1IELA

Crystal structure of ampc beta-lactamase from e. coli in complex with ceftazidime
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIGSDNIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase
publication title Structures of ceftazidime and its transition-state analogue in complex with AmpC beta-lactamase: implications for resistance mutations and inhibitor design.
pubmed doi rcsb
source organism Escherichia coli
total genus 116
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ielA00
1FSWA 1K38A 1K54A 4NK3A 2Y2OA 5FATA 2WKEA 1K4FA 3G2ZA 3Q07A 4MLLA 4XXRA 5AQ7A 4E6XA 3TG9A 1FOFA 2FFYA 1BT5A 2XDMA 4N9LA 1NY0A 4FCFA 3FWLA 4OPRA 3WS5A 5GLCA 4PPRA 2Y2MA 1PI4A 4JXWA 5HX9A 4Q8IA 1MWUA 5J8XA 3NI9A 2JCHA 4S2JA 5EVIA 3UDXA 3LO7A 1SHVA 1W79A 3VP1A 2Q9NA 2Z2LB 1FQGA 5CTMA 1ONHA 1BTLA 2XQZA 1XA7A 4LCLA 1PWDA 3HLBA 3V3RA 3Q82A 5F83A 1ONGA 1Q2PA 2FFFB 3SH9A 3MXRA 1IKGA 3IHBA 5FQMA 4WBGA 1BLCA 3NIAA 5CRFA 3NY4A 3WS2A 1ESIA 1K4EA 1ES4A 4JBFA 3OCNA 4QHCA 5EECA 3O88A 3BFGA 5A92A 3OPLA 1QMEA 1MKIA 4YINA 1OMEA 2XR0A 1CK3A 3ZG0A 1YT4A 2QPNA 3PBNA 5CERA 3UE1A 3V3SA 4KQQA 4MBFA 1SKFA 2ZJ9A 4DRTA 3ZG7B 5AQ9A 4HBUA 1ZC2A 3A3JA 4JLFA 3FV7A 4GD8A 1LL5A 4EQIA 5GLAA 1ES3A 2WZXA 4OQHA 4S2NC 1LHYA 4N1XA 1G68A 4B88A 2C5WB 4BENA 4N1HA 3C7VA 3VSLA 4S2KA 1LI0A 1IYSA 4KZ7A 5EVID 3RJUA 4C75A 3OPPA 5HAPA 3UPPA 3O87A 2H0TA 4P0MA 4QJGA 4ZDXA 3IF6C 2WUQA 3VP3A 3W4QA 3BFFA 5FI6A 1Z6FA 5DF9A 2HDUA 5GLDA 3Q7VA 5AQAA 4E3IA 4KQOA 2C6WB 3BFEA 3O86A 4GNUA 2P9VA 2QZ6A 2V2FF 4OONA 1KVMA 5CECA 5HAQA 2B5RA 1E25A 1GHPA 1KGFA 1NRFA 3HLCA 3QNBA 2OLUA 2HP9A 2Y55A 4P85A 3UPNA 1GA0A 2J7VA 2WAEA 3WRZA 2P74A 2WGVA 3PBRA 4Z9QA 4H8RA 2ZC4B 1Y54A 1NZUA 1YQSA 1ZG6A 1FSYA 3WS4A 1PWGA 5GL9A 2BLSA 4R0QA 3GR2A 1W8QA 2ZM0A 4RX2A 4BQMA 2EFXA 4R3JA 4S2PA 1ZG4A 2H0YA 1K6RA 1LLBA 4JKTA 3CZDA 4U0XA 3VFHA 1L0EA 4E3NA 2XGNA 3MZFA 3OCLA 3LEZA 3W4OA 2HDRA 2ZQAA 2H10A 3SOIA 4OQ0A 1K55C 4KZ5A 2HDSA 3GV9A 5DTSA 4LV0A 1JTDA 1XP4A 3G30A 1ES5A 1H8YA 2BG1A 3ZNTA 1BULA 1NXYA 1WE4A 3Q81A 4K0XA 4E3OA 4UA9A 3ZHHA 4IVKA 1IYPA 5FQ9A 3UO9A 4JXGA 2WKHA 3W8KA 3ZVWA 3C4PA 3A3EA 3G35A 3PBTA 3BFCA 4GZBA 4OP8A 4ZBEA 5EOOA 1IEMA 1XX2A 4XUXA 1O07A 3PBQA 2G2UA 4LV3A 4GB7A 5E43A 3UE3A 3N6IA 2WGWA 4WZ4A 4WMCA 5EOEA 4ID4A 5CGWA 2EX2A 4UHUA 2EFUA 4JF6A 1JWZA 4S2OA 5CHUA 2OV5A 3DTMA 3GQZA 3VSKA 4CJNA 1ESUA 2E8IA 3NDEA 1LL9A 3LY4A 5DTKA 1KVLA 3LY3A 4FD8A 2IWDA 5CTNA 1JWVA 4LENA 2EXAA 4PM6A 5GLBA 1YLWA 3ZDJA 3ISGA 4Y0TA 4RX3A 4OPQA 3ZCZA 1IKIA 3MKFA 4EBPA 5E2EA 1PW1A 1YLZA 1FR1A 4KZ4A 3IXGA 5F82A 2DRWA 4XUZA 4HEFA 1I5QA 2ZC6B 5FI2A 4DDYA 1ZKJA 5BOHA 1K57A 4UAAA 1PYYA 3BYDA 3UDFA 3ITBA 5JYOA 1XXMA 4QB8A 3HVFA 5GHZA 3JYIA 2J9PA 3C5AA 1MBLA 4OQIA 5DF8A 2Y2PA 4DE0A 3O3VA 2VGKA 5M1AA 1XGIA 3GMWA 3AGDA 3IXHA 3G32A 3NCKA 5EPHA 3FZCA 1GCEA 5TGFA 2XD5A 3G34A 5KSHA 4Y0OA 1YLPA 2X71A 1YLYA 1KDSA 2ZD8A 1KE0A 2Y2KA 3G31A 5CGSA 3OC2A 3VP0A 5CXWA 1K6SA 3FKWA 3ZG8B 3QHYA 2JBFA 3HUOA 3N8RA 5CHMA 3FKVA 1E4DA 2OLVA 1EROA 3FYZA 3LCEA 5FDHA 4WMCD 4FH2A 1FCNA 3MZEA 4EUZA 3EQUA 4X68A 2HP5A 3MKEA 3IH9A 1RGZA 3VMAA 4E3MA 4GDNA 5KSCA 3HL9A 2ZLYA 3C7UA 5HARA 4E3LA 4R4RA 4OLDA 3UNWA 4EWFA 2WAFA 3HLGA 3RXWA 1EI5A 1SDNA 3NDGA 1VQQA 4OVDA 4LV1A 1RP5A 1XGJA 3P98A 1L2SA 2X01A 4CPKA 5CEBA 5FI7A 3ZNYA 1HZOA 5A91A 4B4XA 1MPLA 5HW3A 2XK1A 4X56A 5I94A 2EX6A 4FH4A 4ZJ3A 4KZ6A 3SS3A 5TFQA 3V39A 4OPYA 1TEMA 2Y2JA 2WZZA 4NETA 3PTEA 3AGEA 4X55A 4WZ5C 2JE5A 1CEFA 3MBZA 4WELA 4C6YA 1K54C 1SCWA 1SDEA 4RVAA 1JVJA 2ZC3B 1YLTA 1RGYA 3IF6B 4DXBA 2UWXA 3E2KA 4GN2A 3RXXA 4MEZA 4JF4A 1BLHA 4JXSA 4UA6A 3G2YA 4YFMA 5HL1A 2ZM8A 1PZPA 1W8YA 4PM8A 3ZFZA 1MXOA 1H8ZA 3A3DA 4A5RA 5EVIC 2WKIA 4KG5A 3G4PA 2ZQ8A 1YMXA 2GDNA 4OKPA 4RYEA 5CGXA 3VOZA 3IWIA 3NBLA 2XFSA 3OPHA 2Y2IA 2ZQ7A 4OOMA 5KZHA 5GHXA 3W4PA 1I2SA 1VM1A 4Y7PA 4BD1A 1PIOA 5L2FA 4D2OA 1EWZA 1GHIA 1FCOA 1PWCA 3Q1FA 4LCMA 4QD4A 4E3JA 2PBYA 3HLFA 3WS0A 3VFFA 1H5XA 2G2WA 1GHMA 3GRJA 3MXSA 2RL3A 3WWXA 3MZDA 2IWCA 1M6KA 5EVLA 3V50A 3VP4A 3M6BA 5TR7A 4BD0A 1CEGA 2J9OA 1FCMA 4MBKA 4WEKA 3DWKA 3E2LA 2Z2MB 1IELA 1I2WA 2Y2QA 5D3OA 1BLSA 2XD1A 3S22A 1J9MA 4E3KA 3OZHA 2Y2HA 3SH7A 3IXBA 1NYMA 1C3BA 2EXBA 4L0LA 1KGGA 1TVFA 2I72A 2RCXA 5FQKA 2IWBA 1DJCA 1K56A 1TDLA 4KZ8A 3S4XA 3UDIA 1WYBA 3UN7A 3IQAA 4EV4A 5FQIA 4PM9A 4JF5A 5A90A 3WS1A 1S0WA 3P09A 4X69A 3Q7VB 2HPBA 5DVAA 4ZJ1A 3ZG9B 1MWSA 2ZC5B 1IYQA 4K0WA 2Y2LA 3Q7ZA 4OP5A 1ERMA 2R9XA 3HREA 2J8YA 2ZC7A 3HUMA 5E2GA 1XPBA 3N4IA 4WYYA 4U0TA 1NYYA 3IF6A 3IT9A 2H5SA 3HLDA 3OPRA 3ZG5A 1E3UA 4K91A 1MWRA 3HLWA 2Y2NA 4BL2A 2ZQDA 1L0DA 3ZGAB 3UE0A 3QNCA 1PZOA 1W5DA 4KQRA 3V5MA 1TDGA 1NJ4A 5CEDA 4QY6A 4HBTA 4KG2A 4KZAA 4KZ3A 1HVBA 3WRTA 5JYPA 3CG5A 2XF3A 3M2JA 4OOYA 4WEJA 3UY6A 4LV2A 2XLNA 1K56D 1PI5A 4GD6A 4U3TA 1YM1A 4E6WA 2EX9A 3HUNA 5M19A 3D4FA 1BLPA 3A3IA 5FASA 4OLGA 4Y0UA 2CC1A 1W7FA 2V1ZA 4S2MA 5DTTA 2Y91A 1WYCA 1K55A 2WGWB 3BM6A 2A49A 4OPZA 3BECA 2XEPA 4KENB 4KG6A 4X53A 4X6TA 5EE8A 1N9BA 4DF6A 4IBXA 4QY5A 3VP2A 2WGIA 3NC8A 4GKUA 3I7JA 1AXBA 5FAPA 1MWTA 1BUEA 1M40A 4JPMA 2VGJA 5IHVA 2XFTA 2QMIA 3IF5A 3CJMA 4GDBA 1N4OA 3IWOA 4OQGA 1DY6A 1E3UD 1GA9A 3ITAA 4MBHA 1CI8A 1XKZA 2PU4A 5F1GA 5FQQA 1KDWA 4DDSA 1L0FA 1K57C 2Y2GA 4R23A 5E2HA 4OOLA 1ES2A 4MNRA 5U47A 4GOGA 5M18A 3UPOA 1Q2QA 3BRMA 5KMWA 1L0GA 3MFDA 3IHAA 3N7WA 5CHJA 3IXDA 5EVIB 4OH0A 2Y59A 3BLSA 1FR6A 5FSRA 4BL3A 4IEDA 2XH9A 4N9KA 3C4OA 3IH8A 3CMZA 4IVIA 1QMFA 3HLEA 1HD8A 1BZAA 5FQJA 2PU2A 2HDQA 5HAIA 5DF7A 3PBOA 2JC7A 3BLMA 4KZ9A 4BLMA 2WADA 2ZQCA 4EBNA 4F94A 4M3KA 3SH8A 1G6AA 4PMAA 3GVBA 4IBRA 4ZAMA 2ZQ9A 1XA1A 2OSUA 4WM9A 1S6RA 1JWPA 3PAEA 4P87A 4UA7A 3EQVA 1BSGA 2HP6A 2X02A 3B3XA 3HBRA 4FSFA 3SS4A 4S2LA 1O7EA 1DJBA 3S1YA 1JTGA 5A93A 4RA7A 2Y4AA 1YLJA 4R4SA 3ZVTA 4DKIA 4C3QA 2EX8A 3DWZA 2WYXA 3SS5A 3N8SA 4N92A 1ALQA 5HFOA 4EBLA 4DXCA 4S2IA 1U60A 1PW8A 2ZM2A 2A3UA 4DE3A 3DW0A 4R1GA 1DJAA 3GSGA 4BJPA 3M6HA 5GHYA 5EUAA 1YMSA 4DE1A 2WK0A 3BFDA 1KE4A 1KE3A 4PM7A 5FA7A 5F1FA 4DE2A 4R3BA 1ERQA 3BEBA 1RCJA 1LI9A 3A3FA 1K25A 5E2FA 5FAQA 1HTZA 4ZJ2A 4PM5A 2R9WA 3N8LA 4KZBA 4O7DA 5AQBA 5FAOA 3PBSA 2V20A 4JXVA 3PAGA 5G18A 1NZOA 3GTCA 3M2KA 2DNSA 4S2NA 1MY8A 2P9VB 4ZTKA 3TOIA 4P6BA 4QU3A 3VOYA 1IYOA 3IWQA 4B4ZA 1CI9A 1KGEA 4HESA 2DCFA 2Q9MA 4WZ5A 3AGFA 3TSGA 2ZMAA
chains in the Genus database with same CATH superfamily
1K54A 2WKEA 3Q07A 2Y8HA 1FOFA 1BT5A 2XDMA 1NY0A 4L9EA 3QP6A 4MN7A 1PI4A 4JXWA 4Q8IA 3QP2A 3IX3A 4HH3A 4S2JA 3HJIA 1SHVA 1W79A 2Z2LB 3T4TA 5CTMA 1BTLA 4NXEA 4LCLA 2O0YA 2XSSA 3EOIA 3HLBA 3T1QB 5FQMA 3NIAA 3O88A 5A92A 1MKIA 4YINA 5TJJA 1OMEA 4BBUA 3T12B 3ZG0A 3PBNA 5HPFA 4MBFA 1SKFA 2W3GA 4JLFA 4EU0A 1CJFA 1DP8A 4BENA 4N1HA 2D02A 5EVID 5HAPA 3OPPA 4ETXA 3BFFA 5FI6A 3Q7VA 4ESPA 3BFEA 3LI9A 2P9VA 4I3IA 4L9FA 1KVMA 1E25A 1GHPA 1KGFA 5C5KA 2OLUA 4P85A 1GA0A 2J7VA 2WAEA 2ZMVA 3PBRA 4ETZA 4GCZA 4CLCE 1NZUA 3IS2A 5LBRA 4WF0A 2H0YA 1LLBA 4JKTA 3R7WA 2XGNA 2PRFA 1XP4A 3G30A 1ES5A 1WE4A 5FQ9A 2WKHA 3C4PA 3P01A 4O0PA 2PYRA 2HGVA 1O07A 4LV3A 2Q0OA 1XJ6A 4H6JB 4ID4A 5CGWA 4EW7A 3T4OA 4S2OA 1JWZA 5CHUA 3DTMA 3GQZA 2E8IA 1LL9A 1N9OA 4FD8A 3F1NB 5GLBA 3ZDJA 4Y0TA 3ISGA 3ZCZA 5E2EA 1PW1A 3T4QA 1I5QA 4F3LB 3NHQA 5HD5A 2VJWA 4QB8A 5GHZA 2J9PA 1MBLA 3GMWA 3AGDA 1S67L 3HJKA 4HY8A 2X71A 5HL6A 1KDSA 2Y2KA 3G31A 3OC2A 2VX8A 3FKWA 3N8RA 3LR5A 1D1JA 3VMAA 1RGZA 5KSCA 5HARA 3C7UA 2WAFA 3HLGA 1MKMA 3PR6A 3NDGA 1XGJA 5EFWA 4CQHA 3ZNYA 1MPLA 1XFNA 2XK1A 4X56A 4B9OA 4E04A 2EX6A 3E98A 4KZ6A 3LGOA 4OPYA 4PKYA 4NETA 2JE5A 1CEFA 3MBZA 1S4SA 1K54C 1SCWA 1SDEA 4DXBA 1JVJA 1YSQA 4HJ6A 4UA6A 3LIAA 1W8YA 1YMXA 1VETB 2GDNA 3VOZA 1OTAA 5F6AA 3NOUC 3C8CA 2A2LA 4OOMA 5KZHA 5GHXA 3W4PA 4GW9A 1I2SA 1VM1A 3VOLA 3LICA 1PWCA 2V1AA 2PBYA 3HLFA 1OTBA 2G2WA 3BWLA 3KYZA 2KX6A 2JKRM 2INWA 5FDSA 1FCMA 1NRJA 2Z2MB 3QP1A 3MQQA 2HZ5A 3OZHA 1NYMA 1C3BA 2I72A 5FQKA 2IWBA 3KSFA 1T1BA 3PHYA 3UB9A 4MN5A 1DJCA 1K56A 3T1XA 2WKRA 1Z09A 3R4KA 4FOFA 3RTYA 4JF5A 5L09A 4X69A 4ZJ1A 2HPBA 3ZG9B 1MWSA 4K0WA 3BY9A 3KO6A 4KUOA 2R9XA 4IUHA 3H7WB 3IT9A 2H5SA 2BTFP 1V9YA 4BL2A 2Y2NA 2OOLA 4KQRA 3V5MA 1NJ4A 2JN7A 4KZAA 4KZ3A 5JYPA 1HVBA 3BJNA 3CG5A 2XLNA 4GD6A 4Y0UA 1W7FA 2O99A 2B95A 2Y79A 3F1PB 3V67A 2A49A 4OPZA 3OLOA 4DF6A 4GKUA 3NC8A 2PDRA 5CX7A 1S4RA 1MWTA 2NUPC 1BUEA 1G5UA 1IFQA 1M40A 4JPMA 5A8BA 3IF5A 3CJMA 1ZTUA 1GA9A 1XKZA 2PU4A 4H6JA 1KDWA 4ARZB 1L0FA 3RH8B 1ES2A 4MNRA 4GOGA 3GECA 3UPOA 3W2ZA 5CHJA 2Y59A 1FR6A 4N9KA 3C4OA 1QMFA 1HD8A 2L4RA 3C38A 3DTEA 1YSPA 1W63M 4F3LA 2W3FA 2WADA 2WKPA 5DJTA 2JKTM 4F94A 4CLCD 1G6AA 2ZQ9A 1XA1A 2OSUA 4EEUA 4P87A 1BSGA 4Y2FA 1DJBA 3S1YA 5A93A 4RA7A 2PR6A 3SS5A 1ALQA 1F2KA 3LYXA 1TS7A 4S2IA 2P7JA 4FTXA 4R1GA 3M6HA 4DE1A 4DE2A 2ZOHA 1RCJA 1LI9A 3A3FA 1K25A 4ZRRA 4O7DA 5AQBA 4JXVA 3PAGA 3GTCA 4ZTKA 2P9VB 2E8JA 1LL8A 1IYOA 3KYEA 4NG2A 4MMNA 4HESA 4M4XA 1AWIA 4WZ5A 1FSWA 3LIEA 2Y2OA 5TBMA 3TG9A 4N9LA 3T4LA 4FCFA 3FWLA 4PPRA 5HX9A 5J8XA 3NI9A 4R70A 5EVIA 3LO7A 1VETA 4QPRA 5DFYA 4II7A 2XQZA 3V3RA 1YPRA 3Q82A 1FILA 5G4ZA 1ONGA 3IHBA 5HD3A 4WBGA 1BLCA 5CRFA 3B47A 4WLAA 3NY4A 3OCNA 3CHWP 3BFGA 3FPVA 1DP6A 1SKOA 1F9IA 3MQ0A 2XR0A 3BQAA 1CK3A 3UE1A 4DRTA 4HBUA 3A3JA 1LL5A 4EQIA 5GLAA 5HSQA 1VB6A 1PRQA 4OQHA 4P6ZS 4S2NC 2K31A 1OT6A 3C7VA 4S2KA 4KZ7A 4C75A 4O8GA 2GX5A 2H0TA 3S7QA 4ZDXA 3LEQA 2WUQA 3W4QA 2W27A 5GLDA 2V1BA 5AQAA 4KQOA 4HIAA 4QWOA 2C6WB 2G7UA 3O86A 5DJUA 1CQAA 2QYBA 4O01A 5HDDA 2B5RA 3HLCA 3QNBA 2A24B 4Q0JA 4R3AA 2WGVA 5DKLA 3H7WA 4H8RA 2ZC4B 2P08A 1PWGA 3MJQA 4R0QA 2FZ0A 2ZM0A 4RX2A 4I39A 4S2PA 2ACGA 3C30A 3CZDA 3A0SA 3LEZA 2H10A 2V8FA 3A0VA 3LIFA 2DMWA 2HDSA 5DTSA 4LV0A 3B33A 4GHIB 3KX0X 4E3OA 1BULA 3ZHHA 4IVKA 3UO9A 3G35A 3PBTA 1IEMA 3D3OA 3PBQA 3N6IA 3F1PA 4WZ4A 4HJ3A 4YOFA 1N9LA 2VGLS 2LB9A 3NDEA 3CAXA 3MMHA 5K5BA 4RX3A 1TS6A 4EBPA 1YLZA 1FR1A 3IXGA 2DRWA 4HEFA 4ARZA 4KQDA 2W1TB 4LLOB 3UB6A 3UDFA 5JYOA 3O3VA 1NWZA 1XGIA 5EPHA 3OOVA 4Y0OA 1KE0A 3VP0A 5CXWA 2JBFA 3HUOA 1E4DA 5EV0A 2MJ6A 5AVFA 4X68A 3UB5P 3MSHA 4E3LA 4R4RA 4OLDA 3UNWA 2ZMFA 4OVDA 3MF0A 1GSVA 3MS6A 3P98A 3PYPA 5FI7A 4B4XA 5HW3A 3SS3A 3V39A 2PHYA 2FH5A 1TEMA 4WZ5C 4WELA 4DDSA 3ZYTA 1TF1A 1YLTA 1RGYA 2UWXA 2ZL1B 3E2KA 4HNBA 4JF4A 1BLHA 4JXSA 4UEYA 4YFMA 5HL1A 4LPZA 2ZM8A 1PZPA 1S1ZA 3ZFZA 1T1AA 4A5RA 5EVIC 2P04A 2WKIA 3G4PA 2EWVA 2QJ7A 4OKPA 4RYEA 1L3LA 5CGXA 3IWIA 3NBLA 2ZQ7A 4FUWA 2W0NA 1OTDA 4Y15A 4I5SA 1DRMA 1PIOA 3TW8A 4D2OA 1EWZA 2HV1A 1H5XA 2V9AA 2YKHA 3GRJA 1SZVA 2RL3A 2K7SA 5EVLA 1LSVA 5TR7A 2AVXA 4WEKA 3E2LA 1IELA 2Y2QA 5D3OA 1GSWA 3S22A 1J9MA 1J3WA 3T1RA 2Y2HA 3IXBA 2EXBA 1KGGA 2RCXA 3EEHA 1TDLA 2XA7S 3IQAA 2J3TD 1CF0A 5FQIA 1TD5A 5A90A 5DVAA 5HWTA 4R38A 4Z1WA 1ERMA 2J8YA 4PHTA 3E4PA 4WYYA 4U0TA 3C2WA 1OPXA 4K91A 3HLWA 1L0DA 1WA9A 3JPUA 1OTEA 3ZGAB 3QNCA 1W5DA 2A24A 4QY6A 3WRTA 4OOYA 4LV2A 2B02A 5M19A 3D4FA 2CC1A 4S2MA 5DTTA 1N9NA 3LIDA 3QP5A 4CLCA 3IBRA 4GHIA 4KENB 4X6TA 1UGUA 1N9BA 5J4EA 2WGIA 1AXBA 4YNRA 5TBMB 5IHVA 2QMIA 1N4OA 3IWOA 1E3UD 5G18A 3UB8A 5F1GA 1LT0A 4OOLA 1H0MA 5M18A 3MFDA 3N7WA 3IXDA 3CI6A 4G3VA 5EVIB 3DBAA 2XH9A 3CMZA 1PNEA 5FQJA 2HDQA 2W1TA 5DF7A 3PBOA 2JC7A 3BLMA 4BLMA 4IBRA 3UMEA 1G6OA 4UA7A 1SKOB 3B3XA 4K08A 3SS4A 3T50A 2J3WA 4PAUA 3ZVTA 4R4SA 3QP4A 4DKIA 4WL9A 3N8SA 4N92A 1H3QA 3TE8A 1MC0A 2A3UA 5EUAA 2WK0A 2L1MA 4PM7A 3O5YA 1DP9A 4ZJ2A 4PM5A 2W1RA 4NXFA 3PBSA 2KDKA 3MXQA 1NZOA 3M2KA 4S2NA 4UQIS 4B4ZA 2M7VA 1KGEA 5EM1A 2Q9MA 2JHEA 3AGFA 4NK3A 1K38A 2PD7A 5FATA 4MLLA 1K4FA 3G2ZA 4E6XA 4XXRA 2ZL1A 4JGOA 2W3EA 2GJ3A 4OPRA 5GLCA 2GZAA 3JVUA 3DTKA 2JCHA 3UDXA 1FQGA 2VV6A 1XA7A 2V0WA 2IA2A 4HH2A 2FFFB 4LRYC 1ESIA 1BYWA 1ES4A 1T19A 1STZA 1D7EA 1QMEA 5IS1A 5MC7A 3CLOA 2QPNA 5CERA 3V3SA 4BWIA 3L9KA 2PT7A 1ACFA 2ZJ9A 1ZC2A 3K2NA 1LSWA 4Q0HA 4GD8A 1ES3A 1NLYA 2WZXA 1G68A 3CWFA 1LI0A 3DTIA 2VEAA 3O87A 4P0MA 3VP3A 3JVVA 1XJ3A 4EQ1A 5CECA 5HAQA 1NRFA 2HP9A 2Y55A 4EUVA 2OAP1 3S7NA 4EEPA 3WS4A 1F98A 3GR2A 1W8QA 2O9BA 4WUJA 2EFXA 4I3AA 1K6RA 1W63Q 3VFHA 3OCLA 3W4OA 2ZQAA 4BBTA 5L07A 4OQ0A 4CLCC 3GV9A 1JTDA 2JKFA 2BG1A 4Q0IA 3ZNTA 1NXYA 4K0XA 3Q81A 4UA9A 4X1LA 2OWHA 4GZBA 3BFCA 4ZBEA 4OP8A 2VV7A 5J7EA 3TRCA 3LUQA 4X25A 2EX2A 3LFVA 4UHUA 3MR0A 4JF6A 3LY4A 3LY3A 5CTNA 4LENA 2EXAA 4PM6A 1NLZA 3H9WA 1YLWA 4OPQA 4DDYA 5BOHA 3UE6A 1TS0A 3BYDA 5HZHA 3HVFA 3C5AA 4OQIA 5DF8A 2Y2PA 4DE0A 3EEAA 2VGKA 2JKRI 1YKDA 3G32A 3NCKA 3NOPC 2XD5A 3G34A 1HLUP 1YLYA 2ZD8A 5CGSA 4MN6A 1EW0A 3QHYA 4DN0A 5CHMA 4G3WA 5FDHA 4WMCD 3BY8A 1FCNA 3MZEA 3IH9A 3P7NA 3LI8A 3HL9A 2ZLYA 4NKPA 4EWFA 3RXWA 2VLGA 1EI5A 1VQQA 1L2SA 2X01A 4CPKA 5CEBA 3CPTB 2PAVP 5I94A 4FH4A 4ZJ3A 3SZTA 3KSHA 4HQAA 1ODVA 3PTEA 4ME4A 4X55A 3U4LP 4RVAA 3ULFA 4GS9B 4GN2A 3RXXA 5KIZA 3G2YA 4Y5FA 4JGPA 4PM8A 2O9AA 1H8ZA 1VEUB 3A3DA 2H28A 2ZQ8A 3BW6A 2QWSA 3GDIA 2XFSA 3OPHA 4IUKA 2V8CA 2QJ5A 4CLCB 2ZOIA 1FCOA 1GHIA 4LCMA 3Q1FA 4QD4A 4E3JA 2O9CA 4P6ZM 3MZDA 2B18A 1OT9A 2IWCA 3M6BA 4EESA 4BD0A 1CEGA 2J9OA 4MBKA 3DWKA 2XD1A 3T4SA 2JKGA 3SH7A 4L0LA 1T18A 3S4XA 4KZ8A 1IOUA 1WYBA 3UN7A 4EV4A 1KOUA 4PM9A 2JKTI 3P09A 2KLIA 2ZC5B 2M1CA 5HDSA 4L9GA 1Y4OA 3KSGA 3FC7A 2UV0E 2Y2LA 2ZC7A 3U2AA 5IU1A 1OJ5A 3F1OB 5HDCA 3IF6A 3HLDA 2QHKA 1E3UA 1MWRA 4DJ3A 2Z6CA 3ZQ5A 4IHQA 5CEDA 4HBTA 4JGQA 2XF3A 3OBFA 2VGLM 1PI5A 4Y17A 4E6WA 4HI4A 3HUNA 4LRZE 4OLGA 2LB5A 2V1ZA 1WYCA 1K55A 3DAVA 2WGWB 3BM6A 4DJ2A 4D60A 2XEPA 2J80A 1FIKA 3UB7A 4QY5A 4EETB 5FAPA 3NOTC 2XFTA 3UMDA 4GDBA 3ITAA 5FQQA 5FEFA 1CI8A 5IT5A 2Y2GA 4R23A 1D06A 5U47A 1Q2QA 5FSRA 4BL3A 4IEDA 3IH8A 1BZAA 2PU2A 3K3DA 3SW1A 2VZWA 2I9VA 4KZ9A 4I38A 2QKPA 3T4KA 3SH8A 4PMAA 3GVBA 4XT2B 4ZAMA 3IX4A 4WM9A 1S6RA 2HP6A 2Y4AA 1YLJA 4C3QA 2EX8A 2WYXA 4EBLA 1U60A 1S66L 1DJAA 4BJPA 1YMSA 3KSIA 1KE3A 5F1FA 1V9ZA 2W3DA 4R3BA 1ERQA 3BEBA 5E2FA 5FAQA 1HTZA 1JNUA 4KZBA 3N8LA 5F69A 2V20A 3CPTA 3NULA 2DNSA 3NECA 3TOIA 1ZHHB 2HJEA 1CI9A 1Q2PA 3TSGA 5AQ7A 2J3TC 4GS9A 3A0RA 5G4YA 5EVEA 3IBJA 2FFYA 3EWKA 3WS5A 2PBDP 4HP4A 2Y2MA 3EGDC 5FL3A 1MWUA 1VEUA 3VP1A 2Q9NA 1TS8A 3T1SA 1ONHA 1H8MA 3TJZC 2XROA 1PWDA 1UWNX 5F83A 2XA7M 3SH9A 3MXRA 5L8MA 4BMWA 3E4QA 1IKGA 3D9YA 1S1YA 3WS2A 1K4EA 4JBFA 4QHCA 5EECA 3E4OA 3LR3A 3OPLA 4NEED 2PD8A 1YT4A 3IX8A 4LGWA 4KQQA 3ZG7B 5AQ9A 5HWVA 3FV7A 2EA9A 4B88A 1LHYA 4N1XA 1F5MA 2C5WB 2EWWA 2K2NA 3VSLA 3RJUA 1IYSA 3UPPA 3MFXA 4IJGA 4QJGA 4GJ4A 3IF6C 1Z6FA 5DF9A 2HDUA 4E3IA 2BASA 3ICYA 4GNUA 2QZ6A 2V2FF 4OONA 3CUEA 2WKQA 4RQ9A 3UPNA 3WRZA 2P74A 3S7PA 3F1OA 4Z9QA 1Y54A 1YQSA 1ZG6A 2W3HA 1FSYA 5GL9A 2BLSA 3LR0A 4BQMA 4R3JA 1ZG4A 4U0XA 1L0EA 4E3NA 3MZFA 2HDRA 3SOIA 1K55C 4KZ5A 2VA0A 4BBVA 1H8YA 3L7HA 1IYPA 4JXGA 3W8KA 3ZVWA 4I3JA 3A3EA 4HP9A 4LFUA 5EOOA 4XUXA 1XX2A 2G2UA 4GB7A 5E43A 2R78A 3UE3A 2WGWA 4WMCA 5EOEA 1MZUA 3D72A 1K0KA 2EFUA 2OV5A 3H82B 3VSKA 4CJNA 1ESUA 5DTKA 1KVLA 2IWDA 1G28A 1JWVA 2CMNA 2VK3A 1IKIA 3MKFA 4Y13A 4KZ4A 5F82A 1P97A 4XUZA 5DKKA 2ZC6B 5FI2A 1P0ZA 1ZKJA 3S7OA 1K57A 4JGRA 1PYYA 4UAAA 1T1CA 3ITBA 1XXMA 1XJ4A 3JYIA 5M1AA 3IXHA 4NXBA 3FZCA 1GCEA 5TGFA 5KSHA 1YLPA 1K6SA 3EGXC 3ZG8B 3FKVA 2OLVA 1EROA 3FYZA 3LCEA 4XT2A 4FH2A 4EUZA 3EQUA 2HP5A 3MKEA 4E3MA 4GDNA 2XRNA 4UQIM 4LRXC 4WN5A 1YAXA 2KOIA 1SDNA 3K3CA 4EXOA 4LV1A 1RP5A 1OJGA 1HZOA 3BQ8A 4Y3IA 5A91A 5AVEA 5TFQA 4HJ4A 2Y2JA 2WZZA 4PKYG 3AGEA 5J3WA 3FG8A 5AJGA 4C6YA 2ZC3B 3IF6B 1GSXA 5F68A 4MEZA 1P9WA 1XFQA 3VV4A 3QP8A 1MXOA 3F1NA 4KG5A 4EERA 3PXPA 2Y2IA 3VE3A 4KUKA 1LSXA 5L10A 4Y7PA 4BD1A 5L2FA 3WS0A 4MDZA 2OAQ1 3VFFA 1GHMA 5HPIA 3MXSA 3WWXA 1M6KA 3V50A 3VP4A 2PR5A 2PYPA 1OTIA 2YKFA 1I2WA 1BLSA 1X0OA 4E3KA 1TVFA 3UDIA 3HCYA 1PFLA 3CITA 3WS1A 1S0WA 1A0KA 3Q7VB 2L0WA 2VV8A 1XJ2A 1IYQA 5F5YA 3CUEC 4AFIA 3Q7ZA 4OP5A 1UWPX 3HREA 3B42A 3HUMA 5E2GA 1XPBA 3N4IA 1NYYA 5EM0A 3IS2B 1Y28A 3OPRA 3ZG5A 2ZQDA 3T4JA 3R7WB 3UE0A 3MQOA 1PZOA 1TDGA 2VKSA 4KG2A 4DMZA 3M2JA 4WEJA 3LR4A 3UY6A 1K56D 4U3TA 1YM1A 2EX9A 1BLPA 3A3IA 5FASA 4MCWA 2Y91A 5HWWA 3BECA 3KYQA 4B93A 4KG6A 3NJAA 4X53A 5EE8A 4IBXA 3E0YA 3VP2A 3I7JA 2VGJA 3FPWA 4OQGA 1DY6A 4MBHA 4X1MA 5I5LA 1P9RA 1K57C 5E2HA 3H82A 3BRMA 5KMWA 1L0GA 3IHAA 4HOIA 4OH0A 3BLSA 1VHMA 2NUTC 2D01A 4IVIA 3HLEA 2HF6A 5HAIA 4NXGA 4G3KA 2GNXA 3VE4A 2ZBBA 4EBNA 2ZQCA 2Z6DA 4M3KA 2HJ9C 4GLQA 5FEGA 4R6LA 3LIBA 1JWPA 3PAEA 3EQVA 2X02A 3HBRA 4FSFA 4S2LA 1O7EA 1JTGA 2M7UA 3G6OA 3DWZA 5HFOA 4DXCA 2ZM2A 1PW8A 2OWJA 4DE3A 3DW0A 3GSGA 5GHYA 3BFDA 1KE4A 3RFBA 5FA7A 4YWZA 2R9WA 5FAOA 1MY8A 4P6BA 4QU3A 5DFXA 3VOYA 3IWQA 4HHDA 2V0UA 2DCFA 2ZMAA
chains in the Genus database with same CATH topology
1FSWA 1K38A 1K54A 4NK3A 2Y2OA 5FATA 2WKEA 1K4FA 3G2ZA 3Q07A 4MLLA 4XXRA 5AQ7A 4E6XA 3TG9A 1FOFA 2FFYA 1BT5A 2XDMA 4N9LA 1NY0A 4FCFA 3FWLA 4OPRA 3WS5A 5GLCA 4PPRA 2Y2MA 1PI4A 4JXWA 5HX9A 4Q8IA 1MWUA 5J8XA 3NI9A 2JCHA 4S2JA 5EVIA 3UDXA 3LO7A 1SHVA 1W79A 3VP1A 2Q9NA 2Z2LB 1FQGA 5CTMA 1ONHA 1BTLA 2XQZA 1XA7A 4LCLA 1PWDA 3HLBA 3V3RA 3Q82A 5F83A 1ONGA 1Q2PA 2FFFB 3SH9A 3MXRA 1IKGA 3IHBA 5FQMA 4WBGA 1BLCA 3NIAA 5CRFA 3NY4A 3WS2A 1ESIA 1K4EA 1ES4A 4JBFA 3OCNA 4QHCA 5EECA 3O88A 3BFGA 5A92A 3OPLA 1QMEA 1MKIA 4YINA 1OMEA 2XR0A 1CK3A 3ZG0A 1YT4A 2QPNA 3PBNA 5CERA 3UE1A 3V3SA 4KQQA 4MBFA 1SKFA 2ZJ9A 4DRTA 3ZG7B 5AQ9A 4HBUA 1ZC2A 3A3JA 4JLFA 3FV7A 4GD8A 1LL5A 4EQIA 5GLAA 1ES3A 2WZXA 4OQHA 4S2NC 1LHYA 4N1XA 1G68A 4B88A 2C5WB 4BENA 4N1HA 3C7VA 3VSLA 4S2KA 1LI0A 1IYSA 4KZ7A 5EVID 3RJUA 4C75A 3OPPA 5HAPA 3UPPA 3O87A 2H0TA 4P0MA 4QJGA 4ZDXA 3IF6C 2WUQA 3VP3A 3W4QA 3BFFA 5FI6A 1Z6FA 5DF9A 2HDUA 5GLDA 3Q7VA 5AQAA 4E3IA 4KQOA 2C6WB 3BFEA 3O86A 4GNUA 2P9VA 2QZ6A 2V2FF 4OONA 1KVMA 5CECA 5HAQA 2B5RA 1E25A 1GHPA 1KGFA 1NRFA 3HLCA 3QNBA 2OLUA 2HP9A 2Y55A 4P85A 3UPNA 1GA0A 2J7VA 2WAEA 3WRZA 2P74A 2WGVA 3PBRA 4Z9QA 4H8RA 2ZC4B 1Y54A 1NZUA 1YQSA 1ZG6A 1FSYA 3WS4A 1PWGA 5GL9A 2BLSA 4R0QA 3GR2A 1W8QA 2ZM0A 4RX2A 4BQMA 2EFXA 4R3JA 4S2PA 1ZG4A 2H0YA 1K6RA 1LLBA 4JKTA 3CZDA 4U0XA 3VFHA 1L0EA 4E3NA 2XGNA 3MZFA 3OCLA 3LEZA 3W4OA 2HDRA 2ZQAA 2H10A 3SOIA 4OQ0A 1K55C 4KZ5A 2HDSA 3GV9A 5DTSA 4LV0A 1JTDA 1XP4A 3G30A 1ES5A 1H8YA 2BG1A 3ZNTA 1BULA 1NXYA 1WE4A 3Q81A 4K0XA 4E3OA 4UA9A 3ZHHA 4IVKA 1IYPA 5FQ9A 3UO9A 4JXGA 2WKHA 3W8KA 3ZVWA 3C4PA 3A3EA 3G35A 3PBTA 3BFCA 4GZBA 4OP8A 4ZBEA 5EOOA 1IEMA 1XX2A 4XUXA 1O07A 3PBQA 2G2UA 4LV3A 4GB7A 5E43A 3UE3A 3N6IA 2WGWA 4WZ4A 4WMCA 5EOEA 4ID4A 5CGWA 2EX2A 4UHUA 2EFUA 4JF6A 1JWZA 4S2OA 5CHUA 2OV5A 3DTMA 3GQZA 3VSKA 4CJNA 1ESUA 2E8IA 3NDEA 1LL9A 3LY4A 5DTKA 1KVLA 3LY3A 4FD8A 2IWDA 5CTNA 1JWVA 4LENA 2EXAA 4PM6A 5GLBA 1YLWA 3ZDJA 3ISGA 4Y0TA 4RX3A 4OPQA 3ZCZA 1IKIA 3MKFA 4EBPA 5E2EA 1PW1A 1YLZA 1FR1A 4KZ4A 3IXGA 5F82A 2DRWA 4XUZA 4HEFA 1I5QA 2ZC6B 5FI2A 4DDYA 1ZKJA 5BOHA 1K57A 4UAAA 1PYYA 3BYDA 3UDFA 3ITBA 5JYOA 1XXMA 4QB8A 3HVFA 5GHZA 3JYIA 2J9PA 3C5AA 1MBLA 4OQIA 5DF8A 2Y2PA 4DE0A 3O3VA 2VGKA 5M1AA 1XGIA 3GMWA 3AGDA 3IXHA 3G32A 3NCKA 5EPHA 3FZCA 1GCEA 5TGFA 2XD5A 3G34A 5KSHA 4Y0OA 1YLPA 2X71A 1YLYA 1KDSA 2ZD8A 1KE0A 2Y2KA 3G31A 5CGSA 3OC2A 3VP0A 5CXWA 1K6SA 3FKWA 3ZG8B 3QHYA 2JBFA 3HUOA 3N8RA 5CHMA 3FKVA 1E4DA 2OLVA 1EROA 3FYZA 3LCEA 5FDHA 4WMCD 4FH2A 1FCNA 3MZEA 4EUZA 3EQUA 4X68A 2HP5A 3MKEA 3IH9A 1RGZA 3VMAA 4E3MA 4GDNA 5KSCA 3HL9A 2ZLYA 3C7UA 5HARA 4E3LA 4R4RA 4OLDA 3UNWA 4EWFA 2WAFA 3HLGA 3RXWA 1EI5A 1SDNA 3NDGA 1VQQA 4OVDA 4LV1A 1RP5A 1XGJA 3P98A 1L2SA 2X01A 4CPKA 5CEBA 5FI7A 3ZNYA 1HZOA 5A91A 4B4XA 1MPLA 5HW3A 2XK1A 4X56A 5I94A 2EX6A 4FH4A 4ZJ3A 4KZ6A 3SS3A 5TFQA 3V39A 4OPYA 1TEMA 2Y2JA 2WZZA 4NETA 3PTEA 3AGEA 4X55A 4WZ5C 2JE5A 1CEFA 3MBZA 4WELA 4C6YA 1K54C 1SCWA 1SDEA 4RVAA 1JVJA 2ZC3B 1YLTA 1RGYA 3IF6B 4DXBA 2UWXA 3E2KA 4GN2A 3RXXA 4MEZA 4JF4A 1BLHA 4JXSA 4UA6A 3G2YA 4YFMA 5HL1A 2ZM8A 1PZPA 1W8YA 4PM8A 3ZFZA 1MXOA 1H8ZA 3A3DA 4A5RA 5EVIC 2WKIA 4KG5A 3G4PA 2ZQ8A 1YMXA 2GDNA 4OKPA 4RYEA 5CGXA 3VOZA 3IWIA 3NBLA 2XFSA 3OPHA 2Y2IA 2ZQ7A 4OOMA 5KZHA 5GHXA 3W4PA 1I2SA 1VM1A 4Y7PA 4BD1A 1PIOA 5L2FA 4D2OA 1EWZA 1GHIA 1FCOA 1PWCA 3Q1FA 4LCMA 4QD4A 4E3JA 2PBYA 3HLFA 3WS0A 3VFFA 1H5XA 2G2WA 1GHMA 3GRJA 3MXSA 2RL3A 3WWXA 3MZDA 2IWCA 1M6KA 5EVLA 3V50A 3VP4A 3M6BA 5TR7A 4BD0A 1CEGA 2J9OA 1FCMA 4MBKA 4WEKA 3DWKA 3E2LA 2Z2MB 1IELA 1I2WA 2Y2QA 5D3OA 1BLSA 2XD1A 3S22A 1J9MA 4E3KA 3OZHA 2Y2HA 3SH7A 3IXBA 1NYMA 1C3BA 2EXBA 4L0LA 1KGGA 1TVFA 2I72A 2RCXA 5FQKA 2IWBA 1DJCA 1K56A 1TDLA 4KZ8A 3S4XA 3UDIA 1WYBA 3UN7A 3IQAA 4EV4A 5FQIA 4PM9A 4JF5A 5A90A 3WS1A 1S0WA 3P09A 4X69A 3Q7VB 2HPBA 5DVAA 4ZJ1A 3ZG9B 1MWSA 2ZC5B 1IYQA 4K0WA 2Y2LA 3Q7ZA 4OP5A 1ERMA 2R9XA 3HREA 2J8YA 2ZC7A 3HUMA 5E2GA 1XPBA 3N4IA 4WYYA 4U0TA 1NYYA 3IF6A 3IT9A 2H5SA 3HLDA 3OPRA 3ZG5A 1E3UA 4K91A 1MWRA 3HLWA 2Y2NA 4BL2A 2ZQDA 1L0DA 3ZGAB 3UE0A 3QNCA 1PZOA 1W5DA 4KQRA 3V5MA 1TDGA 1NJ4A 5CEDA 4QY6A 4HBTA 4KG2A 4KZAA 4KZ3A 1HVBA 3WRTA 5JYPA 3CG5A 2XF3A 3M2JA 4OOYA 4WEJA 3UY6A 4LV2A 2XLNA 1K56D 1PI5A 4GD6A 4U3TA 1YM1A 4E6WA 2EX9A 3HUNA 5M19A 3D4FA 1BLPA 3A3IA 5FASA 4OLGA 4Y0UA 2CC1A 1W7FA 2V1ZA 4S2MA 5DTTA 2Y91A 1WYCA 1K55A 2WGWB 3BM6A 2A49A 4OPZA 3BECA 2XEPA 4KENB 4KG6A 4X53A 4X6TA 5EE8A 1N9BA 4DF6A 4IBXA 4QY5A 3VP2A 2WGIA 3NC8A 4GKUA 3I7JA 1AXBA 5FAPA 1MWTA 1BUEA 1M40A 4JPMA 2VGJA 5IHVA 2XFTA 2QMIA 3IF5A 3CJMA 4GDBA 1N4OA 3IWOA 4OQGA 1DY6A 1E3UD 1GA9A 3ITAA 4MBHA 1CI8A 1XKZA 2PU4A 5F1GA 5FQQA 1KDWA 4DDSA 1L0FA 1K57C 2Y2GA 4R23A 5E2HA 4OOLA 1ES2A 4MNRA 5U47A 4GOGA 5M18A 3UPOA 1Q2QA 3BRMA 5KMWA 1L0GA 3MFDA 3IHAA 3N7WA 5CHJA 3IXDA 5EVIB 4OH0A 2Y59A 3BLSA 1FR6A 5FSRA 4BL3A 4IEDA 2XH9A 4N9KA 3C4OA 3IH8A 3CMZA 4IVIA 1QMFA 3HLEA 1HD8A 1BZAA 5FQJA 2PU2A 2HDQA 5HAIA 5DF7A 3PBOA 2JC7A 3BLMA 4KZ9A 4BLMA 2WADA 2ZQCA 4EBNA 4F94A 4M3KA 3SH8A 1G6AA 4PMAA 3GVBA 4IBRA 4ZAMA 2ZQ9A 1XA1A 2OSUA 4WM9A 1S6RA 1JWPA 3PAEA 4P87A 4UA7A 3EQVA 1BSGA 2HP6A 2X02A 3B3XA 3HBRA 4FSFA 3SS4A 4S2LA 1O7EA 1DJBA 3S1YA 1JTGA 5A93A 4RA7A 2Y4AA 1YLJA 4R4SA 3ZVTA 4DKIA 4C3QA 2EX8A 3DWZA 2WYXA 3SS5A 3N8SA 4N92A 1ALQA 5HFOA 4EBLA 4DXCA 4S2IA 1U60A 1PW8A 2ZM2A 2A3UA 4DE3A 3DW0A 4R1GA 1DJAA 3GSGA 4BJPA 3M6HA 5GHYA 5EUAA 1YMSA 4DE1A 2WK0A 3BFDA 1KE4A 1KE3A 4PM7A 5FA7A 5F1FA 4DE2A 4R3BA 1ERQA 3BEBA 1RCJA 1LI9A 3A3FA 1K25A 5E2FA 5FAQA 1HTZA 4ZJ2A 4PM5A 2R9WA 3N8LA 4KZBA 4O7DA 5AQBA 5FAOA 3PBSA 2V20A 4JXVA 3PAGA 5G18A 1NZOA 3GTCA 3M2KA 2DNSA 4S2NA 1MY8A 2P9VB 4ZTKA 3TOIA 4P6BA 4QU3A 3VOYA 1IYOA 3IWQA 4B4ZA 1CI9A 1KGEA 4HESA 2DCFA 2Q9MA 4WZ5A 3AGFA 3TSGA 2ZMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSW A;  1K38 A;  1K54 A;  4NK3 A;  2Y2O A;  5FAT A;  2WKE A;  1K4F A;  3G2Z A;  3Q07 A;  4MLL A;  4XXR A;  5AQ7 A;  4E6X A;  3TG9 A;  1FOF A;  2FFY A;  1BT5 A;  2XDM A;  4N9L A;  1NY0 A;  4FCF A;  3FWL A;  4OPR A;  3WS5 A;  5GLC A;  4PPR A;  2Y2M A;  1PI4 A;  4JXW A;  5HX9 A;  4Q8I A;  1MWU A;  5J8X A;  3NI9 A;  2JCH A;  4S2J A;  5EVI A;  3UDX A;  3LO7 A;  1SHV A;  1W79 A;  3VP1 A;  2Q9N A;  2Z2L B;  1FQG A;  5CTM A;  1ONH A;  1BTL A;  2XQZ A;  1XA7 A;  4LCL A;  1PWD A;  3HLB A;  3V3R A;  3Q82 A;  5F83 A;  1ONG A;  1Q2P A;  2FFF B;  3SH9 A;  3MXR A;  1IKG A;  3IHB A;  5FQM A;  4WBG A;  1BLC A;  3NIA A;  5CRF A;  3NY4 A;  3WS2 A;  1ESI A;  1K4E A;  1ES4 A;  4JBF A;  3OCN A;  4QHC A;  5EEC A;  3O88 A;  3BFG A;  5A92 A;  3OPL A;  1QME A;  1MKI A;  4YIN A;  1OME A;  2XR0 A;  1CK3 A;  3ZG0 A;  1YT4 A;  2QPN A;  3PBN A;  5CER A;  3UE1 A;  3V3S A;  4KQQ A;  4MBF A;  1SKF A;  2ZJ9 A;  4DRT A;  3ZG7 B;  5AQ9 A;  4HBU A;  1ZC2 A;  3A3J A;  4JLF A;  3FV7 A;  4GD8 A;  1LL5 A;  4EQI A;  5GLA A;  1ES3 A;  2WZX A;  4OQH A;  4S2N C;  1LHY A;  4N1X A;  1G68 A;  4B88 A;  2C5W B;  4BEN A;  4N1H A;  3C7V A;  3VSL A;  4S2K A;  1LI0 A;  1IYS A;  4KZ7 A;  5EVI D;  3RJU A;  4C75 A;  3OPP A;  5HAP A;  3UPP A;  3O87 A;  2H0T A;  4P0M A;  4QJG A;  4ZDX A;  3IF6 C;  2WUQ A;  3VP3 A;  3W4Q A;  3BFF A;  5FI6 A;  1Z6F A;  5DF9 A;  2HDU A;  5GLD A;  3Q7V A;  5AQA A;  4E3I A;  4KQO A;  2C6W B;  3BFE A;  3O86 A;  4GNU A;  2P9V A;  2QZ6 A;  2V2F F;  4OON A;  1KVM A;  5CEC A;  5HAQ A;  2B5R A;  1E25 A;  1GHP A;  1KGF A;  1NRF A;  3HLC A;  3QNB A;  2OLU A;  2HP9 A;  2Y55 A;  4P85 A;  3UPN A;  1GA0 A;  2J7V A;  2WAE A;  3WRZ A;  2P74 A;  2WGV A;  3PBR A;  4Z9Q A;  4H8R A;  2ZC4 B;  1Y54 A;  1NZU A;  1YQS A;  1ZG6 A;  1FSY A;  3WS4 A;  1PWG A;  5GL9 A;  2BLS A;  4R0Q A;  3GR2 A;  1W8Q A;  2ZM0 A;  4RX2 A;  4BQM A;  2EFX A;  4R3J A;  4S2P A;  1ZG4 A;  2H0Y A;  1K6R A;  1LLB A;  4JKT A;  3CZD A;  4U0X A;  3VFH A;  1L0E A;  4E3N A;  2XGN A;  3MZF A;  3OCL A;  3LEZ A;  3W4O A;  2HDR A;  2ZQA A;  2H10 A;  3SOI A;  4OQ0 A;  1K55 C;  4KZ5 A;  2HDS A;  3GV9 A;  5DTS A;  4LV0 A;  1JTD A;  1XP4 A;  3G30 A;  1ES5 A;  1H8Y A;  2BG1 A;  3ZNT A;  1BUL A;  1NXY A;  1WE4 A;  3Q81 A;  4K0X A;  4E3O A;  4UA9 A;  3ZHH A;  4IVK A;  1IYP A;  5FQ9 A;  3UO9 A;  4JXG A;  2WKH A;  3W8K A;  3ZVW A;  3C4P A;  3A3E A;  3G35 A;  3PBT A;  3BFC A;  4GZB A;  4OP8 A;  4ZBE A;  5EOO A;  1IEM A;  1XX2 A;  4XUX A;  1O07 A;  3PBQ A;  2G2U A;  4LV3 A;  4GB7 A;  5E43 A;  3UE3 A;  3N6I A;  2WGW A;  4WZ4 A;  4WMC A;  5EOE A;  4ID4 A;  5CGW A;  2EX2 A;  4UHU A;  2EFU A;  4JF6 A;  1JWZ A;  4S2O A;  5CHU A;  2OV5 A;  3DTM A;  3GQZ A;  3VSK A;  4CJN A;  1ESU A;  2E8I A;  3NDE A;  1LL9 A;  3LY4 A;  5DTK A;  1KVL A;  3LY3 A;  4FD8 A;  2IWD A;  5CTN A;  1JWV A;  4LEN A;  2EXA A;  4PM6 A;  5GLB A;  1YLW A;  3ZDJ A;  3ISG A;  4Y0T A;  4RX3 A;  4OPQ A;  3ZCZ A;  1IKI A;  3MKF A;  4EBP A;  5E2E A;  1PW1 A;  1YLZ A;  1FR1 A;  4KZ4 A;  3IXG A;  5F82 A;  2DRW A;  4XUZ A;  4HEF A;  1I5Q A;  2ZC6 B;  5FI2 A;  4DDY A;  1ZKJ A;  5BOH A;  1K57 A;  4UAA A;  1PYY A;  3BYD A;  3UDF A;  3ITB A;  5JYO A;  1XXM A;  4QB8 A;  3HVF A;  5GHZ A;  3JYI A;  2J9P A;  3C5A A;  1MBL A;  4OQI A;  5DF8 A;  2Y2P A;  4DE0 A;  3O3V A;  2VGK A;  5M1A A;  1XGI A;  3GMW A;  3AGD A;  3IXH A;  3G32 A;  3NCK A;  5EPH A;  3FZC A;  1GCE A;  5TGF A;  2XD5 A;  3G34 A;  5KSH A;  4Y0O A;  1YLP A;  2X71 A;  1YLY A;  1KDS A;  2ZD8 A;  1KE0 A;  2Y2K A;  3G31 A;  5CGS A;  3OC2 A;  3VP0 A;  5CXW A;  1K6S A;  3FKW A;  3ZG8 B;  3QHY A;  2JBF A;  3HUO A;  3N8R A;  5CHM A;  3FKV A;  1E4D A;  2OLV A;  1ERO A;  3FYZ A;  3LCE A;  5FDH A;  4WMC D;  4FH2 A;  1FCN A;  3MZE A;  4EUZ A;  3EQU A;  4X68 A;  2HP5 A;  3MKE A;  3IH9 A;  1RGZ A;  3VMA A;  4E3M A;  4GDN A;  5KSC A;  3HL9 A;  2ZLY A;  3C7U A;  5HAR A;  4E3L A;  4R4R A;  4OLD A;  3UNW A;  4EWF A;  2WAF A;  3HLG A;  3RXW A;  1EI5 A;  1SDN A;  3NDG A;  1VQQ A;  4OVD A;  4LV1 A;  1RP5 A;  1XGJ A;  3P98 A;  1L2S A;  2X01 A;  4CPK A;  5CEB A;  5FI7 A;  3ZNY A;  1HZO A;  5A91 A;  4B4X A;  1MPL A;  5HW3 A;  2XK1 A;  4X56 A;  5I94 A;  2EX6 A;  4FH4 A;  4ZJ3 A;  4KZ6 A;  3SS3 A;  5TFQ A;  3V39 A;  4OPY A;  1TEM A;  2Y2J A;  2WZZ A;  4NET A;  3PTE A;  3AGE A;  4X55 A;  4WZ5 C;  2JE5 A;  1CEF A;  3MBZ A;  4WEL A;  4C6Y A;  1K54 C;  1SCW A;  1SDE A;  4RVA A;  1JVJ A;  2ZC3 B;  1YLT A;  1RGY A;  3IF6 B;  4DXB A;  2UWX A;  3E2K A;  4GN2 A;  3RXX A;  4MEZ A;  4JF4 A;  1BLH A;  4JXS A;  4UA6 A;  3G2Y A;  4YFM A;  5HL1 A;  2ZM8 A;  1PZP A;  1W8Y A;  4PM8 A;  3ZFZ A;  1MXO A;  1H8Z A;  3A3D A;  4A5R A;  5EVI C;  2WKI A;  4KG5 A;  3G4P A;  2ZQ8 A;  1YMX A;  2GDN A;  4OKP A;  4RYE A;  5CGX A;  3VOZ A;  3IWI A;  3NBL A;  2XFS A;  3OPH A;  2Y2I A;  2ZQ7 A;  4OOM A;  5KZH A;  5GHX A;  3W4P A;  1I2S A;  1VM1 A;  4Y7P A;  4BD1 A;  1PIO A;  5L2F A;  4D2O A;  1EWZ A;  1GHI A;  1FCO A;  1PWC A;  3Q1F A;  4LCM A;  4QD4 A;  4E3J A;  2PBY A;  3HLF A;  3WS0 A;  3VFF A;  1H5X A;  2G2W A;  1GHM A;  3GRJ A;  3MXS A;  2RL3 A;  3WWX A;  3MZD A;  2IWC A;  1M6K A;  5EVL A;  3V50 A;  3VP4 A;  3M6B A;  5TR7 A;  4BD0 A;  1CEG A;  2J9O A;  1FCM A;  4MBK A;  4WEK A;  3DWK A;  3E2L A;  2Z2M B;  1IEL A;  1I2W A;  2Y2Q A;  5D3O A;  1BLS A;  2XD1 A;  3S22 A;  1J9M A;  4E3K A;  3OZH A;  2Y2H A;  3SH7 A;  3IXB A;  1NYM A;  1C3B A;  2EXB A;  4L0L A;  1KGG A;  1TVF A;  2I72 A;  2RCX A;  5FQK A;  2IWB A;  1DJC A;  1K56 A;  1TDL A;  4KZ8 A;  3S4X A;  3UDI A;  1WYB A;  3UN7 A;  3IQA A;  4EV4 A;  5FQI A;  4PM9 A;  4JF5 A;  5A90 A;  3WS1 A;  1S0W A;  3P09 A;  4X69 A;  3Q7V B;  2HPB A;  5DVA A;  4ZJ1 A;  3ZG9 B;  1MWS A;  2ZC5 B;  1IYQ A;  4K0W A;  2Y2L A;  3Q7Z A;  4OP5 A;  1ERM A;  2R9X A;  3HRE A;  2J8Y A;  2ZC7 A;  3HUM A;  5E2G A;  1XPB A;  3N4I A;  4WYY A;  4U0T A;  1NYY A;  3IF6 A;  3IT9 A;  2H5S A;  3HLD A;  3OPR A;  3ZG5 A;  1E3U A;  4K91 A;  1MWR A;  3HLW A;  2Y2N A;  4BL2 A;  2ZQD A;  1L0D A;  3ZGA B;  3UE0 A;  3QNC A;  1PZO A;  1W5D A;  4KQR A;  3V5M A;  1TDG A;  1NJ4 A;  5CED A;  4QY6 A;  4HBT A;  4KG2 A;  4KZA A;  4KZ3 A;  1HVB A;  3WRT A;  5JYP A;  3CG5 A;  2XF3 A;  3M2J A;  4OOY A;  4WEJ A;  3UY6 A;  4LV2 A;  2XLN A;  1K56 D;  1PI5 A;  4GD6 A;  4U3T A;  1YM1 A;  4E6W A;  2EX9 A;  3HUN A;  5M19 A;  3D4F A;  1BLP A;  3A3I A;  5FAS A;  4OLG A;  4Y0U A;  2CC1 A;  1W7F A;  2V1Z A;  4S2M A;  5DTT A;  2Y91 A;  1WYC A;  1K55 A;  2WGW B;  3BM6 A;  2A49 A;  4OPZ A;  3BEC A;  2XEP A;  4KEN B;  4KG6 A;  4X53 A;  4X6T A;  5EE8 A;  1N9B A;  4DF6 A;  4IBX A;  4QY5 A;  3VP2 A;  2WGI A;  3NC8 A;  4GKU A;  3I7J A;  1AXB A;  5FAP A;  1MWT A;  1BUE A;  1M40 A;  4JPM A;  2VGJ A;  5IHV A;  2XFT A;  2QMI A;  3IF5 A;  3CJM A;  4GDB A;  1N4O A;  3IWO A;  4OQG A;  1DY6 A;  1E3U D;  1GA9 A;  3ITA A;  4MBH A;  1CI8 A;  1XKZ A;  2PU4 A;  5F1G A;  5FQQ A;  1KDW A;  4DDS A;  1L0F A;  1K57 C;  2Y2G A;  4R23 A;  5E2H A;  4OOL A;  1ES2 A;  4MNR A;  5U47 A;  4GOG A;  5M18 A;  3UPO A;  1Q2Q A;  3BRM A;  5KMW A;  1L0G A;  3MFD A;  3IHA A;  3N7W A;  5CHJ A;  3IXD A;  5EVI B;  4OH0 A;  2Y59 A;  3BLS A;  1FR6 A;  5FSR A;  4BL3 A;  4IED A;  2XH9 A;  4N9K A;  3C4O A;  3IH8 A;  3CMZ A;  4IVI A;  1QMF A;  3HLE A;  1HD8 A;  1BZA A;  5FQJ A;  2PU2 A;  2HDQ A;  5HAI A;  5DF7 A;  3PBO A;  2JC7 A;  3BLM A;  4KZ9 A;  4BLM A;  2WAD A;  2ZQC A;  4EBN A;  4F94 A;  4M3K A;  3SH8 A;  1G6A A;  4PMA A;  3GVB A;  4IBR A;  4ZAM A;  2ZQ9 A;  1XA1 A;  2OSU A;  4WM9 A;  1S6R A;  1JWP A;  3PAE A;  4P87 A;  4UA7 A;  3EQV A;  1BSG A;  2HP6 A;  2X02 A;  3B3X A;  3HBR A;  4FSF A;  3SS4 A;  4S2L A;  1O7E A;  1DJB A;  3S1Y A;  1JTG A;  5A93 A;  4RA7 A;  2Y4A A;  1YLJ A;  4R4S A;  3ZVT A;  4DKI A;  4C3Q A;  2EX8 A;  3DWZ A;  2WYX A;  3SS5 A;  3N8S A;  4N92 A;  1ALQ A;  5HFO A;  4EBL A;  4DXC A;  4S2I A;  1U60 A;  1PW8 A;  2ZM2 A;  2A3U A;  4DE3 A;  3DW0 A;  4R1G A;  1DJA A;  3GSG A;  4BJP A;  3M6H A;  5GHY A;  5EUA A;  1YMS A;  4DE1 A;  2WK0 A;  3BFD A;  1KE4 A;  1KE3 A;  4PM7 A;  5FA7 A;  5F1F A;  4DE2 A;  4R3B A;  1ERQ A;  3BEB A;  1RCJ A;  1LI9 A;  3A3F A;  1K25 A;  5E2F A;  5FAQ A;  1HTZ A;  4ZJ2 A;  4PM5 A;  2R9W A;  3N8L A;  4KZB A;  4O7D A;  5AQB A;  5FAO A;  3PBS A;  2V20 A;  4JXV A;  3PAG A;  5G18 A;  1NZO A;  3GTC A;  3M2K A;  2DNS A;  4S2N A;  1MY8 A;  2P9V B;  4ZTK A;  3TOI A;  4P6B A;  4QU3 A;  3VOY A;  1IYO A;  3IWQ A;  4B4Z A;  1CI9 A;  1KGE A;  4HES A;  2DCF A;  2Q9M A;  4WZ5 A;  3AGF A;  3TSG A;  2ZMA A; 
#chains in the Genus database with same CATH topology
 1K54 A;  2WKE A;  3Q07 A;  2Y8H A;  1FOF A;  1BT5 A;  2XDM A;  1NY0 A;  4L9E A;  3QP6 A;  4MN7 A;  1PI4 A;  4JXW A;  4Q8I A;  3QP2 A;  3IX3 A;  4HH3 A;  4S2J A;  3HJI A;  1SHV A;  1W79 A;  2Z2L B;  3T4T A;  5CTM A;  1BTL A;  4NXE A;  4LCL A;  2O0Y A;  2XSS A;  3EOI A;  3HLB A;  3T1Q B;  5FQM A;  3NIA A;  3O88 A;  5A92 A;  1MKI A;  4YIN A;  5TJJ A;  1OME A;  4BBU A;  3T12 B;  3ZG0 A;  3PBN A;  5HPF A;  4MBF A;  1SKF A;  2W3G A;  4JLF A;  4EU0 A;  1CJF A;  1DP8 A;  4BEN A;  4N1H A;  2D02 A;  5EVI D;  5HAP A;  3OPP A;  4ETX A;  3BFF A;  5FI6 A;  3Q7V A;  4ESP A;  3BFE A;  3LI9 A;  2P9V A;  4I3I A;  4L9F A;  1KVM A;  1E25 A;  1GHP A;  1KGF A;  5C5K A;  2OLU A;  4P85 A;  1GA0 A;  2J7V A;  2WAE A;  2ZMV A;  3PBR A;  4ETZ A;  4GCZ A;  4CLC E;  1NZU A;  3IS2 A;  5LBR A;  4WF0 A;  2H0Y A;  1LLB A;  4JKT A;  3R7W A;  2XGN A;  2PRF A;  1XP4 A;  3G30 A;  1ES5 A;  1WE4 A;  5FQ9 A;  2WKH A;  3C4P A;  3P01 A;  4O0P A;  2PYR A;  2HGV A;  1O07 A;  4LV3 A;  2Q0O A;  1XJ6 A;  4H6J B;  4ID4 A;  5CGW A;  4EW7 A;  3T4O A;  4S2O A;  1JWZ A;  5CHU A;  3DTM A;  3GQZ A;  2E8I A;  1LL9 A;  1N9O A;  4FD8 A;  3F1N B;  5GLB A;  3ZDJ A;  4Y0T A;  3ISG A;  3ZCZ A;  5E2E A;  1PW1 A;  3T4Q A;  1I5Q A;  4F3L B;  3NHQ A;  5HD5 A;  2VJW A;  4QB8 A;  5GHZ A;  2J9P A;  1MBL A;  3GMW A;  3AGD A;  1S67 L;  3HJK A;  4HY8 A;  2X71 A;  5HL6 A;  1KDS A;  2Y2K A;  3G31 A;  3OC2 A;  2VX8 A;  3FKW A;  3N8R A;  3LR5 A;  1D1J A;  3VMA A;  1RGZ A;  5KSC A;  5HAR A;  3C7U A;  2WAF A;  3HLG A;  1MKM A;  3PR6 A;  3NDG A;  1XGJ A;  5EFW A;  4CQH A;  3ZNY A;  1MPL A;  1XFN A;  2XK1 A;  4X56 A;  4B9O A;  4E04 A;  2EX6 A;  3E98 A;  4KZ6 A;  3LGO A;  4OPY A;  4PKY A;  4NET A;  2JE5 A;  1CEF A;  3MBZ A;  1S4S A;  1K54 C;  1SCW A;  1SDE A;  4DXB A;  1JVJ A;  1YSQ A;  4HJ6 A;  4UA6 A;  3LIA A;  1W8Y A;  1YMX A;  1VET B;  2GDN A;  3VOZ A;  1OTA A;  5F6A A;  3NOU C;  3C8C A;  2A2L A;  4OOM A;  5KZH A;  5GHX A;  3W4P A;  4GW9 A;  1I2S A;  1VM1 A;  3VOL A;  3LIC A;  1PWC A;  2V1A A;  2PBY A;  3HLF A;  1OTB A;  2G2W A;  3BWL A;  3KYZ A;  2KX6 A;  2JKR M;  2INW A;  5FDS A;  1FCM A;  1NRJ A;  2Z2M B;  3QP1 A;  3MQQ A;  2HZ5 A;  3OZH A;  1NYM A;  1C3B A;  2I72 A;  5FQK A;  2IWB A;  3KSF A;  1T1B A;  3PHY A;  3UB9 A;  4MN5 A;  1DJC A;  1K56 A;  3T1X A;  2WKR A;  1Z09 A;  3R4K A;  4FOF A;  3RTY A;  4JF5 A;  5L09 A;  4X69 A;  4ZJ1 A;  2HPB A;  3ZG9 B;  1MWS A;  4K0W A;  3BY9 A;  3KO6 A;  4KUO A;  2R9X A;  4IUH A;  3H7W B;  3IT9 A;  2H5S A;  2BTF P;  1V9Y A;  4BL2 A;  2Y2N A;  2OOL A;  4KQR A;  3V5M A;  1NJ4 A;  2JN7 A;  4KZA A;  4KZ3 A;  5JYP A;  1HVB A;  3BJN A;  3CG5 A;  2XLN A;  4GD6 A;  4Y0U A;  1W7F A;  2O99 A;  2B95 A;  2Y79 A;  3F1P B;  3V67 A;  2A49 A;  4OPZ A;  3OLO A;  4DF6 A;  4GKU A;  3NC8 A;  2PDR A;  5CX7 A;  1S4R A;  1MWT A;  2NUP C;  1BUE A;  1G5U A;  1IFQ A;  1M40 A;  4JPM A;  5A8B A;  3IF5 A;  3CJM A;  1ZTU A;  1GA9 A;  1XKZ A;  2PU4 A;  4H6J A;  1KDW A;  4ARZ B;  1L0F A;  3RH8 B;  1ES2 A;  4MNR A;  4GOG A;  3GEC A;  3UPO A;  3W2Z A;  5CHJ A;  2Y59 A;  1FR6 A;  4N9K A;  3C4O A;  1QMF A;  1HD8 A;  2L4R A;  3C38 A;  3DTE A;  1YSP A;  1W63 M;  4F3L A;  2W3F A;  2WAD A;  2WKP A;  5DJT A;  2JKT M;  4F94 A;  4CLC D;  1G6A A;  2ZQ9 A;  1XA1 A;  2OSU A;  4EEU A;  4P87 A;  1BSG A;  4Y2F A;  1DJB A;  3S1Y A;  5A93 A;  4RA7 A;  2PR6 A;  3SS5 A;  1ALQ A;  1F2K A;  3LYX A;  1TS7 A;  4S2I A;  2P7J A;  4FTX A;  4R1G A;  3M6H A;  4DE1 A;  4DE2 A;  2ZOH A;  1RCJ A;  1LI9 A;  3A3F A;  1K25 A;  4ZRR A;  4O7D A;  5AQB A;  4JXV A;  3PAG A;  3GTC A;  4ZTK A;  2P9V B;  2E8J A;  1LL8 A;  1IYO A;  3KYE A;  4NG2 A;  4MMN A;  4HES A;  4M4X A;  1AWI A;  4WZ5 A;  1FSW A;  3LIE A;  2Y2O A;  5TBM A;  3TG9 A;  4N9L A;  3T4L A;  4FCF A;  3FWL A;  4PPR A;  5HX9 A;  5J8X A;  3NI9 A;  4R70 A;  5EVI A;  3LO7 A;  1VET A;  4QPR A;  5DFY A;  4II7 A;  2XQZ A;  3V3R A;  1YPR A;  3Q82 A;  1FIL A;  5G4Z A;  1ONG A;  3IHB A;  5HD3 A;  4WBG A;  1BLC A;  5CRF A;  3B47 A;  4WLA A;  3NY4 A;  3OCN A;  3CHW P;  3BFG A;  3FPV A;  1DP6 A;  1SKO A;  1F9I A;  3MQ0 A;  2XR0 A;  3BQA A;  1CK3 A;  3UE1 A;  4DRT A;  4HBU A;  3A3J A;  1LL5 A;  4EQI A;  5GLA A;  5HSQ A;  1VB6 A;  1PRQ A;  4OQH A;  4P6Z S;  4S2N C;  2K31 A;  1OT6 A;  3C7V A;  4S2K A;  4KZ7 A;  4C75 A;  4O8G A;  2GX5 A;  2H0T A;  3S7Q A;  4ZDX A;  3LEQ A;  2WUQ A;  3W4Q A;  2W27 A;  5GLD A;  2V1B A;  5AQA A;  4KQO A;  4HIA A;  4QWO A;  2C6W B;  2G7U A;  3O86 A;  5DJU A;  1CQA A;  2QYB A;  4O01 A;  5HDD A;  2B5R A;  3HLC A;  3QNB A;  2A24 B;  4Q0J A;  4R3A A;  2WGV A;  5DKL A;  3H7W A;  4H8R A;  2ZC4 B;  2P08 A;  1PWG A;  3MJQ A;  4R0Q A;  2FZ0 A;  2ZM0 A;  4RX2 A;  4I39 A;  4S2P A;  2ACG A;  3C30 A;  3CZD A;  3A0S A;  3LEZ A;  2H10 A;  2V8F A;  3A0V A;  3LIF A;  2DMW A;  2HDS A;  5DTS A;  4LV0 A;  3B33 A;  4GHI B;  3KX0 X;  4E3O A;  1BUL A;  3ZHH A;  4IVK A;  3UO9 A;  3G35 A;  3PBT A;  1IEM A;  3D3O A;  3PBQ A;  3N6I A;  3F1P A;  4WZ4 A;  4HJ3 A;  4YOF A;  1N9L A;  2VGL S;  2LB9 A;  3NDE A;  3CAX A;  3MMH A;  5K5B A;  4RX3 A;  1TS6 A;  4EBP A;  1YLZ A;  1FR1 A;  3IXG A;  2DRW A;  4HEF A;  4ARZ A;  4KQD A;  2W1T B;  4LLO B;  3UB6 A;  3UDF A;  5JYO A;  3O3V A;  1NWZ A;  1XGI A;  5EPH A;  3OOV A;  4Y0O A;  1KE0 A;  3VP0 A;  5CXW A;  2JBF A;  3HUO A;  1E4D A;  5EV0 A;  2MJ6 A;  5AVF A;  4X68 A;  3UB5 P;  3MSH A;  4E3L A;  4R4R A;  4OLD A;  3UNW A;  2ZMF A;  4OVD A;  3MF0 A;  1GSV A;  3MS6 A;  3P98 A;  3PYP A;  5FI7 A;  4B4X A;  5HW3 A;  3SS3 A;  3V39 A;  2PHY A;  2FH5 A;  1TEM A;  4WZ5 C;  4WEL A;  4DDS A;  3ZYT A;  1TF1 A;  1YLT A;  1RGY A;  2UWX A;  2ZL1 B;  3E2K A;  4HNB A;  4JF4 A;  1BLH A;  4JXS A;  4UEY A;  4YFM A;  5HL1 A;  4LPZ A;  2ZM8 A;  1PZP A;  1S1Z A;  3ZFZ A;  1T1A A;  4A5R A;  5EVI C;  2P04 A;  2WKI A;  3G4P A;  2EWV A;  2QJ7 A;  4OKP A;  4RYE A;  1L3L A;  5CGX A;  3IWI A;  3NBL A;  2ZQ7 A;  4FUW A;  2W0N A;  1OTD A;  4Y15 A;  4I5S A;  1DRM A;  1PIO A;  3TW8 A;  4D2O A;  1EWZ A;  2HV1 A;  1H5X A;  2V9A A;  2YKH A;  3GRJ A;  1SZV A;  2RL3 A;  2K7S A;  5EVL A;  1LSV A;  5TR7 A;  2AVX A;  4WEK A;  3E2L A;  1IEL A;  2Y2Q A;  5D3O A;  1GSW A;  3S22 A;  1J9M A;  1J3W A;  3T1R A;  2Y2H A;  3IXB A;  2EXB A;  1KGG A;  2RCX A;  3EEH A;  1TDL A;  2XA7 S;  3IQA A;  2J3T D;  1CF0 A;  5FQI A;  1TD5 A;  5A90 A;  5DVA A;  5HWT A;  4R38 A;  4Z1W A;  1ERM A;  2J8Y A;  4PHT A;  3E4P A;  4WYY A;  4U0T A;  3C2W A;  1OPX A;  4K91 A;  3HLW A;  1L0D A;  1WA9 A;  3JPU A;  1OTE A;  3ZGA B;  3QNC A;  1W5D A;  2A24 A;  4QY6 A;  3WRT A;  4OOY A;  4LV2 A;  2B02 A;  5M19 A;  3D4F A;  2CC1 A;  4S2M A;  5DTT A;  1N9N A;  3LID A;  3QP5 A;  4CLC A;  3IBR A;  4GHI A;  4KEN B;  4X6T A;  1UGU A;  1N9B A;  5J4E A;  2WGI A;  1AXB A;  4YNR A;  5TBM B;  5IHV A;  2QMI A;  1N4O A;  3IWO A;  1E3U D;  5G18 A;  3UB8 A;  5F1G A;  1LT0 A;  4OOL A;  1H0M A;  5M18 A;  3MFD A;  3N7W A;  3IXD A;  3CI6 A;  4G3V A;  5EVI B;  3DBA A;  2XH9 A;  3CMZ A;  1PNE A;  5FQJ A;  2HDQ A;  2W1T A;  5DF7 A;  3PBO A;  2JC7 A;  3BLM A;  4BLM A;  4IBR A;  3UME A;  1G6O A;  4UA7 A;  1SKO B;  3B3X A;  4K08 A;  3SS4 A;  3T50 A;  2J3W A;  4PAU A;  3ZVT A;  4R4S A;  3QP4 A;  4DKI A;  4WL9 A;  3N8S A;  4N92 A;  1H3Q A;  3TE8 A;  1MC0 A;  2A3U A;  5EUA A;  2WK0 A;  2L1M A;  4PM7 A;  3O5Y A;  1DP9 A;  4ZJ2 A;  4PM5 A;  2W1R A;  4NXF A;  3PBS A;  2KDK A;  3MXQ A;  1NZO A;  3M2K A;  4S2N A;  4UQI S;  4B4Z A;  2M7V A;  1KGE A;  5EM1 A;  2Q9M A;  2JHE A;  3AGF A;  4NK3 A;  1K38 A;  2PD7 A;  5FAT A;  4MLL A;  1K4F A;  3G2Z A;  4E6X A;  4XXR A;  2ZL1 A;  4JGO A;  2W3E A;  2GJ3 A;  4OPR A;  5GLC A;  2GZA A;  3JVU A;  3DTK A;  2JCH A;  3UDX A;  1FQG A;  2VV6 A;  1XA7 A;  2V0W A;  2IA2 A;  4HH2 A;  2FFF B;  4LRY C;  1ESI A;  1BYW A;  1ES4 A;  1T19 A;  1STZ A;  1D7E A;  1QME A;  5IS1 A;  5MC7 A;  3CLO A;  2QPN A;  5CER A;  3V3S A;  4BWI A;  3L9K A;  2PT7 A;  1ACF A;  2ZJ9 A;  1ZC2 A;  3K2N A;  1LSW A;  4Q0H A;  4GD8 A;  1ES3 A;  1NLY A;  2WZX A;  1G68 A;  3CWF A;  1LI0 A;  3DTI A;  2VEA A;  3O87 A;  4P0M A;  3VP3 A;  3JVV A;  1XJ3 A;  4EQ1 A;  5CEC A;  5HAQ A;  1NRF A;  2HP9 A;  2Y55 A;  4EUV A;  2OAP 1;  3S7N A;  4EEP A;  3WS4 A;  1F98 A;  3GR2 A;  1W8Q A;  2O9B A;  4WUJ A;  2EFX A;  4I3A A;  1K6R A;  1W63 Q;  3VFH A;  3OCL A;  3W4O A;  2ZQA A;  4BBT A;  5L07 A;  4OQ0 A;  4CLC C;  3GV9 A;  1JTD A;  2JKF A;  2BG1 A;  4Q0I A;  3ZNT A;  1NXY A;  4K0X A;  3Q81 A;  4UA9 A;  4X1L A;  2OWH A;  4GZB A;  3BFC A;  4ZBE A;  4OP8 A;  2VV7 A;  5J7E A;  3TRC A;  3LUQ A;  4X25 A;  2EX2 A;  3LFV A;  4UHU A;  3MR0 A;  4JF6 A;  3LY4 A;  3LY3 A;  5CTN A;  4LEN A;  2EXA A;  4PM6 A;  1NLZ A;  3H9W A;  1YLW A;  4OPQ A;  4DDY A;  5BOH A;  3UE6 A;  1TS0 A;  3BYD A;  5HZH A;  3HVF A;  3C5A A;  4OQI A;  5DF8 A;  2Y2P A;  4DE0 A;  3EEA A;  2VGK A;  2JKR I;  1YKD A;  3G32 A;  3NCK A;  3NOP C;  2XD5 A;  3G34 A;  1HLU P;  1YLY A;  2ZD8 A;  5CGS A;  4MN6 A;  1EW0 A;  3QHY A;  4DN0 A;  5CHM A;  4G3W A;  5FDH A;  4WMC D;  3BY8 A;  1FCN A;  3MZE A;  3IH9 A;  3P7N A;  3LI8 A;  3HL9 A;  2ZLY A;  4NKP A;  4EWF A;  3RXW A;  2VLG A;  1EI5 A;  1VQQ A;  1L2S A;  2X01 A;  4CPK A;  5CEB A;  3CPT B;  2PAV P;  5I94 A;  4FH4 A;  4ZJ3 A;  3SZT A;  3KSH A;  4HQA A;  1ODV A;  3PTE A;  4ME4 A;  4X55 A;  3U4L P;  4RVA A;  3ULF A;  4GS9 B;  4GN2 A;  3RXX A;  5KIZ A;  3G2Y A;  4Y5F A;  4JGP A;  4PM8 A;  2O9A A;  1H8Z A;  1VEU B;  3A3D A;  2H28 A;  2ZQ8 A;  3BW6 A;  2QWS A;  3GDI A;  2XFS A;  3OPH A;  4IUK A;  2V8C A;  2QJ5 A;  4CLC B;  2ZOI A;  1FCO A;  1GHI A;  4LCM A;  3Q1F A;  4QD4 A;  4E3J A;  2O9C A;  4P6Z M;  3MZD A;  2B18 A;  1OT9 A;  2IWC A;  3M6B A;  4EES A;  4BD0 A;  1CEG A;  2J9O A;  4MBK A;  3DWK A;  2XD1 A;  3T4S A;  2JKG A;  3SH7 A;  4L0L A;  1T18 A;  3S4X A;  4KZ8 A;  1IOU A;  1WYB A;  3UN7 A;  4EV4 A;  1KOU A;  4PM9 A;  2JKT I;  3P09 A;  2KLI A;  2ZC5 B;  2M1C A;  5HDS A;  4L9G A;  1Y4O A;  3KSG A;  3FC7 A;  2UV0 E;  2Y2L A;  2ZC7 A;  3U2A A;  5IU1 A;  1OJ5 A;  3F1O B;  5HDC A;  3IF6 A;  3HLD A;  2QHK A;  1E3U A;  1MWR A;  4DJ3 A;  2Z6C A;  3ZQ5 A;  4IHQ A;  5CED A;  4HBT A;  4JGQ A;  2XF3 A;  3OBF A;  2VGL M;  1PI5 A;  4Y17 A;  4E6W A;  4HI4 A;  3HUN A;  4LRZ E;  4OLG A;  2LB5 A;  2V1Z A;  1WYC A;  1K55 A;  3DAV A;  2WGW B;  3BM6 A;  4DJ2 A;  4D60 A;  2XEP A;  2J80 A;  1FIK A;  3UB7 A;  4QY5 A;  4EET B;  5FAP A;  3NOT C;  2XFT A;  3UMD A;  4GDB A;  3ITA A;  5FQQ A;  5FEF A;  1CI8 A;  5IT5 A;  2Y2G A;  4R23 A;  1D06 A;  5U47 A;  1Q2Q A;  5FSR A;  4BL3 A;  4IED A;  3IH8 A;  1BZA A;  2PU2 A;  3K3D A;  3SW1 A;  2VZW A;  2I9V A;  4KZ9 A;  4I38 A;  2QKP A;  3T4K A;  3SH8 A;  4PMA A;  3GVB A;  4XT2 B;  4ZAM A;  3IX4 A;  4WM9 A;  1S6R A;  2HP6 A;  2Y4A A;  1YLJ A;  4C3Q A;  2EX8 A;  2WYX A;  4EBL A;  1U60 A;  1S66 L;  1DJA A;  4BJP A;  1YMS A;  3KSI A;  1KE3 A;  5F1F A;  1V9Z A;  2W3D A;  4R3B A;  1ERQ A;  3BEB A;  5E2F A;  5FAQ A;  1HTZ A;  1JNU A;  4KZB A;  3N8L A;  5F69 A;  2V20 A;  3CPT A;  3NUL A;  2DNS A;  3NEC A;  3TOI A;  1ZHH B;  2HJE A;  1CI9 A;  1Q2P A;  3TSG A;  5AQ7 A;  2J3T C;  4GS9 A;  3A0R A;  5G4Y A;  5EVE A;  3IBJ A;  2FFY A;  3EWK A;  3WS5 A;  2PBD P;  4HP4 A;  2Y2M A;  3EGD C;  5FL3 A;  1MWU A;  1VEU A;  3VP1 A;  2Q9N A;  1TS8 A;  3T1S A;  1ONH A;  1H8M A;  3TJZ C;  2XRO A;  1PWD A;  1UWN X;  5F83 A;  2XA7 M;  3SH9 A;  3MXR A;  5L8M A;  4BMW A;  3E4Q A;  1IKG A;  3D9Y A;  1S1Y A;  3WS2 A;  1K4E A;  4JBF A;  4QHC A;  5EEC A;  3E4O A;  3LR3 A;  3OPL A;  4NEE D;  2PD8 A;  1YT4 A;  3IX8 A;  4LGW A;  4KQQ A;  3ZG7 B;  5AQ9 A;  5HWV A;  3FV7 A;  2EA9 A;  4B88 A;  1LHY A;  4N1X A;  1F5M A;  2C5W B;  2EWW A;  2K2N A;  3VSL A;  3RJU A;  1IYS A;  3UPP A;  3MFX A;  4IJG A;  4QJG A;  4GJ4 A;  3IF6 C;  1Z6F A;  5DF9 A;  2HDU A;  4E3I A;  2BAS A;  3ICY A;  4GNU A;  2QZ6 A;  2V2F F;  4OON A;  3CUE A;  2WKQ A;  4RQ9 A;  3UPN A;  3WRZ A;  2P74 A;  3S7P A;  3F1O A;  4Z9Q A;  1Y54 A;  1YQS A;  1ZG6 A;  2W3H A;  1FSY A;  5GL9 A;  2BLS A;  3LR0 A;  4BQM A;  4R3J A;  1ZG4 A;  4U0X A;  1L0E A;  4E3N A;  3MZF A;  2HDR A;  3SOI A;  1K55 C;  4KZ5 A;  2VA0 A;  4BBV A;  1H8Y A;  3L7H A;  1IYP A;  4JXG A;  3W8K A;  3ZVW A;  4I3J A;  3A3E A;  4HP9 A;  4LFU A;  5EOO A;  4XUX A;  1XX2 A;  2G2U A;  4GB7 A;  5E43 A;  2R78 A;  3UE3 A;  2WGW A;  4WMC A;  5EOE A;  1MZU A;  3D72 A;  1K0K A;  2EFU A;  2OV5 A;  3H82 B;  3VSK A;  4CJN A;  1ESU A;  5DTK A;  1KVL A;  2IWD A;  1G28 A;  1JWV A;  2CMN A;  2VK3 A;  1IKI A;  3MKF A;  4Y13 A;  4KZ4 A;  5F82 A;  1P97 A;  4XUZ A;  5DKK A;  2ZC6 B;  5FI2 A;  1P0Z A;  1ZKJ A;  3S7O A;  1K57 A;  4JGR A;  1PYY A;  4UAA A;  1T1C A;  3ITB A;  1XXM A;  1XJ4 A;  3JYI A;  5M1A A;  3IXH A;  4NXB A;  3FZC A;  1GCE A;  5TGF A;  5KSH A;  1YLP A;  1K6S A;  3EGX C;  3ZG8 B;  3FKV A;  2OLV A;  1ERO A;  3FYZ A;  3LCE A;  4XT2 A;  4FH2 A;  4EUZ A;  3EQU A;  2HP5 A;  3MKE A;  4E3M A;  4GDN A;  2XRN A;  4UQI M;  4LRX C;  4WN5 A;  1YAX A;  2KOI A;  1SDN A;  3K3C A;  4EXO A;  4LV1 A;  1RP5 A;  1OJG A;  1HZO A;  3BQ8 A;  4Y3I A;  5A91 A;  5AVE A;  5TFQ A;  4HJ4 A;  2Y2J A;  2WZZ A;  4PKY G;  3AGE A;  5J3W A;  3FG8 A;  5AJG A;  4C6Y A;  2ZC3 B;  3IF6 B;  1GSX A;  5F68 A;  4MEZ A;  1P9W A;  1XFQ A;  3VV4 A;  3QP8 A;  1MXO A;  3F1N A;  4KG5 A;  4EER A;  3PXP A;  2Y2I A;  3VE3 A;  4KUK A;  1LSX A;  5L10 A;  4Y7P A;  4BD1 A;  5L2F A;  3WS0 A;  4MDZ A;  2OAQ 1;  3VFF A;  1GHM A;  5HPI A;  3MXS A;  3WWX A;  1M6K A;  3V50 A;  3VP4 A;  2PR5 A;  2PYP A;  1OTI A;  2YKF A;  1I2W A;  1BLS A;  1X0O A;  4E3K A;  1TVF A;  3UDI A;  3HCY A;  1PFL A;  3CIT A;  3WS1 A;  1S0W A;  1A0K A;  3Q7V B;  2L0W A;  2VV8 A;  1XJ2 A;  1IYQ A;  5F5Y A;  3CUE C;  4AFI A;  3Q7Z A;  4OP5 A;  1UWP X;  3HRE A;  3B42 A;  3HUM A;  5E2G A;  1XPB A;  3N4I A;  1NYY A;  5EM0 A;  3IS2 B;  1Y28 A;  3OPR A;  3ZG5 A;  2ZQD A;  3T4J A;  3R7W B;  3UE0 A;  3MQO A;  1PZO A;  1TDG A;  2VKS A;  4KG2 A;  4DMZ A;  3M2J A;  4WEJ A;  3LR4 A;  3UY6 A;  1K56 D;  4U3T A;  1YM1 A;  2EX9 A;  1BLP A;  3A3I A;  5FAS A;  4MCW A;  2Y91 A;  5HWW A;  3BEC A;  3KYQ A;  4B93 A;  4KG6 A;  3NJA A;  4X53 A;  5EE8 A;  4IBX A;  3E0Y A;  3VP2 A;  3I7J A;  2VGJ A;  3FPW A;  4OQG A;  1DY6 A;  4MBH A;  4X1M A;  5I5L A;  1P9R A;  1K57 C;  5E2H A;  3H82 A;  3BRM A;  5KMW A;  1L0G A;  3IHA A;  4HOI A;  4OH0 A;  3BLS A;  1VHM A;  2NUT C;  2D01 A;  4IVI A;  3HLE A;  2HF6 A;  5HAI A;  4NXG A;  4G3K A;  2GNX A;  3VE4 A;  2ZBB A;  4EBN A;  2ZQC A;  2Z6D A;  4M3K A;  2HJ9 C;  4GLQ A;  5FEG A;  4R6L A;  3LIB A;  1JWP A;  3PAE A;  3EQV A;  2X02 A;  3HBR A;  4FSF A;  4S2L A;  1O7E A;  1JTG A;  2M7U A;  3G6O A;  3DWZ A;  5HFO A;  4DXC A;  2ZM2 A;  1PW8 A;  2OWJ A;  4DE3 A;  3DW0 A;  3GSG A;  5GHY A;  3BFD A;  1KE4 A;  3RFB A;  5FA7 A;  4YWZ A;  2R9W A;  5FAO A;  1MY8 A;  4P6B A;  4QU3 A;  5DFX A;  3VOY A;  3IWQ A;  4HHD A;  2V0U A;  2DCF A;  2ZMA A; 
#chains in the Genus database with same CATH homology
 1FSW A;  1K38 A;  1K54 A;  4NK3 A;  2Y2O A;  5FAT A;  2WKE A;  1K4F A;  3G2Z A;  3Q07 A;  4MLL A;  4XXR A;  5AQ7 A;  4E6X A;  3TG9 A;  1FOF A;  2FFY A;  1BT5 A;  2XDM A;  4N9L A;  1NY0 A;  4FCF A;  3FWL A;  4OPR A;  3WS5 A;  5GLC A;  4PPR A;  2Y2M A;  1PI4 A;  4JXW A;  5HX9 A;  4Q8I A;  1MWU A;  5J8X A;  3NI9 A;  2JCH A;  4S2J A;  5EVI A;  3UDX A;  3LO7 A;  1SHV A;  1W79 A;  3VP1 A;  2Q9N A;  2Z2L B;  1FQG A;  5CTM A;  1ONH A;  1BTL A;  2XQZ A;  1XA7 A;  4LCL A;  1PWD A;  3HLB A;  3V3R A;  3Q82 A;  5F83 A;  1ONG A;  1Q2P A;  2FFF B;  3SH9 A;  3MXR A;  1IKG A;  3IHB A;  5FQM A;  4WBG A;  1BLC A;  3NIA A;  5CRF A;  3NY4 A;  3WS2 A;  1ESI A;  1K4E A;  1ES4 A;  4JBF A;  3OCN A;  4QHC A;  5EEC A;  3O88 A;  3BFG A;  5A92 A;  3OPL A;  1QME A;  1MKI A;  4YIN A;  1OME A;  2XR0 A;  1CK3 A;  3ZG0 A;  1YT4 A;  2QPN A;  3PBN A;  5CER A;  3UE1 A;  3V3S A;  4KQQ A;  4MBF A;  1SKF A;  2ZJ9 A;  4DRT A;  3ZG7 B;  5AQ9 A;  4HBU A;  1ZC2 A;  3A3J A;  4JLF A;  3FV7 A;  4GD8 A;  1LL5 A;  4EQI A;  5GLA A;  1ES3 A;  2WZX A;  4OQH A;  4S2N C;  1LHY A;  4N1X A;  1G68 A;  4B88 A;  2C5W B;  4BEN A;  4N1H A;  3C7V A;  3VSL A;  4S2K A;  1LI0 A;  1IYS A;  4KZ7 A;  5EVI D;  3RJU A;  4C75 A;  3OPP A;  5HAP A;  3UPP A;  3O87 A;  2H0T A;  4P0M A;  4QJG A;  4ZDX A;  3IF6 C;  2WUQ A;  3VP3 A;  3W4Q A;  3BFF A;  5FI6 A;  1Z6F A;  5DF9 A;  2HDU A;  5GLD A;  3Q7V A;  5AQA A;  4E3I A;  4KQO A;  2C6W B;  3BFE A;  3O86 A;  4GNU A;  2P9V A;  2QZ6 A;  2V2F F;  4OON A;  1KVM A;  5CEC A;  5HAQ A;  2B5R A;  1E25 A;  1GHP A;  1KGF A;  1NRF A;  3HLC A;  3QNB A;  2OLU A;  2HP9 A;  2Y55 A;  4P85 A;  3UPN A;  1GA0 A;  2J7V A;  2WAE A;  3WRZ A;  2P74 A;  2WGV A;  3PBR A;  4Z9Q A;  4H8R A;  2ZC4 B;  1Y54 A;  1NZU A;  1YQS A;  1ZG6 A;  1FSY A;  3WS4 A;  1PWG A;  5GL9 A;  2BLS A;  4R0Q A;  3GR2 A;  1W8Q A;  2ZM0 A;  4RX2 A;  4BQM A;  2EFX A;  4R3J A;  4S2P A;  1ZG4 A;  2H0Y A;  1K6R A;  1LLB A;  4JKT A;  3CZD A;  4U0X A;  3VFH A;  1L0E A;  4E3N A;  2XGN A;  3MZF A;  3OCL A;  3LEZ A;  3W4O A;  2HDR A;  2ZQA A;  2H10 A;  3SOI A;  4OQ0 A;  1K55 C;  4KZ5 A;  2HDS A;  3GV9 A;  5DTS A;  4LV0 A;  1JTD A;  1XP4 A;  3G30 A;  1ES5 A;  1H8Y A;  2BG1 A;  3ZNT A;  1BUL A;  1NXY A;  1WE4 A;  3Q81 A;  4K0X A;  4E3O A;  4UA9 A;  3ZHH A;  4IVK A;  1IYP A;  5FQ9 A;  3UO9 A;  4JXG A;  2WKH A;  3W8K A;  3ZVW A;  3C4P A;  3A3E A;  3G35 A;  3PBT A;  3BFC A;  4GZB A;  4OP8 A;  4ZBE A;  5EOO A;  1IEM A;  1XX2 A;  4XUX A;  1O07 A;  3PBQ A;  2G2U A;  4LV3 A;  4GB7 A;  5E43 A;  3UE3 A;  3N6I A;  2WGW A;  4WZ4 A;  4WMC A;  5EOE A;  4ID4 A;  5CGW A;  2EX2 A;  4UHU A;  2EFU A;  4JF6 A;  1JWZ A;  4S2O A;  5CHU A;  2OV5 A;  3DTM A;  3GQZ A;  3VSK A;  4CJN A;  1ESU A;  2E8I A;  3NDE A;  1LL9 A;  3LY4 A;  5DTK A;  1KVL A;  3LY3 A;  4FD8 A;  2IWD A;  5CTN A;  1JWV A;  4LEN A;  2EXA A;  4PM6 A;  5GLB A;  1YLW A;  3ZDJ A;  3ISG A;  4Y0T A;  4RX3 A;  4OPQ A;  3ZCZ A;  1IKI A;  3MKF A;  4EBP A;  5E2E A;  1PW1 A;  1YLZ A;  1FR1 A;  4KZ4 A;  3IXG A;  5F82 A;  2DRW A;  4XUZ A;  4HEF A;  1I5Q A;  2ZC6 B;  5FI2 A;  4DDY A;  1ZKJ A;  5BOH A;  1K57 A;  4UAA A;  1PYY A;  3BYD A;  3UDF A;  3ITB A;  5JYO A;  1XXM A;  4QB8 A;  3HVF A;  5GHZ A;  3JYI A;  2J9P A;  3C5A A;  1MBL A;  4OQI A;  5DF8 A;  2Y2P A;  4DE0 A;  3O3V A;  2VGK A;  5M1A A;  1XGI A;  3GMW A;  3AGD A;  3IXH A;  3G32 A;  3NCK A;  5EPH A;  3FZC A;  1GCE A;  5TGF A;  2XD5 A;  3G34 A;  5KSH A;  4Y0O A;  1YLP A;  2X71 A;  1YLY A;  1KDS A;  2ZD8 A;  1KE0 A;  2Y2K A;  3G31 A;  5CGS A;  3OC2 A;  3VP0 A;  5CXW A;  1K6S A;  3FKW A;  3ZG8 B;  3QHY A;  2JBF A;  3HUO A;  3N8R A;  5CHM A;  3FKV A;  1E4D A;  2OLV A;  1ERO A;  3FYZ A;  3LCE A;  5FDH A;  4WMC D;  4FH2 A;  1FCN A;  3MZE A;  4EUZ A;  3EQU A;  4X68 A;  2HP5 A;  3MKE A;  3IH9 A;  1RGZ A;  3VMA A;  4E3M A;  4GDN A;  5KSC A;  3HL9 A;  2ZLY A;  3C7U A;  5HAR A;  4E3L A;  4R4R A;  4OLD A;  3UNW A;  4EWF A;  2WAF A;  3HLG A;  3RXW A;  1EI5 A;  1SDN A;  3NDG A;  1VQQ A;  4OVD A;  4LV1 A;  1RP5 A;  1XGJ A;  3P98 A;  1L2S A;  2X01 A;  4CPK A;  5CEB A;  5FI7 A;  3ZNY A;  1HZO A;  5A91 A;  4B4X A;  1MPL A;  5HW3 A;  2XK1 A;  4X56 A;  5I94 A;  2EX6 A;  4FH4 A;  4ZJ3 A;  4KZ6 A;  3SS3 A;  5TFQ A;  3V39 A;  4OPY A;  1TEM A;  2Y2J A;  2WZZ A;  4NET A;  3PTE A;  3AGE A;  4X55 A;  4WZ5 C;  2JE5 A;  1CEF A;  3MBZ A;  4WEL A;  4C6Y A;  1K54 C;  1SCW A;  1SDE A;  4RVA A;  1JVJ A;  2ZC3 B;  1YLT A;  1RGY A;  3IF6 B;  4DXB A;  2UWX A;  3E2K A;  4GN2 A;  3RXX A;  4MEZ A;  4JF4 A;  1BLH A;  4JXS A;  4UA6 A;  3G2Y A;  4YFM A;  5HL1 A;  2ZM8 A;  1PZP A;  1W8Y A;  4PM8 A;  3ZFZ A;  1MXO A;  1H8Z A;  3A3D A;  4A5R A;  5EVI C;  2WKI A;  4KG5 A;  3G4P A;  2ZQ8 A;  1YMX A;  2GDN A;  4OKP A;  4RYE A;  5CGX A;  3VOZ A;  3IWI A;  3NBL A;  2XFS A;  3OPH A;  2Y2I A;  2ZQ7 A;  4OOM A;  5KZH A;  5GHX A;  3W4P A;  1I2S A;  1VM1 A;  4Y7P A;  4BD1 A;  1PIO A;  5L2F A;  4D2O A;  1EWZ A;  1GHI A;  1FCO A;  1PWC A;  3Q1F A;  4LCM A;  4QD4 A;  4E3J A;  2PBY A;  3HLF A;  3WS0 A;  3VFF A;  1H5X A;  2G2W A;  1GHM A;  3GRJ A;  3MXS A;  2RL3 A;  3WWX A;  3MZD A;  2IWC A;  1M6K A;  5EVL A;  3V50 A;  3VP4 A;  3M6B A;  5TR7 A;  4BD0 A;  1CEG A;  2J9O A;  1FCM A;  4MBK A;  4WEK A;  3DWK A;  3E2L A;  2Z2M B;  1IEL A;  1I2W A;  2Y2Q A;  5D3O A;  1BLS A;  2XD1 A;  3S22 A;  1J9M A;  4E3K A;  3OZH A;  2Y2H A;  3SH7 A;  3IXB A;  1NYM A;  1C3B A;  2EXB A;  4L0L A;  1KGG A;  1TVF A;  2I72 A;  2RCX A;  5FQK A;  2IWB A;  1DJC A;  1K56 A;  1TDL A;  4KZ8 A;  3S4X A;  3UDI A;  1WYB A;  3UN7 A;  3IQA A;  4EV4 A;  5FQI A;  4PM9 A;  4JF5 A;  5A90 A;  3WS1 A;  1S0W A;  3P09 A;  4X69 A;  3Q7V B;  2HPB A;  5DVA A;  4ZJ1 A;  3ZG9 B;  1MWS A;  2ZC5 B;  1IYQ A;  4K0W A;  2Y2L A;  3Q7Z A;  4OP5 A;  1ERM A;  2R9X A;  3HRE A;  2J8Y A;  2ZC7 A;  3HUM A;  5E2G A;  1XPB A;  3N4I A;  4WYY A;  4U0T A;  1NYY A;  3IF6 A;  3IT9 A;  2H5S A;  3HLD A;  3OPR A;  3ZG5 A;  1E3U A;  4K91 A;  1MWR A;  3HLW A;  2Y2N A;  4BL2 A;  2ZQD A;  1L0D A;  3ZGA B;  3UE0 A;  3QNC A;  1PZO A;  1W5D A;  4KQR A;  3V5M A;  1TDG A;  1NJ4 A;  5CED A;  4QY6 A;  4HBT A;  4KG2 A;  4KZA A;  4KZ3 A;  1HVB A;  3WRT A;  5JYP A;  3CG5 A;  2XF3 A;  3M2J A;  4OOY A;  4WEJ A;  3UY6 A;  4LV2 A;  2XLN A;  1K56 D;  1PI5 A;  4GD6 A;  4U3T A;  1YM1 A;  4E6W A;  2EX9 A;  3HUN A;  5M19 A;  3D4F A;  1BLP A;  3A3I A;  5FAS A;  4OLG A;  4Y0U A;  2CC1 A;  1W7F A;  2V1Z A;  4S2M A;  5DTT A;  2Y91 A;  1WYC A;  1K55 A;  2WGW B;  3BM6 A;  2A49 A;  4OPZ A;  3BEC A;  2XEP A;  4KEN B;  4KG6 A;  4X53 A;  4X6T A;  5EE8 A;  1N9B A;  4DF6 A;  4IBX A;  4QY5 A;  3VP2 A;  2WGI A;  3NC8 A;  4GKU A;  3I7J A;  1AXB A;  5FAP A;  1MWT A;  1BUE A;  1M40 A;  4JPM A;  2VGJ A;  5IHV A;  2XFT A;  2QMI A;  3IF5 A;  3CJM A;  4GDB A;  1N4O A;  3IWO A;  4OQG A;  1DY6 A;  1E3U D;  1GA9 A;  3ITA A;  4MBH A;  1CI8 A;  1XKZ A;  2PU4 A;  5F1G A;  5FQQ A;  1KDW A;  4DDS A;  1L0F A;  1K57 C;  2Y2G A;  4R23 A;  5E2H A;  4OOL A;  1ES2 A;  4MNR A;  5U47 A;  4GOG A;  5M18 A;  3UPO A;  1Q2Q A;  3BRM A;  5KMW A;  1L0G A;  3MFD A;  3IHA A;  3N7W A;  5CHJ A;  3IXD A;  5EVI B;  4OH0 A;  2Y59 A;  3BLS A;  1FR6 A;  5FSR A;  4BL3 A;  4IED A;  2XH9 A;  4N9K A;  3C4O A;  3IH8 A;  3CMZ A;  4IVI A;  1QMF A;  3HLE A;  1HD8 A;  1BZA A;  5FQJ A;  2PU2 A;  2HDQ A;  5HAI A;  5DF7 A;  3PBO A;  2JC7 A;  3BLM A;  4KZ9 A;  4BLM A;  2WAD A;  2ZQC A;  4EBN A;  4F94 A;  4M3K A;  3SH8 A;  1G6A A;  4PMA A;  3GVB A;  4IBR A;  4ZAM A;  2ZQ9 A;  1XA1 A;  2OSU A;  4WM9 A;  1S6R A;  1JWP A;  3PAE A;  4P87 A;  4UA7 A;  3EQV A;  1BSG A;  2HP6 A;  2X02 A;  3B3X A;  3HBR A;  4FSF A;  3SS4 A;  4S2L A;  1O7E A;  1DJB A;  3S1Y A;  1JTG A;  5A93 A;  4RA7 A;  2Y4A A;  1YLJ A;  4R4S A;  3ZVT A;  4DKI A;  4C3Q A;  2EX8 A;  3DWZ A;  2WYX A;  3SS5 A;  3N8S A;  4N92 A;  1ALQ A;  5HFO A;  4EBL A;  4DXC A;  4S2I A;  1U60 A;  1PW8 A;  2ZM2 A;  2A3U A;  4DE3 A;  3DW0 A;  4R1G A;  1DJA A;  3GSG A;  4BJP A;  3M6H A;  5GHY A;  5EUA A;  1YMS A;  4DE1 A;  2WK0 A;  3BFD A;  1KE4 A;  1KE3 A;  4PM7 A;  5FA7 A;  5F1F A;  4DE2 A;  4R3B A;  1ERQ A;  3BEB A;  1RCJ A;  1LI9 A;  3A3F A;  1K25 A;  5E2F A;  5FAQ A;  1HTZ A;  4ZJ2 A;  4PM5 A;  2R9W A;  3N8L A;  4KZB A;  4O7D A;  5AQB A;  5FAO A;  3PBS A;  2V20 A;  4JXV A;  3PAG A;  5G18 A;  1NZO A;  3GTC A;  3M2K A;  2DNS A;  4S2N A;  1MY8 A;  2P9V B;  4ZTK A;  3TOI A;  4P6B A;  4QU3 A;  3VOY A;  1IYO A;  3IWQ A;  4B4Z A;  1CI9 A;  1KGE A;  4HES A;  2DCF A;  2Q9M A;  4WZ5 A;  3AGF A;  3TSG A;  2ZMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...