3BLMA

Refined crystal structure of beta-lactamase from staphylococcus aureus pc1 at 2.0
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Refined crystal structure of beta-lactamase from Staphylococcus aureus PC1 at 2.0 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 94
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1990-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3blmA00
1KE4A 3LY3A 3BFGA 1YLPA 2X01A 3O86A 3E2KA 1XA1A 4WMCD 4IVKA 4OOLA 1KVLA 3V50A 1PWCA 3SS4A 1XA7A 4MLLA 2Q9MA 2PBYA 3UPOA 1EWZA 1IYSA 2VGKA 4LV0A 5FI2A 1YLTA 5FDHA 1NRFA 5E2EA 2H0TA 5EUAA 2IWCA 5EE8A 1VQQA 3IF6B 2ZMAA 4KZ9A 2V1ZA 1K55C 1MPLA 4E6XA 4WEJA 3OZHA 3BFDA 4ZDXA 4CJNA 4LV1A 4JF6A 3G35A 4B88A 2EX6A 2QMIA 1DY6A 3AGDA 1K57A 4NK3A 3BEBA 3PTEA 3MXSA 5BOHA 2ZM2A 3GR2A 4H8RA 3EQUA 3AGEA 3BFEA 1K38A 1YT4A 3JYIA 5D3OA 4GDNA 1GHPA 3HVFA 1W8QA 3OCLA 2Y2JA 1YM1A 3QNCA 3SH9A 3SOIA 3LO7A 4XXRA 3UNWA 3HUMA 1K4EA 5A92A 5FAOA 4F94A 3G2ZA 5FQIA 3NDEA 4DDSA 1C3BA 1BLSA 1S0WA 4OVDA 4QD4A 4X6TA 3MKEA 2ZC6B 4K0WA 5G18A 3UDFA 2ZQ9A 3ZVWA 1KE0A 4Y7PA 3GQZA 4WZ5A 5TR7A 1FQGA 3G31A 5GLAA 4X55A 3UPPA 5M1AA 3IHAA 1GA9A 1K57C 1PWDA 1ONGA 1NYMA 3C7VA 5EVID 1CK3A 4P0MA 4GKUA 5CGWA 4LV2A 1JWPA 2H5SA 3DTMA 3OPLA 4D2OA 3HLBA 5A93A 1Z6FA 5EVIA 2XF3A 3WWXA 4DXCA 1NZUA 1LL5A 3ZCZA 1AXBA 1M6KA 2EXBA 3MZEA 1DJAA 1BTLA 1S6RA 1XGJA 3MFDA 4JKTA 4WZ5C 5HARA 3TOIA 4DE3A 3ITAA 2WGVA 1H5XA 3WRZA 4KQOA 1ES5A 2XQZA 2ZM0A 3CJMA 3IXGA 3N6IA 4FH4A 4KZ5A 4S2JA 2C6WB 2HDQA 2XH9A 3A3JA 4E3LA 1YLYA 5DF9A 5HL1A 3PBTA 3WS5A 2XD5A 3BFCA 3Q1FA 1H8YA 3NY4A 1CI9A 5EOOA 5EVIC 2Y2PA 2JBFA 3DWZA 3O87A 4OLDA 1PW1A 2XR0A 3OCNA 2FFYA 3ZNYA 3HLGA 3FZCA 1ONHA 4R3BA 4E3OA 4HBUA 2I72A 2Y2GA 3FYZA 1WYBA 4UHUA 3N7WA 4IEDA 3VP2A 3RJUA 3PBOA 4E3IA 2IWBA 2WADA 2EFXA 4JF4A 5F1GA 4BQMA 5HAPA 4ZAMA 1BSGA 5FA7A 1JTGA 2WZZA 3HLEA 4JBFA 1MWRA 2Z2MB 1ERQA 2ZJ9A 3BRMA 3S4XA 4UA9A 1GCEA 1Q2QA 5DTSA 5F83A 1I2WA 2XLNA 4KENB 3VP4A 3PBSA 4L0LA 1WE4A 4GOGA 4LV3A 3CZDA 3EQVA 3B3XA 5F82A 3SH8A 5CECA 1K56D 4HBTA 2WGWB 3IWOA 3V3RA 4PM6A 4MBKA 1K54A 1TVFA 1MKIA 2ZQ7A 1W7FA 2ZC7A 1VM1A 4OQ0A 2XEPA 1KDWA 3OPPA 4KZ6A 1QMEA 4A5RA 4BJPA 2Y91A 2HPBA 3PBNA 4KZ4A 3Q81A 3VP3A 1WYCA 3G2YA 3P09A 1K56A 5M19A 4EUZA 2QPNA 4JXSA 5CTNA 1PZPA 5TFQA 4PM7A 1CI8A 1TEMA 2WZXA 3N8SA 1XGIA 3Q7VB 2Y2QA 3A3FA 4CPKA 4GN2A 1PYYA 2G2WA 5GLDA 3O3VA 2IWDA 1ALQA 4YINA 1MWUA 5AQBA 1XKZA 4Y0TA 4RVAA 4Y0OA 4RX2A 4EWFA 3OC2A 4IBXA 3ZG5A 4BD1A 3HLFA 3A3DA 4ZJ1A 4S2PA 2A49A 1K54C 1JWZA 1E3UD 3BYDA 4K91A 1L2SA 2ZC4B 3ZG9B 3G4PA 3OPRA 2DNSA 1FSYA 3PBQA 4JXWA 2OLUA 5FQQA 5GLCA 3BM6A 4DKIA 2Y2LA 4OPZA 1RCJA 2P9VB 2ZLYA 3M2JA 4OP5A 1L0GA 3W8KA 3FKVA 4B4ZA 4WMCA 4BD0A 3M2KA 5KMWA 1DJBA 3LEZA 4S2MA 4GD8A 3VFFA 2ZQ8A 4MNRA 2G2UA 3W4PA 2ZQAA 1LLBA 2JCHA 2HP6A 3PBRA 5FI6A 3UN7A 2EX2A 3ZNTA 1CEFA 1XXMA 5KSHA 4DE2A 1PI4A 2A3UA 5E43A 4P6BA 3UE0A 3V3SA 3BLMA 2H0YA 4PM8A 1GA0A 4LENA 5CGXA 1NYYA 1IELA 3G32A 4U0TA 1I5QA 4EBPA 2XGNA 3W4QA 1BLPA 5DF8A 3VSLA 1FCMA 5DTTA 2WK0A 4OQIA 4DDYA 4XUZA 4U0XA 4BLMA 1CEGA 5M18A 4UAAA 1TDLA 4OOMA 1Y54A 5DVAA 1PZOA 4KG6A 2V2FF 5TGFA 2WGIA 2J9OA 5FASA 1L0FA 1LHYA 3CG5A 5DTKA 2HDUA 1IEMA 3QNBA 1FSWA 2XFSA 2WAEA 4S2IA 1GHMA 2OSUA 3LY4A 5CXWA 4QHCA 2RCXA 4BL2A 1ZG4A 5AQ9A 3O88A 4KZBA 4OONA 1I2SA 4DE1A 3VFHA 1ERMA 1RGZA 1W79A 5HFOA 1PW8A 3C7UA 5FSRA 4QU3A 3ZG7B 4MEZA 4N92A 1YMXA 3M6HA 4X68A 4M3KA 3HLDA 4QY5A 4WEKA 4DRTA 3NDGA 5FQ9A 5EVIB 1KGEA 3WS0A 1O7EA 2Y2OA 2ZQDA 4E3KA 4E3NA 4KZ8A 5CRFA 1FCOA 2BG1A 2E8IA 4ZTKA 1IYOA 3E2LA 4OQHA 5EOEA 4OLGA 3UDXA 3CMZA 2RL3A 2EXAA 3DWKA 4C75A 5CEBA 1EI5A 2WKEA 1LI0A 3HUOA 1SHVA 3DW0A 1NXYA 1ES2A 2Y2NA 3PAGA 4GB7A 1BLHA 1M40A 1BT5A 4JF5A 1IKIA 3TSGA 2BLSA 3VOZA 1LI9A 3I7JA 1Q2PA 3GV9A 3UE1A 4K0XA 3HLCA 1HZOA 2WKIA 4YFMA 3UPNA 1MBLA 3IXBA 2EFUA 1KE3A 2HP5A 3ZHHA 5A90A 1G6AA 3V39A 4PPRA 3MBZA 1MXOA 3FKWA 4WBGA 3Q07A 4RYEA 4X53A 5KSCA 3C4OA 1BULA 4R3JA 1IYPA 1PWGA 4QJGA 3IXHA 5JYOA 1HVBA 1PIOA 4HESA 3HL9A 3IT9A 2Y59A 4ID4A 4LCMA 1LL9A 4UA7A 4KG5A 4MBFA 1FCNA 1YQSA 2C5WB 4NETA 2ZC3B 3HUNA 4JPMA 2X71A 2Q9NA 4RX3A 4X56A 5EECA 1XPBA 3ISGA 3MZDA 2JC7A 1W8YA 3NBLA 2J8YA 4IBRA 4S2LA 5CHUA 5GHXA 2XD1A 5FI7A 4FCFA 2OV5A 3Q7VA 1G68A 2J7VA 5EVLA 5IHVA 5FAPA 2ZC5B 3SH7A 4KG2A 5JYPA 4OPRA 4Z9QA 3FV7A 5HW3A 3FWLA 2HDSA 2WKHA 2JE5A 3ZFZA 1FR6A 4DE0A 4KZ7A 5J8XA 2B5RA 4S2KA 4GDBA 2DCFA 1FR1A 3WS2A 4E6WA 2WAFA 1N4OA 1ZKJA 2Y4AA 3PAEA 1XX2A 4UA6A 1MWSA 3ZGAB 2VGJA 2ZD8A 3G30A 1ZG6A 1SCWA 1N9BA 2FFFB 5CGSA 1MWTA 1RGYA 1E3UA 4ZJ3A 4C3QA 3N8LA 1ES4A 3C4PA 5L2FA 3ZG8B 2X02A 5FQMA 3IF6A 1ZC2A 4DXBA 1IKGA 4QY6A 4E3JA 3RXWA 4Q8IA 4HEFA 1K6SA 4KZ3A 4XUXA 4C6YA 3N4IA 2PU2A 1K25A 3SS5A 3ZVTA 3WRTA 3QHYA 2Y2HA 3GTCA 1E4DA 1XP4A 5AQAA 3ZG0A 3BLSA 1JWVA 5FAQA 1KGFA 5E2HA 1YLJA 2QZ6A 3GMWA 1GHIA 3IF6C 4GNUA 4JXGA 4WM9A 5EPHA 2GDNA 3P98A 4P85A 1J9MA 3G34A 4EV4A 4R4SA 3MKFA 1BZAA 4E3MA 5I94A 4IVIA 4S2NA 4PM9A 5GHYA 5CHMA 4ZJ2A 5HAIA 3BECA 2WUQA 2ZQCA 3GRJA 3ITBA 3UY6A 4KZAA 1JVJA 3IWQA 5CERA 4R4RA 4B4XA 1ESUA 3HREA 3IWIA 1U60A 1OMEA 3HLWA 1RP5A 5U47A 2V20A 4N1XA 1L0EA 1NY0A 3NC8A 3V5MA 3IH8A 1ES3A 1FOFA 5CHJA 3UDIA 4S2NC 2XDMA 1NZOA 4X69A 4P87A 1O07A 5FATA 3NI9A 2ZM8A 4JXVA 2HP9A 3N8RA 2XK1A 2EX9A 4KQQA 5HAQA 1E25A 1TDGA 3SS3A 3AGFA 2P74A 1KGGA 3Q7ZA 4JLFA 4U3TA 4DF6A 2R9WA 3IHBA 1PI5A 4PMAA 3S1YA 4BL3A 3D4FA 5AQ7A 5KZHA 5A91A 1L0DA 3IQAA 4N1HA 5FQKA 2Y2IA 3ZDJA 4EBLA 4EQIA 2Y2KA 2XFTA 3UO9A 3UE3A 1IYQA 4GD6A 1YLZA 4OP8A 5CTMA 3C5AA 4WZ4A 3VP0A 4OQGA 4OPYA 4FSFA 2H10A 2PU4A 4WELA 4RA7A 1W5DA 4BENA 5CEDA 2WGWA 1ESIA 1KDSA 3BFFA 3MZFA 4FH2A 4R1GA 3WS4A 3S22A 1MY8A 3GSGA 4S2OA 3NIAA 5GHZA 4N9LA 4MBHA 2EX8A 1K6RA 3TG9A 1HTZA 1DJCA 3W4OA 3WS1A 3Q82A 3RXXA 4OH0A 1KVMA 2HDRA 1JTDA 4R0QA 1K4FA 1HD8A 2WYXA 3GVBA 2Y55A 4FD8A 2UWXA 2OLVA 3M6BA 1QMFA 5FQJA 3IH9A 3VMAA 3HBRA 4GZBA 1BUEA 5GLBA 4WYYA 1H8ZA 2DRWA 4OOYA 5HX9A 4O7DA 5DF7A 3OPHA 2Z2LB 1YLWA 4LCLA 1NJ4A 2CC1A 2R9XA 4KQRA 3NCKA 3VP1A 3VSKA 1BLCA 1SDNA 4OKPA 5E2FA 4PM5A 3MXRA 4QB8A 5GL9A 2J9PA 2P9VA 1SKFA 3LCEA 1YMSA 1EROA 4OPQA 4EBNA 5E2GA 2Y2MA 3VOYA 4ZBEA 1K55A 3IF5A 3IXDA 4Y0UA 1SDEA 3A3IA 3A3EA 5F1FA 4N9KA 4R23A
chains in the Genus database with same CATH superfamily
2OOLA 4OOLA 1KVLA 2WKQA 4MCWA 3UMEA 4NKPA 2PBYA 3UPOA 3T50A 1YLTA 5EE8A 4E6XA 4ZDXA 4B88A 2HF6A 3BEBA 3EQUA 3JYIA 3HVFA 1W8QA 2Y2JA 1T18A 4KQDA 3CAXA 3SH9A 1G5UA 3HUMA 4BBVA 4G3WA 4QD4A 3LIFA 4X6TA 4K0WA 2ZQ9A 3MQOA 5M1AA 1GSXA 1PWDA 1NYMA 3OPLA 3KSHA 4GCZA 3HLBA 1S4RA 4PAUA 2XF3A 1LL5A 4HNBA 1M6KA 2EXBA 5DJUA 1BTLA 3MFDA 4DE3A 1NRJA 1ES5A 2ZM0A 3CJMA 2C6WB 2XH9A 3MQQA 2Z6DA 2NUPC 3Q1FA 3MMHA 3NY4A 1CI9A 4OLDA 1PW1A 3TRCA 3A0SA 3HLGA 3FZCA 4H6JB 3PHYA 1WYBA 4UHUA 1SKOB 2EFXA 2WADA 1JTGA 3HLEA 4ARZA 4JBFA 1MWRA 1TF1A 1GCEA 4E04A 3T4LA 1I2WA 4LV3A 2V8CA 4EW7A 3SH8A 3A0RA 4HBTA 2O0YA 2ZC7A 1VM1A 1LSXA 2P7JA 1QMEA 2PR5A 5AVFA 2HPBA 1TEMA 3A3FA 2L0WA 2OWHA 4CPKA 1ALQA 1MWUA 4EWFA 3OC2A 2W3FA 4UQIM 2A49A 2KLIA 4HH2A 3QP6A 2V8FA 4ETZA 4JXWA 3HJIA 1VB6A 4B9OA 2Y2LA 4OPZA 1RCJA 3M2JA 1L0GA 3W8KA 4B4ZA 1DJBA 5DKKA 1MKMA 2GZAA 2BASA 1G28A 2QJ7A 2L4RA 4FUWA 5I5LA 2G2UA 3VE4A 2JCHA 2K2NA 3T4JA 3BLMA 4PM8A 3D72A 3G32A 1I5QA 4EBPA 4NEED 4LRZE 3UMDA 4EESA 1FCMA 5HWWA 4BLMA 4UAAA 2O9CA 1PZOA 4KG6A 1LHYA 3T1RA 3QP1A 1FSWA 4S2IA 1GHMA 5TBMB 1ZG4A 1UWPX 4OONA 1XFQA 1I2SA 1ERMA 5HFOA 4QU3A 4MEZA 4N92A 4X68A 3OLOA 3T4SA 5KIZA 3WS0A 1O7EA 4E3NA 5HWTA 4ZTKA 3BQ8A 3CITA 3LR5A 3CMZA 2RL3A 3DWKA 1F2KA 5CEBA 1EI5A 2WKEA 3DW0A 1NXYA 2MJ6A 5IT5A 3GV9A 1DP8A 4YFMA 2HP5A 1YKDA 4WBGA 4R3JA 2EWVA 1PWGA 2J3TC 4I3JA 1HVBA 1PIOA 3HL9A 3IT9A 4HOIA 4ID4A 4LCMA 4LRXC 2BTFP 4MBFA 1FCNA 1YQSA 3JPUA 3HUNA 2X71A 4RX3A 5EECA 3ISGA 1H3QA 1S4SA 5FI7A 4FCFA 4NG2A 1TS7A 3Q7VA 3SH7A 3QP2A 4R70A 3V67A 1NWZA 5HW3A 3FWLA 2WKHA 2W1TA 2JE5A 3ZFZA 1AWIA 4DE0A 5J8XA 3QP5A 4E6WA 2K31A 2HGVA 3WS2A 3DTKA 2WAFA 3NOPC 4FTXA 4UA6A 3ZGAB 1Y4OA 1RGYA 1E3UA 4ZJ3A 3IX4A 3C4PA 4Y5FA 3MQ0A 3T1SA 4L9GA 3B47A 4XT2B 2V0WA 4E3JA 4KUOA 4KZ3A 4C6YA 3IBJA 1XP4A 4B93A 2VX8A 2P08A 2QZ6A 4GNUA 4EQ1A 1MC0A 5EPHA 2JKFA 4HH3A 1J9MA 3G34A 4R4SA 3MKFA 3LIAA 4P6ZS 3MR0A 2V0UA 4PM9A 3BECA 2WUQA 3IWIA 2QHKA 2XROA 3CUEA 4N1XA 1NY0A 3V5MA 1WA9A 5FL3A 3MSHA 4R38A 5L09A 4AFIA 3B33A 1OTEA 4P87A 1EW0A 3SZTA 2EX9A 3F1NA 3CUEC 5HAQA 3SS3A 1TDGA 4H6JA 2P74A 2GJ3A 1PI5A 4PMAA 3D4FA 5DFYA 1SKOA 3CHWP 1STZA 3F1PB 3NOTC 4EBLA 3UE3A 4OP8A 5CTMA 3LUQA 3C5AA 1TS6A 4OQGA 4OPYA 2PU4A 4WELA 1W5DA 1TD5A 1ESIA 4R1GA 3WS4A 1W63Q 3S22A 2DMWA 4L9FA 4S2OA 2WKRA 4MBHA 3D9YA 1DJCA 3KSFA 3QP8A 2UV0E 2WYXA 2Y55A 2UWXA 2OLVA 3U4LP 3KX0X 4WYYA 1OT9A 5EM1A 4OOYA 3OPHA 1YLWA 2FH5A 3UE6A 4KQRA 3EOIA 3KO6A 4OKPA 2M7VA 3MXRA 4QB8A 2J9PA 3LCEA 1YMSA 1EROA 4OPQA 4EBNA 4Y0UA 1SDEA 1OT6A 4N9KA 3L9KA 3S7PA 3LY3A 5EFWA 1YLPA 2OWJA 1T1CA 4WMCD 2Q9MA 1IYSA 2VGKA 3OOVA 1A0KA 5FDSA 5FDHA 1VQQA 4KZ9A 2ZMAA 5HD5A 1MPLA 4JF6A 2PRFA 3AGDA 5F68A 3PTEA 3MXSA 2ZM2A 3GR2A 4M4XA 2W27A 5D3OA 4GDNA 1YM1A 3QNCA 3LO7A 3MF0A 1K4EA 4Y15A 5A92A 5FQIA 3SW1A 4DDSA 4GW9A 3MKEA 3UDFA 3ZVWA 4Y7PA 5TBMA 3FG8A 3G31A 4X55A 3CPTB 3IHAA 1GA9A 4WN5A 1ONGA 4HQAA 1CK3A 1JWPA 2H5SA 2ZL1B 5MC7A 3WWXA 3TW8A 4DXCA 1S1YA 2V1BA 5AVEA 3TOIA 4JKTA 2WGVA 2B95A 3N6IA 4S2JA 4E3LA 1YLYA 5DF9A 5HL1A 3PBTA 2XD5A 1H8YA 3C2WA 3O87A 5EVEA 3IS2B 2XR0A 3OCNA 2M1CA 4R3BA 3FYZA 4I5SA 3N7WA 3RJUA 4MN6A 4BQMA 5FA7A 4BBUA 1GSVA 3S4XA 4UA9A 3VP4A 5FEGA 5EV0A 3CZDA 1J3WA 3B3XA 5IU1A 5CECA 3IWOA 4PM6A 1K54A 1TVFA 3K3DA 3OPPA 4BJPA 4DN0A 3NJAA 3JVVA 4EU0A 4JXSA 2A24B 3DAVA 5CTNA 5G4ZA 4PM7A 1CI8A 2WZXA 3Q7VB 2Y2QA 2INWA 1PYYA 5GLDA 3O3VA 2IWDA 1XKZA 4RVAA 4RX2A 4IBXA 4X25A 1K54C 1JWZA 3BYDA 4XT2A 1L2SA 1K0KA 2ZC4B 4IJGA 1FSYA 5GLCA 4DKIA 2P9VB 3MS6A 2ZLYA 3FKVA 4BD0A 3LEZA 3GECA 4GD8A 3P01A 2QJ5A 1IFQA 2ZQ8A 1DP6A 2ZQAA 1LLBA 3IX3A 1XXMA 4DE2A 3C8CA 3V3SA 2H0YA 4LENA 4I38A 1IELA 2XGNA 3W4QA 5FEFA 5DF8A 4LLOB 5DTTA 3S7OA 4HJ6A 2V1AA 4DDYA 2VLGA 3C38A 1Y54A 1P9WA 2PBDP 5TGFA 2WGIA 2QYBA 5HDCA 3KYZA 3EWKA 2WAEA 3LY4A 4Y3IA 5CXWA 5L07A 2HV1A 1DP9A 2W3HA 5EM0A 3RTYA 3R7WB 4WEKA 5EVIB 1KGEA 3F1PA 5CRFA 2BG1A 3LIEA 3F1NB 1IYOA 1S67L 4JGPA 4QWOA 3VE3A 1SHVA 2AVXA 2Y2NA 3GDIA 4P6ZM 1BLHA 1M40A 1BT5A 5F69A 2BLSA 3UE1A 4DJ3A 5IS1A 1MBLA 3ZHHA 1KE3A 5A90A 1G6AA 3NHQA 3V39A 4PPRA 3MBZA 3Q07A 2VGLS 5JYOA 3JVUA 4PKYA 1LL9A 1D7EA 4JGOA 1PNEA 2ZC3B 2Q9NA 3T4OA 4S2LA 1XPBA 3R4KA 2JC7A 4IBRA 4DXBA 5GHXA 2W3EA 3BY8A 2OV5A 2D01A 1G68A 3U2AA 5JYPA 4OPRA 3FPWA 2HDSA 4O8GA 2B5RA 4GDBA 4QPRA 1N4OA 3PAEA 3B42A 1MWSA 2ZD8A 3CWFA 5LBRA 1N9BA 1XJ6A 2FFFB 3T4KA 1MWTA 3N8LA 1ES4A 2W3DA 5L2FA 3BJNA 4X1LA 3PXPA 2ACGA 3EGXC 1ZC2A 2H28A 4CLCD 2QWSA 1LT0A 4R3AA 3EEAA 3ZVTA 3WRTA 3QHYA 3GTCA 1E4DA 5AQAA 3ZG0A 4EETB 3FC7A 5E2HA 1YLJA 1GHIA 3DBAA 1YAXA 2XA7S 4WM9A 3CPTA 5A8BA 5CX7A 4P85A 3S7NA 1P0ZA 1NLYA 4EV4A 1PFLA 2ZMFA 2ZL1A 5GHYA 3GRJA 5CERA 1FIKA 4R4RA 1ESUA 1U60A 1RP5A 5U47A 2V20A 1L0EA 3NC8A 3T1QB 4D60A 3LI9A 3LR0A 2XDMA 3VOLA 1F98A 1O07A 2ZM8A 1YSPA 2K7SA 4KQQA 3IS2A 2JKGA 4MDZA 1E25A 4U3TA 4DF6A 2R9WA 3IHBA 3S1YA 5AQ7A 5A91A 1L0DA 1LSWA 2Y2IA 3ZDJA 1OTAA 1OTDA 4EQIA 3KSGA 2XFTA 1V9YA 1IYQA 4PHTA 4WZ4A 3VP0A 1T19A 2H10A 4FH2A 1W63M 1UWNX 3GSGA 1K6RA 5HDSA 1HTZA 2PR6A 2O9AA 2XSSA 3RXXA 4OH0A 1BYWA 1JTDA 1K4FA 5DFXA 2A24A 2CMNA 4FD8A 2OAQ1 5FQJA 3VMAA 3HBRA 4WL9A 5HX9A 2V9AA 2Z2LB 1NJ4A 4WUJA 3NCKA 3VP1A 3ZYTA 1XFNA 1BLCA 1SDNA 3UB5P 4DJ2A 5GL9A 2P9VA 2ZOIA 5E2GA 2Y2MA 4CQHA 3IXDA 3K2NA 3LR4A 2VK3A 2KDKA 3BFGA 2X01A 2PHYA 3O86A 3E2KA 3BY9A 1N9NA 1XA7A 4MLLA 4LV0A 5FI2A 2H0TA 5EUAA 5I94A 3BFDA 4LV1A 2ZBBA 2LB5A 1DY6A 1K57A 5BOHA 1TS8A 4H8RA 1K38A 1YT4A 3KYQA 3OCLA 4HHDA 4ETXA 3SOIA 4XXRA 3BWLA 4F94A 2LB9A 3NDEA 1BLSA 4OVDA 2ZC6B 4I3AA 5G18A 5J7EA 4MN7A 3GQZA 1K57C 2XRNA 5AJGA 3C7VA 5EVID 4GKUA 1VEUB 4LV2A 3DTMA 2YKFA 3R7WA 5A93A 1Z6FA 5EVIA 1NZUA 2HJ9C 3ZCZA 1AXBA 3CI6A 1DJAA 1F5MA 1S6RA 1XGJA 4GJ4A 5HARA 1H5XA 4KQOA 2XQZA 4KZ5A 3P7NA 1H8MA 2HDQA 3A3JA 4YOFA 1L3LA 1HLUP 3BFCA 5EOOA 5EVIC 1N9OA 2Y2PA 2JBFA 2FFYA 4BBTA 3ZNYA 2JKTM 1ONHA 4HBUA 2VV8A 2I72A 2Y2GA 4GHIB 3TJZC 4IEDA 3VP2A 2IWBA 5F1GA 2WZZA 3ULFA 2PAVP 1Q2QA 4LGWA 5DTSA 5F83A 2XLNA 3PBSA 4L0LA 4I3IA 4GOGA 5HZHA 1K56D 2WGWB 1MKIA 1W7FA 2XEPA 3C30A 1VETB 4KZ4A 3VP3A 3G2YA 3P09A 4K08A 1K56A 4ZRRA 4EUZA 2QPNA 4LPZA 5TFQA 4GN2A 1D06A 4YINA 4IUKA 3ZG5A 4BD1A 4MMNA 3MFXA 2DNSA 4FOFA 2OLUA 1T1BA 4II7A 4WMCA 3M2KA 4MNRA 5HPFA 2HP6A 3ZNTA 3H7WB 2E8JA 1CEFA 5KSHA 4CLCB 4P6BA 1DRMA 3VV4A 1GA0A 3LIBA 1PRQA 5CGXA 4JGQA 1BLPA 5L8MA 2L1MA 5L10A 2WK0A 4XUZA 5M18A 1TDLA 3RFBA 5DVAA 4EEPA 2V2FF 4BMWA 4BWIA 2J9OA 5FASA 3CG5A 2HDUA 2RCXA 4LFUA 2IA2A 1W79A 1PW8A 5FSRA 3ZG7B 1ZTUA 1CJFA 4WLAA 4NXEA 4M3KA 4QY5A 4DRTA 1T1AA 3E4OA 3E98A 4E3KA 4KZ8A 2JKRM 2E8IA 3E0YA 3MXQA 1JNUA 3NULA 3NECA 2B18A 4OQHA 5EOEA 3UDXA 2EXAA 3S7QA 3PAGA 4GB7A 1IKIA 1LI9A 3I7JA 3UB7A 3VOZA 4K0XA 1HZOA 2WKIA 3UPNA 3IXBA 3UB8A 5DKLA 2OAP1 3FKWA 4HP4A 3E4PA 4X53A 5KSCA 1BULA 1IYPA 3IXHA 2GX5A 4I39A 4KG5A 4Q0IA 4NETA 4JPMA 3H82A 1LSVA 4X56A 2A2LA 5CHUA 4G3VA 5IHVA 2J7VA 5EVLA 2PYRA 4KG2A 3G6OA 1D1JA 1FR6A 2DCFA 1XX2A 2VGJA 1SCWA 4HIAA 2X02A 2W3GA 1FILA 4QY6A 3RXWA 4HEFA 4X1MA 1K6SA 4XUXA 2Y2HA 4L9EA 3DTEA 3BLSA 2KOIA 4HJ4A 4HY8A 3GMWA 4JXGA 2HZ5A 4ESPA 2JKRI 2GDNA 3P98A 2GNXA 1UGUA 1VEUA 1X0OA 5J4EA 3IX8A 5CHMA 3UY6A 4B4XA 2Y8HA 3HREA 3HLWA 1OTBA 2JHEA 4Y17A 4YWZA 1ES3A 1P97A 3UDIA 4ME4A 1NZOA 4Q0JA 2HP9A 4Y2FA 2VEAA 3AGFA 1KGGA 4JLFA 4O0PA 4GHIA 5KZHA 4N1HA 1OPXA 4Z1WA 5F5YA 2J80A 4GD6A 1LL8A 4RA7A 4RQ9A 4BENA 5CEDA 4O01A 2WGWA 3BFFA 3MZFA 1S66L 3NIAA 3PR6A 4N9LA 3A0VA 1VETA 3W4OA 3MJQA 1KVMA 2HDRA 3M6BA 1QMFA 2I9VA 1H8ZA 2DRWA 4O7DA 2CC1A 2R9XA 1YSQA 2NUTC 3H9WA 3KYEA 5E2FA 4PM5A 3K3CA 3HJKA 3VOYA 1K55A 4EUVA 3A3IA 1KE4A 1VHMA 1XA1A 4G3KA 4IVKA 3UB6A 3V50A 1PWCA 3SS4A 3H7WA 2Z6CA 1EWZA 4CLCA 4NXFA 2QKPA 1NRFA 5E2EA 2IWCA 3EGDC 3IF6B 2V1ZA 1K55C 4WEJA 3OBFA 3LEQA 3OZHA 4CJNA 3G35A 2EX6A 2QMIA 4NK3A 3AGEA 3BFEA 2R78A 1GHPA 3UNWA 4Q0HA 4CLCC 2Y79A 5FAOA 3G2ZA 1C3BA 1S0WA 2O9BA 1KE0A 4WZ5A 5TR7A 1FQGA 3UPPA 5GLAA 4HI4A 4P0MA 5CGWA 3BQAA 4YNRA 4D2OA 1H0MA 3QP4A 3T12B 2PD8A 3MZEA 3T4QA 1OTIA 1G6OA 4F3LB 4WZ5C 3ITAA 3WRZA 3IXGA 4FH4A 2JN7A 4GS9B 2VA0A 5HD3A 3WS5A 2J3TD 2P04A 3DWZA 4KUKA 3O5YA 3IBRA 4E3OA 3T1XA 3PBOA 4E3IA 4JF4A 5HAPA 4ZAMA 1BSGA 2Z2MB 1ERQA 2ZJ9A 3L7HA 3BRMA 1P9RA 4KENB 3KSIA 1WE4A 3EQVA 5F82A 1Y28A 3V3RA 4MBKA 2ZQ7A 5HWVA 4OQ0A 4KZ6A 1KDWA 3H82B 4A5RA 4PKYG 2VV7A 2Y91A 3PBNA 3Q81A 1WYCA 5M19A 1PZPA 1KOUA 3N8SA 1XGIA 4LRYC 2G2WA 5AQBA 4Y0TA 4Y0OA 3HLFA 4NXGA 3A3DA 4ZJ1A 4S2PA 1E3UD 4K91A 2WKPA 3ZG9B 3G4PA 3OPRA 2HJEA 3PBQA 5FQQA 5G4YA 3BM6A 5TJJA 2M7UA 5J3WA 3E4QA 4OP5A 5KMWA 4S2MA 3F1OB 3VFFA 3W4PA 4CLCE 2O99A 2J3WA 3PBRA 5FI6A 3UN7A 2EX2A 1PI4A 2A3UA 5E43A 3UE0A 1TS0A 1ODVA 4UEYA 1V9ZA 1NYYA 4U0TA 3PYPA 3VSLA 1SZVA 4OQIA 4U0XA 1CEGA 4OOMA 4Y13A 1L0FA 5DTKA 1IEMA 3QNBA 2XFSA 2PYPA 2OSUA 4QHCA 4BL2A 5AQ9A 3O88A 4KZBA 4DE1A 3VFHA 1RGZA 3C7UA 3LFVA 1YMXA 3M6HA 1ACFA 3RH8B 3HLDA 3NDGA 5FQ9A 2Y2OA 2ZQDA 3LR3A 1FCOA 1Z09A 3ICYA 3E2LA 4OLGA 4C75A 1LI0A 3HUOA 4JF5A 1ES2A 4UQIS 3TSGA 3LGOA 1Q2PA 3HLCA 4WF0A 3T4TA 5C5KA 2EFUA 1GSWA 3HCYA 1MXOA 4RYEA 3C4OA 4EXOA 4QJGA 1IOUA 2VKSA 4HESA 2Y59A 4UA7A 3CLOA 4ARZB 2YKHA 2PD7A 2C5WB 2D02A 3MZDA 3NBLA 1W8YA 3LICA 2J8YA 3D3OA 2XD1A 3LI8A 2Q0OA 4DMZA 5FAPA 2ZC5B 2PT7A 4HJ3A 4Z9QA 3FV7A 2ZOHA 2VZWA 4KZ7A 4S2KA 1OJGA 1FR1A 4JGRA 1ZKJA 2Y4AA 1YPRA 3G30A 1ZG6A 5CGSA 5HSQA 2VGLM 4C3QA 4EERA 3W2ZA 3LIDA 3ZG8B 5FQMA 3IF6A 1IKGA 4Q8IA 3N4IA 4IHQA 4GLQA 2PU2A 1K25A 1OJ5A 3SS5A 2PDRA 1S1ZA 2W1RA 2VV6A 1CF0A 1JWVA 3FPVA 5FAQA 1KGFA 3ZQ5A 3IF6C 5DJTA 3NOUC 5K5BA 4HP9A 3DTIA 2JKTI 1ZHHB 1XJ4A 1BZAA 4E3MA 4IVIA 4R6LA 4S2NA 4ZJ2A 5HAIA 2KX6A 5HL6A 2ZQCA 3ITBA 4KZAA 1JVJA 3IWQA 3EEHA 3TE8A 1OMEA 1XJ2A 4NXBA 4F3LA 2ZMVA 3IH8A 3UB9A 4EEUA 1FOFA 5CHJA 1MZUA 1NLZA 4GS9A 5F6AA 4S2NC 2EWWA 4X69A 5FATA 3NI9A 4JXVA 3N8RA 2XK1A 2XA7M 2EA9A 3Q7ZA 4BL3A 3IQAA 5FQKA 1XJ3A 2B02A 2Y2KA 3UO9A 5HDDA 1YLZA 1CQAA 4FSFA 1KDSA 1MY8A 5GHZA 5HPIA 3BW6A 2EX8A 3TG9A 3WS1A 3Q82A 1F9IA 4R0QA 1HD8A 2VJWA 3GVBA 4MN5A 3IH9A 4GZBA 1BUEA 5GLBA 2W0NA 2G7UA 1N9LA 5DF7A 4LCLA 3VSKA 4IUHA 1SKFA 4ZBEA 3IF5A 3A3EA 3F1OA 2FZ0A 5F1FA 2W1TB 3LYXA 4R23A
chains in the Genus database with same CATH topology
1KE4A 3LY3A 3BFGA 1YLPA 2X01A 3O86A 3E2KA 1XA1A 4WMCD 4IVKA 4OOLA 1KVLA 3V50A 1PWCA 3SS4A 1XA7A 4MLLA 2Q9MA 2PBYA 3UPOA 1EWZA 1IYSA 2VGKA 4LV0A 5FI2A 1YLTA 5FDHA 1NRFA 5E2EA 2H0TA 5EUAA 2IWCA 5EE8A 1VQQA 3IF6B 2ZMAA 4KZ9A 2V1ZA 1K55C 1MPLA 4E6XA 4WEJA 3OZHA 3BFDA 4ZDXA 4CJNA 4LV1A 4JF6A 3G35A 4B88A 2EX6A 2QMIA 1DY6A 3AGDA 1K57A 4NK3A 3BEBA 3PTEA 3MXSA 5BOHA 2ZM2A 3GR2A 4H8RA 3EQUA 3AGEA 3BFEA 1K38A 1YT4A 3JYIA 5D3OA 4GDNA 1GHPA 3HVFA 1W8QA 3OCLA 2Y2JA 1YM1A 3QNCA 3SH9A 3SOIA 3LO7A 4XXRA 3UNWA 3HUMA 1K4EA 5A92A 5FAOA 4F94A 3G2ZA 5FQIA 3NDEA 4DDSA 1C3BA 1BLSA 1S0WA 4OVDA 4QD4A 4X6TA 3MKEA 2ZC6B 4K0WA 5G18A 3UDFA 2ZQ9A 3ZVWA 1KE0A 4Y7PA 3GQZA 4WZ5A 5TR7A 1FQGA 3G31A 5GLAA 4X55A 3UPPA 5M1AA 3IHAA 1GA9A 1K57C 1PWDA 1ONGA 1NYMA 3C7VA 5EVID 1CK3A 4P0MA 4GKUA 5CGWA 4LV2A 1JWPA 2H5SA 3DTMA 3OPLA 4D2OA 3HLBA 5A93A 1Z6FA 5EVIA 2XF3A 3WWXA 4DXCA 1NZUA 1LL5A 3ZCZA 1AXBA 1M6KA 2EXBA 3MZEA 1DJAA 1BTLA 1S6RA 1XGJA 3MFDA 4JKTA 4WZ5C 5HARA 3TOIA 4DE3A 3ITAA 2WGVA 1H5XA 3WRZA 4KQOA 1ES5A 2XQZA 2ZM0A 3CJMA 3IXGA 3N6IA 4FH4A 4KZ5A 4S2JA 2C6WB 2HDQA 2XH9A 3A3JA 4E3LA 1YLYA 5DF9A 5HL1A 3PBTA 3WS5A 2XD5A 3BFCA 3Q1FA 1H8YA 3NY4A 1CI9A 5EOOA 5EVIC 2Y2PA 2JBFA 3DWZA 3O87A 4OLDA 1PW1A 2XR0A 3OCNA 2FFYA 3ZNYA 3HLGA 3FZCA 1ONHA 4R3BA 4E3OA 4HBUA 2I72A 2Y2GA 3FYZA 1WYBA 4UHUA 3N7WA 4IEDA 3VP2A 3RJUA 3PBOA 4E3IA 2IWBA 2WADA 2EFXA 4JF4A 5F1GA 4BQMA 5HAPA 4ZAMA 1BSGA 5FA7A 1JTGA 2WZZA 3HLEA 4JBFA 1MWRA 2Z2MB 1ERQA 2ZJ9A 3BRMA 3S4XA 4UA9A 1GCEA 1Q2QA 5DTSA 5F83A 1I2WA 2XLNA 4KENB 3VP4A 3PBSA 4L0LA 1WE4A 4GOGA 4LV3A 3CZDA 3EQVA 3B3XA 5F82A 3SH8A 5CECA 1K56D 4HBTA 2WGWB 3IWOA 3V3RA 4PM6A 4MBKA 1K54A 1TVFA 1MKIA 2ZQ7A 1W7FA 2ZC7A 1VM1A 4OQ0A 2XEPA 1KDWA 3OPPA 4KZ6A 1QMEA 4A5RA 4BJPA 2Y91A 2HPBA 3PBNA 4KZ4A 3Q81A 3VP3A 1WYCA 3G2YA 3P09A 1K56A 5M19A 4EUZA 2QPNA 4JXSA 5CTNA 1PZPA 5TFQA 4PM7A 1CI8A 1TEMA 2WZXA 3N8SA 1XGIA 3Q7VB 2Y2QA 3A3FA 4CPKA 4GN2A 1PYYA 2G2WA 5GLDA 3O3VA 2IWDA 1ALQA 4YINA 1MWUA 5AQBA 1XKZA 4Y0TA 4RVAA 4Y0OA 4RX2A 4EWFA 3OC2A 4IBXA 3ZG5A 4BD1A 3HLFA 3A3DA 4ZJ1A 4S2PA 2A49A 1K54C 1JWZA 1E3UD 3BYDA 4K91A 1L2SA 2ZC4B 3ZG9B 3G4PA 3OPRA 2DNSA 1FSYA 3PBQA 4JXWA 2OLUA 5FQQA 5GLCA 3BM6A 4DKIA 2Y2LA 4OPZA 1RCJA 2P9VB 2ZLYA 3M2JA 4OP5A 1L0GA 3W8KA 3FKVA 4B4ZA 4WMCA 4BD0A 3M2KA 5KMWA 1DJBA 3LEZA 4S2MA 4GD8A 3VFFA 2ZQ8A 4MNRA 2G2UA 3W4PA 2ZQAA 1LLBA 2JCHA 2HP6A 3PBRA 5FI6A 3UN7A 2EX2A 3ZNTA 1CEFA 1XXMA 5KSHA 4DE2A 1PI4A 2A3UA 5E43A 4P6BA 3UE0A 3V3SA 3BLMA 2H0YA 4PM8A 1GA0A 4LENA 5CGXA 1NYYA 1IELA 3G32A 4U0TA 1I5QA 4EBPA 2XGNA 3W4QA 1BLPA 5DF8A 3VSLA 1FCMA 5DTTA 2WK0A 4OQIA 4DDYA 4XUZA 4U0XA 4BLMA 1CEGA 5M18A 4UAAA 1TDLA 4OOMA 1Y54A 5DVAA 1PZOA 4KG6A 2V2FF 5TGFA 2WGIA 2J9OA 5FASA 1L0FA 1LHYA 3CG5A 5DTKA 2HDUA 1IEMA 3QNBA 1FSWA 2XFSA 2WAEA 4S2IA 1GHMA 2OSUA 3LY4A 5CXWA 4QHCA 2RCXA 4BL2A 1ZG4A 5AQ9A 3O88A 4KZBA 4OONA 1I2SA 4DE1A 3VFHA 1ERMA 1RGZA 1W79A 5HFOA 1PW8A 3C7UA 5FSRA 4QU3A 3ZG7B 4MEZA 4N92A 1YMXA 3M6HA 4X68A 4M3KA 3HLDA 4QY5A 4WEKA 4DRTA 3NDGA 5FQ9A 5EVIB 1KGEA 3WS0A 1O7EA 2Y2OA 2ZQDA 4E3KA 4E3NA 4KZ8A 5CRFA 1FCOA 2BG1A 2E8IA 4ZTKA 1IYOA 3E2LA 4OQHA 5EOEA 4OLGA 3UDXA 3CMZA 2RL3A 2EXAA 3DWKA 4C75A 5CEBA 1EI5A 2WKEA 1LI0A 3HUOA 1SHVA 3DW0A 1NXYA 1ES2A 2Y2NA 3PAGA 4GB7A 1BLHA 1M40A 1BT5A 4JF5A 1IKIA 3TSGA 2BLSA 3VOZA 1LI9A 3I7JA 1Q2PA 3GV9A 3UE1A 4K0XA 3HLCA 1HZOA 2WKIA 4YFMA 3UPNA 1MBLA 3IXBA 2EFUA 1KE3A 2HP5A 3ZHHA 5A90A 1G6AA 3V39A 4PPRA 3MBZA 1MXOA 3FKWA 4WBGA 3Q07A 4RYEA 4X53A 5KSCA 3C4OA 1BULA 4R3JA 1IYPA 1PWGA 4QJGA 3IXHA 5JYOA 1HVBA 1PIOA 4HESA 3HL9A 3IT9A 2Y59A 4ID4A 4LCMA 1LL9A 4UA7A 4KG5A 4MBFA 1FCNA 1YQSA 2C5WB 4NETA 2ZC3B 3HUNA 4JPMA 2X71A 2Q9NA 4RX3A 4X56A 5EECA 1XPBA 3ISGA 3MZDA 2JC7A 1W8YA 3NBLA 2J8YA 4IBRA 4S2LA 5CHUA 5GHXA 2XD1A 5FI7A 4FCFA 2OV5A 3Q7VA 1G68A 2J7VA 5EVLA 5IHVA 5FAPA 2ZC5B 3SH7A 4KG2A 5JYPA 4OPRA 4Z9QA 3FV7A 5HW3A 3FWLA 2HDSA 2WKHA 2JE5A 3ZFZA 1FR6A 4DE0A 4KZ7A 5J8XA 2B5RA 4S2KA 4GDBA 2DCFA 1FR1A 3WS2A 4E6WA 2WAFA 1N4OA 1ZKJA 2Y4AA 3PAEA 1XX2A 4UA6A 1MWSA 3ZGAB 2VGJA 2ZD8A 3G30A 1ZG6A 1SCWA 1N9BA 2FFFB 5CGSA 1MWTA 1RGYA 1E3UA 4ZJ3A 4C3QA 3N8LA 1ES4A 3C4PA 5L2FA 3ZG8B 2X02A 5FQMA 3IF6A 1ZC2A 4DXBA 1IKGA 4QY6A 4E3JA 3RXWA 4Q8IA 4HEFA 1K6SA 4KZ3A 4XUXA 4C6YA 3N4IA 2PU2A 1K25A 3SS5A 3ZVTA 3WRTA 3QHYA 2Y2HA 3GTCA 1E4DA 1XP4A 5AQAA 3ZG0A 3BLSA 1JWVA 5FAQA 1KGFA 5E2HA 1YLJA 2QZ6A 3GMWA 1GHIA 3IF6C 4GNUA 4JXGA 4WM9A 5EPHA 2GDNA 3P98A 4P85A 1J9MA 3G34A 4EV4A 4R4SA 3MKFA 1BZAA 4E3MA 5I94A 4IVIA 4S2NA 4PM9A 5GHYA 5CHMA 4ZJ2A 5HAIA 3BECA 2WUQA 2ZQCA 3GRJA 3ITBA 3UY6A 4KZAA 1JVJA 3IWQA 5CERA 4R4RA 4B4XA 1ESUA 3HREA 3IWIA 1U60A 1OMEA 3HLWA 1RP5A 5U47A 2V20A 4N1XA 1L0EA 1NY0A 3NC8A 3V5MA 3IH8A 1ES3A 1FOFA 5CHJA 3UDIA 4S2NC 2XDMA 1NZOA 4X69A 4P87A 1O07A 5FATA 3NI9A 2ZM8A 4JXVA 2HP9A 3N8RA 2XK1A 2EX9A 4KQQA 5HAQA 1E25A 1TDGA 3SS3A 3AGFA 2P74A 1KGGA 3Q7ZA 4JLFA 4U3TA 4DF6A 2R9WA 3IHBA 1PI5A 4PMAA 3S1YA 4BL3A 3D4FA 5AQ7A 5KZHA 5A91A 1L0DA 3IQAA 4N1HA 5FQKA 2Y2IA 3ZDJA 4EBLA 4EQIA 2Y2KA 2XFTA 3UO9A 3UE3A 1IYQA 4GD6A 1YLZA 4OP8A 5CTMA 3C5AA 4WZ4A 3VP0A 4OQGA 4OPYA 4FSFA 2H10A 2PU4A 4WELA 4RA7A 1W5DA 4BENA 5CEDA 2WGWA 1ESIA 1KDSA 3BFFA 3MZFA 4FH2A 4R1GA 3WS4A 3S22A 1MY8A 3GSGA 4S2OA 3NIAA 5GHZA 4N9LA 4MBHA 2EX8A 1K6RA 3TG9A 1HTZA 1DJCA 3W4OA 3WS1A 3Q82A 3RXXA 4OH0A 1KVMA 2HDRA 1JTDA 4R0QA 1K4FA 1HD8A 2WYXA 3GVBA 2Y55A 4FD8A 2UWXA 2OLVA 3M6BA 1QMFA 5FQJA 3IH9A 3VMAA 3HBRA 4GZBA 1BUEA 5GLBA 4WYYA 1H8ZA 2DRWA 4OOYA 5HX9A 4O7DA 5DF7A 3OPHA 2Z2LB 1YLWA 4LCLA 1NJ4A 2CC1A 2R9XA 4KQRA 3NCKA 3VP1A 3VSKA 1BLCA 1SDNA 4OKPA 5E2FA 4PM5A 3MXRA 4QB8A 5GL9A 2J9PA 2P9VA 1SKFA 3LCEA 1YMSA 1EROA 4OPQA 4EBNA 5E2GA 2Y2MA 3VOYA 4ZBEA 1K55A 3IF5A 3IXDA 4Y0UA 1SDEA 3A3IA 3A3EA 5F1FA 4N9KA 4R23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KE4 A;  3LY3 A;  3BFG A;  1YLP A;  2X01 A;  3O86 A;  3E2K A;  1XA1 A;  4WMC D;  4IVK A;  4OOL A;  1KVL A;  3V50 A;  1PWC A;  3SS4 A;  1XA7 A;  4MLL A;  2Q9M A;  2PBY A;  3UPO A;  1EWZ A;  1IYS A;  2VGK A;  4LV0 A;  5FI2 A;  1YLT A;  5FDH A;  1NRF A;  5E2E A;  2H0T A;  5EUA A;  2IWC A;  5EE8 A;  1VQQ A;  3IF6 B;  2ZMA A;  4KZ9 A;  2V1Z A;  1K55 C;  1MPL A;  4E6X A;  4WEJ A;  3OZH A;  3BFD A;  4ZDX A;  4CJN A;  4LV1 A;  4JF6 A;  3G35 A;  4B88 A;  2EX6 A;  2QMI A;  1DY6 A;  3AGD A;  1K57 A;  4NK3 A;  3BEB A;  3PTE A;  3MXS A;  5BOH A;  2ZM2 A;  3GR2 A;  4H8R A;  3EQU A;  3AGE A;  3BFE A;  1K38 A;  1YT4 A;  3JYI A;  5D3O A;  4GDN A;  1GHP A;  3HVF A;  1W8Q A;  3OCL A;  2Y2J A;  1YM1 A;  3QNC A;  3SH9 A;  3SOI A;  3LO7 A;  4XXR A;  3UNW A;  3HUM A;  1K4E A;  5A92 A;  5FAO A;  4F94 A;  3G2Z A;  5FQI A;  3NDE A;  4DDS A;  1C3B A;  1BLS A;  1S0W A;  4OVD A;  4QD4 A;  4X6T A;  3MKE A;  2ZC6 B;  4K0W A;  5G18 A;  3UDF A;  2ZQ9 A;  3ZVW A;  1KE0 A;  4Y7P A;  3GQZ A;  4WZ5 A;  5TR7 A;  1FQG A;  3G31 A;  5GLA A;  4X55 A;  3UPP A;  5M1A A;  3IHA A;  1GA9 A;  1K57 C;  1PWD A;  1ONG A;  1NYM A;  3C7V A;  5EVI D;  1CK3 A;  4P0M A;  4GKU A;  5CGW A;  4LV2 A;  1JWP A;  2H5S A;  3DTM A;  3OPL A;  4D2O A;  3HLB A;  5A93 A;  1Z6F A;  5EVI A;  2XF3 A;  3WWX A;  4DXC A;  1NZU A;  1LL5 A;  3ZCZ A;  1AXB A;  1M6K A;  2EXB A;  3MZE A;  1DJA A;  1BTL A;  1S6R A;  1XGJ A;  3MFD A;  4JKT A;  4WZ5 C;  5HAR A;  3TOI A;  4DE3 A;  3ITA A;  2WGV A;  1H5X A;  3WRZ A;  4KQO A;  1ES5 A;  2XQZ A;  2ZM0 A;  3CJM A;  3IXG A;  3N6I A;  4FH4 A;  4KZ5 A;  4S2J A;  2C6W B;  2HDQ A;  2XH9 A;  3A3J A;  4E3L A;  1YLY A;  5DF9 A;  5HL1 A;  3PBT A;  3WS5 A;  2XD5 A;  3BFC A;  3Q1F A;  1H8Y A;  3NY4 A;  1CI9 A;  5EOO A;  5EVI C;  2Y2P A;  2JBF A;  3DWZ A;  3O87 A;  4OLD A;  1PW1 A;  2XR0 A;  3OCN A;  2FFY A;  3ZNY A;  3HLG A;  3FZC A;  1ONH A;  4R3B A;  4E3O A;  4HBU A;  2I72 A;  2Y2G A;  3FYZ A;  1WYB A;  4UHU A;  3N7W A;  4IED A;  3VP2 A;  3RJU A;  3PBO A;  4E3I A;  2IWB A;  2WAD A;  2EFX A;  4JF4 A;  5F1G A;  4BQM A;  5HAP A;  4ZAM A;  1BSG A;  5FA7 A;  1JTG A;  2WZZ A;  3HLE A;  4JBF A;  1MWR A;  2Z2M B;  1ERQ A;  2ZJ9 A;  3BRM A;  3S4X A;  4UA9 A;  1GCE A;  1Q2Q A;  5DTS A;  5F83 A;  1I2W A;  2XLN A;  4KEN B;  3VP4 A;  3PBS A;  4L0L A;  1WE4 A;  4GOG A;  4LV3 A;  3CZD A;  3EQV A;  3B3X A;  5F82 A;  3SH8 A;  5CEC A;  1K56 D;  4HBT A;  2WGW B;  3IWO A;  3V3R A;  4PM6 A;  4MBK A;  1K54 A;  1TVF A;  1MKI A;  2ZQ7 A;  1W7F A;  2ZC7 A;  1VM1 A;  4OQ0 A;  2XEP A;  1KDW A;  3OPP A;  4KZ6 A;  1QME A;  4A5R A;  4BJP A;  2Y91 A;  2HPB A;  3PBN A;  4KZ4 A;  3Q81 A;  3VP3 A;  1WYC A;  3G2Y A;  3P09 A;  1K56 A;  5M19 A;  4EUZ A;  2QPN A;  4JXS A;  5CTN A;  1PZP A;  5TFQ A;  4PM7 A;  1CI8 A;  1TEM A;  2WZX A;  3N8S A;  1XGI A;  3Q7V B;  2Y2Q A;  3A3F A;  4CPK A;  4GN2 A;  1PYY A;  2G2W A;  5GLD A;  3O3V A;  2IWD A;  1ALQ A;  4YIN A;  1MWU A;  5AQB A;  1XKZ A;  4Y0T A;  4RVA A;  4Y0O A;  4RX2 A;  4EWF A;  3OC2 A;  4IBX A;  3ZG5 A;  4BD1 A;  3HLF A;  3A3D A;  4ZJ1 A;  4S2P A;  2A49 A;  1K54 C;  1JWZ A;  1E3U D;  3BYD A;  4K91 A;  1L2S A;  2ZC4 B;  3ZG9 B;  3G4P A;  3OPR A;  2DNS A;  1FSY A;  3PBQ A;  4JXW A;  2OLU A;  5FQQ A;  5GLC A;  3BM6 A;  4DKI A;  2Y2L A;  4OPZ A;  1RCJ A;  2P9V B;  2ZLY A;  3M2J A;  4OP5 A;  1L0G A;  3W8K A;  3FKV A;  4B4Z A;  4WMC A;  4BD0 A;  3M2K A;  5KMW A;  1DJB A;  3LEZ A;  4S2M A;  4GD8 A;  3VFF A;  2ZQ8 A;  4MNR A;  2G2U A;  3W4P A;  2ZQA A;  1LLB A;  2JCH A;  2HP6 A;  3PBR A;  5FI6 A;  3UN7 A;  2EX2 A;  3ZNT A;  1CEF A;  1XXM A;  5KSH A;  4DE2 A;  1PI4 A;  2A3U A;  5E43 A;  4P6B A;  3UE0 A;  3V3S A;  3BLM A;  2H0Y A;  4PM8 A;  1GA0 A;  4LEN A;  5CGX A;  1NYY A;  1IEL A;  3G32 A;  4U0T A;  1I5Q A;  4EBP A;  2XGN A;  3W4Q A;  1BLP A;  5DF8 A;  3VSL A;  1FCM A;  5DTT A;  2WK0 A;  4OQI A;  4DDY A;  4XUZ A;  4U0X A;  4BLM A;  1CEG A;  5M18 A;  4UAA A;  1TDL A;  4OOM A;  1Y54 A;  5DVA A;  1PZO A;  4KG6 A;  2V2F F;  5TGF A;  2WGI A;  2J9O A;  5FAS A;  1L0F A;  1LHY A;  3CG5 A;  5DTK A;  2HDU A;  1IEM A;  3QNB A;  1FSW A;  2XFS A;  2WAE A;  4S2I A;  1GHM A;  2OSU A;  3LY4 A;  5CXW A;  4QHC A;  2RCX A;  4BL2 A;  1ZG4 A;  5AQ9 A;  3O88 A;  4KZB A;  4OON A;  1I2S A;  4DE1 A;  3VFH A;  1ERM A;  1RGZ A;  1W79 A;  5HFO A;  1PW8 A;  3C7U A;  5FSR A;  4QU3 A;  3ZG7 B;  4MEZ A;  4N92 A;  1YMX A;  3M6H A;  4X68 A;  4M3K A;  3HLD A;  4QY5 A;  4WEK A;  4DRT A;  3NDG A;  5FQ9 A;  5EVI B;  1KGE A;  3WS0 A;  1O7E A;  2Y2O A;  2ZQD A;  4E3K A;  4E3N A;  4KZ8 A;  5CRF A;  1FCO A;  2BG1 A;  2E8I A;  4ZTK A;  1IYO A;  3E2L A;  4OQH A;  5EOE A;  4OLG A;  3UDX A;  3CMZ A;  2RL3 A;  2EXA A;  3DWK A;  4C75 A;  5CEB A;  1EI5 A;  2WKE A;  1LI0 A;  3HUO A;  1SHV A;  3DW0 A;  1NXY A;  1ES2 A;  2Y2N A;  3PAG A;  4GB7 A;  1BLH A;  1M40 A;  1BT5 A;  4JF5 A;  1IKI A;  3TSG A;  2BLS A;  3VOZ A;  1LI9 A;  3I7J A;  1Q2P A;  3GV9 A;  3UE1 A;  4K0X A;  3HLC A;  1HZO A;  2WKI A;  4YFM A;  3UPN A;  1MBL A;  3IXB A;  2EFU A;  1KE3 A;  2HP5 A;  3ZHH A;  5A90 A;  1G6A A;  3V39 A;  4PPR A;  3MBZ A;  1MXO A;  3FKW A;  4WBG A;  3Q07 A;  4RYE A;  4X53 A;  5KSC A;  3C4O A;  1BUL A;  4R3J A;  1IYP A;  1PWG A;  4QJG A;  3IXH A;  5JYO A;  1HVB A;  1PIO A;  4HES A;  3HL9 A;  3IT9 A;  2Y59 A;  4ID4 A;  4LCM A;  1LL9 A;  4UA7 A;  4KG5 A;  4MBF A;  1FCN A;  1YQS A;  2C5W B;  4NET A;  2ZC3 B;  3HUN A;  4JPM A;  2X71 A;  2Q9N A;  4RX3 A;  4X56 A;  5EEC A;  1XPB A;  3ISG A;  3MZD A;  2JC7 A;  1W8Y A;  3NBL A;  2J8Y A;  4IBR A;  4S2L A;  5CHU A;  5GHX A;  2XD1 A;  5FI7 A;  4FCF A;  2OV5 A;  3Q7V A;  1G68 A;  2J7V A;  5EVL A;  5IHV A;  5FAP A;  2ZC5 B;  3SH7 A;  4KG2 A;  5JYP A;  4OPR A;  4Z9Q A;  3FV7 A;  5HW3 A;  3FWL A;  2HDS A;  2WKH A;  2JE5 A;  3ZFZ A;  1FR6 A;  4DE0 A;  4KZ7 A;  5J8X A;  2B5R A;  4S2K A;  4GDB A;  2DCF A;  1FR1 A;  3WS2 A;  4E6W A;  2WAF A;  1N4O A;  1ZKJ A;  2Y4A A;  3PAE A;  1XX2 A;  4UA6 A;  1MWS A;  3ZGA B;  2VGJ A;  2ZD8 A;  3G30 A;  1ZG6 A;  1SCW A;  1N9B A;  2FFF B;  5CGS A;  1MWT A;  1RGY A;  1E3U A;  4ZJ3 A;  4C3Q A;  3N8L A;  1ES4 A;  3C4P A;  5L2F A;  3ZG8 B;  2X02 A;  5FQM A;  3IF6 A;  1ZC2 A;  4DXB A;  1IKG A;  4QY6 A;  4E3J A;  3RXW A;  4Q8I A;  4HEF A;  1K6S A;  4KZ3 A;  4XUX A;  4C6Y A;  3N4I A;  2PU2 A;  1K25 A;  3SS5 A;  3ZVT A;  3WRT A;  3QHY A;  2Y2H A;  3GTC A;  1E4D A;  1XP4 A;  5AQA A;  3ZG0 A;  3BLS A;  1JWV A;  5FAQ A;  1KGF A;  5E2H A;  1YLJ A;  2QZ6 A;  3GMW A;  1GHI A;  3IF6 C;  4GNU A;  4JXG A;  4WM9 A;  5EPH A;  2GDN A;  3P98 A;  4P85 A;  1J9M A;  3G34 A;  4EV4 A;  4R4S A;  3MKF A;  1BZA A;  4E3M A;  5I94 A;  4IVI A;  4S2N A;  4PM9 A;  5GHY A;  5CHM A;  4ZJ2 A;  5HAI A;  3BEC A;  2WUQ A;  2ZQC A;  3GRJ A;  3ITB A;  3UY6 A;  4KZA A;  1JVJ A;  3IWQ A;  5CER A;  4R4R A;  4B4X A;  1ESU A;  3HRE A;  3IWI A;  1U60 A;  1OME A;  3HLW A;  1RP5 A;  5U47 A;  2V20 A;  4N1X A;  1L0E A;  1NY0 A;  3NC8 A;  3V5M A;  3IH8 A;  1ES3 A;  1FOF A;  5CHJ A;  3UDI A;  4S2N C;  2XDM A;  1NZO A;  4X69 A;  4P87 A;  1O07 A;  5FAT A;  3NI9 A;  2ZM8 A;  4JXV A;  2HP9 A;  3N8R A;  2XK1 A;  2EX9 A;  4KQQ A;  5HAQ A;  1E25 A;  1TDG A;  3SS3 A;  3AGF A;  2P74 A;  1KGG A;  3Q7Z A;  4JLF A;  4U3T A;  4DF6 A;  2R9W A;  3IHB A;  1PI5 A;  4PMA A;  3S1Y A;  4BL3 A;  3D4F A;  5AQ7 A;  5KZH A;  5A91 A;  1L0D A;  3IQA A;  4N1H A;  5FQK A;  2Y2I A;  3ZDJ A;  4EBL A;  4EQI A;  2Y2K A;  2XFT A;  3UO9 A;  3UE3 A;  1IYQ A;  4GD6 A;  1YLZ A;  4OP8 A;  5CTM A;  3C5A A;  4WZ4 A;  3VP0 A;  4OQG A;  4OPY A;  4FSF A;  2H10 A;  2PU4 A;  4WEL A;  4RA7 A;  1W5D A;  4BEN A;  5CED A;  2WGW A;  1ESI A;  1KDS A;  3BFF A;  3MZF A;  4FH2 A;  4R1G A;  3WS4 A;  3S22 A;  1MY8 A;  3GSG A;  4S2O A;  3NIA A;  5GHZ A;  4N9L A;  4MBH A;  2EX8 A;  1K6R A;  3TG9 A;  1HTZ A;  1DJC A;  3W4O A;  3WS1 A;  3Q82 A;  3RXX A;  4OH0 A;  1KVM A;  2HDR A;  1JTD A;  4R0Q A;  1K4F A;  1HD8 A;  2WYX A;  3GVB A;  2Y55 A;  4FD8 A;  2UWX A;  2OLV A;  3M6B A;  1QMF A;  5FQJ A;  3IH9 A;  3VMA A;  3HBR A;  4GZB A;  1BUE A;  5GLB A;  4WYY A;  1H8Z A;  2DRW A;  4OOY A;  5HX9 A;  4O7D A;  5DF7 A;  3OPH A;  2Z2L B;  1YLW A;  4LCL A;  1NJ4 A;  2CC1 A;  2R9X A;  4KQR A;  3NCK A;  3VP1 A;  3VSK A;  1BLC A;  1SDN A;  4OKP A;  5E2F A;  4PM5 A;  3MXR A;  4QB8 A;  5GL9 A;  2J9P A;  2P9V A;  1SKF A;  3LCE A;  1YMS A;  1ERO A;  4OPQ A;  4EBN A;  5E2G A;  2Y2M A;  3VOY A;  4ZBE A;  1K55 A;  3IF5 A;  3IXD A;  4Y0U A;  1SDE A;  3A3I A;  3A3E A;  5F1F A;  4N9K A;  4R23 A; 
#chains in the Genus database with same CATH topology
 2OOL A;  4OOL A;  1KVL A;  2WKQ A;  4MCW A;  3UME A;  4NKP A;  2PBY A;  3UPO A;  3T50 A;  1YLT A;  5EE8 A;  4E6X A;  4ZDX A;  4B88 A;  2HF6 A;  3BEB A;  3EQU A;  3JYI A;  3HVF A;  1W8Q A;  2Y2J A;  1T18 A;  4KQD A;  3CAX A;  3SH9 A;  1G5U A;  3HUM A;  4BBV A;  4G3W A;  4QD4 A;  3LIF A;  4X6T A;  4K0W A;  2ZQ9 A;  3MQO A;  5M1A A;  1GSX A;  1PWD A;  1NYM A;  3OPL A;  3KSH A;  4GCZ A;  3HLB A;  1S4R A;  4PAU A;  2XF3 A;  1LL5 A;  4HNB A;  1M6K A;  2EXB A;  5DJU A;  1BTL A;  3MFD A;  4DE3 A;  1NRJ A;  1ES5 A;  2ZM0 A;  3CJM A;  2C6W B;  2XH9 A;  3MQQ A;  2Z6D A;  2NUP C;  3Q1F A;  3MMH A;  3NY4 A;  1CI9 A;  4OLD A;  1PW1 A;  3TRC A;  3A0S A;  3HLG A;  3FZC A;  4H6J B;  3PHY A;  1WYB A;  4UHU A;  1SKO B;  2EFX A;  2WAD A;  1JTG A;  3HLE A;  4ARZ A;  4JBF A;  1MWR A;  1TF1 A;  1GCE A;  4E04 A;  3T4L A;  1I2W A;  4LV3 A;  2V8C A;  4EW7 A;  3SH8 A;  3A0R A;  4HBT A;  2O0Y A;  2ZC7 A;  1VM1 A;  1LSX A;  2P7J A;  1QME A;  2PR5 A;  5AVF A;  2HPB A;  1TEM A;  3A3F A;  2L0W A;  2OWH A;  4CPK A;  1ALQ A;  1MWU A;  4EWF A;  3OC2 A;  2W3F A;  4UQI M;  2A49 A;  2KLI A;  4HH2 A;  3QP6 A;  2V8F A;  4ETZ A;  4JXW A;  3HJI A;  1VB6 A;  4B9O A;  2Y2L A;  4OPZ A;  1RCJ A;  3M2J A;  1L0G A;  3W8K A;  4B4Z A;  1DJB A;  5DKK A;  1MKM A;  2GZA A;  2BAS A;  1G28 A;  2QJ7 A;  2L4R A;  4FUW A;  5I5L A;  2G2U A;  3VE4 A;  2JCH A;  2K2N A;  3T4J A;  3BLM A;  4PM8 A;  3D72 A;  3G32 A;  1I5Q A;  4EBP A;  4NEE D;  4LRZ E;  3UMD A;  4EES A;  1FCM A;  5HWW A;  4BLM A;  4UAA A;  2O9C A;  1PZO A;  4KG6 A;  1LHY A;  3T1R A;  3QP1 A;  1FSW A;  4S2I A;  1GHM A;  5TBM B;  1ZG4 A;  1UWP X;  4OON A;  1XFQ A;  1I2S A;  1ERM A;  5HFO A;  4QU3 A;  4MEZ A;  4N92 A;  4X68 A;  3OLO A;  3T4S A;  5KIZ A;  3WS0 A;  1O7E A;  4E3N A;  5HWT A;  4ZTK A;  3BQ8 A;  3CIT A;  3LR5 A;  3CMZ A;  2RL3 A;  3DWK A;  1F2K A;  5CEB A;  1EI5 A;  2WKE A;  3DW0 A;  1NXY A;  2MJ6 A;  5IT5 A;  3GV9 A;  1DP8 A;  4YFM A;  2HP5 A;  1YKD A;  4WBG A;  4R3J A;  2EWV A;  1PWG A;  2J3T C;  4I3J A;  1HVB A;  1PIO A;  3HL9 A;  3IT9 A;  4HOI A;  4ID4 A;  4LCM A;  4LRX C;  2BTF P;  4MBF A;  1FCN A;  1YQS A;  3JPU A;  3HUN A;  2X71 A;  4RX3 A;  5EEC A;  3ISG A;  1H3Q A;  1S4S A;  5FI7 A;  4FCF A;  4NG2 A;  1TS7 A;  3Q7V A;  3SH7 A;  3QP2 A;  4R70 A;  3V67 A;  1NWZ A;  5HW3 A;  3FWL A;  2WKH A;  2W1T A;  2JE5 A;  3ZFZ A;  1AWI A;  4DE0 A;  5J8X A;  3QP5 A;  4E6W A;  2K31 A;  2HGV A;  3WS2 A;  3DTK A;  2WAF A;  3NOP C;  4FTX A;  4UA6 A;  3ZGA B;  1Y4O A;  1RGY A;  1E3U A;  4ZJ3 A;  3IX4 A;  3C4P A;  4Y5F A;  3MQ0 A;  3T1S A;  4L9G A;  3B47 A;  4XT2 B;  2V0W A;  4E3J A;  4KUO A;  4KZ3 A;  4C6Y A;  3IBJ A;  1XP4 A;  4B93 A;  2VX8 A;  2P08 A;  2QZ6 A;  4GNU A;  4EQ1 A;  1MC0 A;  5EPH A;  2JKF A;  4HH3 A;  1J9M A;  3G34 A;  4R4S A;  3MKF A;  3LIA A;  4P6Z S;  3MR0 A;  2V0U A;  4PM9 A;  3BEC A;  2WUQ A;  3IWI A;  2QHK A;  2XRO A;  3CUE A;  4N1X A;  1NY0 A;  3V5M A;  1WA9 A;  5FL3 A;  3MSH A;  4R38 A;  5L09 A;  4AFI A;  3B33 A;  1OTE A;  4P87 A;  1EW0 A;  3SZT A;  2EX9 A;  3F1N A;  3CUE C;  5HAQ A;  3SS3 A;  1TDG A;  4H6J A;  2P74 A;  2GJ3 A;  1PI5 A;  4PMA A;  3D4F A;  5DFY A;  1SKO A;  3CHW P;  1STZ A;  3F1P B;  3NOT C;  4EBL A;  3UE3 A;  4OP8 A;  5CTM A;  3LUQ A;  3C5A A;  1TS6 A;  4OQG A;  4OPY A;  2PU4 A;  4WEL A;  1W5D A;  1TD5 A;  1ESI A;  4R1G A;  3WS4 A;  1W63 Q;  3S22 A;  2DMW A;  4L9F A;  4S2O A;  2WKR A;  4MBH A;  3D9Y A;  1DJC A;  3KSF A;  3QP8 A;  2UV0 E;  2WYX A;  2Y55 A;  2UWX A;  2OLV A;  3U4L P;  3KX0 X;  4WYY A;  1OT9 A;  5EM1 A;  4OOY A;  3OPH A;  1YLW A;  2FH5 A;  3UE6 A;  4KQR A;  3EOI A;  3KO6 A;  4OKP A;  2M7V A;  3MXR A;  4QB8 A;  2J9P A;  3LCE A;  1YMS A;  1ERO A;  4OPQ A;  4EBN A;  4Y0U A;  1SDE A;  1OT6 A;  4N9K A;  3L9K A;  3S7P A;  3LY3 A;  5EFW A;  1YLP A;  2OWJ A;  1T1C A;  4WMC D;  2Q9M A;  1IYS A;  2VGK A;  3OOV A;  1A0K A;  5FDS A;  5FDH A;  1VQQ A;  4KZ9 A;  2ZMA A;  5HD5 A;  1MPL A;  4JF6 A;  2PRF A;  3AGD A;  5F68 A;  3PTE A;  3MXS A;  2ZM2 A;  3GR2 A;  4M4X A;  2W27 A;  5D3O A;  4GDN A;  1YM1 A;  3QNC A;  3LO7 A;  3MF0 A;  1K4E A;  4Y15 A;  5A92 A;  5FQI A;  3SW1 A;  4DDS A;  4GW9 A;  3MKE A;  3UDF A;  3ZVW A;  4Y7P A;  5TBM A;  3FG8 A;  3G31 A;  4X55 A;  3CPT B;  3IHA A;  1GA9 A;  4WN5 A;  1ONG A;  4HQA A;  1CK3 A;  1JWP A;  2H5S A;  2ZL1 B;  5MC7 A;  3WWX A;  3TW8 A;  4DXC A;  1S1Y A;  2V1B A;  5AVE A;  3TOI A;  4JKT A;  2WGV A;  2B95 A;  3N6I A;  4S2J A;  4E3L A;  1YLY A;  5DF9 A;  5HL1 A;  3PBT A;  2XD5 A;  1H8Y A;  3C2W A;  3O87 A;  5EVE A;  3IS2 B;  2XR0 A;  3OCN A;  2M1C A;  4R3B A;  3FYZ A;  4I5S A;  3N7W A;  3RJU A;  4MN6 A;  4BQM A;  5FA7 A;  4BBU A;  1GSV A;  3S4X A;  4UA9 A;  3VP4 A;  5FEG A;  5EV0 A;  3CZD A;  1J3W A;  3B3X A;  5IU1 A;  5CEC A;  3IWO A;  4PM6 A;  1K54 A;  1TVF A;  3K3D A;  3OPP A;  4BJP A;  4DN0 A;  3NJA A;  3JVV A;  4EU0 A;  4JXS A;  2A24 B;  3DAV A;  5CTN A;  5G4Z A;  4PM7 A;  1CI8 A;  2WZX A;  3Q7V B;  2Y2Q A;  2INW A;  1PYY A;  5GLD A;  3O3V A;  2IWD A;  1XKZ A;  4RVA A;  4RX2 A;  4IBX A;  4X25 A;  1K54 C;  1JWZ A;  3BYD A;  4XT2 A;  1L2S A;  1K0K A;  2ZC4 B;  4IJG A;  1FSY A;  5GLC A;  4DKI A;  2P9V B;  3MS6 A;  2ZLY A;  3FKV A;  4BD0 A;  3LEZ A;  3GEC A;  4GD8 A;  3P01 A;  2QJ5 A;  1IFQ A;  2ZQ8 A;  1DP6 A;  2ZQA A;  1LLB A;  3IX3 A;  1XXM A;  4DE2 A;  3C8C A;  3V3S A;  2H0Y A;  4LEN A;  4I38 A;  1IEL A;  2XGN A;  3W4Q A;  5FEF A;  5DF8 A;  4LLO B;  5DTT A;  3S7O A;  4HJ6 A;  2V1A A;  4DDY A;  2VLG A;  3C38 A;  1Y54 A;  1P9W A;  2PBD P;  5TGF A;  2WGI A;  2QYB A;  5HDC A;  3KYZ A;  3EWK A;  2WAE A;  3LY4 A;  4Y3I A;  5CXW A;  5L07 A;  2HV1 A;  1DP9 A;  2W3H A;  5EM0 A;  3RTY A;  3R7W B;  4WEK A;  5EVI B;  1KGE A;  3F1P A;  5CRF A;  2BG1 A;  3LIE A;  3F1N B;  1IYO A;  1S67 L;  4JGP A;  4QWO A;  3VE3 A;  1SHV A;  2AVX A;  2Y2N A;  3GDI A;  4P6Z M;  1BLH A;  1M40 A;  1BT5 A;  5F69 A;  2BLS A;  3UE1 A;  4DJ3 A;  5IS1 A;  1MBL A;  3ZHH A;  1KE3 A;  5A90 A;  1G6A A;  3NHQ A;  3V39 A;  4PPR A;  3MBZ A;  3Q07 A;  2VGL S;  5JYO A;  3JVU A;  4PKY A;  1LL9 A;  1D7E A;  4JGO A;  1PNE A;  2ZC3 B;  2Q9N A;  3T4O A;  4S2L A;  1XPB A;  3R4K A;  2JC7 A;  4IBR A;  4DXB A;  5GHX A;  2W3E A;  3BY8 A;  2OV5 A;  2D01 A;  1G68 A;  3U2A A;  5JYP A;  4OPR A;  3FPW A;  2HDS A;  4O8G A;  2B5R A;  4GDB A;  4QPR A;  1N4O A;  3PAE A;  3B42 A;  1MWS A;  2ZD8 A;  3CWF A;  5LBR A;  1N9B A;  1XJ6 A;  2FFF B;  3T4K A;  1MWT A;  3N8L A;  1ES4 A;  2W3D A;  5L2F A;  3BJN A;  4X1L A;  3PXP A;  2ACG A;  3EGX C;  1ZC2 A;  2H28 A;  4CLC D;  2QWS A;  1LT0 A;  4R3A A;  3EEA A;  3ZVT A;  3WRT A;  3QHY A;  3GTC A;  1E4D A;  5AQA A;  3ZG0 A;  4EET B;  3FC7 A;  5E2H A;  1YLJ A;  1GHI A;  3DBA A;  1YAX A;  2XA7 S;  4WM9 A;  3CPT A;  5A8B A;  5CX7 A;  4P85 A;  3S7N A;  1P0Z A;  1NLY A;  4EV4 A;  1PFL A;  2ZMF A;  2ZL1 A;  5GHY A;  3GRJ A;  5CER A;  1FIK A;  4R4R A;  1ESU A;  1U60 A;  1RP5 A;  5U47 A;  2V20 A;  1L0E A;  3NC8 A;  3T1Q B;  4D60 A;  3LI9 A;  3LR0 A;  2XDM A;  3VOL A;  1F98 A;  1O07 A;  2ZM8 A;  1YSP A;  2K7S A;  4KQQ A;  3IS2 A;  2JKG A;  4MDZ A;  1E25 A;  4U3T A;  4DF6 A;  2R9W A;  3IHB A;  3S1Y A;  5AQ7 A;  5A91 A;  1L0D A;  1LSW A;  2Y2I A;  3ZDJ A;  1OTA A;  1OTD A;  4EQI A;  3KSG A;  2XFT A;  1V9Y A;  1IYQ A;  4PHT A;  4WZ4 A;  3VP0 A;  1T19 A;  2H10 A;  4FH2 A;  1W63 M;  1UWN X;  3GSG A;  1K6R A;  5HDS A;  1HTZ A;  2PR6 A;  2O9A A;  2XSS A;  3RXX A;  4OH0 A;  1BYW A;  1JTD A;  1K4F A;  5DFX A;  2A24 A;  2CMN A;  4FD8 A;  2OAQ 1;  5FQJ A;  3VMA A;  3HBR A;  4WL9 A;  5HX9 A;  2V9A A;  2Z2L B;  1NJ4 A;  4WUJ A;  3NCK A;  3VP1 A;  3ZYT A;  1XFN A;  1BLC A;  1SDN A;  3UB5 P;  4DJ2 A;  5GL9 A;  2P9V A;  2ZOI A;  5E2G A;  2Y2M A;  4CQH A;  3IXD A;  3K2N A;  3LR4 A;  2VK3 A;  2KDK A;  3BFG A;  2X01 A;  2PHY A;  3O86 A;  3E2K A;  3BY9 A;  1N9N A;  1XA7 A;  4MLL A;  4LV0 A;  5FI2 A;  2H0T A;  5EUA A;  5I94 A;  3BFD A;  4LV1 A;  2ZBB A;  2LB5 A;  1DY6 A;  1K57 A;  5BOH A;  1TS8 A;  4H8R A;  1K38 A;  1YT4 A;  3KYQ A;  3OCL A;  4HHD A;  4ETX A;  3SOI A;  4XXR A;  3BWL A;  4F94 A;  2LB9 A;  3NDE A;  1BLS A;  4OVD A;  2ZC6 B;  4I3A A;  5G18 A;  5J7E A;  4MN7 A;  3GQZ A;  1K57 C;  2XRN A;  5AJG A;  3C7V A;  5EVI D;  4GKU A;  1VEU B;  4LV2 A;  3DTM A;  2YKF A;  3R7W A;  5A93 A;  1Z6F A;  5EVI A;  1NZU A;  2HJ9 C;  3ZCZ A;  1AXB A;  3CI6 A;  1DJA A;  1F5M A;  1S6R A;  1XGJ A;  4GJ4 A;  5HAR A;  1H5X A;  4KQO A;  2XQZ A;  4KZ5 A;  3P7N A;  1H8M A;  2HDQ A;  3A3J A;  4YOF A;  1L3L A;  1HLU P;  3BFC A;  5EOO A;  5EVI C;  1N9O A;  2Y2P A;  2JBF A;  2FFY A;  4BBT A;  3ZNY A;  2JKT M;  1ONH A;  4HBU A;  2VV8 A;  2I72 A;  2Y2G A;  4GHI B;  3TJZ C;  4IED A;  3VP2 A;  2IWB A;  5F1G A;  2WZZ A;  3ULF A;  2PAV P;  1Q2Q A;  4LGW A;  5DTS A;  5F83 A;  2XLN A;  3PBS A;  4L0L A;  4I3I A;  4GOG A;  5HZH A;  1K56 D;  2WGW B;  1MKI A;  1W7F A;  2XEP A;  3C30 A;  1VET B;  4KZ4 A;  3VP3 A;  3G2Y A;  3P09 A;  4K08 A;  1K56 A;  4ZRR A;  4EUZ A;  2QPN A;  4LPZ A;  5TFQ A;  4GN2 A;  1D06 A;  4YIN A;  4IUK A;  3ZG5 A;  4BD1 A;  4MMN A;  3MFX A;  2DNS A;  4FOF A;  2OLU A;  1T1B A;  4II7 A;  4WMC A;  3M2K A;  4MNR A;  5HPF A;  2HP6 A;  3ZNT A;  3H7W B;  2E8J A;  1CEF A;  5KSH A;  4CLC B;  4P6B A;  1DRM A;  3VV4 A;  1GA0 A;  3LIB A;  1PRQ A;  5CGX A;  4JGQ A;  1BLP A;  5L8M A;  2L1M A;  5L10 A;  2WK0 A;  4XUZ A;  5M18 A;  1TDL A;  3RFB A;  5DVA A;  4EEP A;  2V2F F;  4BMW A;  4BWI A;  2J9O A;  5FAS A;  3CG5 A;  2HDU A;  2RCX A;  4LFU A;  2IA2 A;  1W79 A;  1PW8 A;  5FSR A;  3ZG7 B;  1ZTU A;  1CJF A;  4WLA A;  4NXE A;  4M3K A;  4QY5 A;  4DRT A;  1T1A A;  3E4O A;  3E98 A;  4E3K A;  4KZ8 A;  2JKR M;  2E8I A;  3E0Y A;  3MXQ A;  1JNU A;  3NUL A;  3NEC A;  2B18 A;  4OQH A;  5EOE A;  3UDX A;  2EXA A;  3S7Q A;  3PAG A;  4GB7 A;  1IKI A;  1LI9 A;  3I7J A;  3UB7 A;  3VOZ A;  4K0X A;  1HZO A;  2WKI A;  3UPN A;  3IXB A;  3UB8 A;  5DKL A;  2OAP 1;  3FKW A;  4HP4 A;  3E4P A;  4X53 A;  5KSC A;  1BUL A;  1IYP A;  3IXH A;  2GX5 A;  4I39 A;  4KG5 A;  4Q0I A;  4NET A;  4JPM A;  3H82 A;  1LSV A;  4X56 A;  2A2L A;  5CHU A;  4G3V A;  5IHV A;  2J7V A;  5EVL A;  2PYR A;  4KG2 A;  3G6O A;  1D1J A;  1FR6 A;  2DCF A;  1XX2 A;  2VGJ A;  1SCW A;  4HIA A;  2X02 A;  2W3G A;  1FIL A;  4QY6 A;  3RXW A;  4HEF A;  4X1M A;  1K6S A;  4XUX A;  2Y2H A;  4L9E A;  3DTE A;  3BLS A;  2KOI A;  4HJ4 A;  4HY8 A;  3GMW A;  4JXG A;  2HZ5 A;  4ESP A;  2JKR I;  2GDN A;  3P98 A;  2GNX A;  1UGU A;  1VEU A;  1X0O A;  5J4E A;  3IX8 A;  5CHM A;  3UY6 A;  4B4X A;  2Y8H A;  3HRE A;  3HLW A;  1OTB A;  2JHE A;  4Y17 A;  4YWZ A;  1ES3 A;  1P97 A;  3UDI A;  4ME4 A;  1NZO A;  4Q0J A;  2HP9 A;  4Y2F A;  2VEA A;  3AGF A;  1KGG A;  4JLF A;  4O0P A;  4GHI A;  5KZH A;  4N1H A;  1OPX A;  4Z1W A;  5F5Y A;  2J80 A;  4GD6 A;  1LL8 A;  4RA7 A;  4RQ9 A;  4BEN A;  5CED A;  4O01 A;  2WGW A;  3BFF A;  3MZF A;  1S66 L;  3NIA A;  3PR6 A;  4N9L A;  3A0V A;  1VET A;  3W4O A;  3MJQ A;  1KVM A;  2HDR A;  3M6B A;  1QMF A;  2I9V A;  1H8Z A;  2DRW A;  4O7D A;  2CC1 A;  2R9X A;  1YSQ A;  2NUT C;  3H9W A;  3KYE A;  5E2F A;  4PM5 A;  3K3C A;  3HJK A;  3VOY A;  1K55 A;  4EUV A;  3A3I A;  1KE4 A;  1VHM A;  1XA1 A;  4G3K A;  4IVK A;  3UB6 A;  3V50 A;  1PWC A;  3SS4 A;  3H7W A;  2Z6C A;  1EWZ A;  4CLC A;  4NXF A;  2QKP A;  1NRF A;  5E2E A;  2IWC A;  3EGD C;  3IF6 B;  2V1Z A;  1K55 C;  4WEJ A;  3OBF A;  3LEQ A;  3OZH A;  4CJN A;  3G35 A;  2EX6 A;  2QMI A;  4NK3 A;  3AGE A;  3BFE A;  2R78 A;  1GHP A;  3UNW A;  4Q0H A;  4CLC C;  2Y79 A;  5FAO A;  3G2Z A;  1C3B A;  1S0W A;  2O9B A;  1KE0 A;  4WZ5 A;  5TR7 A;  1FQG A;  3UPP A;  5GLA A;  4HI4 A;  4P0M A;  5CGW A;  3BQA A;  4YNR A;  4D2O A;  1H0M A;  3QP4 A;  3T12 B;  2PD8 A;  3MZE A;  3T4Q A;  1OTI A;  1G6O A;  4F3L B;  4WZ5 C;  3ITA A;  3WRZ A;  3IXG A;  4FH4 A;  2JN7 A;  4GS9 B;  2VA0 A;  5HD3 A;  3WS5 A;  2J3T D;  2P04 A;  3DWZ A;  4KUK A;  3O5Y A;  3IBR A;  4E3O A;  3T1X A;  3PBO A;  4E3I A;  4JF4 A;  5HAP A;  4ZAM A;  1BSG A;  2Z2M B;  1ERQ A;  2ZJ9 A;  3L7H A;  3BRM A;  1P9R A;  4KEN B;  3KSI A;  1WE4 A;  3EQV A;  5F82 A;  1Y28 A;  3V3R A;  4MBK A;  2ZQ7 A;  5HWV A;  4OQ0 A;  4KZ6 A;  1KDW A;  3H82 B;  4A5R A;  4PKY G;  2VV7 A;  2Y91 A;  3PBN A;  3Q81 A;  1WYC A;  5M19 A;  1PZP A;  1KOU A;  3N8S A;  1XGI A;  4LRY C;  2G2W A;  5AQB A;  4Y0T A;  4Y0O A;  3HLF A;  4NXG A;  3A3D A;  4ZJ1 A;  4S2P A;  1E3U D;  4K91 A;  2WKP A;  3ZG9 B;  3G4P A;  3OPR A;  2HJE A;  3PBQ A;  5FQQ A;  5G4Y A;  3BM6 A;  5TJJ A;  2M7U A;  5J3W A;  3E4Q A;  4OP5 A;  5KMW A;  4S2M A;  3F1O B;  3VFF A;  3W4P A;  4CLC E;  2O99 A;  2J3W A;  3PBR A;  5FI6 A;  3UN7 A;  2EX2 A;  1PI4 A;  2A3U A;  5E43 A;  3UE0 A;  1TS0 A;  1ODV A;  4UEY A;  1V9Z A;  1NYY A;  4U0T A;  3PYP A;  3VSL A;  1SZV A;  4OQI A;  4U0X A;  1CEG A;  4OOM A;  4Y13 A;  1L0F A;  5DTK A;  1IEM A;  3QNB A;  2XFS A;  2PYP A;  2OSU A;  4QHC A;  4BL2 A;  5AQ9 A;  3O88 A;  4KZB A;  4DE1 A;  3VFH A;  1RGZ A;  3C7U A;  3LFV A;  1YMX A;  3M6H A;  1ACF A;  3RH8 B;  3HLD A;  3NDG A;  5FQ9 A;  2Y2O A;  2ZQD A;  3LR3 A;  1FCO A;  1Z09 A;  3ICY A;  3E2L A;  4OLG A;  4C75 A;  1LI0 A;  3HUO A;  4JF5 A;  1ES2 A;  4UQI S;  3TSG A;  3LGO A;  1Q2P A;  3HLC A;  4WF0 A;  3T4T A;  5C5K A;  2EFU A;  1GSW A;  3HCY A;  1MXO A;  4RYE A;  3C4O A;  4EXO A;  4QJG A;  1IOU A;  2VKS A;  4HES A;  2Y59 A;  4UA7 A;  3CLO A;  4ARZ B;  2YKH A;  2PD7 A;  2C5W B;  2D02 A;  3MZD A;  3NBL A;  1W8Y A;  3LIC A;  2J8Y A;  3D3O A;  2XD1 A;  3LI8 A;  2Q0O A;  4DMZ A;  5FAP A;  2ZC5 B;  2PT7 A;  4HJ3 A;  4Z9Q A;  3FV7 A;  2ZOH A;  2VZW A;  4KZ7 A;  4S2K A;  1OJG A;  1FR1 A;  4JGR A;  1ZKJ A;  2Y4A A;  1YPR A;  3G30 A;  1ZG6 A;  5CGS A;  5HSQ A;  2VGL M;  4C3Q A;  4EER A;  3W2Z A;  3LID A;  3ZG8 B;  5FQM A;  3IF6 A;  1IKG A;  4Q8I A;  3N4I A;  4IHQ A;  4GLQ A;  2PU2 A;  1K25 A;  1OJ5 A;  3SS5 A;  2PDR A;  1S1Z A;  2W1R A;  2VV6 A;  1CF0 A;  1JWV A;  3FPV A;  5FAQ A;  1KGF A;  3ZQ5 A;  3IF6 C;  5DJT A;  3NOU C;  5K5B A;  4HP9 A;  3DTI A;  2JKT I;  1ZHH B;  1XJ4 A;  1BZA A;  4E3M A;  4IVI A;  4R6L A;  4S2N A;  4ZJ2 A;  5HAI A;  2KX6 A;  5HL6 A;  2ZQC A;  3ITB A;  4KZA A;  1JVJ A;  3IWQ A;  3EEH A;  3TE8 A;  1OME A;  1XJ2 A;  4NXB A;  4F3L A;  2ZMV A;  3IH8 A;  3UB9 A;  4EEU A;  1FOF A;  5CHJ A;  1MZU A;  1NLZ A;  4GS9 A;  5F6A A;  4S2N C;  2EWW A;  4X69 A;  5FAT A;  3NI9 A;  4JXV A;  3N8R A;  2XK1 A;  2XA7 M;  2EA9 A;  3Q7Z A;  4BL3 A;  3IQA A;  5FQK A;  1XJ3 A;  2B02 A;  2Y2K A;  3UO9 A;  5HDD A;  1YLZ A;  1CQA A;  4FSF A;  1KDS A;  1MY8 A;  5GHZ A;  5HPI A;  3BW6 A;  2EX8 A;  3TG9 A;  3WS1 A;  3Q82 A;  1F9I A;  4R0Q A;  1HD8 A;  2VJW A;  3GVB A;  4MN5 A;  3IH9 A;  4GZB A;  1BUE A;  5GLB A;  2W0N A;  2G7U A;  1N9L A;  5DF7 A;  4LCL A;  3VSK A;  4IUH A;  1SKF A;  4ZBE A;  3IF5 A;  3A3E A;  3F1O A;  2FZ0 A;  5F1F A;  2W1T B;  3LYX A;  4R23 A; 
#chains in the Genus database with same CATH homology
 1KE4 A;  3LY3 A;  3BFG A;  1YLP A;  2X01 A;  3O86 A;  3E2K A;  1XA1 A;  4WMC D;  4IVK A;  4OOL A;  1KVL A;  3V50 A;  1PWC A;  3SS4 A;  1XA7 A;  4MLL A;  2Q9M A;  2PBY A;  3UPO A;  1EWZ A;  1IYS A;  2VGK A;  4LV0 A;  5FI2 A;  1YLT A;  5FDH A;  1NRF A;  5E2E A;  2H0T A;  5EUA A;  2IWC A;  5EE8 A;  1VQQ A;  3IF6 B;  2ZMA A;  4KZ9 A;  2V1Z A;  1K55 C;  1MPL A;  4E6X A;  4WEJ A;  3OZH A;  3BFD A;  4ZDX A;  4CJN A;  4LV1 A;  4JF6 A;  3G35 A;  4B88 A;  2EX6 A;  2QMI A;  1DY6 A;  3AGD A;  1K57 A;  4NK3 A;  3BEB A;  3PTE A;  3MXS A;  5BOH A;  2ZM2 A;  3GR2 A;  4H8R A;  3EQU A;  3AGE A;  3BFE A;  1K38 A;  1YT4 A;  3JYI A;  5D3O A;  4GDN A;  1GHP A;  3HVF A;  1W8Q A;  3OCL A;  2Y2J A;  1YM1 A;  3QNC A;  3SH9 A;  3SOI A;  3LO7 A;  4XXR A;  3UNW A;  3HUM A;  1K4E A;  5A92 A;  5FAO A;  4F94 A;  3G2Z A;  5FQI A;  3NDE A;  4DDS A;  1C3B A;  1BLS A;  1S0W A;  4OVD A;  4QD4 A;  4X6T A;  3MKE A;  2ZC6 B;  4K0W A;  5G18 A;  3UDF A;  2ZQ9 A;  3ZVW A;  1KE0 A;  4Y7P A;  3GQZ A;  4WZ5 A;  5TR7 A;  1FQG A;  3G31 A;  5GLA A;  4X55 A;  3UPP A;  5M1A A;  3IHA A;  1GA9 A;  1K57 C;  1PWD A;  1ONG A;  1NYM A;  3C7V A;  5EVI D;  1CK3 A;  4P0M A;  4GKU A;  5CGW A;  4LV2 A;  1JWP A;  2H5S A;  3DTM A;  3OPL A;  4D2O A;  3HLB A;  5A93 A;  1Z6F A;  5EVI A;  2XF3 A;  3WWX A;  4DXC A;  1NZU A;  1LL5 A;  3ZCZ A;  1AXB A;  1M6K A;  2EXB A;  3MZE A;  1DJA A;  1BTL A;  1S6R A;  1XGJ A;  3MFD A;  4JKT A;  4WZ5 C;  5HAR A;  3TOI A;  4DE3 A;  3ITA A;  2WGV A;  1H5X A;  3WRZ A;  4KQO A;  1ES5 A;  2XQZ A;  2ZM0 A;  3CJM A;  3IXG A;  3N6I A;  4FH4 A;  4KZ5 A;  4S2J A;  2C6W B;  2HDQ A;  2XH9 A;  3A3J A;  4E3L A;  1YLY A;  5DF9 A;  5HL1 A;  3PBT A;  3WS5 A;  2XD5 A;  3BFC A;  3Q1F A;  1H8Y A;  3NY4 A;  1CI9 A;  5EOO A;  5EVI C;  2Y2P A;  2JBF A;  3DWZ A;  3O87 A;  4OLD A;  1PW1 A;  2XR0 A;  3OCN A;  2FFY A;  3ZNY A;  3HLG A;  3FZC A;  1ONH A;  4R3B A;  4E3O A;  4HBU A;  2I72 A;  2Y2G A;  3FYZ A;  1WYB A;  4UHU A;  3N7W A;  4IED A;  3VP2 A;  3RJU A;  3PBO A;  4E3I A;  2IWB A;  2WAD A;  2EFX A;  4JF4 A;  5F1G A;  4BQM A;  5HAP A;  4ZAM A;  1BSG A;  5FA7 A;  1JTG A;  2WZZ A;  3HLE A;  4JBF A;  1MWR A;  2Z2M B;  1ERQ A;  2ZJ9 A;  3BRM A;  3S4X A;  4UA9 A;  1GCE A;  1Q2Q A;  5DTS A;  5F83 A;  1I2W A;  2XLN A;  4KEN B;  3VP4 A;  3PBS A;  4L0L A;  1WE4 A;  4GOG A;  4LV3 A;  3CZD A;  3EQV A;  3B3X A;  5F82 A;  3SH8 A;  5CEC A;  1K56 D;  4HBT A;  2WGW B;  3IWO A;  3V3R A;  4PM6 A;  4MBK A;  1K54 A;  1TVF A;  1MKI A;  2ZQ7 A;  1W7F A;  2ZC7 A;  1VM1 A;  4OQ0 A;  2XEP A;  1KDW A;  3OPP A;  4KZ6 A;  1QME A;  4A5R A;  4BJP A;  2Y91 A;  2HPB A;  3PBN A;  4KZ4 A;  3Q81 A;  3VP3 A;  1WYC A;  3G2Y A;  3P09 A;  1K56 A;  5M19 A;  4EUZ A;  2QPN A;  4JXS A;  5CTN A;  1PZP A;  5TFQ A;  4PM7 A;  1CI8 A;  1TEM A;  2WZX A;  3N8S A;  1XGI A;  3Q7V B;  2Y2Q A;  3A3F A;  4CPK A;  4GN2 A;  1PYY A;  2G2W A;  5GLD A;  3O3V A;  2IWD A;  1ALQ A;  4YIN A;  1MWU A;  5AQB A;  1XKZ A;  4Y0T A;  4RVA A;  4Y0O A;  4RX2 A;  4EWF A;  3OC2 A;  4IBX A;  3ZG5 A;  4BD1 A;  3HLF A;  3A3D A;  4ZJ1 A;  4S2P A;  2A49 A;  1K54 C;  1JWZ A;  1E3U D;  3BYD A;  4K91 A;  1L2S A;  2ZC4 B;  3ZG9 B;  3G4P A;  3OPR A;  2DNS A;  1FSY A;  3PBQ A;  4JXW A;  2OLU A;  5FQQ A;  5GLC A;  3BM6 A;  4DKI A;  2Y2L A;  4OPZ A;  1RCJ A;  2P9V B;  2ZLY A;  3M2J A;  4OP5 A;  1L0G A;  3W8K A;  3FKV A;  4B4Z A;  4WMC A;  4BD0 A;  3M2K A;  5KMW A;  1DJB A;  3LEZ A;  4S2M A;  4GD8 A;  3VFF A;  2ZQ8 A;  4MNR A;  2G2U A;  3W4P A;  2ZQA A;  1LLB A;  2JCH A;  2HP6 A;  3PBR A;  5FI6 A;  3UN7 A;  2EX2 A;  3ZNT A;  1CEF A;  1XXM A;  5KSH A;  4DE2 A;  1PI4 A;  2A3U A;  5E43 A;  4P6B A;  3UE0 A;  3V3S A;  3BLM A;  2H0Y A;  4PM8 A;  1GA0 A;  4LEN A;  5CGX A;  1NYY A;  1IEL A;  3G32 A;  4U0T A;  1I5Q A;  4EBP A;  2XGN A;  3W4Q A;  1BLP A;  5DF8 A;  3VSL A;  1FCM A;  5DTT A;  2WK0 A;  4OQI A;  4DDY A;  4XUZ A;  4U0X A;  4BLM A;  1CEG A;  5M18 A;  4UAA A;  1TDL A;  4OOM A;  1Y54 A;  5DVA A;  1PZO A;  4KG6 A;  2V2F F;  5TGF A;  2WGI A;  2J9O A;  5FAS A;  1L0F A;  1LHY A;  3CG5 A;  5DTK A;  2HDU A;  1IEM A;  3QNB A;  1FSW A;  2XFS A;  2WAE A;  4S2I A;  1GHM A;  2OSU A;  3LY4 A;  5CXW A;  4QHC A;  2RCX A;  4BL2 A;  1ZG4 A;  5AQ9 A;  3O88 A;  4KZB A;  4OON A;  1I2S A;  4DE1 A;  3VFH A;  1ERM A;  1RGZ A;  1W79 A;  5HFO A;  1PW8 A;  3C7U A;  5FSR A;  4QU3 A;  3ZG7 B;  4MEZ A;  4N92 A;  1YMX A;  3M6H A;  4X68 A;  4M3K A;  3HLD A;  4QY5 A;  4WEK A;  4DRT A;  3NDG A;  5FQ9 A;  5EVI B;  1KGE A;  3WS0 A;  1O7E A;  2Y2O A;  2ZQD A;  4E3K A;  4E3N A;  4KZ8 A;  5CRF A;  1FCO A;  2BG1 A;  2E8I A;  4ZTK A;  1IYO A;  3E2L A;  4OQH A;  5EOE A;  4OLG A;  3UDX A;  3CMZ A;  2RL3 A;  2EXA A;  3DWK A;  4C75 A;  5CEB A;  1EI5 A;  2WKE A;  1LI0 A;  3HUO A;  1SHV A;  3DW0 A;  1NXY A;  1ES2 A;  2Y2N A;  3PAG A;  4GB7 A;  1BLH A;  1M40 A;  1BT5 A;  4JF5 A;  1IKI A;  3TSG A;  2BLS A;  3VOZ A;  1LI9 A;  3I7J A;  1Q2P A;  3GV9 A;  3UE1 A;  4K0X A;  3HLC A;  1HZO A;  2WKI A;  4YFM A;  3UPN A;  1MBL A;  3IXB A;  2EFU A;  1KE3 A;  2HP5 A;  3ZHH A;  5A90 A;  1G6A A;  3V39 A;  4PPR A;  3MBZ A;  1MXO A;  3FKW A;  4WBG A;  3Q07 A;  4RYE A;  4X53 A;  5KSC A;  3C4O A;  1BUL A;  4R3J A;  1IYP A;  1PWG A;  4QJG A;  3IXH A;  5JYO A;  1HVB A;  1PIO A;  4HES A;  3HL9 A;  3IT9 A;  2Y59 A;  4ID4 A;  4LCM A;  1LL9 A;  4UA7 A;  4KG5 A;  4MBF A;  1FCN A;  1YQS A;  2C5W B;  4NET A;  2ZC3 B;  3HUN A;  4JPM A;  2X71 A;  2Q9N A;  4RX3 A;  4X56 A;  5EEC A;  1XPB A;  3ISG A;  3MZD A;  2JC7 A;  1W8Y A;  3NBL A;  2J8Y A;  4IBR A;  4S2L A;  5CHU A;  5GHX A;  2XD1 A;  5FI7 A;  4FCF A;  2OV5 A;  3Q7V A;  1G68 A;  2J7V A;  5EVL A;  5IHV A;  5FAP A;  2ZC5 B;  3SH7 A;  4KG2 A;  5JYP A;  4OPR A;  4Z9Q A;  3FV7 A;  5HW3 A;  3FWL A;  2HDS A;  2WKH A;  2JE5 A;  3ZFZ A;  1FR6 A;  4DE0 A;  4KZ7 A;  5J8X A;  2B5R A;  4S2K A;  4GDB A;  2DCF A;  1FR1 A;  3WS2 A;  4E6W A;  2WAF A;  1N4O A;  1ZKJ A;  2Y4A A;  3PAE A;  1XX2 A;  4UA6 A;  1MWS A;  3ZGA B;  2VGJ A;  2ZD8 A;  3G30 A;  1ZG6 A;  1SCW A;  1N9B A;  2FFF B;  5CGS A;  1MWT A;  1RGY A;  1E3U A;  4ZJ3 A;  4C3Q A;  3N8L A;  1ES4 A;  3C4P A;  5L2F A;  3ZG8 B;  2X02 A;  5FQM A;  3IF6 A;  1ZC2 A;  4DXB A;  1IKG A;  4QY6 A;  4E3J A;  3RXW A;  4Q8I A;  4HEF A;  1K6S A;  4KZ3 A;  4XUX A;  4C6Y A;  3N4I A;  2PU2 A;  1K25 A;  3SS5 A;  3ZVT A;  3WRT A;  3QHY A;  2Y2H A;  3GTC A;  1E4D A;  1XP4 A;  5AQA A;  3ZG0 A;  3BLS A;  1JWV A;  5FAQ A;  1KGF A;  5E2H A;  1YLJ A;  2QZ6 A;  3GMW A;  1GHI A;  3IF6 C;  4GNU A;  4JXG A;  4WM9 A;  5EPH A;  2GDN A;  3P98 A;  4P85 A;  1J9M A;  3G34 A;  4EV4 A;  4R4S A;  3MKF A;  1BZA A;  4E3M A;  5I94 A;  4IVI A;  4S2N A;  4PM9 A;  5GHY A;  5CHM A;  4ZJ2 A;  5HAI A;  3BEC A;  2WUQ A;  2ZQC A;  3GRJ A;  3ITB A;  3UY6 A;  4KZA A;  1JVJ A;  3IWQ A;  5CER A;  4R4R A;  4B4X A;  1ESU A;  3HRE A;  3IWI A;  1U60 A;  1OME A;  3HLW A;  1RP5 A;  5U47 A;  2V20 A;  4N1X A;  1L0E A;  1NY0 A;  3NC8 A;  3V5M A;  3IH8 A;  1ES3 A;  1FOF A;  5CHJ A;  3UDI A;  4S2N C;  2XDM A;  1NZO A;  4X69 A;  4P87 A;  1O07 A;  5FAT A;  3NI9 A;  2ZM8 A;  4JXV A;  2HP9 A;  3N8R A;  2XK1 A;  2EX9 A;  4KQQ A;  5HAQ A;  1E25 A;  1TDG A;  3SS3 A;  3AGF A;  2P74 A;  1KGG A;  3Q7Z A;  4JLF A;  4U3T A;  4DF6 A;  2R9W A;  3IHB A;  1PI5 A;  4PMA A;  3S1Y A;  4BL3 A;  3D4F A;  5AQ7 A;  5KZH A;  5A91 A;  1L0D A;  3IQA A;  4N1H A;  5FQK A;  2Y2I A;  3ZDJ A;  4EBL A;  4EQI A;  2Y2K A;  2XFT A;  3UO9 A;  3UE3 A;  1IYQ A;  4GD6 A;  1YLZ A;  4OP8 A;  5CTM A;  3C5A A;  4WZ4 A;  3VP0 A;  4OQG A;  4OPY A;  4FSF A;  2H10 A;  2PU4 A;  4WEL A;  4RA7 A;  1W5D A;  4BEN A;  5CED A;  2WGW A;  1ESI A;  1KDS A;  3BFF A;  3MZF A;  4FH2 A;  4R1G A;  3WS4 A;  3S22 A;  1MY8 A;  3GSG A;  4S2O A;  3NIA A;  5GHZ A;  4N9L A;  4MBH A;  2EX8 A;  1K6R A;  3TG9 A;  1HTZ A;  1DJC A;  3W4O A;  3WS1 A;  3Q82 A;  3RXX A;  4OH0 A;  1KVM A;  2HDR A;  1JTD A;  4R0Q A;  1K4F A;  1HD8 A;  2WYX A;  3GVB A;  2Y55 A;  4FD8 A;  2UWX A;  2OLV A;  3M6B A;  1QMF A;  5FQJ A;  3IH9 A;  3VMA A;  3HBR A;  4GZB A;  1BUE A;  5GLB A;  4WYY A;  1H8Z A;  2DRW A;  4OOY A;  5HX9 A;  4O7D A;  5DF7 A;  3OPH A;  2Z2L B;  1YLW A;  4LCL A;  1NJ4 A;  2CC1 A;  2R9X A;  4KQR A;  3NCK A;  3VP1 A;  3VSK A;  1BLC A;  1SDN A;  4OKP A;  5E2F A;  4PM5 A;  3MXR A;  4QB8 A;  5GL9 A;  2J9P A;  2P9V A;  1SKF A;  3LCE A;  1YMS A;  1ERO A;  4OPQ A;  4EBN A;  5E2G A;  2Y2M A;  3VOY A;  4ZBE A;  1K55 A;  3IF5 A;  3IXD A;  4Y0U A;  1SDE A;  3A3I A;  3A3E A;  5F1F A;  4N9K A;  4R23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...