3BLMA

Refined crystal structure of beta-lactamase from staphylococcus aureus pc1 at 2.0
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Refined crystal structure of beta-lactamase from Staphylococcus aureus PC1 at 2.0 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 94
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1990-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3blmA00
4WZ4A 3W4PA 1EROA 3IH8A 1K6RA 3DWKA 1ERMA 1JTDA 1FSWA 1NRFA 3GSGA 3LCEA 1BLSA 2Y2KA 4QD4A 1VQQA 2H10A 3S22A 2Y2PA 3V39A 4PM9A 1W79A 4OOYA 2HP6A 3V5MA 1PZPA 4OLGA 1W8YA 3I7JA 1VM1A 1YLJA 1NY0A 4IBRA 4M3KA 3GTCA 4JXWA 4KZ7A 4QU3A 4WZ5C 2ZQCA 5IHVA 3MKEA 2R9XA 5DF8A 4S2OA 4KZ5A 3PAEA 4JLFA 2R9WA 2ZC3B 2ZJ9A 3AGFA 4JBFA 4DXBA 1JVJA 2V2FF 5E2FA 5F1FA 1FR6A 2J9OA 1S0WA 1GHIA 4C6YA 4FH4A 3UE0A 1TVFA 2ZQ7A 5GL9A 5FQ9A 4K91A 2V20A 4KQQA 1NYYA 3HLCA 1LL9A 3S4XA 1K57C 3EQVA 1GCEA 1IYSA 3G2YA 3ZNTA 4UA9A 3IWOA 3BFDA 5A92A 1BLHA 4B4ZA 1GA0A 1BZAA 2XFSA 5BOHA 1WYCA 4UA6A 2Y4AA 4IEDA 2PBYA 2JCHA 1JTGA 3EQUA 3IXBA 1ONHA 4P87A 1SDNA 1XKZA 4BD1A 3OPLA 4OQHA 3MBZA 4UA7A 1PI4A 4OQGA 3IQAA 4X56A 1ES5A 4MEZA 1FOFA 2IWDA 1NJ4A 4BQMA 1GHPA 2OV5A 3GRJA 4RVAA 4HESA 4OPZA 1ONGA 5EE8A 1YM1A 2WKIA 4R4RA 1PW1A 2J9PA 5E2HA 1O7EA 3WRTA 3SH7A 2V1ZA 3FKWA 3LEZA 1PIOA 3BEBA 3JYIA 4WM9A 1PWDA 2X01A 4LV3A 2XD1A 5EVIB 1CI8A 4HBTA 5D3OA 4KQRA 3G35A 1E25A 2WGVA 1EWZA 4R23A 5CHJA 3VP4A 4KQOA 4F94A 2DRWA 2A49A 1L0FA 1LI9A 1BUEA 3OCLA 4HBUA 4IBXA 4GB7A 1FQGA 3A3JA 4BLMA 3PAGA 4GDBA 2X02A 4K0XA 2XQZA 1PWGA 1MWSA 4JXVA 4L0LA 1SDEA 3BRMA 3MZFA 1PZOA 1WYBA 1XA1A 3ITAA 1LI0A 5FQMA 2Z2MB 3A3IA 3FKVA 5FI7A 3FYZA 3FWLA 3IXGA 4JF5A 3ZNYA 4OQIA 3VP1A 3W4OA 2B5RA 5DTKA 2QMIA 2HDQA 3VFFA 4N92A 2WGWB 4B4XA 1ZG6A 5CXWA 1DJCA 3NIAA 3UDFA 2Z2LB 3AGDA 3CG5A 4LV1A 1I2SA 4ZJ3A 3LY4A 3VSLA 4MLLA 2ZM0A 3IWIA 1QMFA 4WYYA 4YFMA 3A3DA 2WAEA 4FH2A 2X71A 1IEMA 5DTTA 2HP5A 3SS5A 3G34A 4YINA 3ZGAB 3O3VA 4U0XA 4EBLA 4DDSA 2EX2A 1BLCA 1ES4A 1I5QA 1YQSA 2Y2HA 1IYOA 5FDHA 1N4OA 3E2LA 1YMSA 4N9LA 4S2IA 1K54C 1Z6FA 4UHUA 1XX2A 3NCKA 3VOYA 4E3MA 3UPPA 4FD8A 2I72A 3A3EA 1NZOA 3UO9A 3HUOA 4OONA 5DTSA 4S2NA 3BFCA 1IKIA 2CC1A 2EX8A 4GOGA 4Y0OA 3N8RA 5CGSA 3S1YA 2G2UA 4PMAA 3NI9A 4PM7A 1ESIA 3HBRA 4PPRA 4ZAMA 5EOEA 3ZG7B 5A90A 3NDGA 2J7VA 3Q7ZA 3SS3A 4ZTKA 2P9VA 2UWXA 3N8LA 4DDYA 5EOOA 1KDWA 3N6IA 2EX9A 1AXBA 3RXWA 1TDGA 3BFEA 3BFGA 2HDUA 3BM6A 2Y55A 3RXXA 4S2LA 4KZ4A 4WMCA 3G30A 3C5AA 1FR1A 2ZM2A 5AQAA 1MBLA 2ZC7A 1JWVA 1K6SA 1BSGA 5L2FA 4IVKA 4ZBEA 4QJGA 2G2WA 3UE1A 1PWCA 4QHCA 3HLEA 2PU2A 3MKFA 3MZDA 5FA7A 3DWZA 5FAOA 1ESUA 4GD6A 1K38A 2OLUA 4R3JA 5EVIA 1YLZA 2ZQ9A 3NBLA 4Q8IA 1K25A 3OCNA 2HP9A 3Q07A 5DVAA 1TEMA 4XUXA 4DKIA 4N1XA 2Y91A 4R1GA 4KENB 4P0MA 1XGJA 5TFQA 3ZVWA 1IELA 3CMZA 2WUQA 3GQZA 3HLBA 5GHZA 5CERA 1CEFA 1HD8A 1MPLA 3N7WA 2WKEA 3QNCA 3TSGA 5FATA 1H8ZA 5J8XA 4X68A 3IHBA 5HAIA 3SH8A 1GA9A 4OH0A 5EECA 2A3UA 1CK3A 3AGEA 4KZAA 4GD8A 4WBGA 4E6XA 2HPBA 4OPQA 3NC8A 4S2PA 1BT5A 4WEJA 2P9VB 3WS5A 4EV4A 1W8QA 4FSFA 1YLWA 4X53A 2WK0A 2WGWA 5GLCA 4S2NC 1BLPA 5FSRA 1IYQA 2WZZA 3B3XA 1KVLA 4LENA 4S2JA 5FQQA 3A3FA 4OPRA 1K56D 3OPRA 1MXOA 1XP4A 2ZC5B 3ZDJA 1WE4A 4E6WA 1QMEA 4O7DA 5GLBA 3HL9A 3UY6A 2VGJA 3BECA 2Y2MA 3IF5A 2Y2NA 5FAPA 1KGGA 1KE0A 2ZC4B 3HLGA 2C6WB 1MKIA 1J9MA 3Q7VB 3GR2A 1K55A 5GHXA 4PM8A 2E8IA 2RL3A 1I2WA 3VFHA 4EUZA 3OZHA 3OPPA 1L0DA 1NYMA 3M2JA 5CRFA 4ZJ2A 1MY8A 4MBFA 1PW8A 5EVIC 4QY5A 1LL5A 4MBKA 4OKPA 5KZHA 3NY4A 2XR0A 3BFFA 4KZ9A 1K4EA 3IH9A 1ZG4A 1MWTA 3DW0A 4N1HA 4Z9QA 3ZG9B 4Y7PA 2XEPA 3UN7A 1OMEA 4QB8A 5M18A 4S2KA 2Q9MA 4RYEA 3MFDA 3QHYA 1JWPA 4BL3A 1RCJA 3VSKA 4EWFA 3NDEA 5GLAA 3ZCZA 3IHAA 5FAQA 4NK3A 2P74A 2XH9A 2Y59A 2IWBA 5FQKA 4WZ5A 3CJMA 3N8SA 4GKUA 5TGFA 1PI5A 5CECA 2GDNA 4RX3A 3M6HA 5FASA 5M19A 2WADA 2Y2QA 1RGZA 3IF6B 5KSCA 5FI2A 2Y2LA 4B88A 3BLMA 4OP5A 3WS2A 1BULA 3LY3A 5HARA 4P6BA 3C7UA 1K57A 4R3BA 4LV2A 3MZEA 3G4PA 1XPBA 1KE4A 4KZ3A 1N9BA 1ZC2A 3G2ZA 2OSUA 3DTMA 2ZC6B 4KG5A 1YLTA 1RP5A 3HVFA 1FCMA 5TR7A 3TOIA 1GHMA 2EXAA 2Q9NA 1E3UA 1W5DA 4N9KA 4CJNA 1KVMA 2ZQ8A 3PBTA 3WWXA 4WELA 4DXCA 4FCFA 4HEFA 1RGYA 3W4QA 3P09A 1M40A 3ZVTA 4OQ0A 5FI6A 5FQJA 3HLFA 5CEBA 3N4IA 3UPOA 5CHMA 5EVID 2Y2GA 5CTMA 5KSHA 3SS4A 5JYOA 1IYPA 4QY6A 4PM6A 5G18A 1O07A 3HUNA 1Y54A 4R4SA 4DE0A 4DE2A 3O87A 3C7VA 3LO7A 3HUMA 3BYDA 2QPNA 4KZ6A 3WS0A 5GHYA 2XK1A 4Y0TA 4E3KA 5AQ7A 4LV0A 4MBHA 1FCOA 5E2EA 2XD5A 2ZM8A 2WAFA 3Q7VA 4OLDA 3ZHHA 4X6TA 4C75A 3GV9A 1C3BA 2WKHA 3IT9A 4KG6A 2XLNA 2XF3A 5CHUA 2Y2JA 2Y2IA 3UE3A 4EQIA 3GMWA 1LLBA 5F82A 3ZG8B 5CEDA 4LCMA 2Y2OA 3UNWA 1KDSA 3VOZA 4MNRA 3V50A 4ZDXA 1YLPA 3MXSA 1DY6A 2FFYA 3OC2A 2JE5A 3VP2A 3C4OA 1KE3A 2PU4A 1FCNA 1SKFA 5HAQA 1LHYA 5HAPA 3BLSA 5AQ9A 3TG9A 3GVBA 3IXHA 3PBQA 3HLDA 2EXBA 4U0TA 2H0TA 4BJPA 3O88A 2WYXA 1MWRA 1NZUA 1S6RA 2XFTA 3CZDA 1EI5A 1G68A 1ES3A 1L2SA 3PBNA 1H5XA 4JKTA 4UAAA 3IXDA 3VP3A 4X55A 2EX6A 5I94A 4E3JA 1NXYA 4RA7A 3PTEA 2ZLYA 5F1GA 5A93A 2JC7A 5GLDA 5CTNA 3V3RA 1DJBA 3IF6A 3RJUA 3M2KA 5JYPA 5A91A 4NETA 4OP8A 3M6BA 3P98A 4BL2A 1ES2A 4DE3A 4DF6A 3UDIA 3HLWA 2ZQAA 4DE1A 1CEGA 1K4FA 1K54A 2WZXA 3G31A 3G32A 3MXRA 2EFXA 4JF4A 1YLYA 1ALQA 1KGFA 3C4PA 1SCWA 4EBNA 2ZD8A 1U60A 4XUZA 4R0QA 4C3QA 4E3OA 1TDLA 1MWUA 5U47A 2BG1A 1HTZA 2FFFB 3ITBA 3ZFZA 3UDXA 4DRTA 4U3TA 1L0EA 3VP0A 4GDNA 4D2OA 5HFOA 2HDRA 2QZ6A 1K56A 3FV7A 3PBSA 2OLVA 5M1AA 1PYYA 2JBFA 4BENA 1M6KA 4ID4A 4IVIA 5HL1A 4LCLA 5FQIA 4OOMA 5CGXA 2DCFA 2ZMAA 4KZ8A 5EVLA 2XDMA 5DF9A 3D4FA 4GZBA 4JPMA 4X69A 1HVBA 4XXRA 1Q2QA 2HDSA 2RCXA 5DF7A 3ISGA 2H5SA 1XGIA 4KG2A 1E4DA 3FZCA 3V3SA 3PBRA 3SOIA 4P85A 4K0WA 2IWCA 4JXGA 4BD0A 1IKGA 1XA7A 4JF6A 3UPNA 5EUAA 4WEKA 5EPHA 3Q82A 3WS4A 1E3UD 5CGWA 1G6AA 4OOLA 5E2GA 1HZOA 3O86A 4A5RA 1KGEA 2VGKA 4GN2A 2C5WB 3WRZA 1H8YA 1W7FA 3HREA 1DJAA 1CI9A 4Y0UA 1BTLA 1FSYA 3IWQA 3OPHA 4E3IA 1YT4A 4OPYA 4WMCD 4PM5A 3QNBA 4EBPA 2ZQDA 2DNSA 2XGNA 2J8YA 4OVDA 3WS1A 3IF6C 4JXSA 1JWZA 5F83A 1XXMA 2BLSA 4S2MA 1YMXA 5AQBA 5KMWA 1K55C 3PBOA 4KZBA 4RX2A 5E43A 4E3LA 3ZG5A 2H0YA 1L0GA 4GNUA 1SHVA 3Q1FA 3Q81A 5HX9A 4ZJ1A 5HW3A 2WGIA 3ZG0A 3W8KA 3E2KA 4H8RA 3VMAA 4CPKA 2EFUA 4E3NA 1Q2PA 3SH9A 1ZKJA 1ERQA
chains in the Genus database with same CATH superfamily
2W3EA 4WZ4A 2KDKA 3DWKA 3TE8A 1JTDA 3B33A 4LLOB 1FSWA 2H10A 2Y2PA 4PM9A 5EFWA 2Q0OA 3V5MA 1W8YA 5KIZA 1VM1A 3MR0A 4IBRA 4JXWA 1XFQA 4QU3A 1Y28A 2R9XA 4LRYC 4JLFA 3AGFA 4DXBA 2V2FF 5E2FA 1FR6A 3KYEA 1GHIA 3W2ZA 5GL9A 3ULFA 1SZVA 1LL9A 1Y4OA 3EQVA 4IUKA 3G2YA 1D7EA 3P7NA 1IFQA 1BZAA 2A24B 5K5BA 1ONHA 1OTBA 3OPLA 4OQHA 4X56A 1ES5A 4MEZA 1FOFA 4BQMA 3GRJA 3SH7A 2V1ZA 3FKWA 2DMWA 3JYIA 3UB8A 2X01A 5EVIB 2O9BA 4HBTA 5D3OA 3G35A 1E25A 2WGVA 2J3WA 3VP4A 1F9IA 5FDSA 2V1BA 2A49A 1L0FA 1LI9A 1BUEA 4JGPA 4HBUA 4IBXA 3E98A 1FQGA 3KSGA 3ZQ5A 1P0ZA 3OOVA 1T18A 3PAGA 3QP5A 4GDBA 5TBMA 2JKFA 2PRFA 3S7QA 1MKMA 4JXVA 3MZFA 1OT9A 1WYBA 1XA1A 3ITAA 3FKVA 3S7OA 3FWLA 2B5RA 5DTKA 5L09A 2WGWB 3LYXA 4LV1A 4ZJ3A 3A0VA 4HJ3A 2ZM0A 4B9OA 2VGLS 4LGWA 2EWVA 4CQHA 5DTTA 3R7WB 2EX2A 3MJQA 2KOIA 1TS6A 1IYOA 3A0SA 1YMSA 2W3GA 4E3MA 3NCKA 4OONA 3EOIA 3BFCA 5CGSA 3S1YA 2G2UA 2A24A 3BQAA 2NUPC 5EOEA 5A90A 3CUEA 3Q7ZA 3SS3A 2P9VA 2UWXA 5EOOA 1KDWA 2W1TB 2J3TC 1TDGA 2FH5A 4CLCB 2Y55A 4S2LA 3G30A 2ZM2A 4ZBEA 2O9CA 3LR4A 4QHCA 3MKFA 5FAOA 5EVIA 4R3JA 1YLZA 4Q8IA 1LL8A 1P97A 3DTKA 3A0RA 4FTXA 4EQ1A 5TFQA 3ZVWA 3GQZA 3HLBA 5CERA 3LR0A 3VOLA 3TSGA 2Y79A 1GA9A 4ME4A 4KZAA 2E8JA 4WBGA 3JVVA 1BT5A 4WEJA 2ACGA 3E4OA 2WK0A 2WGWA 5FSRA 1BLPA 3CITA 1DP6A 3TRCA 2J3TD 3HJIA 3MSHA 3R7WA 5GLBA 2VGJA 3K3CA 3BECA 2Y2MA 2NUTC 1KE0A 4L9GA 1MKIA 2C6WB 1J9MA 3GR2A 2O0YA 3H9WA 2OWJA 1MY8A 4MBFA 1PW8A 3IH9A 4X1MA 4N1HA 2VA0A 2W1TA 3ZG9B 3UN7A 3RH8B 4CLCA 3U2AA 2Q9MA 4RYEA 3MFDA 3QHYA 3T1RA 1RCJA 3NDEA 4LFUA 2YKFA 4RX3A 1S1YA 1V9YA 2PD8A 3C7UA 1K57A 3KSHA 4KZ3A 1P9WA 2ZC6B 1YLTA 5TR7A 1E3UA 1TF1A 1W5DA 2ZQ8A 4DXCA 1RGYA 3T4LA 3DTIA 5CEBA 1OTAA 2Y2GA 4HIAA 5JYOA 1IYPA 4WUJA 2UV0E 1O07A 3O87A 3HUMA 3MQ0A 5GHYA 5G4YA 4LV0A 2ZM8A 3H82A 2W3DA 3IT9A 4NXFA 1CF0A 4Y17A 1P9RA 5CEDA 3VOZA 2JN7A 3V50A 5HSQA 1MZUA 3VP2A 2PT7A 1LHYA 3TG9A 3IXHA 2H0TA 4JKTA 3NECA 3IXDA 3VP3A 3GECA 4HI4A 2Y8HA 5LBRA 2WKPA 4RA7A 5F1GA 4E3JA 2R78A 1YSPA 1DJBA 1OJGA 4BL2A 1ES2A 1STZA 2HJEA 3HLWA 1CEGA 2WZXA 3MXRA 2EFXA 1KGFA 3C4PA 2LB9A 3UMEA 1TDLA 1OJ5A 5U47A 3FPVA 3ZFZA 4U3TA 3VP0A 4GDNA 5HFOA 3OBFA 4LRZE 2OLVA 2K31A 1TS7A 3R4KA 5CGXA 2ZMAA 5EVLA 3D4FA 1HVBA 3T4JA 4KG2A 2KX6A 1G28A 1IOUA 2A2LA 3MQQA 3Q82A 2QJ5A 4Q0IA 4EW7A 2PR6A 4KQDA 1H8YA 1W7FA 3HREA 2JKRI 4E3IA 3QNBA 5A8BA 2J8YA 3WS1A 1JWZA 1XXMA 2PYPA 5KMWA 2H0YA 1SHVA 5HW3A 4X1LA 2WGIA 4Y13A 4CPKA 1GSXA 1Q2PA 3W4PA 1VHMA 3LCEA 1BLSA 1SKOB 2Y2KA 4QD4A 3V39A 1F98A 2HP6A 3TW8A 1LSVA 1YLJA 3GTCA 3T1QB 5I5LA 2VEAA 5EV0A 1D06A 2ZJ9A 1VETB 1JVJA 4EU0A 1ZHHB 5F1FA 3SZTA 2XROA 4C6YA 1TVFA 2ZQ7A 5FQ9A 2B02A 2JKTI 3HLCA 1K57C 4UA9A 3IWOA 1LSWA 4B4ZA 3L9KA 3EQUA 4BD1A 4IHQA 1NJ4A 2V8FA 4HESA 1YM1A 1PW1A 5G4ZA 4CLCD 3FC7A 4Y15A 2XD1A 1S4RA 1CI8A 1EWZA 3LI8A 4R23A 3OCLA 4GB7A 4EEPA 3A3JA 4BLMA 3EEHA 3PR6A 1PWGA 4L0LA 3BRMA 5IT5A 5FQMA 1LI0A 3FYZA 2VV8A 3K3DA 3VP1A 1SKOA 2EWWA 4KUKA 1TS0A 2Z6CA 3NIAA 3CG5A 4NXBA 3LY4A 1IEMA 1VETA 4YINA 2VZWA 4U0XA 5AJGA 1BLCA 1I5QA 4E04A 2Y2HA 4S2IA 3A3EA 1NZOA 3HUOA 4GOGA 2EX8A 3E0YA 5MC7A 2VKSA 4ZAMA 2J7VA 4ZTKA 3N8LA 2EX9A 1AXBA 3RXWA 3NULA 3BFGA 5AQAA 2ZC7A 4QJGA 2PAVP 3T4QA 3HLEA 2PU2A 3F1PB 1OTIA 4GD6A 4EXOA 2ZQ9A 3NBLA 2OWHA 4QWOA 1OTDA 2AVXA 4KENB 3CMZA 2WUQA 1CEFA 1HD8A 3N7WA 3QNCA 5FATA 3P01A 1CK3A 2VLGA 3AGEA 4E6XA 2VGLM 2HPBA 2P9VB 2V8CA 3VE4A 1YSQA 2WZZA 3F1OB 4OPRA 4E6WA 1D1JA 5IS1A 1K55A 4PM8A 4G3WA 4EUZA 3OZHA 3M2JA 3KYZA 4OKPA 3NY4A 3BFFA 4KZ9A 1K4EA 2HJ9C 1MWTA 2M7VA 4Y7PA 1OMEA 3QP8A 4DJ3A 2MJ6A 2L1MA 3UE6A 2ZL1A 3RFBA 4CLCE 1JWPA 4BL3A 3G6OA 3VSKA 4DMZA 3F1PA 1T1AA 4NK3A 2Y59A 3N8SA 4GKUA 2GDNA 3T4SA 3M6HA 5HDDA 2Y2QA 3LIFA 3BLMA 3WS2A 1BULA 1H0MA 2XSSA 4R3BA 1S66L 3MZEA 3G2ZA 2OSUA 3DTMA 4KG5A 1RP5A 3TOIA 1KVMA 3PBTA 3WWXA 3CPTB 3N4IA 5L10A 5CTMA 3F1OA 5DKLA 3T4OA 4QY6A 2B18A 5G18A 1EW0A 2I9VA 3ZYTA 4I3JA 1OTEA 4KZ6A 1CJFA 4Y3IA 4X6TA 3S7PA 2LB5A 2WKHA 4HJ4A 5CHUA 2Y2JA 1T1BA 1KDSA 1YLPA 4GJ4A 2JE5A 1SKFA 4IJGA 3BLSA 5HAPA 3GVBA 3PBQA 4PAUA 4BJPA 3LICA 1J3WA 1MWRA 1NZUA 1S6RA 2XFTA 3CZDA 4YWZA 1G68A 2HF6A 5J4EA 1H5XA 2EX6A 2W1RA 2JC7A 5GLDA 3V3RA 3QP1A 5JYPA 5A91A 3M6BA 3P98A 4DF6A 4DE1A 3H82B 3G31A 4JF4A 2QYBA 3B47A 1ALQA 3OLOA 1SCWA 3T1XA 3IS2B 4MN5A 4DN0A 1MWUA 2BG1A 3ITBA 3TJZC 3CPTA 5HZHA 3DTEA 3FV7A 1K56A 1G5UA 4ZRRA 5M1AA 3FG8A 4BENA 4IVIA 4ID4A 4Y5FA 1VB6A 2XDMA 5DF9A 4GZBA 2PR5A 4JPMA 4HP4A 1Q2QA 2XA7S 1PFLA 3ISGA 2V9AA 3SW1A 3V3SA 3NJAA 2L0WA 4K0WA 3LR3A 1XJ6A 3E4PA 4BD0A 1IKGA 1YPRA 5EPHA 3CHWP 1TD5A 4OOLA 1KGEA 2VGKA 1AWIA 3WRZA 1FSYA 3OPHA 1YT4A 3CI6A 4OPYA 4Q0JA 4GW9A 4OVDA 1DP9A 2INWA 4HQAA 3DBAA 4JXSA 3T4TA 5F83A 4S2MA 2PDRA 5AQBA 5TJJA 1K55C 4E3LA 4GNUA 3E4QA 3Q1FA 1ACFA 3VMAA 2G7UA 1N9LA 3JPUA 1ZKJA 4R6LA 4GS9B 3IH8A 1K6RA 3IX4A 1NRFA 3GSGA 1L3LA 4YNRA 1W79A 2VV7A 2PHYA 1PZPA 1DRMA 1NY0A 4KZ7A 3H7WB 3IS2A 2ZQCA 5IHVA 4S2OA 4KZ5A 3PAEA 2R9WA 2VK3A 2ZC3B 4JBFA 5AVFA 3CWFA 4I3IA 2J9OA 3UE0A 3LIAA 4K91A 1NYYA 3S4XA 1LT0A 3BFDA 5A92A 4RQ9A 1T1CA 1BLHA 1GA0A 2XFSA 5HPFA 3MF0A 1VEUB 2Y4AA 3LIEA 2XRNA 5HWWA 2FZ0A 2JCHA 1JTGA 3IXBA 3MS6A 3MXQA 2QHKA 1SDNA 1XKZA 3T50A 4UA7A 1PI4A 4OQGA 4NKPA 1GHPA 1PNEA 4RVAA 5EE8A 5E2HA 1O7EA 3WRTA 2PBDP 4F3LB 3VV4A 3LEZA 4WM9A 1PWDA 4LV3A 5C5KA 4KQRA 5F68A 4F94A 4KQOA 2DRWA 4GHIB 4HNBA 4WF0A 2X02A 4MN6A 1S1ZA 4Q0HA 1MWSA 2YKHA 4BBUA 3A3IA 3UB6A 3IXGA 4GS9A 4JF5A 2IA2A 3ZNYA 3LUQA 3W4OA 4X25A 2Z6DA 2QMIA 5FL3A 2HDQA 5IU1A 4N92A 4B4XA 5CXWA 3UDFA 2Z2LB 3AGDA 3D72A 1WA9A 2ZOIA 4MLLA 3H7WA 3IWIA 2O99A 3A3DA 4LRXC 2WAEA 4O8GA 2HP5A 3ZGAB 4EBLA 4BBTA 4DDSA 4EETB 1F2KA 1ES4A 5DJUA 4O01A 4N9LA 3BJNA 3VOYA 3UPPA 2I72A 3C2WA 4O0PA 1IKIA 1FIKA 1FILA 2W0NA 1VEUA 1ESIA 3HBRA 4R3AA 3NHQA 3NDGA 3C38A 4HY8A 3IBJA 4DDYA 3MFXA 3N6IA 4HH2A 2HDUA 4II7A 3IX3A 1FR1A 5HWTA 3BQ8A 1MBLA 1JWVA 3O5YA 1K6SA 4G3VA 4F3LA 5L2FA 2G2WA 4P6ZM 1ESUA 1K38A 1K25A 3OCNA 2HP9A 4XUXA 3DAVA 2WKRA 4GHIA 4R1GA 4P0MA 1XGJA 4HH3A 1IELA 4HJ6A 2WKEA 2ZMVA 3IHBA 3UMDA 3SH8A 5EECA 2A3UA 4GD8A 4S2PA 4OPQA 3NC8A 3WS5A 4EV4A 1HLUP 1W8QA 3S7NA 4FSFA 2O9AA 4I5SA 4S2NC 5F69A 1F5MA 1IYQA 3B3XA 1KVLA 5FQQA 4S2JA 1BYWA 1K56D 3OPRA 3IX8A 2ZC5B 1W63M 2BTFP 4L9FA 3IF5A 5DFYA 5FAPA 2ZC4B 1NLZA 3HLGA 3Q7VB 5GHXA 2RL3A 3VFHA 1LSXA 4P6ZS 3OPPA 1L0DA 4PHTA 1NYMA 4ZJ2A 2V1AA 5CRFA 2W3FA 4QY5A 2XR0A 4NXEA 4GLQA 1ZG4A 3DW0A 4I3AA 1S4SA 2XEPA 1UGUA 5M18A 4NG2A 4KUOA 4S2KA 1ZTUA 4PKYA 5GLAA 3ZCZA 3IHAA 2P74A 2XH9A 2IWBA 4WZ5A 5TGFA 5CECA 1PI5A 5M19A 4I39A 1RGZA 2Y2LA 4B88A 4BMWA 4OP5A 5DFXA 5EM0A 4LV2A 3G4PA 3CLOA 4R70A 1KE4A 1NLYA 2HZ5A 4NXGA 3CAXA 3HVFA 4D60A 2EA9A 1FCMA 1GHMA 2Q9NA 1DP8A 4FCFA 2P04A 3P09A 5FI6A 1H8MA 3HLFA 3UPOA 2ZL1B 1T19A 2WKQA 3KSFA 1Y54A 4R4SA 5HD5A 4DE0A 4EEUA 4DE2A 3C7VA 1S67L 3BYDA 3ICYA 3WS0A 2XK1A 4Y0TA 2K7SA 4E3KA 4YOFA 4MBHA 5AQ7A 5E2EA 2WAFA 3Q7VA 4UQIS 3LEQA 4C75A 3GV9A 2XLNA 4JGOA 4MDZA 3GDIA 3GMWA 3ZG8B 4LCMA 3UNWA 4MNRA 4ZDXA 2JHEA 5HDSA 1DY6A 3BY8A 3OC2A 2K2NA 3C4OA 1KE3A 1FCNA 5HAQA 3HLDA 3O88A 2WYXA 1EI5A 1ES3A 2OOLA 2VV6A 1NXYA 3PTEA 4BBVA 4FUWA 4M4XA 2B95A 5HD3A 1K54A 2GZAA 4B93A 1U60A 4XUZA 4R0QA 4E3OA 4R38A 1HTZA 3KO6A 3UDXA 4DRTA 4D2OA 2HDRA 2QZ6A 3PBSA 1PYYA 4LCLA 3RTYA 4KZ8A 5CX7A 4XXRA 2RCXA 3BY9A 2JKRM 3T4KA 3FZCA 1XA7A 4JF6A 4WEKA 2D01A 1G6AA 5E2GA 1HZOA 3O86A 4G3KA 4A5RA 4GN2A 2C5WB 1DJAA 1CI9A 3FPWA 1MC0A 4XT2B 1BTLA 3IWQA 4K08A 2ZQDA 3PHYA 2DNSA 3QP4A 2XGNA 3IF6C 1PRQA 2W27A 2BASA 3PBOA 4KZBA 4RX2A 5E43A 1L0GA 3Q81A 5HX9A 5EM1A 4ZJ1A 4H6JB 3E2KA 2EFUA 4E3NA 3F1NB 1ERQA 3EWKA 1EROA 1ERMA 1UWPX 1VQQA 3S22A 3KYQA 4OOYA 3EGXC 4OLGA 3I7JA 2JKTM 4M3KA 4WZ5C 3MKEA 5DF8A 1XJ2A 4I38A 2XA7M 3PYPA 4JGRA 1S0WA 4FH4A 3LR5A 2V20A 4KQQA 3PXPA 1GCEA 1IYSA 3ZNTA 4BWIA 3IBRA 5BOHA 1OT6A 1WYCA 4UA6A 5DJTA 4IEDA 2PBYA 4P87A 3NOPC 3MBZA 3VE3A 3IQAA 2IWDA 2OV5A 4OPZA 1ONGA 2WKIA 2GNXA 4R4RA 5J3WA 2J9PA 1K0KA 1PIOA 3BEBA 4XT2A 4QPRA 2L4RA 5CHJA 4WN5A 3LFVA 4MCWA 2VX8A 4K0XA 2XQZA 4H6JA 1SDEA 1N9NA 1PZOA 4PKYG 3LI9A 2Z2MB 3F1NA 5FEFA 5FI7A 3B42A 4IUHA 1N9OA 1CQAA 1G6OA 4MMNA 5L07A 4OQIA 3T12B 3VFFA 3BW6A 3K2NA 1ZG6A 1DJCA 1I2SA 3T1SA 3VSLA 3LIDA 1QMFA 4WYYA 4YFMA 4FH2A 2X71A 4ETXA 3SS5A 3G34A 3O3VA 3BWLA 1YQSA 5FDHA 1N4OA 3E2LA 4UHUA 1K54C 1Z6FA 1XX2A 4FD8A 3UO9A 1XJ4A 5DTSA 4S2NA 2PYRA 2QKPA 2CC1A 4Y0OA 3N8RA 4PMAA 2ZOHA 3NI9A 4PM7A 4PPRA 3ZG7B 3UB7A 4ETZA 2JKGA 3BFEA 3BM6A 3RXXA 2J80A 4KZ4A 4WMCA 3C5AA 2GJ3A 1BSGA 4IVKA 3U4LP 4WLAA 3UE1A 1PWCA 3MZDA 5FA7A 3DWZA 1NRJA 2OLUA 2V0UA 1TS8A 3Q07A 5DVAA 1TEMA 4DKIA 2KLIA 4EERA 4N1XA 2Y91A 5GHZA 1GSWA 3NOTC 3UB9A 1MPLA 1H8ZA 5J8XA 4X68A 1A0KA 5HAIA 1W63Q 4OH0A 2M1CA 2ZMFA 2HGVA 1YLWA 4X53A 5GLCA 5HDCA 4HOIA 4LENA 4DJ2A 3A3FA 1V9ZA 3KSIA 3CUEC 1MXOA 1XP4A 3ZDJA 1WE4A 2H28A 1QMEA 4O7DA 3HL9A 3UY6A 1YKDA 3LGOA 2Y2NA 1KGGA 1GSVA 2E8IA 1I2WA 1UWNX 5EVIC 1LL5A 4MBKA 4WL9A 5KZHA 3D9YA 2QJ7A 4Z9QA 2ZBBA 3C8CA 4QB8A 2M7UA 2HV1A 4EWFA 5FAQA 5FQKA 3CJMA 3L7HA 5FASA 2WADA 3IF6B 5KSCA 5FI2A 5F6AA 5EVEA 3LY3A 5HARA 4P6BA 1XFNA 4EESA 1XPBA 3LIBA 1N9BA 1ZC2A 2EXAA 4N9KA 4JGQA 5F5YA 4CJNA 4WELA 4HEFA 3W4QA 3ZVTA 1M40A 1YAXA 2OAP1 4OQ0A 3C30A 5FQJA 3QP6A 4ESPA 4LPZA 5CHMA 5EVID 3MMHA 5KSHA 3SS4A 5HPIA 4Z1WA 4PM6A 3HUNA 5AVEA 1Z09A 1ODVA 3LO7A 2QPNA 3KX0X 4CLCC 1FCOA 5J7EA 2XD5A 2P08A 4OLDA 3ZHHA 4ARZB 1C3BA 4KG6A 2XF3A 1X0OA 4EQIA 2Y2IA 3UE3A 1LLBA 5F82A 1OPXA 4HHDA 2Y2OA 3MXSA 2FFYA 2PU4A 3UB5P 5AQ9A 2EXBA 2P7JA 5FEGA 4U0TA 5HWVA 1L2SA 2V0WA 3PBNA 1JNUA 4UAAA 4X55A 2CMNA 5I94A 2ZLYA 5A93A 1KOUA 5CTNA 3MQOA 3JVUA 2W3HA 3IF6A 3RJUA 3M2KA 4Y2FA 4NETA 4OP8A 4DE3A 5HL6A 1NWZA 3UDIA 2ZQAA 4HP9A 1K4FA 3G32A 1YLYA 4EBNA 2ZD8A 2QWSA 4L9EA 4C3QA 2FFFB 3HCYA 1L0EA 5DKKA 2D02A 4UEYA 4AFIA 2JBFA 1XJ3A 1M6KA 5HL1A 5FQIA 3V67A 4OOMA 2DCFA 1H3QA 4UQIM 4NEED 4X69A 3EEAA 2HDSA 5DF7A 2H5SA 2VJWA 1XGIA 4EUVA 1E4DA 3PBRA 3SOIA 4P85A 2IWCA 4JXGA 2OAQ1 3UPNA 4ARZA 5EUAA 3WS4A 1E3UD 5CGWA 3EGDC 3HJKA 5L8MA 4Y0UA 2PD7A 4PM5A 4WMCD 4EBPA 4GCZA 3QP2A 2BLSA 2GX5A 1YMXA 3D3OA 3ZG5A 5TBMB 3NOUC 4FOFA 4MN7A 3ZG0A 3W8KA 4H8RA 3SH9A
chains in the Genus database with same CATH topology
4WZ4A 3W4PA 1EROA 3IH8A 1K6RA 3DWKA 1ERMA 1JTDA 1FSWA 1NRFA 3GSGA 3LCEA 1BLSA 2Y2KA 4QD4A 1VQQA 2H10A 3S22A 2Y2PA 3V39A 4PM9A 1W79A 4OOYA 2HP6A 3V5MA 1PZPA 4OLGA 1W8YA 3I7JA 1VM1A 1YLJA 1NY0A 4IBRA 4M3KA 3GTCA 4JXWA 4KZ7A 4QU3A 4WZ5C 2ZQCA 5IHVA 3MKEA 2R9XA 5DF8A 4S2OA 4KZ5A 3PAEA 4JLFA 2R9WA 2ZC3B 2ZJ9A 3AGFA 4JBFA 4DXBA 1JVJA 2V2FF 5E2FA 5F1FA 1FR6A 2J9OA 1S0WA 1GHIA 4C6YA 4FH4A 3UE0A 1TVFA 2ZQ7A 5GL9A 5FQ9A 4K91A 2V20A 4KQQA 1NYYA 3HLCA 1LL9A 3S4XA 1K57C 3EQVA 1GCEA 1IYSA 3G2YA 3ZNTA 4UA9A 3IWOA 3BFDA 5A92A 1BLHA 4B4ZA 1GA0A 1BZAA 2XFSA 5BOHA 1WYCA 4UA6A 2Y4AA 4IEDA 2PBYA 2JCHA 1JTGA 3EQUA 3IXBA 1ONHA 4P87A 1SDNA 1XKZA 4BD1A 3OPLA 4OQHA 3MBZA 4UA7A 1PI4A 4OQGA 3IQAA 4X56A 1ES5A 4MEZA 1FOFA 2IWDA 1NJ4A 4BQMA 1GHPA 2OV5A 3GRJA 4RVAA 4HESA 4OPZA 1ONGA 5EE8A 1YM1A 2WKIA 4R4RA 1PW1A 2J9PA 5E2HA 1O7EA 3WRTA 3SH7A 2V1ZA 3FKWA 3LEZA 1PIOA 3BEBA 3JYIA 4WM9A 1PWDA 2X01A 4LV3A 2XD1A 5EVIB 1CI8A 4HBTA 5D3OA 4KQRA 3G35A 1E25A 2WGVA 1EWZA 4R23A 5CHJA 3VP4A 4KQOA 4F94A 2DRWA 2A49A 1L0FA 1LI9A 1BUEA 3OCLA 4HBUA 4IBXA 4GB7A 1FQGA 3A3JA 4BLMA 3PAGA 4GDBA 2X02A 4K0XA 2XQZA 1PWGA 1MWSA 4JXVA 4L0LA 1SDEA 3BRMA 3MZFA 1PZOA 1WYBA 1XA1A 3ITAA 1LI0A 5FQMA 2Z2MB 3A3IA 3FKVA 5FI7A 3FYZA 3FWLA 3IXGA 4JF5A 3ZNYA 4OQIA 3VP1A 3W4OA 2B5RA 5DTKA 2QMIA 2HDQA 3VFFA 4N92A 2WGWB 4B4XA 1ZG6A 5CXWA 1DJCA 3NIAA 3UDFA 2Z2LB 3AGDA 3CG5A 4LV1A 1I2SA 4ZJ3A 3LY4A 3VSLA 4MLLA 2ZM0A 3IWIA 1QMFA 4WYYA 4YFMA 3A3DA 2WAEA 4FH2A 2X71A 1IEMA 5DTTA 2HP5A 3SS5A 3G34A 4YINA 3ZGAB 3O3VA 4U0XA 4EBLA 4DDSA 2EX2A 1BLCA 1ES4A 1I5QA 1YQSA 2Y2HA 1IYOA 5FDHA 1N4OA 3E2LA 1YMSA 4N9LA 4S2IA 1K54C 1Z6FA 4UHUA 1XX2A 3NCKA 3VOYA 4E3MA 3UPPA 4FD8A 2I72A 3A3EA 1NZOA 3UO9A 3HUOA 4OONA 5DTSA 4S2NA 3BFCA 1IKIA 2CC1A 2EX8A 4GOGA 4Y0OA 3N8RA 5CGSA 3S1YA 2G2UA 4PMAA 3NI9A 4PM7A 1ESIA 3HBRA 4PPRA 4ZAMA 5EOEA 3ZG7B 5A90A 3NDGA 2J7VA 3Q7ZA 3SS3A 4ZTKA 2P9VA 2UWXA 3N8LA 4DDYA 5EOOA 1KDWA 3N6IA 2EX9A 1AXBA 3RXWA 1TDGA 3BFEA 3BFGA 2HDUA 3BM6A 2Y55A 3RXXA 4S2LA 4KZ4A 4WMCA 3G30A 3C5AA 1FR1A 2ZM2A 5AQAA 1MBLA 2ZC7A 1JWVA 1K6SA 1BSGA 5L2FA 4IVKA 4ZBEA 4QJGA 2G2WA 3UE1A 1PWCA 4QHCA 3HLEA 2PU2A 3MKFA 3MZDA 5FA7A 3DWZA 5FAOA 1ESUA 4GD6A 1K38A 2OLUA 4R3JA 5EVIA 1YLZA 2ZQ9A 3NBLA 4Q8IA 1K25A 3OCNA 2HP9A 3Q07A 5DVAA 1TEMA 4XUXA 4DKIA 4N1XA 2Y91A 4R1GA 4KENB 4P0MA 1XGJA 5TFQA 3ZVWA 1IELA 3CMZA 2WUQA 3GQZA 3HLBA 5GHZA 5CERA 1CEFA 1HD8A 1MPLA 3N7WA 2WKEA 3QNCA 3TSGA 5FATA 1H8ZA 5J8XA 4X68A 3IHBA 5HAIA 3SH8A 1GA9A 4OH0A 5EECA 2A3UA 1CK3A 3AGEA 4KZAA 4GD8A 4WBGA 4E6XA 2HPBA 4OPQA 3NC8A 4S2PA 1BT5A 4WEJA 2P9VB 3WS5A 4EV4A 1W8QA 4FSFA 1YLWA 4X53A 2WK0A 2WGWA 5GLCA 4S2NC 1BLPA 5FSRA 1IYQA 2WZZA 3B3XA 1KVLA 4LENA 4S2JA 5FQQA 3A3FA 4OPRA 1K56D 3OPRA 1MXOA 1XP4A 2ZC5B 3ZDJA 1WE4A 4E6WA 1QMEA 4O7DA 5GLBA 3HL9A 3UY6A 2VGJA 3BECA 2Y2MA 3IF5A 2Y2NA 5FAPA 1KGGA 1KE0A 2ZC4B 3HLGA 2C6WB 1MKIA 1J9MA 3Q7VB 3GR2A 1K55A 5GHXA 4PM8A 2E8IA 2RL3A 1I2WA 3VFHA 4EUZA 3OZHA 3OPPA 1L0DA 1NYMA 3M2JA 5CRFA 4ZJ2A 1MY8A 4MBFA 1PW8A 5EVIC 4QY5A 1LL5A 4MBKA 4OKPA 5KZHA 3NY4A 2XR0A 3BFFA 4KZ9A 1K4EA 3IH9A 1ZG4A 1MWTA 3DW0A 4N1HA 4Z9QA 3ZG9B 4Y7PA 2XEPA 3UN7A 1OMEA 4QB8A 5M18A 4S2KA 2Q9MA 4RYEA 3MFDA 3QHYA 1JWPA 4BL3A 1RCJA 3VSKA 4EWFA 3NDEA 5GLAA 3ZCZA 3IHAA 5FAQA 4NK3A 2P74A 2XH9A 2Y59A 2IWBA 5FQKA 4WZ5A 3CJMA 3N8SA 4GKUA 5TGFA 1PI5A 5CECA 2GDNA 4RX3A 3M6HA 5FASA 5M19A 2WADA 2Y2QA 1RGZA 3IF6B 5KSCA 5FI2A 2Y2LA 4B88A 3BLMA 4OP5A 3WS2A 1BULA 3LY3A 5HARA 4P6BA 3C7UA 1K57A 4R3BA 4LV2A 3MZEA 3G4PA 1XPBA 1KE4A 4KZ3A 1N9BA 1ZC2A 3G2ZA 2OSUA 3DTMA 2ZC6B 4KG5A 1YLTA 1RP5A 3HVFA 1FCMA 5TR7A 3TOIA 1GHMA 2EXAA 2Q9NA 1E3UA 1W5DA 4N9KA 4CJNA 1KVMA 2ZQ8A 3PBTA 3WWXA 4WELA 4DXCA 4FCFA 4HEFA 1RGYA 3W4QA 3P09A 1M40A 3ZVTA 4OQ0A 5FI6A 5FQJA 3HLFA 5CEBA 3N4IA 3UPOA 5CHMA 5EVID 2Y2GA 5CTMA 5KSHA 3SS4A 5JYOA 1IYPA 4QY6A 4PM6A 5G18A 1O07A 3HUNA 1Y54A 4R4SA 4DE0A 4DE2A 3O87A 3C7VA 3LO7A 3HUMA 3BYDA 2QPNA 4KZ6A 3WS0A 5GHYA 2XK1A 4Y0TA 4E3KA 5AQ7A 4LV0A 4MBHA 1FCOA 5E2EA 2XD5A 2ZM8A 2WAFA 3Q7VA 4OLDA 3ZHHA 4X6TA 4C75A 3GV9A 1C3BA 2WKHA 3IT9A 4KG6A 2XLNA 2XF3A 5CHUA 2Y2JA 2Y2IA 3UE3A 4EQIA 3GMWA 1LLBA 5F82A 3ZG8B 5CEDA 4LCMA 2Y2OA 3UNWA 1KDSA 3VOZA 4MNRA 3V50A 4ZDXA 1YLPA 3MXSA 1DY6A 2FFYA 3OC2A 2JE5A 3VP2A 3C4OA 1KE3A 2PU4A 1FCNA 1SKFA 5HAQA 1LHYA 5HAPA 3BLSA 5AQ9A 3TG9A 3GVBA 3IXHA 3PBQA 3HLDA 2EXBA 4U0TA 2H0TA 4BJPA 3O88A 2WYXA 1MWRA 1NZUA 1S6RA 2XFTA 3CZDA 1EI5A 1G68A 1ES3A 1L2SA 3PBNA 1H5XA 4JKTA 4UAAA 3IXDA 3VP3A 4X55A 2EX6A 5I94A 4E3JA 1NXYA 4RA7A 3PTEA 2ZLYA 5F1GA 5A93A 2JC7A 5GLDA 5CTNA 3V3RA 1DJBA 3IF6A 3RJUA 3M2KA 5JYPA 5A91A 4NETA 4OP8A 3M6BA 3P98A 4BL2A 1ES2A 4DE3A 4DF6A 3UDIA 3HLWA 2ZQAA 4DE1A 1CEGA 1K4FA 1K54A 2WZXA 3G31A 3G32A 3MXRA 2EFXA 4JF4A 1YLYA 1ALQA 1KGFA 3C4PA 1SCWA 4EBNA 2ZD8A 1U60A 4XUZA 4R0QA 4C3QA 4E3OA 1TDLA 1MWUA 5U47A 2BG1A 1HTZA 2FFFB 3ITBA 3ZFZA 3UDXA 4DRTA 4U3TA 1L0EA 3VP0A 4GDNA 4D2OA 5HFOA 2HDRA 2QZ6A 1K56A 3FV7A 3PBSA 2OLVA 5M1AA 1PYYA 2JBFA 4BENA 1M6KA 4ID4A 4IVIA 5HL1A 4LCLA 5FQIA 4OOMA 5CGXA 2DCFA 2ZMAA 4KZ8A 5EVLA 2XDMA 5DF9A 3D4FA 4GZBA 4JPMA 4X69A 1HVBA 4XXRA 1Q2QA 2HDSA 2RCXA 5DF7A 3ISGA 2H5SA 1XGIA 4KG2A 1E4DA 3FZCA 3V3SA 3PBRA 3SOIA 4P85A 4K0WA 2IWCA 4JXGA 4BD0A 1IKGA 1XA7A 4JF6A 3UPNA 5EUAA 4WEKA 5EPHA 3Q82A 3WS4A 1E3UD 5CGWA 1G6AA 4OOLA 5E2GA 1HZOA 3O86A 4A5RA 1KGEA 2VGKA 4GN2A 2C5WB 3WRZA 1H8YA 1W7FA 3HREA 1DJAA 1CI9A 4Y0UA 1BTLA 1FSYA 3IWQA 3OPHA 4E3IA 1YT4A 4OPYA 4WMCD 4PM5A 3QNBA 4EBPA 2ZQDA 2DNSA 2XGNA 2J8YA 4OVDA 3WS1A 3IF6C 4JXSA 1JWZA 5F83A 1XXMA 2BLSA 4S2MA 1YMXA 5AQBA 5KMWA 1K55C 3PBOA 4KZBA 4RX2A 5E43A 4E3LA 3ZG5A 2H0YA 1L0GA 4GNUA 1SHVA 3Q1FA 3Q81A 5HX9A 4ZJ1A 5HW3A 2WGIA 3ZG0A 3W8KA 3E2KA 4H8RA 3VMAA 4CPKA 2EFUA 4E3NA 1Q2PA 3SH9A 1ZKJA 1ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ4 A;  3W4P A;  1ERO A;  3IH8 A;  1K6R A;  3DWK A;  1ERM A;  1JTD A;  1FSW A;  1NRF A;  3GSG A;  3LCE A;  1BLS A;  2Y2K A;  4QD4 A;  1VQQ A;  2H10 A;  3S22 A;  2Y2P A;  3V39 A;  4PM9 A;  1W79 A;  4OOY A;  2HP6 A;  3V5M A;  1PZP A;  4OLG A;  1W8Y A;  3I7J A;  1VM1 A;  1YLJ A;  1NY0 A;  4IBR A;  4M3K A;  3GTC A;  4JXW A;  4KZ7 A;  4QU3 A;  4WZ5 C;  2ZQC A;  5IHV A;  3MKE A;  2R9X A;  5DF8 A;  4S2O A;  4KZ5 A;  3PAE A;  4JLF A;  2R9W A;  2ZC3 B;  2ZJ9 A;  3AGF A;  4JBF A;  4DXB A;  1JVJ A;  2V2F F;  5E2F A;  5F1F A;  1FR6 A;  2J9O A;  1S0W A;  1GHI A;  4C6Y A;  4FH4 A;  3UE0 A;  1TVF A;  2ZQ7 A;  5GL9 A;  5FQ9 A;  4K91 A;  2V20 A;  4KQQ A;  1NYY A;  3HLC A;  1LL9 A;  3S4X A;  1K57 C;  3EQV A;  1GCE A;  1IYS A;  3G2Y A;  3ZNT A;  4UA9 A;  3IWO A;  3BFD A;  5A92 A;  1BLH A;  4B4Z A;  1GA0 A;  1BZA A;  2XFS A;  5BOH A;  1WYC A;  4UA6 A;  2Y4A A;  4IED A;  2PBY A;  2JCH A;  1JTG A;  3EQU A;  3IXB A;  1ONH A;  4P87 A;  1SDN A;  1XKZ A;  4BD1 A;  3OPL A;  4OQH A;  3MBZ A;  4UA7 A;  1PI4 A;  4OQG A;  3IQA A;  4X56 A;  1ES5 A;  4MEZ A;  1FOF A;  2IWD A;  1NJ4 A;  4BQM A;  1GHP A;  2OV5 A;  3GRJ A;  4RVA A;  4HES A;  4OPZ A;  1ONG A;  5EE8 A;  1YM1 A;  2WKI A;  4R4R A;  1PW1 A;  2J9P A;  5E2H A;  1O7E A;  3WRT A;  3SH7 A;  2V1Z A;  3FKW A;  3LEZ A;  1PIO A;  3BEB A;  3JYI A;  4WM9 A;  1PWD A;  2X01 A;  4LV3 A;  2XD1 A;  5EVI B;  1CI8 A;  4HBT A;  5D3O A;  4KQR A;  3G35 A;  1E25 A;  2WGV A;  1EWZ A;  4R23 A;  5CHJ A;  3VP4 A;  4KQO A;  4F94 A;  2DRW A;  2A49 A;  1L0F A;  1LI9 A;  1BUE A;  3OCL A;  4HBU A;  4IBX A;  4GB7 A;  1FQG A;  3A3J A;  4BLM A;  3PAG A;  4GDB A;  2X02 A;  4K0X A;  2XQZ A;  1PWG A;  1MWS A;  4JXV A;  4L0L A;  1SDE A;  3BRM A;  3MZF A;  1PZO A;  1WYB A;  1XA1 A;  3ITA A;  1LI0 A;  5FQM A;  2Z2M B;  3A3I A;  3FKV A;  5FI7 A;  3FYZ A;  3FWL A;  3IXG A;  4JF5 A;  3ZNY A;  4OQI A;  3VP1 A;  3W4O A;  2B5R A;  5DTK A;  2QMI A;  2HDQ A;  3VFF A;  4N92 A;  2WGW B;  4B4X A;  1ZG6 A;  5CXW A;  1DJC A;  3NIA A;  3UDF A;  2Z2L B;  3AGD A;  3CG5 A;  4LV1 A;  1I2S A;  4ZJ3 A;  3LY4 A;  3VSL A;  4MLL A;  2ZM0 A;  3IWI A;  1QMF A;  4WYY A;  4YFM A;  3A3D A;  2WAE A;  4FH2 A;  2X71 A;  1IEM A;  5DTT A;  2HP5 A;  3SS5 A;  3G34 A;  4YIN A;  3ZGA B;  3O3V A;  4U0X A;  4EBL A;  4DDS A;  2EX2 A;  1BLC A;  1ES4 A;  1I5Q A;  1YQS A;  2Y2H A;  1IYO A;  5FDH A;  1N4O A;  3E2L A;  1YMS A;  4N9L A;  4S2I A;  1K54 C;  1Z6F A;  4UHU A;  1XX2 A;  3NCK A;  3VOY A;  4E3M A;  3UPP A;  4FD8 A;  2I72 A;  3A3E A;  1NZO A;  3UO9 A;  3HUO A;  4OON A;  5DTS A;  4S2N A;  3BFC A;  1IKI A;  2CC1 A;  2EX8 A;  4GOG A;  4Y0O A;  3N8R A;  5CGS A;  3S1Y A;  2G2U A;  4PMA A;  3NI9 A;  4PM7 A;  1ESI A;  3HBR A;  4PPR A;  4ZAM A;  5EOE A;  3ZG7 B;  5A90 A;  3NDG A;  2J7V A;  3Q7Z A;  3SS3 A;  4ZTK A;  2P9V A;  2UWX A;  3N8L A;  4DDY A;  5EOO A;  1KDW A;  3N6I A;  2EX9 A;  1AXB A;  3RXW A;  1TDG A;  3BFE A;  3BFG A;  2HDU A;  3BM6 A;  2Y55 A;  3RXX A;  4S2L A;  4KZ4 A;  4WMC A;  3G30 A;  3C5A A;  1FR1 A;  2ZM2 A;  5AQA A;  1MBL A;  2ZC7 A;  1JWV A;  1K6S A;  1BSG A;  5L2F A;  4IVK A;  4ZBE A;  4QJG A;  2G2W A;  3UE1 A;  1PWC A;  4QHC A;  3HLE A;  2PU2 A;  3MKF A;  3MZD A;  5FA7 A;  3DWZ A;  5FAO A;  1ESU A;  4GD6 A;  1K38 A;  2OLU A;  4R3J A;  5EVI A;  1YLZ A;  2ZQ9 A;  3NBL A;  4Q8I A;  1K25 A;  3OCN A;  2HP9 A;  3Q07 A;  5DVA A;  1TEM A;  4XUX A;  4DKI A;  4N1X A;  2Y91 A;  4R1G A;  4KEN B;  4P0M A;  1XGJ A;  5TFQ A;  3ZVW A;  1IEL A;  3CMZ A;  2WUQ A;  3GQZ A;  3HLB A;  5GHZ A;  5CER A;  1CEF A;  1HD8 A;  1MPL A;  3N7W A;  2WKE A;  3QNC A;  3TSG A;  5FAT A;  1H8Z A;  5J8X A;  4X68 A;  3IHB A;  5HAI A;  3SH8 A;  1GA9 A;  4OH0 A;  5EEC A;  2A3U A;  1CK3 A;  3AGE A;  4KZA A;  4GD8 A;  4WBG A;  4E6X A;  2HPB A;  4OPQ A;  3NC8 A;  4S2P A;  1BT5 A;  4WEJ A;  2P9V B;  3WS5 A;  4EV4 A;  1W8Q A;  4FSF A;  1YLW A;  4X53 A;  2WK0 A;  2WGW A;  5GLC A;  4S2N C;  1BLP A;  5FSR A;  1IYQ A;  2WZZ A;  3B3X A;  1KVL A;  4LEN A;  4S2J A;  5FQQ A;  3A3F A;  4OPR A;  1K56 D;  3OPR A;  1MXO A;  1XP4 A;  2ZC5 B;  3ZDJ A;  1WE4 A;  4E6W A;  1QME A;  4O7D A;  5GLB A;  3HL9 A;  3UY6 A;  2VGJ A;  3BEC A;  2Y2M A;  3IF5 A;  2Y2N A;  5FAP A;  1KGG A;  1KE0 A;  2ZC4 B;  3HLG A;  2C6W B;  1MKI A;  1J9M A;  3Q7V B;  3GR2 A;  1K55 A;  5GHX A;  4PM8 A;  2E8I A;  2RL3 A;  1I2W A;  3VFH A;  4EUZ A;  3OZH A;  3OPP A;  1L0D A;  1NYM A;  3M2J A;  5CRF A;  4ZJ2 A;  1MY8 A;  4MBF A;  1PW8 A;  5EVI C;  4QY5 A;  1LL5 A;  4MBK A;  4OKP A;  5KZH A;  3NY4 A;  2XR0 A;  3BFF A;  4KZ9 A;  1K4E A;  3IH9 A;  1ZG4 A;  1MWT A;  3DW0 A;  4N1H A;  4Z9Q A;  3ZG9 B;  4Y7P A;  2XEP A;  3UN7 A;  1OME A;  4QB8 A;  5M18 A;  4S2K A;  2Q9M A;  4RYE A;  3MFD A;  3QHY A;  1JWP A;  4BL3 A;  1RCJ A;  3VSK A;  4EWF A;  3NDE A;  5GLA A;  3ZCZ A;  3IHA A;  5FAQ A;  4NK3 A;  2P74 A;  2XH9 A;  2Y59 A;  2IWB A;  5FQK A;  4WZ5 A;  3CJM A;  3N8S A;  4GKU A;  5TGF A;  1PI5 A;  5CEC A;  2GDN A;  4RX3 A;  3M6H A;  5FAS A;  5M19 A;  2WAD A;  2Y2Q A;  1RGZ A;  3IF6 B;  5KSC A;  5FI2 A;  2Y2L A;  4B88 A;  3BLM A;  4OP5 A;  3WS2 A;  1BUL A;  3LY3 A;  5HAR A;  4P6B A;  3C7U A;  1K57 A;  4R3B A;  4LV2 A;  3MZE A;  3G4P A;  1XPB A;  1KE4 A;  4KZ3 A;  1N9B A;  1ZC2 A;  3G2Z A;  2OSU A;  3DTM A;  2ZC6 B;  4KG5 A;  1YLT A;  1RP5 A;  3HVF A;  1FCM A;  5TR7 A;  3TOI A;  1GHM A;  2EXA A;  2Q9N A;  1E3U A;  1W5D A;  4N9K A;  4CJN A;  1KVM A;  2ZQ8 A;  3PBT A;  3WWX A;  4WEL A;  4DXC A;  4FCF A;  4HEF A;  1RGY A;  3W4Q A;  3P09 A;  1M40 A;  3ZVT A;  4OQ0 A;  5FI6 A;  5FQJ A;  3HLF A;  5CEB A;  3N4I A;  3UPO A;  5CHM A;  5EVI D;  2Y2G A;  5CTM A;  5KSH A;  3SS4 A;  5JYO A;  1IYP A;  4QY6 A;  4PM6 A;  5G18 A;  1O07 A;  3HUN A;  1Y54 A;  4R4S A;  4DE0 A;  4DE2 A;  3O87 A;  3C7V A;  3LO7 A;  3HUM A;  3BYD A;  2QPN A;  4KZ6 A;  3WS0 A;  5GHY A;  2XK1 A;  4Y0T A;  4E3K A;  5AQ7 A;  4LV0 A;  4MBH A;  1FCO A;  5E2E A;  2XD5 A;  2ZM8 A;  2WAF A;  3Q7V A;  4OLD A;  3ZHH A;  4X6T A;  4C75 A;  3GV9 A;  1C3B A;  2WKH A;  3IT9 A;  4KG6 A;  2XLN A;  2XF3 A;  5CHU A;  2Y2J A;  2Y2I A;  3UE3 A;  4EQI A;  3GMW A;  1LLB A;  5F82 A;  3ZG8 B;  5CED A;  4LCM A;  2Y2O A;  3UNW A;  1KDS A;  3VOZ A;  4MNR A;  3V50 A;  4ZDX A;  1YLP A;  3MXS A;  1DY6 A;  2FFY A;  3OC2 A;  2JE5 A;  3VP2 A;  3C4O A;  1KE3 A;  2PU4 A;  1FCN A;  1SKF A;  5HAQ A;  1LHY A;  5HAP A;  3BLS A;  5AQ9 A;  3TG9 A;  3GVB A;  3IXH A;  3PBQ A;  3HLD A;  2EXB A;  4U0T A;  2H0T A;  4BJP A;  3O88 A;  2WYX A;  1MWR A;  1NZU A;  1S6R A;  2XFT A;  3CZD A;  1EI5 A;  1G68 A;  1ES3 A;  1L2S A;  3PBN A;  1H5X A;  4JKT A;  4UAA A;  3IXD A;  3VP3 A;  4X55 A;  2EX6 A;  5I94 A;  4E3J A;  1NXY A;  4RA7 A;  3PTE A;  2ZLY A;  5F1G A;  5A93 A;  2JC7 A;  5GLD A;  5CTN A;  3V3R A;  1DJB A;  3IF6 A;  3RJU A;  3M2K A;  5JYP A;  5A91 A;  4NET A;  4OP8 A;  3M6B A;  3P98 A;  4BL2 A;  1ES2 A;  4DE3 A;  4DF6 A;  3UDI A;  3HLW A;  2ZQA A;  4DE1 A;  1CEG A;  1K4F A;  1K54 A;  2WZX A;  3G31 A;  3G32 A;  3MXR A;  2EFX A;  4JF4 A;  1YLY A;  1ALQ A;  1KGF A;  3C4P A;  1SCW A;  4EBN A;  2ZD8 A;  1U60 A;  4XUZ A;  4R0Q A;  4C3Q A;  4E3O A;  1TDL A;  1MWU A;  5U47 A;  2BG1 A;  1HTZ A;  2FFF B;  3ITB A;  3ZFZ A;  3UDX A;  4DRT A;  4U3T A;  1L0E A;  3VP0 A;  4GDN A;  4D2O A;  5HFO A;  2HDR A;  2QZ6 A;  1K56 A;  3FV7 A;  3PBS A;  2OLV A;  5M1A A;  1PYY A;  2JBF A;  4BEN A;  1M6K A;  4ID4 A;  4IVI A;  5HL1 A;  4LCL A;  5FQI A;  4OOM A;  5CGX A;  2DCF A;  2ZMA A;  4KZ8 A;  5EVL A;  2XDM A;  5DF9 A;  3D4F A;  4GZB A;  4JPM A;  4X69 A;  1HVB A;  4XXR A;  1Q2Q A;  2HDS A;  2RCX A;  5DF7 A;  3ISG A;  2H5S A;  1XGI A;  4KG2 A;  1E4D A;  3FZC A;  3V3S A;  3PBR A;  3SOI A;  4P85 A;  4K0W A;  2IWC A;  4JXG A;  4BD0 A;  1IKG A;  1XA7 A;  4JF6 A;  3UPN A;  5EUA A;  4WEK A;  5EPH A;  3Q82 A;  3WS4 A;  1E3U D;  5CGW A;  1G6A A;  4OOL A;  5E2G A;  1HZO A;  3O86 A;  4A5R A;  1KGE A;  2VGK A;  4GN2 A;  2C5W B;  3WRZ A;  1H8Y A;  1W7F A;  3HRE A;  1DJA A;  1CI9 A;  4Y0U A;  1BTL A;  1FSY A;  3IWQ A;  3OPH A;  4E3I A;  1YT4 A;  4OPY A;  4WMC D;  4PM5 A;  3QNB A;  4EBP A;  2ZQD A;  2DNS A;  2XGN A;  2J8Y A;  4OVD A;  3WS1 A;  3IF6 C;  4JXS A;  1JWZ A;  5F83 A;  1XXM A;  2BLS A;  4S2M A;  1YMX A;  5AQB A;  5KMW A;  1K55 C;  3PBO A;  4KZB A;  4RX2 A;  5E43 A;  4E3L A;  3ZG5 A;  2H0Y A;  1L0G A;  4GNU A;  1SHV A;  3Q1F A;  3Q81 A;  5HX9 A;  4ZJ1 A;  5HW3 A;  2WGI A;  3ZG0 A;  3W8K A;  3E2K A;  4H8R A;  3VMA A;  4CPK A;  2EFU A;  4E3N A;  1Q2P A;  3SH9 A;  1ZKJ A;  1ERQ A; 
#chains in the Genus database with same CATH topology
 2W3E A;  4WZ4 A;  2KDK A;  3DWK A;  3TE8 A;  1JTD A;  3B33 A;  4LLO B;  1FSW A;  2H10 A;  2Y2P A;  4PM9 A;  5EFW A;  2Q0O A;  3V5M A;  1W8Y A;  5KIZ A;  1VM1 A;  3MR0 A;  4IBR A;  4JXW A;  1XFQ A;  4QU3 A;  1Y28 A;  2R9X A;  4LRY C;  4JLF A;  3AGF A;  4DXB A;  2V2F F;  5E2F A;  1FR6 A;  3KYE A;  1GHI A;  3W2Z A;  5GL9 A;  3ULF A;  1SZV A;  1LL9 A;  1Y4O A;  3EQV A;  4IUK A;  3G2Y A;  1D7E A;  3P7N A;  1IFQ A;  1BZA A;  2A24 B;  5K5B A;  1ONH A;  1OTB A;  3OPL A;  4OQH A;  4X56 A;  1ES5 A;  4MEZ A;  1FOF A;  4BQM A;  3GRJ A;  3SH7 A;  2V1Z A;  3FKW A;  2DMW A;  3JYI A;  3UB8 A;  2X01 A;  5EVI B;  2O9B A;  4HBT A;  5D3O A;  3G35 A;  1E25 A;  2WGV A;  2J3W A;  3VP4 A;  1F9I A;  5FDS A;  2V1B A;  2A49 A;  1L0F A;  1LI9 A;  1BUE A;  4JGP A;  4HBU A;  4IBX A;  3E98 A;  1FQG A;  3KSG A;  3ZQ5 A;  1P0Z A;  3OOV A;  1T18 A;  3PAG A;  3QP5 A;  4GDB A;  5TBM A;  2JKF A;  2PRF A;  3S7Q A;  1MKM A;  4JXV A;  3MZF A;  1OT9 A;  1WYB A;  1XA1 A;  3ITA A;  3FKV A;  3S7O A;  3FWL A;  2B5R A;  5DTK A;  5L09 A;  2WGW B;  3LYX A;  4LV1 A;  4ZJ3 A;  3A0V A;  4HJ3 A;  2ZM0 A;  4B9O A;  2VGL S;  4LGW A;  2EWV A;  4CQH A;  5DTT A;  3R7W B;  2EX2 A;  3MJQ A;  2KOI A;  1TS6 A;  1IYO A;  3A0S A;  1YMS A;  2W3G A;  4E3M A;  3NCK A;  4OON A;  3EOI A;  3BFC A;  5CGS A;  3S1Y A;  2G2U A;  2A24 A;  3BQA A;  2NUP C;  5EOE A;  5A90 A;  3CUE A;  3Q7Z A;  3SS3 A;  2P9V A;  2UWX A;  5EOO A;  1KDW A;  2W1T B;  2J3T C;  1TDG A;  2FH5 A;  4CLC B;  2Y55 A;  4S2L A;  3G30 A;  2ZM2 A;  4ZBE A;  2O9C A;  3LR4 A;  4QHC A;  3MKF A;  5FAO A;  5EVI A;  4R3J A;  1YLZ A;  4Q8I A;  1LL8 A;  1P97 A;  3DTK A;  3A0R A;  4FTX A;  4EQ1 A;  5TFQ A;  3ZVW A;  3GQZ A;  3HLB A;  5CER A;  3LR0 A;  3VOL A;  3TSG A;  2Y79 A;  1GA9 A;  4ME4 A;  4KZA A;  2E8J A;  4WBG A;  3JVV A;  1BT5 A;  4WEJ A;  2ACG A;  3E4O A;  2WK0 A;  2WGW A;  5FSR A;  1BLP A;  3CIT A;  1DP6 A;  3TRC A;  2J3T D;  3HJI A;  3MSH A;  3R7W A;  5GLB A;  2VGJ A;  3K3C A;  3BEC A;  2Y2M A;  2NUT C;  1KE0 A;  4L9G A;  1MKI A;  2C6W B;  1J9M A;  3GR2 A;  2O0Y A;  3H9W A;  2OWJ A;  1MY8 A;  4MBF A;  1PW8 A;  3IH9 A;  4X1M A;  4N1H A;  2VA0 A;  2W1T A;  3ZG9 B;  3UN7 A;  3RH8 B;  4CLC A;  3U2A A;  2Q9M A;  4RYE A;  3MFD A;  3QHY A;  3T1R A;  1RCJ A;  3NDE A;  4LFU A;  2YKF A;  4RX3 A;  1S1Y A;  1V9Y A;  2PD8 A;  3C7U A;  1K57 A;  3KSH A;  4KZ3 A;  1P9W A;  2ZC6 B;  1YLT A;  5TR7 A;  1E3U A;  1TF1 A;  1W5D A;  2ZQ8 A;  4DXC A;  1RGY A;  3T4L A;  3DTI A;  5CEB A;  1OTA A;  2Y2G A;  4HIA A;  5JYO A;  1IYP A;  4WUJ A;  2UV0 E;  1O07 A;  3O87 A;  3HUM A;  3MQ0 A;  5GHY A;  5G4Y A;  4LV0 A;  2ZM8 A;  3H82 A;  2W3D A;  3IT9 A;  4NXF A;  1CF0 A;  4Y17 A;  1P9R A;  5CED A;  3VOZ A;  2JN7 A;  3V50 A;  5HSQ A;  1MZU A;  3VP2 A;  2PT7 A;  1LHY A;  3TG9 A;  3IXH A;  2H0T A;  4JKT A;  3NEC A;  3IXD A;  3VP3 A;  3GEC A;  4HI4 A;  2Y8H A;  5LBR A;  2WKP A;  4RA7 A;  5F1G A;  4E3J A;  2R78 A;  1YSP A;  1DJB A;  1OJG A;  4BL2 A;  1ES2 A;  1STZ A;  2HJE A;  3HLW A;  1CEG A;  2WZX A;  3MXR A;  2EFX A;  1KGF A;  3C4P A;  2LB9 A;  3UME A;  1TDL A;  1OJ5 A;  5U47 A;  3FPV A;  3ZFZ A;  4U3T A;  3VP0 A;  4GDN A;  5HFO A;  3OBF A;  4LRZ E;  2OLV A;  2K31 A;  1TS7 A;  3R4K A;  5CGX A;  2ZMA A;  5EVL A;  3D4F A;  1HVB A;  3T4J A;  4KG2 A;  2KX6 A;  1G28 A;  1IOU A;  2A2L A;  3MQQ A;  3Q82 A;  2QJ5 A;  4Q0I A;  4EW7 A;  2PR6 A;  4KQD A;  1H8Y A;  1W7F A;  3HRE A;  2JKR I;  4E3I A;  3QNB A;  5A8B A;  2J8Y A;  3WS1 A;  1JWZ A;  1XXM A;  2PYP A;  5KMW A;  2H0Y A;  1SHV A;  5HW3 A;  4X1L A;  2WGI A;  4Y13 A;  4CPK A;  1GSX A;  1Q2P A;  3W4P A;  1VHM A;  3LCE A;  1BLS A;  1SKO B;  2Y2K A;  4QD4 A;  3V39 A;  1F98 A;  2HP6 A;  3TW8 A;  1LSV A;  1YLJ A;  3GTC A;  3T1Q B;  5I5L A;  2VEA A;  5EV0 A;  1D06 A;  2ZJ9 A;  1VET B;  1JVJ A;  4EU0 A;  1ZHH B;  5F1F A;  3SZT A;  2XRO A;  4C6Y A;  1TVF A;  2ZQ7 A;  5FQ9 A;  2B02 A;  2JKT I;  3HLC A;  1K57 C;  4UA9 A;  3IWO A;  1LSW A;  4B4Z A;  3L9K A;  3EQU A;  4BD1 A;  4IHQ A;  1NJ4 A;  2V8F A;  4HES A;  1YM1 A;  1PW1 A;  5G4Z A;  4CLC D;  3FC7 A;  4Y15 A;  2XD1 A;  1S4R A;  1CI8 A;  1EWZ A;  3LI8 A;  4R23 A;  3OCL A;  4GB7 A;  4EEP A;  3A3J A;  4BLM A;  3EEH A;  3PR6 A;  1PWG A;  4L0L A;  3BRM A;  5IT5 A;  5FQM A;  1LI0 A;  3FYZ A;  2VV8 A;  3K3D A;  3VP1 A;  1SKO A;  2EWW A;  4KUK A;  1TS0 A;  2Z6C A;  3NIA A;  3CG5 A;  4NXB A;  3LY4 A;  1IEM A;  1VET A;  4YIN A;  2VZW A;  4U0X A;  5AJG A;  1BLC A;  1I5Q A;  4E04 A;  2Y2H A;  4S2I A;  3A3E A;  1NZO A;  3HUO A;  4GOG A;  2EX8 A;  3E0Y A;  5MC7 A;  2VKS A;  4ZAM A;  2J7V A;  4ZTK A;  3N8L A;  2EX9 A;  1AXB A;  3RXW A;  3NUL A;  3BFG A;  5AQA A;  2ZC7 A;  4QJG A;  2PAV P;  3T4Q A;  3HLE A;  2PU2 A;  3F1P B;  1OTI A;  4GD6 A;  4EXO A;  2ZQ9 A;  3NBL A;  2OWH A;  4QWO A;  1OTD A;  2AVX A;  4KEN B;  3CMZ A;  2WUQ A;  1CEF A;  1HD8 A;  3N7W A;  3QNC A;  5FAT A;  3P01 A;  1CK3 A;  2VLG A;  3AGE A;  4E6X A;  2VGL M;  2HPB A;  2P9V B;  2V8C A;  3VE4 A;  1YSQ A;  2WZZ A;  3F1O B;  4OPR A;  4E6W A;  1D1J A;  5IS1 A;  1K55 A;  4PM8 A;  4G3W A;  4EUZ A;  3OZH A;  3M2J A;  3KYZ A;  4OKP A;  3NY4 A;  3BFF A;  4KZ9 A;  1K4E A;  2HJ9 C;  1MWT A;  2M7V A;  4Y7P A;  1OME A;  3QP8 A;  4DJ3 A;  2MJ6 A;  2L1M A;  3UE6 A;  2ZL1 A;  3RFB A;  4CLC E;  1JWP A;  4BL3 A;  3G6O A;  3VSK A;  4DMZ A;  3F1P A;  1T1A A;  4NK3 A;  2Y59 A;  3N8S A;  4GKU A;  2GDN A;  3T4S A;  3M6H A;  5HDD A;  2Y2Q A;  3LIF A;  3BLM A;  3WS2 A;  1BUL A;  1H0M A;  2XSS A;  4R3B A;  1S66 L;  3MZE A;  3G2Z A;  2OSU A;  3DTM A;  4KG5 A;  1RP5 A;  3TOI A;  1KVM A;  3PBT A;  3WWX A;  3CPT B;  3N4I A;  5L10 A;  5CTM A;  3F1O A;  5DKL A;  3T4O A;  4QY6 A;  2B18 A;  5G18 A;  1EW0 A;  2I9V A;  3ZYT A;  4I3J A;  1OTE A;  4KZ6 A;  1CJF A;  4Y3I A;  4X6T A;  3S7P A;  2LB5 A;  2WKH A;  4HJ4 A;  5CHU A;  2Y2J A;  1T1B A;  1KDS A;  1YLP A;  4GJ4 A;  2JE5 A;  1SKF A;  4IJG A;  3BLS A;  5HAP A;  3GVB A;  3PBQ A;  4PAU A;  4BJP A;  3LIC A;  1J3W A;  1MWR A;  1NZU A;  1S6R A;  2XFT A;  3CZD A;  4YWZ A;  1G68 A;  2HF6 A;  5J4E A;  1H5X A;  2EX6 A;  2W1R A;  2JC7 A;  5GLD A;  3V3R A;  3QP1 A;  5JYP A;  5A91 A;  3M6B A;  3P98 A;  4DF6 A;  4DE1 A;  3H82 B;  3G31 A;  4JF4 A;  2QYB A;  3B47 A;  1ALQ A;  3OLO A;  1SCW A;  3T1X A;  3IS2 B;  4MN5 A;  4DN0 A;  1MWU A;  2BG1 A;  3ITB A;  3TJZ C;  3CPT A;  5HZH A;  3DTE A;  3FV7 A;  1K56 A;  1G5U A;  4ZRR A;  5M1A A;  3FG8 A;  4BEN A;  4IVI A;  4ID4 A;  4Y5F A;  1VB6 A;  2XDM A;  5DF9 A;  4GZB A;  2PR5 A;  4JPM A;  4HP4 A;  1Q2Q A;  2XA7 S;  1PFL A;  3ISG A;  2V9A A;  3SW1 A;  3V3S A;  3NJA A;  2L0W A;  4K0W A;  3LR3 A;  1XJ6 A;  3E4P A;  4BD0 A;  1IKG A;  1YPR A;  5EPH A;  3CHW P;  1TD5 A;  4OOL A;  1KGE A;  2VGK A;  1AWI A;  3WRZ A;  1FSY A;  3OPH A;  1YT4 A;  3CI6 A;  4OPY A;  4Q0J A;  4GW9 A;  4OVD A;  1DP9 A;  2INW A;  4HQA A;  3DBA A;  4JXS A;  3T4T A;  5F83 A;  4S2M A;  2PDR A;  5AQB A;  5TJJ A;  1K55 C;  4E3L A;  4GNU A;  3E4Q A;  3Q1F A;  1ACF A;  3VMA A;  2G7U A;  1N9L A;  3JPU A;  1ZKJ A;  4R6L A;  4GS9 B;  3IH8 A;  1K6R A;  3IX4 A;  1NRF A;  3GSG A;  1L3L A;  4YNR A;  1W79 A;  2VV7 A;  2PHY A;  1PZP A;  1DRM A;  1NY0 A;  4KZ7 A;  3H7W B;  3IS2 A;  2ZQC A;  5IHV A;  4S2O A;  4KZ5 A;  3PAE A;  2R9W A;  2VK3 A;  2ZC3 B;  4JBF A;  5AVF A;  3CWF A;  4I3I A;  2J9O A;  3UE0 A;  3LIA A;  4K91 A;  1NYY A;  3S4X A;  1LT0 A;  3BFD A;  5A92 A;  4RQ9 A;  1T1C A;  1BLH A;  1GA0 A;  2XFS A;  5HPF A;  3MF0 A;  1VEU B;  2Y4A A;  3LIE A;  2XRN A;  5HWW A;  2FZ0 A;  2JCH A;  1JTG A;  3IXB A;  3MS6 A;  3MXQ A;  2QHK A;  1SDN A;  1XKZ A;  3T50 A;  4UA7 A;  1PI4 A;  4OQG A;  4NKP A;  1GHP A;  1PNE A;  4RVA A;  5EE8 A;  5E2H A;  1O7E A;  3WRT A;  2PBD P;  4F3L B;  3VV4 A;  3LEZ A;  4WM9 A;  1PWD A;  4LV3 A;  5C5K A;  4KQR A;  5F68 A;  4F94 A;  4KQO A;  2DRW A;  4GHI B;  4HNB A;  4WF0 A;  2X02 A;  4MN6 A;  1S1Z A;  4Q0H A;  1MWS A;  2YKH A;  4BBU A;  3A3I A;  3UB6 A;  3IXG A;  4GS9 A;  4JF5 A;  2IA2 A;  3ZNY A;  3LUQ A;  3W4O A;  4X25 A;  2Z6D A;  2QMI A;  5FL3 A;  2HDQ A;  5IU1 A;  4N92 A;  4B4X A;  5CXW A;  3UDF A;  2Z2L B;  3AGD A;  3D72 A;  1WA9 A;  2ZOI A;  4MLL A;  3H7W A;  3IWI A;  2O99 A;  3A3D A;  4LRX C;  2WAE A;  4O8G A;  2HP5 A;  3ZGA B;  4EBL A;  4BBT A;  4DDS A;  4EET B;  1F2K A;  1ES4 A;  5DJU A;  4O01 A;  4N9L A;  3BJN A;  3VOY A;  3UPP A;  2I72 A;  3C2W A;  4O0P A;  1IKI A;  1FIK A;  1FIL A;  2W0N A;  1VEU A;  1ESI A;  3HBR A;  4R3A A;  3NHQ A;  3NDG A;  3C38 A;  4HY8 A;  3IBJ A;  4DDY A;  3MFX A;  3N6I A;  4HH2 A;  2HDU A;  4II7 A;  3IX3 A;  1FR1 A;  5HWT A;  3BQ8 A;  1MBL A;  1JWV A;  3O5Y A;  1K6S A;  4G3V A;  4F3L A;  5L2F A;  2G2W A;  4P6Z M;  1ESU A;  1K38 A;  1K25 A;  3OCN A;  2HP9 A;  4XUX A;  3DAV A;  2WKR A;  4GHI A;  4R1G A;  4P0M A;  1XGJ A;  4HH3 A;  1IEL A;  4HJ6 A;  2WKE A;  2ZMV A;  3IHB A;  3UMD A;  3SH8 A;  5EEC A;  2A3U A;  4GD8 A;  4S2P A;  4OPQ A;  3NC8 A;  3WS5 A;  4EV4 A;  1HLU P;  1W8Q A;  3S7N A;  4FSF A;  2O9A A;  4I5S A;  4S2N C;  5F69 A;  1F5M A;  1IYQ A;  3B3X A;  1KVL A;  5FQQ A;  4S2J A;  1BYW A;  1K56 D;  3OPR A;  3IX8 A;  2ZC5 B;  1W63 M;  2BTF P;  4L9F A;  3IF5 A;  5DFY A;  5FAP A;  2ZC4 B;  1NLZ A;  3HLG A;  3Q7V B;  5GHX A;  2RL3 A;  3VFH A;  1LSX A;  4P6Z S;  3OPP A;  1L0D A;  4PHT A;  1NYM A;  4ZJ2 A;  2V1A A;  5CRF A;  2W3F A;  4QY5 A;  2XR0 A;  4NXE A;  4GLQ A;  1ZG4 A;  3DW0 A;  4I3A A;  1S4S A;  2XEP A;  1UGU A;  5M18 A;  4NG2 A;  4KUO A;  4S2K A;  1ZTU A;  4PKY A;  5GLA A;  3ZCZ A;  3IHA A;  2P74 A;  2XH9 A;  2IWB A;  4WZ5 A;  5TGF A;  5CEC A;  1PI5 A;  5M19 A;  4I39 A;  1RGZ A;  2Y2L A;  4B88 A;  4BMW A;  4OP5 A;  5DFX A;  5EM0 A;  4LV2 A;  3G4P A;  3CLO A;  4R70 A;  1KE4 A;  1NLY A;  2HZ5 A;  4NXG A;  3CAX A;  3HVF A;  4D60 A;  2EA9 A;  1FCM A;  1GHM A;  2Q9N A;  1DP8 A;  4FCF A;  2P04 A;  3P09 A;  5FI6 A;  1H8M A;  3HLF A;  3UPO A;  2ZL1 B;  1T19 A;  2WKQ A;  3KSF A;  1Y54 A;  4R4S A;  5HD5 A;  4DE0 A;  4EEU A;  4DE2 A;  3C7V A;  1S67 L;  3BYD A;  3ICY A;  3WS0 A;  2XK1 A;  4Y0T A;  2K7S A;  4E3K A;  4YOF A;  4MBH A;  5AQ7 A;  5E2E A;  2WAF A;  3Q7V A;  4UQI S;  3LEQ A;  4C75 A;  3GV9 A;  2XLN A;  4JGO A;  4MDZ A;  3GDI A;  3GMW A;  3ZG8 B;  4LCM A;  3UNW A;  4MNR A;  4ZDX A;  2JHE A;  5HDS A;  1DY6 A;  3BY8 A;  3OC2 A;  2K2N A;  3C4O A;  1KE3 A;  1FCN A;  5HAQ A;  3HLD A;  3O88 A;  2WYX A;  1EI5 A;  1ES3 A;  2OOL A;  2VV6 A;  1NXY A;  3PTE A;  4BBV A;  4FUW A;  4M4X A;  2B95 A;  5HD3 A;  1K54 A;  2GZA A;  4B93 A;  1U60 A;  4XUZ A;  4R0Q A;  4E3O A;  4R38 A;  1HTZ A;  3KO6 A;  3UDX A;  4DRT A;  4D2O A;  2HDR A;  2QZ6 A;  3PBS A;  1PYY A;  4LCL A;  3RTY A;  4KZ8 A;  5CX7 A;  4XXR A;  2RCX A;  3BY9 A;  2JKR M;  3T4K A;  3FZC A;  1XA7 A;  4JF6 A;  4WEK A;  2D01 A;  1G6A A;  5E2G A;  1HZO A;  3O86 A;  4G3K A;  4A5R A;  4GN2 A;  2C5W B;  1DJA A;  1CI9 A;  3FPW A;  1MC0 A;  4XT2 B;  1BTL A;  3IWQ A;  4K08 A;  2ZQD A;  3PHY A;  2DNS A;  3QP4 A;  2XGN A;  3IF6 C;  1PRQ A;  2W27 A;  2BAS A;  3PBO A;  4KZB A;  4RX2 A;  5E43 A;  1L0G A;  3Q81 A;  5HX9 A;  5EM1 A;  4ZJ1 A;  4H6J B;  3E2K A;  2EFU A;  4E3N A;  3F1N B;  1ERQ A;  3EWK A;  1ERO A;  1ERM A;  1UWP X;  1VQQ A;  3S22 A;  3KYQ A;  4OOY A;  3EGX C;  4OLG A;  3I7J A;  2JKT M;  4M3K A;  4WZ5 C;  3MKE A;  5DF8 A;  1XJ2 A;  4I38 A;  2XA7 M;  3PYP A;  4JGR A;  1S0W A;  4FH4 A;  3LR5 A;  2V20 A;  4KQQ A;  3PXP A;  1GCE A;  1IYS A;  3ZNT A;  4BWI A;  3IBR A;  5BOH A;  1OT6 A;  1WYC A;  4UA6 A;  5DJT A;  4IED A;  2PBY A;  4P87 A;  3NOP C;  3MBZ A;  3VE3 A;  3IQA A;  2IWD A;  2OV5 A;  4OPZ A;  1ONG A;  2WKI A;  2GNX A;  4R4R A;  5J3W A;  2J9P A;  1K0K A;  1PIO A;  3BEB A;  4XT2 A;  4QPR A;  2L4R A;  5CHJ A;  4WN5 A;  3LFV A;  4MCW A;  2VX8 A;  4K0X A;  2XQZ A;  4H6J A;  1SDE A;  1N9N A;  1PZO A;  4PKY G;  3LI9 A;  2Z2M B;  3F1N A;  5FEF A;  5FI7 A;  3B42 A;  4IUH A;  1N9O A;  1CQA A;  1G6O A;  4MMN A;  5L07 A;  4OQI A;  3T12 B;  3VFF A;  3BW6 A;  3K2N A;  1ZG6 A;  1DJC A;  1I2S A;  3T1S A;  3VSL A;  3LID A;  1QMF A;  4WYY A;  4YFM A;  4FH2 A;  2X71 A;  4ETX A;  3SS5 A;  3G34 A;  3O3V A;  3BWL A;  1YQS A;  5FDH A;  1N4O A;  3E2L A;  4UHU A;  1K54 C;  1Z6F A;  1XX2 A;  4FD8 A;  3UO9 A;  1XJ4 A;  5DTS A;  4S2N A;  2PYR A;  2QKP A;  2CC1 A;  4Y0O A;  3N8R A;  4PMA A;  2ZOH A;  3NI9 A;  4PM7 A;  4PPR A;  3ZG7 B;  3UB7 A;  4ETZ A;  2JKG A;  3BFE A;  3BM6 A;  3RXX A;  2J80 A;  4KZ4 A;  4WMC A;  3C5A A;  2GJ3 A;  1BSG A;  4IVK A;  3U4L P;  4WLA A;  3UE1 A;  1PWC A;  3MZD A;  5FA7 A;  3DWZ A;  1NRJ A;  2OLU A;  2V0U A;  1TS8 A;  3Q07 A;  5DVA A;  1TEM A;  4DKI A;  2KLI A;  4EER A;  4N1X A;  2Y91 A;  5GHZ A;  1GSW A;  3NOT C;  3UB9 A;  1MPL A;  1H8Z A;  5J8X A;  4X68 A;  1A0K A;  5HAI A;  1W63 Q;  4OH0 A;  2M1C A;  2ZMF A;  2HGV A;  1YLW A;  4X53 A;  5GLC A;  5HDC A;  4HOI A;  4LEN A;  4DJ2 A;  3A3F A;  1V9Z A;  3KSI A;  3CUE C;  1MXO A;  1XP4 A;  3ZDJ A;  1WE4 A;  2H28 A;  1QME A;  4O7D A;  3HL9 A;  3UY6 A;  1YKD A;  3LGO A;  2Y2N A;  1KGG A;  1GSV A;  2E8I A;  1I2W A;  1UWN X;  5EVI C;  1LL5 A;  4MBK A;  4WL9 A;  5KZH A;  3D9Y A;  2QJ7 A;  4Z9Q A;  2ZBB A;  3C8C A;  4QB8 A;  2M7U A;  2HV1 A;  4EWF A;  5FAQ A;  5FQK A;  3CJM A;  3L7H A;  5FAS A;  2WAD A;  3IF6 B;  5KSC A;  5FI2 A;  5F6A A;  5EVE A;  3LY3 A;  5HAR A;  4P6B A;  1XFN A;  4EES A;  1XPB A;  3LIB A;  1N9B A;  1ZC2 A;  2EXA A;  4N9K A;  4JGQ A;  5F5Y A;  4CJN A;  4WEL A;  4HEF A;  3W4Q A;  3ZVT A;  1M40 A;  1YAX A;  2OAP 1;  4OQ0 A;  3C30 A;  5FQJ A;  3QP6 A;  4ESP A;  4LPZ A;  5CHM A;  5EVI D;  3MMH A;  5KSH A;  3SS4 A;  5HPI A;  4Z1W A;  4PM6 A;  3HUN A;  5AVE A;  1Z09 A;  1ODV A;  3LO7 A;  2QPN A;  3KX0 X;  4CLC C;  1FCO A;  5J7E A;  2XD5 A;  2P08 A;  4OLD A;  3ZHH A;  4ARZ B;  1C3B A;  4KG6 A;  2XF3 A;  1X0O A;  4EQI A;  2Y2I A;  3UE3 A;  1LLB A;  5F82 A;  1OPX A;  4HHD A;  2Y2O A;  3MXS A;  2FFY A;  2PU4 A;  3UB5 P;  5AQ9 A;  2EXB A;  2P7J A;  5FEG A;  4U0T A;  5HWV A;  1L2S A;  2V0W A;  3PBN A;  1JNU A;  4UAA A;  4X55 A;  2CMN A;  5I94 A;  2ZLY A;  5A93 A;  1KOU A;  5CTN A;  3MQO A;  3JVU A;  2W3H A;  3IF6 A;  3RJU A;  3M2K A;  4Y2F A;  4NET A;  4OP8 A;  4DE3 A;  5HL6 A;  1NWZ A;  3UDI A;  2ZQA A;  4HP9 A;  1K4F A;  3G32 A;  1YLY A;  4EBN A;  2ZD8 A;  2QWS A;  4L9E A;  4C3Q A;  2FFF B;  3HCY A;  1L0E A;  5DKK A;  2D02 A;  4UEY A;  4AFI A;  2JBF A;  1XJ3 A;  1M6K A;  5HL1 A;  5FQI A;  3V67 A;  4OOM A;  2DCF A;  1H3Q A;  4UQI M;  4NEE D;  4X69 A;  3EEA A;  2HDS A;  5DF7 A;  2H5S A;  2VJW A;  1XGI A;  4EUV A;  1E4D A;  3PBR A;  3SOI A;  4P85 A;  2IWC A;  4JXG A;  2OAQ 1;  3UPN A;  4ARZ A;  5EUA A;  3WS4 A;  1E3U D;  5CGW A;  3EGD C;  3HJK A;  5L8M A;  4Y0U A;  2PD7 A;  4PM5 A;  4WMC D;  4EBP A;  4GCZ A;  3QP2 A;  2BLS A;  2GX5 A;  1YMX A;  3D3O A;  3ZG5 A;  5TBM B;  3NOU C;  4FOF A;  4MN7 A;  3ZG0 A;  3W8K A;  4H8R A;  3SH9 A; 
#chains in the Genus database with same CATH homology
 4WZ4 A;  3W4P A;  1ERO A;  3IH8 A;  1K6R A;  3DWK A;  1ERM A;  1JTD A;  1FSW A;  1NRF A;  3GSG A;  3LCE A;  1BLS A;  2Y2K A;  4QD4 A;  1VQQ A;  2H10 A;  3S22 A;  2Y2P A;  3V39 A;  4PM9 A;  1W79 A;  4OOY A;  2HP6 A;  3V5M A;  1PZP A;  4OLG A;  1W8Y A;  3I7J A;  1VM1 A;  1YLJ A;  1NY0 A;  4IBR A;  4M3K A;  3GTC A;  4JXW A;  4KZ7 A;  4QU3 A;  4WZ5 C;  2ZQC A;  5IHV A;  3MKE A;  2R9X A;  5DF8 A;  4S2O A;  4KZ5 A;  3PAE A;  4JLF A;  2R9W A;  2ZC3 B;  2ZJ9 A;  3AGF A;  4JBF A;  4DXB A;  1JVJ A;  2V2F F;  5E2F A;  5F1F A;  1FR6 A;  2J9O A;  1S0W A;  1GHI A;  4C6Y A;  4FH4 A;  3UE0 A;  1TVF A;  2ZQ7 A;  5GL9 A;  5FQ9 A;  4K91 A;  2V20 A;  4KQQ A;  1NYY A;  3HLC A;  1LL9 A;  3S4X A;  1K57 C;  3EQV A;  1GCE A;  1IYS A;  3G2Y A;  3ZNT A;  4UA9 A;  3IWO A;  3BFD A;  5A92 A;  1BLH A;  4B4Z A;  1GA0 A;  1BZA A;  2XFS A;  5BOH A;  1WYC A;  4UA6 A;  2Y4A A;  4IED A;  2PBY A;  2JCH A;  1JTG A;  3EQU A;  3IXB A;  1ONH A;  4P87 A;  1SDN A;  1XKZ A;  4BD1 A;  3OPL A;  4OQH A;  3MBZ A;  4UA7 A;  1PI4 A;  4OQG A;  3IQA A;  4X56 A;  1ES5 A;  4MEZ A;  1FOF A;  2IWD A;  1NJ4 A;  4BQM A;  1GHP A;  2OV5 A;  3GRJ A;  4RVA A;  4HES A;  4OPZ A;  1ONG A;  5EE8 A;  1YM1 A;  2WKI A;  4R4R A;  1PW1 A;  2J9P A;  5E2H A;  1O7E A;  3WRT A;  3SH7 A;  2V1Z A;  3FKW A;  3LEZ A;  1PIO A;  3BEB A;  3JYI A;  4WM9 A;  1PWD A;  2X01 A;  4LV3 A;  2XD1 A;  5EVI B;  1CI8 A;  4HBT A;  5D3O A;  4KQR A;  3G35 A;  1E25 A;  2WGV A;  1EWZ A;  4R23 A;  5CHJ A;  3VP4 A;  4KQO A;  4F94 A;  2DRW A;  2A49 A;  1L0F A;  1LI9 A;  1BUE A;  3OCL A;  4HBU A;  4IBX A;  4GB7 A;  1FQG A;  3A3J A;  4BLM A;  3PAG A;  4GDB A;  2X02 A;  4K0X A;  2XQZ A;  1PWG A;  1MWS A;  4JXV A;  4L0L A;  1SDE A;  3BRM A;  3MZF A;  1PZO A;  1WYB A;  1XA1 A;  3ITA A;  1LI0 A;  5FQM A;  2Z2M B;  3A3I A;  3FKV A;  5FI7 A;  3FYZ A;  3FWL A;  3IXG A;  4JF5 A;  3ZNY A;  4OQI A;  3VP1 A;  3W4O A;  2B5R A;  5DTK A;  2QMI A;  2HDQ A;  3VFF A;  4N92 A;  2WGW B;  4B4X A;  1ZG6 A;  5CXW A;  1DJC A;  3NIA A;  3UDF A;  2Z2L B;  3AGD A;  3CG5 A;  4LV1 A;  1I2S A;  4ZJ3 A;  3LY4 A;  3VSL A;  4MLL A;  2ZM0 A;  3IWI A;  1QMF A;  4WYY A;  4YFM A;  3A3D A;  2WAE A;  4FH2 A;  2X71 A;  1IEM A;  5DTT A;  2HP5 A;  3SS5 A;  3G34 A;  4YIN A;  3ZGA B;  3O3V A;  4U0X A;  4EBL A;  4DDS A;  2EX2 A;  1BLC A;  1ES4 A;  1I5Q A;  1YQS A;  2Y2H A;  1IYO A;  5FDH A;  1N4O A;  3E2L A;  1YMS A;  4N9L A;  4S2I A;  1K54 C;  1Z6F A;  4UHU A;  1XX2 A;  3NCK A;  3VOY A;  4E3M A;  3UPP A;  4FD8 A;  2I72 A;  3A3E A;  1NZO A;  3UO9 A;  3HUO A;  4OON A;  5DTS A;  4S2N A;  3BFC A;  1IKI A;  2CC1 A;  2EX8 A;  4GOG A;  4Y0O A;  3N8R A;  5CGS A;  3S1Y A;  2G2U A;  4PMA A;  3NI9 A;  4PM7 A;  1ESI A;  3HBR A;  4PPR A;  4ZAM A;  5EOE A;  3ZG7 B;  5A90 A;  3NDG A;  2J7V A;  3Q7Z A;  3SS3 A;  4ZTK A;  2P9V A;  2UWX A;  3N8L A;  4DDY A;  5EOO A;  1KDW A;  3N6I A;  2EX9 A;  1AXB A;  3RXW A;  1TDG A;  3BFE A;  3BFG A;  2HDU A;  3BM6 A;  2Y55 A;  3RXX A;  4S2L A;  4KZ4 A;  4WMC A;  3G30 A;  3C5A A;  1FR1 A;  2ZM2 A;  5AQA A;  1MBL A;  2ZC7 A;  1JWV A;  1K6S A;  1BSG A;  5L2F A;  4IVK A;  4ZBE A;  4QJG A;  2G2W A;  3UE1 A;  1PWC A;  4QHC A;  3HLE A;  2PU2 A;  3MKF A;  3MZD A;  5FA7 A;  3DWZ A;  5FAO A;  1ESU A;  4GD6 A;  1K38 A;  2OLU A;  4R3J A;  5EVI A;  1YLZ A;  2ZQ9 A;  3NBL A;  4Q8I A;  1K25 A;  3OCN A;  2HP9 A;  3Q07 A;  5DVA A;  1TEM A;  4XUX A;  4DKI A;  4N1X A;  2Y91 A;  4R1G A;  4KEN B;  4P0M A;  1XGJ A;  5TFQ A;  3ZVW A;  1IEL A;  3CMZ A;  2WUQ A;  3GQZ A;  3HLB A;  5GHZ A;  5CER A;  1CEF A;  1HD8 A;  1MPL A;  3N7W A;  2WKE A;  3QNC A;  3TSG A;  5FAT A;  1H8Z A;  5J8X A;  4X68 A;  3IHB A;  5HAI A;  3SH8 A;  1GA9 A;  4OH0 A;  5EEC A;  2A3U A;  1CK3 A;  3AGE A;  4KZA A;  4GD8 A;  4WBG A;  4E6X A;  2HPB A;  4OPQ A;  3NC8 A;  4S2P A;  1BT5 A;  4WEJ A;  2P9V B;  3WS5 A;  4EV4 A;  1W8Q A;  4FSF A;  1YLW A;  4X53 A;  2WK0 A;  2WGW A;  5GLC A;  4S2N C;  1BLP A;  5FSR A;  1IYQ A;  2WZZ A;  3B3X A;  1KVL A;  4LEN A;  4S2J A;  5FQQ A;  3A3F A;  4OPR A;  1K56 D;  3OPR A;  1MXO A;  1XP4 A;  2ZC5 B;  3ZDJ A;  1WE4 A;  4E6W A;  1QME A;  4O7D A;  5GLB A;  3HL9 A;  3UY6 A;  2VGJ A;  3BEC A;  2Y2M A;  3IF5 A;  2Y2N A;  5FAP A;  1KGG A;  1KE0 A;  2ZC4 B;  3HLG A;  2C6W B;  1MKI A;  1J9M A;  3Q7V B;  3GR2 A;  1K55 A;  5GHX A;  4PM8 A;  2E8I A;  2RL3 A;  1I2W A;  3VFH A;  4EUZ A;  3OZH A;  3OPP A;  1L0D A;  1NYM A;  3M2J A;  5CRF A;  4ZJ2 A;  1MY8 A;  4MBF A;  1PW8 A;  5EVI C;  4QY5 A;  1LL5 A;  4MBK A;  4OKP A;  5KZH A;  3NY4 A;  2XR0 A;  3BFF A;  4KZ9 A;  1K4E A;  3IH9 A;  1ZG4 A;  1MWT A;  3DW0 A;  4N1H A;  4Z9Q A;  3ZG9 B;  4Y7P A;  2XEP A;  3UN7 A;  1OME A;  4QB8 A;  5M18 A;  4S2K A;  2Q9M A;  4RYE A;  3MFD A;  3QHY A;  1JWP A;  4BL3 A;  1RCJ A;  3VSK A;  4EWF A;  3NDE A;  5GLA A;  3ZCZ A;  3IHA A;  5FAQ A;  4NK3 A;  2P74 A;  2XH9 A;  2Y59 A;  2IWB A;  5FQK A;  4WZ5 A;  3CJM A;  3N8S A;  4GKU A;  5TGF A;  1PI5 A;  5CEC A;  2GDN A;  4RX3 A;  3M6H A;  5FAS A;  5M19 A;  2WAD A;  2Y2Q A;  1RGZ A;  3IF6 B;  5KSC A;  5FI2 A;  2Y2L A;  4B88 A;  3BLM A;  4OP5 A;  3WS2 A;  1BUL A;  3LY3 A;  5HAR A;  4P6B A;  3C7U A;  1K57 A;  4R3B A;  4LV2 A;  3MZE A;  3G4P A;  1XPB A;  1KE4 A;  4KZ3 A;  1N9B A;  1ZC2 A;  3G2Z A;  2OSU A;  3DTM A;  2ZC6 B;  4KG5 A;  1YLT A;  1RP5 A;  3HVF A;  1FCM A;  5TR7 A;  3TOI A;  1GHM A;  2EXA A;  2Q9N A;  1E3U A;  1W5D A;  4N9K A;  4CJN A;  1KVM A;  2ZQ8 A;  3PBT A;  3WWX A;  4WEL A;  4DXC A;  4FCF A;  4HEF A;  1RGY A;  3W4Q A;  3P09 A;  1M40 A;  3ZVT A;  4OQ0 A;  5FI6 A;  5FQJ A;  3HLF A;  5CEB A;  3N4I A;  3UPO A;  5CHM A;  5EVI D;  2Y2G A;  5CTM A;  5KSH A;  3SS4 A;  5JYO A;  1IYP A;  4QY6 A;  4PM6 A;  5G18 A;  1O07 A;  3HUN A;  1Y54 A;  4R4S A;  4DE0 A;  4DE2 A;  3O87 A;  3C7V A;  3LO7 A;  3HUM A;  3BYD A;  2QPN A;  4KZ6 A;  3WS0 A;  5GHY A;  2XK1 A;  4Y0T A;  4E3K A;  5AQ7 A;  4LV0 A;  4MBH A;  1FCO A;  5E2E A;  2XD5 A;  2ZM8 A;  2WAF A;  3Q7V A;  4OLD A;  3ZHH A;  4X6T A;  4C75 A;  3GV9 A;  1C3B A;  2WKH A;  3IT9 A;  4KG6 A;  2XLN A;  2XF3 A;  5CHU A;  2Y2J A;  2Y2I A;  3UE3 A;  4EQI A;  3GMW A;  1LLB A;  5F82 A;  3ZG8 B;  5CED A;  4LCM A;  2Y2O A;  3UNW A;  1KDS A;  3VOZ A;  4MNR A;  3V50 A;  4ZDX A;  1YLP A;  3MXS A;  1DY6 A;  2FFY A;  3OC2 A;  2JE5 A;  3VP2 A;  3C4O A;  1KE3 A;  2PU4 A;  1FCN A;  1SKF A;  5HAQ A;  1LHY A;  5HAP A;  3BLS A;  5AQ9 A;  3TG9 A;  3GVB A;  3IXH A;  3PBQ A;  3HLD A;  2EXB A;  4U0T A;  2H0T A;  4BJP A;  3O88 A;  2WYX A;  1MWR A;  1NZU A;  1S6R A;  2XFT A;  3CZD A;  1EI5 A;  1G68 A;  1ES3 A;  1L2S A;  3PBN A;  1H5X A;  4JKT A;  4UAA A;  3IXD A;  3VP3 A;  4X55 A;  2EX6 A;  5I94 A;  4E3J A;  1NXY A;  4RA7 A;  3PTE A;  2ZLY A;  5F1G A;  5A93 A;  2JC7 A;  5GLD A;  5CTN A;  3V3R A;  1DJB A;  3IF6 A;  3RJU A;  3M2K A;  5JYP A;  5A91 A;  4NET A;  4OP8 A;  3M6B A;  3P98 A;  4BL2 A;  1ES2 A;  4DE3 A;  4DF6 A;  3UDI A;  3HLW A;  2ZQA A;  4DE1 A;  1CEG A;  1K4F A;  1K54 A;  2WZX A;  3G31 A;  3G32 A;  3MXR A;  2EFX A;  4JF4 A;  1YLY A;  1ALQ A;  1KGF A;  3C4P A;  1SCW A;  4EBN A;  2ZD8 A;  1U60 A;  4XUZ A;  4R0Q A;  4C3Q A;  4E3O A;  1TDL A;  1MWU A;  5U47 A;  2BG1 A;  1HTZ A;  2FFF B;  3ITB A;  3ZFZ A;  3UDX A;  4DRT A;  4U3T A;  1L0E A;  3VP0 A;  4GDN A;  4D2O A;  5HFO A;  2HDR A;  2QZ6 A;  1K56 A;  3FV7 A;  3PBS A;  2OLV A;  5M1A A;  1PYY A;  2JBF A;  4BEN A;  1M6K A;  4ID4 A;  4IVI A;  5HL1 A;  4LCL A;  5FQI A;  4OOM A;  5CGX A;  2DCF A;  2ZMA A;  4KZ8 A;  5EVL A;  2XDM A;  5DF9 A;  3D4F A;  4GZB A;  4JPM A;  4X69 A;  1HVB A;  4XXR A;  1Q2Q A;  2HDS A;  2RCX A;  5DF7 A;  3ISG A;  2H5S A;  1XGI A;  4KG2 A;  1E4D A;  3FZC A;  3V3S A;  3PBR A;  3SOI A;  4P85 A;  4K0W A;  2IWC A;  4JXG A;  4BD0 A;  1IKG A;  1XA7 A;  4JF6 A;  3UPN A;  5EUA A;  4WEK A;  5EPH A;  3Q82 A;  3WS4 A;  1E3U D;  5CGW A;  1G6A A;  4OOL A;  5E2G A;  1HZO A;  3O86 A;  4A5R A;  1KGE A;  2VGK A;  4GN2 A;  2C5W B;  3WRZ A;  1H8Y A;  1W7F A;  3HRE A;  1DJA A;  1CI9 A;  4Y0U A;  1BTL A;  1FSY A;  3IWQ A;  3OPH A;  4E3I A;  1YT4 A;  4OPY A;  4WMC D;  4PM5 A;  3QNB A;  4EBP A;  2ZQD A;  2DNS A;  2XGN A;  2J8Y A;  4OVD A;  3WS1 A;  3IF6 C;  4JXS A;  1JWZ A;  5F83 A;  1XXM A;  2BLS A;  4S2M A;  1YMX A;  5AQB A;  5KMW A;  1K55 C;  3PBO A;  4KZB A;  4RX2 A;  5E43 A;  4E3L A;  3ZG5 A;  2H0Y A;  1L0G A;  4GNU A;  1SHV A;  3Q1F A;  3Q81 A;  5HX9 A;  4ZJ1 A;  5HW3 A;  2WGI A;  3ZG0 A;  3W8K A;  3E2K A;  4H8R A;  3VMA A;  4CPK A;  2EFU A;  4E3N A;  1Q2P A;  3SH9 A;  1ZKJ A;  1ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...