3C30 A;  4UQI M;  2P04 A;  4EES A;  2E8J A;  3ULF A;  2J3T C;  3VOY A;  4BLM A;  5C5K A;  5HD5 A;  5FQK A;  1CI9 A;  3RTY A;  5KZH A;  4OOM A;  2V1A A;  3T4L A;  4DXC A;  2XLN A;  3G4P A;  4YOF A;  2W3E A;  2ZJ9 A;  1G28 A;  2A2L A;  1KGF A;  1DP9 A;  4DE1 A;  1W63 M;  2LB5 A;  2HV1 A;  3QHY A;  2E8I A;  1VET B;  3G34 A;  4BJP A;  4BQM A;  3G35 A;  1RCJ A;  2W27 A;  4NXF A;  1P97 A;  3A3D A;  1LSW A;  4LPZ A;  3B3X A;  5BOH A;  5EOE A;  3OPL A;  1O07 A;  3M2K A;  2Q9M A;  4HOI A;  2Y2G A;  2HDR A;  4EUZ A;  3BFD A;  1KGG A;  1YLY A;  2W3D A;  1YKD A;  3EEH A;  3NJA A;  1GHI A;  3BJN A;  1QMF A;  3T50 A;  4HIA A;  4QB8 A;  5G4Y A;  4R0Q A;  4BMW A;  4GDB A;  2ZQA A;  2Y2N A;  1W5D A;  2EX6 A;  4HQA A;  2Y2Q A;  5GHZ A;  2ACG A;  5HAP A;  3BQA A;  2B02 A;  2K2N A;  4Y7P A;  1GCE A;  2WKQ A;  4O0P A;  4KG5 A;  5A93 A;  3IBJ A;  4CPK A;  3RXX A;  3Q7Z A;  2Y2J A;  4E3L A;  1BYW A;  4NEE D;  2ZC7 A;  3BY8 A;  1OTE A;  2R9W A;  4MN6 A;  2L4R A;  3MJQ A;  3LUQ A;  4KZ8 A;  1PWG A;  4Y0U A;  2EXB A;  4KQD A;  3GRJ A;  4Q0I A;  2IWB A;  1S1Y A;  3Q82 A;  5MC7 A;  4NK3 A;  4KZ4 A;  2WZX A;  1VEU B;  5L07 A;  4GS9 B;  2VZW A;  4L9E A;  3BFE A;  4OPQ A;  3DTE A;  3A0V A;  4N9L A;  4RA7 A;  3R4K A;  5EVL A;  4EER A;  1W63 Q;  4S2M A;  4JXG A;  5FQI A;  1W7F A;  4EV4 A;  4YIN A;  4JXW A;  5TR7 A;  1ESU A;  1K0K A;  4NXB A;  3HLC A;  4KUK A;  2LB9 A;  2CC1 A;  1V9Z A;  4R3J A;  1I2S A;  3CUE A;  5M1A A;  5AJG A;  1ERO A;  2A24 A;  3C4O A;  4MBF A;  3FV7 A;  2RL3 A;  4JF5 A;  3S7Q A;  2V1Z A;  1ES5 A;  5FA7 A;  3R7W B;  1OTD A;  2WAF A;  3ZG8 B;  3HCY A;  4X68 A;  2V0W A;  5FQ9 A;  5FAQ A;  5HW3 A;  3DAV A;  4O8G A;  1OJG A;  2PD8 A;  2Y8H A;  3GVB A;  3UDF A;  2Y55 A;  1DP6 A;  1HLU P;  3E2L A;  1AXB A;  3ZYT A;  4HHD A;  3VSK A;  2V8F A;  3HJK A;  3RXW A;  3UO9 A;  4KQO A;  1IEL A;  1DP8 A;  5HSQ A;  3IX3 A;  2JKG A;  3IWO A;  2ZQ8 A;  1MWT A;  4R4R A;  1NRF A;  2WGW A;  3N6I A;  3K2N A;  1SCW A;  5CTM A;  4ETZ A;  5CEB A;  2H5S A;  3SS5 A;  4I39 A;  4LRZ E;  2J7V A;  4KZ3 A;  4GD6 A;  1IOU A;  1TF1 A;  3QNC A;  4KZ6 A;  4XUZ A;  3IF6 C;  2XRO A;  4KZ7 A;  1YMS A;  5FDH A;  3CMZ A;  3LFV A;  4JBF A;  4N9K A;  5TBM A;  1JWP A;  5L8M A;  5I5L A;  4EEU A;  4B4X A;  3C7V A;  3QP2 A;  1Y28 A;  4OH0 A;  3TW8 A;  3MZE A;  3O87 A;  4JGR A;  3MXQ A;  3SH8 A;  4DE2 A;  4WEJ A;  3T4K A;  2Z6D A;  3VV4 A;  1XXM A;  4CQH A;  4MBK A;  2W3F A;  1EW0 A;  3CUE C;  1FSY A;  3TG9 A;  5FEF A;  3WS4 A;  4IVI A;  2JKT M;  4DE3 A;  5L2F A;  2OWH A;  2AVX A;  4OQH A;  5A8B A;  4R3A A;  4KEN B;  2FZ0 A;  3VOZ A;  2JCH A;  2PR6 A;  2HDQ A;  3KO6 A;  4GN2 A;  3KSH A;  3T1S A;  2VGL S;  3C2W A;  1XFN A;  2HDS A;  1KE3 A;  4P85 A;  3JVU A;  4X1M A;  3QNB A;  3G30 A;  5AQA A;  2UV0 E;  1H8M A;  1XJ2 A;  3ISG A;  5F1F A;  3QP1 A;  3G2Z A;  3PBQ A;  1XPB A;  2IA2 A;  1ESI A;  1FSW A;  3FKW A;  2EFX A;  5FI6 A;  4LV0 A;  5GL9 A;  1MBL A;  2G2U A;  1NZU A;  4UA9 A;  1N9L A;  3LIC A;  3MKE A;  3ZG9 B;  5EE8 A;  3HUM A;  2J9O A;  4OON A;  5FAO A;  3HLE A;  4P0M A;  4XT2 B;  1NZO A;  2HJE A;  4E6W A;  5FDS A;  5HX9 A;  3IHA A;  5DF9 A;  1TS8 A;  4HJ6 A;  3R7W A;  4BBU A;  2PU4 A;  5EM1 A;  1XJ3 A;  3OPH A;  4ARZ B;  4OOY A;  3LIF A;  4JGO A;  4RX3 A;  3W4Q A;  3C4P A;  2VEA A;  2Y2L A;  1N4O A;  1FIL A;  1IFQ A;  1X0O A;  4UQI S;  2XFS A;  3LR5 A;  2Y2H A;  4MDZ A;  4NET A;  1OME A;  4Y15 A;  4S2N C;  3IS2 A;  3W4P A;  4XXR A;  3LR0 A;  4ZTK A;  4ZRR A;  2ZC3 B;  1Q2P A;  3BYD A;  5E2H A;  3D3O A;  1BUE A;  3WS5 A;  3O88 A;  4OQI A;  4JPM A;  1XGJ A;  3CWF A;  3KSI A;  5FAS A;  1PI4 A;  4PMA A;  4K08 A;  1FCN A;  4S2L A;  3LEZ A;  3S7N A;  3FPW A;  3IXH A;  5KMW A;  1TS0 A;  4HJ4 A;  2WYX A;  2W1T B;  4R4S A;  4ID4 A;  1S66 L;  1BLS A;  4OQG A;  3CHW P;  2J8Y A;  2EX8 A;  4B88 A;  3IBR A;  1CI8 A;  4GLQ A;  4FSF A;  2QJ7 A;  3WS2 A;  1YM1 A;  3E4Q A;  2J9P A;  5FAT A;  5FL3 A;  3UE0 A;  2H10 A;  4C6Y A;  4X69 A;  2I72 A;  4MMN A;  2VGJ A;  1ES3 A;  1SKF A;  5M18 A;  5IS1 A;  3HJI A;  4MBH A;  4X53 A;  4MN5 A;  2ZC5 B;  3CPT B;  5TJJ A;  4X6T A;  1WE4 A;  2PYR A;  3LY4 A;  4YNR A;  1QME A;  5EV0 A;  5CHU A;  3KYQ A;  1XX2 A;  2IWC A;  2VK3 A;  5HL6 A;  2OAQ 1;  2G2W A;  3NOP C;  2MJ6 A;  5AVE A;  3AGF A;  1YLW A;  3IHB A;  4X1L A;  2XDM A;  2K31 A;  2ZL1 B;  4UEY A;  2XF3 A;  1PIO A;  2ZC6 B;  4ZDX A;  2M7V A;  1JTD A;  1OPX A;  4ZBE A;  3PBR A;  3BLM A;  5JYO A;  2WGV A;  5E2G A;  3HL9 A;  4P87 A;  3QP6 A;  2Q0O A;  1N9B A;  1F98 A;  3E0Y A;  4LFU A;  4WEK A;  3LEQ A;  4WEL A;  1HD8 A;  5IHV A;  2XFT A;  3UDX A;  3KX0 X;  3D72 A;  4X25 A;  4NG2 A;  2ZM8 A;  2WKP A;  2C6W B;  2WGI A;  1S4R A;  2QYB A;  4DRT A;  1ALQ A;  2GZA A;  3T4T A;  2P74 A;  1Q2Q A;  3EQV A;  4H6J B;  2ZMA A;  1HZO A;  3A3F A;  1JTG A;  3OPR A;  1DJC A;  2JC7 A;  1TD5 A;  2ZQ9 A;  1F5M A;  5CHJ A;  4S2N A;  4CLC D;  4HJ3 A;  1NYM A;  4S2O A;  3AGE A;  4QD4 A;  5DFY A;  4F3L A;  5A90 A;  3LCE A;  3S7O A;  3MXS A;  5HDD A;  5A92 A;  3NI9 A;  4X56 A;  3A3J A;  3SS4 A;  2B18 A;  3MFX A;  4HH2 A;  1NRJ A;  1WYB A;  5HDC A;  4PPR A;  5TFQ A;  3GEC A;  4D2O A;  4EBN A;  1K57 C;  2EX9 A;  4OKP A;  2Y4A A;  1KOU A;  3BFG A;  2QKP A;  2CMN A;  4CLC B;  2JHE A;  1ZTU A;  5CGX A;  4S2K A;  3MMH A;  4HI4 A;  3PAE A;  3P09 A;  3BFC A;  3Q7V B;  4GW9 A;  1H5X A;  2KDK A;  3CJM A;  3EQU A;  1D7E A;  4R38 A;  3HVF A;  1K57 A;  3BRM A;  2W3H A;  1BUL A;  1YLZ A;  1M40 A;  2DCF A;  3ICY A;  3N8R A;  2GDN A;  5J4E A;  4WMC D;  1KE0 A;  2OLU A;  4RVA A;  2PDR A;  3T1Q B;  1TDL A;  3V3S A;  1BLP A;  1KDW A;  4FOF A;  2J3W A;  5GHX A;  2KLI A;  5DTK A;  3WS1 A;  3CZD A;  1H0M A;  5EVI D;  1MY8 A;  1K55 A;  5HAR A;  3NIA A;  5CGS A;  1UWN X;  1NJ4 A;  4X55 A;  1BT5 A;  5CTN A;  1XKZ A;  2ZBB A;  4E3M A;  4DJ3 A;  5DF8 A;  4LLO B;  1G6O A;  1FCM A;  1NWZ A;  3M2J A;  1TDG A;  1J9M A;  1NLZ A;  4WYY A;  4EWF A;  1E3U A;  3T4S A;  2ZQD A;  1K6R A;  1K25 A;  3WRZ A;  1T1A A;  3F1N B;  2HPB A;  3FPV A;  3ZG0 A;  2R78 A;  1L0E A;  3VE3 A;  2VA0 A;  1I5Q A;  4EQ1 A;  5HAQ A;  1K4F A;  3DTI A;  1JWZ A;  5CXW A;  3DW0 A;  3ZG5 A;  4I3I A;  2VV6 A;  2Y2O A;  3SOI A;  3GDI A;  5TGF A;  4PM6 A;  3E4O A;  4O01 A;  3G31 A;  3NCK A;  5F5Y A;  1ES4 A;  1ZHH B;  1BLH A;  3NHQ A;  4N1H A;  1CQA A;  4UA6 A;  4A5R A;  4WN5 A;  1IYO A;  2A3U A;  3ZVW A;  1FCO A;  4Q0J A;  4R1G A;  2XRN A;  2IWD A;  1YPR A;  4D60 A;  1PRQ A;  3MQ0 A;  4EUV A;  2VJW A;  3PBN A;  2EWV A;  3BWL A;  3JYI A;  4LEN A;  4QHC A;  4N92 A;  1Y54 A;  5F83 A;  4FD8 A;  4FH4 A;  1LHY A;  4LV1 A;  2XGN A;  2ZM2 A;  3UB7 A;  4WL9 A;  2VKS A;  3F1O B;  4WMC A;  3RFB A;  2Z2L B;  4WZ5 C;  3L7H A;  3VOL A;  4BL3 A;  4M4X A;  4BL2 A;  2GJ3 A;  4DDY A; 
#chains in the Genus database with same CATH homology
 5EE8 A;  5FI7 A;  3HUM A;  2J9O A;  3C7U A;  4KZ9 A;  4OON A;  1XA1 A;  5FAO A;  1ONH A;  4LCL A;  3HLE A;  4E3J A;  1NXY A;  4P0M A;  1MPL A;  1MKI A;  4OPY A;  1LI9 A;  1NZO A;  2X01 A;  1NYY A;  4E6W A;  4DXB A;  2XH9 A;  3NY4 A;  3FWL A;  5D3O A;  3MZF A;  5HX9 A;  3IHA A;  1BTL A;  2XD1 A;  3A3E A;  4IVK A;  5DF9 A;  5EVI A;  3ZNY A;  3M6B A;  5FQQ A;  3HLW A;  1SDN A;  2PU4 A;  2Y2P A;  1KVM A;  4BEN A;  3SS3 A;  1FR1 A;  2Y2I A;  2BLS A;  3OPH A;  4OVD A;  4EQI A;  4OOY A;  2PBY A;  4HES A;  5GLA A;  1PW1 A;  3IH8 A;  4RX3 A;  2WAE A;  3W4O A;  3W4Q A;  3C4P A;  2Y2L A;  2V20 A;  1N4O A;  1E3U D;  3VSL A;  1U60 A;  2XFS A;  2Y2H A;  1FQG A;  2QMI A;  4NET A;  1Z6F A;  4FCF A;  3PBT A;  1OME A;  1W8Q A;  4BD0 A;  5CRF A;  5E2F A;  4S2N C;  4U0X A;  5EEC A;  1HTZ A;  3W4P A;  4XXR A;  3I7J A;  4H8R A;  4ZTK A;  2XEP A;  3FYZ A;  4EBL A;  2ZC3 B;  1Q2P A;  3BYD A;  3C5A A;  5E2H A;  1HVB A;  4GDN A;  4UA7 A;  4M3K A;  4F94 A;  1ZG6 A;  1BUE A;  3IF6 A;  1FOF A;  3TSG A;  3WS5 A;  3O88 A;  2V2F F;  4PM5 A;  3HLB A;  3HLD A;  4OQI A;  4S2P A;  4JPM A;  1XGJ A;  3UPO A;  3VOY A;  5CEC A;  4C75 A;  4BD1 A;  5FAS A;  4BLM A;  2P9V B;  1PI4 A;  4P6B A;  4PMA A;  4DKI A;  5DF7 A;  1FCN A;  4S2L A;  3LEZ A;  5FQK A;  3BLS A;  4LCM A;  3IXH A;  1CI9 A;  5KMW A;  5DVA A;  2WYX A;  5KZH A;  3ZHH A;  1ZG4 A;  3NBL A;  4R4S A;  5FAP A;  4OOM A;  2ZQ7 A;  4ID4 A;  2X71 A;  3FZC A;  5G18 A;  1JWV A;  1BLS A;  2HP9 A;  4DXC A;  3ITA A;  4OQG A;  2XLN A;  5AQB A;  1JVJ A;  2ZLY A;  3V39 A;  3UY6 A;  2J8Y A;  3G4P A;  3MBZ A;  5GLD A;  2EX8 A;  1YT4 A;  1O7E A;  1YLJ A;  4B88 A;  3S4X A;  1KDS A;  2ZJ9 A;  2FFF B;  2PU2 A;  1CI8 A;  2RCX A;  4FSF A;  1KGF A;  2JE5 A;  2JBF A;  4UHU A;  2WKE A;  3WS2 A;  1PWC A;  4DE1 A;  3HLF A;  1K54 C;  1L2S A;  2XR0 A;  3QHY A;  1YM1 A;  5CED A;  3FKV A;  2J9P A;  4E3N A;  2E8I A;  1YQS A;  4KZB A;  5FAT A;  1IKI A;  3P98 A;  3G34 A;  3UPP A;  2HP5 A;  4BJP A;  3PBO A;  3GV9 A;  1KVL A;  1MWS A;  2X02 A;  1BZA A;  3UE0 A;  2H10 A;  4B4Z A;  4C6Y A;  4X69 A;  4BQM A;  3GMW A;  2DRW A;  4ZJ3 A;  3IQA A;  2EX2 A;  3G35 A;  3HUO A;  4CJN A;  1RCJ A;  2I72 A;  2VGJ A;  1H8Y A;  4MNR A;  4IED A;  1ES3 A;  1SKF A;  4EBP A;  3A3D A;  5M18 A;  4OOL A;  1KE4 A;  3B3X A;  4MBH A;  2WKI A;  5BOH A;  5EOE A;  2OV5 A;  3OPL A;  1O07 A;  1W79 A;  2WKH A;  2Q9M A;  1IYS A;  2ZC5 B;  3M2K A;  3N8L A;  2Y2G A;  4KG2 A;  2HDR A;  4X53 A;  4DE0 A;  4EUZ A;  3BFD A;  1KGG A;  4X6T A;  4UAA A;  1WE4 A;  1YLY A;  5F82 A;  4FH2 A;  1G6A A;  3S1Y A;  5EUA A;  5JYP A;  3LY4 A;  1QME A;  4QY6 A;  5CHU A;  1GHI A;  1QMF A;  5GHY A;  1XX2 A;  3IWQ A;  4K0X A;  1IYP A;  2IWC A;  4QB8 A;  1MXO A;  4DF6 A;  1E4D A;  2EXA A;  2XD5 A;  2G2W A;  4KG6 A;  1RP5 A;  3ZDJ A;  4R0Q A;  3G2Y A;  3IXG A;  4GDB A;  2ZQA A;  3AGF A;  1YLW A;  2Y2N A;  3IHB A;  1NY0 A;  1W5D A;  2EX6 A;  4OLG A;  2H0Y A;  5EPH A;  1KGE A;  1EI5 A;  1RGY A;  1ES2 A;  4LV2 A;  2XDM A;  2FFY A;  1IEM A;  1CEG A;  2Y2Q A;  2XF3 A;  5GHZ A;  4L0L A;  3VP2 A;  2EFU A;  1PIO A;  2QZ6 A;  4N1X A;  2ZC6 B;  4ZDX A;  1CEF A;  1JTD A;  4WZ5 A;  5HAP A;  1W8Y A;  2HDU A;  2R9X A;  4ZBE A;  3PBR A;  4Y7P A;  3BLM A;  1GCE A;  5JYO A;  2WGV A;  2DNS A;  5E2G A;  3OPP A;  3VMA A;  2Q9N A;  3HL9 A;  4P87 A;  4E3K A;  4GD8 A;  4KG5 A;  4OP8 A;  5EVI C;  5J8X A;  5A93 A;  1N9B A;  3Q1F A;  4CPK A;  1DY6 A;  3RXX A;  1GA9 A;  3Q7Z A;  2Y2J A;  4PM9 A;  4E3L A;  4WEK A;  4Y0T A;  4WEL A;  2A49 A;  1HD8 A;  3N7W A;  2ZC7 A;  5IHV A;  3VP4 A;  3VP1 A;  2XFT A;  3UDX A;  3UDI A;  2R9W A;  3Q7V A;  1GHM A;  2ZM0 A;  2ZM8 A;  3LY3 A;  2WGI A;  2C6W B;  1MWR A;  4XUX A;  4DRT A;  3MZD A;  1ALQ A;  4WM9 A;  4OQ0 A;  2P74 A;  4KZ8 A;  4U3T A;  1PWG A;  2Y91 A;  1Q2Q A;  3ZVT A;  3EQV A;  4Y0U A;  2ZMA A;  1HZO A;  1WYC A;  2EXB A;  3A3F A;  3GRJ A;  1JTG A;  3WS0 A;  3OPR A;  3AGD A;  1DJC A;  2JC7 A;  3MKF A;  1XGI A;  2ZQ9 A;  1K55 C;  3N8S A;  2IWB A;  4R23 A;  3Q82 A;  1E25 A;  5CHJ A;  1MWU A;  5AQ7 A;  4S2N A;  4NK3 A;  3ITB A;  4KZ4 A;  4S2J A;  2WZX A;  1NYM A;  5CER A;  4S2O A;  4PM7 A;  3G32 A;  3AGE A;  3OC2 A;  3ZGA B;  4QD4 A;  3BFE A;  4OPQ A;  1K54 A;  5A90 A;  1LL9 A;  1VM1 A;  4N9L A;  3VFH A;  1TVF A;  4RA7 A;  3LCE A;  5EVL A;  3DWK A;  3MXS A;  4S2M A;  5A92 A;  4QY5 A;  3MXR A;  4JXG A;  1LLB A;  5FQI A;  3NI9 A;  1W7F A;  4RX2 A;  4X56 A;  5FI2 A;  4YIN A;  3A3J A;  4JXW A;  5TR7 A;  4EV4 A;  3SS4 A;  4HBU A;  1ESU A;  3IH9 A;  4KZ5 A;  3UN7 A;  3IF6 B;  1WYB A;  4PPR A;  5TFQ A;  3HLC A;  4MLL A;  3IXB A;  3ZNT A;  4D2O A;  2CC1 A;  4R3J A;  4EBN A;  5U47 A;  1K57 C;  3PBS A;  5FQM A;  2EX9 A;  4OKP A;  2Y4A A;  1I2S A;  5M1A A;  3BFG A;  5HAI A;  2WAD A;  1ERO A;  2ZD8 A;  3C4O A;  3HLG A;  3VP0 A;  4MBF A;  3BM6 A;  5CGX A;  3FV7 A;  4S2K A;  1G68 A;  1ZC2 A;  2ZC4 B;  2RL3 A;  3GTC A;  4JF5 A;  4OPR A;  1K56 D;  4RYE A;  3PAE A;  3OCL A;  3P09 A;  5E2E A;  3ZCZ A;  3BFC A;  2WZZ A;  1ZKJ A;  3Q81 A;  3GSG A;  3HBR A;  3Q7V B;  1XP4 A;  1H5X A;  4JLF A;  1YMX A;  2V1Z A;  3CJM A;  1ES5 A;  3CG5 A;  5FA7 A;  2OSU A;  2WAF A;  5EVI B;  3EQU A;  1ERQ A;  3ZG8 B;  4X68 A;  5FQ9 A;  5FAQ A;  5HW3 A;  5FQJ A;  3HVF A;  1PWD A;  2WUQ A;  1K57 A;  3BRM A;  5HFO A;  4QJG A;  3GVB A;  3PTE A;  3UDF A;  1YLP A;  2Y55 A;  3S22 A;  3E2L A;  2HP6 A;  1BUL A;  4WZ4 A;  3VFF A;  1YLZ A;  1AXB A;  1M40 A;  1SHV A;  2DCF A;  3N8R A;  2GDN A;  4E3I A;  3VSK A;  3RXW A;  3PAG A;  4KQQ A;  3NC8 A;  3UO9 A;  4KQO A;  4GB7 A;  1IEL A;  1PI5 A;  4WMC D;  1IKG A;  3V5M A;  1KE0 A;  4E6X A;  2OLU A;  4RVA A;  5KSH A;  5DTT A;  3M6H A;  3IWO A;  3WWX A;  2ZQ8 A;  1MWT A;  2WGW B;  4IBR A;  4R4R A;  4WBG A;  4R3B A;  1NRF A;  3V3R A;  1TDL A;  2QPN A;  1BSG A;  1BLC A;  4HBT A;  2Y59 A;  2WGW A;  3V3S A;  1ERM A;  1BLP A;  1KDW A;  3N6I A;  1SCW A;  5CTM A;  3BEC A;  5CEB A;  2H5S A;  3BEB A;  4O7D A;  5GHX A;  3SH7 A;  3SS5 A;  4QU3 A;  5DTK A;  4HEF A;  3WS1 A;  4KQR A;  3CZD A;  1XA7 A;  1PYY A;  5EVI D;  1MY8 A;  5F1G A;  4IBX A;  2J7V A;  1K55 A;  5HAR A;  4KZ3 A;  1L0G A;  3NIA A;  5CGS A;  4GD6 A;  1K38 A;  1NJ4 A;  2BG1 A;  3IF5 A;  4X55 A;  1BT5 A;  1GA0 A;  5CTN A;  5AQ9 A;  3QNC A;  1IYQ A;  1XKZ A;  4KZ6 A;  4XUZ A;  3IF6 C;  4E3M A;  5DF8 A;  4KZ7 A;  3UE1 A;  1SDE A;  1CK3 A;  1FCM A;  3M2J A;  1TDG A;  1J9M A;  1YMS A;  5FDH A;  5M19 A;  4C3Q A;  4WYY A;  4EWF A;  1E3U A;  3CMZ A;  5CHM A;  4GZB A;  4JBF A;  4DDS A;  2ZQD A;  2B5R A;  1K6R A;  1K25 A;  1S0W A;  4N9K A;  3WRZ A;  3V50 A;  2HPB A;  3HRE A;  1JWP A;  4U0T A;  4OLD A;  4ZAM A;  3E2K A;  3ZG0 A;  3DTM A;  3ZFZ A;  2UWX A;  4B4X A;  1L0E A;  3C7V A;  4JF6 A;  1LL5 A;  1I5Q A;  2ZQC A;  5HAQ A;  1K4F A;  1PW8 A;  2H0T A;  1DJA A;  1JWZ A;  5EOO A;  1K6S A;  4OH0 A;  5CXW A;  1RGZ A;  3DW0 A;  1H8Z A;  4LV3 A;  3ZG5 A;  3MZE A;  4ZJ1 A;  3O87 A;  1S6R A;  2Y2O A;  3IWI A;  4S2I A;  4Y0O A;  3SH8 A;  3SOI A;  4DE2 A;  4Q8I A;  4WEJ A;  4YFM A;  1L0F A;  5TGF A;  3UPN A;  1XXM A;  4PM6 A;  4K91 A;  3LO7 A;  2Y2K A;  2OLV A;  4GOG A;  4MBK A;  3OCN A;  5CGW A;  4GKU A;  3G31 A;  3NCK A;  3OZH A;  1FSY A;  1ES4 A;  2VGK A;  4Z9Q A;  1BLH A;  3NDG A;  4N1H A;  3TG9 A;  1GHP A;  5FSR A;  4UA6 A;  4A5R A;  2P9V A;  3WS4 A;  5HL1 A;  4JF4 A;  1IYO A;  2A3U A;  1K56 A;  4IVI A;  1C3B A;  3ZVW A;  1PZO A;  3D4F A;  4DE3 A;  2WK0 A;  5L2F A;  1TEM A;  1FCO A;  4OQH A;  5GLB A;  1M6K A;  1L0D A;  4JXV A;  4R1G A;  3RJU A;  4KZA A;  3ZG7 B;  4KEN B;  2IWD A;  4JXS A;  3VP3 A;  3IT9 A;  3NDE A;  3VOZ A;  1YLT A;  2JCH A;  2HDQ A;  4E3O A;  3TOI A;  2XK1 A;  3N4I A;  4GN2 A;  4GNU A;  1LI0 A;  3MFD A;  3Q07 A;  4OPZ A;  3GR2 A;  1I2W A;  1FR6 A;  2HDS A;  3PBN A;  2XQZ A;  1KE3 A;  4P85 A;  1VQQ A;  3JYI A;  3QNB A;  3DWZ A;  4LEN A;  3G30 A;  5AQA A;  5GLC A;  5KSC A;  3UE3 A;  4QHC A;  4N92 A;  1Y54 A;  5F83 A;  3IXD A;  3O86 A;  4ZJ2 A;  3UNW A;  2C5W B;  3WRT A;  3SH9 A;  4FD8 A;  4FH4 A;  3ISG A;  5F1F A;  5DTS A;  1LHY A;  3G2Z A;  4LV1 A;  3W8K A;  4JKT A;  2XGN A;  3PBQ A;  1ONG A;  2ZM2 A;  1XPB A;  5E43 A;  4K0W A;  1EWZ A;  2Z2M B;  1ESI A;  1FSW A;  1PZP A;  4PM8 A;  3FKW A;  3BFF A;  2Z2L B;  3A3I A;  4WMC A;  5I94 A;  4OP5 A;  2EFX A;  4WZ5 C;  5FI6 A;  4MEZ A;  4BL3 A;  4LV0 A;  3HUN A;  4BL2 A;  5GL9 A;  1MBL A;  2G2U A;  2Y2M A;  3O3V A;  5A91 A;  1NZU A;  4UA9 A;  3MKE A;  3GQZ A;  3ZG9 B;  4DDY A;  1DJB A;  1K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...