3G34A

Ctx-m-9 class a beta-lactamase complexed with compound 11 (1ce)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g34A00
3N8LA 4LCMA 3BM6A 2HP5A 3DTMA 4KQRA 4Y0OA 3C7UA 1CEFA 1AXBA 4P85A 4GD8A 1BSGA 4R3JA 3IHAA 1BULA 4C75A 3VOYA 4EBPA 4IBRA 1FSYA 4EV4A 4OPZA 1SHVA 5G18A 3OPHA 2PBYA 5HAPA 2H0YA 3IQAA 5F82A 4FH2A 2PU4A 4JXWA 5IHVA 3HLGA 4OP8A 3O87A 3ZCZA 1YLPA 5DTKA 5TGFA 4N1HA 3W4PA 4C3QA 2ZQCA 1C3BA 4DXBA 2ZQ7A 4XUZA 5F1FA 3C7VA 3UPPA 1SDNA 1TVFA 1S6RA 3HVFA 1K55C 2Y55A 3HL9A 3IHBA 2DNSA 3MXRA 4DRTA 2Y2JA 4QHCA 4D2OA 4KZAA 4EBNA 4MBHA 4JXSA 3A3EA 3Q1FA 2ZQ8A 1OMEA 1KE4A 3CMZA 3FWLA 4PM9A 1K55A 1ZG6A 1GCEA 3V5MA 3B3XA 3IF6B 1XGIA 4BQMA 3FKWA 5FSRA 4JPMA 1PZPA 3ZNYA 3LEZA 2WKHA 5KSCA 3OZHA 4JF6A 3PAGA 2OV5A 1FR6A 4U0TA 1CEGA 5FQKA 4DXCA 3P98A 4E3MA 4MBFA 3O3VA 1W8YA 1DJBA 5CHMA 4RYEA 4KZ6A 4ZDXA 5DF7A 5FQMA 2ZC7A 4KENB 3S1YA 2UWXA 2HDUA 4OLDA 4GN2A 3G4PA 4GDBA 1PI5A 1W79A 4PM6A 2RL3A 5A92A 3FZCA 4ID4A 3UPNA 4BL2A 1K6SA 4GKUA 3ZHHA 3E2LA 5HL1A 2XFSA 3M2JA 1SDEA 5EVID 1Z6FA 3UPOA 4KG2A 1O07A 1XP4A 1YMXA 3M2KA 1KE0A 3IT9A 5DVAA 3LO7A 3OCLA 3SOIA 1J9MA 3WS0A 3BLSA 3HUNA 2EX2A 3Q7ZA 2ZM8A 1HZOA 4QJGA 4JLFA 4N9LA 5EUAA 2Y2HA 4H8RA 3W4QA 4PM8A 3UDIA 1K56D 1WYBA 1WYCA 4E6XA 4E3JA 1MXOA 3QNCA 2XH9A 3G30A 3ZG9B 3ITAA 3ZGAB 4KQQA 1W7FA 4HBUA 3A3DA 1PW8A 1IKIA 3UE1A 3V39A 3IWOA 5CERA 2Y2GA 1LL5A 3BFFA 4RX2A 1WE4A 3VMAA 1CI9A 2QMIA 4XUXA 5CXWA 2XQZA 3C4PA 3BFDA 3NDEA 4GZBA 4OPYA 1GHPA 2JE5A 4LV0A 2V20A 2WYXA 3HLEA 1K4EA 2BLSA 2QZ6A 4FD8A 3ZG5A 4MBKA 1NRFA 2Y91A 4R1GA 3Q7VB 3NDGA 4GD6A 3UE3A 3WRTA 4E6WA 3EQUA 5I94A 5TFQA 5EVIC 1JWPA 3RXXA 4JF4A 3BLMA 4QD4A 3ZG8B 1YLWA 1PZOA 1JTDA 2WKIA 4KZ5A 5EVLA 3M6BA 1YQSA 4OONA 4IVIA 5CGWA 4M3KA 3E2KA 3MFDA 1JVJA 3ZNTA 4L0LA 1GHMA 4QY6A 1BLHA 4ZJ1A 4HBTA 4DE0A 1KDWA 4X6TA 1BUEA 3HLWA 3BRMA 2WAEA 1BT5A 5FAPA 4EWFA 4OQGA 4GDNA 2OSUA 1K56A 5FDHA 3NI9A 1RGZA 4DKIA 1ESIA 4QU3A 2JCHA 4R4SA 1KGGA 5FQIA 3SH8A 2FFFB 2R9WA 5CGXA 4RX3A 3GTCA 4ZBEA 4OOLA 4WYYA 3ZVTA 4BL3A 3UDXA 1E4DA 1JWVA 4WEKA 2ZLYA 5A93A 2X02A 3PBSA 3VP4A 1XPBA 1TEMA 3UNWA 3NBLA 1U60A 3ZFZA 1IELA 2VGJA 2HP6A 1N9BA 1L0EA 4DE2A 4KZBA 3CZDA 2Q9MA 2H0TA 5HW3A 1BLCA 4MNRA 2ZD8A 3N8RA 4K0WA 4R0QA 1IYOA 2Y2OA 3IH9A 4X69A 5CEBA 3CJMA 2XD5A 4PM5A 2XK1A 1K6RA 4IBXA 3PBNA 1FQGA 1JTGA 1SCWA 4IEDA 4DDYA 1KDSA 1QMEA 1BTLA 3OPLA 4S2NC 2EX9A 3ISGA 2X01A 1MWUA 1S0WA 2WGWA 2R9XA 5U47A 3PBQA 4WBGA 4OOMA 4KZ9A 1HTZA 1E25A 5EE8A 5HAIA 4DDSA 1G68A 1N4OA 1NXYA 2WGIA 3Q07A 3GV9A 4S2NA 4EQIA 2EX6A 3PBTA 2I72A 1MWSA 3MBZA 2WUQA 4BD0A 4UA6A 1PIOA 4F94A 3G34A 2VGKA 1NY0A 4KZ3A 5M1AA 1I2WA 2ZQDA 3PTEA 4WM9A 1JWZA 1PWDA 1ONHA 4R23A 5A90A 1IYQA 2WKEA 4JBFA 3SS4A 3N7WA 3NIAA 1ES4A 3FKVA 4S2LA 1XGJA 5FASA 2Y2IA 2WZZA 2ZC3B 1K54A 1ERQA 5E2HA 2OLUA 3IF5A 1BLSA 3DW0A 4B4ZA 3HUMA 5CEDA 3UN7A 3EQVA 2J7VA 3IWQA 4PPRA 1Q2PA 1K57C 5FQ9A 4OPRA 3N8SA 5GLCA 1NJ4A 3IXDA 4NK3A 4X55A 4ZJ2A 2XEPA 4QY5A 1KGFA 1XA7A 3G35A 3O86A 5F83A 2IWDA 3BYDA 3IF6C 5M18A 2HPBA 3ZDJA 4FH4A 2WGVA 3A3IA 1K57A 3N6IA 2Y59A 3OCNA 3S22A 5GLDA 5GLAA 5FAQA 1LLBA 4PMAA 4CJNA 3IF6A 3G2YA 2Y2QA 1FSWA 4P0MA 3SH7A 5FI6A 3HUOA 4WMCD 2DRWA 4HEFA 4S2PA 4S2MA 4WZ4A 4E3NA 1IYPA 4Q8IA 3VP3A 3WRZA 1HD8A 4E3LA 3LCEA 3RXWA 1MBLA 1M40A 2XD1A 4DE1A 4LV2A 4Y0TA 1KGEA 4S2IA 5J8XA 1NYMA 3HLFA 1O7EA 2BG1A 1HVBA 3AGEA 3GVBA 2EXBA 3PBRA 4B88A 4XXRA 3QNBA 4RA7A 2ZQ9A 4DE3A 4N92A 2Y2MA 1GA9A 5E2GA 3N4IA 3QHYA 4QB8A 3OPPA 1ES3A 4MLLA 4EBLA 4Y0UA 1EI5A 2ZJ9A 4LCLA 2XGNA 3P09A 4WELA 3OC2A 5CTNA 2EFUA 4JXGA 3V3RA 1IEMA 1ONGA 2Y2KA 3GMWA 4X56A 5HFOA 1PYYA 3JYIA 2WK0A 5KMWA 5AQ7A 1LL9A 2C6WB 3WS5A 3WS1A 4BJPA 3LY3A 1K38A 1ES5A 2DCFA 3IXBA 3A3JA 4O7DA 1PI4A 3GRJA 4EUZA 4K91A 1W8QA 1NZOA 3VP1A 1VM1A 4YINA 4OOYA 5KZHA 3Q82A 4MEZA 4JXVA 3DWZA 2ZM0A 2IWBA 4CPKA 3UY6A 3HREA 3UDFA 4LV1A 4OVDA 4UA9A 1KVLA 2XLNA 5DF8A 2B5RA 1NZUA 3PBOA 4FCFA 4C6YA 1RGYA 5GLBA 1NYYA 4OKPA 3MZDA 1RCJA 5GHXA 1ALQA 5AQBA 4WMCA 1GHIA 4X68A 3V50A 2XDMA 4JKTA 3HLDA 3MKEA 1G6AA 3Q7VA 2ZC4B 5DF9A 5M19A 2XFTA 2RCXA 1ERMA 2WAFA 3MZFA 3W4OA 1EROA 1H8ZA 1XXMA 1BZAA 1H5XA 2HDRA 2P9VB 1PW1A 3G32A 1H8YA 1KVMA 2P74A 1TDLA 2ZC6B 3VP2A 4UA7A 5HX9A 1RP5A 4BENA 5CGSA 3IXHA 1YLZA 2H5SA 4WEJA 1L0DA 4N9KA 3GQZA 4Z9QA 2EXAA 2ZC5B 5A91A 5CECA 3BFGA 4P87A 1GA0A 1CI8A 4PM7A 1KE3A 4RVAA 2GDNA 1CK3A 3FV7A 3S4XA 3AGDA 1MPLA 1TDGA 1ESUA 5AQ9A 3A3FA 3AGFA 2ZQAA 4ZJ3A 2Y4AA 1L0GA 1QMFA 1XKZA 1DY6A 5DTSA 5TR7A 3CG5A 4UAAA 3VFFA 4KZ7A 1YLJA 3C5AA 4E3KA 5FAOA 4S2KA 1K54C 3RJUA 5E43A 4FSFA 1FR1A 4P6BA 4X53A 1M6KA 2C5WB 5CHJA 2JC7A 4B4XA 3SS3A 3WS2A 5FI2A 1ZG4A 1ZC2A 5JYPA 1L2SA 1XA1A 2IWCA 1PWGA 2WZXA 3TG9A 1LI0A 2ZMAA 5JYOA 5AQAA 3NY4A 4KG6A 3UE0A 3IWIA 4Y7PA 2G2WA 4OQHA 2WADA 1K4FA 2E8IA 2P9VA 1I5QA 5FATA 1DJCA 1Y54A 5GHYA 3IXGA 2V1ZA 4YFMA 5D3OA 5FQQA 3M6HA 4DF6A 2J8YA 4BD1A 1E3UD 4OQIA 3D4FA 4OH0A 1PWCA 1XX2A 2HP9A 2OLVA 1FCNA 3FYZA 4HESA 1ZKJA 1L0FA 3ZG0A 4KG5A 1YLYA 4U0XA 4UHUA 3MXSA 4BLMA 1MWRA 3WS4A 3BFEA 4R4RA 3O88A 1ES2A 3OPRA 2Y2LA 4OPQA 2H10A 2XF3A 4R3BA 5EVIB 4KZ4A 1YM1A 3VP0A 5FI7A 3WWXA 3C4OA 3NCKA 4E3IA 1YLTA 4K0XA 5FA7A 3W8KA 5KSHA 2Z2LB 3ZG7B 2Z2MB 4WZ5C 2A3UA 4LENA 2X71A 2XR0A 3HBRA 5GL9A 1W5DA 2A49A 1YMSA 2FFYA 3BFCA 3MZEA 4ZTKA 1I2SA 4U3TA 3I7JA 2PU2A 4KZ8A 4A5RA 2ZM2A 4OQ0A 3LY4A 1FCOA 4WZ5A 5EOEA 3SS5A 3V3SA 1BLPA 4OLGA 3HLBA 5L2FA 2HDSA 1FCMA 5CRFA 5F1GA 4NETA 1FOFA 4GOGA 3UO9A 5HARA 5E2EA 5DTTA 1MY8A 1YT4A 3GSGA 3BECA 2J9PA 4LV3A 3SH9A 3MKFA 5BOHA 5GHZA 3VSKA 3HLCA 4IVKA 1SKFA 3Q81A 4S2OA 5EOOA 5HAQA 1LI9A 2G2UA 1E3UA 2Y2NA 2EFXA 1DJAA 1LHYA 4N1XA 3VOZA 5CHUA 4ZAMA 2Q9NA 3TSGA 2CC1A 4KQOA 3G31A 3IH8A 3ITBA 2HDQA 5EECA 2Y2PA 5EPHA 1IYSA 5E2FA 5EVIA 2QPNA 5FQJA 3DWKA 1VQQA 2WGWB 1EWZA 4OP5A 4GNUA 4JF5A 3ZVWA 3VFHA 4GB7A 5CTMA 3TOIA 3BEBA 3GR2A 2JBFA 3NC8A 4S2JA 3G2ZA 3VSLA 2V2FF 1MKIA 1Q2QA 1MWTA 2EX8A 3PAEA 2J9OA 4E3OA 1IKGA 1K25A
chains in the Genus database with same CATH superfamily
3N8LA 4LCMA 3BM6A 4KQRA 3C7UA 4P85A 4R3JA 3IHAA 4EW7A 1FSYA 1S4SA 4EV4A 3T1XA 4FH2A 3MQQA 3KX0X 1YLPA 3CPTB 5DTKA 5TGFA 4C3QA 2OOLA 5F1FA 3C7VA 1SDNA 1TVFA 4Q0IA 2Y55A 1G5UA 4D2OA 5FEFA 4KZAA 1OMEA 1KE4A 3IF6B 1G28A 2KLIA 3LEZA 1FR6A 4MBFA 5KIZA 4RYEA 2ZC7A 3NOTC 2UWXA 4OLDA 3G4PA 3R7WB 1PFLA 3FZCA 3HJIA 3UPNA 4BMWA 2V8FA 1XP4A 3M2KA 1KE0A 2O9AA 3LO7A 3F1NA 3BLSA 2EX2A 2FH5A 3W4QA 3CITA 4I38A 1MXOA 3QNCA 3ZG9B 3ZGAB 4I3JA 1PRQA 3V39A 3IWOA 1XJ6A 4RX2A 2VA0A 3VMAA 1CI9A 5CXWA 2QMIA 2Y79A 4GZBA 4OPYA 2QZ6A 2BLSA 4LGWA 3ZG5A 2Y91A 4GD6A 3UE3A 2B95A 5TFQA 2A24A 1KOUA 3ZG8B 1PZOA 4O0PA 1YQSA 3MFDA 3S7NA 4HHDA 3B42A 4HBTA 4YNRA 3T1SA 3BRMA 4EWFA 4MDZA 4OQGA 5HPIA 4GDNA 2OSUA 2XRNA 3KSGA 4FTXA 2ZMVA 5I5LA 2O0YA 4OOLA 3DTEA 2ZLYA 5L07A 3H7WA 1N9BA 4DE2A 3CZDA 2Q9MA 2V1BA 1OTDA 4PM5A 1CF0A 3PBNA 2NUPC 1KDSA 2R9XA 5U47A 2W3FA 4KZ9A 1E25A 5HAIA 4DDSA 3T4OA 3Q07A 1ACFA 1TS7A 2MJ6A 3GV9A 1OJ5A 2EX6A 3PBTA 1MWSA 4F94A 3BQ8A 5IU1A 1PWDA 4R23A 2WKEA 4JBFA 4IUHA 1ES4A 5MC7A 4WN5A 2ZC3B 1GSXA 1BLSA 3HUMA 5CEDA 1FIKA 1VETA 1VEUA 1K57C 5FQ9A 3N8SA 1T1AA 4X55A 4QY5A 3O86A 5F83A 4KQDA 4KUKA 1GSWA 5GLDA 2HZ5A 1TF1A 2W3DA 5FAQA 2KDKA 4CJNA 4WL9A 2VX8A 2Y2QA 4Z1WA 1LT0A 2QYBA 3HUOA 4WZ4A 4E3NA 4E3LA 3WRZA 3TE8A 1MBLA 4DE1A 4LV2A 4S2IA 1NYMA 4B88A 1N9LA 3QNBA 2ZQ9A 2PYPA 1GA9A 1DP9A 3QP6A 1EI5A 4LCLA 3P09A 4WELA 2EFUA 2HV1A 4MN5A 3V3RA 1IEMA 3SW1A 3UMDA 5HFOA 2WK0A 3K3CA 3WS5A 3WS1A 1K38A 2DCFA 3A3JA 1PI4A 2P04A 1NLZA 5KZHA 3DWZA 2IWBA 4CPKA 3UY6A 3CWFA 3UDFA 2H28A 1KVLA 1MKMA 3L9KA 5L10A 5FL3A 5GLBA 3HLDA 3DBAA 3TJZC 1OTEA 5F69A 5M19A 1EROA 1H8ZA 1H5XA 1PW1A 1H8YA 4DJ2A 3UB8A 2ZC6B 2O99A 1RP5A 4BENA 4II7A 4B9OA 3T4KA 2H5SA 1L0DA 5CECA 1GA0A 1CI8A 1PNEA 1KE3A 4RVAA 4R70A 4YOFA 3FV7A 2XA7S 1HLUP 5DFYA 1ZHHB 3T4SA 2Y4AA 1DY6A 3KYEA 5DTSA 2ZOHA 2W0NA 4KZ7A 5FAOA 3LYXA 3P7NA 3RJUA 4P6BA 4R6LA 3SS3A 4NXGA 3LI8A 2VLGA 1PWGA 3NY4A 3IWIA 2P9VA 1DJCA 2VV7A 3IXGA 3L7HA 3V67A 5D3OA 5FQQA 3M6HA 3TRCA 4OQIA 4ETXA 2HP9A 3F1PB 3FYZA 4CLCD 1ZKJA 3CAXA 4KG5A 1ZTUA 3BFEA 4R4RA 3OPRA 2Y2LA 4OPQA 4KZ4A 3WWXA 5FA7A 3ZG7B 2Z2MB 4I39A 4LENA 2XR0A 3HBRA 5TJJA 2FFYA 3BFCA 4ZTKA 1I2SA 2ZM2A 3H9WA 4WZ5A 2L0WA 3T4QA 4NETA 4HQAA 3T1QB 5DTTA 3GSGA 3A0VA 5GHZA 3Q81A 2PYRA 5HAQA 2Y2NA 4N1XA 3VOZA 4FOFA 4IUKA 2Q9NA 4HI4A 5L8MA 4CLCA 5EECA 4EEUA 2Y2PA 2EA9A 3T4LA 2ZL1A 2WGWB 2K31A 3QP1A 1D06A 3GR2A 1A0KA 3T4JA 3NC8A 2V2FF 3QP8A 2EX8A 4E3OA 1MWTA 3JVUA 3BY8A 5HZHA 4Y0OA 3E4OA 1T18A 3MQ0A 4C75A 3VOYA 4EBPA 5G18A 2PBYA 2H0YA 3IQAA 4H6JB 3HLGA 4OP8A 4Y15A 3O87A 4EERA 3W4PA 5DFXA 1C3BA 4XUZA 3LR0A 3UPPA 1S6RA 2DNSA 5K5BA 4QHCA 4MBHA 4JXSA 3A3EA 3Q1FA 4P6ZM 2QWSA 3UB6A 2LB5A 1K55A 1ZG6A 4CQHA 3FKWA 5FSRA 4JPMA 1PZPA 5FQKA 3UB5P 4DXCA 3O3VA 1W8YA 4ZDXA 5DF7A 3RTYA 2R78A 5AVEA 4WLAA 5DKKA 3VV4A 4GDBA 1PI5A 5HL1A 2XFSA 1SDEA 5EVID 1Z6FA 3UPOA 4KG2A 3PHYA 1YMXA 3SOIA 4K08A 3HUNA 3KSIA 4QJGA 4N9LA 3SZTA 4H8RA 4HP9A 4ARZA 5DJTA 2XH9A 4EETB 1DP8A 2B18A 1CQAA 2Y2GA 3BFDA 2JE5A 4DN0A 1V9YA 3CHWP 4JF4A 4QD4A 2I9VA 3IX4A 1JTDA 1LSXA 4OONA 4IVIA 5CGWA 4M3KA 3E2KA 3ZNTA 3MJQA 4QY6A 1KDWA 4GHIB 4YWZA 4F3LB 5EM0A 1BUEA 3HLWA 2WAEA 3S7QA 3VE4A 5FAPA 4DKIA 2JCHA 2R9WA 3VOLA 4ZBEA 4WYYA 4BL3A 1E4DA 4HJ4A 3UNWA 1L0EA 4KZBA 5HW3A 4FUWA 2ZD8A 4R0QA 1IYOA 2Y2OA 4PHTA 4IJGA 4X69A 3CJMA 3MQOA 2XK1A 3MFXA 3LR4A 4BBUA 5J7EA 1JTGA 4HH3A 4DDYA 1QMEA 2EX9A 1S0WA 1SKOB 1HTZA 1G68A 2WGIA 2I72A 4BD0A 2WUQA 2A2LA 3LR5A 5C5KA 1I2WA 3PTEA 1JWZA 5A90A 1IYQA 1N9NA 3N7WA 1OJGA 5FASA 1K54A 5F6AA 2OLUA 3E0YA 4AFIA 3OOVA 3EQVA 1NJ4A 4NK3A 4ZJ2A 3T12B 1KGFA 1XA7A 4MCWA 3BYDA 2HPBA 2HGVA 3OCNA 4I3IA 5GLAA 4I5SA 1LLBA 4HP4A 4UEYA 2M7UA 4GS9A 4P0MA 3SH7A 2DRWA 4S2MA 4WUJA 3VP3A 3RXWA 1M40A 1YSQA 4D60A 1O7EA 3E4PA 2EXBA 4XXRA 2JKFA 4N92A 5E2GA 3PR6A 1T1CA 1ES3A 2ZMFA 3PYPA 2Z6CA 1P9RA 3TW8A 1ODVA 3LI9A 3LIFA 2Y2KA 1PYYA 5KMWA 3LICA 4O7DA 1TS0A 1VM1A 4YINA 4OOYA 3Q82A 4MEZA 3HREA 4LV1A 1K0KA 1LL8A 4PKYG 5DF8A 4FCFA 5TBMA 1L3LA 1OTAA 1RCJA 1GHIA 1G6AA 3Q7VA 2XFTA 2WAFA 3MZFA 3G32A 1KVMA 2P74A 5CGSA 1YLZA 3NECA 4N9KA 2ZC5B 2V9AA 4P87A 3AGDA 1MPLA 5AJGA 3A3FA 3AGFA 4NG2A 4ZJ3A 4HH2A 4CLCE 4HJ6A 3FPVA 4UAAA 3F1NB 4S2KA 5E43A 4B4XA 3WS2A 1ZG4A 1ZC2A 5JYPA 1X0OA 1XA1A 5J3WA 4KG6A 4HOIA 4UQIS 4BWIA 4Y7PA 2G2WA 1NLYA 1CJFA 4LRXC 1S1YA 1K4FA 1XFQA 3NJAA 1I5QA 2ZOIA 2JKGA 1Y54A 2V1ZA 2J8YA 1E3UD 1PWCA 1XX2A 5A8BA 2A24B 4HESA 2XROA 1YLYA 2PBDP 3C8CA 4BLMA 1MWRA 2VV6A 4R3BA 4NEED 4NXEA 3C4OA 4E3IA 2VJWA 3W8KA 2Z2LB 3QP5A 4WZ5C 3BY9A 2X71A 1W5DA 2A49A 1YMSA 2QKPA 4KZ8A 4A5RA 3GDIA 2W27A 5EOEA 1D7EA 4L9EA 3V3SA 5L2FA 2HDSA 1FCMA 2PD7A 2P08A 5HL6A 3P01A 3UO9A 2OWHA 4XT2A 1MY8A 4CLCC 5HWVA 2J9PA 1G6OA 3O5YA 4IVKA 4S2OA 1LI9A 1E3UA 4G3VA 1IOUA 3IH8A 5F5YA 5EPHA 2QPNA 3LFVA 2PHYA 3DWKA 1VQQA 2JKTM 1XJ3A 4HNBA 4OP5A 4JGOA 3H82A 4GB7A 4LRYC 3BEBA 2VEAA 1MKIA 2HP5A 3DTMA 4HIAA 4R38A 4GD8A 1BSGA 2V0UA 5HAPA 1F9IA 3ZCZA 1VETB 1VEUB 4DXBA 2ZQ7A 3HVFA 1K55C 4EESA 2M1CA 3HL9A 4DRTA 3MXRA 2WKRA 4EBNA 2ZQ8A 1LSWA 2D02A 1OTIA 3EEAA 3F1OA 3FWLA 1V9ZA 2OAP1 3B3XA 2W3EA 4BQMA 2AVXA 3OBFA 1F5MA 4O01A 3ZNYA 5KSCA 3PAGA 2OV5A 1CEGA 1AWIA 3P98A 4LFUA 2GX5A 4KENB 2ACGA 3S1YA 2HDUA 2O9BA 4GN2A 1W79A 5A92A 4BL2A 1K6SA 3ZHHA 2Q0OA 4H6JA 3OCLA 3WS0A 4EXOA 2ZM8A 1HZOA 2UV0E 2Y2HA 4PM8A 1K56D 1WYCA 3FG8A 3GECA 2L4RA 3G30A 2KX6A 4KQQA 1W7FA 3A3DA 1PW8A 4I3AA 2BTFP 3UB9A 1LL5A 4XUXA 1S1ZA 1P9WA 5IT5A 2XQZA 3C4PA 3NDEA 5EV0A 3HLEA 1K4EA 4R1GA 1NRFA 3R4KA 5G4ZA 2EWWA 3WRTA 4E6WA 1VHMA 1D1JA 5EVIC 1JWPA 3IS2B 5EVLA 3M6BA 2FZ0A 5G4YA 1BLHA 3BQAA 2XSSA 4ZJ1A 4X6TA 1BT5A 2W1TB 1T1BA 1K56A 3E4QA 1ESIA 4R4SA 5FQIA 1KGGA 4EU0A 5CGXA 2VGLM 4RX3A 4JGRA 5EVEA 3DTIA 1JWVA 4WEKA 2JN7A 3VP4A 3T4TA 1XPBA 3NBLA 2VGJA 2HP6A 2NUTC 3D72A 2H0TA 1BLCA 3HJKA 1WA9A 5HSQA 1YSPA 2PR5A 1K6RA 2WKQA 4IEDA 3OPLA 3ISGA 3KYQA 1N4OA 1TS8A 4M4XA 4S2NA 4EQIA 4ETZA 4MMNA 4NKPA 3G34A 3ZYTA 2VGKA 2J3TD 4WM9A 1ONHA 3JPUA 3SS4A 3NIAA 3CUEA 3FKVA 2W3GA 1XGJA 2Y2IA 2WZZA 1ERQA 1JNUA 3IF5A 3DW0A 3LEQA 2J7VA 3CPTA 1OTBA 3DAVA 4PPRA 2B02A 1Q2PA 2O9CA 5L09A 4OPRA 5GLCA 2GZAA 3G35A 2IWDA 5M18A 4X1MA 3A3IA 4Y5FA 2XA7M 4CLCB 4PMAA 3IF6A 4Y17A 1FSWA 2WKPA 5FI6A 4WMCD 4HEFA 2Y8HA 2ZL1B 4Q8IA 3LCEA 3EGXC 4Y0TA 1KGEA 4JGQA 3HLFA 2JKRM 1HVBA 4ZRRA 3PBRA 3R7WA 2Y2MA 3N4IA 3QHYA 3OPPA 4Y0UA 2ZJ9A 3QP2A 3OC2A 1ONGA 3JYIA 4DMZA 5AQ7A 4NXBA 3IXBA 1S67L 3GRJA 4EUZA 3VP1A 1MC0A 3U4LP 4OVDA 2B5RA 3PBOA 4C6YA 1NYYA 1OT6A 3MZDA 4OKPA 1ALQA 4WMCA 5IS1A 4X68A 3V50A 2XDMA 2D01A 4JKTA 5DF9A 2RCXA 1ERMA 3W4OA 2HDRA 1BZAA 2PDRA 1Z09A 2HF6A 5HX9A 5A91A 4PM7A 2BASA 2GDNA 2QJ7A 1TDGA 1IFQA 4IHQA 5AQ9A 1L0GA 1QMFA 1XKZA 5TR7A 3VFFA 1YLJA 4GLQA 3C5AA 1FR1A 2C5WB 4ARZB 5FI2A 4X1LA 4HJ3A 1L2SA 2WZXA 2IWCA 3CLOA 2KOIA 1LI0A 2ZMAA 5JYOA 5AQAA 1YPRA 3LUQA 3UE0A 2DMWA 4OQHA 4PAUA 5FATA 3G6OA 5HDCA 4YFMA 4MN7A 1P0ZA 3KYZA 4BBVA 1FCNA 5F68A 3ZG0A 4G3KA 5J4EA 3DTKA 3WS4A 3K3DA 3O88A 5EVIB 1YM1A 2PAVP 2M7VA 5KSHA 2A3UA 2IA2A 2QHKA 3MZEA 3I7JA 2PU2A 4OQ0A 1FCOA 4GCZA 3B33A 1MZUA 4DJ3A 4OLGA 3KSFA 5F1GA 1FOFA 4GOGA 1FILA 1UWNX 2VK3A 1VB6A 1YT4A 4LV3A 3SH9A 3OLOA 3NOPC 3IBJA 3HLCA 5EOOA 3UE6A 1DJAA 5FEGA 5CHUA 4ZAMA 1BYWA 4KQOA 1DRMA 5AVFA 3ITBA 2L1MA 2HDQA 3FPWA 1IYSA 1Y28A 1EWZA 1T19A 4QPRA 4JF5A 2YKHA 5CTMA 3TOIA 2EWVA 2JBFA 2VZWA 2JHEA 3RFBA 2PT7A 3BJNA 4L9FA 4ESPA 1CEFA 1AXBA 3JVVA 3UMEA 1BULA 4IBRA 3VE3A 4OPZA 1SHVA 3OPHA 5F82A 2PU4A 4JXWA 5IHVA 4GJ4A 5HDDA 2G7UA 2PRFA 4N1HA 2ZQCA 4LRZE 4R3AA 3IHBA 2Y2JA 3CMZA 4PM9A 1GCEA 3V5MA 1XGIA 5HWWA 2W1RA 2WKHA 3EWKA 3K2NA 3HCYA 4MN6A 4EQ1A 3OZHA 4GS9B 4JF6A 2GNXA 3FC7A 4U0TA 3MMHA 4E3MA 5CHMA 1YAXA 1DJBA 4KZ6A 5FQMA 4PM6A 2RL3A 4ID4A 3MF0A 4GKUA 3E2LA 3M2JA 4Q0HA 1YKDA 1O07A 3IT9A 5DVAA 3KSHA 1J9MA 1J3WA 3A0SA 3Q7ZA 4JLFA 5EUAA 3UDIA 1WYBA 4E6XA 4E3JA 3E98A 3ITAA 3LIBA 3PXPA 4HBUA 1IKIA 3UE1A 1DP6A 5CERA 2VGLS 3BFFA 3NOUC 5TBMB 1WE4A 5HPFA 3NHQA 2ZBBA 4RQ9A 1GHPA 4LV0A 2V20A 2WYXA 2JKTI 4FD8A 3H7WB 4MBKA 3Q7VB 3NDGA 3EQUA 5I94A 3F1PA 3RXXA 1STZA 3BLMA 3IBRA 1YLWA 2WKIA 4KZ5A 1JVJA 2J80A 4L0LA 4NXFA 1GHMA 4P6ZS 2PD8A 4DE0A 4PKYA 3KO6A 1P97A 3C2WA 1W63M 1W63Q 5HWTA 3QP4A 5FDHA 3NI9A 1RGZA 4QU3A 1H3QA 3LR3A 3SH8A 2FFFB 1NRJA 1UWPX 3LGOA 3GTCA 3ZVTA 3UDXA 5A93A 2X02A 3PBSA 3BWLA 1TEMA 1U60A 3ZFZA 1IELA 5HD3A 4MNRA 3N8RA 4K0WA 4JGPA 2K7SA 3IS2A 5CEBA 2XD5A 2YKFA 1XJ2A 4IBXA 1UGUA 1FQGA 1SCWA 3W2ZA 1BTLA 4S2NC 2INWA 2X01A 1MWUA 5EFWA 2WGWA 3PBQA 4WBGA 4OOMA 5EE8A 1NXYA 2PR6A 3ULFA 2W1TA 3CUEC 3MBZA 4UA6A 2OAQ1 1PIOA 1NY0A 4KZ3A 2VKSA 5M1AA 2ZQDA 1EW0A 4L9GA 4S2LA 2VV8A 2E8JA 5E2HA 5FDSA 4B4ZA 1XFNA 3UN7A 3BW6A 4X25A 3IWQA 1F2KA 2K2NA 3IXDA 3MSHA 4XT2B 3LIEA 2XEPA 2HJEA 1H8MA 1OT9A 3T50A 3IF6C 3ZDJA 4FH4A 2WGVA 3N6IA 1K57A 2Y59A 3S22A 3G2YA 2V0WA 2V8CA 2OWJA 4EEPA 2J3TC 2LB9A 4S2PA 1IYPA 1HD8A 2XD1A 3H82B 3D3OA 5J8XA 2BG1A 3AGEA 3GVBA 5DKLA 3MS6A 4RA7A 3A0RA 4DE3A 4UQIM 3RH8B 4QB8A 4MLLA 4QWOA 4EBLA 1TD5A 2XGNA 4E04A 2W3HA 5CTNA 3EOIA 4JXGA 3GMWA 4X56A 4LLOB 1SZVA 1LL9A 2C6WB 3ZQ5A 4BJPA 3LY3A 1ES5A 4K91A 1W8QA 1NZOA 4JXVA 2ZM0A 4UA9A 4WF0A 2XLNA 1NZUA 3B47A 1RGYA 5DJUA 4Q0JA 4GW9A 3F1OB 1N9OA 5GHXA 5AQBA 3C30A 3MKEA 2ZC4B 1NWZA 3IH9A 4ME4A 4Y3IA 1XXMA 2P9VB 1TDLA 3VP2A 4UA7A 3IXHA 4WEJA 4Z9QA 3GQZA 2EXAA 3EEHA 3BFGA 4Y2FA 1CK3A 3NULA 3S4XA 3T1RA 1ESUA 1TS6A 4GHIA 4F3LA 2ZQAA 2CMNA 1F98A 3UB7A 2HJ9C 2V1AA 3CG5A 4E3KA 3MXQA 1K54C 4FSFA 4X53A 4EUVA 1M6KA 5CHJA 2JC7A 1S66L 5EM1A 4BBTA 3TG9A 2P7JA 4HY8A 1OPXA 1S4RA 5HDSA 3EGDC 2WADA 2E8IA 5GHYA 4B93A 4DF6A 4BD1A 3ICYA 4Y13A 3D4FA 4OH0A 2OLVA 3IX8A 5HD5A 1L0FA 2JKRI 2QJ5A 4U0XA 4UHUA 5CX7A 1Y4OA 3MXSA 1SKOA 3S7PA 1ES2A 2Z6DA 2H10A 2XF3A 3VP0A 5FI7A 1H0MA 3NCKA 1YLTA 4K0XA 5LBRA 2GJ3A 4G3WA 1XJ4A 5GL9A 4O8GA 4U3TA 4KUOA 3LY4A 1GSVA 3SS5A 1BLPA 3HLBA 5CRFA 3CI6A 3D9YA 5HARA 5E2EA 3BECA 3MKFA 5BOHA 3VSKA 1SKFA 3C38A 2G2UA 2EFXA 1LHYA 4LPZA 1LSVA 3TSGA 2CC1A 3G31A 3LIAA 2J3WA 3IX3A 5E2FA 5EVIA 5FQJA 3MR0A 3U2AA 4GNUA 3LIDA 3ZVWA 3VFHA 3S7OA 4S2JA 3G2ZA 3VSLA 1Q2QA 3PAEA 2J9OA 1IKGA 1K25A
chains in the Genus database with same CATH topology
3N8LA 4LCMA 3BM6A 2HP5A 3DTMA 4KQRA 4Y0OA 3C7UA 1CEFA 1AXBA 4P85A 4GD8A 1BSGA 4R3JA 3IHAA 1BULA 4C75A 3VOYA 4EBPA 4IBRA 1FSYA 4EV4A 4OPZA 1SHVA 5G18A 3OPHA 2PBYA 5HAPA 2H0YA 3IQAA 5F82A 4FH2A 2PU4A 4JXWA 5IHVA 3HLGA 4OP8A 3O87A 3ZCZA 1YLPA 5DTKA 5TGFA 4N1HA 3W4PA 4C3QA 2ZQCA 1C3BA 4DXBA 2ZQ7A 4XUZA 5F1FA 3C7VA 3UPPA 1SDNA 1TVFA 1S6RA 3HVFA 1K55C 2Y55A 3HL9A 3IHBA 2DNSA 3MXRA 4DRTA 2Y2JA 4QHCA 4D2OA 4KZAA 4EBNA 4MBHA 4JXSA 3A3EA 3Q1FA 2ZQ8A 1OMEA 1KE4A 3CMZA 3FWLA 4PM9A 1K55A 1ZG6A 1GCEA 3V5MA 3B3XA 3IF6B 1XGIA 4BQMA 3FKWA 5FSRA 4JPMA 1PZPA 3ZNYA 3LEZA 2WKHA 5KSCA 3OZHA 4JF6A 3PAGA 2OV5A 1FR6A 4U0TA 1CEGA 5FQKA 4DXCA 3P98A 4E3MA 4MBFA 3O3VA 1W8YA 1DJBA 5CHMA 4RYEA 4KZ6A 4ZDXA 5DF7A 5FQMA 2ZC7A 4KENB 3S1YA 2UWXA 2HDUA 4OLDA 4GN2A 3G4PA 4GDBA 1PI5A 1W79A 4PM6A 2RL3A 5A92A 3FZCA 4ID4A 3UPNA 4BL2A 1K6SA 4GKUA 3ZHHA 3E2LA 5HL1A 2XFSA 3M2JA 1SDEA 5EVID 1Z6FA 3UPOA 4KG2A 1O07A 1XP4A 1YMXA 3M2KA 1KE0A 3IT9A 5DVAA 3LO7A 3OCLA 3SOIA 1J9MA 3WS0A 3BLSA 3HUNA 2EX2A 3Q7ZA 2ZM8A 1HZOA 4QJGA 4JLFA 4N9LA 5EUAA 2Y2HA 4H8RA 3W4QA 4PM8A 3UDIA 1K56D 1WYBA 1WYCA 4E6XA 4E3JA 1MXOA 3QNCA 2XH9A 3G30A 3ZG9B 3ITAA 3ZGAB 4KQQA 1W7FA 4HBUA 3A3DA 1PW8A 1IKIA 3UE1A 3V39A 3IWOA 5CERA 2Y2GA 1LL5A 3BFFA 4RX2A 1WE4A 3VMAA 1CI9A 2QMIA 4XUXA 5CXWA 2XQZA 3C4PA 3BFDA 3NDEA 4GZBA 4OPYA 1GHPA 2JE5A 4LV0A 2V20A 2WYXA 3HLEA 1K4EA 2BLSA 2QZ6A 4FD8A 3ZG5A 4MBKA 1NRFA 2Y91A 4R1GA 3Q7VB 3NDGA 4GD6A 3UE3A 3WRTA 4E6WA 3EQUA 5I94A 5TFQA 5EVIC 1JWPA 3RXXA 4JF4A 3BLMA 4QD4A 3ZG8B 1YLWA 1PZOA 1JTDA 2WKIA 4KZ5A 5EVLA 3M6BA 1YQSA 4OONA 4IVIA 5CGWA 4M3KA 3E2KA 3MFDA 1JVJA 3ZNTA 4L0LA 1GHMA 4QY6A 1BLHA 4ZJ1A 4HBTA 4DE0A 1KDWA 4X6TA 1BUEA 3HLWA 3BRMA 2WAEA 1BT5A 5FAPA 4EWFA 4OQGA 4GDNA 2OSUA 1K56A 5FDHA 3NI9A 1RGZA 4DKIA 1ESIA 4QU3A 2JCHA 4R4SA 1KGGA 5FQIA 3SH8A 2FFFB 2R9WA 5CGXA 4RX3A 3GTCA 4ZBEA 4OOLA 4WYYA 3ZVTA 4BL3A 3UDXA 1E4DA 1JWVA 4WEKA 2ZLYA 5A93A 2X02A 3PBSA 3VP4A 1XPBA 1TEMA 3UNWA 3NBLA 1U60A 3ZFZA 1IELA 2VGJA 2HP6A 1N9BA 1L0EA 4DE2A 4KZBA 3CZDA 2Q9MA 2H0TA 5HW3A 1BLCA 4MNRA 2ZD8A 3N8RA 4K0WA 4R0QA 1IYOA 2Y2OA 3IH9A 4X69A 5CEBA 3CJMA 2XD5A 4PM5A 2XK1A 1K6RA 4IBXA 3PBNA 1FQGA 1JTGA 1SCWA 4IEDA 4DDYA 1KDSA 1QMEA 1BTLA 3OPLA 4S2NC 2EX9A 3ISGA 2X01A 1MWUA 1S0WA 2WGWA 2R9XA 5U47A 3PBQA 4WBGA 4OOMA 4KZ9A 1HTZA 1E25A 5EE8A 5HAIA 4DDSA 1G68A 1N4OA 1NXYA 2WGIA 3Q07A 3GV9A 4S2NA 4EQIA 2EX6A 3PBTA 2I72A 1MWSA 3MBZA 2WUQA 4BD0A 4UA6A 1PIOA 4F94A 3G34A 2VGKA 1NY0A 4KZ3A 5M1AA 1I2WA 2ZQDA 3PTEA 4WM9A 1JWZA 1PWDA 1ONHA 4R23A 5A90A 1IYQA 2WKEA 4JBFA 3SS4A 3N7WA 3NIAA 1ES4A 3FKVA 4S2LA 1XGJA 5FASA 2Y2IA 2WZZA 2ZC3B 1K54A 1ERQA 5E2HA 2OLUA 3IF5A 1BLSA 3DW0A 4B4ZA 3HUMA 5CEDA 3UN7A 3EQVA 2J7VA 3IWQA 4PPRA 1Q2PA 1K57C 5FQ9A 4OPRA 3N8SA 5GLCA 1NJ4A 3IXDA 4NK3A 4X55A 4ZJ2A 2XEPA 4QY5A 1KGFA 1XA7A 3G35A 3O86A 5F83A 2IWDA 3BYDA 3IF6C 5M18A 2HPBA 3ZDJA 4FH4A 2WGVA 3A3IA 1K57A 3N6IA 2Y59A 3OCNA 3S22A 5GLDA 5GLAA 5FAQA 1LLBA 4PMAA 4CJNA 3IF6A 3G2YA 2Y2QA 1FSWA 4P0MA 3SH7A 5FI6A 3HUOA 4WMCD 2DRWA 4HEFA 4S2PA 4S2MA 4WZ4A 4E3NA 1IYPA 4Q8IA 3VP3A 3WRZA 1HD8A 4E3LA 3LCEA 3RXWA 1MBLA 1M40A 2XD1A 4DE1A 4LV2A 4Y0TA 1KGEA 4S2IA 5J8XA 1NYMA 3HLFA 1O7EA 2BG1A 1HVBA 3AGEA 3GVBA 2EXBA 3PBRA 4B88A 4XXRA 3QNBA 4RA7A 2ZQ9A 4DE3A 4N92A 2Y2MA 1GA9A 5E2GA 3N4IA 3QHYA 4QB8A 3OPPA 1ES3A 4MLLA 4EBLA 4Y0UA 1EI5A 2ZJ9A 4LCLA 2XGNA 3P09A 4WELA 3OC2A 5CTNA 2EFUA 4JXGA 3V3RA 1IEMA 1ONGA 2Y2KA 3GMWA 4X56A 5HFOA 1PYYA 3JYIA 2WK0A 5KMWA 5AQ7A 1LL9A 2C6WB 3WS5A 3WS1A 4BJPA 3LY3A 1K38A 1ES5A 2DCFA 3IXBA 3A3JA 4O7DA 1PI4A 3GRJA 4EUZA 4K91A 1W8QA 1NZOA 3VP1A 1VM1A 4YINA 4OOYA 5KZHA 3Q82A 4MEZA 4JXVA 3DWZA 2ZM0A 2IWBA 4CPKA 3UY6A 3HREA 3UDFA 4LV1A 4OVDA 4UA9A 1KVLA 2XLNA 5DF8A 2B5RA 1NZUA 3PBOA 4FCFA 4C6YA 1RGYA 5GLBA 1NYYA 4OKPA 3MZDA 1RCJA 5GHXA 1ALQA 5AQBA 4WMCA 1GHIA 4X68A 3V50A 2XDMA 4JKTA 3HLDA 3MKEA 1G6AA 3Q7VA 2ZC4B 5DF9A 5M19A 2XFTA 2RCXA 1ERMA 2WAFA 3MZFA 3W4OA 1EROA 1H8ZA 1XXMA 1BZAA 1H5XA 2HDRA 2P9VB 1PW1A 3G32A 1H8YA 1KVMA 2P74A 1TDLA 2ZC6B 3VP2A 4UA7A 5HX9A 1RP5A 4BENA 5CGSA 3IXHA 1YLZA 2H5SA 4WEJA 1L0DA 4N9KA 3GQZA 4Z9QA 2EXAA 2ZC5B 5A91A 5CECA 3BFGA 4P87A 1GA0A 1CI8A 4PM7A 1KE3A 4RVAA 2GDNA 1CK3A 3FV7A 3S4XA 3AGDA 1MPLA 1TDGA 1ESUA 5AQ9A 3A3FA 3AGFA 2ZQAA 4ZJ3A 2Y4AA 1L0GA 1QMFA 1XKZA 1DY6A 5DTSA 5TR7A 3CG5A 4UAAA 3VFFA 4KZ7A 1YLJA 3C5AA 4E3KA 5FAOA 4S2KA 1K54C 3RJUA 5E43A 4FSFA 1FR1A 4P6BA 4X53A 1M6KA 2C5WB 5CHJA 2JC7A 4B4XA 3SS3A 3WS2A 5FI2A 1ZG4A 1ZC2A 5JYPA 1L2SA 1XA1A 2IWCA 1PWGA 2WZXA 3TG9A 1LI0A 2ZMAA 5JYOA 5AQAA 3NY4A 4KG6A 3UE0A 3IWIA 4Y7PA 2G2WA 4OQHA 2WADA 1K4FA 2E8IA 2P9VA 1I5QA 5FATA 1DJCA 1Y54A 5GHYA 3IXGA 2V1ZA 4YFMA 5D3OA 5FQQA 3M6HA 4DF6A 2J8YA 4BD1A 1E3UD 4OQIA 3D4FA 4OH0A 1PWCA 1XX2A 2HP9A 2OLVA 1FCNA 3FYZA 4HESA 1ZKJA 1L0FA 3ZG0A 4KG5A 1YLYA 4U0XA 4UHUA 3MXSA 4BLMA 1MWRA 3WS4A 3BFEA 4R4RA 3O88A 1ES2A 3OPRA 2Y2LA 4OPQA 2H10A 2XF3A 4R3BA 5EVIB 4KZ4A 1YM1A 3VP0A 5FI7A 3WWXA 3C4OA 3NCKA 4E3IA 1YLTA 4K0XA 5FA7A 3W8KA 5KSHA 2Z2LB 3ZG7B 2Z2MB 4WZ5C 2A3UA 4LENA 2X71A 2XR0A 3HBRA 5GL9A 1W5DA 2A49A 1YMSA 2FFYA 3BFCA 3MZEA 4ZTKA 1I2SA 4U3TA 3I7JA 2PU2A 4KZ8A 4A5RA 2ZM2A 4OQ0A 3LY4A 1FCOA 4WZ5A 5EOEA 3SS5A 3V3SA 1BLPA 4OLGA 3HLBA 5L2FA 2HDSA 1FCMA 5CRFA 5F1GA 4NETA 1FOFA 4GOGA 3UO9A 5HARA 5E2EA 5DTTA 1MY8A 1YT4A 3GSGA 3BECA 2J9PA 4LV3A 3SH9A 3MKFA 5BOHA 5GHZA 3VSKA 3HLCA 4IVKA 1SKFA 3Q81A 4S2OA 5EOOA 5HAQA 1LI9A 2G2UA 1E3UA 2Y2NA 2EFXA 1DJAA 1LHYA 4N1XA 3VOZA 5CHUA 4ZAMA 2Q9NA 3TSGA 2CC1A 4KQOA 3G31A 3IH8A 3ITBA 2HDQA 5EECA 2Y2PA 5EPHA 1IYSA 5E2FA 5EVIA 2QPNA 5FQJA 3DWKA 1VQQA 2WGWB 1EWZA 4OP5A 4GNUA 4JF5A 3ZVWA 3VFHA 4GB7A 5CTMA 3TOIA 3BEBA 3GR2A 2JBFA 3NC8A 4S2JA 3G2ZA 3VSLA 2V2FF 1MKIA 1Q2QA 1MWTA 2EX8A 3PAEA 2J9OA 4E3OA 1IKGA 1K25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N8L A;  4LCM A;  3BM6 A;  2HP5 A;  3DTM A;  4KQR A;  4Y0O A;  3C7U A;  1CEF A;  1AXB A;  4P85 A;  4GD8 A;  1BSG A;  4R3J A;  3IHA A;  1BUL A;  4C75 A;  3VOY A;  4EBP A;  4IBR A;  1FSY A;  4EV4 A;  4OPZ A;  1SHV A;  5G18 A;  3OPH A;  2PBY A;  5HAP A;  2H0Y A;  3IQA A;  5F82 A;  4FH2 A;  2PU4 A;  4JXW A;  5IHV A;  3HLG A;  4OP8 A;  3O87 A;  3ZCZ A;  1YLP A;  5DTK A;  5TGF A;  4N1H A;  3W4P A;  4C3Q A;  2ZQC A;  1C3B A;  4DXB A;  2ZQ7 A;  4XUZ A;  5F1F A;  3C7V A;  3UPP A;  1SDN A;  1TVF A;  1S6R A;  3HVF A;  1K55 C;  2Y55 A;  3HL9 A;  3IHB A;  2DNS A;  3MXR A;  4DRT A;  2Y2J A;  4QHC A;  4D2O A;  4KZA A;  4EBN A;  4MBH A;  4JXS A;  3A3E A;  3Q1F A;  2ZQ8 A;  1OME A;  1KE4 A;  3CMZ A;  3FWL A;  4PM9 A;  1K55 A;  1ZG6 A;  1GCE A;  3V5M A;  3B3X A;  3IF6 B;  1XGI A;  4BQM A;  3FKW A;  5FSR A;  4JPM A;  1PZP A;  3ZNY A;  3LEZ A;  2WKH A;  5KSC A;  3OZH A;  4JF6 A;  3PAG A;  2OV5 A;  1FR6 A;  4U0T A;  1CEG A;  5FQK A;  4DXC A;  3P98 A;  4E3M A;  4MBF A;  3O3V A;  1W8Y A;  1DJB A;  5CHM A;  4RYE A;  4KZ6 A;  4ZDX A;  5DF7 A;  5FQM A;  2ZC7 A;  4KEN B;  3S1Y A;  2UWX A;  2HDU A;  4OLD A;  4GN2 A;  3G4P A;  4GDB A;  1PI5 A;  1W79 A;  4PM6 A;  2RL3 A;  5A92 A;  3FZC A;  4ID4 A;  3UPN A;  4BL2 A;  1K6S A;  4GKU A;  3ZHH A;  3E2L A;  5HL1 A;  2XFS A;  3M2J A;  1SDE A;  5EVI D;  1Z6F A;  3UPO A;  4KG2 A;  1O07 A;  1XP4 A;  1YMX A;  3M2K A;  1KE0 A;  3IT9 A;  5DVA A;  3LO7 A;  3OCL A;  3SOI A;  1J9M A;  3WS0 A;  3BLS A;  3HUN A;  2EX2 A;  3Q7Z A;  2ZM8 A;  1HZO A;  4QJG A;  4JLF A;  4N9L A;  5EUA A;  2Y2H A;  4H8R A;  3W4Q A;  4PM8 A;  3UDI A;  1K56 D;  1WYB A;  1WYC A;  4E6X A;  4E3J A;  1MXO A;  3QNC A;  2XH9 A;  3G30 A;  3ZG9 B;  3ITA A;  3ZGA B;  4KQQ A;  1W7F A;  4HBU A;  3A3D A;  1PW8 A;  1IKI A;  3UE1 A;  3V39 A;  3IWO A;  5CER A;  2Y2G A;  1LL5 A;  3BFF A;  4RX2 A;  1WE4 A;  3VMA A;  1CI9 A;  2QMI A;  4XUX A;  5CXW A;  2XQZ A;  3C4P A;  3BFD A;  3NDE A;  4GZB A;  4OPY A;  1GHP A;  2JE5 A;  4LV0 A;  2V20 A;  2WYX A;  3HLE A;  1K4E A;  2BLS A;  2QZ6 A;  4FD8 A;  3ZG5 A;  4MBK A;  1NRF A;  2Y91 A;  4R1G A;  3Q7V B;  3NDG A;  4GD6 A;  3UE3 A;  3WRT A;  4E6W A;  3EQU A;  5I94 A;  5TFQ A;  5EVI C;  1JWP A;  3RXX A;  4JF4 A;  3BLM A;  4QD4 A;  3ZG8 B;  1YLW A;  1PZO A;  1JTD A;  2WKI A;  4KZ5 A;  5EVL A;  3M6B A;  1YQS A;  4OON A;  4IVI A;  5CGW A;  4M3K A;  3E2K A;  3MFD A;  1JVJ A;  3ZNT A;  4L0L A;  1GHM A;  4QY6 A;  1BLH A;  4ZJ1 A;  4HBT A;  4DE0 A;  1KDW A;  4X6T A;  1BUE A;  3HLW A;  3BRM A;  2WAE A;  1BT5 A;  5FAP A;  4EWF A;  4OQG A;  4GDN A;  2OSU A;  1K56 A;  5FDH A;  3NI9 A;  1RGZ A;  4DKI A;  1ESI A;  4QU3 A;  2JCH A;  4R4S A;  1KGG A;  5FQI A;  3SH8 A;  2FFF B;  2R9W A;  5CGX A;  4RX3 A;  3GTC A;  4ZBE A;  4OOL A;  4WYY A;  3ZVT A;  4BL3 A;  3UDX A;  1E4D A;  1JWV A;  4WEK A;  2ZLY A;  5A93 A;  2X02 A;  3PBS A;  3VP4 A;  1XPB A;  1TEM A;  3UNW A;  3NBL A;  1U60 A;  3ZFZ A;  1IEL A;  2VGJ A;  2HP6 A;  1N9B A;  1L0E A;  4DE2 A;  4KZB A;  3CZD A;  2Q9M A;  2H0T A;  5HW3 A;  1BLC A;  4MNR A;  2ZD8 A;  3N8R A;  4K0W A;  4R0Q A;  1IYO A;  2Y2O A;  3IH9 A;  4X69 A;  5CEB A;  3CJM A;  2XD5 A;  4PM5 A;  2XK1 A;  1K6R A;  4IBX A;  3PBN A;  1FQG A;  1JTG A;  1SCW A;  4IED A;  4DDY A;  1KDS A;  1QME A;  1BTL A;  3OPL A;  4S2N C;  2EX9 A;  3ISG A;  2X01 A;  1MWU A;  1S0W A;  2WGW A;  2R9X A;  5U47 A;  3PBQ A;  4WBG A;  4OOM A;  4KZ9 A;  1HTZ A;  1E25 A;  5EE8 A;  5HAI A;  4DDS A;  1G68 A;  1N4O A;  1NXY A;  2WGI A;  3Q07 A;  3GV9 A;  4S2N A;  4EQI A;  2EX6 A;  3PBT A;  2I72 A;  1MWS A;  3MBZ A;  2WUQ A;  4BD0 A;  4UA6 A;  1PIO A;  4F94 A;  3G34 A;  2VGK A;  1NY0 A;  4KZ3 A;  5M1A A;  1I2W A;  2ZQD A;  3PTE A;  4WM9 A;  1JWZ A;  1PWD A;  1ONH A;  4R23 A;  5A90 A;  1IYQ A;  2WKE A;  4JBF A;  3SS4 A;  3N7W A;  3NIA A;  1ES4 A;  3FKV A;  4S2L A;  1XGJ A;  5FAS A;  2Y2I A;  2WZZ A;  2ZC3 B;  1K54 A;  1ERQ A;  5E2H A;  2OLU A;  3IF5 A;  1BLS A;  3DW0 A;  4B4Z A;  3HUM A;  5CED A;  3UN7 A;  3EQV A;  2J7V A;  3IWQ A;  4PPR A;  1Q2P A;  1K57 C;  5FQ9 A;  4OPR A;  3N8S A;  5GLC A;  1NJ4 A;  3IXD A;  4NK3 A;  4X55 A;  4ZJ2 A;  2XEP A;  4QY5 A;  1KGF A;  1XA7 A;  3G35 A;  3O86 A;  5F83 A;  2IWD A;  3BYD A;  3IF6 C;  5M18 A;  2HPB A;  3ZDJ A;  4FH4 A;  2WGV A;  3A3I A;  1K57 A;  3N6I A;  2Y59 A;  3OCN A;  3S22 A;  5GLD A;  5GLA A;  5FAQ A;  1LLB A;  4PMA A;  4CJN A;  3IF6 A;  3G2Y A;  2Y2Q A;  1FSW A;  4P0M A;  3SH7 A;  5FI6 A;  3HUO A;  4WMC D;  2DRW A;  4HEF A;  4S2P A;  4S2M A;  4WZ4 A;  4E3N A;  1IYP A;  4Q8I A;  3VP3 A;  3WRZ A;  1HD8 A;  4E3L A;  3LCE A;  3RXW A;  1MBL A;  1M40 A;  2XD1 A;  4DE1 A;  4LV2 A;  4Y0T A;  1KGE A;  4S2I A;  5J8X A;  1NYM A;  3HLF A;  1O7E A;  2BG1 A;  1HVB A;  3AGE A;  3GVB A;  2EXB A;  3PBR A;  4B88 A;  4XXR A;  3QNB A;  4RA7 A;  2ZQ9 A;  4DE3 A;  4N92 A;  2Y2M A;  1GA9 A;  5E2G A;  3N4I A;  3QHY A;  4QB8 A;  3OPP A;  1ES3 A;  4MLL A;  4EBL A;  4Y0U A;  1EI5 A;  2ZJ9 A;  4LCL A;  2XGN A;  3P09 A;  4WEL A;  3OC2 A;  5CTN A;  2EFU A;  4JXG A;  3V3R A;  1IEM A;  1ONG A;  2Y2K A;  3GMW A;  4X56 A;  5HFO A;  1PYY A;  3JYI A;  2WK0 A;  5KMW A;  5AQ7 A;  1LL9 A;  2C6W B;  3WS5 A;  3WS1 A;  4BJP A;  3LY3 A;  1K38 A;  1ES5 A;  2DCF A;  3IXB A;  3A3J A;  4O7D A;  1PI4 A;  3GRJ A;  4EUZ A;  4K91 A;  1W8Q A;  1NZO A;  3VP1 A;  1VM1 A;  4YIN A;  4OOY A;  5KZH A;  3Q82 A;  4MEZ A;  4JXV A;  3DWZ A;  2ZM0 A;  2IWB A;  4CPK A;  3UY6 A;  3HRE A;  3UDF A;  4LV1 A;  4OVD A;  4UA9 A;  1KVL A;  2XLN A;  5DF8 A;  2B5R A;  1NZU A;  3PBO A;  4FCF A;  4C6Y A;  1RGY A;  5GLB A;  1NYY A;  4OKP A;  3MZD A;  1RCJ A;  5GHX A;  1ALQ A;  5AQB A;  4WMC A;  1GHI A;  4X68 A;  3V50 A;  2XDM A;  4JKT A;  3HLD A;  3MKE A;  1G6A A;  3Q7V A;  2ZC4 B;  5DF9 A;  5M19 A;  2XFT A;  2RCX A;  1ERM A;  2WAF A;  3MZF A;  3W4O A;  1ERO A;  1H8Z A;  1XXM A;  1BZA A;  1H5X A;  2HDR A;  2P9V B;  1PW1 A;  3G32 A;  1H8Y A;  1KVM A;  2P74 A;  1TDL A;  2ZC6 B;  3VP2 A;  4UA7 A;  5HX9 A;  1RP5 A;  4BEN A;  5CGS A;  3IXH A;  1YLZ A;  2H5S A;  4WEJ A;  1L0D A;  4N9K A;  3GQZ A;  4Z9Q A;  2EXA A;  2ZC5 B;  5A91 A;  5CEC A;  3BFG A;  4P87 A;  1GA0 A;  1CI8 A;  4PM7 A;  1KE3 A;  4RVA A;  2GDN A;  1CK3 A;  3FV7 A;  3S4X A;  3AGD A;  1MPL A;  1TDG A;  1ESU A;  5AQ9 A;  3A3F A;  3AGF A;  2ZQA A;  4ZJ3 A;  2Y4A A;  1L0G A;  1QMF A;  1XKZ A;  1DY6 A;  5DTS A;  5TR7 A;  3CG5 A;  4UAA A;  3VFF A;  4KZ7 A;  1YLJ A;  3C5A A;  4E3K A;  5FAO A;  4S2K A;  1K54 C;  3RJU A;  5E43 A;  4FSF A;  1FR1 A;  4P6B A;  4X53 A;  1M6K A;  2C5W B;  5CHJ A;  2JC7 A;  4B4X A;  3SS3 A;  3WS2 A;  5FI2 A;  1ZG4 A;  1ZC2 A;  5JYP A;  1L2S A;  1XA1 A;  2IWC A;  1PWG A;  2WZX A;  3TG9 A;  1LI0 A;  2ZMA A;  5JYO A;  5AQA A;  3NY4 A;  4KG6 A;  3UE0 A;  3IWI A;  4Y7P A;  2G2W A;  4OQH A;  2WAD A;  1K4F A;  2E8I A;  2P9V A;  1I5Q A;  5FAT A;  1DJC A;  1Y54 A;  5GHY A;  3IXG A;  2V1Z A;  4YFM A;  5D3O A;  5FQQ A;  3M6H A;  4DF6 A;  2J8Y A;  4BD1 A;  1E3U D;  4OQI A;  3D4F A;  4OH0 A;  1PWC A;  1XX2 A;  2HP9 A;  2OLV A;  1FCN A;  3FYZ A;  4HES A;  1ZKJ A;  1L0F A;  3ZG0 A;  4KG5 A;  1YLY A;  4U0X A;  4UHU A;  3MXS A;  4BLM A;  1MWR A;  3WS4 A;  3BFE A;  4R4R A;  3O88 A;  1ES2 A;  3OPR A;  2Y2L A;  4OPQ A;  2H10 A;  2XF3 A;  4R3B A;  5EVI B;  4KZ4 A;  1YM1 A;  3VP0 A;  5FI7 A;  3WWX A;  3C4O A;  3NCK A;  4E3I A;  1YLT A;  4K0X A;  5FA7 A;  3W8K A;  5KSH A;  2Z2L B;  3ZG7 B;  2Z2M B;  4WZ5 C;  2A3U A;  4LEN A;  2X71 A;  2XR0 A;  3HBR A;  5GL9 A;  1W5D A;  2A49 A;  1YMS A;  2FFY A;  3BFC A;  3MZE A;  4ZTK A;  1I2S A;  4U3T A;  3I7J A;  2PU2 A;  4KZ8 A;  4A5R A;  2ZM2 A;  4OQ0 A;  3LY4 A;  1FCO A;  4WZ5 A;  5EOE A;  3SS5 A;  3V3S A;  1BLP A;  4OLG A;  3HLB A;  5L2F A;  2HDS A;  1FCM A;  5CRF A;  5F1G A;  4NET A;  1FOF A;  4GOG A;  3UO9 A;  5HAR A;  5E2E A;  5DTT A;  1MY8 A;  1YT4 A;  3GSG A;  3BEC A;  2J9P A;  4LV3 A;  3SH9 A;  3MKF A;  5BOH A;  5GHZ A;  3VSK A;  3HLC A;  4IVK A;  1SKF A;  3Q81 A;  4S2O A;  5EOO A;  5HAQ A;  1LI9 A;  2G2U A;  1E3U A;  2Y2N A;  2EFX A;  1DJA A;  1LHY A;  4N1X A;  3VOZ A;  5CHU A;  4ZAM A;  2Q9N A;  3TSG A;  2CC1 A;  4KQO A;  3G31 A;  3IH8 A;  3ITB A;  2HDQ A;  5EEC A;  2Y2P A;  5EPH A;  1IYS A;  5E2F A;  5EVI A;  2QPN A;  5FQJ A;  3DWK A;  1VQQ A;  2WGW B;  1EWZ A;  4OP5 A;  4GNU A;  4JF5 A;  3ZVW A;  3VFH A;  4GB7 A;  5CTM A;  3TOI A;  3BEB A;  3GR2 A;  2JBF A;  3NC8 A;  4S2J A;  3G2Z A;  3VSL A;  2V2F F;  1MKI A;  1Q2Q A;  1MWT A;  2EX8 A;  3PAE A;  2J9O A;  4E3O A;  1IKG A;  1K25 A; 
#chains in the Genus database with same CATH topology
 3N8L A;  4LCM A;  3BM6 A;  4KQR A;  3C7U A;  4P85 A;  4R3J A;  3IHA A;  4EW7 A;  1FSY A;  1S4S A;  4EV4 A;  3T1X A;  4FH2 A;  3MQQ A;  3KX0 X;  1YLP A;  3CPT B;  5DTK A;  5TGF A;  4C3Q A;  2OOL A;  5F1F A;  3C7V A;  1SDN A;  1TVF A;  4Q0I A;  2Y55 A;  1G5U A;  4D2O A;  5FEF A;  4KZA A;  1OME A;  1KE4 A;  3IF6 B;  1G28 A;  2KLI A;  3LEZ A;  1FR6 A;  4MBF A;  5KIZ A;  4RYE A;  2ZC7 A;  3NOT C;  2UWX A;  4OLD A;  3G4P A;  3R7W B;  1PFL A;  3FZC A;  3HJI A;  3UPN A;  4BMW A;  2V8F A;  1XP4 A;  3M2K A;  1KE0 A;  2O9A A;  3LO7 A;  3F1N A;  3BLS A;  2EX2 A;  2FH5 A;  3W4Q A;  3CIT A;  4I38 A;  1MXO A;  3QNC A;  3ZG9 B;  3ZGA B;  4I3J A;  1PRQ A;  3V39 A;  3IWO A;  1XJ6 A;  4RX2 A;  2VA0 A;  3VMA A;  1CI9 A;  5CXW A;  2QMI A;  2Y79 A;  4GZB A;  4OPY A;  2QZ6 A;  2BLS A;  4LGW A;  3ZG5 A;  2Y91 A;  4GD6 A;  3UE3 A;  2B95 A;  5TFQ A;  2A24 A;  1KOU A;  3ZG8 B;  1PZO A;  4O0P A;  1YQS A;  3MFD A;  3S7N A;  4HHD A;  3B42 A;  4HBT A;  4YNR A;  3T1S A;  3BRM A;  4EWF A;  4MDZ A;  4OQG A;  5HPI A;  4GDN A;  2OSU A;  2XRN A;  3KSG A;  4FTX A;  2ZMV A;  5I5L A;  2O0Y A;  4OOL A;  3DTE A;  2ZLY A;  5L07 A;  3H7W A;  1N9B A;  4DE2 A;  3CZD A;  2Q9M A;  2V1B A;  1OTD A;  4PM5 A;  1CF0 A;  3PBN A;  2NUP C;  1KDS A;  2R9X A;  5U47 A;  2W3F A;  4KZ9 A;  1E25 A;  5HAI A;  4DDS A;  3T4O A;  3Q07 A;  1ACF A;  1TS7 A;  2MJ6 A;  3GV9 A;  1OJ5 A;  2EX6 A;  3PBT A;  1MWS A;  4F94 A;  3BQ8 A;  5IU1 A;  1PWD A;  4R23 A;  2WKE A;  4JBF A;  4IUH A;  1ES4 A;  5MC7 A;  4WN5 A;  2ZC3 B;  1GSX A;  1BLS A;  3HUM A;  5CED A;  1FIK A;  1VET A;  1VEU A;  1K57 C;  5FQ9 A;  3N8S A;  1T1A A;  4X55 A;  4QY5 A;  3O86 A;  5F83 A;  4KQD A;  4KUK A;  1GSW A;  5GLD A;  2HZ5 A;  1TF1 A;  2W3D A;  5FAQ A;  2KDK A;  4CJN A;  4WL9 A;  2VX8 A;  2Y2Q A;  4Z1W A;  1LT0 A;  2QYB A;  3HUO A;  4WZ4 A;  4E3N A;  4E3L A;  3WRZ A;  3TE8 A;  1MBL A;  4DE1 A;  4LV2 A;  4S2I A;  1NYM A;  4B88 A;  1N9L A;  3QNB A;  2ZQ9 A;  2PYP A;  1GA9 A;  1DP9 A;  3QP6 A;  1EI5 A;  4LCL A;  3P09 A;  4WEL A;  2EFU A;  2HV1 A;  4MN5 A;  3V3R A;  1IEM A;  3SW1 A;  3UMD A;  5HFO A;  2WK0 A;  3K3C A;  3WS5 A;  3WS1 A;  1K38 A;  2DCF A;  3A3J A;  1PI4 A;  2P04 A;  1NLZ A;  5KZH A;  3DWZ A;  2IWB A;  4CPK A;  3UY6 A;  3CWF A;  3UDF A;  2H28 A;  1KVL A;  1MKM A;  3L9K A;  5L10 A;  5FL3 A;  5GLB A;  3HLD A;  3DBA A;  3TJZ C;  1OTE A;  5F69 A;  5M19 A;  1ERO A;  1H8Z A;  1H5X A;  1PW1 A;  1H8Y A;  4DJ2 A;  3UB8 A;  2ZC6 B;  2O99 A;  1RP5 A;  4BEN A;  4II7 A;  4B9O A;  3T4K A;  2H5S A;  1L0D A;  5CEC A;  1GA0 A;  1CI8 A;  1PNE A;  1KE3 A;  4RVA A;  4R70 A;  4YOF A;  3FV7 A;  2XA7 S;  1HLU P;  5DFY A;  1ZHH B;  3T4S A;  2Y4A A;  1DY6 A;  3KYE A;  5DTS A;  2ZOH A;  2W0N A;  4KZ7 A;  5FAO A;  3LYX A;  3P7N A;  3RJU A;  4P6B A;  4R6L A;  3SS3 A;  4NXG A;  3LI8 A;  2VLG A;  1PWG A;  3NY4 A;  3IWI A;  2P9V A;  1DJC A;  2VV7 A;  3IXG A;  3L7H A;  3V67 A;  5D3O A;  5FQQ A;  3M6H A;  3TRC A;  4OQI A;  4ETX A;  2HP9 A;  3F1P B;  3FYZ A;  4CLC D;  1ZKJ A;  3CAX A;  4KG5 A;  1ZTU A;  3BFE A;  4R4R A;  3OPR A;  2Y2L A;  4OPQ A;  4KZ4 A;  3WWX A;  5FA7 A;  3ZG7 B;  2Z2M B;  4I39 A;  4LEN A;  2XR0 A;  3HBR A;  5TJJ A;  2FFY A;  3BFC A;  4ZTK A;  1I2S A;  2ZM2 A;  3H9W A;  4WZ5 A;  2L0W A;  3T4Q A;  4NET A;  4HQA A;  3T1Q B;  5DTT A;  3GSG A;  3A0V A;  5GHZ A;  3Q81 A;  2PYR A;  5HAQ A;  2Y2N A;  4N1X A;  3VOZ A;  4FOF A;  4IUK A;  2Q9N A;  4HI4 A;  5L8M A;  4CLC A;  5EEC A;  4EEU A;  2Y2P A;  2EA9 A;  3T4L A;  2ZL1 A;  2WGW B;  2K31 A;  3QP1 A;  1D06 A;  3GR2 A;  1A0K A;  3T4J A;  3NC8 A;  2V2F F;  3QP8 A;  2EX8 A;  4E3O A;  1MWT A;  3JVU A;  3BY8 A;  5HZH A;  4Y0O A;  3E4O A;  1T18 A;  3MQ0 A;  4C75 A;  3VOY A;  4EBP A;  5G18 A;  2PBY A;  2H0Y A;  3IQA A;  4H6J B;  3HLG A;  4OP8 A;  4Y15 A;  3O87 A;  4EER A;  3W4P A;  5DFX A;  1C3B A;  4XUZ A;  3LR0 A;  3UPP A;  1S6R A;  2DNS A;  5K5B A;  4QHC A;  4MBH A;  4JXS A;  3A3E A;  3Q1F A;  4P6Z M;  2QWS A;  3UB6 A;  2LB5 A;  1K55 A;  1ZG6 A;  4CQH A;  3FKW A;  5FSR A;  4JPM A;  1PZP A;  5FQK A;  3UB5 P;  4DXC A;  3O3V A;  1W8Y A;  4ZDX A;  5DF7 A;  3RTY A;  2R78 A;  5AVE A;  4WLA A;  5DKK A;  3VV4 A;  4GDB A;  1PI5 A;  5HL1 A;  2XFS A;  1SDE A;  5EVI D;  1Z6F A;  3UPO A;  4KG2 A;  3PHY A;  1YMX A;  3SOI A;  4K08 A;  3HUN A;  3KSI A;  4QJG A;  4N9L A;  3SZT A;  4H8R A;  4HP9 A;  4ARZ A;  5DJT A;  2XH9 A;  4EET B;  1DP8 A;  2B18 A;  1CQA A;  2Y2G A;  3BFD A;  2JE5 A;  4DN0 A;  1V9Y A;  3CHW P;  4JF4 A;  4QD4 A;  2I9V A;  3IX4 A;  1JTD A;  1LSX A;  4OON A;  4IVI A;  5CGW A;  4M3K A;  3E2K A;  3ZNT A;  3MJQ A;  4QY6 A;  1KDW A;  4GHI B;  4YWZ A;  4F3L B;  5EM0 A;  1BUE A;  3HLW A;  2WAE A;  3S7Q A;  3VE4 A;  5FAP A;  4DKI A;  2JCH A;  2R9W A;  3VOL A;  4ZBE A;  4WYY A;  4BL3 A;  1E4D A;  4HJ4 A;  3UNW A;  1L0E A;  4KZB A;  5HW3 A;  4FUW A;  2ZD8 A;  4R0Q A;  1IYO A;  2Y2O A;  4PHT A;  4IJG A;  4X69 A;  3CJM A;  3MQO A;  2XK1 A;  3MFX A;  3LR4 A;  4BBU A;  5J7E A;  1JTG A;  4HH3 A;  4DDY A;  1QME A;  2EX9 A;  1S0W A;  1SKO B;  1HTZ A;  1G68 A;  2WGI A;  2I72 A;  4BD0 A;  2WUQ A;  2A2L A;  3LR5 A;  5C5K A;  1I2W A;  3PTE A;  1JWZ A;  5A90 A;  1IYQ A;  1N9N A;  3N7W A;  1OJG A;  5FAS A;  1K54 A;  5F6A A;  2OLU A;  3E0Y A;  4AFI A;  3OOV A;  3EQV A;  1NJ4 A;  4NK3 A;  4ZJ2 A;  3T12 B;  1KGF A;  1XA7 A;  4MCW A;  3BYD A;  2HPB A;  2HGV A;  3OCN A;  4I3I A;  5GLA A;  4I5S A;  1LLB A;  4HP4 A;  4UEY A;  2M7U A;  4GS9 A;  4P0M A;  3SH7 A;  2DRW A;  4S2M A;  4WUJ A;  3VP3 A;  3RXW A;  1M40 A;  1YSQ A;  4D60 A;  1O7E A;  3E4P A;  2EXB A;  4XXR A;  2JKF A;  4N92 A;  5E2G A;  3PR6 A;  1T1C A;  1ES3 A;  2ZMF A;  3PYP A;  2Z6C A;  1P9R A;  3TW8 A;  1ODV A;  3LI9 A;  3LIF A;  2Y2K A;  1PYY A;  5KMW A;  3LIC A;  4O7D A;  1TS0 A;  1VM1 A;  4YIN A;  4OOY A;  3Q82 A;  4MEZ A;  3HRE A;  4LV1 A;  1K0K A;  1LL8 A;  4PKY G;  5DF8 A;  4FCF A;  5TBM A;  1L3L A;  1OTA A;  1RCJ A;  1GHI A;  1G6A A;  3Q7V A;  2XFT A;  2WAF A;  3MZF A;  3G32 A;  1KVM A;  2P74 A;  5CGS A;  1YLZ A;  3NEC A;  4N9K A;  2ZC5 B;  2V9A A;  4P87 A;  3AGD A;  1MPL A;  5AJG A;  3A3F A;  3AGF A;  4NG2 A;  4ZJ3 A;  4HH2 A;  4CLC E;  4HJ6 A;  3FPV A;  4UAA A;  3F1N B;  4S2K A;  5E43 A;  4B4X A;  3WS2 A;  1ZG4 A;  1ZC2 A;  5JYP A;  1X0O A;  1XA1 A;  5J3W A;  4KG6 A;  4HOI A;  4UQI S;  4BWI A;  4Y7P A;  2G2W A;  1NLY A;  1CJF A;  4LRX C;  1S1Y A;  1K4F A;  1XFQ A;  3NJA A;  1I5Q A;  2ZOI A;  2JKG A;  1Y54 A;  2V1Z A;  2J8Y A;  1E3U D;  1PWC A;  1XX2 A;  5A8B A;  2A24 B;  4HES A;  2XRO A;  1YLY A;  2PBD P;  3C8C A;  4BLM A;  1MWR A;  2VV6 A;  4R3B A;  4NEE D;  4NXE A;  3C4O A;  4E3I A;  2VJW A;  3W8K A;  2Z2L B;  3QP5 A;  4WZ5 C;  3BY9 A;  2X71 A;  1W5D A;  2A49 A;  1YMS A;  2QKP A;  4KZ8 A;  4A5R A;  3GDI A;  2W27 A;  5EOE A;  1D7E A;  4L9E A;  3V3S A;  5L2F A;  2HDS A;  1FCM A;  2PD7 A;  2P08 A;  5HL6 A;  3P01 A;  3UO9 A;  2OWH A;  4XT2 A;  1MY8 A;  4CLC C;  5HWV A;  2J9P A;  1G6O A;  3O5Y A;  4IVK A;  4S2O A;  1LI9 A;  1E3U A;  4G3V A;  1IOU A;  3IH8 A;  5F5Y A;  5EPH A;  2QPN A;  3LFV A;  2PHY A;  3DWK A;  1VQQ A;  2JKT M;  1XJ3 A;  4HNB A;  4OP5 A;  4JGO A;  3H82 A;  4GB7 A;  4LRY C;  3BEB A;  2VEA A;  1MKI A;  2HP5 A;  3DTM A;  4HIA A;  4R38 A;  4GD8 A;  1BSG A;  2V0U A;  5HAP A;  1F9I A;  3ZCZ A;  1VET B;  1VEU B;  4DXB A;  2ZQ7 A;  3HVF A;  1K55 C;  4EES A;  2M1C A;  3HL9 A;  4DRT A;  3MXR A;  2WKR A;  4EBN A;  2ZQ8 A;  1LSW A;  2D02 A;  1OTI A;  3EEA A;  3F1O A;  3FWL A;  1V9Z A;  2OAP 1;  3B3X A;  2W3E A;  4BQM A;  2AVX A;  3OBF A;  1F5M A;  4O01 A;  3ZNY A;  5KSC A;  3PAG A;  2OV5 A;  1CEG A;  1AWI A;  3P98 A;  4LFU A;  2GX5 A;  4KEN B;  2ACG A;  3S1Y A;  2HDU A;  2O9B A;  4GN2 A;  1W79 A;  5A92 A;  4BL2 A;  1K6S A;  3ZHH A;  2Q0O A;  4H6J A;  3OCL A;  3WS0 A;  4EXO A;  2ZM8 A;  1HZO A;  2UV0 E;  2Y2H A;  4PM8 A;  1K56 D;  1WYC A;  3FG8 A;  3GEC A;  2L4R A;  3G30 A;  2KX6 A;  4KQQ A;  1W7F A;  3A3D A;  1PW8 A;  4I3A A;  2BTF P;  3UB9 A;  1LL5 A;  4XUX A;  1S1Z A;  1P9W A;  5IT5 A;  2XQZ A;  3C4P A;  3NDE A;  5EV0 A;  3HLE A;  1K4E A;  4R1G A;  1NRF A;  3R4K A;  5G4Z A;  2EWW A;  3WRT A;  4E6W A;  1VHM A;  1D1J A;  5EVI C;  1JWP A;  3IS2 B;  5EVL A;  3M6B A;  2FZ0 A;  5G4Y A;  1BLH A;  3BQA A;  2XSS A;  4ZJ1 A;  4X6T A;  1BT5 A;  2W1T B;  1T1B A;  1K56 A;  3E4Q A;  1ESI A;  4R4S A;  5FQI A;  1KGG A;  4EU0 A;  5CGX A;  2VGL M;  4RX3 A;  4JGR A;  5EVE A;  3DTI A;  1JWV A;  4WEK A;  2JN7 A;  3VP4 A;  3T4T A;  1XPB A;  3NBL A;  2VGJ A;  2HP6 A;  2NUT C;  3D72 A;  2H0T A;  1BLC A;  3HJK A;  1WA9 A;  5HSQ A;  1YSP A;  2PR5 A;  1K6R A;  2WKQ A;  4IED A;  3OPL A;  3ISG A;  3KYQ A;  1N4O A;  1TS8 A;  4M4X A;  4S2N A;  4EQI A;  4ETZ A;  4MMN A;  4NKP A;  3G34 A;  3ZYT A;  2VGK A;  2J3T D;  4WM9 A;  1ONH A;  3JPU A;  3SS4 A;  3NIA A;  3CUE A;  3FKV A;  2W3G A;  1XGJ A;  2Y2I A;  2WZZ A;  1ERQ A;  1JNU A;  3IF5 A;  3DW0 A;  3LEQ A;  2J7V A;  3CPT A;  1OTB A;  3DAV A;  4PPR A;  2B02 A;  1Q2P A;  2O9C A;  5L09 A;  4OPR A;  5GLC A;  2GZA A;  3G35 A;  2IWD A;  5M18 A;  4X1M A;  3A3I A;  4Y5F A;  2XA7 M;  4CLC B;  4PMA A;  3IF6 A;  4Y17 A;  1FSW A;  2WKP A;  5FI6 A;  4WMC D;  4HEF A;  2Y8H A;  2ZL1 B;  4Q8I A;  3LCE A;  3EGX C;  4Y0T A;  1KGE A;  4JGQ A;  3HLF A;  2JKR M;  1HVB A;  4ZRR A;  3PBR A;  3R7W A;  2Y2M A;  3N4I A;  3QHY A;  3OPP A;  4Y0U A;  2ZJ9 A;  3QP2 A;  3OC2 A;  1ONG A;  3JYI A;  4DMZ A;  5AQ7 A;  4NXB A;  3IXB A;  1S67 L;  3GRJ A;  4EUZ A;  3VP1 A;  1MC0 A;  3U4L P;  4OVD A;  2B5R A;  3PBO A;  4C6Y A;  1NYY A;  1OT6 A;  3MZD A;  4OKP A;  1ALQ A;  4WMC A;  5IS1 A;  4X68 A;  3V50 A;  2XDM A;  2D01 A;  4JKT A;  5DF9 A;  2RCX A;  1ERM A;  3W4O A;  2HDR A;  1BZA A;  2PDR A;  1Z09 A;  2HF6 A;  5HX9 A;  5A91 A;  4PM7 A;  2BAS A;  2GDN A;  2QJ7 A;  1TDG A;  1IFQ A;  4IHQ A;  5AQ9 A;  1L0G A;  1QMF A;  1XKZ A;  5TR7 A;  3VFF A;  1YLJ A;  4GLQ A;  3C5A A;  1FR1 A;  2C5W B;  4ARZ B;  5FI2 A;  4X1L A;  4HJ3 A;  1L2S A;  2WZX A;  2IWC A;  3CLO A;  2KOI A;  1LI0 A;  2ZMA A;  5JYO A;  5AQA A;  1YPR A;  3LUQ A;  3UE0 A;  2DMW A;  4OQH A;  4PAU A;  5FAT A;  3G6O A;  5HDC A;  4YFM A;  4MN7 A;  1P0Z A;  3KYZ A;  4BBV A;  1FCN A;  5F68 A;  3ZG0 A;  4G3K A;  5J4E A;  3DTK A;  3WS4 A;  3K3D A;  3O88 A;  5EVI B;  1YM1 A;  2PAV P;  2M7V A;  5KSH A;  2A3U A;  2IA2 A;  2QHK A;  3MZE A;  3I7J A;  2PU2 A;  4OQ0 A;  1FCO A;  4GCZ A;  3B33 A;  1MZU A;  4DJ3 A;  4OLG A;  3KSF A;  5F1G A;  1FOF A;  4GOG A;  1FIL A;  1UWN X;  2VK3 A;  1VB6 A;  1YT4 A;  4LV3 A;  3SH9 A;  3OLO A;  3NOP C;  3IBJ A;  3HLC A;  5EOO A;  3UE6 A;  1DJA A;  5FEG A;  5CHU A;  4ZAM A;  1BYW A;  4KQO A;  1DRM A;  5AVF A;  3ITB A;  2L1M A;  2HDQ A;  3FPW A;  1IYS A;  1Y28 A;  1EWZ A;  1T19 A;  4QPR A;  4JF5 A;  2YKH A;  5CTM A;  3TOI A;  2EWV A;  2JBF A;  2VZW A;  2JHE A;  3RFB A;  2PT7 A;  3BJN A;  4L9F A;  4ESP A;  1CEF A;  1AXB A;  3JVV A;  3UME A;  1BUL A;  4IBR A;  3VE3 A;  4OPZ A;  1SHV A;  3OPH A;  5F82 A;  2PU4 A;  4JXW A;  5IHV A;  4GJ4 A;  5HDD A;  2G7U A;  2PRF A;  4N1H A;  2ZQC A;  4LRZ E;  4R3A A;  3IHB A;  2Y2J A;  3CMZ A;  4PM9 A;  1GCE A;  3V5M A;  1XGI A;  5HWW A;  2W1R A;  2WKH A;  3EWK A;  3K2N A;  3HCY A;  4MN6 A;  4EQ1 A;  3OZH A;  4GS9 B;  4JF6 A;  2GNX A;  3FC7 A;  4U0T A;  3MMH A;  4E3M A;  5CHM A;  1YAX A;  1DJB A;  4KZ6 A;  5FQM A;  4PM6 A;  2RL3 A;  4ID4 A;  3MF0 A;  4GKU A;  3E2L A;  3M2J A;  4Q0H A;  1YKD A;  1O07 A;  3IT9 A;  5DVA A;  3KSH A;  1J9M A;  1J3W A;  3A0S A;  3Q7Z A;  4JLF A;  5EUA A;  3UDI A;  1WYB A;  4E6X A;  4E3J A;  3E98 A;  3ITA A;  3LIB A;  3PXP A;  4HBU A;  1IKI A;  3UE1 A;  1DP6 A;  5CER A;  2VGL S;  3BFF A;  3NOU C;  5TBM B;  1WE4 A;  5HPF A;  3NHQ A;  2ZBB A;  4RQ9 A;  1GHP A;  4LV0 A;  2V20 A;  2WYX A;  2JKT I;  4FD8 A;  3H7W B;  4MBK A;  3Q7V B;  3NDG A;  3EQU A;  5I94 A;  3F1P A;  3RXX A;  1STZ A;  3BLM A;  3IBR A;  1YLW A;  2WKI A;  4KZ5 A;  1JVJ A;  2J80 A;  4L0L A;  4NXF A;  1GHM A;  4P6Z S;  2PD8 A;  4DE0 A;  4PKY A;  3KO6 A;  1P97 A;  3C2W A;  1W63 M;  1W63 Q;  5HWT A;  3QP4 A;  5FDH A;  3NI9 A;  1RGZ A;  4QU3 A;  1H3Q A;  3LR3 A;  3SH8 A;  2FFF B;  1NRJ A;  1UWP X;  3LGO A;  3GTC A;  3ZVT A;  3UDX A;  5A93 A;  2X02 A;  3PBS A;  3BWL A;  1TEM A;  1U60 A;  3ZFZ A;  1IEL A;  5HD3 A;  4MNR A;  3N8R A;  4K0W A;  4JGP A;  2K7S A;  3IS2 A;  5CEB A;  2XD5 A;  2YKF A;  1XJ2 A;  4IBX A;  1UGU A;  1FQG A;  1SCW A;  3W2Z A;  1BTL A;  4S2N C;  2INW A;  2X01 A;  1MWU A;  5EFW A;  2WGW A;  3PBQ A;  4WBG A;  4OOM A;  5EE8 A;  1NXY A;  2PR6 A;  3ULF A;  2W1T A;  3CUE C;  3MBZ A;  4UA6 A;  2OAQ 1;  1PIO A;  1NY0 A;  4KZ3 A;  2VKS A;  5M1A A;  2ZQD A;  1EW0 A;  4L9G A;  4S2L A;  2VV8 A;  2E8J A;  5E2H A;  5FDS A;  4B4Z A;  1XFN A;  3UN7 A;  3BW6 A;  4X25 A;  3IWQ A;  1F2K A;  2K2N A;  3IXD A;  3MSH A;  4XT2 B;  3LIE A;  2XEP A;  2HJE A;  1H8M A;  1OT9 A;  3T50 A;  3IF6 C;  3ZDJ A;  4FH4 A;  2WGV A;  3N6I A;  1K57 A;  2Y59 A;  3S22 A;  3G2Y A;  2V0W A;  2V8C A;  2OWJ A;  4EEP A;  2J3T C;  2LB9 A;  4S2P A;  1IYP A;  1HD8 A;  2XD1 A;  3H82 B;  3D3O A;  5J8X A;  2BG1 A;  3AGE A;  3GVB A;  5DKL A;  3MS6 A;  4RA7 A;  3A0R A;  4DE3 A;  4UQI M;  3RH8 B;  4QB8 A;  4MLL A;  4QWO A;  4EBL A;  1TD5 A;  2XGN A;  4E04 A;  2W3H A;  5CTN A;  3EOI A;  4JXG A;  3GMW A;  4X56 A;  4LLO B;  1SZV A;  1LL9 A;  2C6W B;  3ZQ5 A;  4BJP A;  3LY3 A;  1ES5 A;  4K91 A;  1W8Q A;  1NZO A;  4JXV A;  2ZM0 A;  4UA9 A;  4WF0 A;  2XLN A;  1NZU A;  3B47 A;  1RGY A;  5DJU A;  4Q0J A;  4GW9 A;  3F1O B;  1N9O A;  5GHX A;  5AQB A;  3C30 A;  3MKE A;  2ZC4 B;  1NWZ A;  3IH9 A;  4ME4 A;  4Y3I A;  1XXM A;  2P9V B;  1TDL A;  3VP2 A;  4UA7 A;  3IXH A;  4WEJ A;  4Z9Q A;  3GQZ A;  2EXA A;  3EEH A;  3BFG A;  4Y2F A;  1CK3 A;  3NUL A;  3S4X A;  3T1R A;  1ESU A;  1TS6 A;  4GHI A;  4F3L A;  2ZQA A;  2CMN A;  1F98 A;  3UB7 A;  2HJ9 C;  2V1A A;  3CG5 A;  4E3K A;  3MXQ A;  1K54 C;  4FSF A;  4X53 A;  4EUV A;  1M6K A;  5CHJ A;  2JC7 A;  1S66 L;  5EM1 A;  4BBT A;  3TG9 A;  2P7J A;  4HY8 A;  1OPX A;  1S4R A;  5HDS A;  3EGD C;  2WAD A;  2E8I A;  5GHY A;  4B93 A;  4DF6 A;  4BD1 A;  3ICY A;  4Y13 A;  3D4F A;  4OH0 A;  2OLV A;  3IX8 A;  5HD5 A;  1L0F A;  2JKR I;  2QJ5 A;  4U0X A;  4UHU A;  5CX7 A;  1Y4O A;  3MXS A;  1SKO A;  3S7P A;  1ES2 A;  2Z6D A;  2H10 A;  2XF3 A;  3VP0 A;  5FI7 A;  1H0M A;  3NCK A;  1YLT A;  4K0X A;  5LBR A;  2GJ3 A;  4G3W A;  1XJ4 A;  5GL9 A;  4O8G A;  4U3T A;  4KUO A;  3LY4 A;  1GSV A;  3SS5 A;  1BLP A;  3HLB A;  5CRF A;  3CI6 A;  3D9Y A;  5HAR A;  5E2E A;  3BEC A;  3MKF A;  5BOH A;  3VSK A;  1SKF A;  3C38 A;  2G2U A;  2EFX A;  1LHY A;  4LPZ A;  1LSV A;  3TSG A;  2CC1 A;  3G31 A;  3LIA A;  2J3W A;  3IX3 A;  5E2F A;  5EVI A;  5FQJ A;  3MR0 A;  3U2A A;  4GNU A;  3LID A;  3ZVW A;  3VFH A;  3S7O A;  4S2J A;  3G2Z A;  3VSL A;  1Q2Q A;  3PAE A;  2J9O A;  1IKG A;  1K25 A; 
#chains in the Genus database with same CATH homology
 3N8L A;  4LCM A;  3BM6 A;  2HP5 A;  3DTM A;  4KQR A;  4Y0O A;  3C7U A;  1CEF A;  1AXB A;  4P85 A;  4GD8 A;  1BSG A;  4R3J A;  3IHA A;  1BUL A;  4C75 A;  3VOY A;  4EBP A;  4IBR A;  1FSY A;  4EV4 A;  4OPZ A;  1SHV A;  5G18 A;  3OPH A;  2PBY A;  5HAP A;  2H0Y A;  3IQA A;  5F82 A;  4FH2 A;  2PU4 A;  4JXW A;  5IHV A;  3HLG A;  4OP8 A;  3O87 A;  3ZCZ A;  1YLP A;  5DTK A;  5TGF A;  4N1H A;  3W4P A;  4C3Q A;  2ZQC A;  1C3B A;  4DXB A;  2ZQ7 A;  4XUZ A;  5F1F A;  3C7V A;  3UPP A;  1SDN A;  1TVF A;  1S6R A;  3HVF A;  1K55 C;  2Y55 A;  3HL9 A;  3IHB A;  2DNS A;  3MXR A;  4DRT A;  2Y2J A;  4QHC A;  4D2O A;  4KZA A;  4EBN A;  4MBH A;  4JXS A;  3A3E A;  3Q1F A;  2ZQ8 A;  1OME A;  1KE4 A;  3CMZ A;  3FWL A;  4PM9 A;  1K55 A;  1ZG6 A;  1GCE A;  3V5M A;  3B3X A;  3IF6 B;  1XGI A;  4BQM A;  3FKW A;  5FSR A;  4JPM A;  1PZP A;  3ZNY A;  3LEZ A;  2WKH A;  5KSC A;  3OZH A;  4JF6 A;  3PAG A;  2OV5 A;  1FR6 A;  4U0T A;  1CEG A;  5FQK A;  4DXC A;  3P98 A;  4E3M A;  4MBF A;  3O3V A;  1W8Y A;  1DJB A;  5CHM A;  4RYE A;  4KZ6 A;  4ZDX A;  5DF7 A;  5FQM A;  2ZC7 A;  4KEN B;  3S1Y A;  2UWX A;  2HDU A;  4OLD A;  4GN2 A;  3G4P A;  4GDB A;  1PI5 A;  1W79 A;  4PM6 A;  2RL3 A;  5A92 A;  3FZC A;  4ID4 A;  3UPN A;  4BL2 A;  1K6S A;  4GKU A;  3ZHH A;  3E2L A;  5HL1 A;  2XFS A;  3M2J A;  1SDE A;  5EVI D;  1Z6F A;  3UPO A;  4KG2 A;  1O07 A;  1XP4 A;  1YMX A;  3M2K A;  1KE0 A;  3IT9 A;  5DVA A;  3LO7 A;  3OCL A;  3SOI A;  1J9M A;  3WS0 A;  3BLS A;  3HUN A;  2EX2 A;  3Q7Z A;  2ZM8 A;  1HZO A;  4QJG A;  4JLF A;  4N9L A;  5EUA A;  2Y2H A;  4H8R A;  3W4Q A;  4PM8 A;  3UDI A;  1K56 D;  1WYB A;  1WYC A;  4E6X A;  4E3J A;  1MXO A;  3QNC A;  2XH9 A;  3G30 A;  3ZG9 B;  3ITA A;  3ZGA B;  4KQQ A;  1W7F A;  4HBU A;  3A3D A;  1PW8 A;  1IKI A;  3UE1 A;  3V39 A;  3IWO A;  5CER A;  2Y2G A;  1LL5 A;  3BFF A;  4RX2 A;  1WE4 A;  3VMA A;  1CI9 A;  2QMI A;  4XUX A;  5CXW A;  2XQZ A;  3C4P A;  3BFD A;  3NDE A;  4GZB A;  4OPY A;  1GHP A;  2JE5 A;  4LV0 A;  2V20 A;  2WYX A;  3HLE A;  1K4E A;  2BLS A;  2QZ6 A;  4FD8 A;  3ZG5 A;  4MBK A;  1NRF A;  2Y91 A;  4R1G A;  3Q7V B;  3NDG A;  4GD6 A;  3UE3 A;  3WRT A;  4E6W A;  3EQU A;  5I94 A;  5TFQ A;  5EVI C;  1JWP A;  3RXX A;  4JF4 A;  3BLM A;  4QD4 A;  3ZG8 B;  1YLW A;  1PZO A;  1JTD A;  2WKI A;  4KZ5 A;  5EVL A;  3M6B A;  1YQS A;  4OON A;  4IVI A;  5CGW A;  4M3K A;  3E2K A;  3MFD A;  1JVJ A;  3ZNT A;  4L0L A;  1GHM A;  4QY6 A;  1BLH A;  4ZJ1 A;  4HBT A;  4DE0 A;  1KDW A;  4X6T A;  1BUE A;  3HLW A;  3BRM A;  2WAE A;  1BT5 A;  5FAP A;  4EWF A;  4OQG A;  4GDN A;  2OSU A;  1K56 A;  5FDH A;  3NI9 A;  1RGZ A;  4DKI A;  1ESI A;  4QU3 A;  2JCH A;  4R4S A;  1KGG A;  5FQI A;  3SH8 A;  2FFF B;  2R9W A;  5CGX A;  4RX3 A;  3GTC A;  4ZBE A;  4OOL A;  4WYY A;  3ZVT A;  4BL3 A;  3UDX A;  1E4D A;  1JWV A;  4WEK A;  2ZLY A;  5A93 A;  2X02 A;  3PBS A;  3VP4 A;  1XPB A;  1TEM A;  3UNW A;  3NBL A;  1U60 A;  3ZFZ A;  1IEL A;  2VGJ A;  2HP6 A;  1N9B A;  1L0E A;  4DE2 A;  4KZB A;  3CZD A;  2Q9M A;  2H0T A;  5HW3 A;  1BLC A;  4MNR A;  2ZD8 A;  3N8R A;  4K0W A;  4R0Q A;  1IYO A;  2Y2O A;  3IH9 A;  4X69 A;  5CEB A;  3CJM A;  2XD5 A;  4PM5 A;  2XK1 A;  1K6R A;  4IBX A;  3PBN A;  1FQG A;  1JTG A;  1SCW A;  4IED A;  4DDY A;  1KDS A;  1QME A;  1BTL A;  3OPL A;  4S2N C;  2EX9 A;  3ISG A;  2X01 A;  1MWU A;  1S0W A;  2WGW A;  2R9X A;  5U47 A;  3PBQ A;  4WBG A;  4OOM A;  4KZ9 A;  1HTZ A;  1E25 A;  5EE8 A;  5HAI A;  4DDS A;  1G68 A;  1N4O A;  1NXY A;  2WGI A;  3Q07 A;  3GV9 A;  4S2N A;  4EQI A;  2EX6 A;  3PBT A;  2I72 A;  1MWS A;  3MBZ A;  2WUQ A;  4BD0 A;  4UA6 A;  1PIO A;  4F94 A;  3G34 A;  2VGK A;  1NY0 A;  4KZ3 A;  5M1A A;  1I2W A;  2ZQD A;  3PTE A;  4WM9 A;  1JWZ A;  1PWD A;  1ONH A;  4R23 A;  5A90 A;  1IYQ A;  2WKE A;  4JBF A;  3SS4 A;  3N7W A;  3NIA A;  1ES4 A;  3FKV A;  4S2L A;  1XGJ A;  5FAS A;  2Y2I A;  2WZZ A;  2ZC3 B;  1K54 A;  1ERQ A;  5E2H A;  2OLU A;  3IF5 A;  1BLS A;  3DW0 A;  4B4Z A;  3HUM A;  5CED A;  3UN7 A;  3EQV A;  2J7V A;  3IWQ A;  4PPR A;  1Q2P A;  1K57 C;  5FQ9 A;  4OPR A;  3N8S A;  5GLC A;  1NJ4 A;  3IXD A;  4NK3 A;  4X55 A;  4ZJ2 A;  2XEP A;  4QY5 A;  1KGF A;  1XA7 A;  3G35 A;  3O86 A;  5F83 A;  2IWD A;  3BYD A;  3IF6 C;  5M18 A;  2HPB A;  3ZDJ A;  4FH4 A;  2WGV A;  3A3I A;  1K57 A;  3N6I A;  2Y59 A;  3OCN A;  3S22 A;  5GLD A;  5GLA A;  5FAQ A;  1LLB A;  4PMA A;  4CJN A;  3IF6 A;  3G2Y A;  2Y2Q A;  1FSW A;  4P0M A;  3SH7 A;  5FI6 A;  3HUO A;  4WMC D;  2DRW A;  4HEF A;  4S2P A;  4S2M A;  4WZ4 A;  4E3N A;  1IYP A;  4Q8I A;  3VP3 A;  3WRZ A;  1HD8 A;  4E3L A;  3LCE A;  3RXW A;  1MBL A;  1M40 A;  2XD1 A;  4DE1 A;  4LV2 A;  4Y0T A;  1KGE A;  4S2I A;  5J8X A;  1NYM A;  3HLF A;  1O7E A;  2BG1 A;  1HVB A;  3AGE A;  3GVB A;  2EXB A;  3PBR A;  4B88 A;  4XXR A;  3QNB A;  4RA7 A;  2ZQ9 A;  4DE3 A;  4N92 A;  2Y2M A;  1GA9 A;  5E2G A;  3N4I A;  3QHY A;  4QB8 A;  3OPP A;  1ES3 A;  4MLL A;  4EBL A;  4Y0U A;  1EI5 A;  2ZJ9 A;  4LCL A;  2XGN A;  3P09 A;  4WEL A;  3OC2 A;  5CTN A;  2EFU A;  4JXG A;  3V3R A;  1IEM A;  1ONG A;  2Y2K A;  3GMW A;  4X56 A;  5HFO A;  1PYY A;  3JYI A;  2WK0 A;  5KMW A;  5AQ7 A;  1LL9 A;  2C6W B;  3WS5 A;  3WS1 A;  4BJP A;  3LY3 A;  1K38 A;  1ES5 A;  2DCF A;  3IXB A;  3A3J A;  4O7D A;  1PI4 A;  3GRJ A;  4EUZ A;  4K91 A;  1W8Q A;  1NZO A;  3VP1 A;  1VM1 A;  4YIN A;  4OOY A;  5KZH A;  3Q82 A;  4MEZ A;  4JXV A;  3DWZ A;  2ZM0 A;  2IWB A;  4CPK A;  3UY6 A;  3HRE A;  3UDF A;  4LV1 A;  4OVD A;  4UA9 A;  1KVL A;  2XLN A;  5DF8 A;  2B5R A;  1NZU A;  3PBO A;  4FCF A;  4C6Y A;  1RGY A;  5GLB A;  1NYY A;  4OKP A;  3MZD A;  1RCJ A;  5GHX A;  1ALQ A;  5AQB A;  4WMC A;  1GHI A;  4X68 A;  3V50 A;  2XDM A;  4JKT A;  3HLD A;  3MKE A;  1G6A A;  3Q7V A;  2ZC4 B;  5DF9 A;  5M19 A;  2XFT A;  2RCX A;  1ERM A;  2WAF A;  3MZF A;  3W4O A;  1ERO A;  1H8Z A;  1XXM A;  1BZA A;  1H5X A;  2HDR A;  2P9V B;  1PW1 A;  3G32 A;  1H8Y A;  1KVM A;  2P74 A;  1TDL A;  2ZC6 B;  3VP2 A;  4UA7 A;  5HX9 A;  1RP5 A;  4BEN A;  5CGS A;  3IXH A;  1YLZ A;  2H5S A;  4WEJ A;  1L0D A;  4N9K A;  3GQZ A;  4Z9Q A;  2EXA A;  2ZC5 B;  5A91 A;  5CEC A;  3BFG A;  4P87 A;  1GA0 A;  1CI8 A;  4PM7 A;  1KE3 A;  4RVA A;  2GDN A;  1CK3 A;  3FV7 A;  3S4X A;  3AGD A;  1MPL A;  1TDG A;  1ESU A;  5AQ9 A;  3A3F A;  3AGF A;  2ZQA A;  4ZJ3 A;  2Y4A A;  1L0G A;  1QMF A;  1XKZ A;  1DY6 A;  5DTS A;  5TR7 A;  3CG5 A;  4UAA A;  3VFF A;  4KZ7 A;  1YLJ A;  3C5A A;  4E3K A;  5FAO A;  4S2K A;  1K54 C;  3RJU A;  5E43 A;  4FSF A;  1FR1 A;  4P6B A;  4X53 A;  1M6K A;  2C5W B;  5CHJ A;  2JC7 A;  4B4X A;  3SS3 A;  3WS2 A;  5FI2 A;  1ZG4 A;  1ZC2 A;  5JYP A;  1L2S A;  1XA1 A;  2IWC A;  1PWG A;  2WZX A;  3TG9 A;  1LI0 A;  2ZMA A;  5JYO A;  5AQA A;  3NY4 A;  4KG6 A;  3UE0 A;  3IWI A;  4Y7P A;  2G2W A;  4OQH A;  2WAD A;  1K4F A;  2E8I A;  2P9V A;  1I5Q A;  5FAT A;  1DJC A;  1Y54 A;  5GHY A;  3IXG A;  2V1Z A;  4YFM A;  5D3O A;  5FQQ A;  3M6H A;  4DF6 A;  2J8Y A;  4BD1 A;  1E3U D;  4OQI A;  3D4F A;  4OH0 A;  1PWC A;  1XX2 A;  2HP9 A;  2OLV A;  1FCN A;  3FYZ A;  4HES A;  1ZKJ A;  1L0F A;  3ZG0 A;  4KG5 A;  1YLY A;  4U0X A;  4UHU A;  3MXS A;  4BLM A;  1MWR A;  3WS4 A;  3BFE A;  4R4R A;  3O88 A;  1ES2 A;  3OPR A;  2Y2L A;  4OPQ A;  2H10 A;  2XF3 A;  4R3B A;  5EVI B;  4KZ4 A;  1YM1 A;  3VP0 A;  5FI7 A;  3WWX A;  3C4O A;  3NCK A;  4E3I A;  1YLT A;  4K0X A;  5FA7 A;  3W8K A;  5KSH A;  2Z2L B;  3ZG7 B;  2Z2M B;  4WZ5 C;  2A3U A;  4LEN A;  2X71 A;  2XR0 A;  3HBR A;  5GL9 A;  1W5D A;  2A49 A;  1YMS A;  2FFY A;  3BFC A;  3MZE A;  4ZTK A;  1I2S A;  4U3T A;  3I7J A;  2PU2 A;  4KZ8 A;  4A5R A;  2ZM2 A;  4OQ0 A;  3LY4 A;  1FCO A;  4WZ5 A;  5EOE A;  3SS5 A;  3V3S A;  1BLP A;  4OLG A;  3HLB A;  5L2F A;  2HDS A;  1FCM A;  5CRF A;  5F1G A;  4NET A;  1FOF A;  4GOG A;  3UO9 A;  5HAR A;  5E2E A;  5DTT A;  1MY8 A;  1YT4 A;  3GSG A;  3BEC A;  2J9P A;  4LV3 A;  3SH9 A;  3MKF A;  5BOH A;  5GHZ A;  3VSK A;  3HLC A;  4IVK A;  1SKF A;  3Q81 A;  4S2O A;  5EOO A;  5HAQ A;  1LI9 A;  2G2U A;  1E3U A;  2Y2N A;  2EFX A;  1DJA A;  1LHY A;  4N1X A;  3VOZ A;  5CHU A;  4ZAM A;  2Q9N A;  3TSG A;  2CC1 A;  4KQO A;  3G31 A;  3IH8 A;  3ITB A;  2HDQ A;  5EEC A;  2Y2P A;  5EPH A;  1IYS A;  5E2F A;  5EVI A;  2QPN A;  5FQJ A;  3DWK A;  1VQQ A;  2WGW B;  1EWZ A;  4OP5 A;  4GNU A;  4JF5 A;  3ZVW A;  3VFH A;  4GB7 A;  5CTM A;  3TOI A;  3BEB A;  3GR2 A;  2JBF A;  3NC8 A;  4S2J A;  3G2Z A;  3VSL A;  2V2F F;  1MKI A;  1Q2Q A;  1MWT A;  2EX8 A;  3PAE A;  2J9O A;  4E3O A;  1IKG A;  1K25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...