3BLMA

Refined crystal structure of beta-lactamase from staphylococcus aureus pc1 at 2.0
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of beta-lactamase from Staphylococcus aureus PC1 at 2.0 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 94
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1990-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3blmA00
3FV7A 5G18A 1BZAA 3HREA 3W4QA 3ZGAB 4IVKA 4GOGA 4WZ5C 4A5RA 1N9BA 3BFGA 2HDRA 4UA6A 5AQBA 4OP8A 4PMAA 1MBLA 4JF5A 3PAEA 1NJ4A 3MKEA 3ZVWA 4BLMA 4E3OA 2B5RA 5CTMA 1K6RA 5CGWA 3OCLA 5GHZA 2E8IA 5CHJA 2XGNA 4JF4A 1MPLA 3SS5A 1MY8A 3OPHA 1IYSA 2ZC7A 3HLBA 3HLFA 3GSGA 3HL9A 5EE8A 3P09A 2WKHA 3UNWA 5KMWA 1YT4A 2ZD8A 2Y2MA 3MZFA 3ZG0A 3WS4A 3OCNA 1PIOA 3PBTA 1W8QA 1I5QA 3LY4A 4WMCA 5E2FA 5L2FA 5DF7A 3OPPA 4KZ7A 3A3IA 4OQHA 4RA7A 3G31A 3GV9A 4GDBA 3EQVA 4LV3A 3NBLA 1FR1A 4KZ8A 5FAPA 1XA1A 5HW3A 3W4PA 1IELA 4B4XA 4M3KA 1MWRA 5HARA 3MFDA 1DY6A 3ZNYA 2J7VA 1L2SA 3PBQA 3BLMA 1GHIA 3IHAA 5AQ9A 5CECA 1BLSA 1PW1A 3BFFA 3V5MA 4MNRA 1Q2QA 1NRFA 2P9VA 5FATA 4RX3A 4DXBA 3NIAA 1PZOA 3LY3A 5FI7A 3N6IA 4GZBA 2FFFB 4QU3A 3EQUA 1ZG4A 1XGJA 5HL1A 1SDEA 2XF3A 4OPRA 1ZC2A 1MKIA 2ZMAA 3BLSA 1KVMA 4FSFA 3ZG9B 4ZTKA 1H8ZA 1EWZA 3VP0A 1CI8A 3PBNA 1S0WA 2Y2PA 3HVFA 1YLTA 2Y2KA 2UWXA 1IYOA 4C75A 3LO7A 1YM1A 4DF6A 3G34A 3IHBA 3IH8A 3TSGA 4E3MA 4C3QA 1K4FA 2EXAA 1FCMA 2VGJA 1W79A 3IT9A 5BOHA 4HBTA 1MWSA 4WZ5A 4N9KA 3HLCA 3HUNA 3PTEA 4X68A 4DE3A 4KZ5A 1DJBA 1W7FA 2WKEA 3DWZA 5HAQA 2EX8A 2WGWB 1XXMA 2V20A 1BULA 3IWOA 3P98A 4LCMA 4MLLA 4N9LA 3C4OA 4R0QA 5JYOA 3VOZA 2XD1A 3BYDA 4OOYA 4S2IA 4E6WA 4D2OA 2V2FF 5DTSA 2EX9A 3UDIA 1RGZA 4EUZA 4R23A 2I72A 4JPMA 4YFMA 1KE0A 1MWTA 3IF6C 3N7WA 3CJMA 2PU4A 1ES2A 1AXBA 3GQZA 2EFUA 5EUAA 3UO9A 1YLPA 4QY5A 5GLDA 1L0EA 1W8YA 4DXCA 1YLYA 2HDQA 4OPZA 4OQGA 3G2ZA 5A93A 5GLAA 2BLSA 3UE1A 1GA9A 4ZDXA 5DF8A 5DTTA 1K4EA 3FKWA 1K55A 4N1XA 3VSLA 4KZ3A 3IF6B 1PI5A 1YMXA 2Y2JA 1Z6FA 3O3VA 2G2UA 2H10A 1E3UA 4OPQA 4X6TA 5FQQA 1ALQA 2P74A 2Y4AA 1BLPA 5TGFA 4OQIA 4P85A 1BUEA 3M2JA 4EV4A 5M18A 2RL3A 5EVIB 1M40A 2HP6A 4FH4A 2VGKA 1VM1A 1OMEA 4IBXA 5M19A 3WS5A 1XX2A 3C7VA 3N4IA 4MBFA 1K57A 4FD8A 4OVDA 3AGFA 3BFEA 1SKFA 5FASA 5AQ7A 1RGYA 1RCJA 3ISGA 4K91A 4LV1A 1LL5A 3A3DA 3SS3A 3UE0A 2HPBA 3VP1A 4E6XA 1JTGA 2BG1A 3ZG5A 1CEGA 1ONHA 5AQAA 3RXXA 1K54C 4NETA 1K54A 3UDFA 4CJNA 4PM6A 5A90A 4EBPA 2ZM0A 3Q7VA 3G32A 2ZQCA 3WS2A 3SH8A 5KSCA 4GDNA 2H5SA 1H5XA 2XDMA 4OONA 5E43A 1IYQA 2C5WB 1CK3A 1WYBA 3HLEA 1E25A 3O87A 1MXOA 2XR0A 1JTDA 2Q9MA 1NYYA 4HBUA 3ZCZA 2HP5A 4E3NA 3O86A 4R4RA 4X55A 4LCLA 4S2NA 1XA7A 4JF6A 1XKZA 5F83A 4MBHA 3NDGA 3WS1A 5FQKA 3B3XA 5HAIA 1QMEA 5A92A 2XH9A 2WKIA 1L0GA 1ZKJA 2Z2MB 1FQGA 3VMAA 1K38A 1I2WA 1XP4A 2ZQ8A 4X56A 4KQRA 4GKUA 4X69A 1C3BA 3CMZA 4ZAMA 3ZG8B 3W4OA 2Y91A 4U3TA 5DTKA 4N92A 2GDNA 5FQMA 1I2SA 3IWIA 4IEDA 4UAAA 2WYXA 2FFYA 4WZ4A 3S1YA 3IXBA 4UA7A 2ZQ9A 3IF6A 2OLUA 3ZDJA 2ZC4B 5CTNA 3BECA 1NY0A 3C5AA 3M6HA 3SOIA 1JWVA 3VFHA 3FYZA 4RX2A 4PM7A 4PM5A 1KE3A 5E2HA 4R4SA 4DDYA 4Y0TA 3IF5A 3SH7A 2R9WA 3ITBA 3MXRA 4GNUA 1KVLA 3A3JA 3HUOA 4PM9A 2ZC6B 1SHVA 2WAEA 2EX2A 5CGSA 3VFFA 4QY6A 3UPOA 5M1AA 3VP4A 2WAFA 1QMFA 2OSUA 3Q81A 4JXSA 3NY4A 5CXWA 1J9MA 2ZM2A 3D4FA 1FSWA 4JBFA 1NZOA 2WGWA 4XXRA 1LLBA 3ZVTA 5CGXA 1NYMA 5EVIA 3WS0A 1XPBA 3GR2A 3IQAA 4JKTA 1HVBA 4DDSA 4BL2A 2EFXA 3E2LA 3TG9A 3WWXA 3OC2A 1RP5A 4GD6A 3ZG7B 1NZUA 3PAGA 2PU2A 4S2PA 1XGIA 1YLJA 5EVID 4Q8IA 4GB7A 3QHYA 1FR6A 1KGGA 2QPNA 1W5DA 2XK1A 3CG5A 4OOMA 4U0XA 4QB8A 5CRFA 3DW0A 3FZCA 4MBKA 3V50A 4B4ZA 5CEDA 5F1GA 4P6BA 4KG2A 1IEMA 5E2EA 1BTLA 1PI4A 4WMCD 5GHYA 4EBNA 2G2WA 4EBLA 5EVIC 5TR7A 3LEZA 2J9OA 4GN2A 4ZJ2A 1IKGA 2IWCA 3IXHA 4ID4A 4DE0A 4FCFA 5JYPA 2X02A 2WZZA 3GMWA 1PWGA 4OOLA 2A49A 2DRWA 3W8KA 3DTMA 3MXSA 1LI9A 1TDGA 4S2NC 3S4XA 2ZQ7A 1KGEA 4EWFA 4S2OA 4KZ9A 3ZHHA 3Q7VB 2XLNA 1KDWA 5FQJA 3M6BA 3VP2A 1K25A 1IKIA 2JCHA 3Q7ZA 1CEFA 2Z2LB 5CERA 4ZBEA 1YMSA 3BFCA 4JXWA 1TEMA 3ITAA 5FI6A 2OLVA 3RJUA 3CZDA 4WM9A 4X53A 3SH9A 1M6KA 1Q2PA 4LV2A 4QJGA 1PZPA 4P0MA 1GCEA 1PWDA 4WEKA 1K6SA 4MEZA 5FDHA 1ERMA 2QZ6A 1DJAA 3IXDA 2XFTA 5TFQA 4KENB 4RYEA 3MZEA 4S2LA 1O7EA 4R1GA 3UE3A 2HP9A 1K56D 1FCNA 3N8SA 2WZXA 2Y2NA 5CHMA 5HFOA 5U47A 2WGVA 2JBFA 2IWBA 4S2MA 4KZBA 1MWUA 2A3UA 3C7UA 5EVLA 4IVIA 5GHXA 1K56A 4R3JA 2Y2QA 1L0DA 2CC1A 1FOFA 3IXGA 4HESA 1YLWA 2Y55A 1VQQA 2X01A 1WE4A 2WGIA 1BLCA 3HBRA 3PBRA 2P9VB 3Q1FA 4WEJA 4XUXA 5DVAA 3AGDA 4WYYA 1ESUA 1FCOA 4OKPA 3V39A 1NXYA 2C6WB 3WRZA 4E3KA 5CEBA 5FAQA 3UPNA 3M2KA 3Q82A 4S2KA 4KZ4A 4K0XA 1ZG6A 2H0TA 4ZJ3A 4O7DA 1E3UD 2JC7A 2Y2OA 3A3EA 3BFDA 3TOIA 1KDSA 4WBGA 2X71A 4E3LA 1GHPA 3ZFZA 3PBOA 4Y0UA 3LCEA 2Y2IA 3Q07A 4BL3A 3QNBA 1KGFA 3GTCA 5GLBA 3S22A 1FSYA 4E3IA 2RCXA 3BEBA 1G6AA 3VSKA 1LI0A 3BM6A 5J8XA 2DNSA 2XEPA 4FH2A 3AGEA 4Y7PA 3V3RA 2ZQDA 4E3JA 1G68A 4R3BA 1BSGA 3HLWA 4CPKA 5EOOA 3PBSA 1DJCA 3HUMA 4DKIA 2WK0A 4JXGA 5GL9A 1YQSA 5HX9A 4ZJ1A 4YINA 2R9XA 5E2GA 1TDLA 1JWZA 4GD8A 3HLGA 4UHUA 4BJPA 3RXWA 1ESIA 3GVBA 3NDEA 2Y2GA 3UY6A 3WRTA 1N4OA 3IH9A 1YLZA 2WUQA 4NK3A 4KG6A 4DE1A 1E4DA 3MKFA 4QD4A 5CHUA 1ES5A 4PM8A 3I7JA 2HDSA 3BRMA 3OPLA 5HAPA 3C4PA 5GLCA 2PBYA 2ZLYA 1TVFA 5IHVA 1IYPA 5KSHA 1O07A 4OLGA 1PW8A 4BD0A 3G35A 4OPYA 2QMIA 2ZQAA 3O88A 1GHMA 3E2KA 3GRJA 4KQOA 3HLDA 4OLDA 4BD1A 5DF9A 1ES3A 1S6RA 3UPPA 4N1HA 4IBRA 4QHCA 4F94A 3UDXA 3FWLA 5I94A 2WADA 3OPRA 4JXVA 1HZOA 2ZJ9A 3VOYA 2J8YA 1ONGA 1BLHA 5EECA 5F82A 3NC8A 3DWKA 4LV0A 2XD5A 1WYCA 3NCKA 1CI9A 2J9PA 4HEFA 4LENA 3FKVA 4KQQA 4BQMA 5FI2A 2EXBA 2IWDA 1U60A 3OZHA 1JVJA 3JYIA 2ZM8A 4PPRA 1GA0A 2DCFA 1ES4A 5KZHA 2Y2HA 1EROA 4B88A 3UN7A 4DE2A 4UA9A 4OP5A 5D3OA 5FQ9A 1SDNA 2HDUA 2ZC5B 3VP3A 4WELA 3G4PA 1BT5A 1K55C 4KG5A 4Z9QA 4L0LA 4Y0OA 4EQIA 4DRTA 2ZC3B 2XQZA 4KZ6A 4RVAA 3A3FA 2OV5A 4P87A 1PWCA 1ERQA 3ZNTA 4OH0A 3N8LA 5A91A 5FAOA 3N8RA 2JE5A 1Y54A 4OQ0A 1K57C 1SCWA 3QNCA 4BENA 3SS4A 4K0WA 2H0YA 1PYYA 4H8RA 3IWQA 2XFSA 5F1FA 4KZAA 2Y59A 4XUZA 3MBZA 5FA7A 4S2JA 2Y2LA 4U0TA 3G30A 3MZDA 5FQIA 5FSRA 1JWPA 4JLFA 4C6YA 5EOEA 3V3SA 1HD8A 1L0FA 1KE4A 1H8YA 2Q9NA 1LHYA 3NI9A 1EI5A 1LL9A 1HTZA 3G2YA 2V1ZA 2EX6A 5EPHA
chains in the Genus database with same CATH superfamily
1YSPA 3FV7A 3EGDC 5G18A 3S7PA 4A5RA 4IVKA 1N9BA 1OTBA 4O01A 3EEAA 3LGOA 4IJGA 3SW1A 1NJ4A 4BLMA 4XT2B 3F1PA 2OWHA 4JF4A 1MPLA 3SS5A 3OPHA 5EE8A 3HLFA 1STZA 2WKHA 2PYPA 3OCNA 2H28A 1W8QA 4BWIA 5EFWA 2V1AA 5E2FA 5L2FA 2KX6A 1XJ4A 4CLCE 4KZ7A 4OQHA 5L07A 2DMWA 2WKPA 3UB8A 4GDBA 5EV0A 3PBQA 2ZBBA 5AQ9A 2ZL1B 4MNRA 5FATA 3U2AA 1GSWA 1S4RA 3LY3A 4QU3A 1VETA 4OPRA 1F98A 4ETXA 3IBJA 3BLSA 3ZG9B 3PBNA 1IYOA 4DF6A 3MJQA 3IHBA 4D60A 1MWSA 4N9KA 2GNXA 3HUNA 3PTEA 4KZ5A 1DJBA 3IS2B 2WGWB 3IWOA 3P98A 3H9WA 4R0QA 5DJTA 3VOZA 4OOYA 2V2FF 1RGZA 3C2WA 4R23A 4YFMA 1KE0A 1ES2A 4F3LB 3T4QA 1W8YA 1YLYA 4OQGA 3G2ZA 5GLAA 3UE1A 3VSLA 1K55A 2R78A 1ZHHB 2Y2JA 1Z6FA 2QYBA 2G2UA 3O3VA 4MCWA 1E3UA 4OPQA 1T1CA 3CI6A 4OQIA 3FPVA 2RL3A 1M40A 2HP6A 5K5BA 1VM1A 2FZ0A 4IBXA 5M19A 1XX2A 3BFEA 1Y4OA 3ISGA 3UE0A 1XJ6A 2BG1A 3ZG5A 2XSSA 4EBPA 2ZM0A 2D01A 3WS2A 3HCYA 4GDNA 2H5SA 1H5XA 3UB6A 4OONA 1LL8A 4AFIA 1WYBA 3HLEA 3LFVA 5EM0A 3O86A 1YPRA 3KO6A 1P0ZA 3WS1A 5A92A 2XH9A 3JVUA 1XP4A 1I2WA 1UWPX 3ZG8B 2EWVA 4U3TA 1GSVA 4N92A 2GDNA 4RQ9A 1F5MA 2VV8A 4JGRA 3U4LP 1JNUA 5LBRA 5HWWA 2M7UA 2KDKA 4GNUA 1SHVA 3K3DA 2B02A 2OSUA 3Q81A 4JXSA 4IHQA 2W1TA 4HH3A 3E98A 3D4FA 4JBFA 3NOPC 4XXRA 3ZVTA 3P01A 5CGXA 3UB9A 3WS0A 4JKTA 3IQAA 1HVBA 2EFXA 2JKGA 3WWXA 3OC2A 1RP5A 4GD6A 3ZG7B 3MFXA 1NZUA 1S1YA 1IOUA 3PAGA 2PU2A 3CPTB 4GB7A 1S66L 3CG5A 4OOMA 2Z6CA 3ZYTA 3FZCA 5CEDA 4EBLA 5FL3A 4ARZB 3LEZA 4IUKA 4ZJ2A 3KSGA 1IKGA 2IWCA 2FH5A 4DE0A 2X02A 3KSFA 4OOLA 5F68A 1TDGA 1F9IA 2ZQ7A 4EWFA 1OTAA 3ZHHA 3M6BA 3VP2A 1N9OA 1IKIA 3IX4A 5DJUA 3Q7ZA 4ZBEA 4JXWA 5FI6A 3RJUA 1VETB 4Y3IA 4P0MA 1GCEA 2HF6A 4MEZA 5FDHA 4NXGA 3LYXA 3TJZC 3NOTC 3T4KA 5TFQA 5FEFA 1O7EA 2HV1A 2EA9A 5CHMA 2Y2NA 3IBRA 3C7UA 3OOVA 1T1BA 4HESA 2Y55A 1BLCA 2P9VB 4WEJA 3WRZA 3DTEA 3EOIA 3M2KA 4KZ4A 4K0XA 1W63Q 1E3UD 4O7DA 3BFDA 4L9EA 1KDSA 3TOIA 3PBOA 3LCEA 2Y2IA 5GLBA 3S22A 1FSYA 3VSKA 3ZQ5A 1PNEA 4Y7PA 3AGEA 4CQHA 1G68A 2V0UA 1DJCA 4DKIA 1SKOB 5HX9A 3H82B 1TDLA 4GD8A 1ESIA 3GVBA 3NDEA 1N4OA 4BMWA 4NK3A 3MKFA 4PM8A 1KOUA 2W27A 3BRMA 2L0WA 1O07A 4CLCB 1GHMA 3E2KA 3PYPA 3HLDA 4CLCD 2W3GA 1PFLA 3W2ZA 2WADA 4JXVA 2Y8HA 3LI9A 5F82A 3DWKA 3NCKA 1N9NA 4G3WA 4BQMA 2ZM8A 2J3WA 2IA2A 2VA0A 4B88A 3UN7A 5D3OA 1SDNA 2HDUA 2J3TD 1BT5A 3T4SA 3UMEA 4Y0OA 4EQIA 2XQZA 4RVAA 1DP9A 3A3FA 3LR4A 1PWCA 2ACGA 3FPWA 1UWNX 5FAOA 1VEUB 3L9KA 4M4XA 2PD7A 4BENA 4HIAA 4K0WA 3MF0A 2XFSA 2Y59A 4XUZA 1VEUA 3MZDA 1OTDA 1JWPA 4JLFA 5EOEA 3FC7A 1DP8A 2Q9NA 1FILA 1LHYA 3NI9A 1HLUP 2D02A 3G2YA 4E3JA 4RYEA 1V9YA 3W4QA 4WZ5C 4GOGA 4IUHA 1WA9A 3BWLA 1MBLA 3ZVWA 1PRQA 3OCLA 5GHZA 5CHJA 2OOLA 1T19A 3LIBA 1IYSA 2ZC7A 3HL9A 3UNWA 3P09A 4O0PA 3ZG0A 3WS4A 3D3OA 3LUQA 4EEUA 4RA7A 3G31A 3GV9A 4LV3A 3NBLA 1XA1A 1IELA 5KIZA 3DBAA 2GJ3A 4E04A 5FEGA 5CECA 5AVFA 2WKRA 5TBMA 1Q2QA 4LRZE 2P9VA 3F1NA 5J4EA 1PZOA 2FFFB 4HI4A 3LIFA 3EQUA 4EW7A 1ZG4A 1XGJA 5HL1A 1MKIA 2KOIA 1H3QA 1EWZA 3VP0A 1YLTA 4PKYG 1YM1A 2PD8A 3OLOA 4HBTA 1W63M 5HZHA 2OAQ1 4X68A 4UEYA 2QHKA 3D72A 2WKEA 4LCMA 4N9LA 3C4OA 3GDIA 4E6WA 4D2OA 5DTSA 2EX9A 4UQIM 3UDIA 4EUZA 2I72A 3N7WA 3F1OB 4QY5A 4L9GA 4DXCA 4Q0IA 5A93A 3UE6A 3A0RA 3LI8A 1GA9A 1YKDA 5DF8A 1L3LA 2O9BA 1MC0A 2L4RA 3R7WB 1BUEA 3M2JA 4DJ2A 2XA7M 2VGKA 3MSHA 4MBFA 3MQQA 1SKFA 1RGYA 1RCJA 1T1AA 4E6XA 1TD5A 1CEGA 1ONHA 3RXXA 1K54C 3F1NB 2B95A 5A90A 3Q7VA 2CMNA 5TBMB 2K31A 2JKTI 5KSCA 2C5WB 1E25A 1MXOA 1JTDA 2HP5A 4E3NA 4JF6A 5F83A 3T1RA 5FQKA 2YKFA 3B3XA 5HDDA 2Z2MB 1FQGA 4X56A 1DRMA 1G28A 3F1PB 1C3BA 4LPZA 5DTKA 5AVEA 5HDSA 1I2SA 4NXEA 3IWIA 4IEDA 4YOFA 2FFYA 4WZ4A 3S1YA 3R7WA 4UA7A 3QP6A 2ZQ9A 3IF6A 2OLUA 5CTNA 3BECA 1NY0A 4WF0A 3T4JA 1MZUA 4RX2A 4MDZA 4PM5A 2JN7A 5E2HA 4C3QA 3ITBA 3MXRA 1KVLA 2EX2A 5CGSA 3BJNA 4QY6A 1QMFA 4L9FA 1NZOA 1TS8A 1XPBA 5HL6A 1LT0A 3E2LA 2ZOIA 3T4OA 3CITA 4NEED 4X1LA 2M1CA 1YLJA 5EVID 4Q8IA 2GX5A 2QPNA 4U0XA 5CRFA 4B4ZA 3V50A 4MBKA 3KSHA 3MQOA 5F1GA 4P6BA 1BTLA 5GHYA 4WMCD 2G2WA 3S7NA 5EVIC 4DJ3A 1ZTUA 2ZOHA 3IXHA 4FCFA 2XRNA 2WZZA 4CLCC 2A49A 2DRWA 3T1QB 3MXSA 1KGEA 4NG2A 4KZ9A 3Q7VB 4I3IA 4HJ3A 2WKQA 1K25A 4KUKA 1CEFA 5CERA 3BFCA 3ITAA 2OLVA 4GJ4A 1Q2PA 3KX0X 3QP5A 1ERMA 4ME4A 4HOIA 3MZEA 4R1GA 3UE3A 5DFYA 1K56D 1FCNA 2WZXA 5U47A 2WGVA 3PHYA 4S2MA 4Y13A 1MWUA 4B9OA 4F3LA 5F5YA 2X01A 2WGIA 2VZWA 4FTXA 1ESUA 1FCOA 4E3KA 4ESPA 3UPNA 2P04A 3Q82A 4Y17A 3B33A 1ZG6A 4ZJ3A 2Y2OA 4E3LA 1GHPA 3T1XA 1KGFA 1UGUA 3T4LA 2RCXA 2V0WA 1LI0A 3BM6A 2PBDP 4HQAA 2BASA 2ZQDA 3HLWA 4CPKA 1S1ZA 3HUMA 4JXGA 5GL9A 4YINA 5E2GA 4BJPA 2EWWA 2OAP1 1EW0A 3UMDA 2B18A 2HDSA 5IU1A 3OPLA 3C4PA 2PBYA 2PAVP 3VE3A 5IS1A 5IHVA 4BD0A 4OPYA 5J7EA 4OLDA 5HPIA 4F94A 3OPRA 2ZJ9A 3VOYA 1ONGA 1BLHA 1OTIA 2XD5A 3T4TA 2J9PA 4HEFA 1OPXA 3BQAA 1JVJA 2A2LA 4H6JA 2Y2HA 2INWA 3MQ0A 5J3WA 4UA9A 4OP5A 5FQ9A 3VP3A 1TS6A 3NHQA 1TS7A 3NJAA 2V9AA 2ZC3B 2VGLS 2PRFA 1OJ5A 2ZMFA 2OV5A 4R38A 2JKTM 5A91A 3A0VA 2JE5A 3QNCA 1SCWA 3PXPA 2QKPA 2H0YA 4LFUA 2YKHA 3RFBA 3KYQA 5FA7A 4DMZA 4HP4A 2Y2LA 3LIEA 1HD8A 1L0FA 3TE8A 3MXQA 2PYRA 2V1ZA 4R6LA 2VV7A 3HREA 4WLAA 3BFGA 3MS6A 4FUWA 1P9WA 2HDRA 4UA6A 5AQBA 4OP8A 3PAEA 3MKEA 2O9AA 4E3OA 2B5RA 5CGWA 1D06A 2E8IA 1LSWA 2W3EA 3HLBA 4P6ZS 2ZD8A 2Y2MA 3MZFA 2W1TB 3PBTA 3E0YA 1I5QA 3LY4A 1H0MA 5DF7A 4BBVA 5TJJA 4HP9A 3LR3A 3A3IA 3GECA 3EQVA 4KZ8A 5FAPA 4B4XA 4M3KA 4Q0HA 1MWRA 1DY6A 3ZNYA 1L2SA 2A24B 1GHIA 3IHAA 5HPFA 1PW1A 5C5KA 1NRFA 4RX3A 1MKMA 4DXBA 3NIAA 4QWOA 3MMHA 4GZBA 4R70A 3D9YA 1SDEA 2XF3A 1ZC2A 2ZMAA 4FSFA 4ZTKA 4K08A 2HGVA 1S0WA 2W0NA 3HVFA 2UWXA 5IT5A 3IH8A 3TSGA 4E3MA 1K4FA 1FCMA 1W79A 3IT9A 4DE3A 3DWZA 5HAQA 2EX8A 1J3WA 1BULA 5DKKA 2XD1A 3BYDA 4S2IA 5HD3A 5HSQA 4JPMA 3IF6C 1MWTA 4X25A 5FDSA 3CJMA 1LSXA 2PU4A 1AXBA 5EUAA 5GLDA 3S7OA 1N9LA 2HDQA 2BLSA 2OWJA 3FKWA 1XJ2A 3KSIA 4KZ3A 3IF6B 1PI5A 2V1BA 2Y4AA 4EV4A 5EVIB 4ETZA 1OMEA 2W1RA 3C30A 3N4IA 2VLGA 4FD8A 4OVDA 3AGFA 4LGWA 4I3AA 1K0KA 5AQ7A 4LV1A 4K91A 3RTYA 1LL5A 3A3DA 2HPBA 1JTGA 5DFXA 1K54A 3UDFA 4PM6A 3G32A 4JGPA 5L09A 2XDMA 1CK3A 3O87A 2XR0A 1S4SA 2Q9MA 3ZCZA 4X1MA 4MN5A 2PR6A 5HDCA 1FIKA 2ZQ8A 3H7WA 3CMZA 4ZAMA 3W4OA 2KLIA 5FQMA 4HNBA 1ODVA 4UAAA 2WYXA 4MMNA 2W3FA 3TRCA 2ZC4B 3C5AA 1AWIA 1JWVA 3VFHA 4YNRA 1KE3A 2Q0OA 2R9WA 3BY8A 3HUOA 3EGXC 2ZC6B 2WAEA 4HH2A 3UPOA 5M1AA 3NY4A 1FSWA 1LLBA 5EVIA 5EVEA 4DDSA 4BL2A 4XT2A 4EUVA 3TG9A 2G7UA 5AJGA 1DP6A 4PHTA 4S2PA 1XGIA 4G3KA 1FR6A 1KGGA 1CJFA 3B47A 3DW0A 3FG8A 3CUEA 2ZMVA 1PI4A 4EBNA 5TR7A 2JHEA 4ID4A 5JYPA 3GMWA 1PWGA 4B93A 5I5LA 4S2NC 3S4XA 3BW6A 2XLNA 4WN5A 4GS9A 2V8CA 4NKPA 3CZDA 4X53A 3SH9A 1M6KA 4LV2A 4QJGA 1PWDA 3L7HA 3HJIA 4LLOB 1K6SA 1XFNA 1DJAA 3IXDA 5F69A 4KENB 3CUEC 4BBUA 5HFOA 2IWBA 5L8MA 5EVLA 2LB9A 4IVIA 4R3JA 2Y2QA 1L0DA 2CC1A 2PR5A 2VKSA 1WE4A 3V39A 4OKPA 1S67L 4ZRRA 4YWZA 3DTIA 4MN6A 3E4PA 1XJ3A 4S2KA 2H0TA 3V67A 3R4KA 4WBGA 5HD5A 3QNBA 3GTCA 4CLCA 4E3IA 4LRYC 5J8XA 2DNSA 3V3RA 4O8GA 5EOOA 2WK0A 3HLGA 4UHUA 2E8JA 3RXWA 2Y2GA 3UY6A 1YLZA 1OTEA 4QD4A 2VEAA 3I7JA 1TVFA 4Y2FA 2M7VA 1IYPA 5MC7A 1NLYA 4OLGA 1PW8A 2QMIA 2ZQAA 3GRJA 4KQOA 3LIDA 3UPPA 4IBRA 2VGLM 2J80A 3P7NA 2Z6DA 5CX7A 5EECA 4LV0A 2HZ5A 1WYCA 1OJGA 4KQQA 2GZAA 2IWDA 4PPRA 3KYZA 3S7QA 1X0OA 1GA0A 2DCFA 1SKOA 3MR0A 1EROA 4DE2A 3QP2A 4G3VA 4Z9QA 4DRTA 4P87A 2J3TC 3ZNTA 3OBFA 2JKRM 5F6AA 4OQ0A 2PDRA 1PYYA 4H8RA 1CQAA 3EEHA 5F1FA 4KZAA 1G5UA 1TF1A 3TW8A 1F2KA 4EERA 4S2JA 3UB7A 4U0TA 2LB5A 5FQIA 5FSRA 4DN0A 2BTFP 1H8YA 4Q0JA 1EI5A 1HTZA 1BZAA 3ZGAB 2P08A 1TS0A 4PMAA 4JF5A 1A0KA 5DKLA 2VV6A 3PR6A 5CTMA 1YSQA 3CHWP 1K6RA 2XGNA 4II7A 1MY8A 3GSGA 5KMWA 1YT4A 2AVXA 3BQ8A 1P9RA 1PIOA 4WMCA 3OPPA 2O9CA 4GS9B 2QJ5A 1FR1A 5L10A 4QPRA 2JKRI 5HW3A 3W4PA 4FOFA 3KYEA 5HARA 5EM1A 3MFDA 2J7VA 3BLMA 2VJWA 1BLSA 3BFFA 3V5MA 4UQIS 5FI7A 3N6IA 1KVMA 1H8ZA 1CI8A 2Y2PA 2Y2KA 4C75A 3LO7A 4EU0A 3G34A 3JVVA 2VGJA 2EXAA 5BOHA 4WZ5A 3CPTA 3SZTA 3HLCA 3VE4A 1W7FA 3K3CA 1XXMA 2V20A 4MLLA 5JYOA 1NRJA 2W3DA 3QP1A 4ARZA 3CWFA 3GQZA 2EFUA 3UO9A 1YLPA 2K2NA 3LEQA 1L0EA 1NWZA 1GSXA 4OPZA 2P7JA 4KQDA 3E4QA 4ZDXA 5DTTA 1K4EA 4N1XA 1YMXA 4GLQA 2H10A 4X6TA 5FQQA 1ALQA 2P74A 5TGFA 1BLPA 4I5SA 4P85A 5M18A 4FH4A 4I38A 3WS5A 3C7VA 1K57A 5FASA 3VP1A 3SS3A 1YAXA 3QP8A 2O0YA 4NXFA 5AQAA 4NETA 4CJNA 2ZQCA 3G6OA 4HHDA 3SH8A 4Y5FA 2QJ7A 5E43A 3IX8A 1IYQA 3CAXA 3IS2A 3O5YA 1BYWA 1NYYA 1Z09A 1D1JA 4HBUA 5G4YA 4WUJA 4R4RA 4X55A 2NUPC 4LCLA 4S2NA 1XA7A 3H7WB 3CLOA 4EETB 1XKZA 2Y79A 4MBHA 1P97A 3NDGA 5HAIA 1QMEA 1IFQA 2V8FA 2WKIA 3LICA 3VOLA 1L0GA 1ZKJA 3VMAA 1CF0A 1K38A 3K2NA 4KQRA 4GKUA 4X69A 4GCZA 2Y91A 3B42A 4KUOA 3IXBA 3ZDJA 3M6HA 3SOIA 3FYZA 4PM7A 3LR5A 4LRXC 4R4SA 4DDYA 4Y0TA 3IF5A 3SH7A 4PM9A 3A0SA 3A3JA 3VFFA 3VP4A 2WAFA 5CXWA 1J9MA 2ZM2A 4EEPA 2WGWA 1NYMA 3GR2A 3ICYA 2XA7S 3T50A 4EESA 1NLZA 4MN7A 2XROA 3QHYA 1W5DA 2XK1A 4QB8A 1D7EA 4KG2A 1IEMA 5E2EA 1LSVA 2J9OA 3T1SA 4GN2A 3C38A 1VHMA 1Y28A 4GW9A 3NECA 5HWTA 4EQ1A 3W8KA 3DTMA 2ZL1A 1LI9A 4BBTA 2HJ9C 4S2OA 2L1MA 1KDWA 5FQJA 4HY8A 2JCHA 3T12B 2Z2LB 1T18A 3F1OA 1YMSA 4WL9A 4EXOA 1TEMA 4WM9A 3EWKA 1PZPA 1ACFA 4WEKA 2QZ6A 2XFTA 1VB6A 4S2LA 2HP9A 3N8SA 2JBFA 4KZBA 3VV4A 2A3UA 1H8MA 5GHXA 1K56A 3DTKA 4JGQA 1FOFA 3IXGA 1YLWA 1VQQA 2W3HA 3PBRA 3HBRA 3Q1FA 4XUXA 5DVAA 3AGDA 4WYYA 5A8BA 1NXYA 2C6WB 5CEBA 5FAQA 4GHIA 4P6ZM 2HJEA 2JC7A 3A3EA 2JKFA 2X71A 3ZFZA 4Y0UA 3Q07A 4BL3A 3HJKA 3LR0A 3C8CA 3BEBA 1G6AA 5HWVA 2XEPA 4FH2A 4R3BA 1BSGA 3UB5P 3PBSA 1G6OA 4PAUA 1YQSA 4I3JA 4ZJ1A 2R9XA 1SZVA 1JWZA 1V9ZA 5G4ZA 4HJ6A 3WRTA 2A24A 4GHIB 3IH9A 2WUQA 4KG6A 4DE1A 1E4DA 4JGOA 5CHUA 1ES5A 2QWSA 2NUTC 5HAPA 2O99A 5GLCA 2ZLYA 4Y15A 3JPUA 5KSHA 1OT6A 3G35A 3O88A 2PHYA 4BD1A 5DF9A 1ES3A 1S6RA 4N1HA 4QHCA 3UDXA 3FWLA 3ULFA 3DAVA 5I94A 3BY9A 1HZOA 2J8YA 3NC8A 1CI9A 2I9VA 4I39A 4LENA 3FKVA 5FI2A 2EXBA 4Z1WA 2PT7A 1U60A 3OZHA 3JYIA 1ES4A 2VX8A 5KZHA 4PKYA 3RH8B 2ZC5B 4WELA 3G4PA 1XFQA 1K55C 4KG5A 4L0LA 3LIAA 4KZ6A 4H6JB 3E4OA 3NOUC 1ERQA 4OH0A 3N8LA 2VK3A 3N8RA 1Y54A 3IX3A 1K57C 4HJ4A 3SS4A 3IWQA 4NXBA 3H82A 3MBZA 3G30A 2MJ6A 4R3AA 3QP4A 1OT9A 4C6YA 3V3SA 1KE4A 2UV0E 2K7SA 3NULA 1LL9A 2EX6A 5EPHA
chains in the Genus database with same CATH topology
3FV7A 5G18A 1BZAA 3HREA 3W4QA 3ZGAB 4IVKA 4GOGA 4WZ5C 4A5RA 1N9BA 3BFGA 2HDRA 4UA6A 5AQBA 4OP8A 4PMAA 1MBLA 4JF5A 3PAEA 1NJ4A 3MKEA 3ZVWA 4BLMA 4E3OA 2B5RA 5CTMA 1K6RA 5CGWA 3OCLA 5GHZA 2E8IA 5CHJA 2XGNA 4JF4A 1MPLA 3SS5A 1MY8A 3OPHA 1IYSA 2ZC7A 3HLBA 3HLFA 3GSGA 3HL9A 5EE8A 3P09A 2WKHA 3UNWA 5KMWA 1YT4A 2ZD8A 2Y2MA 3MZFA 3ZG0A 3WS4A 3OCNA 1PIOA 3PBTA 1W8QA 1I5QA 3LY4A 4WMCA 5E2FA 5L2FA 5DF7A 3OPPA 4KZ7A 3A3IA 4OQHA 4RA7A 3G31A 3GV9A 4GDBA 3EQVA 4LV3A 3NBLA 1FR1A 4KZ8A 5FAPA 1XA1A 5HW3A 3W4PA 1IELA 4B4XA 4M3KA 1MWRA 5HARA 3MFDA 1DY6A 3ZNYA 2J7VA 1L2SA 3PBQA 3BLMA 1GHIA 3IHAA 5AQ9A 5CECA 1BLSA 1PW1A 3BFFA 3V5MA 4MNRA 1Q2QA 1NRFA 2P9VA 5FATA 4RX3A 4DXBA 3NIAA 1PZOA 3LY3A 5FI7A 3N6IA 4GZBA 2FFFB 4QU3A 3EQUA 1ZG4A 1XGJA 5HL1A 1SDEA 2XF3A 4OPRA 1ZC2A 1MKIA 2ZMAA 3BLSA 1KVMA 4FSFA 3ZG9B 4ZTKA 1H8ZA 1EWZA 3VP0A 1CI8A 3PBNA 1S0WA 2Y2PA 3HVFA 1YLTA 2Y2KA 2UWXA 1IYOA 4C75A 3LO7A 1YM1A 4DF6A 3G34A 3IHBA 3IH8A 3TSGA 4E3MA 4C3QA 1K4FA 2EXAA 1FCMA 2VGJA 1W79A 3IT9A 5BOHA 4HBTA 1MWSA 4WZ5A 4N9KA 3HLCA 3HUNA 3PTEA 4X68A 4DE3A 4KZ5A 1DJBA 1W7FA 2WKEA 3DWZA 5HAQA 2EX8A 2WGWB 1XXMA 2V20A 1BULA 3IWOA 3P98A 4LCMA 4MLLA 4N9LA 3C4OA 4R0QA 5JYOA 3VOZA 2XD1A 3BYDA 4OOYA 4S2IA 4E6WA 4D2OA 2V2FF 5DTSA 2EX9A 3UDIA 1RGZA 4EUZA 4R23A 2I72A 4JPMA 4YFMA 1KE0A 1MWTA 3IF6C 3N7WA 3CJMA 2PU4A 1ES2A 1AXBA 3GQZA 2EFUA 5EUAA 3UO9A 1YLPA 4QY5A 5GLDA 1L0EA 1W8YA 4DXCA 1YLYA 2HDQA 4OPZA 4OQGA 3G2ZA 5A93A 5GLAA 2BLSA 3UE1A 1GA9A 4ZDXA 5DF8A 5DTTA 1K4EA 3FKWA 1K55A 4N1XA 3VSLA 4KZ3A 3IF6B 1PI5A 1YMXA 2Y2JA 1Z6FA 3O3VA 2G2UA 2H10A 1E3UA 4OPQA 4X6TA 5FQQA 1ALQA 2P74A 2Y4AA 1BLPA 5TGFA 4OQIA 4P85A 1BUEA 3M2JA 4EV4A 5M18A 2RL3A 5EVIB 1M40A 2HP6A 4FH4A 2VGKA 1VM1A 1OMEA 4IBXA 5M19A 3WS5A 1XX2A 3C7VA 3N4IA 4MBFA 1K57A 4FD8A 4OVDA 3AGFA 3BFEA 1SKFA 5FASA 5AQ7A 1RGYA 1RCJA 3ISGA 4K91A 4LV1A 1LL5A 3A3DA 3SS3A 3UE0A 2HPBA 3VP1A 4E6XA 1JTGA 2BG1A 3ZG5A 1CEGA 1ONHA 5AQAA 3RXXA 1K54C 4NETA 1K54A 3UDFA 4CJNA 4PM6A 5A90A 4EBPA 2ZM0A 3Q7VA 3G32A 2ZQCA 3WS2A 3SH8A 5KSCA 4GDNA 2H5SA 1H5XA 2XDMA 4OONA 5E43A 1IYQA 2C5WB 1CK3A 1WYBA 3HLEA 1E25A 3O87A 1MXOA 2XR0A 1JTDA 2Q9MA 1NYYA 4HBUA 3ZCZA 2HP5A 4E3NA 3O86A 4R4RA 4X55A 4LCLA 4S2NA 1XA7A 4JF6A 1XKZA 5F83A 4MBHA 3NDGA 3WS1A 5FQKA 3B3XA 5HAIA 1QMEA 5A92A 2XH9A 2WKIA 1L0GA 1ZKJA 2Z2MB 1FQGA 3VMAA 1K38A 1I2WA 1XP4A 2ZQ8A 4X56A 4KQRA 4GKUA 4X69A 1C3BA 3CMZA 4ZAMA 3ZG8B 3W4OA 2Y91A 4U3TA 5DTKA 4N92A 2GDNA 5FQMA 1I2SA 3IWIA 4IEDA 4UAAA 2WYXA 2FFYA 4WZ4A 3S1YA 3IXBA 4UA7A 2ZQ9A 3IF6A 2OLUA 3ZDJA 2ZC4B 5CTNA 3BECA 1NY0A 3C5AA 3M6HA 3SOIA 1JWVA 3VFHA 3FYZA 4RX2A 4PM7A 4PM5A 1KE3A 5E2HA 4R4SA 4DDYA 4Y0TA 3IF5A 3SH7A 2R9WA 3ITBA 3MXRA 4GNUA 1KVLA 3A3JA 3HUOA 4PM9A 2ZC6B 1SHVA 2WAEA 2EX2A 5CGSA 3VFFA 4QY6A 3UPOA 5M1AA 3VP4A 2WAFA 1QMFA 2OSUA 3Q81A 4JXSA 3NY4A 5CXWA 1J9MA 2ZM2A 3D4FA 1FSWA 4JBFA 1NZOA 2WGWA 4XXRA 1LLBA 3ZVTA 5CGXA 1NYMA 5EVIA 3WS0A 1XPBA 3GR2A 3IQAA 4JKTA 1HVBA 4DDSA 4BL2A 2EFXA 3E2LA 3TG9A 3WWXA 3OC2A 1RP5A 4GD6A 3ZG7B 1NZUA 3PAGA 2PU2A 4S2PA 1XGIA 1YLJA 5EVID 4Q8IA 4GB7A 3QHYA 1FR6A 1KGGA 2QPNA 1W5DA 2XK1A 3CG5A 4OOMA 4U0XA 4QB8A 5CRFA 3DW0A 3FZCA 4MBKA 3V50A 4B4ZA 5CEDA 5F1GA 4P6BA 4KG2A 1IEMA 5E2EA 1BTLA 1PI4A 4WMCD 5GHYA 4EBNA 2G2WA 4EBLA 5EVIC 5TR7A 3LEZA 2J9OA 4GN2A 4ZJ2A 1IKGA 2IWCA 3IXHA 4ID4A 4DE0A 4FCFA 5JYPA 2X02A 2WZZA 3GMWA 1PWGA 4OOLA 2A49A 2DRWA 3W8KA 3DTMA 3MXSA 1LI9A 1TDGA 4S2NC 3S4XA 2ZQ7A 1KGEA 4EWFA 4S2OA 4KZ9A 3ZHHA 3Q7VB 2XLNA 1KDWA 5FQJA 3M6BA 3VP2A 1K25A 1IKIA 2JCHA 3Q7ZA 1CEFA 2Z2LB 5CERA 4ZBEA 1YMSA 3BFCA 4JXWA 1TEMA 3ITAA 5FI6A 2OLVA 3RJUA 3CZDA 4WM9A 4X53A 3SH9A 1M6KA 1Q2PA 4LV2A 4QJGA 1PZPA 4P0MA 1GCEA 1PWDA 4WEKA 1K6SA 4MEZA 5FDHA 1ERMA 2QZ6A 1DJAA 3IXDA 2XFTA 5TFQA 4KENB 4RYEA 3MZEA 4S2LA 1O7EA 4R1GA 3UE3A 2HP9A 1K56D 1FCNA 3N8SA 2WZXA 2Y2NA 5CHMA 5HFOA 5U47A 2WGVA 2JBFA 2IWBA 4S2MA 4KZBA 1MWUA 2A3UA 3C7UA 5EVLA 4IVIA 5GHXA 1K56A 4R3JA 2Y2QA 1L0DA 2CC1A 1FOFA 3IXGA 4HESA 1YLWA 2Y55A 1VQQA 2X01A 1WE4A 2WGIA 1BLCA 3HBRA 3PBRA 2P9VB 3Q1FA 4WEJA 4XUXA 5DVAA 3AGDA 4WYYA 1ESUA 1FCOA 4OKPA 3V39A 1NXYA 2C6WB 3WRZA 4E3KA 5CEBA 5FAQA 3UPNA 3M2KA 3Q82A 4S2KA 4KZ4A 4K0XA 1ZG6A 2H0TA 4ZJ3A 4O7DA 1E3UD 2JC7A 2Y2OA 3A3EA 3BFDA 3TOIA 1KDSA 4WBGA 2X71A 4E3LA 1GHPA 3ZFZA 3PBOA 4Y0UA 3LCEA 2Y2IA 3Q07A 4BL3A 3QNBA 1KGFA 3GTCA 5GLBA 3S22A 1FSYA 4E3IA 2RCXA 3BEBA 1G6AA 3VSKA 1LI0A 3BM6A 5J8XA 2DNSA 2XEPA 4FH2A 3AGEA 4Y7PA 3V3RA 2ZQDA 4E3JA 1G68A 4R3BA 1BSGA 3HLWA 4CPKA 5EOOA 3PBSA 1DJCA 3HUMA 4DKIA 2WK0A 4JXGA 5GL9A 1YQSA 5HX9A 4ZJ1A 4YINA 2R9XA 5E2GA 1TDLA 1JWZA 4GD8A 3HLGA 4UHUA 4BJPA 3RXWA 1ESIA 3GVBA 3NDEA 2Y2GA 3UY6A 3WRTA 1N4OA 3IH9A 1YLZA 2WUQA 4NK3A 4KG6A 4DE1A 1E4DA 3MKFA 4QD4A 5CHUA 1ES5A 4PM8A 3I7JA 2HDSA 3BRMA 3OPLA 5HAPA 3C4PA 5GLCA 2PBYA 2ZLYA 1TVFA 5IHVA 1IYPA 5KSHA 1O07A 4OLGA 1PW8A 4BD0A 3G35A 4OPYA 2QMIA 2ZQAA 3O88A 1GHMA 3E2KA 3GRJA 4KQOA 3HLDA 4OLDA 4BD1A 5DF9A 1ES3A 1S6RA 3UPPA 4N1HA 4IBRA 4QHCA 4F94A 3UDXA 3FWLA 5I94A 2WADA 3OPRA 4JXVA 1HZOA 2ZJ9A 3VOYA 2J8YA 1ONGA 1BLHA 5EECA 5F82A 3NC8A 3DWKA 4LV0A 2XD5A 1WYCA 3NCKA 1CI9A 2J9PA 4HEFA 4LENA 3FKVA 4KQQA 4BQMA 5FI2A 2EXBA 2IWDA 1U60A 3OZHA 1JVJA 3JYIA 2ZM8A 4PPRA 1GA0A 2DCFA 1ES4A 5KZHA 2Y2HA 1EROA 4B88A 3UN7A 4DE2A 4UA9A 4OP5A 5D3OA 5FQ9A 1SDNA 2HDUA 2ZC5B 3VP3A 4WELA 3G4PA 1BT5A 1K55C 4KG5A 4Z9QA 4L0LA 4Y0OA 4EQIA 4DRTA 2ZC3B 2XQZA 4KZ6A 4RVAA 3A3FA 2OV5A 4P87A 1PWCA 1ERQA 3ZNTA 4OH0A 3N8LA 5A91A 5FAOA 3N8RA 2JE5A 1Y54A 4OQ0A 1K57C 1SCWA 3QNCA 4BENA 3SS4A 4K0WA 2H0YA 1PYYA 4H8RA 3IWQA 2XFSA 5F1FA 4KZAA 2Y59A 4XUZA 3MBZA 5FA7A 4S2JA 2Y2LA 4U0TA 3G30A 3MZDA 5FQIA 5FSRA 1JWPA 4JLFA 4C6YA 5EOEA 3V3SA 1HD8A 1L0FA 1KE4A 1H8YA 2Q9NA 1LHYA 3NI9A 1EI5A 1LL9A 1HTZA 3G2YA 2V1ZA 2EX6A 5EPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FV7 A;  5G18 A;  1BZA A;  3HRE A;  3W4Q A;  3ZGA B;  4IVK A;  4GOG A;  4WZ5 C;  4A5R A;  1N9B A;  3BFG A;  2HDR A;  4UA6 A;  5AQB A;  4OP8 A;  4PMA A;  1MBL A;  4JF5 A;  3PAE A;  1NJ4 A;  3MKE A;  3ZVW A;  4BLM A;  4E3O A;  2B5R A;  5CTM A;  1K6R A;  5CGW A;  3OCL A;  5GHZ A;  2E8I A;  5CHJ A;  2XGN A;  4JF4 A;  1MPL A;  3SS5 A;  1MY8 A;  3OPH A;  1IYS A;  2ZC7 A;  3HLB A;  3HLF A;  3GSG A;  3HL9 A;  5EE8 A;  3P09 A;  2WKH A;  3UNW A;  5KMW A;  1YT4 A;  2ZD8 A;  2Y2M A;  3MZF A;  3ZG0 A;  3WS4 A;  3OCN A;  1PIO A;  3PBT A;  1W8Q A;  1I5Q A;  3LY4 A;  4WMC A;  5E2F A;  5L2F A;  5DF7 A;  3OPP A;  4KZ7 A;  3A3I A;  4OQH A;  4RA7 A;  3G31 A;  3GV9 A;  4GDB A;  3EQV A;  4LV3 A;  3NBL A;  1FR1 A;  4KZ8 A;  5FAP A;  1XA1 A;  5HW3 A;  3W4P A;  1IEL A;  4B4X A;  4M3K A;  1MWR A;  5HAR A;  3MFD A;  1DY6 A;  3ZNY A;  2J7V A;  1L2S A;  3PBQ A;  3BLM A;  1GHI A;  3IHA A;  5AQ9 A;  5CEC A;  1BLS A;  1PW1 A;  3BFF A;  3V5M A;  4MNR A;  1Q2Q A;  1NRF A;  2P9V A;  5FAT A;  4RX3 A;  4DXB A;  3NIA A;  1PZO A;  3LY3 A;  5FI7 A;  3N6I A;  4GZB A;  2FFF B;  4QU3 A;  3EQU A;  1ZG4 A;  1XGJ A;  5HL1 A;  1SDE A;  2XF3 A;  4OPR A;  1ZC2 A;  1MKI A;  2ZMA A;  3BLS A;  1KVM A;  4FSF A;  3ZG9 B;  4ZTK A;  1H8Z A;  1EWZ A;  3VP0 A;  1CI8 A;  3PBN A;  1S0W A;  2Y2P A;  3HVF A;  1YLT A;  2Y2K A;  2UWX A;  1IYO A;  4C75 A;  3LO7 A;  1YM1 A;  4DF6 A;  3G34 A;  3IHB A;  3IH8 A;  3TSG A;  4E3M A;  4C3Q A;  1K4F A;  2EXA A;  1FCM A;  2VGJ A;  1W79 A;  3IT9 A;  5BOH A;  4HBT A;  1MWS A;  4WZ5 A;  4N9K A;  3HLC A;  3HUN A;  3PTE A;  4X68 A;  4DE3 A;  4KZ5 A;  1DJB A;  1W7F A;  2WKE A;  3DWZ A;  5HAQ A;  2EX8 A;  2WGW B;  1XXM A;  2V20 A;  1BUL A;  3IWO A;  3P98 A;  4LCM A;  4MLL A;  4N9L A;  3C4O A;  4R0Q A;  5JYO A;  3VOZ A;  2XD1 A;  3BYD A;  4OOY A;  4S2I A;  4E6W A;  4D2O A;  2V2F F;  5DTS A;  2EX9 A;  3UDI A;  1RGZ A;  4EUZ A;  4R23 A;  2I72 A;  4JPM A;  4YFM A;  1KE0 A;  1MWT A;  3IF6 C;  3N7W A;  3CJM A;  2PU4 A;  1ES2 A;  1AXB A;  3GQZ A;  2EFU A;  5EUA A;  3UO9 A;  1YLP A;  4QY5 A;  5GLD A;  1L0E A;  1W8Y A;  4DXC A;  1YLY A;  2HDQ A;  4OPZ A;  4OQG A;  3G2Z A;  5A93 A;  5GLA A;  2BLS A;  3UE1 A;  1GA9 A;  4ZDX A;  5DF8 A;  5DTT A;  1K4E A;  3FKW A;  1K55 A;  4N1X A;  3VSL A;  4KZ3 A;  3IF6 B;  1PI5 A;  1YMX A;  2Y2J A;  1Z6F A;  3O3V A;  2G2U A;  2H10 A;  1E3U A;  4OPQ A;  4X6T A;  5FQQ A;  1ALQ A;  2P74 A;  2Y4A A;  1BLP A;  5TGF A;  4OQI A;  4P85 A;  1BUE A;  3M2J A;  4EV4 A;  5M18 A;  2RL3 A;  5EVI B;  1M40 A;  2HP6 A;  4FH4 A;  2VGK A;  1VM1 A;  1OME A;  4IBX A;  5M19 A;  3WS5 A;  1XX2 A;  3C7V A;  3N4I A;  4MBF A;  1K57 A;  4FD8 A;  4OVD A;  3AGF A;  3BFE A;  1SKF A;  5FAS A;  5AQ7 A;  1RGY A;  1RCJ A;  3ISG A;  4K91 A;  4LV1 A;  1LL5 A;  3A3D A;  3SS3 A;  3UE0 A;  2HPB A;  3VP1 A;  4E6X A;  1JTG A;  2BG1 A;  3ZG5 A;  1CEG A;  1ONH A;  5AQA A;  3RXX A;  1K54 C;  4NET A;  1K54 A;  3UDF A;  4CJN A;  4PM6 A;  5A90 A;  4EBP A;  2ZM0 A;  3Q7V A;  3G32 A;  2ZQC A;  3WS2 A;  3SH8 A;  5KSC A;  4GDN A;  2H5S A;  1H5X A;  2XDM A;  4OON A;  5E43 A;  1IYQ A;  2C5W B;  1CK3 A;  1WYB A;  3HLE A;  1E25 A;  3O87 A;  1MXO A;  2XR0 A;  1JTD A;  2Q9M A;  1NYY A;  4HBU A;  3ZCZ A;  2HP5 A;  4E3N A;  3O86 A;  4R4R A;  4X55 A;  4LCL A;  4S2N A;  1XA7 A;  4JF6 A;  1XKZ A;  5F83 A;  4MBH A;  3NDG A;  3WS1 A;  5FQK A;  3B3X A;  5HAI A;  1QME A;  5A92 A;  2XH9 A;  2WKI A;  1L0G A;  1ZKJ A;  2Z2M B;  1FQG A;  3VMA A;  1K38 A;  1I2W A;  1XP4 A;  2ZQ8 A;  4X56 A;  4KQR A;  4GKU A;  4X69 A;  1C3B A;  3CMZ A;  4ZAM A;  3ZG8 B;  3W4O A;  2Y91 A;  4U3T A;  5DTK A;  4N92 A;  2GDN A;  5FQM A;  1I2S A;  3IWI A;  4IED A;  4UAA A;  2WYX A;  2FFY A;  4WZ4 A;  3S1Y A;  3IXB A;  4UA7 A;  2ZQ9 A;  3IF6 A;  2OLU A;  3ZDJ A;  2ZC4 B;  5CTN A;  3BEC A;  1NY0 A;  3C5A A;  3M6H A;  3SOI A;  1JWV A;  3VFH A;  3FYZ A;  4RX2 A;  4PM7 A;  4PM5 A;  1KE3 A;  5E2H A;  4R4S A;  4DDY A;  4Y0T A;  3IF5 A;  3SH7 A;  2R9W A;  3ITB A;  3MXR A;  4GNU A;  1KVL A;  3A3J A;  3HUO A;  4PM9 A;  2ZC6 B;  1SHV A;  2WAE A;  2EX2 A;  5CGS A;  3VFF A;  4QY6 A;  3UPO A;  5M1A A;  3VP4 A;  2WAF A;  1QMF A;  2OSU A;  3Q81 A;  4JXS A;  3NY4 A;  5CXW A;  1J9M A;  2ZM2 A;  3D4F A;  1FSW A;  4JBF A;  1NZO A;  2WGW A;  4XXR A;  1LLB A;  3ZVT A;  5CGX A;  1NYM A;  5EVI A;  3WS0 A;  1XPB A;  3GR2 A;  3IQA A;  4JKT A;  1HVB A;  4DDS A;  4BL2 A;  2EFX A;  3E2L A;  3TG9 A;  3WWX A;  3OC2 A;  1RP5 A;  4GD6 A;  3ZG7 B;  1NZU A;  3PAG A;  2PU2 A;  4S2P A;  1XGI A;  1YLJ A;  5EVI D;  4Q8I A;  4GB7 A;  3QHY A;  1FR6 A;  1KGG A;  2QPN A;  1W5D A;  2XK1 A;  3CG5 A;  4OOM A;  4U0X A;  4QB8 A;  5CRF A;  3DW0 A;  3FZC A;  4MBK A;  3V50 A;  4B4Z A;  5CED A;  5F1G A;  4P6B A;  4KG2 A;  1IEM A;  5E2E A;  1BTL A;  1PI4 A;  4WMC D;  5GHY A;  4EBN A;  2G2W A;  4EBL A;  5EVI C;  5TR7 A;  3LEZ A;  2J9O A;  4GN2 A;  4ZJ2 A;  1IKG A;  2IWC A;  3IXH A;  4ID4 A;  4DE0 A;  4FCF A;  5JYP A;  2X02 A;  2WZZ A;  3GMW A;  1PWG A;  4OOL A;  2A49 A;  2DRW A;  3W8K A;  3DTM A;  3MXS A;  1LI9 A;  1TDG A;  4S2N C;  3S4X A;  2ZQ7 A;  1KGE A;  4EWF A;  4S2O A;  4KZ9 A;  3ZHH A;  3Q7V B;  2XLN A;  1KDW A;  5FQJ A;  3M6B A;  3VP2 A;  1K25 A;  1IKI A;  2JCH A;  3Q7Z A;  1CEF A;  2Z2L B;  5CER A;  4ZBE A;  1YMS A;  3BFC A;  4JXW A;  1TEM A;  3ITA A;  5FI6 A;  2OLV A;  3RJU A;  3CZD A;  4WM9 A;  4X53 A;  3SH9 A;  1M6K A;  1Q2P A;  4LV2 A;  4QJG A;  1PZP A;  4P0M A;  1GCE A;  1PWD A;  4WEK A;  1K6S A;  4MEZ A;  5FDH A;  1ERM A;  2QZ6 A;  1DJA A;  3IXD A;  2XFT A;  5TFQ A;  4KEN B;  4RYE A;  3MZE A;  4S2L A;  1O7E A;  4R1G A;  3UE3 A;  2HP9 A;  1K56 D;  1FCN A;  3N8S A;  2WZX A;  2Y2N A;  5CHM A;  5HFO A;  5U47 A;  2WGV A;  2JBF A;  2IWB A;  4S2M A;  4KZB A;  1MWU A;  2A3U A;  3C7U A;  5EVL A;  4IVI A;  5GHX A;  1K56 A;  4R3J A;  2Y2Q A;  1L0D A;  2CC1 A;  1FOF A;  3IXG A;  4HES A;  1YLW A;  2Y55 A;  1VQQ A;  2X01 A;  1WE4 A;  2WGI A;  1BLC A;  3HBR A;  3PBR A;  2P9V B;  3Q1F A;  4WEJ A;  4XUX A;  5DVA A;  3AGD A;  4WYY A;  1ESU A;  1FCO A;  4OKP A;  3V39 A;  1NXY A;  2C6W B;  3WRZ A;  4E3K A;  5CEB A;  5FAQ A;  3UPN A;  3M2K A;  3Q82 A;  4S2K A;  4KZ4 A;  4K0X A;  1ZG6 A;  2H0T A;  4ZJ3 A;  4O7D A;  1E3U D;  2JC7 A;  2Y2O A;  3A3E A;  3BFD A;  3TOI A;  1KDS A;  4WBG A;  2X71 A;  4E3L A;  1GHP A;  3ZFZ A;  3PBO A;  4Y0U A;  3LCE A;  2Y2I A;  3Q07 A;  4BL3 A;  3QNB A;  1KGF A;  3GTC A;  5GLB A;  3S22 A;  1FSY A;  4E3I A;  2RCX A;  3BEB A;  1G6A A;  3VSK A;  1LI0 A;  3BM6 A;  5J8X A;  2DNS A;  2XEP A;  4FH2 A;  3AGE A;  4Y7P A;  3V3R A;  2ZQD A;  4E3J A;  1G68 A;  4R3B A;  1BSG A;  3HLW A;  4CPK A;  5EOO A;  3PBS A;  1DJC A;  3HUM A;  4DKI A;  2WK0 A;  4JXG A;  5GL9 A;  1YQS A;  5HX9 A;  4ZJ1 A;  4YIN A;  2R9X A;  5E2G A;  1TDL A;  1JWZ A;  4GD8 A;  3HLG A;  4UHU A;  4BJP A;  3RXW A;  1ESI A;  3GVB A;  3NDE A;  2Y2G A;  3UY6 A;  3WRT A;  1N4O A;  3IH9 A;  1YLZ A;  2WUQ A;  4NK3 A;  4KG6 A;  4DE1 A;  1E4D A;  3MKF A;  4QD4 A;  5CHU A;  1ES5 A;  4PM8 A;  3I7J A;  2HDS A;  3BRM A;  3OPL A;  5HAP A;  3C4P A;  5GLC A;  2PBY A;  2ZLY A;  1TVF A;  5IHV A;  1IYP A;  5KSH A;  1O07 A;  4OLG A;  1PW8 A;  4BD0 A;  3G35 A;  4OPY A;  2QMI A;  2ZQA A;  3O88 A;  1GHM A;  3E2K A;  3GRJ A;  4KQO A;  3HLD A;  4OLD A;  4BD1 A;  5DF9 A;  1ES3 A;  1S6R A;  3UPP A;  4N1H A;  4IBR A;  4QHC A;  4F94 A;  3UDX A;  3FWL A;  5I94 A;  2WAD A;  3OPR A;  4JXV A;  1HZO A;  2ZJ9 A;  3VOY A;  2J8Y A;  1ONG A;  1BLH A;  5EEC A;  5F82 A;  3NC8 A;  3DWK A;  4LV0 A;  2XD5 A;  1WYC A;  3NCK A;  1CI9 A;  2J9P A;  4HEF A;  4LEN A;  3FKV A;  4KQQ A;  4BQM A;  5FI2 A;  2EXB A;  2IWD A;  1U60 A;  3OZH A;  1JVJ A;  3JYI A;  2ZM8 A;  4PPR A;  1GA0 A;  2DCF A;  1ES4 A;  5KZH A;  2Y2H A;  1ERO A;  4B88 A;  3UN7 A;  4DE2 A;  4UA9 A;  4OP5 A;  5D3O A;  5FQ9 A;  1SDN A;  2HDU A;  2ZC5 B;  3VP3 A;  4WEL A;  3G4P A;  1BT5 A;  1K55 C;  4KG5 A;  4Z9Q A;  4L0L A;  4Y0O A;  4EQI A;  4DRT A;  2ZC3 B;  2XQZ A;  4KZ6 A;  4RVA A;  3A3F A;  2OV5 A;  4P87 A;  1PWC A;  1ERQ A;  3ZNT A;  4OH0 A;  3N8L A;  5A91 A;  5FAO A;  3N8R A;  2JE5 A;  1Y54 A;  4OQ0 A;  1K57 C;  1SCW A;  3QNC A;  4BEN A;  3SS4 A;  4K0W A;  2H0Y A;  1PYY A;  4H8R A;  3IWQ A;  2XFS A;  5F1F A;  4KZA A;  2Y59 A;  4XUZ A;  3MBZ A;  5FA7 A;  4S2J A;  2Y2L A;  4U0T A;  3G30 A;  3MZD A;  5FQI A;  5FSR A;  1JWP A;  4JLF A;  4C6Y A;  5EOE A;  3V3S A;  1HD8 A;  1L0F A;  1KE4 A;  1H8Y A;  2Q9N A;  1LHY A;  3NI9 A;  1EI5 A;  1LL9 A;  1HTZ A;  3G2Y A;  2V1Z A;  2EX6 A;  5EPH A; 
#chains in the Genus database with same CATH topology
 1YSP A;  3FV7 A;  3EGD C;  5G18 A;  3S7P A;  4A5R A;  4IVK A;  1N9B A;  1OTB A;  4O01 A;  3EEA A;  3LGO A;  4IJG A;  3SW1 A;  1NJ4 A;  4BLM A;  4XT2 B;  3F1P A;  2OWH A;  4JF4 A;  1MPL A;  3SS5 A;  3OPH A;  5EE8 A;  3HLF A;  1STZ A;  2WKH A;  2PYP A;  3OCN A;  2H28 A;  1W8Q A;  4BWI A;  5EFW A;  2V1A A;  5E2F A;  5L2F A;  2KX6 A;  1XJ4 A;  4CLC E;  4KZ7 A;  4OQH A;  5L07 A;  2DMW A;  2WKP A;  3UB8 A;  4GDB A;  5EV0 A;  3PBQ A;  2ZBB A;  5AQ9 A;  2ZL1 B;  4MNR A;  5FAT A;  3U2A A;  1GSW A;  1S4R A;  3LY3 A;  4QU3 A;  1VET A;  4OPR A;  1F98 A;  4ETX A;  3IBJ A;  3BLS A;  3ZG9 B;  3PBN A;  1IYO A;  4DF6 A;  3MJQ A;  3IHB A;  4D60 A;  1MWS A;  4N9K A;  2GNX A;  3HUN A;  3PTE A;  4KZ5 A;  1DJB A;  3IS2 B;  2WGW B;  3IWO A;  3P98 A;  3H9W A;  4R0Q A;  5DJT A;  3VOZ A;  4OOY A;  2V2F F;  1RGZ A;  3C2W A;  4R23 A;  4YFM A;  1KE0 A;  1ES2 A;  4F3L B;  3T4Q A;  1W8Y A;  1YLY A;  4OQG A;  3G2Z A;  5GLA A;  3UE1 A;  3VSL A;  1K55 A;  2R78 A;  1ZHH B;  2Y2J A;  1Z6F A;  2QYB A;  2G2U A;  3O3V A;  4MCW A;  1E3U A;  4OPQ A;  1T1C A;  3CI6 A;  4OQI A;  3FPV A;  2RL3 A;  1M40 A;  2HP6 A;  5K5B A;  1VM1 A;  2FZ0 A;  4IBX A;  5M19 A;  1XX2 A;  3BFE A;  1Y4O A;  3ISG A;  3UE0 A;  1XJ6 A;  2BG1 A;  3ZG5 A;  2XSS A;  4EBP A;  2ZM0 A;  2D01 A;  3WS2 A;  3HCY A;  4GDN A;  2H5S A;  1H5X A;  3UB6 A;  4OON A;  1LL8 A;  4AFI A;  1WYB A;  3HLE A;  3LFV A;  5EM0 A;  3O86 A;  1YPR A;  3KO6 A;  1P0Z A;  3WS1 A;  5A92 A;  2XH9 A;  3JVU A;  1XP4 A;  1I2W A;  1UWP X;  3ZG8 B;  2EWV A;  4U3T A;  1GSV A;  4N92 A;  2GDN A;  4RQ9 A;  1F5M A;  2VV8 A;  4JGR A;  3U4L P;  1JNU A;  5LBR A;  5HWW A;  2M7U A;  2KDK A;  4GNU A;  1SHV A;  3K3D A;  2B02 A;  2OSU A;  3Q81 A;  4JXS A;  4IHQ A;  2W1T A;  4HH3 A;  3E98 A;  3D4F A;  4JBF A;  3NOP C;  4XXR A;  3ZVT A;  3P01 A;  5CGX A;  3UB9 A;  3WS0 A;  4JKT A;  3IQA A;  1HVB A;  2EFX A;  2JKG A;  3WWX A;  3OC2 A;  1RP5 A;  4GD6 A;  3ZG7 B;  3MFX A;  1NZU A;  1S1Y A;  1IOU A;  3PAG A;  2PU2 A;  3CPT B;  4GB7 A;  1S66 L;  3CG5 A;  4OOM A;  2Z6C A;  3ZYT A;  3FZC A;  5CED A;  4EBL A;  5FL3 A;  4ARZ B;  3LEZ A;  4IUK A;  4ZJ2 A;  3KSG A;  1IKG A;  2IWC A;  2FH5 A;  4DE0 A;  2X02 A;  3KSF A;  4OOL A;  5F68 A;  1TDG A;  1F9I A;  2ZQ7 A;  4EWF A;  1OTA A;  3ZHH A;  3M6B A;  3VP2 A;  1N9O A;  1IKI A;  3IX4 A;  5DJU A;  3Q7Z A;  4ZBE A;  4JXW A;  5FI6 A;  3RJU A;  1VET B;  4Y3I A;  4P0M A;  1GCE A;  2HF6 A;  4MEZ A;  5FDH A;  4NXG A;  3LYX A;  3TJZ C;  3NOT C;  3T4K A;  5TFQ A;  5FEF A;  1O7E A;  2HV1 A;  2EA9 A;  5CHM A;  2Y2N A;  3IBR A;  3C7U A;  3OOV A;  1T1B A;  4HES A;  2Y55 A;  1BLC A;  2P9V B;  4WEJ A;  3WRZ A;  3DTE A;  3EOI A;  3M2K A;  4KZ4 A;  4K0X A;  1W63 Q;  1E3U D;  4O7D A;  3BFD A;  4L9E A;  1KDS A;  3TOI A;  3PBO A;  3LCE A;  2Y2I A;  5GLB A;  3S22 A;  1FSY A;  3VSK A;  3ZQ5 A;  1PNE A;  4Y7P A;  3AGE A;  4CQH A;  1G68 A;  2V0U A;  1DJC A;  4DKI A;  1SKO B;  5HX9 A;  3H82 B;  1TDL A;  4GD8 A;  1ESI A;  3GVB A;  3NDE A;  1N4O A;  4BMW A;  4NK3 A;  3MKF A;  4PM8 A;  1KOU A;  2W27 A;  3BRM A;  2L0W A;  1O07 A;  4CLC B;  1GHM A;  3E2K A;  3PYP A;  3HLD A;  4CLC D;  2W3G A;  1PFL A;  3W2Z A;  2WAD A;  4JXV A;  2Y8H A;  3LI9 A;  5F82 A;  3DWK A;  3NCK A;  1N9N A;  4G3W A;  4BQM A;  2ZM8 A;  2J3W A;  2IA2 A;  2VA0 A;  4B88 A;  3UN7 A;  5D3O A;  1SDN A;  2HDU A;  2J3T D;  1BT5 A;  3T4S A;  3UME A;  4Y0O A;  4EQI A;  2XQZ A;  4RVA A;  1DP9 A;  3A3F A;  3LR4 A;  1PWC A;  2ACG A;  3FPW A;  1UWN X;  5FAO A;  1VEU B;  3L9K A;  4M4X A;  2PD7 A;  4BEN A;  4HIA A;  4K0W A;  3MF0 A;  2XFS A;  2Y59 A;  4XUZ A;  1VEU A;  3MZD A;  1OTD A;  1JWP A;  4JLF A;  5EOE A;  3FC7 A;  1DP8 A;  2Q9N A;  1FIL A;  1LHY A;  3NI9 A;  1HLU P;  2D02 A;  3G2Y A;  4E3J A;  4RYE A;  1V9Y A;  3W4Q A;  4WZ5 C;  4GOG A;  4IUH A;  1WA9 A;  3BWL A;  1MBL A;  3ZVW A;  1PRQ A;  3OCL A;  5GHZ A;  5CHJ A;  2OOL A;  1T19 A;  3LIB A;  1IYS A;  2ZC7 A;  3HL9 A;  3UNW A;  3P09 A;  4O0P A;  3ZG0 A;  3WS4 A;  3D3O A;  3LUQ A;  4EEU A;  4RA7 A;  3G31 A;  3GV9 A;  4LV3 A;  3NBL A;  1XA1 A;  1IEL A;  5KIZ A;  3DBA A;  2GJ3 A;  4E04 A;  5FEG A;  5CEC A;  5AVF A;  2WKR A;  5TBM A;  1Q2Q A;  4LRZ E;  2P9V A;  3F1N A;  5J4E A;  1PZO A;  2FFF B;  4HI4 A;  3LIF A;  3EQU A;  4EW7 A;  1ZG4 A;  1XGJ A;  5HL1 A;  1MKI A;  2KOI A;  1H3Q A;  1EWZ A;  3VP0 A;  1YLT A;  4PKY G;  1YM1 A;  2PD8 A;  3OLO A;  4HBT A;  1W63 M;  5HZH A;  2OAQ 1;  4X68 A;  4UEY A;  2QHK A;  3D72 A;  2WKE A;  4LCM A;  4N9L A;  3C4O A;  3GDI A;  4E6W A;  4D2O A;  5DTS A;  2EX9 A;  4UQI M;  3UDI A;  4EUZ A;  2I72 A;  3N7W A;  3F1O B;  4QY5 A;  4L9G A;  4DXC A;  4Q0I A;  5A93 A;  3UE6 A;  3A0R A;  3LI8 A;  1GA9 A;  1YKD A;  5DF8 A;  1L3L A;  2O9B A;  1MC0 A;  2L4R A;  3R7W B;  1BUE A;  3M2J A;  4DJ2 A;  2XA7 M;  2VGK A;  3MSH A;  4MBF A;  3MQQ A;  1SKF A;  1RGY A;  1RCJ A;  1T1A A;  4E6X A;  1TD5 A;  1CEG A;  1ONH A;  3RXX A;  1K54 C;  3F1N B;  2B95 A;  5A90 A;  3Q7V A;  2CMN A;  5TBM B;  2K31 A;  2JKT I;  5KSC A;  2C5W B;  1E25 A;  1MXO A;  1JTD A;  2HP5 A;  4E3N A;  4JF6 A;  5F83 A;  3T1R A;  5FQK A;  2YKF A;  3B3X A;  5HDD A;  2Z2M B;  1FQG A;  4X56 A;  1DRM A;  1G28 A;  3F1P B;  1C3B A;  4LPZ A;  5DTK A;  5AVE A;  5HDS A;  1I2S A;  4NXE A;  3IWI A;  4IED A;  4YOF A;  2FFY A;  4WZ4 A;  3S1Y A;  3R7W A;  4UA7 A;  3QP6 A;  2ZQ9 A;  3IF6 A;  2OLU A;  5CTN A;  3BEC A;  1NY0 A;  4WF0 A;  3T4J A;  1MZU A;  4RX2 A;  4MDZ A;  4PM5 A;  2JN7 A;  5E2H A;  4C3Q A;  3ITB A;  3MXR A;  1KVL A;  2EX2 A;  5CGS A;  3BJN A;  4QY6 A;  1QMF A;  4L9F A;  1NZO A;  1TS8 A;  1XPB A;  5HL6 A;  1LT0 A;  3E2L A;  2ZOI A;  3T4O A;  3CIT A;  4NEE D;  4X1L A;  2M1C A;  1YLJ A;  5EVI D;  4Q8I A;  2GX5 A;  2QPN A;  4U0X A;  5CRF A;  4B4Z A;  3V50 A;  4MBK A;  3KSH A;  3MQO A;  5F1G A;  4P6B A;  1BTL A;  5GHY A;  4WMC D;  2G2W A;  3S7N A;  5EVI C;  4DJ3 A;  1ZTU A;  2ZOH A;  3IXH A;  4FCF A;  2XRN A;  2WZZ A;  4CLC C;  2A49 A;  2DRW A;  3T1Q B;  3MXS A;  1KGE A;  4NG2 A;  4KZ9 A;  3Q7V B;  4I3I A;  4HJ3 A;  2WKQ A;  1K25 A;  4KUK A;  1CEF A;  5CER A;  3BFC A;  3ITA A;  2OLV A;  4GJ4 A;  1Q2P A;  3KX0 X;  3QP5 A;  1ERM A;  4ME4 A;  4HOI A;  3MZE A;  4R1G A;  3UE3 A;  5DFY A;  1K56 D;  1FCN A;  2WZX A;  5U47 A;  2WGV A;  3PHY A;  4S2M A;  4Y13 A;  1MWU A;  4B9O A;  4F3L A;  5F5Y A;  2X01 A;  2WGI A;  2VZW A;  4FTX A;  1ESU A;  1FCO A;  4E3K A;  4ESP A;  3UPN A;  2P04 A;  3Q82 A;  4Y17 A;  3B33 A;  1ZG6 A;  4ZJ3 A;  2Y2O A;  4E3L A;  1GHP A;  3T1X A;  1KGF A;  1UGU A;  3T4L A;  2RCX A;  2V0W A;  1LI0 A;  3BM6 A;  2PBD P;  4HQA A;  2BAS A;  2ZQD A;  3HLW A;  4CPK A;  1S1Z A;  3HUM A;  4JXG A;  5GL9 A;  4YIN A;  5E2G A;  4BJP A;  2EWW A;  2OAP 1;  1EW0 A;  3UMD A;  2B18 A;  2HDS A;  5IU1 A;  3OPL A;  3C4P A;  2PBY A;  2PAV P;  3VE3 A;  5IS1 A;  5IHV A;  4BD0 A;  4OPY A;  5J7E A;  4OLD A;  5HPI A;  4F94 A;  3OPR A;  2ZJ9 A;  3VOY A;  1ONG A;  1BLH A;  1OTI A;  2XD5 A;  3T4T A;  2J9P A;  4HEF A;  1OPX A;  3BQA A;  1JVJ A;  2A2L A;  4H6J A;  2Y2H A;  2INW A;  3MQ0 A;  5J3W A;  4UA9 A;  4OP5 A;  5FQ9 A;  3VP3 A;  1TS6 A;  3NHQ A;  1TS7 A;  3NJA A;  2V9A A;  2ZC3 B;  2VGL S;  2PRF A;  1OJ5 A;  2ZMF A;  2OV5 A;  4R38 A;  2JKT M;  5A91 A;  3A0V A;  2JE5 A;  3QNC A;  1SCW A;  3PXP A;  2QKP A;  2H0Y A;  4LFU A;  2YKH A;  3RFB A;  3KYQ A;  5FA7 A;  4DMZ A;  4HP4 A;  2Y2L A;  3LIE A;  1HD8 A;  1L0F A;  3TE8 A;  3MXQ A;  2PYR A;  2V1Z A;  4R6L A;  2VV7 A;  3HRE A;  4WLA A;  3BFG A;  3MS6 A;  4FUW A;  1P9W A;  2HDR A;  4UA6 A;  5AQB A;  4OP8 A;  3PAE A;  3MKE A;  2O9A A;  4E3O A;  2B5R A;  5CGW A;  1D06 A;  2E8I A;  1LSW A;  2W3E A;  3HLB A;  4P6Z S;  2ZD8 A;  2Y2M A;  3MZF A;  2W1T B;  3PBT A;  3E0Y A;  1I5Q A;  3LY4 A;  1H0M A;  5DF7 A;  4BBV A;  5TJJ A;  4HP9 A;  3LR3 A;  3A3I A;  3GEC A;  3EQV A;  4KZ8 A;  5FAP A;  4B4X A;  4M3K A;  4Q0H A;  1MWR A;  1DY6 A;  3ZNY A;  1L2S A;  2A24 B;  1GHI A;  3IHA A;  5HPF A;  1PW1 A;  5C5K A;  1NRF A;  4RX3 A;  1MKM A;  4DXB A;  3NIA A;  4QWO A;  3MMH A;  4GZB A;  4R70 A;  3D9Y A;  1SDE A;  2XF3 A;  1ZC2 A;  2ZMA A;  4FSF A;  4ZTK A;  4K08 A;  2HGV A;  1S0W A;  2W0N A;  3HVF A;  2UWX A;  5IT5 A;  3IH8 A;  3TSG A;  4E3M A;  1K4F A;  1FCM A;  1W79 A;  3IT9 A;  4DE3 A;  3DWZ A;  5HAQ A;  2EX8 A;  1J3W A;  1BUL A;  5DKK A;  2XD1 A;  3BYD A;  4S2I A;  5HD3 A;  5HSQ A;  4JPM A;  3IF6 C;  1MWT A;  4X25 A;  5FDS A;  3CJM A;  1LSX A;  2PU4 A;  1AXB A;  5EUA A;  5GLD A;  3S7O A;  1N9L A;  2HDQ A;  2BLS A;  2OWJ A;  3FKW A;  1XJ2 A;  3KSI A;  4KZ3 A;  3IF6 B;  1PI5 A;  2V1B A;  2Y4A A;  4EV4 A;  5EVI B;  4ETZ A;  1OME A;  2W1R A;  3C30 A;  3N4I A;  2VLG A;  4FD8 A;  4OVD A;  3AGF A;  4LGW A;  4I3A A;  1K0K A;  5AQ7 A;  4LV1 A;  4K91 A;  3RTY A;  1LL5 A;  3A3D A;  2HPB A;  1JTG A;  5DFX A;  1K54 A;  3UDF A;  4PM6 A;  3G32 A;  4JGP A;  5L09 A;  2XDM A;  1CK3 A;  3O87 A;  2XR0 A;  1S4S A;  2Q9M A;  3ZCZ A;  4X1M A;  4MN5 A;  2PR6 A;  5HDC A;  1FIK A;  2ZQ8 A;  3H7W A;  3CMZ A;  4ZAM A;  3W4O A;  2KLI A;  5FQM A;  4HNB A;  1ODV A;  4UAA A;  2WYX A;  4MMN A;  2W3F A;  3TRC A;  2ZC4 B;  3C5A A;  1AWI A;  1JWV A;  3VFH A;  4YNR A;  1KE3 A;  2Q0O A;  2R9W A;  3BY8 A;  3HUO A;  3EGX C;  2ZC6 B;  2WAE A;  4HH2 A;  3UPO A;  5M1A A;  3NY4 A;  1FSW A;  1LLB A;  5EVI A;  5EVE A;  4DDS A;  4BL2 A;  4XT2 A;  4EUV A;  3TG9 A;  2G7U A;  5AJG A;  1DP6 A;  4PHT A;  4S2P A;  1XGI A;  4G3K A;  1FR6 A;  1KGG A;  1CJF A;  3B47 A;  3DW0 A;  3FG8 A;  3CUE A;  2ZMV A;  1PI4 A;  4EBN A;  5TR7 A;  2JHE A;  4ID4 A;  5JYP A;  3GMW A;  1PWG A;  4B93 A;  5I5L A;  4S2N C;  3S4X A;  3BW6 A;  2XLN A;  4WN5 A;  4GS9 A;  2V8C A;  4NKP A;  3CZD A;  4X53 A;  3SH9 A;  1M6K A;  4LV2 A;  4QJG A;  1PWD A;  3L7H A;  3HJI A;  4LLO B;  1K6S A;  1XFN A;  1DJA A;  3IXD A;  5F69 A;  4KEN B;  3CUE C;  4BBU A;  5HFO A;  2IWB A;  5L8M A;  5EVL A;  2LB9 A;  4IVI A;  4R3J A;  2Y2Q A;  1L0D A;  2CC1 A;  2PR5 A;  2VKS A;  1WE4 A;  3V39 A;  4OKP A;  1S67 L;  4ZRR A;  4YWZ A;  3DTI A;  4MN6 A;  3E4P A;  1XJ3 A;  4S2K A;  2H0T A;  3V67 A;  3R4K A;  4WBG A;  5HD5 A;  3QNB A;  3GTC A;  4CLC A;  4E3I A;  4LRY C;  5J8X A;  2DNS A;  3V3R A;  4O8G A;  5EOO A;  2WK0 A;  3HLG A;  4UHU A;  2E8J A;  3RXW A;  2Y2G A;  3UY6 A;  1YLZ A;  1OTE A;  4QD4 A;  2VEA A;  3I7J A;  1TVF A;  4Y2F A;  2M7V A;  1IYP A;  5MC7 A;  1NLY A;  4OLG A;  1PW8 A;  2QMI A;  2ZQA A;  3GRJ A;  4KQO A;  3LID A;  3UPP A;  4IBR A;  2VGL M;  2J80 A;  3P7N A;  2Z6D A;  5CX7 A;  5EEC A;  4LV0 A;  2HZ5 A;  1WYC A;  1OJG A;  4KQQ A;  2GZA A;  2IWD A;  4PPR A;  3KYZ A;  3S7Q A;  1X0O A;  1GA0 A;  2DCF A;  1SKO A;  3MR0 A;  1ERO A;  4DE2 A;  3QP2 A;  4G3V A;  4Z9Q A;  4DRT A;  4P87 A;  2J3T C;  3ZNT A;  3OBF A;  2JKR M;  5F6A A;  4OQ0 A;  2PDR A;  1PYY A;  4H8R A;  1CQA A;  3EEH A;  5F1F A;  4KZA A;  1G5U A;  1TF1 A;  3TW8 A;  1F2K A;  4EER A;  4S2J A;  3UB7 A;  4U0T A;  2LB5 A;  5FQI A;  5FSR A;  4DN0 A;  2BTF P;  1H8Y A;  4Q0J A;  1EI5 A;  1HTZ A;  1BZA A;  3ZGA B;  2P08 A;  1TS0 A;  4PMA A;  4JF5 A;  1A0K A;  5DKL A;  2VV6 A;  3PR6 A;  5CTM A;  1YSQ A;  3CHW P;  1K6R A;  2XGN A;  4II7 A;  1MY8 A;  3GSG A;  5KMW A;  1YT4 A;  2AVX A;  3BQ8 A;  1P9R A;  1PIO A;  4WMC A;  3OPP A;  2O9C A;  4GS9 B;  2QJ5 A;  1FR1 A;  5L10 A;  4QPR A;  2JKR I;  5HW3 A;  3W4P A;  4FOF A;  3KYE A;  5HAR A;  5EM1 A;  3MFD A;  2J7V A;  3BLM A;  2VJW A;  1BLS A;  3BFF A;  3V5M A;  4UQI S;  5FI7 A;  3N6I A;  1KVM A;  1H8Z A;  1CI8 A;  2Y2P A;  2Y2K A;  4C75 A;  3LO7 A;  4EU0 A;  3G34 A;  3JVV A;  2VGJ A;  2EXA A;  5BOH A;  4WZ5 A;  3CPT A;  3SZT A;  3HLC A;  3VE4 A;  1W7F A;  3K3C A;  1XXM A;  2V20 A;  4MLL A;  5JYO A;  1NRJ A;  2W3D A;  3QP1 A;  4ARZ A;  3CWF A;  3GQZ A;  2EFU A;  3UO9 A;  1YLP A;  2K2N A;  3LEQ A;  1L0E A;  1NWZ A;  1GSX A;  4OPZ A;  2P7J A;  4KQD A;  3E4Q A;  4ZDX A;  5DTT A;  1K4E A;  4N1X A;  1YMX A;  4GLQ A;  2H10 A;  4X6T A;  5FQQ A;  1ALQ A;  2P74 A;  5TGF A;  1BLP A;  4I5S A;  4P85 A;  5M18 A;  4FH4 A;  4I38 A;  3WS5 A;  3C7V A;  1K57 A;  5FAS A;  3VP1 A;  3SS3 A;  1YAX A;  3QP8 A;  2O0Y A;  4NXF A;  5AQA A;  4NET A;  4CJN A;  2ZQC A;  3G6O A;  4HHD A;  3SH8 A;  4Y5F A;  2QJ7 A;  5E43 A;  3IX8 A;  1IYQ A;  3CAX A;  3IS2 A;  3O5Y A;  1BYW A;  1NYY A;  1Z09 A;  1D1J A;  4HBU A;  5G4Y A;  4WUJ A;  4R4R A;  4X55 A;  2NUP C;  4LCL A;  4S2N A;  1XA7 A;  3H7W B;  3CLO A;  4EET B;  1XKZ A;  2Y79 A;  4MBH A;  1P97 A;  3NDG A;  5HAI A;  1QME A;  1IFQ A;  2V8F A;  2WKI A;  3LIC A;  3VOL A;  1L0G A;  1ZKJ A;  3VMA A;  1CF0 A;  1K38 A;  3K2N A;  4KQR A;  4GKU A;  4X69 A;  4GCZ A;  2Y91 A;  3B42 A;  4KUO A;  3IXB A;  3ZDJ A;  3M6H A;  3SOI A;  3FYZ A;  4PM7 A;  3LR5 A;  4LRX C;  4R4S A;  4DDY A;  4Y0T A;  3IF5 A;  3SH7 A;  4PM9 A;  3A0S A;  3A3J A;  3VFF A;  3VP4 A;  2WAF A;  5CXW A;  1J9M A;  2ZM2 A;  4EEP A;  2WGW A;  1NYM A;  3GR2 A;  3ICY A;  2XA7 S;  3T50 A;  4EES A;  1NLZ A;  4MN7 A;  2XRO A;  3QHY A;  1W5D A;  2XK1 A;  4QB8 A;  1D7E A;  4KG2 A;  1IEM A;  5E2E A;  1LSV A;  2J9O A;  3T1S A;  4GN2 A;  3C38 A;  1VHM A;  1Y28 A;  4GW9 A;  3NEC A;  5HWT A;  4EQ1 A;  3W8K A;  3DTM A;  2ZL1 A;  1LI9 A;  4BBT A;  2HJ9 C;  4S2O A;  2L1M A;  1KDW A;  5FQJ A;  4HY8 A;  2JCH A;  3T12 B;  2Z2L B;  1T18 A;  3F1O A;  1YMS A;  4WL9 A;  4EXO A;  1TEM A;  4WM9 A;  3EWK A;  1PZP A;  1ACF A;  4WEK A;  2QZ6 A;  2XFT A;  1VB6 A;  4S2L A;  2HP9 A;  3N8S A;  2JBF A;  4KZB A;  3VV4 A;  2A3U A;  1H8M A;  5GHX A;  1K56 A;  3DTK A;  4JGQ A;  1FOF A;  3IXG A;  1YLW A;  1VQQ A;  2W3H A;  3PBR A;  3HBR A;  3Q1F A;  4XUX A;  5DVA A;  3AGD A;  4WYY A;  5A8B A;  1NXY A;  2C6W B;  5CEB A;  5FAQ A;  4GHI A;  4P6Z M;  2HJE A;  2JC7 A;  3A3E A;  2JKF A;  2X71 A;  3ZFZ A;  4Y0U A;  3Q07 A;  4BL3 A;  3HJK A;  3LR0 A;  3C8C A;  3BEB A;  1G6A A;  5HWV A;  2XEP A;  4FH2 A;  4R3B A;  1BSG A;  3UB5 P;  3PBS A;  1G6O A;  4PAU A;  1YQS A;  4I3J A;  4ZJ1 A;  2R9X A;  1SZV A;  1JWZ A;  1V9Z A;  5G4Z A;  4HJ6 A;  3WRT A;  2A24 A;  4GHI B;  3IH9 A;  2WUQ A;  4KG6 A;  4DE1 A;  1E4D A;  4JGO A;  5CHU A;  1ES5 A;  2QWS A;  2NUT C;  5HAP A;  2O99 A;  5GLC A;  2ZLY A;  4Y15 A;  3JPU A;  5KSH A;  1OT6 A;  3G35 A;  3O88 A;  2PHY A;  4BD1 A;  5DF9 A;  1ES3 A;  1S6R A;  4N1H A;  4QHC A;  3UDX A;  3FWL A;  3ULF A;  3DAV A;  5I94 A;  3BY9 A;  1HZO A;  2J8Y A;  3NC8 A;  1CI9 A;  2I9V A;  4I39 A;  4LEN A;  3FKV A;  5FI2 A;  2EXB A;  4Z1W A;  2PT7 A;  1U60 A;  3OZH A;  3JYI A;  1ES4 A;  2VX8 A;  5KZH A;  4PKY A;  3RH8 B;  2ZC5 B;  4WEL A;  3G4P A;  1XFQ A;  1K55 C;  4KG5 A;  4L0L A;  3LIA A;  4KZ6 A;  4H6J B;  3E4O A;  3NOU C;  1ERQ A;  4OH0 A;  3N8L A;  2VK3 A;  3N8R A;  1Y54 A;  3IX3 A;  1K57 C;  4HJ4 A;  3SS4 A;  3IWQ A;  4NXB A;  3H82 A;  3MBZ A;  3G30 A;  2MJ6 A;  4R3A A;  3QP4 A;  1OT9 A;  4C6Y A;  3V3S A;  1KE4 A;  2UV0 E;  2K7S A;  3NUL A;  1LL9 A;  2EX6 A;  5EPH A; 
#chains in the Genus database with same CATH homology
 3FV7 A;  5G18 A;  1BZA A;  3HRE A;  3W4Q A;  3ZGA B;  4IVK A;  4GOG A;  4WZ5 C;  4A5R A;  1N9B A;  3BFG A;  2HDR A;  4UA6 A;  5AQB A;  4OP8 A;  4PMA A;  1MBL A;  4JF5 A;  3PAE A;  1NJ4 A;  3MKE A;  3ZVW A;  4BLM A;  4E3O A;  2B5R A;  5CTM A;  1K6R A;  5CGW A;  3OCL A;  5GHZ A;  2E8I A;  5CHJ A;  2XGN A;  4JF4 A;  1MPL A;  3SS5 A;  1MY8 A;  3OPH A;  1IYS A;  2ZC7 A;  3HLB A;  3HLF A;  3GSG A;  3HL9 A;  5EE8 A;  3P09 A;  2WKH A;  3UNW A;  5KMW A;  1YT4 A;  2ZD8 A;  2Y2M A;  3MZF A;  3ZG0 A;  3WS4 A;  3OCN A;  1PIO A;  3PBT A;  1W8Q A;  1I5Q A;  3LY4 A;  4WMC A;  5E2F A;  5L2F A;  5DF7 A;  3OPP A;  4KZ7 A;  3A3I A;  4OQH A;  4RA7 A;  3G31 A;  3GV9 A;  4GDB A;  3EQV A;  4LV3 A;  3NBL A;  1FR1 A;  4KZ8 A;  5FAP A;  1XA1 A;  5HW3 A;  3W4P A;  1IEL A;  4B4X A;  4M3K A;  1MWR A;  5HAR A;  3MFD A;  1DY6 A;  3ZNY A;  2J7V A;  1L2S A;  3PBQ A;  3BLM A;  1GHI A;  3IHA A;  5AQ9 A;  5CEC A;  1BLS A;  1PW1 A;  3BFF A;  3V5M A;  4MNR A;  1Q2Q A;  1NRF A;  2P9V A;  5FAT A;  4RX3 A;  4DXB A;  3NIA A;  1PZO A;  3LY3 A;  5FI7 A;  3N6I A;  4GZB A;  2FFF B;  4QU3 A;  3EQU A;  1ZG4 A;  1XGJ A;  5HL1 A;  1SDE A;  2XF3 A;  4OPR A;  1ZC2 A;  1MKI A;  2ZMA A;  3BLS A;  1KVM A;  4FSF A;  3ZG9 B;  4ZTK A;  1H8Z A;  1EWZ A;  3VP0 A;  1CI8 A;  3PBN A;  1S0W A;  2Y2P A;  3HVF A;  1YLT A;  2Y2K A;  2UWX A;  1IYO A;  4C75 A;  3LO7 A;  1YM1 A;  4DF6 A;  3G34 A;  3IHB A;  3IH8 A;  3TSG A;  4E3M A;  4C3Q A;  1K4F A;  2EXA A;  1FCM A;  2VGJ A;  1W79 A;  3IT9 A;  5BOH A;  4HBT A;  1MWS A;  4WZ5 A;  4N9K A;  3HLC A;  3HUN A;  3PTE A;  4X68 A;  4DE3 A;  4KZ5 A;  1DJB A;  1W7F A;  2WKE A;  3DWZ A;  5HAQ A;  2EX8 A;  2WGW B;  1XXM A;  2V20 A;  1BUL A;  3IWO A;  3P98 A;  4LCM A;  4MLL A;  4N9L A;  3C4O A;  4R0Q A;  5JYO A;  3VOZ A;  2XD1 A;  3BYD A;  4OOY A;  4S2I A;  4E6W A;  4D2O A;  2V2F F;  5DTS A;  2EX9 A;  3UDI A;  1RGZ A;  4EUZ A;  4R23 A;  2I72 A;  4JPM A;  4YFM A;  1KE0 A;  1MWT A;  3IF6 C;  3N7W A;  3CJM A;  2PU4 A;  1ES2 A;  1AXB A;  3GQZ A;  2EFU A;  5EUA A;  3UO9 A;  1YLP A;  4QY5 A;  5GLD A;  1L0E A;  1W8Y A;  4DXC A;  1YLY A;  2HDQ A;  4OPZ A;  4OQG A;  3G2Z A;  5A93 A;  5GLA A;  2BLS A;  3UE1 A;  1GA9 A;  4ZDX A;  5DF8 A;  5DTT A;  1K4E A;  3FKW A;  1K55 A;  4N1X A;  3VSL A;  4KZ3 A;  3IF6 B;  1PI5 A;  1YMX A;  2Y2J A;  1Z6F A;  3O3V A;  2G2U A;  2H10 A;  1E3U A;  4OPQ A;  4X6T A;  5FQQ A;  1ALQ A;  2P74 A;  2Y4A A;  1BLP A;  5TGF A;  4OQI A;  4P85 A;  1BUE A;  3M2J A;  4EV4 A;  5M18 A;  2RL3 A;  5EVI B;  1M40 A;  2HP6 A;  4FH4 A;  2VGK A;  1VM1 A;  1OME A;  4IBX A;  5M19 A;  3WS5 A;  1XX2 A;  3C7V A;  3N4I A;  4MBF A;  1K57 A;  4FD8 A;  4OVD A;  3AGF A;  3BFE A;  1SKF A;  5FAS A;  5AQ7 A;  1RGY A;  1RCJ A;  3ISG A;  4K91 A;  4LV1 A;  1LL5 A;  3A3D A;  3SS3 A;  3UE0 A;  2HPB A;  3VP1 A;  4E6X A;  1JTG A;  2BG1 A;  3ZG5 A;  1CEG A;  1ONH A;  5AQA A;  3RXX A;  1K54 C;  4NET A;  1K54 A;  3UDF A;  4CJN A;  4PM6 A;  5A90 A;  4EBP A;  2ZM0 A;  3Q7V A;  3G32 A;  2ZQC A;  3WS2 A;  3SH8 A;  5KSC A;  4GDN A;  2H5S A;  1H5X A;  2XDM A;  4OON A;  5E43 A;  1IYQ A;  2C5W B;  1CK3 A;  1WYB A;  3HLE A;  1E25 A;  3O87 A;  1MXO A;  2XR0 A;  1JTD A;  2Q9M A;  1NYY A;  4HBU A;  3ZCZ A;  2HP5 A;  4E3N A;  3O86 A;  4R4R A;  4X55 A;  4LCL A;  4S2N A;  1XA7 A;  4JF6 A;  1XKZ A;  5F83 A;  4MBH A;  3NDG A;  3WS1 A;  5FQK A;  3B3X A;  5HAI A;  1QME A;  5A92 A;  2XH9 A;  2WKI A;  1L0G A;  1ZKJ A;  2Z2M B;  1FQG A;  3VMA A;  1K38 A;  1I2W A;  1XP4 A;  2ZQ8 A;  4X56 A;  4KQR A;  4GKU A;  4X69 A;  1C3B A;  3CMZ A;  4ZAM A;  3ZG8 B;  3W4O A;  2Y91 A;  4U3T A;  5DTK A;  4N92 A;  2GDN A;  5FQM A;  1I2S A;  3IWI A;  4IED A;  4UAA A;  2WYX A;  2FFY A;  4WZ4 A;  3S1Y A;  3IXB A;  4UA7 A;  2ZQ9 A;  3IF6 A;  2OLU A;  3ZDJ A;  2ZC4 B;  5CTN A;  3BEC A;  1NY0 A;  3C5A A;  3M6H A;  3SOI A;  1JWV A;  3VFH A;  3FYZ A;  4RX2 A;  4PM7 A;  4PM5 A;  1KE3 A;  5E2H A;  4R4S A;  4DDY A;  4Y0T A;  3IF5 A;  3SH7 A;  2R9W A;  3ITB A;  3MXR A;  4GNU A;  1KVL A;  3A3J A;  3HUO A;  4PM9 A;  2ZC6 B;  1SHV A;  2WAE A;  2EX2 A;  5CGS A;  3VFF A;  4QY6 A;  3UPO A;  5M1A A;  3VP4 A;  2WAF A;  1QMF A;  2OSU A;  3Q81 A;  4JXS A;  3NY4 A;  5CXW A;  1J9M A;  2ZM2 A;  3D4F A;  1FSW A;  4JBF A;  1NZO A;  2WGW A;  4XXR A;  1LLB A;  3ZVT A;  5CGX A;  1NYM A;  5EVI A;  3WS0 A;  1XPB A;  3GR2 A;  3IQA A;  4JKT A;  1HVB A;  4DDS A;  4BL2 A;  2EFX A;  3E2L A;  3TG9 A;  3WWX A;  3OC2 A;  1RP5 A;  4GD6 A;  3ZG7 B;  1NZU A;  3PAG A;  2PU2 A;  4S2P A;  1XGI A;  1YLJ A;  5EVI D;  4Q8I A;  4GB7 A;  3QHY A;  1FR6 A;  1KGG A;  2QPN A;  1W5D A;  2XK1 A;  3CG5 A;  4OOM A;  4U0X A;  4QB8 A;  5CRF A;  3DW0 A;  3FZC A;  4MBK A;  3V50 A;  4B4Z A;  5CED A;  5F1G A;  4P6B A;  4KG2 A;  1IEM A;  5E2E A;  1BTL A;  1PI4 A;  4WMC D;  5GHY A;  4EBN A;  2G2W A;  4EBL A;  5EVI C;  5TR7 A;  3LEZ A;  2J9O A;  4GN2 A;  4ZJ2 A;  1IKG A;  2IWC A;  3IXH A;  4ID4 A;  4DE0 A;  4FCF A;  5JYP A;  2X02 A;  2WZZ A;  3GMW A;  1PWG A;  4OOL A;  2A49 A;  2DRW A;  3W8K A;  3DTM A;  3MXS A;  1LI9 A;  1TDG A;  4S2N C;  3S4X A;  2ZQ7 A;  1KGE A;  4EWF A;  4S2O A;  4KZ9 A;  3ZHH A;  3Q7V B;  2XLN A;  1KDW A;  5FQJ A;  3M6B A;  3VP2 A;  1K25 A;  1IKI A;  2JCH A;  3Q7Z A;  1CEF A;  2Z2L B;  5CER A;  4ZBE A;  1YMS A;  3BFC A;  4JXW A;  1TEM A;  3ITA A;  5FI6 A;  2OLV A;  3RJU A;  3CZD A;  4WM9 A;  4X53 A;  3SH9 A;  1M6K A;  1Q2P A;  4LV2 A;  4QJG A;  1PZP A;  4P0M A;  1GCE A;  1PWD A;  4WEK A;  1K6S A;  4MEZ A;  5FDH A;  1ERM A;  2QZ6 A;  1DJA A;  3IXD A;  2XFT A;  5TFQ A;  4KEN B;  4RYE A;  3MZE A;  4S2L A;  1O7E A;  4R1G A;  3UE3 A;  2HP9 A;  1K56 D;  1FCN A;  3N8S A;  2WZX A;  2Y2N A;  5CHM A;  5HFO A;  5U47 A;  2WGV A;  2JBF A;  2IWB A;  4S2M A;  4KZB A;  1MWU A;  2A3U A;  3C7U A;  5EVL A;  4IVI A;  5GHX A;  1K56 A;  4R3J A;  2Y2Q A;  1L0D A;  2CC1 A;  1FOF A;  3IXG A;  4HES A;  1YLW A;  2Y55 A;  1VQQ A;  2X01 A;  1WE4 A;  2WGI A;  1BLC A;  3HBR A;  3PBR A;  2P9V B;  3Q1F A;  4WEJ A;  4XUX A;  5DVA A;  3AGD A;  4WYY A;  1ESU A;  1FCO A;  4OKP A;  3V39 A;  1NXY A;  2C6W B;  3WRZ A;  4E3K A;  5CEB A;  5FAQ A;  3UPN A;  3M2K A;  3Q82 A;  4S2K A;  4KZ4 A;  4K0X A;  1ZG6 A;  2H0T A;  4ZJ3 A;  4O7D A;  1E3U D;  2JC7 A;  2Y2O A;  3A3E A;  3BFD A;  3TOI A;  1KDS A;  4WBG A;  2X71 A;  4E3L A;  1GHP A;  3ZFZ A;  3PBO A;  4Y0U A;  3LCE A;  2Y2I A;  3Q07 A;  4BL3 A;  3QNB A;  1KGF A;  3GTC A;  5GLB A;  3S22 A;  1FSY A;  4E3I A;  2RCX A;  3BEB A;  1G6A A;  3VSK A;  1LI0 A;  3BM6 A;  5J8X A;  2DNS A;  2XEP A;  4FH2 A;  3AGE A;  4Y7P A;  3V3R A;  2ZQD A;  4E3J A;  1G68 A;  4R3B A;  1BSG A;  3HLW A;  4CPK A;  5EOO A;  3PBS A;  1DJC A;  3HUM A;  4DKI A;  2WK0 A;  4JXG A;  5GL9 A;  1YQS A;  5HX9 A;  4ZJ1 A;  4YIN A;  2R9X A;  5E2G A;  1TDL A;  1JWZ A;  4GD8 A;  3HLG A;  4UHU A;  4BJP A;  3RXW A;  1ESI A;  3GVB A;  3NDE A;  2Y2G A;  3UY6 A;  3WRT A;  1N4O A;  3IH9 A;  1YLZ A;  2WUQ A;  4NK3 A;  4KG6 A;  4DE1 A;  1E4D A;  3MKF A;  4QD4 A;  5CHU A;  1ES5 A;  4PM8 A;  3I7J A;  2HDS A;  3BRM A;  3OPL A;  5HAP A;  3C4P A;  5GLC A;  2PBY A;  2ZLY A;  1TVF A;  5IHV A;  1IYP A;  5KSH A;  1O07 A;  4OLG A;  1PW8 A;  4BD0 A;  3G35 A;  4OPY A;  2QMI A;  2ZQA A;  3O88 A;  1GHM A;  3E2K A;  3GRJ A;  4KQO A;  3HLD A;  4OLD A;  4BD1 A;  5DF9 A;  1ES3 A;  1S6R A;  3UPP A;  4N1H A;  4IBR A;  4QHC A;  4F94 A;  3UDX A;  3FWL A;  5I94 A;  2WAD A;  3OPR A;  4JXV A;  1HZO A;  2ZJ9 A;  3VOY A;  2J8Y A;  1ONG A;  1BLH A;  5EEC A;  5F82 A;  3NC8 A;  3DWK A;  4LV0 A;  2XD5 A;  1WYC A;  3NCK A;  1CI9 A;  2J9P A;  4HEF A;  4LEN A;  3FKV A;  4KQQ A;  4BQM A;  5FI2 A;  2EXB A;  2IWD A;  1U60 A;  3OZH A;  1JVJ A;  3JYI A;  2ZM8 A;  4PPR A;  1GA0 A;  2DCF A;  1ES4 A;  5KZH A;  2Y2H A;  1ERO A;  4B88 A;  3UN7 A;  4DE2 A;  4UA9 A;  4OP5 A;  5D3O A;  5FQ9 A;  1SDN A;  2HDU A;  2ZC5 B;  3VP3 A;  4WEL A;  3G4P A;  1BT5 A;  1K55 C;  4KG5 A;  4Z9Q A;  4L0L A;  4Y0O A;  4EQI A;  4DRT A;  2ZC3 B;  2XQZ A;  4KZ6 A;  4RVA A;  3A3F A;  2OV5 A;  4P87 A;  1PWC A;  1ERQ A;  3ZNT A;  4OH0 A;  3N8L A;  5A91 A;  5FAO A;  3N8R A;  2JE5 A;  1Y54 A;  4OQ0 A;  1K57 C;  1SCW A;  3QNC A;  4BEN A;  3SS4 A;  4K0W A;  2H0Y A;  1PYY A;  4H8R A;  3IWQ A;  2XFS A;  5F1F A;  4KZA A;  2Y59 A;  4XUZ A;  3MBZ A;  5FA7 A;  4S2J A;  2Y2L A;  4U0T A;  3G30 A;  3MZD A;  5FQI A;  5FSR A;  1JWP A;  4JLF A;  4C6Y A;  5EOE A;  3V3S A;  1HD8 A;  1L0F A;  1KE4 A;  1H8Y A;  2Q9N A;  1LHY A;  3NI9 A;  1EI5 A;  1LL9 A;  1HTZ A;  3G2Y A;  2V1Z A;  2EX6 A;  5EPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...