1IELA

Crystal structure of ampc beta-lactamase from e. coli in complex with ceftazidime
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIGSDNIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of ceftazidime and its transition-state analogue in complex with AmpC beta-lactamase: implications for resistance mutations and inhibitor design.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase
total genus 116
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ielA00
3MBZA 3ZDJA 2OV5A 1K25A 4HBTA 2FFYA 2HP9A 2Y2NA 4GOGA 4WEKA 2Y4AA 5CTNA 1L0DA 1K55A 2B5RA 2HP6A 1PI5A 2ZC3B 3SS5A 2X01A 3TG9A 1PWCA 2HDRA 1HVBA 4OPRA 2Z2MB 2PU2A 3MFDA 2V2FF 3V5MA 3P98A 4LV1A 4Q8IA 3WS4A 2CC1A 2EXBA 1W7FA 2Y2QA 4EBPA 4BQMA 1GA0A 4KZBA 3DTMA 3UPPA 5E2HA 3ISGA 1SHVA 3Q7VA 2ZC7A 4FH4A 4OVDA 1K56D 3C4PA 3BRMA 3N6IA 4D2OA 1JTGA 3W4QA 5A92A 4WM9A 4KZ9A 4QY6A 3JYIA 3I7JA 1RP5A 1Z6FA 3V39A 4ID4A 3WRTA 1LL5A 3EQVA 2OLVA 1XGIA 1MWTA 5E2GA 1TVFA 2J8YA 3OPPA 3CMZA 4KZ3A 1ERMA 5I94A 1ONGA 3IF6A 4MBFA 1NZUA 4S2NA 4ZAMA 5FQ9A 3VP2A 5TGFA 4DRTA 2XFSA 4E3IA 4X55A 3W8KA 4M3KA 3N7WA 3Q07A 2C5WB 1U60A 1PIOA 2DRWA 4PPRA 3UE1A 1KE0A 4XUZA 4OPQA 3IH8A 4S2MA 4OOMA 1K54C 4KQOA 1ZG4A 3NCKA 5GLDA 1FR1A 1BULA 4NK3A 5HX9A 2HDUA 3DW0A 2Y2KA 3BFGA 1NJ4A 3HLEA 1CI9A 5DF9A 5KSHA 4OOYA 2J7VA 2H0YA 4FSFA 1FCNA 3V3RA 3Q1FA 5CGXA 3AGDA 5JYPA 4KENB 1YLPA 3SH8A 3S1YA 4DE1A 2OSUA 3G2YA 2WKIA 4BJPA 1RGYA 1HD8A 2Y2JA 1CEGA 1I5QA 4DDYA 1S6RA 4JLFA 4MNRA 2WKHA 3PBNA 4QU3A 2ZD8A 2ZQ7A 4KZ4A 1E3UD 3UO9A 4X56A 4LENA 3UY6A 3OC2A 3Q7ZA 1ZKJA 3ZG8B 4B4XA 4S2PA 4QJGA 1DJAA 1KVMA 1NRFA 3Q82A 3MKEA 5EVLA 3GR2A 5HAQA 4U0TA 4X6TA 2RL3A 3D4FA 3WS5A 4S2KA 1YM1A 3TOIA 4DE3A 4R3JA 1ES2A 1MWUA 4QB8A 2A49A 4MLLA 5CHMA 2OLUA 1GHIA 2A3UA 3C7UA 4WZ5A 4ZJ3A 1MBLA 3ZG9B 2FFFB 3G2ZA 3HLDA 3PBQA 1K4FA 2Y2GA 5DTSA 3BFCA 4N1HA 2HDSA 3G32A 1XPBA 5M1AA 5TR7A 1DJCA 4K0XA 3A3FA 1CI8A 5GLBA 3NDEA 4E6XA 2DNSA 5FQIA 3C7VA 4EQIA 3BFFA 1H8ZA 4OQ0A 3MXSA 4WYYA 2BLSA 4NETA 1N9BA 4KQQA 5TFQA 3VP3A 3GQZA 4FCFA 5AQBA 3IT9A 3MXRA 2X02A 4UAAA 3BEBA 3WS1A 3VMAA 5FQQA 2IWBA 4HESA 3ZNYA 5HW3A 2EFXA 3PBTA 2ZC5B 4C3QA 3LY3A 3M6HA 1KVLA 3IHBA 1WYBA 3QNCA 2EX2A 3MZFA 2ZJ9A 1BUEA 4PM7A 4X68A 3NBLA 1IYQA 1TDLA 5FATA 5EE8A 3ZG5A 4EBLA 5E43A 3VOYA 3BECA 4R0QA 3M2JA 3PBSA 2I72A 3VFHA 1IEMA 4OPYA 1BLCA 3PBRA 5U47A 2ZQDA 2ZQCA 4ZDXA 1ERQA 2XDMA 4JXSA 3VSLA 4BL2A 4WZ5C 4OP8A 1SDEA 2P9VB 4HEFA 2WAFA 1FCMA 2QMIA 5FSRA 1CK3A 3QHYA 4LCMA 3GMWA 1YLJA 1K55C 4WEJA 2Y2IA 4RYEA 3SS4A 2PBYA 1BLHA 2EX9A 3LEZA 2Y2LA 3RXXA 1EROA 4KZAA 3IH9A 1XA7A 4DXBA 3DWKA 3IWOA 3SS3A 4OP5A 4FH2A 2XK1A 1SDNA 1ZG6A 4JXWA 3HLFA 3P09A 1GHMA 1S0WA 2E8IA 4PMAA 2WKEA 1BZAA 2PU4A 4CPKA 4KQRA 1GA9A 1K57A 1KGEA 1DY6A 2WZZA 2JBFA 1RCJA 1HTZA 1XKZA 4KZ7A 2XR0A 1W5DA 4N9KA 5EOEA 1I2WA 4GB7A 1KGGA 2J9OA 1KE4A 3A3EA 1NY0A 1IKIA 2Y2MA 5CTMA 5HFOA 2UWXA 3FWLA 3RJUA 5F1FA 3G35A 4WBGA 5HAPA 3IF5A 4ZJ2A 5FA7A 3G30A 3M2KA 2XFTA 3E2KA 3OCLA 3VP0A 1GCEA 4JF5A 2JC7A 5FI2A 5GHXA 1KE3A 3DWZA 3W4PA 1KDSA 2JE5A 3IXHA 4IBRA 2P9VA 5CGWA 3ZGAB 1K56A 1KGFA 3BM6A 4JBFA 1LI9A 1M6KA 2XGNA 5CGSA 2EFUA 5FDHA 1E25A 1ESUA 4HBUA 4B4ZA 5KZHA 4E3LA 1XX2A 4GD8A 3S22A 5CEDA 1ES3A 1VQQA 4C75A 4WELA 4GKUA 4DKIA 1PW1A 3Q7VB 2WGWA 4OQHA 4UHUA 3UE0A 3IXBA 5EPHA 2ZQ8A 4BL3A 4DDSA 3PAGA 4RX2A 2GDNA 3HUNA 1OMEA 1JWVA 2Q9NA 4WZ4A 2Y2OA 5FQJA 3CJMA 4IVIA 2C6WB 3IQAA 4P85A 5M19A 2Y55A 5IHVA 4EV4A 1NXYA 4LV3A 5F82A 3RXWA 3A3DA 1IELA 4XUXA 5L2FA 3BLSA 2XLNA 1MXOA 1Y54A 5DF8A 3ZG7B 1BLPA 5CRFA 3LCEA 4Y0UA 1H5XA 1RGZA 2H10A 3IF6B 4LCLA 1FSYA 3E2LA 4U0XA 4Y7PA 5FQMA 3NY4A 4DE0A 1HZOA 3HLBA 4YFMA 1W8QA 2HDQA 4OKPA 3OPLA 3ZFZA 1LHYA 4PM9A 3BYDA 5CERA 1ONHA 5HL1A 3MKFA 4GDBA 4R1GA 4MEZA 3AGFA 4EBNA 2VGKA 1N4OA 4ZTKA 5DTKA 3EQUA 2ZQ9A 5GL9A 1QMFA 5J8XA 1YQSA 3G34A 1KDWA 3HLWA 4H8RA 5E2FA 1L0GA 5A90A 1ZC2A 2EX8A 2WYXA 1ES4A 3IHAA 1BLSA 4FD8A 5F1GA 3HVFA 4JF6A 1EI5A 4QD4A 3BFEA 3FYZA 4OLDA 3UPOA 4QHCA 2ZC4B 5FAOA 4QY5A 4RA7A 5KSCA 1I2SA 4IEDA 4OOLA 4GNUA 4F94A 1JTDA 2WZXA 5DF7A 4DXCA 4ZBEA 3AGEA 3ZVWA 1SKFA 2ZQAA 4MBHA 4S2NC 4UA7A 1G68A 2QPNA 1PYYA 2Q9MA 5GLCA 1E3UA 2WUQA 1TDGA 3O3VA 4P87A 5GHYA 5GHZA 3CZDA 1FSWA 4UA6A 3W4OA 3GTCA 2J9PA 2JCHA 1NYMA 3VOZA 4B88A 3HUOA 5G18A 3N4IA 3FKVA 4GD6A 4IVKA 2EX6A 1MPLA 1MWSA 2HP5A 3ZNTA 1FCOA 5FAQA 2H5SA 3V50A 3O87A 1FR6A 1O7EA 1FOFA 1VM1A 3ITAA 3OPRA 2Y91A 1XGJA 5EOOA 5A93A 1MWRA 4S2IA 5JYOA 1IKGA 5HAIA 1K6RA 4KZ5A 3OCNA 3GSGA 4KG5A 1K38A 1PZOA 2WGVA 1CEFA 4IBXA 4GZBA 3BLMA 5E2EA 3Q81A 3N8LA 4BLMA 2VGJA 2Z2LB 3O86A 5D3OA 4Z9QA 4C6YA 3BFDA 4BENA 4O7DA 4LV0A 1H8YA 4UA9A 2V20A 3UPNA 1GHPA 5DTTA 1MKIA 1QMEA 3UDIA 3UNWA 2IWCA 4DE2A 2XD1A 2ZM2A 1MY8A 1JVJA 3GRJA 4YINA 1DJBA 3GVBA 3HLCA 3QNBA 4N9LA 5FAPA 5CHJA 4Y0TA 1W8YA 1YMXA 3NI9A 3VP1A 4OQIA 4ZJ1A 3C5AA 5CEBA 3G31A 4BD1A 4E3KA 1G6AA 2IWDA 4X69A 4K0WA 2XF3A 4WMCA 1IYPA 2X71A 4LV2A 4U3TA 3HREA 3PAEA 5A91A 1PZPA 4JKTA 4N1XA 3ZHHA 3HUMA 2RCXA 3IXDA 1M40A 2BG1A 1L0FA 4MBKA 4R4RA 4DF6A 1L2SA 1JWPA 4GDNA 3HLGA 5GLAA 2ZM8A 4OLGA 4A5RA 4P0MA 4K91A 1ES5A 5CHUA 3TSGA 1YLZA 5KMWA 5EVIB 4S2LA 3VSKA 5EVIA 2WGWB 4S2OA 4OQGA 3WS2A 2XD5A 2Y2PA 5FQKA 1YLWA 1ESIA 4P6BA 5FI6A 1Q2PA 5AQ7A 3ZVTA 4N92A 4EWFA 3ITBA 1C3BA 1XA1A 3FV7A 3UDFA 1BSGA 4E6WA 1LI0A 1Q2QA 2R9XA 3HBRA 3IF6C 3WRZA 4RX3A 5CECA 3VFFA 1K57C 2HPBA 1PW8A 5AQAA 3PBOA 2XH9A 4BD0A 1BT5A 1JWZA 5FI7A 3OPHA 3N8SA 2ZLYA 4PM8A 2WAEA 4JXGA 3SOIA 2WK0A 3A3IA 1EWZA 2P74A 3O88A 3OZHA 4KZ8A 1IYSA 4KG2A 2QZ6A 2ZM0A 3MZDA 5HARA 2Y2HA 1W79A 5M18A 3SH7A 3CG5A 1K6SA 4RVAA 1YLYA 4XXRA 3V3SA 5AQ9A 3GV9A 3SH9A 4JXVA 3C4OA 3UN7A 3G4PA 2H0TA 3PTEA 1BTLA 2G2UA 4L0LA 5DVAA 4EUZA 1YMSA 2ZMAA 4OPZA 3MZEA 3S4XA 4S2JA 5FASA 2R9WA 4GN2A 1NZOA 4JF4A 3NIAA 3ZG0A 3NDGA 3IWQA 5BOHA 3UDXA 4PM5A 5CXWA 4E3MA 1WYCA 2WADA 3M6BA 2Y59A 3LY4A 3NC8A 3FZCA 1K4EA 1ALQA 3WWXA 4JPMA 1LLBA 2ZC6B 1PI4A 4OONA 2V1ZA 1PWDA 1K54A 3HL9A 4E3OA 3B3XA 1PWGA 5EUAA 2G2WA 5EVIC 1WE4A 1L0EA 3LO7A 4PM6A 1SCWA 5EECA 4KZ6A 3FKWA 1NYYA 3IXGA 4X53A 3IWIA 1LL9A 1AXBA 1YLTA 1XP4A 1FQGA 2WGIA 4WMCD 3VP4A 2XEPA 3ZCZA 4R4SA 4CJNA 1O07A 4KG6A 1E4DA 5EVID 1XXMA 1IYOA 3A3JA 4E3JA 3N8RA 2DCFA 4R23A 4Y0OA 4E3NA 5F83A 2EXAA 1J9MA 1YT4A 4OH0A 3WS0A 1TEMA 4R3BA 3UE3A 2XQZA
chains in the Genus database with same CATH superfamily
1K25A 4I38A 3MFXA 5F5YA 2Y2NA 2VV8A 1K55A 1F5MA 2X01A 1PWCA 2HDRA 3QP4A 4OPRA 1IOUA 2Y2QA 4KZBA 3Q7VA 4I3AA 4FH4A 4OVDA 1YSQA 2V9AA 1L3LA 1JTGA 3H7WA 5A92A 4WUJA 3VE3A 2QKPA 3JYIA 3T1SA 3WRTA 1MWTA 2NUTC 4M4XA 3T1XA 4S2NA 5FQ9A 5TGFA 3PXPA 3TRCA 1VB6A 3Q07A 4XUZA 4OOMA 2Y79A 3S7OA 5GLDA 1FR1A 3IX4A 3MMHA 3DW0A 3GECA 1STZA 1FCNA 3V3RA 3Q1FA 5CGXA 5JYPA 1H0MA 2PT7A 3QP1A 3SH8A 3S1YA 1D1JA 3G2YA 3T4TA 2G7UA 1HD8A 3CAXA 2PR6A 4MNRA 3PBNA 4Y3IA 5AVEA 4KZ4A 1E3UD 3UO9A 4X56A 3OC2A 3F1NB 3ZG8B 4B4XA 3R4KA 1DJAA 5HSQA 5EVLA 4U0TA 2RL3A 4S2KA 3H82A 2JKTM 4DE3A 4R3JA 4HIAA 2FFFB 5HD3A 4N1HA 2HDSA 3MQOA 1XPBA 3IX3A 3A3FA 1CI8A 5GLBA 4E6XA 2DNSA 5FQIA 2M1CA 1H8ZA 5DFYA 4WYYA 2BLSA 5EFWA 4KQQA 3CITA 5HDDA 2DMWA 2JN7A 2ZC5B 4Y15A 1W63Q 1WYBA 1BUEA 4PM7A 3NBLA 4EBLA 5EE8A 3BECA 4R0QA 3VFHA 1BLCA 3PBRA 4BL2A 3VSLA 4WZ5C 1SDEA 4HEFA 3ICYA 1YLJA 2V1AA 5L8MA 4DXBA 1XA7A 4AFIA 4FH2A 3U4LP 2E8IA 4HY8A 2O9CA 4KQRA 3RFBA 2J9OA 1NY0A 1MZUA 3BY8A 4EEUA 4WBGA 4BWIA 4JF5A 5FI2A 2W3GA 1KE3A 3IXHA 3KSFA 3ZGAB 1KGFA 1M6KA 1SKOA 4JGQA 5CGSA 4HBUA 4NEED 3LEQA 4FUWA 1TS0A 4GKUA 2PAVP 4DKIA 1PW1A 1YKDA 3T4OA 4B93A 3PAGA 2Q9NA 5A8BA 4WZ4A 3CJMA 5M19A 2Y55A 4EV4A 1NXYA 4GJ4A 3RXWA 1IELA 4XUXA 1BLPA 5CRFA 5HX9A 4LCLA 3E2LA 4HJ4A 1F9IA 1HZOA 1LHYA 3BYDA 1ONHA 4GDBA 2EWVA 2VGKA 4ZTKA 5L10A 3EQUA 1QMFA 5A90A 3LICA 5DFXA 3HVFA 1EI5A 3LUQA 5KSCA 1I2SA 1WA9A 3E98A 4OOLA 2W3EA 2WZXA 1E3UA 2WUQA 1FSWA 5FDSA 4QWOA 3GTCA 1OT9A 3FKVA 4NKPA 4IVKA 3DBAA 1UGUA 1MWSA 2HP5A 5FAQA 2H5SA 3O87A 1VM1A 1FOFA 2Y91A 4JGPA 4S2IA 1K0KA 3IS2B 1K6RA 3DAVA 3CPTB 3UB9A 1PZOA 4GHIA 2LB5A 1IFQA 2CMNA 4IBXA 2O9BA 2ZOHA 3Q81A 4HHDA 2VGJA 4C6YA 4BENA 1YAXA 4UA9A 3UB5P 3A0SA 4YINA 5FAPA 4DJ2A 3VP1A 2VEAA 3G31A 1G6AA 5EV0A 4K0WA 4X69A 5CX7A 1IYPA 1OTAA 1CQAA 2W3FA 3NOTC 5LBRA 2RCXA 5HDSA 5EM0A 4YOFA 1DRMA 1D7EA 1DP9A 4A5RA 3HJIA 4P0MA 4K91A 1ES5A 3TSGA 4S2OA 2XD5A 2Y2PA 4HJ3A 3C8CA 1ESIA 4P6BA 3ZVTA 1Q2PA 4EWFA 4N92A 4H6JA 1CJFA 2VZWA 1BSGA 4E6WA 3QP2A 3IF6C 3WRZA 4EERA 3IX8A 2J3TC 4WL9A 3OZHA 4KZ8A 4EUVA 1IYSA 2ZM0A 2V8CA 5M18A 1K6SA 1YLYA 3GV9A 3EWKA 3PTEA 4OPZA 5FASA 3KSHA 2R9WA 4O0PA 3IWQA 1N9OA 1NRJA 4UQIS 4PM5A 3M6BA 2E8JA 1PWDA 3HL9A 4E3OA 3B3XA 1PWGA 3T4JA 4ESPA 1WE4A 3LO7A 4P6ZS 5EECA 4X53A 3F1NA 1FQGA 3VP4A 3ZCZA 3LIDA 1O07A 4E3JA 2I9VA 1OTBA 1VEUB 4R23A 4E3NA 1J9MA 1YT4A 4OH0A 3WS0A 1TEMA 3MBZA 5TBMB 2KX6A 3L7HA 2OV5A 3LIEA 3K3CA 2HP9A 4GLQA 4GOGA 2Y4AA 2V8FA 2B5RA 5HPFA 2QJ5A 4CQHA 2Z2MB 2HF6A 4L9FA 2PU2A 3P98A 4LV1A 4Q8IA 4MN7A 3UPPA 3RTYA 3ISGA 3SW1A 2ZMFA 2MJ6A 3ULFA 1K56D 3MF0A 1S4RA 3P01A 4KZ9A 3I7JA 1RP5A 3EQVA 3RH8B 1TVFA 4KZ3A 3CMZA 3T4QA 4L9EA 2V0WA 3DTEA 4DRTA 1U60A 1PIOA 1NLZA 2WKRA 1K54C 4KQOA 1BULA 4NK3A 1YPRA 2P7JA 2Y2KA 4LPZA 3BFGA 1NJ4A 3HLEA 5DF9A 5KSHA 5DKLA 3AGDA 1YLPA 1KOUA 2OSUA 4BJPA 1CEGA 1S6RA 4JLFA 2ZQ7A 4ETZA 1S4SA 5J3WA 2HJ9C 1F98A 4MDZA 1ZKJA 3F1PA 3Q82A 3GR2A 4JGRA 3D4FA 1YM1A 2A49A 2OLUA 3C7UA 2PD8A 3PBQA 2D01A 5M1AA 5TR7A 1DJCA 4NXFA 1ZHHB 3E4OA 4CLCC 3NDEA 3C7VA 4EQIA 1DP6A 3BFFA 3F1OB 3MXSA 4L9GA 5DJUA 3VP3A 3C38A 3LI9A 4YNRA 2XA7M 4UAAA 2IWBA 4HESA 4BBTA 4EEPA 3IHBA 3NULA 3MZFA 2WKPA 2ZJ9A 4X68A 5FATA 3VOYA 3C2WA 1ZTUA 2I72A 1UWNX 4ZDXA 2ZQCA 4WLAA 3EEHA 4G3KA 2O0YA 5FSRA 1CK3A 3KYEA 3MR0A 2PHYA 4WEJA 3SS4A 2PBYA 1BLHA 2EX9A 2XRNA 1EW0A 3LEZA 3DWKA 4QPRA 1ZG6A 2J80A 2K2NA 4JXWA 2IA2A 1S0WA 4PMAA 2WKEA 2PU4A 1KGEA 2JBFA 1XKZA 3KSGA 3VOLA 3BJNA 3A3EA 1IKIA 2Y2MA 5CTMA 4X1LA 3FWLA 4PKYG 4IHQA 3IF5A 3G30A 3E2KA 1F2KA 1GCEA 1XJ6A 1NLYA 2JC7A 4IBRA 2P9VA 3VE4A 2BASA 1K56A 3BM6A 1XJ4A 2EFUA 4CLCE 2JKRM 1ES3A 5HL6A 4C75A 4WELA 4EW7A 1N9NA 4OQHA 4DDSA 2L4RA 2ZQ8A 3CPTA 2XSSA 3F1PB 4RX2A 1OMEA 2Y2OA 5FQJA 5IHVA 4DJ3A 3A3DA 3TW8A 3MXQA 1MXOA 5DF8A 3LCEA 4CLCB 1RGZA 5FQMA 4U0XA 2J3WA 4DE0A 3HLBA 4YFMA 4MMNA 1W8QA 4HQAA 4PM9A 4BMWA 5CERA 3MKFA 4MEZA 3AGFA 4ME4A 1YQSA 4LRYC 1T1AA 2EX8A 2WYXA 1ES4A 3IHAA 1BLSA 4FD8A 5F1GA 3BFEA 3FYZA 4F3LA 4QHCA 5FAOA 4QY5A 4Z1WA 3ZYTA 3ZVWA 3TE8A 3U2AA 4UA7A 1G68A 1PYYA 2QPNA 5GLCA 1TDGA 3O3VA 3TJZC 3CZDA 4R3AA 5I5LA 5FL3A 3EGXC 2J9PA 3UB6A 4B88A 1NYMA 2JKTI 4MN5A 5G18A 3N4IA 3MS6A 3KSIA 2HGVA 1H8MA 1XJ3A 3ZNTA 3OPRA 1O7EA 5EOOA 3ITAA 5A93A 1XGJA 2W3HA 2PRFA 1K38A 2WGVA 4GZBA 3BLMA 4Z9QA 1AWIA 2GX5A 1H8YA 1GHPA 1TS7A 2YKFA 2ZM2A 1JVJA 3GRJA 1DJBA 1VETB 4Y0TA 4OQIA 3C5AA 4BD1A 4E3KA 4Q0HA 2PYRA 2XF3A 4WMCA 2W1TA 2X71A 3KYZA 3T12B 4JKTA 4IUKA 3HJKA 1PNEA 3B47A 1M40A 2OAQ1 3IXDA 1L2SA 1JWPA 4OLGA 4R6LA 2Z6DA 4PKYA 3VSKA 3WS2A 4DN0A 3CLOA 5AQ7A 3ITBA 1P9WA 3CWFA 3FV7A 2EWWA 1LI0A 3W2ZA 2A2LA 3HBRA 2HJEA 4RX3A 3VFFA 4BBUA 2M7UA 2LB9A 2WAEA 4JXGA 3SOIA 2P74A 1FILA 1G28A 1XFNA 3DTIA 4JXVA 3G4PA 5DVAA 3UB8A 1YMSA 3F1OA 2VA0A 3IBRA 4GN2A 5FEGA 1ODVA 5CXWA 1LT0A 1WYCA 2Y59A 3IBJA 3FZCA 4G3WA 1J3WA 1LLBA 2ZC6B 1PI4A 3KYQA 1X0OA 2G2WA 2GJ3A 1S1YA 3HCYA 1LL9A 2WGIA 4WMCD 4CJNA 5EVID 1IYOA 2VGLM 2DCFA 2VK3A 4R70A 3R7WB 4LRZE 2ZOIA 5F68A 5AVFA 2FFYA 4I3JA 4WEKA 5CTNA 2ZC3B 3SS5A 1TS6A 4NXBA 3TG9A 4I3IA 4JGOA 3LYXA 2V2FF 4D60A 3T4LA 2CC1A 1W7FA 4EBPA 1GA0A 2W1TB 3DTMA 1S1ZA 5E2HA 1SHVA 3K2NA 1JNUA 3FG8A 4B9OA 4D2OA 3V67A 4KQDA 2PYPA 4WM9A 3D3OA 4QY6A 3A0RA 1LL5A 3LIAA 2XA7S 1GSVA 1OPXA 2OLVA 2OOLA 3GDIA 2J8YA 1P9RA 1ERMA 3E4PA 3IF6A 1NZUA 4MBFA 5HZHA 3VP2A 5EVEA 3N7WA 5L09A 2DRWA 4PPRA 3UE1A 3LGOA 1KE0A 4OPQA 1ZG4A 4WN5A 3E0YA 1Z09A 2HDUA 2OWHA 4GW9A 2H0YA 4FSFA 4HNBA 4KENB 3T1QB 2VX8A 2H28A 2Y2JA 5G4YA 2WKHA 4QU3A 4ARZA 3T1RA 3UY6A 3Q7ZA 4S2PA 1KVMA 3T4SA 1NRFA 5HAQA 4X6TA 3PHYA 3TOIA 2WKQA 2JKRI 1ES2A 1MWUA 4QB8A 5CHMA 4MLLA 3WS5A 1GHIA 2VV7A 4WZ5A 1MBLA 3HLDA 1OT6A 4K0XA 4OQ0A 4HI4A 2HV1A 3CUEC 1N9BA 3R7WA 2QHKA 5AQBA 4FCFA 3IT9A 3MXRA 3BEBA 3WS1A 3S7NA 3VMAA 3ZNYA 2EFXA 2PBDP 3PBTA 3QNCA 2PD7A 3ZG5A 5E43A 3M2JA 1IEMA 4OPYA 5U47A 2ZQDA 1ERQA 2XDMA 2W1RA 2P9VB 4EESA 1FCMA 4LCMA 1D06A 1K55C 5TJJA 2Y2IA 1W63M 3IS2A 4RYEA 1P97A 3IH9A 3IWOA 3LIBA 3SS3A 1MC0A 2XK1A 1SDNA 2QWSA 2Y8HA 3LR4A 3S7PA 3HLFA 3P09A 4CPKA 1K57A 2WZZA 2XR0A 3NOUC 2O9AA 5EOEA 1I2WA 4GB7A 1KGGA 1KE4A 4HH3A 3RJUA 5HAPA 5FA7A 2GZAA 3M2KA 3VP0A 3OCLA 5GHXA 4GHIB 3W4PA 1PRQA 4Y5FA 5CGWA 4JBFA 3KX0X 3FPVA 2XGNA 5FDHA 1ESUA 4B4ZA 4E3LA 1XX2A 4GD8A 4Y2FA 3S22A 3PYPA 4NG2A 4ZRRA 2WGWA 3LR3A 5EPHA 3HUNA 5DJTA 3LI8A 1JWVA 1T1BA 2AVXA 4IVIA 3IQAA 4P85A 5IU1A 4LV3A 5F82A 2PR5A 4GS9B 3ZG7B 4Y7PA 3IF6B 1FIKA 1SZVA 2FH5A 2H10A 1Y4OA 3ZFZA 4II7A 4MN6A 5HL1A 4R1GA 4EBNA 1N4OA 3BWLA 5DTKA 2ZQ9A 3MJQA 3H7WB 3HLWA 1KDWA 4H8RA 5E2FA 1L0GA 4R38A 2D02A 1ZC2A 1VHMA 4ETXA 4QD4A 4OLDA 3UPOA 4IUHA 1GSWA 3FPWA 1TS8A 2JHEA 4GNUA 4F94A 1JTDA 2Z6CA 4ZBEA 3AGEA 4LLOB 5HDCA 2ZQAA 4MBHA 4S2NC 2Q9MA 1BYWA 4P87A 5GHYA 5GHZA 2KOIA 2R78A 2JCHA 3VOZA 4GD6A 2EX6A 4HJ6A 3D9YA 3BY9A 1FR6A 1G6OA 1MWRA 5HAIA 3JVUA 3OCNA 3GSGA 5EM1A 1V9YA 1S66L 1HLUP 3UMEA 1MKMA 2Z2LB 3O86A 3BFDA 2V20A 1MKIA 3UNWA 2IWCA 1MY8A 5KIZA 3HLCA 4N9LA 3NI9A 4ZJ1A 2ZL1A 3CI6A 2A24A 3EGDC 4LV2A 2VGLS 4GS9A 1T18A 1PZPA 4MBKA 2BG1A 1L0FA 4DF6A 4GDNA 2ZM8A 3O5YA 4EETB 5CHUA 1YLZA 5KMWA 1NWZA 5EVIA 2WGWB 4OQGA 2A24B 4Y17A 5FQKA 2ZL1B 3DTKA 5FI6A 1C3BA 1XA1A 3UDFA 3T4KA 1Q2QA 2R9XA 5FEFA 4HOIA 3L9KA 5CECA 1K57C 5AQAA 1PW8A 2KDKA 4BD0A 1BT5A 5FI7A 3N8SA 2ZLYA 3CHWP 2WK0A 1EWZA 3MQQA 2Y2HA 3SH7A 3CG5A 1OTIA 3LFVA 3P7NA 5AQ9A 3C30A 3C4OA 2OAP1 2H0TA 1BTLA 2G2UA 4L0LA 4EUZA 2ZMAA 4O8GA 3MZEA 3S4XA 3BW6A 4S2JA 1XJ2A 1NZOA 4JF4A 3ZG0A 1VETA 2HZ5A 2Q0OA 3NDGA 3NOPC 4XT2B 5BOHA 3UDXA 3LY4A 3NC8A 3WWXA 4JPMA 4OONA 2V1ZA 1K54A 2JKFA 5EUAA 3EOIA 4LRXC 4KZ6A 5HPIA 1NYYA 3IXGA 3IWIA 1AXBA 1YLTA 1N9LA 5F6AA 1G5UA 2ACGA 2XEPA 4R4SA 1XXMA 1T1CA 3N8RA 3CUEA 5F83A 2EXAA 2P04A 5JYOA 2XQZA 2L0WA 3ZDJA 4HBTA 2J3TD 1L0DA 2HP6A 1PI5A 2QYBA 1HVBA 3MFDA 3V5MA 2W27A 3WS4A 3K3DA 4F3LB 2EXBA 4BQMA 4UEYA 2ZC7A 3NHQA 3C4PA 1GSXA 3BRMA 3N6IA 3S7QA 3W4QA 4HH2A 3H82B 1SKOB 1Z6FA 3V39A 4ID4A 5HWVA 1Y28A 1XGIA 5E2GA 5J7EA 3OPPA 5I94A 1ONGA 4ZAMA 1XFQA 2XFSA 4E3IA 4X55A 3W8KA 4M3KA 2C5WB 3OBFA 2V0UA 3IH8A 4S2MA 3NCKA 3JPUA 1ACFA 1LSWA 1CI9A 4OOYA 2J7VA 4O01A 3MQ0A 5J4EA 4PHTA 3QP8A 4DE1A 2K7SA 2WKIA 1RGYA 1I5QA 2B18A 4DDYA 2O99A 2ZD8A 3FC7A 4LENA 5L07A 4QJGA 5IS1A 2QJ7A 3MKEA 4X25A 3UB7A 4CLCD 4ZJ3A 3ZG9B 3D72A 2A3UA 2YKHA 3G2ZA 1K4FA 2Y2GA 4P6ZM 3BFCA 5DTSA 3G32A 2PDRA 5HWWA 4NETA 5TFQA 4HP4A 2KLIA 3GQZA 2X02A 5FQQA 3PR6A 1H3QA 4XT2A 5HW3A 4C3QA 3LY3A 3M6HA 2W3DA 1KVLA 4RQ9A 2EX2A 4GCZA 1IYQA 1TDLA 4X1MA 3PBSA 5IT5A 4JXSA 2V1BA 5MC7A 3T50A 4OP8A 3LR5A 2WAFA 2QMIA 4I5SA 4DMZA 3QHYA 3GMWA 4ARZB 1TD5A 2Y2LA 3RXXA 1EROA 4KZAA 4OP5A 3BQ8A 1GHMA 1BZAA 4UQIM 1GA9A 4Q0IA 4Q0JA 1DY6A 2VKSA 1RCJA 1HTZA 3MSHA 4KZ7A 1W5DA 4N9KA 2UV0E 1UWPX 5HFOA 1OJGA 2UWXA 5F1FA 3G35A 4ZJ2A 2XFTA 1T19A 5HD5A 4LGWA 4E04A 3DWZA 1KDSA 1OTDA 2JE5A 1LSXA 4IJGA 4FOFA 2VLGA 4Y13A 3QP6A 1A0KA 1LI9A 1E25A 5KZHA 5CEDA 4EU0A 2INWA 1VQQA 3Q7VB 4BL3A 4UHUA 3UE0A 3IXBA 1YSPA 2GDNA 3QP5A 2VV6A 2C6WB 2VJWA 2B95A 4WF0A 5L2FA 3BLSA 2XLNA 1Y54A 1TF1A 4Y0UA 4FTXA 1H5XA 4YWZA 1FSYA 3A0VA 3G6OA 3NY4A 2HDQA 4OKPA 3OPLA 4MCWA 1P0ZA 5C5KA 4KUKA 5GL9A 5J8XA 3G34A 2ZBBA 3UE6A 5TBMA 4JF6A 2ZC4B 4RA7A 4CLCA 4IEDA 5HWTA 5DKKA 5DF7A 4DXCA 1SKFA 2JKGA 4UA6A 3W4OA 2EA9A 3HUOA 1MPLA 3ZQ5A 1FCOA 1OTEA 4EQ1A 3V50A 1IKGA 2L1MA 4KZ5A 2XROA 4KG5A 1CEFA 5E2EA 4BLMA 3N8LA 5D3OA 2M7VA 4O7DA 4LV0A 1VEUA 3UPNA 5DTTA 1S67L 4DE2A 1QMEA 3UDIA 2XD1A 3GVBA 3QNBA 5CHJA 1W8YA 1YMXA 5CEBA 1PFLA 2IWDA 2B02A 3B33A 2ZMVA 4U3TA 3HREA 4LFUA 3PAEA 5A91A 3H9WA 4N1XA 3ZHHA 3HUMA 4R4RA 3OOVA 4H6JB 2FZ0A 3HLGA 5GLAA 5EVIB 4S2LA 4KUOA 4BBVA 1YLWA 3OLOA 2OWJA 5K5BA 3JVVA 5AJGA 5F69A 3B42A 1V9ZA 3NJAA 2W0NA 4G3VA 2K31A 2HPBA 3PBOA 2XH9A 1JWZA 2GNXA 3OPHA 4PM8A 1DP8A 3A3IA 3O88A 3LR0A 4KG2A 2QZ6A 3MZDA 5HARA 1W79A 4NXGA 4RVAA 3EEAA 4XXRA 3V3SA 3LIFA 3SH9A 3BQAA 3UN7A 1LSVA 4HP9A 3NIAA 3SZTA 3VV4A 4E3MA 2P08A 2WADA 4PAUA 1ALQA 1K4EA 1CF0A 3KO6A 4NXEA 5EVIC 1L0EA 4PM6A 1SCWA 3FKWA 4K08A 4EXOA 3UMDA 3NECA 2BTFP 5G4ZA 1LL8A 3E4QA 1XP4A 2NUPC 1OJ5A 4KG6A 1E4DA 3A3JA 4Y0OA 4I39A 4R3BA 3UE3A
chains in the Genus database with same CATH topology
3MBZA 3ZDJA 2OV5A 1K25A 4HBTA 2FFYA 2HP9A 2Y2NA 4GOGA 4WEKA 2Y4AA 5CTNA 1L0DA 1K55A 2B5RA 2HP6A 1PI5A 2ZC3B 3SS5A 2X01A 3TG9A 1PWCA 2HDRA 1HVBA 4OPRA 2Z2MB 2PU2A 3MFDA 2V2FF 3V5MA 3P98A 4LV1A 4Q8IA 3WS4A 2CC1A 2EXBA 1W7FA 2Y2QA 4EBPA 4BQMA 1GA0A 4KZBA 3DTMA 3UPPA 5E2HA 3ISGA 1SHVA 3Q7VA 2ZC7A 4FH4A 4OVDA 1K56D 3C4PA 3BRMA 3N6IA 4D2OA 1JTGA 3W4QA 5A92A 4WM9A 4KZ9A 4QY6A 3JYIA 3I7JA 1RP5A 1Z6FA 3V39A 4ID4A 3WRTA 1LL5A 3EQVA 2OLVA 1XGIA 1MWTA 5E2GA 1TVFA 2J8YA 3OPPA 3CMZA 4KZ3A 1ERMA 5I94A 1ONGA 3IF6A 4MBFA 1NZUA 4S2NA 4ZAMA 5FQ9A 3VP2A 5TGFA 4DRTA 2XFSA 4E3IA 4X55A 3W8KA 4M3KA 3N7WA 3Q07A 2C5WB 1U60A 1PIOA 2DRWA 4PPRA 3UE1A 1KE0A 4XUZA 4OPQA 3IH8A 4S2MA 4OOMA 1K54C 4KQOA 1ZG4A 3NCKA 5GLDA 1FR1A 1BULA 4NK3A 5HX9A 2HDUA 3DW0A 2Y2KA 3BFGA 1NJ4A 3HLEA 1CI9A 5DF9A 5KSHA 4OOYA 2J7VA 2H0YA 4FSFA 1FCNA 3V3RA 3Q1FA 5CGXA 3AGDA 5JYPA 4KENB 1YLPA 3SH8A 3S1YA 4DE1A 2OSUA 3G2YA 2WKIA 4BJPA 1RGYA 1HD8A 2Y2JA 1CEGA 1I5QA 4DDYA 1S6RA 4JLFA 4MNRA 2WKHA 3PBNA 4QU3A 2ZD8A 2ZQ7A 4KZ4A 1E3UD 3UO9A 4X56A 4LENA 3UY6A 3OC2A 3Q7ZA 1ZKJA 3ZG8B 4B4XA 4S2PA 4QJGA 1DJAA 1KVMA 1NRFA 3Q82A 3MKEA 5EVLA 3GR2A 5HAQA 4U0TA 4X6TA 2RL3A 3D4FA 3WS5A 4S2KA 1YM1A 3TOIA 4DE3A 4R3JA 1ES2A 1MWUA 4QB8A 2A49A 4MLLA 5CHMA 2OLUA 1GHIA 2A3UA 3C7UA 4WZ5A 4ZJ3A 1MBLA 3ZG9B 2FFFB 3G2ZA 3HLDA 3PBQA 1K4FA 2Y2GA 5DTSA 3BFCA 4N1HA 2HDSA 3G32A 1XPBA 5M1AA 5TR7A 1DJCA 4K0XA 3A3FA 1CI8A 5GLBA 3NDEA 4E6XA 2DNSA 5FQIA 3C7VA 4EQIA 3BFFA 1H8ZA 4OQ0A 3MXSA 4WYYA 2BLSA 4NETA 1N9BA 4KQQA 5TFQA 3VP3A 3GQZA 4FCFA 5AQBA 3IT9A 3MXRA 2X02A 4UAAA 3BEBA 3WS1A 3VMAA 5FQQA 2IWBA 4HESA 3ZNYA 5HW3A 2EFXA 3PBTA 2ZC5B 4C3QA 3LY3A 3M6HA 1KVLA 3IHBA 1WYBA 3QNCA 2EX2A 3MZFA 2ZJ9A 1BUEA 4PM7A 4X68A 3NBLA 1IYQA 1TDLA 5FATA 5EE8A 3ZG5A 4EBLA 5E43A 3VOYA 3BECA 4R0QA 3M2JA 3PBSA 2I72A 3VFHA 1IEMA 4OPYA 1BLCA 3PBRA 5U47A 2ZQDA 2ZQCA 4ZDXA 1ERQA 2XDMA 4JXSA 3VSLA 4BL2A 4WZ5C 4OP8A 1SDEA 2P9VB 4HEFA 2WAFA 1FCMA 2QMIA 5FSRA 1CK3A 3QHYA 4LCMA 3GMWA 1YLJA 1K55C 4WEJA 2Y2IA 4RYEA 3SS4A 2PBYA 1BLHA 2EX9A 3LEZA 2Y2LA 3RXXA 1EROA 4KZAA 3IH9A 1XA7A 4DXBA 3DWKA 3IWOA 3SS3A 4OP5A 4FH2A 2XK1A 1SDNA 1ZG6A 4JXWA 3HLFA 3P09A 1GHMA 1S0WA 2E8IA 4PMAA 2WKEA 1BZAA 2PU4A 4CPKA 4KQRA 1GA9A 1K57A 1KGEA 1DY6A 2WZZA 2JBFA 1RCJA 1HTZA 1XKZA 4KZ7A 2XR0A 1W5DA 4N9KA 5EOEA 1I2WA 4GB7A 1KGGA 2J9OA 1KE4A 3A3EA 1NY0A 1IKIA 2Y2MA 5CTMA 5HFOA 2UWXA 3FWLA 3RJUA 5F1FA 3G35A 4WBGA 5HAPA 3IF5A 4ZJ2A 5FA7A 3G30A 3M2KA 2XFTA 3E2KA 3OCLA 3VP0A 1GCEA 4JF5A 2JC7A 5FI2A 5GHXA 1KE3A 3DWZA 3W4PA 1KDSA 2JE5A 3IXHA 4IBRA 2P9VA 5CGWA 3ZGAB 1K56A 1KGFA 3BM6A 4JBFA 1LI9A 1M6KA 2XGNA 5CGSA 2EFUA 5FDHA 1E25A 1ESUA 4HBUA 4B4ZA 5KZHA 4E3LA 1XX2A 4GD8A 3S22A 5CEDA 1ES3A 1VQQA 4C75A 4WELA 4GKUA 4DKIA 1PW1A 3Q7VB 2WGWA 4OQHA 4UHUA 3UE0A 3IXBA 5EPHA 2ZQ8A 4BL3A 4DDSA 3PAGA 4RX2A 2GDNA 3HUNA 1OMEA 1JWVA 2Q9NA 4WZ4A 2Y2OA 5FQJA 3CJMA 4IVIA 2C6WB 3IQAA 4P85A 5M19A 2Y55A 5IHVA 4EV4A 1NXYA 4LV3A 5F82A 3RXWA 3A3DA 1IELA 4XUXA 5L2FA 3BLSA 2XLNA 1MXOA 1Y54A 5DF8A 3ZG7B 1BLPA 5CRFA 3LCEA 4Y0UA 1H5XA 1RGZA 2H10A 3IF6B 4LCLA 1FSYA 3E2LA 4U0XA 4Y7PA 5FQMA 3NY4A 4DE0A 1HZOA 3HLBA 4YFMA 1W8QA 2HDQA 4OKPA 3OPLA 3ZFZA 1LHYA 4PM9A 3BYDA 5CERA 1ONHA 5HL1A 3MKFA 4GDBA 4R1GA 4MEZA 3AGFA 4EBNA 2VGKA 1N4OA 4ZTKA 5DTKA 3EQUA 2ZQ9A 5GL9A 1QMFA 5J8XA 1YQSA 3G34A 1KDWA 3HLWA 4H8RA 5E2FA 1L0GA 5A90A 1ZC2A 2EX8A 2WYXA 1ES4A 3IHAA 1BLSA 4FD8A 5F1GA 3HVFA 4JF6A 1EI5A 4QD4A 3BFEA 3FYZA 4OLDA 3UPOA 4QHCA 2ZC4B 5FAOA 4QY5A 4RA7A 5KSCA 1I2SA 4IEDA 4OOLA 4GNUA 4F94A 1JTDA 2WZXA 5DF7A 4DXCA 4ZBEA 3AGEA 3ZVWA 1SKFA 2ZQAA 4MBHA 4S2NC 4UA7A 1G68A 2QPNA 1PYYA 2Q9MA 5GLCA 1E3UA 2WUQA 1TDGA 3O3VA 4P87A 5GHYA 5GHZA 3CZDA 1FSWA 4UA6A 3W4OA 3GTCA 2J9PA 2JCHA 1NYMA 3VOZA 4B88A 3HUOA 5G18A 3N4IA 3FKVA 4GD6A 4IVKA 2EX6A 1MPLA 1MWSA 2HP5A 3ZNTA 1FCOA 5FAQA 2H5SA 3V50A 3O87A 1FR6A 1O7EA 1FOFA 1VM1A 3ITAA 3OPRA 2Y91A 1XGJA 5EOOA 5A93A 1MWRA 4S2IA 5JYOA 1IKGA 5HAIA 1K6RA 4KZ5A 3OCNA 3GSGA 4KG5A 1K38A 1PZOA 2WGVA 1CEFA 4IBXA 4GZBA 3BLMA 5E2EA 3Q81A 3N8LA 4BLMA 2VGJA 2Z2LB 3O86A 5D3OA 4Z9QA 4C6YA 3BFDA 4BENA 4O7DA 4LV0A 1H8YA 4UA9A 2V20A 3UPNA 1GHPA 5DTTA 1MKIA 1QMEA 3UDIA 3UNWA 2IWCA 4DE2A 2XD1A 2ZM2A 1MY8A 1JVJA 3GRJA 4YINA 1DJBA 3GVBA 3HLCA 3QNBA 4N9LA 5FAPA 5CHJA 4Y0TA 1W8YA 1YMXA 3NI9A 3VP1A 4OQIA 4ZJ1A 3C5AA 5CEBA 3G31A 4BD1A 4E3KA 1G6AA 2IWDA 4X69A 4K0WA 2XF3A 4WMCA 1IYPA 2X71A 4LV2A 4U3TA 3HREA 3PAEA 5A91A 1PZPA 4JKTA 4N1XA 3ZHHA 3HUMA 2RCXA 3IXDA 1M40A 2BG1A 1L0FA 4MBKA 4R4RA 4DF6A 1L2SA 1JWPA 4GDNA 3HLGA 5GLAA 2ZM8A 4OLGA 4A5RA 4P0MA 4K91A 1ES5A 5CHUA 3TSGA 1YLZA 5KMWA 5EVIB 4S2LA 3VSKA 5EVIA 2WGWB 4S2OA 4OQGA 3WS2A 2XD5A 2Y2PA 5FQKA 1YLWA 1ESIA 4P6BA 5FI6A 1Q2PA 5AQ7A 3ZVTA 4N92A 4EWFA 3ITBA 1C3BA 1XA1A 3FV7A 3UDFA 1BSGA 4E6WA 1LI0A 1Q2QA 2R9XA 3HBRA 3IF6C 3WRZA 4RX3A 5CECA 3VFFA 1K57C 2HPBA 1PW8A 5AQAA 3PBOA 2XH9A 4BD0A 1BT5A 1JWZA 5FI7A 3OPHA 3N8SA 2ZLYA 4PM8A 2WAEA 4JXGA 3SOIA 2WK0A 3A3IA 1EWZA 2P74A 3O88A 3OZHA 4KZ8A 1IYSA 4KG2A 2QZ6A 2ZM0A 3MZDA 5HARA 2Y2HA 1W79A 5M18A 3SH7A 3CG5A 1K6SA 4RVAA 1YLYA 4XXRA 3V3SA 5AQ9A 3GV9A 3SH9A 4JXVA 3C4OA 3UN7A 3G4PA 2H0TA 3PTEA 1BTLA 2G2UA 4L0LA 5DVAA 4EUZA 1YMSA 2ZMAA 4OPZA 3MZEA 3S4XA 4S2JA 5FASA 2R9WA 4GN2A 1NZOA 4JF4A 3NIAA 3ZG0A 3NDGA 3IWQA 5BOHA 3UDXA 4PM5A 5CXWA 4E3MA 1WYCA 2WADA 3M6BA 2Y59A 3LY4A 3NC8A 3FZCA 1K4EA 1ALQA 3WWXA 4JPMA 1LLBA 2ZC6B 1PI4A 4OONA 2V1ZA 1PWDA 1K54A 3HL9A 4E3OA 3B3XA 1PWGA 5EUAA 2G2WA 5EVIC 1WE4A 1L0EA 3LO7A 4PM6A 1SCWA 5EECA 4KZ6A 3FKWA 1NYYA 3IXGA 4X53A 3IWIA 1LL9A 1AXBA 1YLTA 1XP4A 1FQGA 2WGIA 4WMCD 3VP4A 2XEPA 3ZCZA 4R4SA 4CJNA 1O07A 4KG6A 1E4DA 5EVID 1XXMA 1IYOA 3A3JA 4E3JA 3N8RA 2DCFA 4R23A 4Y0OA 4E3NA 5F83A 2EXAA 1J9MA 1YT4A 4OH0A 3WS0A 1TEMA 4R3BA 3UE3A 2XQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBZ A;  3ZDJ A;  2OV5 A;  1K25 A;  4HBT A;  2FFY A;  2HP9 A;  2Y2N A;  4GOG A;  4WEK A;  2Y4A A;  5CTN A;  1L0D A;  1K55 A;  2B5R A;  2HP6 A;  1PI5 A;  2ZC3 B;  3SS5 A;  2X01 A;  3TG9 A;  1PWC A;  2HDR A;  1HVB A;  4OPR A;  2Z2M B;  2PU2 A;  3MFD A;  2V2F F;  3V5M A;  3P98 A;  4LV1 A;  4Q8I A;  3WS4 A;  2CC1 A;  2EXB A;  1W7F A;  2Y2Q A;  4EBP A;  4BQM A;  1GA0 A;  4KZB A;  3DTM A;  3UPP A;  5E2H A;  3ISG A;  1SHV A;  3Q7V A;  2ZC7 A;  4FH4 A;  4OVD A;  1K56 D;  3C4P A;  3BRM A;  3N6I A;  4D2O A;  1JTG A;  3W4Q A;  5A92 A;  4WM9 A;  4KZ9 A;  4QY6 A;  3JYI A;  3I7J A;  1RP5 A;  1Z6F A;  3V39 A;  4ID4 A;  3WRT A;  1LL5 A;  3EQV A;  2OLV A;  1XGI A;  1MWT A;  5E2G A;  1TVF A;  2J8Y A;  3OPP A;  3CMZ A;  4KZ3 A;  1ERM A;  5I94 A;  1ONG A;  3IF6 A;  4MBF A;  1NZU A;  4S2N A;  4ZAM A;  5FQ9 A;  3VP2 A;  5TGF A;  4DRT A;  2XFS A;  4E3I A;  4X55 A;  3W8K A;  4M3K A;  3N7W A;  3Q07 A;  2C5W B;  1U60 A;  1PIO A;  2DRW A;  4PPR A;  3UE1 A;  1KE0 A;  4XUZ A;  4OPQ A;  3IH8 A;  4S2M A;  4OOM A;  1K54 C;  4KQO A;  1ZG4 A;  3NCK A;  5GLD A;  1FR1 A;  1BUL A;  4NK3 A;  5HX9 A;  2HDU A;  3DW0 A;  2Y2K A;  3BFG A;  1NJ4 A;  3HLE A;  1CI9 A;  5DF9 A;  5KSH A;  4OOY A;  2J7V A;  2H0Y A;  4FSF A;  1FCN A;  3V3R A;  3Q1F A;  5CGX A;  3AGD A;  5JYP A;  4KEN B;  1YLP A;  3SH8 A;  3S1Y A;  4DE1 A;  2OSU A;  3G2Y A;  2WKI A;  4BJP A;  1RGY A;  1HD8 A;  2Y2J A;  1CEG A;  1I5Q A;  4DDY A;  1S6R A;  4JLF A;  4MNR A;  2WKH A;  3PBN A;  4QU3 A;  2ZD8 A;  2ZQ7 A;  4KZ4 A;  1E3U D;  3UO9 A;  4X56 A;  4LEN A;  3UY6 A;  3OC2 A;  3Q7Z A;  1ZKJ A;  3ZG8 B;  4B4X A;  4S2P A;  4QJG A;  1DJA A;  1KVM A;  1NRF A;  3Q82 A;  3MKE A;  5EVL A;  3GR2 A;  5HAQ A;  4U0T A;  4X6T A;  2RL3 A;  3D4F A;  3WS5 A;  4S2K A;  1YM1 A;  3TOI A;  4DE3 A;  4R3J A;  1ES2 A;  1MWU A;  4QB8 A;  2A49 A;  4MLL A;  5CHM A;  2OLU A;  1GHI A;  2A3U A;  3C7U A;  4WZ5 A;  4ZJ3 A;  1MBL A;  3ZG9 B;  2FFF B;  3G2Z A;  3HLD A;  3PBQ A;  1K4F A;  2Y2G A;  5DTS A;  3BFC A;  4N1H A;  2HDS A;  3G32 A;  1XPB A;  5M1A A;  5TR7 A;  1DJC A;  4K0X A;  3A3F A;  1CI8 A;  5GLB A;  3NDE A;  4E6X A;  2DNS A;  5FQI A;  3C7V A;  4EQI A;  3BFF A;  1H8Z A;  4OQ0 A;  3MXS A;  4WYY A;  2BLS A;  4NET A;  1N9B A;  4KQQ A;  5TFQ A;  3VP3 A;  3GQZ A;  4FCF A;  5AQB A;  3IT9 A;  3MXR A;  2X02 A;  4UAA A;  3BEB A;  3WS1 A;  3VMA A;  5FQQ A;  2IWB A;  4HES A;  3ZNY A;  5HW3 A;  2EFX A;  3PBT A;  2ZC5 B;  4C3Q A;  3LY3 A;  3M6H A;  1KVL A;  3IHB A;  1WYB A;  3QNC A;  2EX2 A;  3MZF A;  2ZJ9 A;  1BUE A;  4PM7 A;  4X68 A;  3NBL A;  1IYQ A;  1TDL A;  5FAT A;  5EE8 A;  3ZG5 A;  4EBL A;  5E43 A;  3VOY A;  3BEC A;  4R0Q A;  3M2J A;  3PBS A;  2I72 A;  3VFH A;  1IEM A;  4OPY A;  1BLC A;  3PBR A;  5U47 A;  2ZQD A;  2ZQC A;  4ZDX A;  1ERQ A;  2XDM A;  4JXS A;  3VSL A;  4BL2 A;  4WZ5 C;  4OP8 A;  1SDE A;  2P9V B;  4HEF A;  2WAF A;  1FCM A;  2QMI A;  5FSR A;  1CK3 A;  3QHY A;  4LCM A;  3GMW A;  1YLJ A;  1K55 C;  4WEJ A;  2Y2I A;  4RYE A;  3SS4 A;  2PBY A;  1BLH A;  2EX9 A;  3LEZ A;  2Y2L A;  3RXX A;  1ERO A;  4KZA A;  3IH9 A;  1XA7 A;  4DXB A;  3DWK A;  3IWO A;  3SS3 A;  4OP5 A;  4FH2 A;  2XK1 A;  1SDN A;  1ZG6 A;  4JXW A;  3HLF A;  3P09 A;  1GHM A;  1S0W A;  2E8I A;  4PMA A;  2WKE A;  1BZA A;  2PU4 A;  4CPK A;  4KQR A;  1GA9 A;  1K57 A;  1KGE A;  1DY6 A;  2WZZ A;  2JBF A;  1RCJ A;  1HTZ A;  1XKZ A;  4KZ7 A;  2XR0 A;  1W5D A;  4N9K A;  5EOE A;  1I2W A;  4GB7 A;  1KGG A;  2J9O A;  1KE4 A;  3A3E A;  1NY0 A;  1IKI A;  2Y2M A;  5CTM A;  5HFO A;  2UWX A;  3FWL A;  3RJU A;  5F1F A;  3G35 A;  4WBG A;  5HAP A;  3IF5 A;  4ZJ2 A;  5FA7 A;  3G30 A;  3M2K A;  2XFT A;  3E2K A;  3OCL A;  3VP0 A;  1GCE A;  4JF5 A;  2JC7 A;  5FI2 A;  5GHX A;  1KE3 A;  3DWZ A;  3W4P A;  1KDS A;  2JE5 A;  3IXH A;  4IBR A;  2P9V A;  5CGW A;  3ZGA B;  1K56 A;  1KGF A;  3BM6 A;  4JBF A;  1LI9 A;  1M6K A;  2XGN A;  5CGS A;  2EFU A;  5FDH A;  1E25 A;  1ESU A;  4HBU A;  4B4Z A;  5KZH A;  4E3L A;  1XX2 A;  4GD8 A;  3S22 A;  5CED A;  1ES3 A;  1VQQ A;  4C75 A;  4WEL A;  4GKU A;  4DKI A;  1PW1 A;  3Q7V B;  2WGW A;  4OQH A;  4UHU A;  3UE0 A;  3IXB A;  5EPH A;  2ZQ8 A;  4BL3 A;  4DDS A;  3PAG A;  4RX2 A;  2GDN A;  3HUN A;  1OME A;  1JWV A;  2Q9N A;  4WZ4 A;  2Y2O A;  5FQJ A;  3CJM A;  4IVI A;  2C6W B;  3IQA A;  4P85 A;  5M19 A;  2Y55 A;  5IHV A;  4EV4 A;  1NXY A;  4LV3 A;  5F82 A;  3RXW A;  3A3D A;  1IEL A;  4XUX A;  5L2F A;  3BLS A;  2XLN A;  1MXO A;  1Y54 A;  5DF8 A;  3ZG7 B;  1BLP A;  5CRF A;  3LCE A;  4Y0U A;  1H5X A;  1RGZ A;  2H10 A;  3IF6 B;  4LCL A;  1FSY A;  3E2L A;  4U0X A;  4Y7P A;  5FQM A;  3NY4 A;  4DE0 A;  1HZO A;  3HLB A;  4YFM A;  1W8Q A;  2HDQ A;  4OKP A;  3OPL A;  3ZFZ A;  1LHY A;  4PM9 A;  3BYD A;  5CER A;  1ONH A;  5HL1 A;  3MKF A;  4GDB A;  4R1G A;  4MEZ A;  3AGF A;  4EBN A;  2VGK A;  1N4O A;  4ZTK A;  5DTK A;  3EQU A;  2ZQ9 A;  5GL9 A;  1QMF A;  5J8X A;  1YQS A;  3G34 A;  1KDW A;  3HLW A;  4H8R A;  5E2F A;  1L0G A;  5A90 A;  1ZC2 A;  2EX8 A;  2WYX A;  1ES4 A;  3IHA A;  1BLS A;  4FD8 A;  5F1G A;  3HVF A;  4JF6 A;  1EI5 A;  4QD4 A;  3BFE A;  3FYZ A;  4OLD A;  3UPO A;  4QHC A;  2ZC4 B;  5FAO A;  4QY5 A;  4RA7 A;  5KSC A;  1I2S A;  4IED A;  4OOL A;  4GNU A;  4F94 A;  1JTD A;  2WZX A;  5DF7 A;  4DXC A;  4ZBE A;  3AGE A;  3ZVW A;  1SKF A;  2ZQA A;  4MBH A;  4S2N C;  4UA7 A;  1G68 A;  2QPN A;  1PYY A;  2Q9M A;  5GLC A;  1E3U A;  2WUQ A;  1TDG A;  3O3V A;  4P87 A;  5GHY A;  5GHZ A;  3CZD A;  1FSW A;  4UA6 A;  3W4O A;  3GTC A;  2J9P A;  2JCH A;  1NYM A;  3VOZ A;  4B88 A;  3HUO A;  5G18 A;  3N4I A;  3FKV A;  4GD6 A;  4IVK A;  2EX6 A;  1MPL A;  1MWS A;  2HP5 A;  3ZNT A;  1FCO A;  5FAQ A;  2H5S A;  3V50 A;  3O87 A;  1FR6 A;  1O7E A;  1FOF A;  1VM1 A;  3ITA A;  3OPR A;  2Y91 A;  1XGJ A;  5EOO A;  5A93 A;  1MWR A;  4S2I A;  5JYO A;  1IKG A;  5HAI A;  1K6R A;  4KZ5 A;  3OCN A;  3GSG A;  4KG5 A;  1K38 A;  1PZO A;  2WGV A;  1CEF A;  4IBX A;  4GZB A;  3BLM A;  5E2E A;  3Q81 A;  3N8L A;  4BLM A;  2VGJ A;  2Z2L B;  3O86 A;  5D3O A;  4Z9Q A;  4C6Y A;  3BFD A;  4BEN A;  4O7D A;  4LV0 A;  1H8Y A;  4UA9 A;  2V20 A;  3UPN A;  1GHP A;  5DTT A;  1MKI A;  1QME A;  3UDI A;  3UNW A;  2IWC A;  4DE2 A;  2XD1 A;  2ZM2 A;  1MY8 A;  1JVJ A;  3GRJ A;  4YIN A;  1DJB A;  3GVB A;  3HLC A;  3QNB A;  4N9L A;  5FAP A;  5CHJ A;  4Y0T A;  1W8Y A;  1YMX A;  3NI9 A;  3VP1 A;  4OQI A;  4ZJ1 A;  3C5A A;  5CEB A;  3G31 A;  4BD1 A;  4E3K A;  1G6A A;  2IWD A;  4X69 A;  4K0W A;  2XF3 A;  4WMC A;  1IYP A;  2X71 A;  4LV2 A;  4U3T A;  3HRE A;  3PAE A;  5A91 A;  1PZP A;  4JKT A;  4N1X A;  3ZHH A;  3HUM A;  2RCX A;  3IXD A;  1M40 A;  2BG1 A;  1L0F A;  4MBK A;  4R4R A;  4DF6 A;  1L2S A;  1JWP A;  4GDN A;  3HLG A;  5GLA A;  2ZM8 A;  4OLG A;  4A5R A;  4P0M A;  4K91 A;  1ES5 A;  5CHU A;  3TSG A;  1YLZ A;  5KMW A;  5EVI B;  4S2L A;  3VSK A;  5EVI A;  2WGW B;  4S2O A;  4OQG A;  3WS2 A;  2XD5 A;  2Y2P A;  5FQK A;  1YLW A;  1ESI A;  4P6B A;  5FI6 A;  1Q2P A;  5AQ7 A;  3ZVT A;  4N92 A;  4EWF A;  3ITB A;  1C3B A;  1XA1 A;  3FV7 A;  3UDF A;  1BSG A;  4E6W A;  1LI0 A;  1Q2Q A;  2R9X A;  3HBR A;  3IF6 C;  3WRZ A;  4RX3 A;  5CEC A;  3VFF A;  1K57 C;  2HPB A;  1PW8 A;  5AQA A;  3PBO A;  2XH9 A;  4BD0 A;  1BT5 A;  1JWZ A;  5FI7 A;  3OPH A;  3N8S A;  2ZLY A;  4PM8 A;  2WAE A;  4JXG A;  3SOI A;  2WK0 A;  3A3I A;  1EWZ A;  2P74 A;  3O88 A;  3OZH A;  4KZ8 A;  1IYS A;  4KG2 A;  2QZ6 A;  2ZM0 A;  3MZD A;  5HAR A;  2Y2H A;  1W79 A;  5M18 A;  3SH7 A;  3CG5 A;  1K6S A;  4RVA A;  1YLY A;  4XXR A;  3V3S A;  5AQ9 A;  3GV9 A;  3SH9 A;  4JXV A;  3C4O A;  3UN7 A;  3G4P A;  2H0T A;  3PTE A;  1BTL A;  2G2U A;  4L0L A;  5DVA A;  4EUZ A;  1YMS A;  2ZMA A;  4OPZ A;  3MZE A;  3S4X A;  4S2J A;  5FAS A;  2R9W A;  4GN2 A;  1NZO A;  4JF4 A;  3NIA A;  3ZG0 A;  3NDG A;  3IWQ A;  5BOH A;  3UDX A;  4PM5 A;  5CXW A;  4E3M A;  1WYC A;  2WAD A;  3M6B A;  2Y59 A;  3LY4 A;  3NC8 A;  3FZC A;  1K4E A;  1ALQ A;  3WWX A;  4JPM A;  1LLB A;  2ZC6 B;  1PI4 A;  4OON A;  2V1Z A;  1PWD A;  1K54 A;  3HL9 A;  4E3O A;  3B3X A;  1PWG A;  5EUA A;  2G2W A;  5EVI C;  1WE4 A;  1L0E A;  3LO7 A;  4PM6 A;  1SCW A;  5EEC A;  4KZ6 A;  3FKW A;  1NYY A;  3IXG A;  4X53 A;  3IWI A;  1LL9 A;  1AXB A;  1YLT A;  1XP4 A;  1FQG A;  2WGI A;  4WMC D;  3VP4 A;  2XEP A;  3ZCZ A;  4R4S A;  4CJN A;  1O07 A;  4KG6 A;  1E4D A;  5EVI D;  1XXM A;  1IYO A;  3A3J A;  4E3J A;  3N8R A;  2DCF A;  4R23 A;  4Y0O A;  4E3N A;  5F83 A;  2EXA A;  1J9M A;  1YT4 A;  4OH0 A;  3WS0 A;  1TEM A;  4R3B A;  3UE3 A;  2XQZ A; 
#chains in the Genus database with same CATH topology
 1K25 A;  4I38 A;  3MFX A;  5F5Y A;  2Y2N A;  2VV8 A;  1K55 A;  1F5M A;  2X01 A;  1PWC A;  2HDR A;  3QP4 A;  4OPR A;  1IOU A;  2Y2Q A;  4KZB A;  3Q7V A;  4I3A A;  4FH4 A;  4OVD A;  1YSQ A;  2V9A A;  1L3L A;  1JTG A;  3H7W A;  5A92 A;  4WUJ A;  3VE3 A;  2QKP A;  3JYI A;  3T1S A;  3WRT A;  1MWT A;  2NUT C;  4M4X A;  3T1X A;  4S2N A;  5FQ9 A;  5TGF A;  3PXP A;  3TRC A;  1VB6 A;  3Q07 A;  4XUZ A;  4OOM A;  2Y79 A;  3S7O A;  5GLD A;  1FR1 A;  3IX4 A;  3MMH A;  3DW0 A;  3GEC A;  1STZ A;  1FCN A;  3V3R A;  3Q1F A;  5CGX A;  5JYP A;  1H0M A;  2PT7 A;  3QP1 A;  3SH8 A;  3S1Y A;  1D1J A;  3G2Y A;  3T4T A;  2G7U A;  1HD8 A;  3CAX A;  2PR6 A;  4MNR A;  3PBN A;  4Y3I A;  5AVE A;  4KZ4 A;  1E3U D;  3UO9 A;  4X56 A;  3OC2 A;  3F1N B;  3ZG8 B;  4B4X A;  3R4K A;  1DJA A;  5HSQ A;  5EVL A;  4U0T A;  2RL3 A;  4S2K A;  3H82 A;  2JKT M;  4DE3 A;  4R3J A;  4HIA A;  2FFF B;  5HD3 A;  4N1H A;  2HDS A;  3MQO A;  1XPB A;  3IX3 A;  3A3F A;  1CI8 A;  5GLB A;  4E6X A;  2DNS A;  5FQI A;  2M1C A;  1H8Z A;  5DFY A;  4WYY A;  2BLS A;  5EFW A;  4KQQ A;  3CIT A;  5HDD A;  2DMW A;  2JN7 A;  2ZC5 B;  4Y15 A;  1W63 Q;  1WYB A;  1BUE A;  4PM7 A;  3NBL A;  4EBL A;  5EE8 A;  3BEC A;  4R0Q A;  3VFH A;  1BLC A;  3PBR A;  4BL2 A;  3VSL A;  4WZ5 C;  1SDE A;  4HEF A;  3ICY A;  1YLJ A;  2V1A A;  5L8M A;  4DXB A;  1XA7 A;  4AFI A;  4FH2 A;  3U4L P;  2E8I A;  4HY8 A;  2O9C A;  4KQR A;  3RFB A;  2J9O A;  1NY0 A;  1MZU A;  3BY8 A;  4EEU A;  4WBG A;  4BWI A;  4JF5 A;  5FI2 A;  2W3G A;  1KE3 A;  3IXH A;  3KSF A;  3ZGA B;  1KGF A;  1M6K A;  1SKO A;  4JGQ A;  5CGS A;  4HBU A;  4NEE D;  3LEQ A;  4FUW A;  1TS0 A;  4GKU A;  2PAV P;  4DKI A;  1PW1 A;  1YKD A;  3T4O A;  4B93 A;  3PAG A;  2Q9N A;  5A8B A;  4WZ4 A;  3CJM A;  5M19 A;  2Y55 A;  4EV4 A;  1NXY A;  4GJ4 A;  3RXW A;  1IEL A;  4XUX A;  1BLP A;  5CRF A;  5HX9 A;  4LCL A;  3E2L A;  4HJ4 A;  1F9I A;  1HZO A;  1LHY A;  3BYD A;  1ONH A;  4GDB A;  2EWV A;  2VGK A;  4ZTK A;  5L10 A;  3EQU A;  1QMF A;  5A90 A;  3LIC A;  5DFX A;  3HVF A;  1EI5 A;  3LUQ A;  5KSC A;  1I2S A;  1WA9 A;  3E98 A;  4OOL A;  2W3E A;  2WZX A;  1E3U A;  2WUQ A;  1FSW A;  5FDS A;  4QWO A;  3GTC A;  1OT9 A;  3FKV A;  4NKP A;  4IVK A;  3DBA A;  1UGU A;  1MWS A;  2HP5 A;  5FAQ A;  2H5S A;  3O87 A;  1VM1 A;  1FOF A;  2Y91 A;  4JGP A;  4S2I A;  1K0K A;  3IS2 B;  1K6R A;  3DAV A;  3CPT B;  3UB9 A;  1PZO A;  4GHI A;  2LB5 A;  1IFQ A;  2CMN A;  4IBX A;  2O9B A;  2ZOH A;  3Q81 A;  4HHD A;  2VGJ A;  4C6Y A;  4BEN A;  1YAX A;  4UA9 A;  3UB5 P;  3A0S A;  4YIN A;  5FAP A;  4DJ2 A;  3VP1 A;  2VEA A;  3G31 A;  1G6A A;  5EV0 A;  4K0W A;  4X69 A;  5CX7 A;  1IYP A;  1OTA A;  1CQA A;  2W3F A;  3NOT C;  5LBR A;  2RCX A;  5HDS A;  5EM0 A;  4YOF A;  1DRM A;  1D7E A;  1DP9 A;  4A5R A;  3HJI A;  4P0M A;  4K91 A;  1ES5 A;  3TSG A;  4S2O A;  2XD5 A;  2Y2P A;  4HJ3 A;  3C8C A;  1ESI A;  4P6B A;  3ZVT A;  1Q2P A;  4EWF A;  4N92 A;  4H6J A;  1CJF A;  2VZW A;  1BSG A;  4E6W A;  3QP2 A;  3IF6 C;  3WRZ A;  4EER A;  3IX8 A;  2J3T C;  4WL9 A;  3OZH A;  4KZ8 A;  4EUV A;  1IYS A;  2ZM0 A;  2V8C A;  5M18 A;  1K6S A;  1YLY A;  3GV9 A;  3EWK A;  3PTE A;  4OPZ A;  5FAS A;  3KSH A;  2R9W A;  4O0P A;  3IWQ A;  1N9O A;  1NRJ A;  4UQI S;  4PM5 A;  3M6B A;  2E8J A;  1PWD A;  3HL9 A;  4E3O A;  3B3X A;  1PWG A;  3T4J A;  4ESP A;  1WE4 A;  3LO7 A;  4P6Z S;  5EEC A;  4X53 A;  3F1N A;  1FQG A;  3VP4 A;  3ZCZ A;  3LID A;  1O07 A;  4E3J A;  2I9V A;  1OTB A;  1VEU B;  4R23 A;  4E3N A;  1J9M A;  1YT4 A;  4OH0 A;  3WS0 A;  1TEM A;  3MBZ A;  5TBM B;  2KX6 A;  3L7H A;  2OV5 A;  3LIE A;  3K3C A;  2HP9 A;  4GLQ A;  4GOG A;  2Y4A A;  2V8F A;  2B5R A;  5HPF A;  2QJ5 A;  4CQH A;  2Z2M B;  2HF6 A;  4L9F A;  2PU2 A;  3P98 A;  4LV1 A;  4Q8I A;  4MN7 A;  3UPP A;  3RTY A;  3ISG A;  3SW1 A;  2ZMF A;  2MJ6 A;  3ULF A;  1K56 D;  3MF0 A;  1S4R A;  3P01 A;  4KZ9 A;  3I7J A;  1RP5 A;  3EQV A;  3RH8 B;  1TVF A;  4KZ3 A;  3CMZ A;  3T4Q A;  4L9E A;  2V0W A;  3DTE A;  4DRT A;  1U60 A;  1PIO A;  1NLZ A;  2WKR A;  1K54 C;  4KQO A;  1BUL A;  4NK3 A;  1YPR A;  2P7J A;  2Y2K A;  4LPZ A;  3BFG A;  1NJ4 A;  3HLE A;  5DF9 A;  5KSH A;  5DKL A;  3AGD A;  1YLP A;  1KOU A;  2OSU A;  4BJP A;  1CEG A;  1S6R A;  4JLF A;  2ZQ7 A;  4ETZ A;  1S4S A;  5J3W A;  2HJ9 C;  1F98 A;  4MDZ A;  1ZKJ A;  3F1P A;  3Q82 A;  3GR2 A;  4JGR A;  3D4F A;  1YM1 A;  2A49 A;  2OLU A;  3C7U A;  2PD8 A;  3PBQ A;  2D01 A;  5M1A A;  5TR7 A;  1DJC A;  4NXF A;  1ZHH B;  3E4O A;  4CLC C;  3NDE A;  3C7V A;  4EQI A;  1DP6 A;  3BFF A;  3F1O B;  3MXS A;  4L9G A;  5DJU A;  3VP3 A;  3C38 A;  3LI9 A;  4YNR A;  2XA7 M;  4UAA A;  2IWB A;  4HES A;  4BBT A;  4EEP A;  3IHB A;  3NUL A;  3MZF A;  2WKP A;  2ZJ9 A;  4X68 A;  5FAT A;  3VOY A;  3C2W A;  1ZTU A;  2I72 A;  1UWN X;  4ZDX A;  2ZQC A;  4WLA A;  3EEH A;  4G3K A;  2O0Y A;  5FSR A;  1CK3 A;  3KYE A;  3MR0 A;  2PHY A;  4WEJ A;  3SS4 A;  2PBY A;  1BLH A;  2EX9 A;  2XRN A;  1EW0 A;  3LEZ A;  3DWK A;  4QPR A;  1ZG6 A;  2J80 A;  2K2N A;  4JXW A;  2IA2 A;  1S0W A;  4PMA A;  2WKE A;  2PU4 A;  1KGE A;  2JBF A;  1XKZ A;  3KSG A;  3VOL A;  3BJN A;  3A3E A;  1IKI A;  2Y2M A;  5CTM A;  4X1L A;  3FWL A;  4PKY G;  4IHQ A;  3IF5 A;  3G30 A;  3E2K A;  1F2K A;  1GCE A;  1XJ6 A;  1NLY A;  2JC7 A;  4IBR A;  2P9V A;  3VE4 A;  2BAS A;  1K56 A;  3BM6 A;  1XJ4 A;  2EFU A;  4CLC E;  2JKR M;  1ES3 A;  5HL6 A;  4C75 A;  4WEL A;  4EW7 A;  1N9N A;  4OQH A;  4DDS A;  2L4R A;  2ZQ8 A;  3CPT A;  2XSS A;  3F1P B;  4RX2 A;  1OME A;  2Y2O A;  5FQJ A;  5IHV A;  4DJ3 A;  3A3D A;  3TW8 A;  3MXQ A;  1MXO A;  5DF8 A;  3LCE A;  4CLC B;  1RGZ A;  5FQM A;  4U0X A;  2J3W A;  4DE0 A;  3HLB A;  4YFM A;  4MMN A;  1W8Q A;  4HQA A;  4PM9 A;  4BMW A;  5CER A;  3MKF A;  4MEZ A;  3AGF A;  4ME4 A;  1YQS A;  4LRY C;  1T1A A;  2EX8 A;  2WYX A;  1ES4 A;  3IHA A;  1BLS A;  4FD8 A;  5F1G A;  3BFE A;  3FYZ A;  4F3L A;  4QHC A;  5FAO A;  4QY5 A;  4Z1W A;  3ZYT A;  3ZVW A;  3TE8 A;  3U2A A;  4UA7 A;  1G68 A;  1PYY A;  2QPN A;  5GLC A;  1TDG A;  3O3V A;  3TJZ C;  3CZD A;  4R3A A;  5I5L A;  5FL3 A;  3EGX C;  2J9P A;  3UB6 A;  4B88 A;  1NYM A;  2JKT I;  4MN5 A;  5G18 A;  3N4I A;  3MS6 A;  3KSI A;  2HGV A;  1H8M A;  1XJ3 A;  3ZNT A;  3OPR A;  1O7E A;  5EOO A;  3ITA A;  5A93 A;  1XGJ A;  2W3H A;  2PRF A;  1K38 A;  2WGV A;  4GZB A;  3BLM A;  4Z9Q A;  1AWI A;  2GX5 A;  1H8Y A;  1GHP A;  1TS7 A;  2YKF A;  2ZM2 A;  1JVJ A;  3GRJ A;  1DJB A;  1VET B;  4Y0T A;  4OQI A;  3C5A A;  4BD1 A;  4E3K A;  4Q0H A;  2PYR A;  2XF3 A;  4WMC A;  2W1T A;  2X71 A;  3KYZ A;  3T12 B;  4JKT A;  4IUK A;  3HJK A;  1PNE A;  3B47 A;  1M40 A;  2OAQ 1;  3IXD A;  1L2S A;  1JWP A;  4OLG A;  4R6L A;  2Z6D A;  4PKY A;  3VSK A;  3WS2 A;  4DN0 A;  3CLO A;  5AQ7 A;  3ITB A;  1P9W A;  3CWF A;  3FV7 A;  2EWW A;  1LI0 A;  3W2Z A;  2A2L A;  3HBR A;  2HJE A;  4RX3 A;  3VFF A;  4BBU A;  2M7U A;  2LB9 A;  2WAE A;  4JXG A;  3SOI A;  2P74 A;  1FIL A;  1G28 A;  1XFN A;  3DTI A;  4JXV A;  3G4P A;  5DVA A;  3UB8 A;  1YMS A;  3F1O A;  2VA0 A;  3IBR A;  4GN2 A;  5FEG A;  1ODV A;  5CXW A;  1LT0 A;  1WYC A;  2Y59 A;  3IBJ A;  3FZC A;  4G3W A;  1J3W A;  1LLB A;  2ZC6 B;  1PI4 A;  3KYQ A;  1X0O A;  2G2W A;  2GJ3 A;  1S1Y A;  3HCY A;  1LL9 A;  2WGI A;  4WMC D;  4CJN A;  5EVI D;  1IYO A;  2VGL M;  2DCF A;  2VK3 A;  4R70 A;  3R7W B;  4LRZ E;  2ZOI A;  5F68 A;  5AVF A;  2FFY A;  4I3J A;  4WEK A;  5CTN A;  2ZC3 B;  3SS5 A;  1TS6 A;  4NXB A;  3TG9 A;  4I3I A;  4JGO A;  3LYX A;  2V2F F;  4D60 A;  3T4L A;  2CC1 A;  1W7F A;  4EBP A;  1GA0 A;  2W1T B;  3DTM A;  1S1Z A;  5E2H A;  1SHV A;  3K2N A;  1JNU A;  3FG8 A;  4B9O A;  4D2O A;  3V67 A;  4KQD A;  2PYP A;  4WM9 A;  3D3O A;  4QY6 A;  3A0R A;  1LL5 A;  3LIA A;  2XA7 S;  1GSV A;  1OPX A;  2OLV A;  2OOL A;  3GDI A;  2J8Y A;  1P9R A;  1ERM A;  3E4P A;  3IF6 A;  1NZU A;  4MBF A;  5HZH A;  3VP2 A;  5EVE A;  3N7W A;  5L09 A;  2DRW A;  4PPR A;  3UE1 A;  3LGO A;  1KE0 A;  4OPQ A;  1ZG4 A;  4WN5 A;  3E0Y A;  1Z09 A;  2HDU A;  2OWH A;  4GW9 A;  2H0Y A;  4FSF A;  4HNB A;  4KEN B;  3T1Q B;  2VX8 A;  2H28 A;  2Y2J A;  5G4Y A;  2WKH A;  4QU3 A;  4ARZ A;  3T1R A;  3UY6 A;  3Q7Z A;  4S2P A;  1KVM A;  3T4S A;  1NRF A;  5HAQ A;  4X6T A;  3PHY A;  3TOI A;  2WKQ A;  2JKR I;  1ES2 A;  1MWU A;  4QB8 A;  5CHM A;  4MLL A;  3WS5 A;  1GHI A;  2VV7 A;  4WZ5 A;  1MBL A;  3HLD A;  1OT6 A;  4K0X A;  4OQ0 A;  4HI4 A;  2HV1 A;  3CUE C;  1N9B A;  3R7W A;  2QHK A;  5AQB A;  4FCF A;  3IT9 A;  3MXR A;  3BEB A;  3WS1 A;  3S7N A;  3VMA A;  3ZNY A;  2EFX A;  2PBD P;  3PBT A;  3QNC A;  2PD7 A;  3ZG5 A;  5E43 A;  3M2J A;  1IEM A;  4OPY A;  5U47 A;  2ZQD A;  1ERQ A;  2XDM A;  2W1R A;  2P9V B;  4EES A;  1FCM A;  4LCM A;  1D06 A;  1K55 C;  5TJJ A;  2Y2I A;  1W63 M;  3IS2 A;  4RYE A;  1P97 A;  3IH9 A;  3IWO A;  3LIB A;  3SS3 A;  1MC0 A;  2XK1 A;  1SDN A;  2QWS A;  2Y8H A;  3LR4 A;  3S7P A;  3HLF A;  3P09 A;  4CPK A;  1K57 A;  2WZZ A;  2XR0 A;  3NOU C;  2O9A A;  5EOE A;  1I2W A;  4GB7 A;  1KGG A;  1KE4 A;  4HH3 A;  3RJU A;  5HAP A;  5FA7 A;  2GZA A;  3M2K A;  3VP0 A;  3OCL A;  5GHX A;  4GHI B;  3W4P A;  1PRQ A;  4Y5F A;  5CGW A;  4JBF A;  3KX0 X;  3FPV A;  2XGN A;  5FDH A;  1ESU A;  4B4Z A;  4E3L A;  1XX2 A;  4GD8 A;  4Y2F A;  3S22 A;  3PYP A;  4NG2 A;  4ZRR A;  2WGW A;  3LR3 A;  5EPH A;  3HUN A;  5DJT A;  3LI8 A;  1JWV A;  1T1B A;  2AVX A;  4IVI A;  3IQA A;  4P85 A;  5IU1 A;  4LV3 A;  5F82 A;  2PR5 A;  4GS9 B;  3ZG7 B;  4Y7P A;  3IF6 B;  1FIK A;  1SZV A;  2FH5 A;  2H10 A;  1Y4O A;  3ZFZ A;  4II7 A;  4MN6 A;  5HL1 A;  4R1G A;  4EBN A;  1N4O A;  3BWL A;  5DTK A;  2ZQ9 A;  3MJQ A;  3H7W B;  3HLW A;  1KDW A;  4H8R A;  5E2F A;  1L0G A;  4R38 A;  2D02 A;  1ZC2 A;  1VHM A;  4ETX A;  4QD4 A;  4OLD A;  3UPO A;  4IUH A;  1GSW A;  3FPW A;  1TS8 A;  2JHE A;  4GNU A;  4F94 A;  1JTD A;  2Z6C A;  4ZBE A;  3AGE A;  4LLO B;  5HDC A;  2ZQA A;  4MBH A;  4S2N C;  2Q9M A;  1BYW A;  4P87 A;  5GHY A;  5GHZ A;  2KOI A;  2R78 A;  2JCH A;  3VOZ A;  4GD6 A;  2EX6 A;  4HJ6 A;  3D9Y A;  3BY9 A;  1FR6 A;  1G6O A;  1MWR A;  5HAI A;  3JVU A;  3OCN A;  3GSG A;  5EM1 A;  1V9Y A;  1S66 L;  1HLU P;  3UME A;  1MKM A;  2Z2L B;  3O86 A;  3BFD A;  2V20 A;  1MKI A;  3UNW A;  2IWC A;  1MY8 A;  5KIZ A;  3HLC A;  4N9L A;  3NI9 A;  4ZJ1 A;  2ZL1 A;  3CI6 A;  2A24 A;  3EGD C;  4LV2 A;  2VGL S;  4GS9 A;  1T18 A;  1PZP A;  4MBK A;  2BG1 A;  1L0F A;  4DF6 A;  4GDN A;  2ZM8 A;  3O5Y A;  4EET B;  5CHU A;  1YLZ A;  5KMW A;  1NWZ A;  5EVI A;  2WGW B;  4OQG A;  2A24 B;  4Y17 A;  5FQK A;  2ZL1 B;  3DTK A;  5FI6 A;  1C3B A;  1XA1 A;  3UDF A;  3T4K A;  1Q2Q A;  2R9X A;  5FEF A;  4HOI A;  3L9K A;  5CEC A;  1K57 C;  5AQA A;  1PW8 A;  2KDK A;  4BD0 A;  1BT5 A;  5FI7 A;  3N8S A;  2ZLY A;  3CHW P;  2WK0 A;  1EWZ A;  3MQQ A;  2Y2H A;  3SH7 A;  3CG5 A;  1OTI A;  3LFV A;  3P7N A;  5AQ9 A;  3C30 A;  3C4O A;  2OAP 1;  2H0T A;  1BTL A;  2G2U A;  4L0L A;  4EUZ A;  2ZMA A;  4O8G A;  3MZE A;  3S4X A;  3BW6 A;  4S2J A;  1XJ2 A;  1NZO A;  4JF4 A;  3ZG0 A;  1VET A;  2HZ5 A;  2Q0O A;  3NDG A;  3NOP C;  4XT2 B;  5BOH A;  3UDX A;  3LY4 A;  3NC8 A;  3WWX A;  4JPM A;  4OON A;  2V1Z A;  1K54 A;  2JKF A;  5EUA A;  3EOI A;  4LRX C;  4KZ6 A;  5HPI A;  1NYY A;  3IXG A;  3IWI A;  1AXB A;  1YLT A;  1N9L A;  5F6A A;  1G5U A;  2ACG A;  2XEP A;  4R4S A;  1XXM A;  1T1C A;  3N8R A;  3CUE A;  5F83 A;  2EXA A;  2P04 A;  5JYO A;  2XQZ A;  2L0W A;  3ZDJ A;  4HBT A;  2J3T D;  1L0D A;  2HP6 A;  1PI5 A;  2QYB A;  1HVB A;  3MFD A;  3V5M A;  2W27 A;  3WS4 A;  3K3D A;  4F3L B;  2EXB A;  4BQM A;  4UEY A;  2ZC7 A;  3NHQ A;  3C4P A;  1GSX A;  3BRM A;  3N6I A;  3S7Q A;  3W4Q A;  4HH2 A;  3H82 B;  1SKO B;  1Z6F A;  3V39 A;  4ID4 A;  5HWV A;  1Y28 A;  1XGI A;  5E2G A;  5J7E A;  3OPP A;  5I94 A;  1ONG A;  4ZAM A;  1XFQ A;  2XFS A;  4E3I A;  4X55 A;  3W8K A;  4M3K A;  2C5W B;  3OBF A;  2V0U A;  3IH8 A;  4S2M A;  3NCK A;  3JPU A;  1ACF A;  1LSW A;  1CI9 A;  4OOY A;  2J7V A;  4O01 A;  3MQ0 A;  5J4E A;  4PHT A;  3QP8 A;  4DE1 A;  2K7S A;  2WKI A;  1RGY A;  1I5Q A;  2B18 A;  4DDY A;  2O99 A;  2ZD8 A;  3FC7 A;  4LEN A;  5L07 A;  4QJG A;  5IS1 A;  2QJ7 A;  3MKE A;  4X25 A;  3UB7 A;  4CLC D;  4ZJ3 A;  3ZG9 B;  3D72 A;  2A3U A;  2YKH A;  3G2Z A;  1K4F A;  2Y2G A;  4P6Z M;  3BFC A;  5DTS A;  3G32 A;  2PDR A;  5HWW A;  4NET A;  5TFQ A;  4HP4 A;  2KLI A;  3GQZ A;  2X02 A;  5FQQ A;  3PR6 A;  1H3Q A;  4XT2 A;  5HW3 A;  4C3Q A;  3LY3 A;  3M6H A;  2W3D A;  1KVL A;  4RQ9 A;  2EX2 A;  4GCZ A;  1IYQ A;  1TDL A;  4X1M A;  3PBS A;  5IT5 A;  4JXS A;  2V1B A;  5MC7 A;  3T50 A;  4OP8 A;  3LR5 A;  2WAF A;  2QMI A;  4I5S A;  4DMZ A;  3QHY A;  3GMW A;  4ARZ B;  1TD5 A;  2Y2L A;  3RXX A;  1ERO A;  4KZA A;  4OP5 A;  3BQ8 A;  1GHM A;  1BZA A;  4UQI M;  1GA9 A;  4Q0I A;  4Q0J A;  1DY6 A;  2VKS A;  1RCJ A;  1HTZ A;  3MSH A;  4KZ7 A;  1W5D A;  4N9K A;  2UV0 E;  1UWP X;  5HFO A;  1OJG A;  2UWX A;  5F1F A;  3G35 A;  4ZJ2 A;  2XFT A;  1T19 A;  5HD5 A;  4LGW A;  4E04 A;  3DWZ A;  1KDS A;  1OTD A;  2JE5 A;  1LSX A;  4IJG A;  4FOF A;  2VLG A;  4Y13 A;  3QP6 A;  1A0K A;  1LI9 A;  1E25 A;  5KZH A;  5CED A;  4EU0 A;  2INW A;  1VQQ A;  3Q7V B;  4BL3 A;  4UHU A;  3UE0 A;  3IXB A;  1YSP A;  2GDN A;  3QP5 A;  2VV6 A;  2C6W B;  2VJW A;  2B95 A;  4WF0 A;  5L2F A;  3BLS A;  2XLN A;  1Y54 A;  1TF1 A;  4Y0U A;  4FTX A;  1H5X A;  4YWZ A;  1FSY A;  3A0V A;  3G6O A;  3NY4 A;  2HDQ A;  4OKP A;  3OPL A;  4MCW A;  1P0Z A;  5C5K A;  4KUK A;  5GL9 A;  5J8X A;  3G34 A;  2ZBB A;  3UE6 A;  5TBM A;  4JF6 A;  2ZC4 B;  4RA7 A;  4CLC A;  4IED A;  5HWT A;  5DKK A;  5DF7 A;  4DXC A;  1SKF A;  2JKG A;  4UA6 A;  3W4O A;  2EA9 A;  3HUO A;  1MPL A;  3ZQ5 A;  1FCO A;  1OTE A;  4EQ1 A;  3V50 A;  1IKG A;  2L1M A;  4KZ5 A;  2XRO A;  4KG5 A;  1CEF A;  5E2E A;  4BLM A;  3N8L A;  5D3O A;  2M7V A;  4O7D A;  4LV0 A;  1VEU A;  3UPN A;  5DTT A;  1S67 L;  4DE2 A;  1QME A;  3UDI A;  2XD1 A;  3GVB A;  3QNB A;  5CHJ A;  1W8Y A;  1YMX A;  5CEB A;  1PFL A;  2IWD A;  2B02 A;  3B33 A;  2ZMV A;  4U3T A;  3HRE A;  4LFU A;  3PAE A;  5A91 A;  3H9W A;  4N1X A;  3ZHH A;  3HUM A;  4R4R A;  3OOV A;  4H6J B;  2FZ0 A;  3HLG A;  5GLA A;  5EVI B;  4S2L A;  4KUO A;  4BBV A;  1YLW A;  3OLO A;  2OWJ A;  5K5B A;  3JVV A;  5AJG A;  5F69 A;  3B42 A;  1V9Z A;  3NJA A;  2W0N A;  4G3V A;  2K31 A;  2HPB A;  3PBO A;  2XH9 A;  1JWZ A;  2GNX A;  3OPH A;  4PM8 A;  1DP8 A;  3A3I A;  3O88 A;  3LR0 A;  4KG2 A;  2QZ6 A;  3MZD A;  5HAR A;  1W79 A;  4NXG A;  4RVA A;  3EEA A;  4XXR A;  3V3S A;  3LIF A;  3SH9 A;  3BQA A;  3UN7 A;  1LSV A;  4HP9 A;  3NIA A;  3SZT A;  3VV4 A;  4E3M A;  2P08 A;  2WAD A;  4PAU A;  1ALQ A;  1K4E A;  1CF0 A;  3KO6 A;  4NXE A;  5EVI C;  1L0E A;  4PM6 A;  1SCW A;  3FKW A;  4K08 A;  4EXO A;  3UMD A;  3NEC A;  2BTF P;  5G4Z A;  1LL8 A;  3E4Q A;  1XP4 A;  2NUP C;  1OJ5 A;  4KG6 A;  1E4D A;  3A3J A;  4Y0O A;  4I39 A;  4R3B A;  3UE3 A; 
#chains in the Genus database with same CATH homology
 3MBZ A;  3ZDJ A;  2OV5 A;  1K25 A;  4HBT A;  2FFY A;  2HP9 A;  2Y2N A;  4GOG A;  4WEK A;  2Y4A A;  5CTN A;  1L0D A;  1K55 A;  2B5R A;  2HP6 A;  1PI5 A;  2ZC3 B;  3SS5 A;  2X01 A;  3TG9 A;  1PWC A;  2HDR A;  1HVB A;  4OPR A;  2Z2M B;  2PU2 A;  3MFD A;  2V2F F;  3V5M A;  3P98 A;  4LV1 A;  4Q8I A;  3WS4 A;  2CC1 A;  2EXB A;  1W7F A;  2Y2Q A;  4EBP A;  4BQM A;  1GA0 A;  4KZB A;  3DTM A;  3UPP A;  5E2H A;  3ISG A;  1SHV A;  3Q7V A;  2ZC7 A;  4FH4 A;  4OVD A;  1K56 D;  3C4P A;  3BRM A;  3N6I A;  4D2O A;  1JTG A;  3W4Q A;  5A92 A;  4WM9 A;  4KZ9 A;  4QY6 A;  3JYI A;  3I7J A;  1RP5 A;  1Z6F A;  3V39 A;  4ID4 A;  3WRT A;  1LL5 A;  3EQV A;  2OLV A;  1XGI A;  1MWT A;  5E2G A;  1TVF A;  2J8Y A;  3OPP A;  3CMZ A;  4KZ3 A;  1ERM A;  5I94 A;  1ONG A;  3IF6 A;  4MBF A;  1NZU A;  4S2N A;  4ZAM A;  5FQ9 A;  3VP2 A;  5TGF A;  4DRT A;  2XFS A;  4E3I A;  4X55 A;  3W8K A;  4M3K A;  3N7W A;  3Q07 A;  2C5W B;  1U60 A;  1PIO A;  2DRW A;  4PPR A;  3UE1 A;  1KE0 A;  4XUZ A;  4OPQ A;  3IH8 A;  4S2M A;  4OOM A;  1K54 C;  4KQO A;  1ZG4 A;  3NCK A;  5GLD A;  1FR1 A;  1BUL A;  4NK3 A;  5HX9 A;  2HDU A;  3DW0 A;  2Y2K A;  3BFG A;  1NJ4 A;  3HLE A;  1CI9 A;  5DF9 A;  5KSH A;  4OOY A;  2J7V A;  2H0Y A;  4FSF A;  1FCN A;  3V3R A;  3Q1F A;  5CGX A;  3AGD A;  5JYP A;  4KEN B;  1YLP A;  3SH8 A;  3S1Y A;  4DE1 A;  2OSU A;  3G2Y A;  2WKI A;  4BJP A;  1RGY A;  1HD8 A;  2Y2J A;  1CEG A;  1I5Q A;  4DDY A;  1S6R A;  4JLF A;  4MNR A;  2WKH A;  3PBN A;  4QU3 A;  2ZD8 A;  2ZQ7 A;  4KZ4 A;  1E3U D;  3UO9 A;  4X56 A;  4LEN A;  3UY6 A;  3OC2 A;  3Q7Z A;  1ZKJ A;  3ZG8 B;  4B4X A;  4S2P A;  4QJG A;  1DJA A;  1KVM A;  1NRF A;  3Q82 A;  3MKE A;  5EVL A;  3GR2 A;  5HAQ A;  4U0T A;  4X6T A;  2RL3 A;  3D4F A;  3WS5 A;  4S2K A;  1YM1 A;  3TOI A;  4DE3 A;  4R3J A;  1ES2 A;  1MWU A;  4QB8 A;  2A49 A;  4MLL A;  5CHM A;  2OLU A;  1GHI A;  2A3U A;  3C7U A;  4WZ5 A;  4ZJ3 A;  1MBL A;  3ZG9 B;  2FFF B;  3G2Z A;  3HLD A;  3PBQ A;  1K4F A;  2Y2G A;  5DTS A;  3BFC A;  4N1H A;  2HDS A;  3G32 A;  1XPB A;  5M1A A;  5TR7 A;  1DJC A;  4K0X A;  3A3F A;  1CI8 A;  5GLB A;  3NDE A;  4E6X A;  2DNS A;  5FQI A;  3C7V A;  4EQI A;  3BFF A;  1H8Z A;  4OQ0 A;  3MXS A;  4WYY A;  2BLS A;  4NET A;  1N9B A;  4KQQ A;  5TFQ A;  3VP3 A;  3GQZ A;  4FCF A;  5AQB A;  3IT9 A;  3MXR A;  2X02 A;  4UAA A;  3BEB A;  3WS1 A;  3VMA A;  5FQQ A;  2IWB A;  4HES A;  3ZNY A;  5HW3 A;  2EFX A;  3PBT A;  2ZC5 B;  4C3Q A;  3LY3 A;  3M6H A;  1KVL A;  3IHB A;  1WYB A;  3QNC A;  2EX2 A;  3MZF A;  2ZJ9 A;  1BUE A;  4PM7 A;  4X68 A;  3NBL A;  1IYQ A;  1TDL A;  5FAT A;  5EE8 A;  3ZG5 A;  4EBL A;  5E43 A;  3VOY A;  3BEC A;  4R0Q A;  3M2J A;  3PBS A;  2I72 A;  3VFH A;  1IEM A;  4OPY A;  1BLC A;  3PBR A;  5U47 A;  2ZQD A;  2ZQC A;  4ZDX A;  1ERQ A;  2XDM A;  4JXS A;  3VSL A;  4BL2 A;  4WZ5 C;  4OP8 A;  1SDE A;  2P9V B;  4HEF A;  2WAF A;  1FCM A;  2QMI A;  5FSR A;  1CK3 A;  3QHY A;  4LCM A;  3GMW A;  1YLJ A;  1K55 C;  4WEJ A;  2Y2I A;  4RYE A;  3SS4 A;  2PBY A;  1BLH A;  2EX9 A;  3LEZ A;  2Y2L A;  3RXX A;  1ERO A;  4KZA A;  3IH9 A;  1XA7 A;  4DXB A;  3DWK A;  3IWO A;  3SS3 A;  4OP5 A;  4FH2 A;  2XK1 A;  1SDN A;  1ZG6 A;  4JXW A;  3HLF A;  3P09 A;  1GHM A;  1S0W A;  2E8I A;  4PMA A;  2WKE A;  1BZA A;  2PU4 A;  4CPK A;  4KQR A;  1GA9 A;  1K57 A;  1KGE A;  1DY6 A;  2WZZ A;  2JBF A;  1RCJ A;  1HTZ A;  1XKZ A;  4KZ7 A;  2XR0 A;  1W5D A;  4N9K A;  5EOE A;  1I2W A;  4GB7 A;  1KGG A;  2J9O A;  1KE4 A;  3A3E A;  1NY0 A;  1IKI A;  2Y2M A;  5CTM A;  5HFO A;  2UWX A;  3FWL A;  3RJU A;  5F1F A;  3G35 A;  4WBG A;  5HAP A;  3IF5 A;  4ZJ2 A;  5FA7 A;  3G30 A;  3M2K A;  2XFT A;  3E2K A;  3OCL A;  3VP0 A;  1GCE A;  4JF5 A;  2JC7 A;  5FI2 A;  5GHX A;  1KE3 A;  3DWZ A;  3W4P A;  1KDS A;  2JE5 A;  3IXH A;  4IBR A;  2P9V A;  5CGW A;  3ZGA B;  1K56 A;  1KGF A;  3BM6 A;  4JBF A;  1LI9 A;  1M6K A;  2XGN A;  5CGS A;  2EFU A;  5FDH A;  1E25 A;  1ESU A;  4HBU A;  4B4Z A;  5KZH A;  4E3L A;  1XX2 A;  4GD8 A;  3S22 A;  5CED A;  1ES3 A;  1VQQ A;  4C75 A;  4WEL A;  4GKU A;  4DKI A;  1PW1 A;  3Q7V B;  2WGW A;  4OQH A;  4UHU A;  3UE0 A;  3IXB A;  5EPH A;  2ZQ8 A;  4BL3 A;  4DDS A;  3PAG A;  4RX2 A;  2GDN A;  3HUN A;  1OME A;  1JWV A;  2Q9N A;  4WZ4 A;  2Y2O A;  5FQJ A;  3CJM A;  4IVI A;  2C6W B;  3IQA A;  4P85 A;  5M19 A;  2Y55 A;  5IHV A;  4EV4 A;  1NXY A;  4LV3 A;  5F82 A;  3RXW A;  3A3D A;  1IEL A;  4XUX A;  5L2F A;  3BLS A;  2XLN A;  1MXO A;  1Y54 A;  5DF8 A;  3ZG7 B;  1BLP A;  5CRF A;  3LCE A;  4Y0U A;  1H5X A;  1RGZ A;  2H10 A;  3IF6 B;  4LCL A;  1FSY A;  3E2L A;  4U0X A;  4Y7P A;  5FQM A;  3NY4 A;  4DE0 A;  1HZO A;  3HLB A;  4YFM A;  1W8Q A;  2HDQ A;  4OKP A;  3OPL A;  3ZFZ A;  1LHY A;  4PM9 A;  3BYD A;  5CER A;  1ONH A;  5HL1 A;  3MKF A;  4GDB A;  4R1G A;  4MEZ A;  3AGF A;  4EBN A;  2VGK A;  1N4O A;  4ZTK A;  5DTK A;  3EQU A;  2ZQ9 A;  5GL9 A;  1QMF A;  5J8X A;  1YQS A;  3G34 A;  1KDW A;  3HLW A;  4H8R A;  5E2F A;  1L0G A;  5A90 A;  1ZC2 A;  2EX8 A;  2WYX A;  1ES4 A;  3IHA A;  1BLS A;  4FD8 A;  5F1G A;  3HVF A;  4JF6 A;  1EI5 A;  4QD4 A;  3BFE A;  3FYZ A;  4OLD A;  3UPO A;  4QHC A;  2ZC4 B;  5FAO A;  4QY5 A;  4RA7 A;  5KSC A;  1I2S A;  4IED A;  4OOL A;  4GNU A;  4F94 A;  1JTD A;  2WZX A;  5DF7 A;  4DXC A;  4ZBE A;  3AGE A;  3ZVW A;  1SKF A;  2ZQA A;  4MBH A;  4S2N C;  4UA7 A;  1G68 A;  2QPN A;  1PYY A;  2Q9M A;  5GLC A;  1E3U A;  2WUQ A;  1TDG A;  3O3V A;  4P87 A;  5GHY A;  5GHZ A;  3CZD A;  1FSW A;  4UA6 A;  3W4O A;  3GTC A;  2J9P A;  2JCH A;  1NYM A;  3VOZ A;  4B88 A;  3HUO A;  5G18 A;  3N4I A;  3FKV A;  4GD6 A;  4IVK A;  2EX6 A;  1MPL A;  1MWS A;  2HP5 A;  3ZNT A;  1FCO A;  5FAQ A;  2H5S A;  3V50 A;  3O87 A;  1FR6 A;  1O7E A;  1FOF A;  1VM1 A;  3ITA A;  3OPR A;  2Y91 A;  1XGJ A;  5EOO A;  5A93 A;  1MWR A;  4S2I A;  5JYO A;  1IKG A;  5HAI A;  1K6R A;  4KZ5 A;  3OCN A;  3GSG A;  4KG5 A;  1K38 A;  1PZO A;  2WGV A;  1CEF A;  4IBX A;  4GZB A;  3BLM A;  5E2E A;  3Q81 A;  3N8L A;  4BLM A;  2VGJ A;  2Z2L B;  3O86 A;  5D3O A;  4Z9Q A;  4C6Y A;  3BFD A;  4BEN A;  4O7D A;  4LV0 A;  1H8Y A;  4UA9 A;  2V20 A;  3UPN A;  1GHP A;  5DTT A;  1MKI A;  1QME A;  3UDI A;  3UNW A;  2IWC A;  4DE2 A;  2XD1 A;  2ZM2 A;  1MY8 A;  1JVJ A;  3GRJ A;  4YIN A;  1DJB A;  3GVB A;  3HLC A;  3QNB A;  4N9L A;  5FAP A;  5CHJ A;  4Y0T A;  1W8Y A;  1YMX A;  3NI9 A;  3VP1 A;  4OQI A;  4ZJ1 A;  3C5A A;  5CEB A;  3G31 A;  4BD1 A;  4E3K A;  1G6A A;  2IWD A;  4X69 A;  4K0W A;  2XF3 A;  4WMC A;  1IYP A;  2X71 A;  4LV2 A;  4U3T A;  3HRE A;  3PAE A;  5A91 A;  1PZP A;  4JKT A;  4N1X A;  3ZHH A;  3HUM A;  2RCX A;  3IXD A;  1M40 A;  2BG1 A;  1L0F A;  4MBK A;  4R4R A;  4DF6 A;  1L2S A;  1JWP A;  4GDN A;  3HLG A;  5GLA A;  2ZM8 A;  4OLG A;  4A5R A;  4P0M A;  4K91 A;  1ES5 A;  5CHU A;  3TSG A;  1YLZ A;  5KMW A;  5EVI B;  4S2L A;  3VSK A;  5EVI A;  2WGW B;  4S2O A;  4OQG A;  3WS2 A;  2XD5 A;  2Y2P A;  5FQK A;  1YLW A;  1ESI A;  4P6B A;  5FI6 A;  1Q2P A;  5AQ7 A;  3ZVT A;  4N92 A;  4EWF A;  3ITB A;  1C3B A;  1XA1 A;  3FV7 A;  3UDF A;  1BSG A;  4E6W A;  1LI0 A;  1Q2Q A;  2R9X A;  3HBR A;  3IF6 C;  3WRZ A;  4RX3 A;  5CEC A;  3VFF A;  1K57 C;  2HPB A;  1PW8 A;  5AQA A;  3PBO A;  2XH9 A;  4BD0 A;  1BT5 A;  1JWZ A;  5FI7 A;  3OPH A;  3N8S A;  2ZLY A;  4PM8 A;  2WAE A;  4JXG A;  3SOI A;  2WK0 A;  3A3I A;  1EWZ A;  2P74 A;  3O88 A;  3OZH A;  4KZ8 A;  1IYS A;  4KG2 A;  2QZ6 A;  2ZM0 A;  3MZD A;  5HAR A;  2Y2H A;  1W79 A;  5M18 A;  3SH7 A;  3CG5 A;  1K6S A;  4RVA A;  1YLY A;  4XXR A;  3V3S A;  5AQ9 A;  3GV9 A;  3SH9 A;  4JXV A;  3C4O A;  3UN7 A;  3G4P A;  2H0T A;  3PTE A;  1BTL A;  2G2U A;  4L0L A;  5DVA A;  4EUZ A;  1YMS A;  2ZMA A;  4OPZ A;  3MZE A;  3S4X A;  4S2J A;  5FAS A;  2R9W A;  4GN2 A;  1NZO A;  4JF4 A;  3NIA A;  3ZG0 A;  3NDG A;  3IWQ A;  5BOH A;  3UDX A;  4PM5 A;  5CXW A;  4E3M A;  1WYC A;  2WAD A;  3M6B A;  2Y59 A;  3LY4 A;  3NC8 A;  3FZC A;  1K4E A;  1ALQ A;  3WWX A;  4JPM A;  1LLB A;  2ZC6 B;  1PI4 A;  4OON A;  2V1Z A;  1PWD A;  1K54 A;  3HL9 A;  4E3O A;  3B3X A;  1PWG A;  5EUA A;  2G2W A;  5EVI C;  1WE4 A;  1L0E A;  3LO7 A;  4PM6 A;  1SCW A;  5EEC A;  4KZ6 A;  3FKW A;  1NYY A;  3IXG A;  4X53 A;  3IWI A;  1LL9 A;  1AXB A;  1YLT A;  1XP4 A;  1FQG A;  2WGI A;  4WMC D;  3VP4 A;  2XEP A;  3ZCZ A;  4R4S A;  4CJN A;  1O07 A;  4KG6 A;  1E4D A;  5EVI D;  1XXM A;  1IYO A;  3A3J A;  4E3J A;  3N8R A;  2DCF A;  4R23 A;  4Y0O A;  4E3N A;  5F83 A;  2EXA A;  1J9M A;  1YT4 A;  4OH0 A;  3WS0 A;  1TEM A;  4R3B A;  3UE3 A;  2XQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...