4GHIA

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a benzoxadiazole antagonist
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
107
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
publication title Allosteric inhibition of hypoxia inducible factor-2 with small molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 107
sequence length 113
ec nomenclature
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ghiA00
2P7JA 4H6JA 5EFWA 2PHYA 3H7WB 3MQOA 4B9OA 3K3CA 4XT2B 4EEPA 4KUOA 1XFQA 5DJUA 4WL9A 3RH8B 2V0UA 1LSXA 4I3JA 2I9VA 3E4OA 4HIAA 2M1CA 3LUQA 5HWTA 3UB8A 2KX6A 4BBVA 3NOUC 4E04A 4MN6A 1TS0A 2CMNA 1OJGA 1ODVA 1UGUA 2V9AA 1D7EA 3ZQ5A 1S4SA 3CAXA 3VE3A 1OJ5A 3MQQA 3LIEA 4HQAA 1T1BA 1S66L 1NWZA 1G28A 2JN7A 3E4QA 5HD3A 3NJAA 3IS2A 1S1YA 1N9NA 4HY8A 1T1AA 1OTDA 4I5SA 3FG8A 1V9YA 3UB9A 2W27A 3IBRA 3NOPC 4L9FA 1S67L 3LIAA 1OTBA 1DP6A 4I3AA 4M4XA 1LSWA 3H82A 4HH2A 3ICYA 5DKLA 3A0RA 2ZOHA 3C2WA 1P0ZA 2INWA 1N9LA 1XJ2A 5J3WA 3ULFA 2VV8A 1UWPX 5HSQA 2PR6A 4NXEA 4GHIA 3MJQA 3F1NA 3KX0X 5HDDA 4HP9A 1UWNX 3CLOA 5DJTA 1TS8A 2YKFA 1T1CA 3EWKA 4WF0A 1GSXA 4NXBA 2A24A 2QJ7A 4MN5A 4WN5A 3MR0A 4GS9A 3PHYA 4HJ4A 4L9EA 5TBMB 4R6LA 1S1ZA 2ZBBA 3K3DA 2KDKA 3P7NA 1LSVA 5F69A 1MZUA 2QJ5A 3UB6A 4LRZE 3F1OB 2J80A 3UB7A 5HDSA 2JHEA 1XFNA 5HZHA 3F1PB 4HHDA 5A8BA 1OT6A 1OT9A 4JGPA 4WLAA 5F6AA 5IS1A 3LI9A 1F9IA 4F3LB 4LRYC 2W0NA 2R78A 2VV7A 4H6JB 2PDRA 1T18A 4JGQA 2D01A 3LIFA 3UMDA 3UE6A 4I39A 2V1AA 2L1MA 3MXQA 1JNUA 1VB6A 2V0WA 4R70A 1OTIA 3C8CA 1V9ZA 3HJIA 4HI4A 3LI8A 1X0OA 4HOIA 1DRMA 4EW7A 3EEHA 1XJ4A 4NXFA 2PYRA 3LYXA 4HP4A 1OTAA 1LT0A 3VE4A 2Z6CA 2VEAA 4RQ9A 4LRXC 3H7WA 1DP8A 4XT2A 4HH3A 5AVFA 5F5YA 2QKPA 3IS2B 2YKHA 5HDCA 1GSWA 2V1BA 1DP9A 3BY9A 3G6OA 2QHKA 1XJ3A 4DJ2A 3CWFA 1S4RA 2ZOIA 3H9WA 4BBUA 1F98A 3H82B 3FC7A 4I3IA 4JGRA 4EXOA 4GW9A 2PD7A 3LIDA 3NOTC 2VV6A 1P97A 3A0VA 4KUKA 4JGOA 4EQ1A 4PKYG 1BYWA 3NHQA 5I5LA 3OLOA 5HWWA 4R38A 2D02A 2HV1A 2BASA 4GHIB 3F1NB 1GSVA 2Z6DA 4HJ3A 5DKKA 4I38A 3B33A 2A24B 3RTYA 4WUJA 3LICA 4GS9B 1WA9A 5IU1A 3E4PA 3T50A 2B02A 4YWZA 2QWSA 5KIZA 4EERA 4DJ3A 4EEUA 2K7SA 5G4ZA 3A0SA 4HNBA 2EA9A 2H28A 2L0WA 4R3AA 1OTEA 2WKPA 3BY8A 1N9OA 4K08A 3MFXA 4PKYA 3VOLA 3GECA 3SW1A 2OOLA 1TS6A 3HJKA 3PYPA 4EESA 1LL8A 2L4RA 4KQDA 4NXGA 3GDIA 5TBMA 3BWLA 1T19A 5J4EA 2GJ3A 5F68A 3UMEA 4BBTA 3D72A 5HWVA 3LIBA 2WKQA 2OWJA 3F1OA 1TS7A 1D06A 1XJ6A 1EW0A 3F1PA 2PR5A 5J7EA 4LPZA 2WKRA 4EETB 2PYPA 5HD5A 2PD8A 1KOUA 4HJ6A 5AVEA 2OWHA 4L9GA 5G4YA 1Y28A 4GCZA 4F3LA 2VLGA 4LLOB
chains in the Genus database with same CATH superfamily
1VEUA 4OOYA 4P6ZS 4BJPA 2XSSA 3WRTA 1FIKA 4XT2B 1RGYA 4EU0A 4KUOA 3WS4A 3GQZA 3QNBA 1NYYA 1TDLA 5KSCA 3UE1A 4WL9A 3UNWA 3RH8B 4CPKA 1ZTUA 2PU4A 5CEBA 2J3WA 4EBNA 3NOUC 2W3HA 3CUEA 2HDRA 2CMNA 1OJGA 3T1RA 5TGFA 1ODVA 4R0QA 3T1SA 2EXAA 1UGUA 3LR5A 3UB5P 3VOYA 5M19A 3CAXA 4L0LA 4WM9A 1OJ5A 4U3TA 4OONA 2H10A 1T1BA 3ZVWA 1KVLA 1P9WA 5CX7A 3NJAA 1N9BA 1N9NA 3PXPA 2IA2A 4N9KA 1K55C 2XFTA 1V9YA 3NC8A 3NOPC 2QYBA 2VGKA 4I3AA 1FILA 1LSWA 1ONGA 4GDBA 3ICYA 1HLUP 3NIAA 4RX2A 4UA6A 2Y91A 3FWLA 3D3OA 4O01A 3AGDA 2PBYA 1BLSA 3OPHA 2ZC3B 3VFFA 5DF9A 4QB8A 4QJGA 4KG6A 2INWA 1N9LA 4GZBA 4BLMA 2VV8A 1LI0A 4WYYA 1UWPX 5HSQA 2ZM2A 4NXEA 5CGSA 5HW3A 3V50A 2YKFA 3EWKA 4WF0A 1K25A 4CLCC 2XQZA 2P74A 4NXBA 2JKRI 2A24A 3ZG8B 4MN5A 4MDZA 3BLSA 3PHYA 2EXBA 3JPUA 3IXGA 2V8CA 1S1ZA 1BT5A 2ZBBA 2KDKA 3IQAA 2WUQA 1FR1A 4ARZA 3TJZC 3B47A 3G2YA 4D60A 5AJGA 4LV0A 3F1OB 2J80A 3UB7A 5HDSA 1XGIA 1ERQA 3CZDA 2ZMFA 5DFYA 2A49A 3JVVA 4KZ5A 5A90A 1OT6A 4N1HA 1QMFA 3N8LA 3ZGAB 3UE0A 2Y2PA 5E2FA 2WGWB 5F6AA 1W8YA 2H0TA 1JTGA 1VQQA 2G2WA 3RXWA 3QHYA 2BLSA 1I2WA 2R78A 2ZL1A 2VV7A 3IWOA 1VEUB 2Y2HA 4JGQA 3SOIA 4O0PA 4DE2A 5G18A 1L0DA 3MXQA 5FAPA 1HVBA 1K54A 3WS1A 2VA0A 2Z2LB 2EFXA 4PHTA 4OLGA 4OPQA 4HBUA 3ZHHA 1K4EA 3LI8A 4R4RA 2PRFA 3MBZA 3BEBA 4QHCA 1K38A 3KSIA 1XJ4A 2IWBA 3FV7A 4NG2A 3MSHA 5DTKA 3LYXA 1OTAA 1LT0A 2GDNA 3O87A 2JC7A 2JKRM 2Y2MA 4LRXC 4QD4A 4K0WA 3VFHA 3H7WA 4JXWA 1DP8A 5AVFA 3GVBA 1XXMA 3AGFA 1IOUA 2DNSA 3BRMA 5FEFA 4LCMA 4N1XA 2K31A 4OVDA 2EFUA 2R9WA 5DVAA 4OOLA 1ZHHB 1K55A 2XF3A 3BY9A 5FQMA 3S1YA 3CWFA 4ETZA 2JKGA 5CHUA 2OLVA 2ZOIA 3HLDA 1W7FA 4BBUA 4N92A 3QP2A 4MBHA 1OMEA 1RCJA 4P87A 3VP0A 4WZ5A 3DTEA 3O88A 5L8MA 1S0WA 1YM1A 1MXOA 2G7UA 2VV6A 4KZ4A 2Y2KA 1ES4A 3Q7VA 4KUKA 4OPYA 4EQ1A 1BYWA 5EE8A 4N9LA 2W3EA 2Y2JA 3FKVA 3LEQA 1IFQA 1TF1A 3S7QA 5CGXA 3C7VA 3MF0A 4WEKA 1KE3A 3UPNA 1H8YA 5FAOA 1YKDA 1A0KA 3KYZA 1K6SA 4YOFA 5DKKA 2HJEA 4I38A 4MCWA 3P09A 2A24B 4MBKA 3RTYA 1LI9A 5L2FA 3G35A 3LICA 1ZKJA 1WA9A 2QWSA 5KIZA 5DFXA 4OP8A 1YLWA 4ARZB 2WGVA 2K7SA 5G4ZA 4EWFA 2ZC6B 4JBFA 2O9CA 2EA9A 5EVLA 2Y55A 3IH9A 4LCLA 2WKIA 4BENA 1KDSA 4KZAA 4P0MA 1CF0A 4IEDA 4K08A 1WYBA 1GCEA 3DTKA 4EBPA 2QPNA 5EVIC 4Y5FA 2X01A 4E3IA 5HAPA 3HJKA 1TS6A 3PYPA 4R3JA 3W8KA 2ZL1B 1PWCA 4DN0A 1XPBA 3T4JA 4B93A 4IBXA 2WKEA 1ALQA 4KZ6A 1YLPA 3FPVA 3LIBA 5FA7A 3C30A 1NXYA 3NDEA 1TS7A 4LGWA 5EV0A 3GSGA 4IBRA 4Y0OA 1EW0A 4OP5A 4NKPA 2WKRA 2VZWA 2PYPA 2XROA 1KOUA 3ISGA 2OWHA 1J9MA 4L9GA 4EBLA 4CLCD 1XP4A 3M2JA 1YPRA 3MKEA 2ZLYA 4YNRA 5FAQA 3MFDA 4S2OA 2P9VA 2XFSA 4Z1WA 4WMCD 3H7WB 3T4TA 3EQUA 5F83A 3S7PA 5EM0A 3QP1A 4GLQA 1XFQA 3PAEA 5DJUA 3V5MA 1BTLA 4BD0A 2V0UA 3IX3A 4I3JA 1Y4OA 2I9VA 1ESIA 1DY6A 1ONHA 3ZNTA 4KQQA 3RXXA 1JWVA 1FSYA 5GL9A 1TS0A 3T12B 3A3FA 2JKFA 4OOMA 4GKUA 5FQIA 3DTIA 4KZBA 3WS5A 1D7EA 4UQIS 2NUPC 2RL3A 3DWKA 3VE3A 5FDSA 3LR3A 4EQIA 3Q7VB 1PI4A 2V2FF 4D2OA 3TSGA 3DBAA 2WAEA 3BQAA 3HLEA 1S66L 2GZAA 1KE0A 3GRJA 4E6XA 2J3TC 2JN7A 1L0EA 3CITA 3E4QA 1Q2QA 1JTDA 4KQOA 3LEZA 3TOIA 2EX2A 4BL3A 3S7NA 5HAQA 3B3XA 3VP1A 3UB9A 2W27A 3IBRA 1PW8A 4OH0A 3JYIA 2ZD8A 3TW8A 4MBFA 3T4KA 1OTBA 2WZZA 5CRFA 3NBLA 1MY8A 4M4XA 2ZM0A 1PFLA 1CQAA 4HH2A 3DW0A 5AQAA 2J7VA 3LR0A 4IUKA 3N7WA 3EGXC 2ZOHA 3C2WA 2ZQAA 1PI5A 5HAIA 1XJ2A 3GR2A 5J3WA 1G6AA 2A2LA 2FFFB 3ULFA 1ES3A 2PR6A 1L2SA 4GHIA 3A3IA 3MJQA 4GB7A 5LBRA 1EROA 2Y2NA 5DJTA 3G31A 5AQ7A 1GSXA 3MR0A 1XA7A 4HJ4A 4L9EA 4P6ZM 4R6LA 1LLBA 2H0YA 5C5KA 3CPTA 3K3DA 3P7NA 4FUWA 1LSVA 5IT5A 5TR7A 1NZUA 5E2GA 2HF6A 3D4FA 2WGIA 5GLAA 2QJ5A 3CG5A 4LRZE 2G2UA 1K0KA 1TD5A 3FZCA 3ZG0A 1G5UA 4ESPA 2JHEA 4WELA 5DF7A 2WYXA 1W8QA 3O86A 4IJGA 1NYMA 1EWZA 4JGPA 2VJWA 5IS1A 3N6IA 3IH8A 1ES5A 3IF5A 4LRYC 5HARA 3NY4A 2E8JA 2P9VB 3EEAA 1T18A 1TEMA 2NUTC 3NECA 4I39A 2VGJA 1JNUA 2EX9A 3MMHA 4Y2FA 4R70A 4KG5A 5M18A 4E3LA 3HUMA 2HP5A 1U60A 1M40A 4Y3IA 3MZDA 4KZ3A 3O3VA 4ETXA 4S2PA 4HESA 1K4FA 3L9KA 2ACGA 1S6RA 3UY6A 3HLBA 3ZNYA 4OPRA 3A3DA 5EVID 3T1XA 5HPFA 4FSFA 1NY0A 2LB9A 3VE4A 2Z6CA 3HCYA 4B4ZA 1E3UD 1K57A 3CHWP 3T4OA 3PAGA 1IEMA 3IXDA 3UN7A 1GSWA 1IYQA 4IVKA 1NLZA 2WADA 4O7DA 2QHKA 1XJ3A 4ZJ3A 4RX3A 1S4RA 4S2NA 4BQMA 4Q8IA 4I3IA 3IF6C 4O8GA 1DJAA 2HPBA 3V3RA 3LIDA 3SZTA 3N8SA 4ZRRA 3A0VA 3E2LA 3QNCA 3LY4A 3NHQA 5L09A 1L0FA 3ZDJA 5I5LA 3HUNA 3OLOA 5FDHA 5HWWA 1BLCA 4R38A 1YLTA 5HL1A 2XD1A 2ZC7A 2BASA 4GHIB 1E25A 3S4XA 4NETA 2ZQ7A 4G3VA 3SS3A 4F94A 4ZDXA 2Z6DA 4QY6A 2B18A 2HDUA 3DAVA 4K91A 1Z6FA 3OOVA 5IU1A 3E4PA 1VM1A 3T50A 2B02A 1H5XA 4YWZA 3CPTB 3BFFA 4Q0IA 4DJ3A 4EEUA 2MJ6A 2X71A 2XK1A 2UV0E 3A0SA 4HNBA 4BD1A 4DDSA 3BECA 1SHVA 2J3TD 1OTEA 2WKPA 4GN2A 5D3OA 4B4XA 4Y0TA 1W63Q 4JPMA 4NK3A 4Z9QA 2DMWA 4EESA 3FYZA 1ACFA 4UEYA 3IHAA 3LY3A 2L4RA 5GHXA 4KQDA 4NXGA 1W5DA 3GTCA 1RGZA 3D9YA 1ZG6A 1Q2PA 2BTFP 1JWZA 2IWCA 3BWLA 4DF6A 2ZM8A 5FI6A 5J4EA 2GJ3A 5F68A 4DE3A 2HJ9C 3D72A 5HWVA 2WKQA 2OWJA 1TDGA 1YLZA 5FI2A 3W4PA 3VSKA 2JKTM 4QY5A 3WS0A 3F1PA 1FQGA 2PR5A 5EM1A 4X68A 4EETB 5CHJA 3OBFA 1KVMA 4DE0A 1FOFA 1GHMA 1N4OA 4PMAA 3UDIA 1IYOA 4QWOA 3FPWA 3UE3A 4DRTA 5G4YA 1IKIA 3SS4A 4GCZA 4F3LA 3T4QA 5FEGA 3CMZA 2KLIA 5GLDA 1CEFA 4K0XA 5EFWA 2PHYA 4XUZA 3M6HA 3MQOA 3BJNA 1GHIA 2Q9NA 3UO9A 1PW1A 2LB5A 1IYPA 3E4OA 3HLWA 4HIAA 2M1CA 4BBVA 2KX6A 2ZQ8A 3FKWA 4CLCA 5CXWA 4E3NA 3C38A 3IX4A 3IWQA 3T4LA 1RP5A 3C7UA 3OCNA 5L07A 4R1GA 2PT7A 5BOHA 4WMCA 2M7VA 4R23A 1SDNA 2VK3A 3MQ0A 4FH4A 1STZA 5CECA 5F82A 5K5BA 1NLYA 3KYEA 4RYEA 2HP9A 3BQ8A 4HQAA 2OSUA 1NWZA 1G28A 3RFBA 3IS2A 1S1YA 3SH9A 3W4OA 1OTDA 3Q81A 4I5SA 4MN7A 1GHPA 4JXSA 1KGEA 1PWGA 1L3LA 4DXBA 1MBLA 2IWDA 4L9FA 3IXBA 2O0YA 1WE4A 2O9AA 1DP6A 3PR6A 4KG2A 1H8ZA 1G68A 2W1RA 3S7OA 2JE5A 5DKLA 4Y17A 4A5RA 1CI9A 3A0RA 4PM9A 3HBRA 4DDYA 2P04A 4II7A 5AQ9A 4QPRA 5FL3A 5HL6A 3KSHA 1P0ZA 3VSLA 4H8RA 5A92A 3RJUA 1IELA 3F1NA 3KX0X 5FATA 4DE1A 3ZYTA 2XDMA 4S2IA 1K56D 3BFDA 3CUEC 5A93A 4FD8A 4WN5A 2WK0A 1M6KA 4KENB 3U4LP 2Y2QA 3IBJA 5F69A 5TJJA 5HFOA 2DCFA 2Y2GA 1MZUA 5DTSA 1MWUA 3O5YA 3IX8A 1NRJA 3V67A 2VKSA 3VP3A 3CI6A 5HZHA 3N4IA 3F1PB 4HHDA 3KYQA 3NI9A 5A8BA 2W3GA 4IUHA 3ZCZA 1OT9A 1ZC2A 3NCKA 5EVEA 3L7HA 1XKZA 1FCOA 4Y0UA 3BFEA 1GA0A 4UQIM 1F9IA 4F3LB 5E43A 2W0NA 2PDRA 3SS5A 2QZ6A 2VGLS 3LIFA 3UE6A 2WZXA 2AVXA 2L1MA 1ES2A 1J3WA 2CC1A 3PBRA 2XR0A 3CJMA 4EUZA 1OTIA 3HLCA 4LV3A 3GV9A 3HJIA 1Z09A 3BW6A 4ZJ2A 4CLCB 3PTEA 3MZEA 4DMZA 1DRMA 4EW7A 2Z2MB 4EUVA 1IYSA 5FQ9A 4HP4A 1PIOA 2VEAA 4G3KA 1YMXA 3UDFA 1F5MA 4HH3A 4WEJA 5CTMA 5F5YA 2XA7S 1TVFA 3IS2B 4FOFA 5HDCA 3TG9A 4E3JA 2V1BA 4U0XA 1NZOA 1YLJA 3Q1FA 5EVIA 2V20A 2XH9A 2XLNA 3LR4A 4DJ2A 3H9WA 3WRZA 4BMWA 5A91A 2J9PA 1FCMA 1F98A 1E3UA 3FC7A 1SKOA 5EOEA 2OV5A 4UA9A 4GW9A 4Y7PA 3R7WA 4LENA 2X02A 2ZQCA 3NOTC 2O9BA 1P97A 1KGFA 4JGOA 2OLUA 2XD5A 3IT9A 3DWZA 4X1LA 1MWRA 2KOIA 4E3OA 4HBTA 2Y79A 2D02A 5EUAA 4IVIA 4XXRA 3S22A 1K54C 3HVFA 1MKIA 1LHYA 4BWIA 4LFUA 3F1NB 2W3DA 3M6BA 2PBDP 4X6TA 3W4QA 3G4PA 1FR6A 1PZPA 2EWVA 5JYOA 4CLCE 2K2NA 1MKMA 1O7EA 4OKPA 3VP4A 4JXGA 4ZAMA 5GHYA 4Y15A 3M2KA 3VOZA 3U2AA 5EPHA 3ZG9B 2UWXA 1YMSA 4GOGA 4P6BA 4R3BA 3QP6A 3TE8A 5HX9A 2WKHA 1O07A 4Y13A 4GNUA 1N9OA 3BFCA 2GNXA 1H0MA 4RVAA 3I7JA 1PNEA 3GMWA 2O99A 3VOLA 3GECA 3SW1A 1MC0A 3P98A 5AQBA 2OOLA 1AWIA 2EWWA 1SDEA 5GLCA 4DKIA 5TBMA 2OAP1 4WZ5C 1NJ4A 2P08A 3UMEA 1MWSA 2B95A 1SCWA 2Q9MA 1Y54A 4S2MA 1YLYA 2Y59A 4E3MA 3E0YA 1VHMA 3MKFA 3OZHA 1D06A 1YSQA 3MXSA 2ZC4B 3K2NA 3BM6A 5J7EA 2V8FA 3VV4A 4LPZA 4X53A 3OPRA 3OPLA 1XA1A 3ITBA 1DJCA 1BULA 1PYYA 3LCEA 1YT4A 4X56A 3NDGA 1YAXA 2VLGA 5IHVA 5CHMA 1YQSA 1OPXA 1BLHA 2P7JA 4H6JA 2JKTI 1DJBA 4GD8A 4Q0JA 4B9OA 3K3CA 4S2KA 4E6WA 4EEPA 3BYDA 3HLFA 5EOOA 4X1MA 5U47A 3EQVA 4ZJ1A 3E98A 4EV4A 1LSXA 2WAFA 5EVIB 4JKTA 4U0TA 1GA9A 3LUQA 3UB8A 5HWTA 4E04A 1HZOA 4MN6A 3NULA 3QP4A 4PM6A 2C6WB 3QP8A 3BLMA 1SKOB 4JF5A 2EX6A 2V9AA 1L0GA 4E3KA 4JF6A 3R7WB 2FFYA 1BUEA 3LFVA 4JXVA 3ZQ5A 1S4SA 3MQQA 3LIEA 4QU3A 2HP6A 3UPOA 3EGDC 4X55A 3SH7A 3OCLA 2ZQ9A 1I5QA 3G30A 1KGGA 5HD3A 3HREA 4MEZA 4HY8A 1T1AA 3ZFZA 3FG8A 5GHZA 2XEPA 2ZMVA 5EECA 2V1ZA 1S67L 3ZVTA 3Q07A 3LIAA 1HD8A 3V3SA 2H5SA 2XGNA 3MXRA 3H82A 4WBGA 3PBNA 4X69A 3SH8A 4JLFA 5FQKA 3PBQA 4PM7A 4PM5A 2QMIA 2GX5A 1AXBA 1D1JA 5M1AA 5FSRA 2FZ0A 5F1GA 3VP2A 2JCHA 4NEED 3B42A 4KQRA 4IHQA 2RCXA 4C3QA 3KO6A 5HDDA 4HP9A 1UWNX 3CLOA 5FI7A 1TS8A 3Q7ZA 5CEDA 1T1CA 5E2EA 1JWPA 2QJ7A 4GS9A 2J8YA 5TBMB 1H8MA 2A3UA 1P9RA 3EOIA 4OQ0A 2HGVA 2C5WB 3UB6A 5DF8A 1XFNA 2BG1A 1K56A 4LV2A 2Q0OA 5FQQA 3PBOA 2W1TA 4UAAA 4YFMA 1LL5A 3A3EA 3HLGA 3IF6A 4WLAA 1VETA 3LI9A 1JVJA 2M7UA 1XX2A 5JYPA 1XGJA 3HUOA 1ZG4A 1PZOA 1EI5A 4H6JB 2HZ5A 2D01A 3TRCA 3UMDA 4OLDA 4M3KA 2V1AA 3PBSA 2JBFA 4OQGA 3BFGA 1PRQA 4C6YA 1VB6A 3WWXA 2EX8A 2V0WA 3QP5A 2Y8HA 3G2ZA 3A3JA 4OQIA 3C8CA 1V9ZA 1W79A 2Y2IA 3R4KA 4HI4A 1X0OA 4HOIA 3T1QB 4X25A 5GLBA 5CGWA 1K6RA 3C4PA 3EEHA 4MNRA 4ZTKA 3W2ZA 2HDQA 3P01A 4NXFA 2PYRA 4CJNA 4OQHA 5L10A 1BLPA 4UHUA 3ZG7B 3C5AA 1MWTA 1H3QA 3JVUA 4RQ9A 4OPZA 3C4OA 3T4SA 2OAQ1 4XT2A 2QKPA 1LL9A 4GJ4A 4C75A 2YKHA 5CERA 4BL2A 1CI8A 3N8RA 1CJFA 1DP9A 2ZJ9A 2FH5A 4XUXA 3G6OA 4FTXA 3UDXA 2J9OA 3V39A 3H82B 4JGRA 3IWIA 4G3WA 4EXOA 4KZ9A 4YINA 4DXCA 2PD7A 2VX8A 1QMEA 4FH2A 3PBTA 2PAVP 4FCFA 5F1FA 4PKYG 2ZMAA 4ME4A 5FASA 1CK3A 4KZ8A 3MS6A 3MZFA 2HV1A 5FQJA 4JF4A 2Y4AA 4S2LA 3HL9A 1FSWA 1ESUA 3DTMA 4P85A 5TFQA 1GSVA 4HJ3A 1F2KA 3B33A 4ID4A 3KSFA 1MPLA 4R4SA 1BSGA 4CQHA 4WUJA 4B88A 4GS9B 1KDWA 1WYCA 1BZAA 1SZVA 4MMNA 2VGLM 2W3FA 5KMWA 4EERA 2PU2A 4GD6A 3UPPA 4PAUA 1IKGA 1E4DA 2ZC5B 4MLLA 4AFIA 1CEGA 4PPRA 4S2JA 3IXHA 3ITAA 2H28A 2L0WA 4R3AA 1K57C 1FCNA 3ZG5A 5HPIA 2DRWA 3BY8A 5KSHA 1NRFA 2W1TB 4ZBEA 2HDSA 3G32A 1W63M 3MFXA 3IF6B 4PKYA 3AGEA 1KE4A 1VETB 1YSPA 4S2NC 3KSGA 2XRNA 1ERMA 2Y2LA 2E8IA 5CTNA 4Q0HA 4WZ4A 1LL8A 4UA7A 3Q82A 2Y2OA 4LV1A 3GDIA 4GDNA 3G34A 2I72A 1T19A 2B5RA 5E2HA 2XA7M 2R9XA 3LO7A 4PM8A 4RA7A 4BBTA 5I94A 3OC2A 1PWDA 3F1OA 5DTTA 1XJ6A 3OPPA 1C3BA 1G6OA 3IHBA 5HD5A 1SKFA 4KZ7A 2PD8A 3WS2A 5MC7A 5KZHA 2WGWA 4HJ6A 5AVEA 1I2SA 1Y28A 5J8XA 4HEFA 2ZQDA 3VMAA 3E2KA 3LGOA 4LLOB 1HTZA
chains in the Genus database with same CATH topology
2P7JA 4H6JA 2JKTI 4Z1WA 4P6ZS 2PHYA 5EFWA 3H7WB 4Q0JA 3T4TA 4BJPA 2XSSA 3EQUA 3MQOA 3S7PA 4B9OA 3K3CA 4XT2B 4GLQA 3BJNA 4EU0A 4EEPA 4KUOA 1XFQA 5DJUA 3EQVA 3E98A 4WL9A 3RH8B 2V0UA 2LB5A 1LSXA 4I3JA 1ZTUA 2I9VA 3E4OA 4HIAA 2M1CA 3LUQA 2J3WA 5HWTA 2KX6A 3UB8A 3NOUC 4BBVA 4E04A 4MN6A 4CLCA 2W3HA 3CUEA 3C38A 3T4LA 3OCNA 1TS0A 2CMNA 1OJGA 2PT7A 1ODVA 4OOMA 1UGUA 3LR5A 2M7VA 2V9AA 3R7WB 3MQ0A 1D7EA 3LFVA 4UQIS 3ZQ5A 2NUPC 1S4SA 1STZA 3CAXA 4L0LA 3VE3A 5K5BA 1NLYA 1OJ5A 3LR3A 3MQQA 3BQ8A 3LIEA 3DBAA 4HQAA 1T1BA 3BQAA 1S66L 2GZAA 3EGDC 1NWZA 1G28A 3OCLA 2J3TC 2JN7A 3CITA 3E4QA 1P9WA 5CX7A 5HD3A 3NJAA 3RFBA 3IS2A 1S1YA 4KQOA 1N9NA 3PXPA 4HY8A 1T1AA 1OTDA 2IA2A 3S7NA 4I5SA 4MN7A 3FG8A 1V9YA 3UB9A 2W27A 2ZMVA 3IBRA 3NOPC 4L9FA 1S67L 3LIAA 2O0YA 2QYBA 3TW8A 3T4KA 1OTBA 2O9AA 1DP6A 3PR6A 4I3AA 4M4XA 1LSWA 3H82A 4HH2A 3PBNA 2W1RA 3ICYA 3S7OA 5DKLA 3PBQA 3A0RA 3LR0A 3D3OA 4IUKA 2GX5A 2P04A 3EGXC 4II7A 4O01A 2ZOHA 3C2WA 5DF9A 4QPRA 5FL3A 2FZ0A 5HL6A 3KSHA 1P0ZA 2INWA 1N9LA 1XJ2A 5J3WA 2A2LA 4NEED 3B42A 3ULFA 2VV8A 1UWPX 5HSQA 2PR6A 4IHQA 4NXEA 4GHIA 3MJQA 3F1NA 3KX0X 3KO6A 5LBRA 5HDDA 3ZYTA 4HP9A 1UWNX 3CLOA 5DJTA 1TS8A 2YKFA 1T1CA 3EWKA 4WF0A 4CLCC 1GSXA 3CUEC 2JKRI 2A24A 4NXBA 2QJ7A 4MN5A 4WN5A 4MDZA 3MR0A 4GS9A 3PHYA 4HJ4A 4L9EA 4P6ZM 5TBMB 4R6LA 1S1ZA 1H8MA 5C5KA 2ZBBA 3K3DA 2KDKA 3P7NA 1LSVA 5IT5A 3IBJA 5F69A 5TJJA 4ARZA 1P9RA 2HF6A 3TJZC 3EOIA 1MZUA 3O5YA 3B47A 2QJ5A 5AJGA 2HGVA 3UB6A 4LRZE 3F1OB 1NRJA 2J80A 3UB7A 5HDSA 3V67A 1TD5A 2VKSA 2JHEA 4WELA 3CI6A 1XFNA 5HZHA 3F1PB 4HHDA 2ZMFA 5DFYA 3JVVA 3KYQA 4IJGA 5A8BA 2W3GA 3PBOA 1OT6A 4IUHA 2W1TA 1OT9A 4JGPA 2VJWA 4WLAA 5F6AA 5IS1A 3LI9A 4UQIM 2M7UA 1F9IA 4F3LB 4LRYC 2W0NA 2R78A 2VV7A 3EEAA 2PDRA 4H6JB 1T18A 4JGQA 2D01A 4O0PA 2NUTC 2VGLS 3TRCA 3LIFA 3UMDA 3UE6A 4I39A 2V1AA 3PBSA 2L1MA 3MXQA 1JNUA 1VB6A 3MMHA 2V0WA 4Y2FA 3PBRA 2Y8HA 4R70A 1OTIA 2VA0A 3C8CA 1V9ZA 3HJIA 4Y3IA 4PHTA 3R4KA 3BW6A 4ETXA 4HI4A 3LI8A 4CLCB 1X0OA 4HOIA 4DMZA 1DRMA 4EW7A 3EEHA 4EUVA 3KSIA 3W2ZA 1XJ4A 3P01A 4NXFA 2PYRA 3LYXA 5HPFA 4FSFA 4HP4A 2LB9A 1OTAA 1LT0A 3VE4A 2Z6CA 3HCYA 2VEAA 4G3KA 4RQ9A 1H3QA 3JVUA 2JKRM 4LRXC 3T4OA 3T4SA 2OAQ1 3H7WA 1DP8A 4XT2A 1F5MA 4HH3A 4WEJA 5AVFA 5F5YA 2QKPA 1IOUA 4GJ4A 2XA7S 3IS2B 4FOFA 2YKHA 5HDCA 1GSWA 2K31A 2V1BA 4OOLA 1DP9A 1ZHHB 1NLZA 2FH5A 3BY9A 3G6OA 2QHKA 1XJ3A 3LR4A 4DJ2A 3CWFA 4ETZA 1S4RA 2ZOIA 3H9WA 4BMWA 4BBUA 1F98A 3H82B 3FC7A 4I3IA 4JGRA 4G3WA 4EXOA 4GW9A 4O8GA 2PD7A 3R7WA 3LIDA 2VX8A 5L8MA 3NOTC 2G7UA 2VV6A 2O9BA 4ZRRA 1P97A 3PBTA 3A0VA 4KUKA 4JGOA 4EQ1A 4PKYG 1BYWA 3NHQA 4ME4A 2W3EA 5I5LA 3OLOA 2KOIA 1IFQA 5HWWA 2Y79A 1TF1A 4R38A 3S7QA 2D02A 2HV1A 2BASA 3MF0A 4GHIB 4WEKA 4BWIA 3F1NB 2W3DA 4G3VA 1YKDA 1GSVA 3KYZA 2Z6DA 4HJ3A 4YOFA 5DKKA 2HJEA 4I38A 3B33A 2B18A 3KSFA 4MCWA 2A24B 2EWVA 3RTYA 4CQHA 4WUJA 3LICA 3OOVA 4GS9B 4CLCE 1WA9A 5IU1A 3E4PA 2K2NA 1MKMA 3T50A 2B02A 4YWZA 2QWSA 4MMNA 2VGLM 2W3FA 5KIZA 4EERA 5DFXA 4Q0IA 4ARZB 4DJ3A 4EEUA 2K7SA 5G4ZA 4PAUA 2MJ6A 4AFIA 3U2AA 2O9CA 3A0SA 4HNBA 2EA9A 2H28A 2L0WA 4R3AA 3TE8A 5HPIA 2J3TD 1OTEA 2WKPA 3BY8A 1N9OA 1W63Q 5KSHA 2GNXA 2W1TB 4K08A 1W63M 3MFXA 4PKYA 2O99A 3VOLA 3GECA 4Y5FA 1YSPA 3SW1A 1MC0A 2DMWA 3HJKA 2OOLA 1TS6A 2EWWA 3KSGA 3PYPA 2XRNA 4EESA 4Q0HA 4UEYA 1LL8A 2L4RA 4KQDA 4NXGA 4DN0A 3T4JA 4B93A 3GDIA 5TBMA 2OAP1 3BWLA 1T19A 2XA7M 2P08A 5J4EA 2GJ3A 5F68A 3UMEA 3FPVA 4BBTA 2HJ9C 3D72A 5HWVA 3LIBA 3OC2A 3E0YA 2WKQA 2OWJA 3C30A 3F1OA 1VHMA 1TS7A 1D06A 1YSQA 1XJ6A 1EW0A 2JKTM 3F1PA 2PR5A 3K2NA 5J7EA 3VV4A 4LPZA 4NKPA 2WKRA 2VZWA 1G6OA 4EETB 2PYPA 5HD5A 3OBFA 2XROA 2PD8A 5MC7A 1KOUA 3FPWA 4HJ6A 2OWHA 5AVEA 3UE3A 4L9GA 5G4YA 1Y28A 4CLCD 4GCZA 4F3LA 4YNRA 3T4QA 1YAXA 2VLGA 4LLOB 2KLIA 1OPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7J A;  4H6J A;  5EFW A;  2PHY A;  3H7W B;  3MQO A;  4B9O A;  3K3C A;  4XT2 B;  4EEP A;  4KUO A;  1XFQ A;  5DJU A;  4WL9 A;  3RH8 B;  2V0U A;  1LSX A;  4I3J A;  2I9V A;  3E4O A;  4HIA A;  2M1C A;  3LUQ A;  5HWT A;  3UB8 A;  2KX6 A;  4BBV A;  3NOU C;  4E04 A;  4MN6 A;  1TS0 A;  2CMN A;  1OJG A;  1ODV A;  1UGU A;  2V9A A;  1D7E A;  3ZQ5 A;  1S4S A;  3CAX A;  3VE3 A;  1OJ5 A;  3MQQ A;  3LIE A;  4HQA A;  1T1B A;  1S66 L;  1NWZ A;  1G28 A;  2JN7 A;  3E4Q A;  5HD3 A;  3NJA A;  3IS2 A;  1S1Y A;  1N9N A;  4HY8 A;  1T1A A;  1OTD A;  4I5S A;  3FG8 A;  1V9Y A;  3UB9 A;  2W27 A;  3IBR A;  3NOP C;  4L9F A;  1S67 L;  3LIA A;  1OTB A;  1DP6 A;  4I3A A;  4M4X A;  1LSW A;  3H82 A;  4HH2 A;  3ICY A;  5DKL A;  3A0R A;  2ZOH A;  3C2W A;  1P0Z A;  2INW A;  1N9L A;  1XJ2 A;  5J3W A;  3ULF A;  2VV8 A;  1UWP X;  5HSQ A;  2PR6 A;  4NXE A;  4GHI A;  3MJQ A;  3F1N A;  3KX0 X;  5HDD A;  4HP9 A;  1UWN X;  3CLO A;  5DJT A;  1TS8 A;  2YKF A;  1T1C A;  3EWK A;  4WF0 A;  1GSX A;  4NXB A;  2A24 A;  2QJ7 A;  4MN5 A;  4WN5 A;  3MR0 A;  4GS9 A;  3PHY A;  4HJ4 A;  4L9E A;  5TBM B;  4R6L A;  1S1Z A;  2ZBB A;  3K3D A;  2KDK A;  3P7N A;  1LSV A;  5F69 A;  1MZU A;  2QJ5 A;  3UB6 A;  4LRZ E;  3F1O B;  2J80 A;  3UB7 A;  5HDS A;  2JHE A;  1XFN A;  5HZH A;  3F1P B;  4HHD A;  5A8B A;  1OT6 A;  1OT9 A;  4JGP A;  4WLA A;  5F6A A;  5IS1 A;  3LI9 A;  1F9I A;  4F3L B;  4LRY C;  2W0N A;  2R78 A;  2VV7 A;  4H6J B;  2PDR A;  1T18 A;  4JGQ A;  2D01 A;  3LIF A;  3UMD A;  3UE6 A;  4I39 A;  2V1A A;  2L1M A;  3MXQ A;  1JNU A;  1VB6 A;  2V0W A;  4R70 A;  1OTI A;  3C8C A;  1V9Z A;  3HJI A;  4HI4 A;  3LI8 A;  1X0O A;  4HOI A;  1DRM A;  4EW7 A;  3EEH A;  1XJ4 A;  4NXF A;  2PYR A;  3LYX A;  4HP4 A;  1OTA A;  1LT0 A;  3VE4 A;  2Z6C A;  2VEA A;  4RQ9 A;  4LRX C;  3H7W A;  1DP8 A;  4XT2 A;  4HH3 A;  5AVF A;  5F5Y A;  2QKP A;  3IS2 B;  2YKH A;  5HDC A;  1GSW A;  2V1B A;  1DP9 A;  3BY9 A;  3G6O A;  2QHK A;  1XJ3 A;  4DJ2 A;  3CWF A;  1S4R A;  2ZOI A;  3H9W A;  4BBU A;  1F98 A;  3H82 B;  3FC7 A;  4I3I A;  4JGR A;  4EXO A;  4GW9 A;  2PD7 A;  3LID A;  3NOT C;  2VV6 A;  1P97 A;  3A0V A;  4KUK A;  4JGO A;  4EQ1 A;  4PKY G;  1BYW A;  3NHQ A;  5I5L A;  3OLO A;  5HWW A;  4R38 A;  2D02 A;  2HV1 A;  2BAS A;  4GHI B;  3F1N B;  1GSV A;  2Z6D A;  4HJ3 A;  5DKK A;  4I38 A;  3B33 A;  2A24 B;  3RTY A;  4WUJ A;  3LIC A;  4GS9 B;  1WA9 A;  5IU1 A;  3E4P A;  3T50 A;  2B02 A;  4YWZ A;  2QWS A;  5KIZ A;  4EER A;  4DJ3 A;  4EEU A;  2K7S A;  5G4Z A;  3A0S A;  4HNB A;  2EA9 A;  2H28 A;  2L0W A;  4R3A A;  1OTE A;  2WKP A;  3BY8 A;  1N9O A;  4K08 A;  3MFX A;  4PKY A;  3VOL A;  3GEC A;  3SW1 A;  2OOL A;  1TS6 A;  3HJK A;  3PYP A;  4EES A;  1LL8 A;  2L4R A;  4KQD A;  4NXG A;  3GDI A;  5TBM A;  3BWL A;  1T19 A;  5J4E A;  2GJ3 A;  5F68 A;  3UME A;  4BBT A;  3D72 A;  5HWV A;  3LIB A;  2WKQ A;  2OWJ A;  3F1O A;  1TS7 A;  1D06 A;  1XJ6 A;  1EW0 A;  3F1P A;  2PR5 A;  5J7E A;  4LPZ A;  2WKR A;  4EET B;  2PYP A;  5HD5 A;  2PD8 A;  1KOU A;  4HJ6 A;  5AVE A;  2OWH A;  4L9G A;  5G4Y A;  1Y28 A;  4GCZ A;  4F3L A;  2VLG A;  4LLO B; 
#chains in the Genus database with same CATH topology
 1VEU A;  4OOY A;  4P6Z S;  4BJP A;  2XSS A;  3WRT A;  1FIK A;  4XT2 B;  1RGY A;  4EU0 A;  4KUO A;  3WS4 A;  3GQZ A;  3QNB A;  1NYY A;  1TDL A;  5KSC A;  3UE1 A;  4WL9 A;  3UNW A;  3RH8 B;  4CPK A;  1ZTU A;  2PU4 A;  5CEB A;  2J3W A;  4EBN A;  3NOU C;  2W3H A;  3CUE A;  2HDR A;  2CMN A;  1OJG A;  3T1R A;  5TGF A;  1ODV A;  4R0Q A;  3T1S A;  2EXA A;  1UGU A;  3LR5 A;  3UB5 P;  3VOY A;  5M19 A;  3CAX A;  4L0L A;  4WM9 A;  1OJ5 A;  4U3T A;  4OON A;  2H10 A;  1T1B A;  3ZVW A;  1KVL A;  1P9W A;  5CX7 A;  3NJA A;  1N9B A;  1N9N A;  3PXP A;  2IA2 A;  4N9K A;  1K55 C;  2XFT A;  1V9Y A;  3NC8 A;  3NOP C;  2QYB A;  2VGK A;  4I3A A;  1FIL A;  1LSW A;  1ONG A;  4GDB A;  3ICY A;  1HLU P;  3NIA A;  4RX2 A;  4UA6 A;  2Y91 A;  3FWL A;  3D3O A;  4O01 A;  3AGD A;  2PBY A;  1BLS A;  3OPH A;  2ZC3 B;  3VFF A;  5DF9 A;  4QB8 A;  4QJG A;  4KG6 A;  2INW A;  1N9L A;  4GZB A;  4BLM A;  2VV8 A;  1LI0 A;  4WYY A;  1UWP X;  5HSQ A;  2ZM2 A;  4NXE A;  5CGS A;  5HW3 A;  3V50 A;  2YKF A;  3EWK A;  4WF0 A;  1K25 A;  4CLC C;  2XQZ A;  2P74 A;  4NXB A;  2JKR I;  2A24 A;  3ZG8 B;  4MN5 A;  4MDZ A;  3BLS A;  3PHY A;  2EXB A;  3JPU A;  3IXG A;  2V8C A;  1S1Z A;  1BT5 A;  2ZBB A;  2KDK A;  3IQA A;  2WUQ A;  1FR1 A;  4ARZ A;  3TJZ C;  3B47 A;  3G2Y A;  4D60 A;  5AJG A;  4LV0 A;  3F1O B;  2J80 A;  3UB7 A;  5HDS A;  1XGI A;  1ERQ A;  3CZD A;  2ZMF A;  5DFY A;  2A49 A;  3JVV A;  4KZ5 A;  5A90 A;  1OT6 A;  4N1H A;  1QMF A;  3N8L A;  3ZGA B;  3UE0 A;  2Y2P A;  5E2F A;  2WGW B;  5F6A A;  1W8Y A;  2H0T A;  1JTG A;  1VQQ A;  2G2W A;  3RXW A;  3QHY A;  2BLS A;  1I2W A;  2R78 A;  2ZL1 A;  2VV7 A;  3IWO A;  1VEU B;  2Y2H A;  4JGQ A;  3SOI A;  4O0P A;  4DE2 A;  5G18 A;  1L0D A;  3MXQ A;  5FAP A;  1HVB A;  1K54 A;  3WS1 A;  2VA0 A;  2Z2L B;  2EFX A;  4PHT A;  4OLG A;  4OPQ A;  4HBU A;  3ZHH A;  1K4E A;  3LI8 A;  4R4R A;  2PRF A;  3MBZ A;  3BEB A;  4QHC A;  1K38 A;  3KSI A;  1XJ4 A;  2IWB A;  3FV7 A;  4NG2 A;  3MSH A;  5DTK A;  3LYX A;  1OTA A;  1LT0 A;  2GDN A;  3O87 A;  2JC7 A;  2JKR M;  2Y2M A;  4LRX C;  4QD4 A;  4K0W A;  3VFH A;  3H7W A;  4JXW A;  1DP8 A;  5AVF A;  3GVB A;  1XXM A;  3AGF A;  1IOU A;  2DNS A;  3BRM A;  5FEF A;  4LCM A;  4N1X A;  2K31 A;  4OVD A;  2EFU A;  2R9W A;  5DVA A;  4OOL A;  1ZHH B;  1K55 A;  2XF3 A;  3BY9 A;  5FQM A;  3S1Y A;  3CWF A;  4ETZ A;  2JKG A;  5CHU A;  2OLV A;  2ZOI A;  3HLD A;  1W7F A;  4BBU A;  4N92 A;  3QP2 A;  4MBH A;  1OME A;  1RCJ A;  4P87 A;  3VP0 A;  4WZ5 A;  3DTE A;  3O88 A;  5L8M A;  1S0W A;  1YM1 A;  1MXO A;  2G7U A;  2VV6 A;  4KZ4 A;  2Y2K A;  1ES4 A;  3Q7V A;  4KUK A;  4OPY A;  4EQ1 A;  1BYW A;  5EE8 A;  4N9L A;  2W3E A;  2Y2J A;  3FKV A;  3LEQ A;  1IFQ A;  1TF1 A;  3S7Q A;  5CGX A;  3C7V A;  3MF0 A;  4WEK A;  1KE3 A;  3UPN A;  1H8Y A;  5FAO A;  1YKD A;  1A0K A;  3KYZ A;  1K6S A;  4YOF A;  5DKK A;  2HJE A;  4I38 A;  4MCW A;  3P09 A;  2A24 B;  4MBK A;  3RTY A;  1LI9 A;  5L2F A;  3G35 A;  3LIC A;  1ZKJ A;  1WA9 A;  2QWS A;  5KIZ A;  5DFX A;  4OP8 A;  1YLW A;  4ARZ B;  2WGV A;  2K7S A;  5G4Z A;  4EWF A;  2ZC6 B;  4JBF A;  2O9C A;  2EA9 A;  5EVL A;  2Y55 A;  3IH9 A;  4LCL A;  2WKI A;  4BEN A;  1KDS A;  4KZA A;  4P0M A;  1CF0 A;  4IED A;  4K08 A;  1WYB A;  1GCE A;  3DTK A;  4EBP A;  2QPN A;  5EVI C;  4Y5F A;  2X01 A;  4E3I A;  5HAP A;  3HJK A;  1TS6 A;  3PYP A;  4R3J A;  3W8K A;  2ZL1 B;  1PWC A;  4DN0 A;  1XPB A;  3T4J A;  4B93 A;  4IBX A;  2WKE A;  1ALQ A;  4KZ6 A;  1YLP A;  3FPV A;  3LIB A;  5FA7 A;  3C30 A;  1NXY A;  3NDE A;  1TS7 A;  4LGW A;  5EV0 A;  3GSG A;  4IBR A;  4Y0O A;  1EW0 A;  4OP5 A;  4NKP A;  2WKR A;  2VZW A;  2PYP A;  2XRO A;  1KOU A;  3ISG A;  2OWH A;  1J9M A;  4L9G A;  4EBL A;  4CLC D;  1XP4 A;  3M2J A;  1YPR A;  3MKE A;  2ZLY A;  4YNR A;  5FAQ A;  3MFD A;  4S2O A;  2P9V A;  2XFS A;  4Z1W A;  4WMC D;  3H7W B;  3T4T A;  3EQU A;  5F83 A;  3S7P A;  5EM0 A;  3QP1 A;  4GLQ A;  1XFQ A;  3PAE A;  5DJU A;  3V5M A;  1BTL A;  4BD0 A;  2V0U A;  3IX3 A;  4I3J A;  1Y4O A;  2I9V A;  1ESI A;  1DY6 A;  1ONH A;  3ZNT A;  4KQQ A;  3RXX A;  1JWV A;  1FSY A;  5GL9 A;  1TS0 A;  3T12 B;  3A3F A;  2JKF A;  4OOM A;  4GKU A;  5FQI A;  3DTI A;  4KZB A;  3WS5 A;  1D7E A;  4UQI S;  2NUP C;  2RL3 A;  3DWK A;  3VE3 A;  5FDS A;  3LR3 A;  4EQI A;  3Q7V B;  1PI4 A;  2V2F F;  4D2O A;  3TSG A;  3DBA A;  2WAE A;  3BQA A;  3HLE A;  1S66 L;  2GZA A;  1KE0 A;  3GRJ A;  4E6X A;  2J3T C;  2JN7 A;  1L0E A;  3CIT A;  3E4Q A;  1Q2Q A;  1JTD A;  4KQO A;  3LEZ A;  3TOI A;  2EX2 A;  4BL3 A;  3S7N A;  5HAQ A;  3B3X A;  3VP1 A;  3UB9 A;  2W27 A;  3IBR A;  1PW8 A;  4OH0 A;  3JYI A;  2ZD8 A;  3TW8 A;  4MBF A;  3T4K A;  1OTB A;  2WZZ A;  5CRF A;  3NBL A;  1MY8 A;  4M4X A;  2ZM0 A;  1PFL A;  1CQA A;  4HH2 A;  3DW0 A;  5AQA A;  2J7V A;  3LR0 A;  4IUK A;  3N7W A;  3EGX C;  2ZOH A;  3C2W A;  2ZQA A;  1PI5 A;  5HAI A;  1XJ2 A;  3GR2 A;  5J3W A;  1G6A A;  2A2L A;  2FFF B;  3ULF A;  1ES3 A;  2PR6 A;  1L2S A;  4GHI A;  3A3I A;  3MJQ A;  4GB7 A;  5LBR A;  1ERO A;  2Y2N A;  5DJT A;  3G31 A;  5AQ7 A;  1GSX A;  3MR0 A;  1XA7 A;  4HJ4 A;  4L9E A;  4P6Z M;  4R6L A;  1LLB A;  2H0Y A;  5C5K A;  3CPT A;  3K3D A;  3P7N A;  4FUW A;  1LSV A;  5IT5 A;  5TR7 A;  1NZU A;  5E2G A;  2HF6 A;  3D4F A;  2WGI A;  5GLA A;  2QJ5 A;  3CG5 A;  4LRZ E;  2G2U A;  1K0K A;  1TD5 A;  3FZC A;  3ZG0 A;  1G5U A;  4ESP A;  2JHE A;  4WEL A;  5DF7 A;  2WYX A;  1W8Q A;  3O86 A;  4IJG A;  1NYM A;  1EWZ A;  4JGP A;  2VJW A;  5IS1 A;  3N6I A;  3IH8 A;  1ES5 A;  3IF5 A;  4LRY C;  5HAR A;  3NY4 A;  2E8J A;  2P9V B;  3EEA A;  1T18 A;  1TEM A;  2NUT C;  3NEC A;  4I39 A;  2VGJ A;  1JNU A;  2EX9 A;  3MMH A;  4Y2F A;  4R70 A;  4KG5 A;  5M18 A;  4E3L A;  3HUM A;  2HP5 A;  1U60 A;  1M40 A;  4Y3I A;  3MZD A;  4KZ3 A;  3O3V A;  4ETX A;  4S2P A;  4HES A;  1K4F A;  3L9K A;  2ACG A;  1S6R A;  3UY6 A;  3HLB A;  3ZNY A;  4OPR A;  3A3D A;  5EVI D;  3T1X A;  5HPF A;  4FSF A;  1NY0 A;  2LB9 A;  3VE4 A;  2Z6C A;  3HCY A;  4B4Z A;  1E3U D;  1K57 A;  3CHW P;  3T4O A;  3PAG A;  1IEM A;  3IXD A;  3UN7 A;  1GSW A;  1IYQ A;  4IVK A;  1NLZ A;  2WAD A;  4O7D A;  2QHK A;  1XJ3 A;  4ZJ3 A;  4RX3 A;  1S4R A;  4S2N A;  4BQM A;  4Q8I A;  4I3I A;  3IF6 C;  4O8G A;  1DJA A;  2HPB A;  3V3R A;  3LID A;  3SZT A;  3N8S A;  4ZRR A;  3A0V A;  3E2L A;  3QNC A;  3LY4 A;  3NHQ A;  5L09 A;  1L0F A;  3ZDJ A;  5I5L A;  3HUN A;  3OLO A;  5FDH A;  5HWW A;  1BLC A;  4R38 A;  1YLT A;  5HL1 A;  2XD1 A;  2ZC7 A;  2BAS A;  4GHI B;  1E25 A;  3S4X A;  4NET A;  2ZQ7 A;  4G3V A;  3SS3 A;  4F94 A;  4ZDX A;  2Z6D A;  4QY6 A;  2B18 A;  2HDU A;  3DAV A;  4K91 A;  1Z6F A;  3OOV A;  5IU1 A;  3E4P A;  1VM1 A;  3T50 A;  2B02 A;  1H5X A;  4YWZ A;  3CPT B;  3BFF A;  4Q0I A;  4DJ3 A;  4EEU A;  2MJ6 A;  2X71 A;  2XK1 A;  2UV0 E;  3A0S A;  4HNB A;  4BD1 A;  4DDS A;  3BEC A;  1SHV A;  2J3T D;  1OTE A;  2WKP A;  4GN2 A;  5D3O A;  4B4X A;  4Y0T A;  1W63 Q;  4JPM A;  4NK3 A;  4Z9Q A;  2DMW A;  4EES A;  3FYZ A;  1ACF A;  4UEY A;  3IHA A;  3LY3 A;  2L4R A;  5GHX A;  4KQD A;  4NXG A;  1W5D A;  3GTC A;  1RGZ A;  3D9Y A;  1ZG6 A;  1Q2P A;  2BTF P;  1JWZ A;  2IWC A;  3BWL A;  4DF6 A;  2ZM8 A;  5FI6 A;  5J4E A;  2GJ3 A;  5F68 A;  4DE3 A;  2HJ9 C;  3D72 A;  5HWV A;  2WKQ A;  2OWJ A;  1TDG A;  1YLZ A;  5FI2 A;  3W4P A;  3VSK A;  2JKT M;  4QY5 A;  3WS0 A;  3F1P A;  1FQG A;  2PR5 A;  5EM1 A;  4X68 A;  4EET B;  5CHJ A;  3OBF A;  1KVM A;  4DE0 A;  1FOF A;  1GHM A;  1N4O A;  4PMA A;  3UDI A;  1IYO A;  4QWO A;  3FPW A;  3UE3 A;  4DRT A;  5G4Y A;  1IKI A;  3SS4 A;  4GCZ A;  4F3L A;  3T4Q A;  5FEG A;  3CMZ A;  2KLI A;  5GLD A;  1CEF A;  4K0X A;  5EFW A;  2PHY A;  4XUZ A;  3M6H A;  3MQO A;  3BJN A;  1GHI A;  2Q9N A;  3UO9 A;  1PW1 A;  2LB5 A;  1IYP A;  3E4O A;  3HLW A;  4HIA A;  2M1C A;  4BBV A;  2KX6 A;  2ZQ8 A;  3FKW A;  4CLC A;  5CXW A;  4E3N A;  3C38 A;  3IX4 A;  3IWQ A;  3T4L A;  1RP5 A;  3C7U A;  3OCN A;  5L07 A;  4R1G A;  2PT7 A;  5BOH A;  4WMC A;  2M7V A;  4R23 A;  1SDN A;  2VK3 A;  3MQ0 A;  4FH4 A;  1STZ A;  5CEC A;  5F82 A;  5K5B A;  1NLY A;  3KYE A;  4RYE A;  2HP9 A;  3BQ8 A;  4HQA A;  2OSU A;  1NWZ A;  1G28 A;  3RFB A;  3IS2 A;  1S1Y A;  3SH9 A;  3W4O A;  1OTD A;  3Q81 A;  4I5S A;  4MN7 A;  1GHP A;  4JXS A;  1KGE A;  1PWG A;  1L3L A;  4DXB A;  1MBL A;  2IWD A;  4L9F A;  3IXB A;  2O0Y A;  1WE4 A;  2O9A A;  1DP6 A;  3PR6 A;  4KG2 A;  1H8Z A;  1G68 A;  2W1R A;  3S7O A;  2JE5 A;  5DKL A;  4Y17 A;  4A5R A;  1CI9 A;  3A0R A;  4PM9 A;  3HBR A;  4DDY A;  2P04 A;  4II7 A;  5AQ9 A;  4QPR A;  5FL3 A;  5HL6 A;  3KSH A;  1P0Z A;  3VSL A;  4H8R A;  5A92 A;  3RJU A;  1IEL A;  3F1N A;  3KX0 X;  5FAT A;  4DE1 A;  3ZYT A;  2XDM A;  4S2I A;  1K56 D;  3BFD A;  3CUE C;  5A93 A;  4FD8 A;  4WN5 A;  2WK0 A;  1M6K A;  4KEN B;  3U4L P;  2Y2Q A;  3IBJ A;  5F69 A;  5TJJ A;  5HFO A;  2DCF A;  2Y2G A;  1MZU A;  5DTS A;  1MWU A;  3O5Y A;  3IX8 A;  1NRJ A;  3V67 A;  2VKS A;  3VP3 A;  3CI6 A;  5HZH A;  3N4I A;  3F1P B;  4HHD A;  3KYQ A;  3NI9 A;  5A8B A;  2W3G A;  4IUH A;  3ZCZ A;  1OT9 A;  1ZC2 A;  3NCK A;  5EVE A;  3L7H A;  1XKZ A;  1FCO A;  4Y0U A;  3BFE A;  1GA0 A;  4UQI M;  1F9I A;  4F3L B;  5E43 A;  2W0N A;  2PDR A;  3SS5 A;  2QZ6 A;  2VGL S;  3LIF A;  3UE6 A;  2WZX A;  2AVX A;  2L1M A;  1ES2 A;  1J3W A;  2CC1 A;  3PBR A;  2XR0 A;  3CJM A;  4EUZ A;  1OTI A;  3HLC A;  4LV3 A;  3GV9 A;  3HJI A;  1Z09 A;  3BW6 A;  4ZJ2 A;  4CLC B;  3PTE A;  3MZE A;  4DMZ A;  1DRM A;  4EW7 A;  2Z2M B;  4EUV A;  1IYS A;  5FQ9 A;  4HP4 A;  1PIO A;  2VEA A;  4G3K A;  1YMX A;  3UDF A;  1F5M A;  4HH3 A;  4WEJ A;  5CTM A;  5F5Y A;  2XA7 S;  1TVF A;  3IS2 B;  4FOF A;  5HDC A;  3TG9 A;  4E3J A;  2V1B A;  4U0X A;  1NZO A;  1YLJ A;  3Q1F A;  5EVI A;  2V20 A;  2XH9 A;  2XLN A;  3LR4 A;  4DJ2 A;  3H9W A;  3WRZ A;  4BMW A;  5A91 A;  2J9P A;  1FCM A;  1F98 A;  1E3U A;  3FC7 A;  1SKO A;  5EOE A;  2OV5 A;  4UA9 A;  4GW9 A;  4Y7P A;  3R7W A;  4LEN A;  2X02 A;  2ZQC A;  3NOT C;  2O9B A;  1P97 A;  1KGF A;  4JGO A;  2OLU A;  2XD5 A;  3IT9 A;  3DWZ A;  4X1L A;  1MWR A;  2KOI A;  4E3O A;  4HBT A;  2Y79 A;  2D02 A;  5EUA A;  4IVI A;  4XXR A;  3S22 A;  1K54 C;  3HVF A;  1MKI A;  1LHY A;  4BWI A;  4LFU A;  3F1N B;  2W3D A;  3M6B A;  2PBD P;  4X6T A;  3W4Q A;  3G4P A;  1FR6 A;  1PZP A;  2EWV A;  5JYO A;  4CLC E;  2K2N A;  1MKM A;  1O7E A;  4OKP A;  3VP4 A;  4JXG A;  4ZAM A;  5GHY A;  4Y15 A;  3M2K A;  3VOZ A;  3U2A A;  5EPH A;  3ZG9 B;  2UWX A;  1YMS A;  4GOG A;  4P6B A;  4R3B A;  3QP6 A;  3TE8 A;  5HX9 A;  2WKH A;  1O07 A;  4Y13 A;  4GNU A;  1N9O A;  3BFC A;  2GNX A;  1H0M A;  4RVA A;  3I7J A;  1PNE A;  3GMW A;  2O99 A;  3VOL A;  3GEC A;  3SW1 A;  1MC0 A;  3P98 A;  5AQB A;  2OOL A;  1AWI A;  2EWW A;  1SDE A;  5GLC A;  4DKI A;  5TBM A;  2OAP 1;  4WZ5 C;  1NJ4 A;  2P08 A;  3UME A;  1MWS A;  2B95 A;  1SCW A;  2Q9M A;  1Y54 A;  4S2M A;  1YLY A;  2Y59 A;  4E3M A;  3E0Y A;  1VHM A;  3MKF A;  3OZH A;  1D06 A;  1YSQ A;  3MXS A;  2ZC4 B;  3K2N A;  3BM6 A;  5J7E A;  2V8F A;  3VV4 A;  4LPZ A;  4X53 A;  3OPR A;  3OPL A;  1XA1 A;  3ITB A;  1DJC A;  1BUL A;  1PYY A;  3LCE A;  1YT4 A;  4X56 A;  3NDG A;  1YAX A;  2VLG A;  5IHV A;  5CHM A;  1YQS A;  1OPX A;  1BLH A;  2P7J A;  4H6J A;  2JKT I;  1DJB A;  4GD8 A;  4Q0J A;  4B9O A;  3K3C A;  4S2K A;  4E6W A;  4EEP A;  3BYD A;  3HLF A;  5EOO A;  4X1M A;  5U47 A;  3EQV A;  4ZJ1 A;  3E98 A;  4EV4 A;  1LSX A;  2WAF A;  5EVI B;  4JKT A;  4U0T A;  1GA9 A;  3LUQ A;  3UB8 A;  5HWT A;  4E04 A;  1HZO A;  4MN6 A;  3NUL A;  3QP4 A;  4PM6 A;  2C6W B;  3QP8 A;  3BLM A;  1SKO B;  4JF5 A;  2EX6 A;  2V9A A;  1L0G A;  4E3K A;  4JF6 A;  3R7W B;  2FFY A;  1BUE A;  3LFV A;  4JXV A;  3ZQ5 A;  1S4S A;  3MQQ A;  3LIE A;  4QU3 A;  2HP6 A;  3UPO A;  3EGD C;  4X55 A;  3SH7 A;  3OCL A;  2ZQ9 A;  1I5Q A;  3G30 A;  1KGG A;  5HD3 A;  3HRE A;  4MEZ A;  4HY8 A;  1T1A A;  3ZFZ A;  3FG8 A;  5GHZ A;  2XEP A;  2ZMV A;  5EEC A;  2V1Z A;  1S67 L;  3ZVT A;  3Q07 A;  3LIA A;  1HD8 A;  3V3S A;  2H5S A;  2XGN A;  3MXR A;  3H82 A;  4WBG A;  3PBN A;  4X69 A;  3SH8 A;  4JLF A;  5FQK A;  3PBQ A;  4PM7 A;  4PM5 A;  2QMI A;  2GX5 A;  1AXB A;  1D1J A;  5M1A A;  5FSR A;  2FZ0 A;  5F1G A;  3VP2 A;  2JCH A;  4NEE D;  3B42 A;  4KQR A;  4IHQ A;  2RCX A;  4C3Q A;  3KO6 A;  5HDD A;  4HP9 A;  1UWN X;  3CLO A;  5FI7 A;  1TS8 A;  3Q7Z A;  5CED A;  1T1C A;  5E2E A;  1JWP A;  2QJ7 A;  4GS9 A;  2J8Y A;  5TBM B;  1H8M A;  2A3U A;  1P9R A;  3EOI A;  4OQ0 A;  2HGV A;  2C5W B;  3UB6 A;  5DF8 A;  1XFN A;  2BG1 A;  1K56 A;  4LV2 A;  2Q0O A;  5FQQ A;  3PBO A;  2W1T A;  4UAA A;  4YFM A;  1LL5 A;  3A3E A;  3HLG A;  3IF6 A;  4WLA A;  1VET A;  3LI9 A;  1JVJ A;  2M7U A;  1XX2 A;  5JYP A;  1XGJ A;  3HUO A;  1ZG4 A;  1PZO A;  1EI5 A;  4H6J B;  2HZ5 A;  2D01 A;  3TRC A;  3UMD A;  4OLD A;  4M3K A;  2V1A A;  3PBS A;  2JBF A;  4OQG A;  3BFG A;  1PRQ A;  4C6Y A;  1VB6 A;  3WWX A;  2EX8 A;  2V0W A;  3QP5 A;  2Y8H A;  3G2Z A;  3A3J A;  4OQI A;  3C8C A;  1V9Z A;  1W79 A;  2Y2I A;  3R4K A;  4HI4 A;  1X0O A;  4HOI A;  3T1Q B;  4X25 A;  5GLB A;  5CGW A;  1K6R A;  3C4P A;  3EEH A;  4MNR A;  4ZTK A;  3W2Z A;  2HDQ A;  3P01 A;  4NXF A;  2PYR A;  4CJN A;  4OQH A;  5L10 A;  1BLP A;  4UHU A;  3ZG7 B;  3C5A A;  1MWT A;  1H3Q A;  3JVU A;  4RQ9 A;  4OPZ A;  3C4O A;  3T4S A;  2OAQ 1;  4XT2 A;  2QKP A;  1LL9 A;  4GJ4 A;  4C75 A;  2YKH A;  5CER A;  4BL2 A;  1CI8 A;  3N8R A;  1CJF A;  1DP9 A;  2ZJ9 A;  2FH5 A;  4XUX A;  3G6O A;  4FTX A;  3UDX A;  2J9O A;  3V39 A;  3H82 B;  4JGR A;  3IWI A;  4G3W A;  4EXO A;  4KZ9 A;  4YIN A;  4DXC A;  2PD7 A;  2VX8 A;  1QME A;  4FH2 A;  3PBT A;  2PAV P;  4FCF A;  5F1F A;  4PKY G;  2ZMA A;  4ME4 A;  5FAS A;  1CK3 A;  4KZ8 A;  3MS6 A;  3MZF A;  2HV1 A;  5FQJ A;  4JF4 A;  2Y4A A;  4S2L A;  3HL9 A;  1FSW A;  1ESU A;  3DTM A;  4P85 A;  5TFQ A;  1GSV A;  4HJ3 A;  1F2K A;  3B33 A;  4ID4 A;  3KSF A;  1MPL A;  4R4S A;  1BSG A;  4CQH A;  4WUJ A;  4B88 A;  4GS9 B;  1KDW A;  1WYC A;  1BZA A;  1SZV A;  4MMN A;  2VGL M;  2W3F A;  5KMW A;  4EER A;  2PU2 A;  4GD6 A;  3UPP A;  4PAU A;  1IKG A;  1E4D A;  2ZC5 B;  4MLL A;  4AFI A;  1CEG A;  4PPR A;  4S2J A;  3IXH A;  3ITA A;  2H28 A;  2L0W A;  4R3A A;  1K57 C;  1FCN A;  3ZG5 A;  5HPI A;  2DRW A;  3BY8 A;  5KSH A;  1NRF A;  2W1T B;  4ZBE A;  2HDS A;  3G32 A;  1W63 M;  3MFX A;  3IF6 B;  4PKY A;  3AGE A;  1KE4 A;  1VET B;  1YSP A;  4S2N C;  3KSG A;  2XRN A;  1ERM A;  2Y2L A;  2E8I A;  5CTN A;  4Q0H A;  4WZ4 A;  1LL8 A;  4UA7 A;  3Q82 A;  2Y2O A;  4LV1 A;  3GDI A;  4GDN A;  3G34 A;  2I72 A;  1T19 A;  2B5R A;  5E2H A;  2XA7 M;  2R9X A;  3LO7 A;  4PM8 A;  4RA7 A;  4BBT A;  5I94 A;  3OC2 A;  1PWD A;  3F1O A;  5DTT A;  1XJ6 A;  3OPP A;  1C3B A;  1G6O A;  3IHB A;  5HD5 A;  1SKF A;  4KZ7 A;  2PD8 A;  3WS2 A;  5MC7 A;  5KZH A;  2WGW A;  4HJ6 A;  5AVE A;  1I2S A;  1Y28 A;  5J8X A;  4HEF A;  2ZQD A;  3VMA A;  3E2K A;  3LGO A;  4LLO B;  1HTZ A; 
#chains in the Genus database with same CATH homology
 2P7J A;  4H6J A;  2JKT I;  4Z1W A;  4P6Z S;  2PHY A;  5EFW A;  3H7W B;  4Q0J A;  3T4T A;  4BJP A;  2XSS A;  3EQU A;  3MQO A;  3S7P A;  4B9O A;  3K3C A;  4XT2 B;  4GLQ A;  3BJN A;  4EU0 A;  4EEP A;  4KUO A;  1XFQ A;  5DJU A;  3EQV A;  3E98 A;  4WL9 A;  3RH8 B;  2V0U A;  2LB5 A;  1LSX A;  4I3J A;  1ZTU A;  2I9V A;  3E4O A;  4HIA A;  2M1C A;  3LUQ A;  2J3W A;  5HWT A;  2KX6 A;  3UB8 A;  3NOU C;  4BBV A;  4E04 A;  4MN6 A;  4CLC A;  2W3H A;  3CUE A;  3C38 A;  3T4L A;  3OCN A;  1TS0 A;  2CMN A;  1OJG A;  2PT7 A;  1ODV A;  4OOM A;  1UGU A;  3LR5 A;  2M7V A;  2V9A A;  3R7W B;  3MQ0 A;  1D7E A;  3LFV A;  4UQI S;  3ZQ5 A;  2NUP C;  1S4S A;  1STZ A;  3CAX A;  4L0L A;  3VE3 A;  5K5B A;  1NLY A;  1OJ5 A;  3LR3 A;  3MQQ A;  3BQ8 A;  3LIE A;  3DBA A;  4HQA A;  1T1B A;  3BQA A;  1S66 L;  2GZA A;  3EGD C;  1NWZ A;  1G28 A;  3OCL A;  2J3T C;  2JN7 A;  3CIT A;  3E4Q A;  1P9W A;  5CX7 A;  5HD3 A;  3NJA A;  3RFB A;  3IS2 A;  1S1Y A;  4KQO A;  1N9N A;  3PXP A;  4HY8 A;  1T1A A;  1OTD A;  2IA2 A;  3S7N A;  4I5S A;  4MN7 A;  3FG8 A;  1V9Y A;  3UB9 A;  2W27 A;  2ZMV A;  3IBR A;  3NOP C;  4L9F A;  1S67 L;  3LIA A;  2O0Y A;  2QYB A;  3TW8 A;  3T4K A;  1OTB A;  2O9A A;  1DP6 A;  3PR6 A;  4I3A A;  4M4X A;  1LSW A;  3H82 A;  4HH2 A;  3PBN A;  2W1R A;  3ICY A;  3S7O A;  5DKL A;  3PBQ A;  3A0R A;  3LR0 A;  3D3O A;  4IUK A;  2GX5 A;  2P04 A;  3EGX C;  4II7 A;  4O01 A;  2ZOH A;  3C2W A;  5DF9 A;  4QPR A;  5FL3 A;  2FZ0 A;  5HL6 A;  3KSH A;  1P0Z A;  2INW A;  1N9L A;  1XJ2 A;  5J3W A;  2A2L A;  4NEE D;  3B42 A;  3ULF A;  2VV8 A;  1UWP X;  5HSQ A;  2PR6 A;  4IHQ A;  4NXE A;  4GHI A;  3MJQ A;  3F1N A;  3KX0 X;  3KO6 A;  5LBR A;  5HDD A;  3ZYT A;  4HP9 A;  1UWN X;  3CLO A;  5DJT A;  1TS8 A;  2YKF A;  1T1C A;  3EWK A;  4WF0 A;  4CLC C;  1GSX A;  3CUE C;  2JKR I;  2A24 A;  4NXB A;  2QJ7 A;  4MN5 A;  4WN5 A;  4MDZ A;  3MR0 A;  4GS9 A;  3PHY A;  4HJ4 A;  4L9E A;  4P6Z M;  5TBM B;  4R6L A;  1S1Z A;  1H8M A;  5C5K A;  2ZBB A;  3K3D A;  2KDK A;  3P7N A;  1LSV A;  5IT5 A;  3IBJ A;  5F69 A;  5TJJ A;  4ARZ A;  1P9R A;  2HF6 A;  3TJZ C;  3EOI A;  1MZU A;  3O5Y A;  3B47 A;  2QJ5 A;  5AJG A;  2HGV A;  3UB6 A;  4LRZ E;  3F1O B;  1NRJ A;  2J80 A;  3UB7 A;  5HDS A;  3V67 A;  1TD5 A;  2VKS A;  2JHE A;  4WEL A;  3CI6 A;  1XFN A;  5HZH A;  3F1P B;  4HHD A;  2ZMF A;  5DFY A;  3JVV A;  3KYQ A;  4IJG A;  5A8B A;  2W3G A;  3PBO A;  1OT6 A;  4IUH A;  2W1T A;  1OT9 A;  4JGP A;  2VJW A;  4WLA A;  5F6A A;  5IS1 A;  3LI9 A;  4UQI M;  2M7U A;  1F9I A;  4F3L B;  4LRY C;  2W0N A;  2R78 A;  2VV7 A;  3EEA A;  2PDR A;  4H6J B;  1T18 A;  4JGQ A;  2D01 A;  4O0P A;  2NUT C;  2VGL S;  3TRC A;  3LIF A;  3UMD A;  3UE6 A;  4I39 A;  2V1A A;  3PBS A;  2L1M A;  3MXQ A;  1JNU A;  1VB6 A;  3MMH A;  2V0W A;  4Y2F A;  3PBR A;  2Y8H A;  4R70 A;  1OTI A;  2VA0 A;  3C8C A;  1V9Z A;  3HJI A;  4Y3I A;  4PHT A;  3R4K A;  3BW6 A;  4ETX A;  4HI4 A;  3LI8 A;  4CLC B;  1X0O A;  4HOI A;  4DMZ A;  1DRM A;  4EW7 A;  3EEH A;  4EUV A;  3KSI A;  3W2Z A;  1XJ4 A;  3P01 A;  4NXF A;  2PYR A;  3LYX A;  5HPF A;  4FSF A;  4HP4 A;  2LB9 A;  1OTA A;  1LT0 A;  3VE4 A;  2Z6C A;  3HCY A;  2VEA A;  4G3K A;  4RQ9 A;  1H3Q A;  3JVU A;  2JKR M;  4LRX C;  3T4O A;  3T4S A;  2OAQ 1;  3H7W A;  1DP8 A;  4XT2 A;  1F5M A;  4HH3 A;  4WEJ A;  5AVF A;  5F5Y A;  2QKP A;  1IOU A;  4GJ4 A;  2XA7 S;  3IS2 B;  4FOF A;  2YKH A;  5HDC A;  1GSW A;  2K31 A;  2V1B A;  4OOL A;  1DP9 A;  1ZHH B;  1NLZ A;  2FH5 A;  3BY9 A;  3G6O A;  2QHK A;  1XJ3 A;  3LR4 A;  4DJ2 A;  3CWF A;  4ETZ A;  1S4R A;  2ZOI A;  3H9W A;  4BMW A;  4BBU A;  1F98 A;  3H82 B;  3FC7 A;  4I3I A;  4JGR A;  4G3W A;  4EXO A;  4GW9 A;  4O8G A;  2PD7 A;  3R7W A;  3LID A;  2VX8 A;  5L8M A;  3NOT C;  2G7U A;  2VV6 A;  2O9B A;  4ZRR A;  1P97 A;  3PBT A;  3A0V A;  4KUK A;  4JGO A;  4EQ1 A;  4PKY G;  1BYW A;  3NHQ A;  4ME4 A;  2W3E A;  5I5L A;  3OLO A;  2KOI A;  1IFQ A;  5HWW A;  2Y79 A;  1TF1 A;  4R38 A;  3S7Q A;  2D02 A;  2HV1 A;  2BAS A;  3MF0 A;  4GHI B;  4WEK A;  4BWI A;  3F1N B;  2W3D A;  4G3V A;  1YKD A;  1GSV A;  3KYZ A;  2Z6D A;  4HJ3 A;  4YOF A;  5DKK A;  2HJE A;  4I38 A;  3B33 A;  2B18 A;  3KSF A;  4MCW A;  2A24 B;  2EWV A;  3RTY A;  4CQH A;  4WUJ A;  3LIC A;  3OOV A;  4GS9 B;  4CLC E;  1WA9 A;  5IU1 A;  3E4P A;  2K2N A;  1MKM A;  3T50 A;  2B02 A;  4YWZ A;  2QWS A;  4MMN A;  2VGL M;  2W3F A;  5KIZ A;  4EER A;  5DFX A;  4Q0I A;  4ARZ B;  4DJ3 A;  4EEU A;  2K7S A;  5G4Z A;  4PAU A;  2MJ6 A;  4AFI A;  3U2A A;  2O9C A;  3A0S A;  4HNB A;  2EA9 A;  2H28 A;  2L0W A;  4R3A A;  3TE8 A;  5HPI A;  2J3T D;  1OTE A;  2WKP A;  3BY8 A;  1N9O A;  1W63 Q;  5KSH A;  2GNX A;  2W1T B;  4K08 A;  1W63 M;  3MFX A;  4PKY A;  2O99 A;  3VOL A;  3GEC A;  4Y5F A;  1YSP A;  3SW1 A;  1MC0 A;  2DMW A;  3HJK A;  2OOL A;  1TS6 A;  2EWW A;  3KSG A;  3PYP A;  2XRN A;  4EES A;  4Q0H A;  4UEY A;  1LL8 A;  2L4R A;  4KQD A;  4NXG A;  4DN0 A;  3T4J A;  4B93 A;  3GDI A;  5TBM A;  2OAP 1;  3BWL A;  1T19 A;  2XA7 M;  2P08 A;  5J4E A;  2GJ3 A;  5F68 A;  3UME A;  3FPV A;  4BBT A;  2HJ9 C;  3D72 A;  5HWV A;  3LIB A;  3OC2 A;  3E0Y A;  2WKQ A;  2OWJ A;  3C30 A;  3F1O A;  1VHM A;  1TS7 A;  1D06 A;  1YSQ A;  1XJ6 A;  1EW0 A;  2JKT M;  3F1P A;  2PR5 A;  3K2N A;  5J7E A;  3VV4 A;  4LPZ A;  4NKP A;  2WKR A;  2VZW A;  1G6O A;  4EET B;  2PYP A;  5HD5 A;  3OBF A;  2XRO A;  2PD8 A;  5MC7 A;  1KOU A;  3FPW A;  4HJ6 A;  2OWH A;  5AVE A;  3UE3 A;  4L9G A;  5G4Y A;  1Y28 A;  4CLC D;  4GCZ A;  4F3L A;  4YNR A;  3T4Q A;  1YAX A;  2VLG A;  4LLO B;  2KLI A;  1OPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...