5MC7A

Crystal structure of truncated human coatomer protein complex, subunit z1 (copz1)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
TVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Coatomer subunit zeta-1
publication title Crystal structure of truncated human coatomer protein complex subunit zeta 1 (Cop zeta 1).
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5mc7A00
2JKRI 2JKTM 4UQIM 4NEED 2XA7S 2VGLS 3TJZC 5MC7A 4UQIS 4P6ZM 2JKRM 1W63Q 4P6ZS 2JKTI 1NRJA 2FH5A 1W63M 2HF6A 2VGLM 2XA7M
chains in the Genus database with same CATH superfamily
4WUJA 4BBVA 4QY6A 4Q8IA 3L7HA 3LR4A 1LHYA 3KYEA 4NXBA 2WADA 2KOIA 1FILA 1YLPA 3G34A 4JXVA 3QP2A 3G32A 2JBFA 4N9LA 1UGUA 1K57A 1XJ2A 4XUZA 1SKOB 4E3IA 2ZQ9A 3C38A 5FEGA 1ESUA 2Z6DA 1TS8A 3BFDA 3LIFA 5DKKA 3T12B 5L2FA 1LSXA 5CHUA 5HWTA 4FOFA 5HL6A 3N8SA 4Y0OA 3FYZA 3WS2A 3R4KA 5FI6A 4HQAA 4OP5A 2BLSA 1EI5A 1PI4A 2ZQDA 1IYPA 5HD5A 2L1MA 5AJGA 4OKPA 3D9YA 3VP2A 2R78A 2EFXA 4U3TA 4O0PA 1EROA 5HAPA 5FQ9A 4GHIA 4HOIA 1KE0A 5DF7A 4LPZA 5FI2A 5E43A 3C4OA 1ES4A 4DE2A 1J9MA 1HVBA 2K31A 1MWTA 1L2SA 4S2LA 2XGNA 4UA6A 3LCEA 3F1NA 5EUAA 2EWWA 1NZOA 3A3JA 1YMXA 1NZUA 3LFVA 4E6XA 2K7SA 4OQIA 4R4SA 4M4XA 2HV1A 3SS3A 1PRQA 2FZ0A 4BBUA 2WAEA 5KIZA 4CLCD 5DJUA 1A0KA 2EFUA 4OQHA 2QZ6A 2DNSA 3DWZA 3SH7A 1OTAA 3E4OA 1GHMA 4GS9A 4BQMA 1K56A 1OTBA 4N1HA 3UB9A 4E6WA 1W63Q 3PBOA 5F1FA 2ZM8A 3VP4A 2J3TC 4ESPA 1TF1A 4EWFA 3IBJA 2VKSA 2Y2NA 1W5DA 4S2PA 1NLZA 3HUOA 1XKZA 1VEUB 1XFNA 3SW1A 4ARZA 1X0OA 2VJWA 5F82A 3IX4A 4WZ4A 2XD1A 4X68A 3K2NA 1V9YA 4MEZA 3HREA 4UAAA 2V1BA 5FDHA 4DKIA 3NIAA 1WE4A 3SZTA 1K57C 1ODVA 1LI0A 4HJ6A 4QHCA 2ZM2A 5HDCA 1IYSA 3N8LA 3IX8A 2EA9A 4HH3A 4G3WA 2KX6A 5EVID 2ZQAA 3WRTA 1OPXA 2J8YA 1IYOA 2W3DA 2A24B 1YPRA 1W8YA 3AGFA 3EGXC 2B18A 3E4PA 2ZL1B 1L0GA 3BFGA 3H82B 3IHAA 3MBZA 5FAQA 3HBRA 3IX3A 3UY6A 3M2KA 3OBFA 1K55A 4I3JA 3UE1A 2C5WB 2Q9NA 1OTEA 5KSCA 4EBLA 2XD5A 2V1ZA 2KLIA 2GNXA 2RCXA 1N9OA 4YWZA 5I94A 2WKIA 2J9PA 1OTIA 5A92A 2W3HA 3PBSA 2XF3A 2ACGA 5HDSA 2OWJA 2WKRA 4M3KA 4F3LB 3CWFA 4Y0UA 4WEKA 2XFSA 2R9XA 2FFFB 4RYEA 3C7VA 1T19A 5EVEA 1GA0A 3ZYTA 4B4ZA 3C5AA 4P87A 4L9FA 4CQHA 1P0ZA 2Y2IA 3S7OA 1G28A 3ITAA 3LUQA 1BULA 4PKYA 1H8MA 4DJ2A 3GSGA 2B5RA 4X56A 3T1QB 4BENA 1AXBA 5E2EA 2HP6A 4MN5A 5E2FA 2INWA 2P04A 1SHVA 2Z2LB 4NXGA 4XUXA 2RL3A 5EOEA 4BJPA 4PM9A 3NC8A 5A91A 4I39A 2PD7A 4EXOA 4WM9A 5CTNA 4ZBEA 5GLBA 1PZPA 2M7VA 4C6YA 2PYRA 4MBFA 5GL9A 3UO9A 2BTFP 1U60A 2P9VA 1TD5A 1OJGA 2EWVA 3HL9A 2WGIA 2XRNA 2WGVA 4QWOA 2BASA 1I2WA 4UQIS 1QMFA 4MNRA 4PMAA 5CTMA 4EERA 4JLFA 1SDEA 3HUNA 1IOUA 2VGKA 4Q0HA 1CK3A 4S2MA 2HPBA 4IBRA 4U0TA 5EM1A 3EEHA 3BW6A 4ZDXA 2H28A 1D06A 3S7NA 4LENA 1Y54A 2W27A 5FL3A 4R6LA 5CERA 2IWDA 4LRYC 3MFXA 5HAQA 3VMAA 4EESA 2D02A 1IFQA 3V3RA 4E3NA 1E3UA 4XT2B 1NXYA 2QPNA 3N6IA 1ALQA 1D1JA 2W3GA 2B02A 5EOOA 3UMEA 2XA7S 1MWSA 1CJFA 4IVKA 4WMCA 1GHIA 3FPWA 4PM5A 3CZDA 1P9RA 2ZOIA 1BYWA 3BFCA 1YAXA 3QP4A 3TE8A 1AWIA 5HX9A 3F1OB 2Y2KA 1W8QA 2P74A 3F1PA 4PPRA 3MXRA 1JVJA 3O87A 3LR3A 2K2NA 3ZVWA 3KYZA 5TR7A 3BJNA 2QHKA 1ZG4A 3BRMA 3DWKA 4OP8A 3ZFZA 4QD4A 4B88A 4RX3A 4OVDA 4LLOB 2J3WA 3B3XA 4I38A 5CHJA 5HPIA 4ME4A 1XX2A 1XGJA 1ZG6A 4QU3A 5FA7A 1F2KA 5FAOA 4KZ8A 5HPFA 2ZBBA 1KGEA 4B9OA 3HLEA 4OOYA 4LV1A 3LGOA 3P01A 4BLMA 4E3MA 1IEMA 5F68A 3K3CA 5L8MA 5AQ7A 2XDMA 1MPLA 3IS2B 4Y3IA 2VV7A 4DE0A 3CI6A 1LSWA 1N4OA 5TBMB 3M6HA 3UE0A 5A90A 5GLDA 2Y59A 3NULA 2W3FA 4GCZA 4R0QA 4PM7A 4GKUA 5TFQA 2UWXA 2VV8A 4H6JB 1Y28A 3BY9A 3RH8B 2Y55A 5MC7A 2ZJ9A 3BQAA 4IUHA 3T4TA 2DCFA 3T4QA 5AQAA 3U4LP 1IKGA 3IBRA 2WGWB 5HARA 3U2AA 4DDYA 2Y2PA 1NRJA 4EUVA 3MZEA 1YM1A 4WEJA 5GLCA 1RCJA 4L0LA 4KQQA 4ZJ2A 1K56D 3QP5A 5HL1A 4E3JA 3UB6A 5FSRA 2L4RA 2LB5A 1KVMA 3LR5A 3V3SA 2DRWA 2VEAA 1GA9A 1GHPA 4EV4A 1ERMA 2Y2JA 3GRJA 1VETA 2Z2MB 2WYXA 5DTSA 3C7UA 2QMIA 3V5MA 2OLVA 5J7EA 5JYOA 3HVFA 1M6KA 4Y2FA 2ZC3B 1IYQA 4X53A 3VP3A 4S2JA 4CJNA 2ZM0A 2OOLA 4P85A 5F83A 4QB8A 5M19A 1FSWA 4BWIA 5KMWA 1TS7A 2V20A 4JGPA 2HF6A 2EX6A 3G35A 1PW1A 3R7WA 1F9IA 2WK0A 1H5XA 3PBTA 4LCMA 1S1ZA 4JGQA 3FV7A 3FZCA 2V2FF 1HD8A 3RTYA 1ONGA 1LL8A 5CX7A 3AGDA 2V8FA 2ZC4B 2NUTC 3VOYA 3CITA 3W8KA 4B4XA 2V1AA 3G2YA 2BG1A 4FSFA 3O88A 1BT5A 2ZC7A 3W4QA 4KUOA 4Y17A 2CC1A 2W3EA 4EW7A 4R3JA 3OC2A 3OCLA 3ITBA 3ZG0A 2OAP1 5FQIA 4GJ4A 1L0FA 4DE3A 3VE3A 4DXBA 3QNCA 4U0XA 3BECA 3Q7ZA 3HLGA 1K54A 3A3IA 3VP1A 5CGXA 2V8CA 5KZHA 4S2KA 2JHEA 1H0MA 2JN7A 4C75A 1YLTA 2EX2A 1Q2PA 3P09A 3ZG8B 2W1TB 1C3BA 1YSQA 1FR6A 5TJJA 1GCEA 4Q0IA 3B33A 2YKHA 4IHQA 3DBAA 3HJIA 4GD8A 4PM6A 1BZAA 4EU0A 5M1AA 3E2KA 1ES2A 2PHYA 2PD8A 3BFEA 3MQOA 1BLHA 3QNBA 3LEZA 2PYPA 3LO7A 3M2JA 1G68A 2Z6CA 3IT9A 3RXWA 3B42A 4D2OA 3VOLA 1P97A 1JNUA 5HAIA 4F94A 4UEYA 3A3EA 4EUZA 1GSXA 4GDNA 3OLOA 3V67A 3LR0A 4L9EA 1TS6A 3VFFA 3ZNTA 3T1XA 4WF0A 4UQIM 4GHIB 1CEGA 2VGLS 4NKPA 4X25A 4X55A 2EX9A 1S1YA 4HP4A 5IHVA 5FASA 4P6BA 4R3AA 1OT9A 1K4EA 4YOFA 2X71A 5CRFA 1YQSA 3IQAA 1CF0A 2OAQ1 4II7A 5C5KA 5F6AA 3MKEA 2J9OA 1I5QA 2GX5A 4OPRA 3F1NB 2AVXA 3UPPA 1LL5A 3A3DA 5CXWA 3GTCA 4ID4A 3C8CA 1ZC2A 2R9WA 3PXPA 1LLBA 3UE6A 2D01A 1SCWA 3GECA 5F5YA 3T4SA 5EE8A 1JTDA 4LFUA 4GS9B 3W4PA 4HBTA 4YFMA 2WAFA 3V50A 3OPPA 1OMEA 5L07A 1MKIA 2ZQCA 1ES5A 4G3KA 3BLMA 1EW0A 1K54C 1KVLA 3MMHA 4P6ZS 4FUWA 4O7DA 3A0RA 3Q7VA 2OWHA 1NWZA 1W63M 3KYQA 5DTTA 4EQ1A 3D3OA 4AFIA 2XROA 4DMZA 4LRXC 3JVVA 2JKFA 1PI5A 4NETA 3PBQA 4ARZB 4K0WA 4DRTA 4K91A 1DRMA 2B95A 2WKQA 1LT0A 2DMWA 2ZD8A 5CGSA 3S22A 3MFDA 5HSQA 1KOUA 2ZQ7A 1L0EA 3UDXA 1PW8A 4K08A 3ZGAB 3E2LA 1PFLA 4HP9A 1T1BA 3KO6A 2ZLYA 3IF5A 4HEFA 4JGOA 3TJZC 4RQ9A 5DFXA 3LYXA 3MXQA 1JTGA 5HWWA 1BUEA 1XJ6A 3GR2A 5DF9A 5A8BA 2VX8A 3E0YA 4JKTA 3HCYA 4GD6A 1DJBA 2XSSA 4LV3A 5L10A 3VE4A 5IU1A 3IWIA 5CECA 3ZG9B 3ZDJA 3HLBA 2ZMVA 3Q7VB 1I2SA 1ACFA 3QP8A 1BLSA 4XXRA 4S2NC 3NJAA 1DY6A 1F98A 4GZBA 1TDLA 3H7WA 4X1MA 4MBKA 4L9GA 3IF6A 4CLCA 2ZOHA 4NEED 3L9KA 2VZWA 2PU2A 4FH2A 5CEDA 4RA7A 4ETZA 3TG9A 2A3UA 1M40A 1XGIA 3A3FA 4BMWA 1P9WA 4WYYA 4O01A 3DW0A 2IA2A 1YLJA 3MKFA 2WZZA 3FG8A 4WELA 4KQOA 2M1CA 1E4DA 4I3IA 3EGDC 1XA1A 3T4JA 1W79A 5J8XA 1PWCA 1G6AA 3O5YA 3EQVA 4OQ0A 1DP6A 5EVLA 1E25A 1PWGA 4BL2A 4LCLA 1OT6A 1MZUA 2X02A 1RP5A 5DJTA 5EVIA 4OOMA 5F1GA 4JPMA 3NOTC 4KUKA 4RX2A 3WWXA 3KX0X 1N9NA 2IWBA 1T18A 3VV4A 2J3TD 2O0YA 1YT4A 2HDQA 2WKPA 4C3QA 2OSUA 2JKGA 4BD0A 5DKLA 2P9VB 2W1RA 3ZNYA 2PR6A 4O8GA 1FCOA 1TVFA 3BLSA 3IH9A 1JWVA 3CHWP 3ISGA 3N4IA 2V9AA 1JWPA 4R70A 3ZG5A 4S2OA 5HW3A 2Y2HA 3MZDA 2P08A 1CI9A 1DP8A 2EX8A 4QPRA 4MCWA 1JWZA 2HDRA 3FPVA 1VHMA 2VV6A 3KSHA 1EWZA 3N7WA 4I5SA 1L3LA 3PTEA 2WKHA 1OJ5A 1K4FA 2Y2LA 3O3VA 3M6BA 3OZHA 3NOPC 3S1YA 3PR6A 3IF6C 4CLCC 3JYIA 2Y2OA 1SDNA 4JF6A 3CJMA 1VM1A 2Q9MA 2Y2GA 4GDBA 4PAUA 3T4OA 2Y2QA 4R23A 4N1XA 3DAVA 1Q2QA 3NBLA 1DJCA 4OPYA 2ZMFA 3T4LA 1FIKA 3G4PA 2VGJA 4HI4A 3DTKA 2ZC6B 4WZ5A 3F1PB 1XJ4A 4JF4A 5F69A 4DE1A 4IJGA 3A0VA 3HJKA 2Y4AA 1STZA 3IXDA 3RJUA 3OPRA 4E04A 1YLYA 3WRZA 3BFFA 4NG2A 3W2ZA 4MBHA 2X01A 1LL9A 3NY4A 3PAEA 1T1AA 2O9BA 4H8RA 4D60A 1K38A 1XPBA 3KSFA 1S4RA 1BTLA 2VGLM 4UA7A 2JC7A 5D3OA 4ZJ1A 2JKRI 4Q0JA 4K0XA 1UWNX 2HJ9C 3E98A 3G2ZA 3ZVTA 3ZHHA 5EVIC 5BOHA 5IS1A 3OPHA 2M7UA 4GOGA 3BWLA 2A49A 3RXXA 3BEBA 4KQRA 5IT5A 4DJ3A 1F5MA 2GJ3A 2YKFA 2UV0E 1ZTUA 1G5UA 1SKOA 2VA0A 3IHBA 3K3DA 1SZVA 4DF6A 2I72A 1XP4A 1KE3A 4DDSA 5DTKA 1ONHA 1S0WA 4GB7A 3PBRA 3GV9A 4LV0A 3BQ8A 4Z9QA 3G30A 3S7PA 2PDRA 1TEMA 2PAVP 1IELA 4UHUA 4GN2A 3BYDA 3TRCA 3NDGA 4NXFA 4P6ZM 3OCNA 2E8JA 5FI7A 5FQKA 2QKPA 1CEFA 5DF8A 1FOFA 2HGVA 5HFOA 3Q07A 3EQUA 3SS4A 3BM6A 3T1RA 3VFHA 3A0SA 4MN6A 4WN5A 5LBRA 4CPKA 3IXBA 3CLOA 1V9ZA 4FTXA 2CMNA 1VQQA 3UDFA 2FFYA 3CUEA 2I9VA 2XR0A 5CHMA 1VETB 1IKIA 4LRZE 5EPHA 2XH9A 3LI9A 3UDIA 5FATA 5CEBA 3LIEA 3KSGA 2G7UA 2WKEA 2HP5A 4WZ5C 2C6WB 3UMDA 4E3LA 4P0MA 3R7WB 3PAGA 3CPTA 3MS6A 3LY3A 2Q0OA 4WBGA 4OLDA 4HY8A 4KZAA 2NUPC 4OPQA 1ERQA 1H8ZA 2QJ7A 3C30A 2H0TA 1FR1A 5JYPA 4ZRRA 2O99A 4BD1A 1KE4A 1VEUA 3CG5A 2JKTI 4R4RA 1LI9A 3EOIA 3C4PA 1PZOA 3LEQA 4E3KA 1PIOA 2HJEA 1K0KA 3W4OA 4KG6A 5FQQA 2Y79A 3UPNA 5FEFA 4Y7PA 1MWRA 4ZTKA 4HNBA 5EECA 2O9AA 4OQGA 3FKVA 5G4YA 1GSWA 2Y2MA 5CGWA 1Y4OA 2XFTA 4S2NA 4DXCA 4Z1WA 2A24A 4Y13A 3MZFA 3CPTB 4I3AA 3SH9A 2A2LA 4G3VA 1XFQA 4Y5FA 5FQMA 3KSIA 4EEUA 4R38A 3TW8A 3S7QA 5M18A 2H5SA 2ZL1A 4KZ7A 3NCKA 2VK3A 3MJQA 3H82A 5GHYA 1PNEA 5I5LA 2XLNA 1CI8A 1NYMA 1N9BA 1YSPA 4JXWA 1H8YA 3AGEA 5HDDA 4EETB 2VLGA 4LGWA 1XJ3A 3OPLA 5AVFA 1KDSA 2XA7M 1VB6A 2G2UA 2O9CA 3LI8A 3LY4A 3CUEC 3UB7A 4F3LA 1DJAA 1H3QA 3VSLA 2V0UA 3LIDA 5AVEA 4OOLA 1MWUA 1XXMA 1L0DA 2H10A 1WYBA 3WS4A 5EV0A 3UPOA 3ZCZA 1E3UD 3GVBA 2HDUA 3D72A 5J3WA 3DTMA 3I7JA 4HHDA 1XA7A 3FC7A 3MSHA 4KZ5A 3CMZA 2ZMAA 4WMCD 2EXBA 4ZAMA 4HBUA 2GZAA 3H9WA 4S2IA 4MN7A 1J3WA 4DN0A 3ICYA 3V39A 2XK1A 4CLCE 4GLQA 4ETXA 5K5BA 1ESIA 5GHXA 4IUKA 2HZ5A 3MQQA 4LV2A 4JXSA 4JBFA 4NK3A 4EEPA 5KSHA 1BSGA 3BY8A 2J80A 1KGGA 3JPUA 5AQBA 3IWOA 4KQDA 1WYCA 1WA9A 3SOIA 2WUQA 4X6TA 3T4KA 2WZXA 5HZHA 3HLWA 4IBXA 1K25A 5G4ZA 3IXHA 3S4XA 1OTDA 1ZKJA 3SH8A 2XEPA 3HUMA 3Q1FA 3LIBA 3MXSA 5DFYA 4WLAA 2EXAA 1TDGA 4BBTA 1ZHHB 5EFWA 1MY8A 1MBLA 4WL9A 1ES3A 5FQJA 3UE3A 3E4QA 3O86A 2JKRM 3DTIA 4YNRA 1W7FA 4R1GA 4E3OA 1DP9A 4KZBA 4ZJ3A 5DVAA 1NJ4A 1YLWA 3VSKA 4FH4A 2ZQ8A 4XT2A 3NI9A 4KZ9A 5GLAA 2V0WA 3QHYA 3ULFA 2E8IA 3NHQA 1S67L 3JVUA 1YLZA 4KZ6A 1CQAA 2P7JA 4IEDA 4R3BA 3C2WA 3EWKA 4GNUA 4KG5A 2HDSA 4HIAA 1FCMA 3F1OA 1RGZA 4Y0TA 4KZ4A 5E2HA 3WS0A 4OH0A 3B47A 3H7WB 5FAPA 4MLLA 4HH2A 3TSGA 3IF6B 4CLCB 3P98A 1SKFA 3PYPA 4PM8A 2ZC5B 3LIAA 3DTEA 3Q82A 5AQ9A 2PBYA 1MXOA 3PBNA 3IH8A 2PU4A 2PBDP 1K6RA 3CAXA 1K55C 3ZQ5A 3NECA 4N92A 1S66L 1HZOA 3QP6A 1QMEA 2PRFA 1N9LA 4OPZA 5HD3A 3UNWA 3UB5P 2J7VA 2PR5A 1O7EA 2OLUA 1Z09A 3GQZA 2W0NA 3QP1A 1PYYA 4NXEA 3IS2A 2LB9A 2G2WA 1FCNA 4FCFA 2Y8HA 5TBMA 4Y15A 3N8RA 1K6SA 3GDIA 3IXGA 4H6JA 1FQGA 1KGFA 5HWVA 5EVIB 4IVIA 3IWQA 4HESA 4KENB 2QJ5A 1BLCA 2WGWA 1LSVA 2JCHA 4JF5A 4BL3A 3VOZA 4JGRA 2JKTM 4EBPA 2XQZA 1HLUP 3FKWA 3NOUC 4PHTA 4UA9A 2QYBA 3UN7A 2L0WA 5L09A 2PT7A 1T1CA 1D7EA 1UWPX 4KG2A 4OONA 3OOVA 1O07A 4GW9A 1MKMA 5J4EA 4FD8A 3HLCA 5G18A 3T1SA 1NLYA 4JXGA 2KDKA 2FH5A 1PWDA 4B93A 1TS0A 1Z6FA 3ZG7B 4X1LA 5EM0A 3UB8A 2GDNA 3PHYA 1NY0A 3WS5A 3G6OA 3P7NA 1BLPA 3GMWA 4HJ4A 4EQIA 4KZ3A 3Q81A 3SS5A 4QJGA 3FWLA 5A93A 3TOIA 1S6RA 2IWCA 1NRFA 2H0YA 2Y91A 1S4SA 3EEAA 5TGFA 4N9KA 3RFBA 3LICA 2QWSA 2JE5A 3VP0A 3WS1A 2HP9A 4PKYG 1GSVA 3HLDA 4RVAA 2OV5A 1HTZA 4MDZA 4QY5A 3T50A 4MMNA 3MF0A 1YMSA 4HJ3A 3MQ0A 4X69A 3MR0A 3NDEA 1YKDA 1FSYA 4OLGA 5E2GA 1MC0A 4EBNA 2MJ6A 3D4FA 1RGYA 4A5RA 5U47A 1G6OA 5FDSA 3G31A 1NYYA 3HLFA 4YINA 5GHZA 1KDWA 2W1TA
chains in the Genus database with same CATH topology
4WUJA 4BBVA 4CLCA 3LR4A 2ZOHA 4NEED 4I38A 5I5LA 5HPIA 4NXBA 4ME4A 2VZWA 2KOIA 1YSPA 4ETZA 5HPFA 1UGUA 5HDDA 2ZBBA 4EETB 2VLGA 4B9OA 1XJ3A 1XJ2A 3P01A 4BMWA 5AVFA 1P9WA 3C38A 2XA7M 4O01A 2Z6DA 1VB6A 1TS8A 2IA2A 2O9CA 5F68A 3LI8A 3K3CA 5L8MA 3LIFA 5DKKA 3CUEC 3UB7A 4F3LA 1LSXA 1H3QA 5HWTA 3FG8A 2V0UA 3LIDA 4WELA 3IS2B 4KQOA 4Y3IA 2VV7A 4FOFA 5HL6A 5AVEA 4OOLA 2M1CA 4I3IA 3CI6A 1LSWA 3EGDC 5TBMB 3R4KA 3T4JA 4HQAA 3D72A 5J3WA 2W3FA 4HHDA 5HD5A 4GCZA 3O5YA 2L1MA 5AJGA 3FC7A 3EQVA 2VV8A 2R78A 4H6JB 1Y28A 3BY9A 1DP6A 3RH8B 4O0PA 5MC7A 3BQAA 4IUHA 3T4TA 4GHIA 3T4QA 2GZAA 3H9WA 4HOIA 4LPZA 3IBRA 1OT6A 4MN7A 1MZUA 4DN0A 3ICYA 3U2AA 1NRJA 4CLCE 4GLQA 5DJTA 4ETXA 5K5BA 4EUVA 4OOMA 4WEJA 3NOTC 4IUKA 3MQQA 4KUKA 2K31A 3KX0X 1N9NA 1T18A 3VV4A 4EEPA 4L0LA 5KSHA 2J3TD 2O0YA 2WKPA 3UB6A 3F1NA 3BY8A 2L4RA 2EWWA 2LB5A 2J80A 3LR5A 5DKLA 2W1RA 3LFVA 4KQDA 1WA9A 2K7SA 2VEAA 4M4XA 2HV1A 2PR6A 2FZ0A 4O8GA 4BBUA 3T4KA 5KIZA 4CLCD 5DJUA 5HZHA 5J7EA 5G4ZA 4Y2FA 1OTAA 3E4OA 4GS9A 2V9AA 4R70A 1OTDA 1OTBA 3UB9A 2P08A 1DP8A 1W63Q 2OOLA 3PBOA 4QPRA 4MCWA 3LIBA 2J3TC 5DFYA 4BWIA 4WLAA 1TF1A 3FPVA 4BBTA 1VHMA 1TS7A 1ZHHB 2HF6A 2VV6A 3KSHA 3IBJA 4JGPA 3R7WA 1F9IA 2VKSA 5EFWA 4I5SA 1NLZA 3PBTA 4WL9A 1OJ5A 3UE3A 1S1ZA 3E4QA 4JGQA 1XFNA 3SW1A 2JKRM 3NOPC 4ARZA 1X0OA 3PR6A 2VJWA 3RTYA 4YNRA 4CLCC 1LL8A 5CX7A 1DP9A 2NUTC 3CITA 2V1AA 4FSFA 3K2NA 4PAUA 3T4OA 1V9YA 4XT2A 2V1BA 4KUOA 2V0WA 2W3EA 3ULFA 2ZMFA 3NHQA 4EW7A 1ODVA 3T4LA 1S67L 3JVUA 4HJ6A 5HDCA 3OC2A 3OCLA 2OAP1 2P7JA 2EA9A 4HH3A 4G3WA 2KX6A 4HI4A 4GJ4A 1OPXA 3VE3A 3F1PB 1XJ4A 2W3DA 5F69A 2A24B 3C2WA 4IJGA 3EWKA 3A0VA 3HJKA 1STZA 4HIAA 3F1OA 2JHEA 4E04A 3EGXC 2B18A 2JN7A 3E4PA 3W2ZA 3B47A 1T1AA 2O9BA 3H7WB 4HH2A 3H82B 3KSFA 2W1TB 4CLCB 1YSQA 5TJJA 1S4RA 3PYPA 3OBFA 2VGLM 4Q0IA 3LIAA 4I3JA 3B33A 2JKRI 2YKHA 4Q0JA 4IHQA 1OTEA 3DBAA 3HJIA 1UWNX 2HJ9C 3PBNA 3E98A 2KLIA 4EU0A 2GNXA 5IS1A 3CAXA 1N9OA 3ZQ5A 2M7UA 2PHYA 2PD8A 4YWZA 3BWLA 1S66L 3MQOA 1OTIA 2W3HA 1N9LA 3PBSA 4DJ3A 5IT5A 1F5MA 2GJ3A 5HDSA 2OWJA 2PYPA 2WKRA 5HD3A 2YKFA 4F3LB 3CWFA 1ZTUA 2Z6CA 4WEKA 2PR5A 2VA0A 3K3DA 3B42A 3VOLA 1T19A 1P97A 1JNUA 3ZYTA 2W0NA 4NXEA 4UEYA 3IS2A 2LB9A 4L9FA 4CQHA 1GSXA 1P0ZA 3PBRA 3S7OA 3OLOA 3V67A 2Y8HA 1G28A 3LR0A 3BQ8A 5TBMA 4L9EA 1TS6A 4WF0A 3LUQA 4UQIM 4GHIB 4PKYA 1H8MA 2VGLS 3S7PA 4DJ2A 4NKPA 2PDRA 3GDIA 3TRCA 4NXFA 4P6ZM 1S1YA 3OCNA 4H6JA 4HP4A 4MN5A 2INWA 5HWVA 2QKPA 4R3AA 1OT9A 4YOFA 2P04A 2QJ5A 1LSVA 2HGVA 2OAQ1 4II7A 4NXGA 5C5KA 5F6AA 4JGRA 2JKTM 3EQUA 4BJPA 2GX5A 3F1NB 3A0SA 4MN6A 4WN5A 5LBRA 4I39A 3NOUC 2PD7A 4EXOA 3C8CA 3CLOA 4PHTA 1V9ZA 2CMNA 2QYBA 2M7VA 3PXPA 3CUEA 2I9VA 3UE6A 2D01A 2L0WA 2PYRA 3GECA 4LRZE 5F5YA 3T4SA 2PT7A 1T1CA 1TD5A 3LI9A 1OJGA 1D7EA 2EWVA 4GS9B 1UWPX 2XRNA 3OOVA 3LIEA 3KSGA 2BASA 4G3KA 2G7UA 4UQIS 4GW9A 1MKMA 5J4EA 4EERA 3UMDA 1EW0A 3MMHA 4P6ZS 1IOUA 1NLYA 3A0RA 3R7WB 2OWHA 4Q0HA 1NWZA 2KDKA 2FH5A 4B93A 1W63M 1TS0A 3KYQA 4HY8A 3D3OA 4AFIA 4EQ1A 2XROA 3EEHA 2NUPC 4DMZA 3BW6A 4LRXC 3JVVA 2QJ7A 2H28A 1D06A 3S7NA 3PBQA 3UB8A 4ARZB 3PHYA 3C30A 2W27A 5FL3A 4R6LA 1DRMA 2WKQA 1LT0A 3G6OA 3MFXA 3P7NA 4LRYC 2DMWA 4HJ4A 4ZRRA 4EESA 2O99A 2D02A 5HSQA 1KOUA 1IFQA 4K08A 2JKTI 4XT2B 4HP9A 3EOIA 2W3GA 2B02A 1T1BA 3KO6A 3UMEA 2HJEA 2XA7S 4JGOA 3TJZC 1S4SA 3EEAA 4RQ9A 5DFXA 3RFBA 2Y79A 3LYXA 3LICA 3FPWA 3MXQA 2QWSA 5HWWA 1P9RA 1XJ6A 4PKYG 2ZOIA 5DF9A 1BYWA 4HNBA 1GSVA 5A8BA 1YAXA 2O9AA 2VX8A 5G4YA 4MDZA 3TE8A 3T50A 3E0YA 4MMNA 3HCYA 1GSWA 3MF0A 3F1OB 2XSSA 4HJ3A 3MQ0A 3VE4A 3MR0A 3F1PA 5IU1A 4Z1WA 2A24A 3LR3A 1YKDA 2K2NA 2ZMVA 3KYZA 3BJNA 4I3AA 1MC0A 2A2LA 2QHKA 4G3VA 1XFQA 4Y5FA 2MJ6A 3KSIA 3NJAA 4EEUA 4R38A 3TW8A 1G6OA 1F98A 3S7QA 4LLOB 3H7WA 3MJQA 2J3WA 3H82A 4L9GA 2W1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKR I;  2JKT M;  4UQI M;  4NEE D;  2XA7 S;  2VGL S;  3TJZ C;  5MC7 A;  4UQI S;  4P6Z M;  2JKR M;  1W63 Q;  4P6Z S;  2JKT I;  1NRJ A;  2FH5 A;  1W63 M;  2HF6 A;  2VGL M;  2XA7 M; 
#chains in the Genus database with same CATH topology
 4WUJ A;  4BBV A;  4QY6 A;  4Q8I A;  3L7H A;  3LR4 A;  1LHY A;  3KYE A;  4NXB A;  2WAD A;  2KOI A;  1FIL A;  1YLP A;  3G34 A;  4JXV A;  3QP2 A;  3G32 A;  2JBF A;  4N9L A;  1UGU A;  1K57 A;  1XJ2 A;  4XUZ A;  1SKO B;  4E3I A;  2ZQ9 A;  3C38 A;  5FEG A;  1ESU A;  2Z6D A;  1TS8 A;  3BFD A;  3LIF A;  5DKK A;  3T12 B;  5L2F A;  1LSX A;  5CHU A;  5HWT A;  4FOF A;  5HL6 A;  3N8S A;  4Y0O A;  3FYZ A;  3WS2 A;  3R4K A;  5FI6 A;  4HQA A;  4OP5 A;  2BLS A;  1EI5 A;  1PI4 A;  2ZQD A;  1IYP A;  5HD5 A;  2L1M A;  5AJG A;  4OKP A;  3D9Y A;  3VP2 A;  2R78 A;  2EFX A;  4U3T A;  4O0P A;  1ERO A;  5HAP A;  5FQ9 A;  4GHI A;  4HOI A;  1KE0 A;  5DF7 A;  4LPZ A;  5FI2 A;  5E43 A;  3C4O A;  1ES4 A;  4DE2 A;  1J9M A;  1HVB A;  2K31 A;  1MWT A;  1L2S A;  4S2L A;  2XGN A;  4UA6 A;  3LCE A;  3F1N A;  5EUA A;  2EWW A;  1NZO A;  3A3J A;  1YMX A;  1NZU A;  3LFV A;  4E6X A;  2K7S A;  4OQI A;  4R4S A;  4M4X A;  2HV1 A;  3SS3 A;  1PRQ A;  2FZ0 A;  4BBU A;  2WAE A;  5KIZ A;  4CLC D;  5DJU A;  1A0K A;  2EFU A;  4OQH A;  2QZ6 A;  2DNS A;  3DWZ A;  3SH7 A;  1OTA A;  3E4O A;  1GHM A;  4GS9 A;  4BQM A;  1K56 A;  1OTB A;  4N1H A;  3UB9 A;  4E6W A;  1W63 Q;  3PBO A;  5F1F A;  2ZM8 A;  3VP4 A;  2J3T C;  4ESP A;  1TF1 A;  4EWF A;  3IBJ A;  2VKS A;  2Y2N A;  1W5D A;  4S2P A;  1NLZ A;  3HUO A;  1XKZ A;  1VEU B;  1XFN A;  3SW1 A;  4ARZ A;  1X0O A;  2VJW A;  5F82 A;  3IX4 A;  4WZ4 A;  2XD1 A;  4X68 A;  3K2N A;  1V9Y A;  4MEZ A;  3HRE A;  4UAA A;  2V1B A;  5FDH A;  4DKI A;  3NIA A;  1WE4 A;  3SZT A;  1K57 C;  1ODV A;  1LI0 A;  4HJ6 A;  4QHC A;  2ZM2 A;  5HDC A;  1IYS A;  3N8L A;  3IX8 A;  2EA9 A;  4HH3 A;  4G3W A;  2KX6 A;  5EVI D;  2ZQA A;  3WRT A;  1OPX A;  2J8Y A;  1IYO A;  2W3D A;  2A24 B;  1YPR A;  1W8Y A;  3AGF A;  3EGX C;  2B18 A;  3E4P A;  2ZL1 B;  1L0G A;  3BFG A;  3H82 B;  3IHA A;  3MBZ A;  5FAQ A;  3HBR A;  3IX3 A;  3UY6 A;  3M2K A;  3OBF A;  1K55 A;  4I3J A;  3UE1 A;  2C5W B;  2Q9N A;  1OTE A;  5KSC A;  4EBL A;  2XD5 A;  2V1Z A;  2KLI A;  2GNX A;  2RCX A;  1N9O A;  4YWZ A;  5I94 A;  2WKI A;  2J9P A;  1OTI A;  5A92 A;  2W3H A;  3PBS A;  2XF3 A;  2ACG A;  5HDS A;  2OWJ A;  2WKR A;  4M3K A;  4F3L B;  3CWF A;  4Y0U A;  4WEK A;  2XFS A;  2R9X A;  2FFF B;  4RYE A;  3C7V A;  1T19 A;  5EVE A;  1GA0 A;  3ZYT A;  4B4Z A;  3C5A A;  4P87 A;  4L9F A;  4CQH A;  1P0Z A;  2Y2I A;  3S7O A;  1G28 A;  3ITA A;  3LUQ A;  1BUL A;  4PKY A;  1H8M A;  4DJ2 A;  3GSG A;  2B5R A;  4X56 A;  3T1Q B;  4BEN A;  1AXB A;  5E2E A;  2HP6 A;  4MN5 A;  5E2F A;  2INW A;  2P04 A;  1SHV A;  2Z2L B;  4NXG A;  4XUX A;  2RL3 A;  5EOE A;  4BJP A;  4PM9 A;  3NC8 A;  5A91 A;  4I39 A;  2PD7 A;  4EXO A;  4WM9 A;  5CTN A;  4ZBE A;  5GLB A;  1PZP A;  2M7V A;  4C6Y A;  2PYR A;  4MBF A;  5GL9 A;  3UO9 A;  2BTF P;  1U60 A;  2P9V A;  1TD5 A;  1OJG A;  2EWV A;  3HL9 A;  2WGI A;  2XRN A;  2WGV A;  4QWO A;  2BAS A;  1I2W A;  4UQI S;  1QMF A;  4MNR A;  4PMA A;  5CTM A;  4EER A;  4JLF A;  1SDE A;  3HUN A;  1IOU A;  2VGK A;  4Q0H A;  1CK3 A;  4S2M A;  2HPB A;  4IBR A;  4U0T A;  5EM1 A;  3EEH A;  3BW6 A;  4ZDX A;  2H28 A;  1D06 A;  3S7N A;  4LEN A;  1Y54 A;  2W27 A;  5FL3 A;  4R6L A;  5CER A;  2IWD A;  4LRY C;  3MFX A;  5HAQ A;  3VMA A;  4EES A;  2D02 A;  1IFQ A;  3V3R A;  4E3N A;  1E3U A;  4XT2 B;  1NXY A;  2QPN A;  3N6I A;  1ALQ A;  1D1J A;  2W3G A;  2B02 A;  5EOO A;  3UME A;  2XA7 S;  1MWS A;  1CJF A;  4IVK A;  4WMC A;  1GHI A;  3FPW A;  4PM5 A;  3CZD A;  1P9R A;  2ZOI A;  1BYW A;  3BFC A;  1YAX A;  3QP4 A;  3TE8 A;  1AWI A;  5HX9 A;  3F1O B;  2Y2K A;  1W8Q A;  2P74 A;  3F1P A;  4PPR A;  3MXR A;  1JVJ A;  3O87 A;  3LR3 A;  2K2N A;  3ZVW A;  3KYZ A;  5TR7 A;  3BJN A;  2QHK A;  1ZG4 A;  3BRM A;  3DWK A;  4OP8 A;  3ZFZ A;  4QD4 A;  4B88 A;  4RX3 A;  4OVD A;  4LLO B;  2J3W A;  3B3X A;  4I38 A;  5CHJ A;  5HPI A;  4ME4 A;  1XX2 A;  1XGJ A;  1ZG6 A;  4QU3 A;  5FA7 A;  1F2K A;  5FAO A;  4KZ8 A;  5HPF A;  2ZBB A;  1KGE A;  4B9O A;  3HLE A;  4OOY A;  4LV1 A;  3LGO A;  3P01 A;  4BLM A;  4E3M A;  1IEM A;  5F68 A;  3K3C A;  5L8M A;  5AQ7 A;  2XDM A;  1MPL A;  3IS2 B;  4Y3I A;  2VV7 A;  4DE0 A;  3CI6 A;  1LSW A;  1N4O A;  5TBM B;  3M6H A;  3UE0 A;  5A90 A;  5GLD A;  2Y59 A;  3NUL A;  2W3F A;  4GCZ A;  4R0Q A;  4PM7 A;  4GKU A;  5TFQ A;  2UWX A;  2VV8 A;  4H6J B;  1Y28 A;  3BY9 A;  3RH8 B;  2Y55 A;  5MC7 A;  2ZJ9 A;  3BQA A;  4IUH A;  3T4T A;  2DCF A;  3T4Q A;  5AQA A;  3U4L P;  1IKG A;  3IBR A;  2WGW B;  5HAR A;  3U2A A;  4DDY A;  2Y2P A;  1NRJ A;  4EUV A;  3MZE A;  1YM1 A;  4WEJ A;  5GLC A;  1RCJ A;  4L0L A;  4KQQ A;  4ZJ2 A;  1K56 D;  3QP5 A;  5HL1 A;  4E3J A;  3UB6 A;  5FSR A;  2L4R A;  2LB5 A;  1KVM A;  3LR5 A;  3V3S A;  2DRW A;  2VEA A;  1GA9 A;  1GHP A;  4EV4 A;  1ERM A;  2Y2J A;  3GRJ A;  1VET A;  2Z2M B;  2WYX A;  5DTS A;  3C7U A;  2QMI A;  3V5M A;  2OLV A;  5J7E A;  5JYO A;  3HVF A;  1M6K A;  4Y2F A;  2ZC3 B;  1IYQ A;  4X53 A;  3VP3 A;  4S2J A;  4CJN A;  2ZM0 A;  2OOL A;  4P85 A;  5F83 A;  4QB8 A;  5M19 A;  1FSW A;  4BWI A;  5KMW A;  1TS7 A;  2V20 A;  4JGP A;  2HF6 A;  2EX6 A;  3G35 A;  1PW1 A;  3R7W A;  1F9I A;  2WK0 A;  1H5X A;  3PBT A;  4LCM A;  1S1Z A;  4JGQ A;  3FV7 A;  3FZC A;  2V2F F;  1HD8 A;  3RTY A;  1ONG A;  1LL8 A;  5CX7 A;  3AGD A;  2V8F A;  2ZC4 B;  2NUT C;  3VOY A;  3CIT A;  3W8K A;  4B4X A;  2V1A A;  3G2Y A;  2BG1 A;  4FSF A;  3O88 A;  1BT5 A;  2ZC7 A;  3W4Q A;  4KUO A;  4Y17 A;  2CC1 A;  2W3E A;  4EW7 A;  4R3J A;  3OC2 A;  3OCL A;  3ITB A;  3ZG0 A;  2OAP 1;  5FQI A;  4GJ4 A;  1L0F A;  4DE3 A;  3VE3 A;  4DXB A;  3QNC A;  4U0X A;  3BEC A;  3Q7Z A;  3HLG A;  1K54 A;  3A3I A;  3VP1 A;  5CGX A;  2V8C A;  5KZH A;  4S2K A;  2JHE A;  1H0M A;  2JN7 A;  4C75 A;  1YLT A;  2EX2 A;  1Q2P A;  3P09 A;  3ZG8 B;  2W1T B;  1C3B A;  1YSQ A;  1FR6 A;  5TJJ A;  1GCE A;  4Q0I A;  3B33 A;  2YKH A;  4IHQ A;  3DBA A;  3HJI A;  4GD8 A;  4PM6 A;  1BZA A;  4EU0 A;  5M1A A;  3E2K A;  1ES2 A;  2PHY A;  2PD8 A;  3BFE A;  3MQO A;  1BLH A;  3QNB A;  3LEZ A;  2PYP A;  3LO7 A;  3M2J A;  1G68 A;  2Z6C A;  3IT9 A;  3RXW A;  3B42 A;  4D2O A;  3VOL A;  1P97 A;  1JNU A;  5HAI A;  4F94 A;  4UEY A;  3A3E A;  4EUZ A;  1GSX A;  4GDN A;  3OLO A;  3V67 A;  3LR0 A;  4L9E A;  1TS6 A;  3VFF A;  3ZNT A;  3T1X A;  4WF0 A;  4UQI M;  4GHI B;  1CEG A;  2VGL S;  4NKP A;  4X25 A;  4X55 A;  2EX9 A;  1S1Y A;  4HP4 A;  5IHV A;  5FAS A;  4P6B A;  4R3A A;  1OT9 A;  1K4E A;  4YOF A;  2X71 A;  5CRF A;  1YQS A;  3IQA A;  1CF0 A;  2OAQ 1;  4II7 A;  5C5K A;  5F6A A;  3MKE A;  2J9O A;  1I5Q A;  2GX5 A;  4OPR A;  3F1N B;  2AVX A;  3UPP A;  1LL5 A;  3A3D A;  5CXW A;  3GTC A;  4ID4 A;  3C8C A;  1ZC2 A;  2R9W A;  3PXP A;  1LLB A;  3UE6 A;  2D01 A;  1SCW A;  3GEC A;  5F5Y A;  3T4S A;  5EE8 A;  1JTD A;  4LFU A;  4GS9 B;  3W4P A;  4HBT A;  4YFM A;  2WAF A;  3V50 A;  3OPP A;  1OME A;  5L07 A;  1MKI A;  2ZQC A;  1ES5 A;  4G3K A;  3BLM A;  1EW0 A;  1K54 C;  1KVL A;  3MMH A;  4P6Z S;  4FUW A;  4O7D A;  3A0R A;  3Q7V A;  2OWH A;  1NWZ A;  1W63 M;  3KYQ A;  5DTT A;  4EQ1 A;  3D3O A;  4AFI A;  2XRO A;  4DMZ A;  4LRX C;  3JVV A;  2JKF A;  1PI5 A;  4NET A;  3PBQ A;  4ARZ B;  4K0W A;  4DRT A;  4K91 A;  1DRM A;  2B95 A;  2WKQ A;  1LT0 A;  2DMW A;  2ZD8 A;  5CGS A;  3S22 A;  3MFD A;  5HSQ A;  1KOU A;  2ZQ7 A;  1L0E A;  3UDX A;  1PW8 A;  4K08 A;  3ZGA B;  3E2L A;  1PFL A;  4HP9 A;  1T1B A;  3KO6 A;  2ZLY A;  3IF5 A;  4HEF A;  4JGO A;  3TJZ C;  4RQ9 A;  5DFX A;  3LYX A;  3MXQ A;  1JTG A;  5HWW A;  1BUE A;  1XJ6 A;  3GR2 A;  5DF9 A;  5A8B A;  2VX8 A;  3E0Y A;  4JKT A;  3HCY A;  4GD6 A;  1DJB A;  2XSS A;  4LV3 A;  5L10 A;  3VE4 A;  5IU1 A;  3IWI A;  5CEC A;  3ZG9 B;  3ZDJ A;  3HLB A;  2ZMV A;  3Q7V B;  1I2S A;  1ACF A;  3QP8 A;  1BLS A;  4XXR A;  4S2N C;  3NJA A;  1DY6 A;  1F98 A;  4GZB A;  1TDL A;  3H7W A;  4X1M A;  4MBK A;  4L9G A;  3IF6 A;  4CLC A;  2ZOH A;  4NEE D;  3L9K A;  2VZW A;  2PU2 A;  4FH2 A;  5CED A;  4RA7 A;  4ETZ A;  3TG9 A;  2A3U A;  1M40 A;  1XGI A;  3A3F A;  4BMW A;  1P9W A;  4WYY A;  4O01 A;  3DW0 A;  2IA2 A;  1YLJ A;  3MKF A;  2WZZ A;  3FG8 A;  4WEL A;  4KQO A;  2M1C A;  1E4D A;  4I3I A;  3EGD C;  1XA1 A;  3T4J A;  1W79 A;  5J8X A;  1PWC A;  1G6A A;  3O5Y A;  3EQV A;  4OQ0 A;  1DP6 A;  5EVL A;  1E25 A;  1PWG A;  4BL2 A;  4LCL A;  1OT6 A;  1MZU A;  2X02 A;  1RP5 A;  5DJT A;  5EVI A;  4OOM A;  5F1G A;  4JPM A;  3NOT C;  4KUK A;  4RX2 A;  3WWX A;  3KX0 X;  1N9N A;  2IWB A;  1T18 A;  3VV4 A;  2J3T D;  2O0Y A;  1YT4 A;  2HDQ A;  2WKP A;  4C3Q A;  2OSU A;  2JKG A;  4BD0 A;  5DKL A;  2P9V B;  2W1R A;  3ZNY A;  2PR6 A;  4O8G A;  1FCO A;  1TVF A;  3BLS A;  3IH9 A;  1JWV A;  3CHW P;  3ISG A;  3N4I A;  2V9A A;  1JWP A;  4R70 A;  3ZG5 A;  4S2O A;  5HW3 A;  2Y2H A;  3MZD A;  2P08 A;  1CI9 A;  1DP8 A;  2EX8 A;  4QPR A;  4MCW A;  1JWZ A;  2HDR A;  3FPV A;  1VHM A;  2VV6 A;  3KSH A;  1EWZ A;  3N7W A;  4I5S A;  1L3L A;  3PTE A;  2WKH A;  1OJ5 A;  1K4F A;  2Y2L A;  3O3V A;  3M6B A;  3OZH A;  3NOP C;  3S1Y A;  3PR6 A;  3IF6 C;  4CLC C;  3JYI A;  2Y2O A;  1SDN A;  4JF6 A;  3CJM A;  1VM1 A;  2Q9M A;  2Y2G A;  4GDB A;  4PAU A;  3T4O A;  2Y2Q A;  4R23 A;  4N1X A;  3DAV A;  1Q2Q A;  3NBL A;  1DJC A;  4OPY A;  2ZMF A;  3T4L A;  1FIK A;  3G4P A;  2VGJ A;  4HI4 A;  3DTK A;  2ZC6 B;  4WZ5 A;  3F1P B;  1XJ4 A;  4JF4 A;  5F69 A;  4DE1 A;  4IJG A;  3A0V A;  3HJK A;  2Y4A A;  1STZ A;  3IXD A;  3RJU A;  3OPR A;  4E04 A;  1YLY A;  3WRZ A;  3BFF A;  4NG2 A;  3W2Z A;  4MBH A;  2X01 A;  1LL9 A;  3NY4 A;  3PAE A;  1T1A A;  2O9B A;  4H8R A;  4D60 A;  1K38 A;  1XPB A;  3KSF A;  1S4R A;  1BTL A;  2VGL M;  4UA7 A;  2JC7 A;  5D3O A;  4ZJ1 A;  2JKR I;  4Q0J A;  4K0X A;  1UWN X;  2HJ9 C;  3E98 A;  3G2Z A;  3ZVT A;  3ZHH A;  5EVI C;  5BOH A;  5IS1 A;  3OPH A;  2M7U A;  4GOG A;  3BWL A;  2A49 A;  3RXX A;  3BEB A;  4KQR A;  5IT5 A;  4DJ3 A;  1F5M A;  2GJ3 A;  2YKF A;  2UV0 E;  1ZTU A;  1G5U A;  1SKO A;  2VA0 A;  3IHB A;  3K3D A;  1SZV A;  4DF6 A;  2I72 A;  1XP4 A;  1KE3 A;  4DDS A;  5DTK A;  1ONH A;  1S0W A;  4GB7 A;  3PBR A;  3GV9 A;  4LV0 A;  3BQ8 A;  4Z9Q A;  3G30 A;  3S7P A;  2PDR A;  1TEM A;  2PAV P;  1IEL A;  4UHU A;  4GN2 A;  3BYD A;  3TRC A;  3NDG A;  4NXF A;  4P6Z M;  3OCN A;  2E8J A;  5FI7 A;  5FQK A;  2QKP A;  1CEF A;  5DF8 A;  1FOF A;  2HGV A;  5HFO A;  3Q07 A;  3EQU A;  3SS4 A;  3BM6 A;  3T1R A;  3VFH A;  3A0S A;  4MN6 A;  4WN5 A;  5LBR A;  4CPK A;  3IXB A;  3CLO A;  1V9Z A;  4FTX A;  2CMN A;  1VQQ A;  3UDF A;  2FFY A;  3CUE A;  2I9V A;  2XR0 A;  5CHM A;  1VET B;  1IKI A;  4LRZ E;  5EPH A;  2XH9 A;  3LI9 A;  3UDI A;  5FAT A;  5CEB A;  3LIE A;  3KSG A;  2G7U A;  2WKE A;  2HP5 A;  4WZ5 C;  2C6W B;  3UMD A;  4E3L A;  4P0M A;  3R7W B;  3PAG A;  3CPT A;  3MS6 A;  3LY3 A;  2Q0O A;  4WBG A;  4OLD A;  4HY8 A;  4KZA A;  2NUP C;  4OPQ A;  1ERQ A;  1H8Z A;  2QJ7 A;  3C30 A;  2H0T A;  1FR1 A;  5JYP A;  4ZRR A;  2O99 A;  4BD1 A;  1KE4 A;  1VEU A;  3CG5 A;  2JKT I;  4R4R A;  1LI9 A;  3EOI A;  3C4P A;  1PZO A;  3LEQ A;  4E3K A;  1PIO A;  2HJE A;  1K0K A;  3W4O A;  4KG6 A;  5FQQ A;  2Y79 A;  3UPN A;  5FEF A;  4Y7P A;  1MWR A;  4ZTK A;  4HNB A;  5EEC A;  2O9A A;  4OQG A;  3FKV A;  5G4Y A;  1GSW A;  2Y2M A;  5CGW A;  1Y4O A;  2XFT A;  4S2N A;  4DXC A;  4Z1W A;  2A24 A;  4Y13 A;  3MZF A;  3CPT B;  4I3A A;  3SH9 A;  2A2L A;  4G3V A;  1XFQ A;  4Y5F A;  5FQM A;  3KSI A;  4EEU A;  4R38 A;  3TW8 A;  3S7Q A;  5M18 A;  2H5S A;  2ZL1 A;  4KZ7 A;  3NCK A;  2VK3 A;  3MJQ A;  3H82 A;  5GHY A;  1PNE A;  5I5L A;  2XLN A;  1CI8 A;  1NYM A;  1N9B A;  1YSP A;  4JXW A;  1H8Y A;  3AGE A;  5HDD A;  4EET B;  2VLG A;  4LGW A;  1XJ3 A;  3OPL A;  5AVF A;  1KDS A;  2XA7 M;  1VB6 A;  2G2U A;  2O9C A;  3LI8 A;  3LY4 A;  3CUE C;  3UB7 A;  4F3L A;  1DJA A;  1H3Q A;  3VSL A;  2V0U A;  3LID A;  5AVE A;  4OOL A;  1MWU A;  1XXM A;  1L0D A;  2H10 A;  1WYB A;  3WS4 A;  5EV0 A;  3UPO A;  3ZCZ A;  1E3U D;  3GVB A;  2HDU A;  3D72 A;  5J3W A;  3DTM A;  3I7J A;  4HHD A;  1XA7 A;  3FC7 A;  3MSH A;  4KZ5 A;  3CMZ A;  2ZMA A;  4WMC D;  2EXB A;  4ZAM A;  4HBU A;  2GZA A;  3H9W A;  4S2I A;  4MN7 A;  1J3W A;  4DN0 A;  3ICY A;  3V39 A;  2XK1 A;  4CLC E;  4GLQ A;  4ETX A;  5K5B A;  1ESI A;  5GHX A;  4IUK A;  2HZ5 A;  3MQQ A;  4LV2 A;  4JXS A;  4JBF A;  4NK3 A;  4EEP A;  5KSH A;  1BSG A;  3BY8 A;  2J80 A;  1KGG A;  3JPU A;  5AQB A;  3IWO A;  4KQD A;  1WYC A;  1WA9 A;  3SOI A;  2WUQ A;  4X6T A;  3T4K A;  2WZX A;  5HZH A;  3HLW A;  4IBX A;  1K25 A;  5G4Z A;  3IXH A;  3S4X A;  1OTD A;  1ZKJ A;  3SH8 A;  2XEP A;  3HUM A;  3Q1F A;  3LIB A;  3MXS A;  5DFY A;  4WLA A;  2EXA A;  1TDG A;  4BBT A;  1ZHH B;  5EFW A;  1MY8 A;  1MBL A;  4WL9 A;  1ES3 A;  5FQJ A;  3UE3 A;  3E4Q A;  3O86 A;  2JKR M;  3DTI A;  4YNR A;  1W7F A;  4R1G A;  4E3O A;  1DP9 A;  4KZB A;  4ZJ3 A;  5DVA A;  1NJ4 A;  1YLW A;  3VSK A;  4FH4 A;  2ZQ8 A;  4XT2 A;  3NI9 A;  4KZ9 A;  5GLA A;  2V0W A;  3QHY A;  3ULF A;  2E8I A;  3NHQ A;  1S67 L;  3JVU A;  1YLZ A;  4KZ6 A;  1CQA A;  2P7J A;  4IED A;  4R3B A;  3C2W A;  3EWK A;  4GNU A;  4KG5 A;  2HDS A;  4HIA A;  1FCM A;  3F1O A;  1RGZ A;  4Y0T A;  4KZ4 A;  5E2H A;  3WS0 A;  4OH0 A;  3B47 A;  3H7W B;  5FAP A;  4MLL A;  4HH2 A;  3TSG A;  3IF6 B;  4CLC B;  3P98 A;  1SKF A;  3PYP A;  4PM8 A;  2ZC5 B;  3LIA A;  3DTE A;  3Q82 A;  5AQ9 A;  2PBY A;  1MXO A;  3PBN A;  3IH8 A;  2PU4 A;  2PBD P;  1K6R A;  3CAX A;  1K55 C;  3ZQ5 A;  3NEC A;  4N92 A;  1S66 L;  1HZO A;  3QP6 A;  1QME A;  2PRF A;  1N9L A;  4OPZ A;  5HD3 A;  3UNW A;  3UB5 P;  2J7V A;  2PR5 A;  1O7E A;  2OLU A;  1Z09 A;  3GQZ A;  2W0N A;  3QP1 A;  1PYY A;  4NXE A;  3IS2 A;  2LB9 A;  2G2W A;  1FCN A;  4FCF A;  2Y8H A;  5TBM A;  4Y15 A;  3N8R A;  1K6S A;  3GDI A;  3IXG A;  4H6J A;  1FQG A;  1KGF A;  5HWV A;  5EVI B;  4IVI A;  3IWQ A;  4HES A;  4KEN B;  2QJ5 A;  1BLC A;  2WGW A;  1LSV A;  2JCH A;  4JF5 A;  4BL3 A;  3VOZ A;  4JGR A;  2JKT M;  4EBP A;  2XQZ A;  1HLU P;  3FKW A;  3NOU C;  4PHT A;  4UA9 A;  2QYB A;  3UN7 A;  2L0W A;  5L09 A;  2PT7 A;  1T1C A;  1D7E A;  1UWP X;  4KG2 A;  4OON A;  3OOV A;  1O07 A;  4GW9 A;  1MKM A;  5J4E A;  4FD8 A;  3HLC A;  5G18 A;  3T1S A;  1NLY A;  4JXG A;  2KDK A;  2FH5 A;  1PWD A;  4B93 A;  1TS0 A;  1Z6F A;  3ZG7 B;  4X1L A;  5EM0 A;  3UB8 A;  2GDN A;  3PHY A;  1NY0 A;  3WS5 A;  3G6O A;  3P7N A;  1BLP A;  3GMW A;  4HJ4 A;  4EQI A;  4KZ3 A;  3Q81 A;  3SS5 A;  4QJG A;  3FWL A;  5A93 A;  3TOI A;  1S6R A;  2IWC A;  1NRF A;  2H0Y A;  2Y91 A;  1S4S A;  3EEA A;  5TGF A;  4N9K A;  3RFB A;  3LIC A;  2QWS A;  2JE5 A;  3VP0 A;  3WS1 A;  2HP9 A;  4PKY G;  1GSV A;  3HLD A;  4RVA A;  2OV5 A;  1HTZ A;  4MDZ A;  4QY5 A;  3T50 A;  4MMN A;  3MF0 A;  1YMS A;  4HJ3 A;  3MQ0 A;  4X69 A;  3MR0 A;  3NDE A;  1YKD A;  1FSY A;  4OLG A;  5E2G A;  1MC0 A;  4EBN A;  2MJ6 A;  3D4F A;  1RGY A;  4A5R A;  5U47 A;  1G6O A;  5FDS A;  3G31 A;  1NYY A;  3HLF A;  4YIN A;  5GHZ A;  1KDW A;  2W1T A; 
#chains in the Genus database with same CATH homology
 4WUJ A;  4BBV A;  4CLC A;  3LR4 A;  2ZOH A;  4NEE D;  4I38 A;  5I5L A;  5HPI A;  4NXB A;  4ME4 A;  2VZW A;  2KOI A;  1YSP A;  4ETZ A;  5HPF A;  1UGU A;  5HDD A;  2ZBB A;  4EET B;  2VLG A;  4B9O A;  1XJ3 A;  1XJ2 A;  3P01 A;  4BMW A;  5AVF A;  1P9W A;  3C38 A;  2XA7 M;  4O01 A;  2Z6D A;  1VB6 A;  1TS8 A;  2IA2 A;  2O9C A;  5F68 A;  3LI8 A;  3K3C A;  5L8M A;  3LIF A;  5DKK A;  3CUE C;  3UB7 A;  4F3L A;  1LSX A;  1H3Q A;  5HWT A;  3FG8 A;  2V0U A;  3LID A;  4WEL A;  3IS2 B;  4KQO A;  4Y3I A;  2VV7 A;  4FOF A;  5HL6 A;  5AVE A;  4OOL A;  2M1C A;  4I3I A;  3CI6 A;  1LSW A;  3EGD C;  5TBM B;  3R4K A;  3T4J A;  4HQA A;  3D72 A;  5J3W A;  2W3F A;  4HHD A;  5HD5 A;  4GCZ A;  3O5Y A;  2L1M A;  5AJG A;  3FC7 A;  3EQV A;  2VV8 A;  2R78 A;  4H6J B;  1Y28 A;  3BY9 A;  1DP6 A;  3RH8 B;  4O0P A;  5MC7 A;  3BQA A;  4IUH A;  3T4T A;  4GHI A;  3T4Q A;  2GZA A;  3H9W A;  4HOI A;  4LPZ A;  3IBR A;  1OT6 A;  4MN7 A;  1MZU A;  4DN0 A;  3ICY A;  3U2A A;  1NRJ A;  4CLC E;  4GLQ A;  5DJT A;  4ETX A;  5K5B A;  4EUV A;  4OOM A;  4WEJ A;  3NOT C;  4IUK A;  3MQQ A;  4KUK A;  2K31 A;  3KX0 X;  1N9N A;  1T18 A;  3VV4 A;  4EEP A;  4L0L A;  5KSH A;  2J3T D;  2O0Y A;  2WKP A;  3UB6 A;  3F1N A;  3BY8 A;  2L4R A;  2EWW A;  2LB5 A;  2J80 A;  3LR5 A;  5DKL A;  2W1R A;  3LFV A;  4KQD A;  1WA9 A;  2K7S A;  2VEA A;  4M4X A;  2HV1 A;  2PR6 A;  2FZ0 A;  4O8G A;  4BBU A;  3T4K A;  5KIZ A;  4CLC D;  5DJU A;  5HZH A;  5J7E A;  5G4Z A;  4Y2F A;  1OTA A;  3E4O A;  4GS9 A;  2V9A A;  4R70 A;  1OTD A;  1OTB A;  3UB9 A;  2P08 A;  1DP8 A;  1W63 Q;  2OOL A;  3PBO A;  4QPR A;  4MCW A;  3LIB A;  2J3T C;  5DFY A;  4BWI A;  4WLA A;  1TF1 A;  3FPV A;  4BBT A;  1VHM A;  1TS7 A;  1ZHH B;  2HF6 A;  2VV6 A;  3KSH A;  3IBJ A;  4JGP A;  3R7W A;  1F9I A;  2VKS A;  5EFW A;  4I5S A;  1NLZ A;  3PBT A;  4WL9 A;  1OJ5 A;  3UE3 A;  1S1Z A;  3E4Q A;  4JGQ A;  1XFN A;  3SW1 A;  2JKR M;  3NOP C;  4ARZ A;  1X0O A;  3PR6 A;  2VJW A;  3RTY A;  4YNR A;  4CLC C;  1LL8 A;  5CX7 A;  1DP9 A;  2NUT C;  3CIT A;  2V1A A;  4FSF A;  3K2N A;  4PAU A;  3T4O A;  1V9Y A;  4XT2 A;  2V1B A;  4KUO A;  2V0W A;  2W3E A;  3ULF A;  2ZMF A;  3NHQ A;  4EW7 A;  1ODV A;  3T4L A;  1S67 L;  3JVU A;  4HJ6 A;  5HDC A;  3OC2 A;  3OCL A;  2OAP 1;  2P7J A;  2EA9 A;  4HH3 A;  4G3W A;  2KX6 A;  4HI4 A;  4GJ4 A;  1OPX A;  3VE3 A;  3F1P B;  1XJ4 A;  2W3D A;  5F69 A;  2A24 B;  3C2W A;  4IJG A;  3EWK A;  3A0V A;  3HJK A;  1STZ A;  4HIA A;  3F1O A;  2JHE A;  4E04 A;  3EGX C;  2B18 A;  2JN7 A;  3E4P A;  3W2Z A;  3B47 A;  1T1A A;  2O9B A;  3H7W B;  4HH2 A;  3H82 B;  3KSF A;  2W1T B;  4CLC B;  1YSQ A;  5TJJ A;  1S4R A;  3PYP A;  3OBF A;  2VGL M;  4Q0I A;  3LIA A;  4I3J A;  3B33 A;  2JKR I;  2YKH A;  4Q0J A;  4IHQ A;  1OTE A;  3DBA A;  3HJI A;  1UWN X;  2HJ9 C;  3PBN A;  3E98 A;  2KLI A;  4EU0 A;  2GNX A;  5IS1 A;  3CAX A;  1N9O A;  3ZQ5 A;  2M7U A;  2PHY A;  2PD8 A;  4YWZ A;  3BWL A;  1S66 L;  3MQO A;  1OTI A;  2W3H A;  1N9L A;  3PBS A;  4DJ3 A;  5IT5 A;  1F5M A;  2GJ3 A;  5HDS A;  2OWJ A;  2PYP A;  2WKR A;  5HD3 A;  2YKF A;  4F3L B;  3CWF A;  1ZTU A;  2Z6C A;  4WEK A;  2PR5 A;  2VA0 A;  3K3D A;  3B42 A;  3VOL A;  1T19 A;  1P97 A;  1JNU A;  3ZYT A;  2W0N A;  4NXE A;  4UEY A;  3IS2 A;  2LB9 A;  4L9F A;  4CQH A;  1GSX A;  1P0Z A;  3PBR A;  3S7O A;  3OLO A;  3V67 A;  2Y8H A;  1G28 A;  3LR0 A;  3BQ8 A;  5TBM A;  4L9E A;  1TS6 A;  4WF0 A;  3LUQ A;  4UQI M;  4GHI B;  4PKY A;  1H8M A;  2VGL S;  3S7P A;  4DJ2 A;  4NKP A;  2PDR A;  3GDI A;  3TRC A;  4NXF A;  4P6Z M;  1S1Y A;  3OCN A;  4H6J A;  4HP4 A;  4MN5 A;  2INW A;  5HWV A;  2QKP A;  4R3A A;  1OT9 A;  4YOF A;  2P04 A;  2QJ5 A;  1LSV A;  2HGV A;  2OAQ 1;  4II7 A;  4NXG A;  5C5K A;  5F6A A;  4JGR A;  2JKT M;  3EQU A;  4BJP A;  2GX5 A;  3F1N B;  3A0S A;  4MN6 A;  4WN5 A;  5LBR A;  4I39 A;  3NOU C;  2PD7 A;  4EXO A;  3C8C A;  3CLO A;  4PHT A;  1V9Z A;  2CMN A;  2QYB A;  2M7V A;  3PXP A;  3CUE A;  2I9V A;  3UE6 A;  2D01 A;  2L0W A;  2PYR A;  3GEC A;  4LRZ E;  5F5Y A;  3T4S A;  2PT7 A;  1T1C A;  1TD5 A;  3LI9 A;  1OJG A;  1D7E A;  2EWV A;  4GS9 B;  1UWP X;  2XRN A;  3OOV A;  3LIE A;  3KSG A;  2BAS A;  4G3K A;  2G7U A;  4UQI S;  4GW9 A;  1MKM A;  5J4E A;  4EER A;  3UMD A;  1EW0 A;  3MMH A;  4P6Z S;  1IOU A;  1NLY A;  3A0R A;  3R7W B;  2OWH A;  4Q0H A;  1NWZ A;  2KDK A;  2FH5 A;  4B93 A;  1W63 M;  1TS0 A;  3KYQ A;  4HY8 A;  3D3O A;  4AFI A;  4EQ1 A;  2XRO A;  3EEH A;  2NUP C;  4DMZ A;  3BW6 A;  4LRX C;  3JVV A;  2QJ7 A;  2H28 A;  1D06 A;  3S7N A;  3PBQ A;  3UB8 A;  4ARZ B;  3PHY A;  3C30 A;  2W27 A;  5FL3 A;  4R6L A;  1DRM A;  2WKQ A;  1LT0 A;  3G6O A;  3MFX A;  3P7N A;  4LRY C;  2DMW A;  4HJ4 A;  4ZRR A;  4EES A;  2O99 A;  2D02 A;  5HSQ A;  1KOU A;  1IFQ A;  4K08 A;  2JKT I;  4XT2 B;  4HP9 A;  3EOI A;  2W3G A;  2B02 A;  1T1B A;  3KO6 A;  3UME A;  2HJE A;  2XA7 S;  4JGO A;  3TJZ C;  1S4S A;  3EEA A;  4RQ9 A;  5DFX A;  3RFB A;  2Y79 A;  3LYX A;  3LIC A;  3FPW A;  3MXQ A;  2QWS A;  5HWW A;  1P9R A;  1XJ6 A;  4PKY G;  2ZOI A;  5DF9 A;  1BYW A;  4HNB A;  1GSV A;  5A8B A;  1YAX A;  2O9A A;  2VX8 A;  5G4Y A;  4MDZ A;  3TE8 A;  3T50 A;  3E0Y A;  4MMN A;  3HCY A;  1GSW A;  3MF0 A;  3F1O B;  2XSS A;  4HJ3 A;  3MQ0 A;  3VE4 A;  3MR0 A;  3F1P A;  5IU1 A;  4Z1W A;  2A24 A;  3LR3 A;  1YKD A;  2K2N A;  2ZMV A;  3KYZ A;  3BJN A;  4I3A A;  1MC0 A;  2A2L A;  2QHK A;  4G3V A;  1XFQ A;  4Y5F A;  2MJ6 A;  3KSI A;  3NJA A;  4EEU A;  4R38 A;  3TW8 A;  1G6O A;  1F98 A;  3S7Q A;  4LLO B;  3H7W A;  3MJQ A;  2J3W A;  3H82 A;  4L9G A;  2W1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...