3BLMA

Refined crystal structure of beta-lactamase from staphylococcus aureus pc1 at 2.0
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Refined crystal structure of beta-lactamase from Staphylococcus aureus PC1 at 2.0 A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 94
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1990-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3blmA00
2WGWB 3UDIA 2ZC3B 3FZCA 1NY0A 4ZBEA 1BLHA 4E3NA 4LV0A 1DJBA 3S22A 5CXWA 1O7EA 1YM1A 4PM5A 3ZG9B 1KVMA 2Y55A 4U0TA 5FQJA 5FI7A 4OP5A 3C5AA 1PWGA 2J8YA 3OC2A 4R0QA 5A91A 2XFTA 1TDLA 2HP9A 1E4DA 2Y2MA 3SOIA 1NRFA 1YLYA 1KE0A 5FQMA 4OQIA 4K91A 2H10A 3MXRA 4E6WA 1FCMA 4WMCA 5TR7A 3ZDJA 3G34A 4BJPA 4S2JA 3WS1A 5F1FA 4QB8A 4O7DA 3Q1FA 5DTTA 1BSGA 4GD6A 4X56A 3IHAA 1NXYA 3UNWA 4KZ5A 1AXBA 1FCOA 5CERA 4CPKA 1BLSA 1QMEA 1YLPA 4C75A 5FAPA 3S4XA 2EFXA 1XGIA 1CI8A 1XP4A 4S2KA 2V1ZA 5M19A 5JYPA 5GLCA 4QHCA 3N7WA 3DTMA 5CEBA 1DJAA 1E25A 1ZC2A 5TGFA 4PM8A 4BL3A 4HBUA 1W8QA 4IVIA 4JXSA 3V5MA 1ERQA 4JPMA 4KZ3A 3N8SA 3MBZA 2H5SA 2C5WB 2Y4AA 3HREA 5AQ9A 4OQHA 4EBNA 5FI6A 3UE0A 3NDEA 4MBFA 1FSWA 4OOLA 3VSLA 1NZOA 3A3JA 5A92A 3IHBA 2R9XA 2RCXA 4ZJ2A 4R4SA 4DF6A 4WZ5C 3PTEA 3QHYA 4EWFA 1I2WA 3WRZA 4EUZA 4N9LA 1IELA 1K54C 3G2ZA 5KSCA 4RA7A 2G2UA 1VM1A 1ES3A 2Q9NA 5CTMA 5EOEA 4S2IA 2Y2IA 1ZG4A 4K0WA 4IBXA 4ZJ3A 4KG5A 4WZ4A 4RX3A 4BL2A 2PU4A 3HBRA 4S2NC 3V39A 3V3SA 4S2OA 1GHMA 4JF5A 5G18A 3CZDA 4R3BA 3P09A 3OPLA 4XUXA 2OLVA 3OPPA 1I2SA 2V2FF 2HP6A 3IXDA 4JXWA 1RGYA 4OKPA 4DDSA 3VP1A 3N8LA 5EVIA 2H0YA 2XF3A 3C7UA 1MY8A 2IWDA 3HLBA 4EBPA 2UWXA 1L0GA 2B5RA 2A49A 1G68A 1ERMA 3BFCA 3ZCZA 4MBHA 4N1XA 4OVDA 4UHUA 1GA9A 3SS4A 2FFFB 1YT4A 2XGNA 1MWUA 4QU3A 5GHZA 1YLZA 4JF4A 5EVIB 2WZZA 1K56D 1K57C 3SH8A 4DE1A 1N9BA 3BYDA 1ONHA 4FCFA 4KZ8A 3NIAA 4C3QA 3UDFA 1MWTA 4JXVA 5E2GA 4LCLA 2P9VA 1O07A 1DY6A 1XGJA 1FR6A 1MWSA 4X6TA 2HDSA 5E2HA 1XA1A 4UAAA 3W8KA 1FCNA 1J9MA 2G2WA 3ZG7B 3VP3A 4MLLA 5GHXA 5KMWA 1CEFA 5EECA 3ITBA 4OPRA 3HLWA 2C6WB 3SS5A 1NYMA 2XK1A 3GMWA 3IF6A 5I94A 2P9VB 4IBRA 3LCEA 3CJMA 1CI9A 4PM6A 3VP2A 2HPBA 3NDGA 4Q8IA 3NC8A 3Q81A 3N6IA 4E3KA 1EWZA 5D3OA 4ID4A 3GQZA 1XA7A 1XPBA 3G35A 3IF6B 5DF7A 3V50A 4E3MA 5FAOA 3EQVA 3M6HA 4R1GA 2WK0A 3BM6A 4Y7PA 4WEJA 3IXHA 2XH9A 1BULA 4EQIA 2J9OA 1JTDA 1FSYA 1K6RA 3HLDA 1BZAA 1WYBA 1K4EA 1W7FA 3OPHA 5DTSA 4KZAA 3UO9A 5JYOA 1KVLA 3CG5A 3B3XA 1CEGA 1VQQA 4DRTA 2ZM8A 3VSKA 5AQBA 3VOYA 1K57A 1PW8A 3QNBA 4S2LA 5F83A 3PBOA 1Q2QA 4N92A 3FWLA 5E2EA 1IYOA 5FDHA 3E2LA 4GZBA 1IKIA 3GR2A 1L2SA 4RYEA 4OPZA 4DDYA 3OPRA 1GA0A 2ZQ8A 5A90A 3BFDA 4S2PA 4WM9A 5DVAA 3IH9A 3Q7VA 1ESUA 1LI9A 2XFSA 3MZDA 5AQAA 5EVIC 3A3EA 3N8RA 3MFDA 5CRFA 2XLNA 4P6BA 5DTKA 3JYIA 2ZC4B 4FH2A 2Y2NA 4BD0A 2BLSA 3M2JA 1K38A 2Y2LA 4C6YA 1PI5A 1LL5A 3LY4A 3Q7VB 2XDMA 5HL1A 2EX9A 4OLDA 2PBYA 3UN7A 4E6XA 4JKTA 1IYQA 3OCNA 3GVBA 3Q7ZA 1KDWA 4IEDA 3FYZA 2P74A 3CMZA 3M2KA 4GB7A 3ZFZA 2XR0A 4HEFA 4OOMA 2BG1A 1NYYA 4R4RA 1DJCA 1H8ZA 1TDGA 1BLCA 2Y2OA 3ZNYA 3N4IA 4BENA 3NY4A 5EOOA 3IQAA 3IF6C 1OMEA 3I7JA 4Y0UA 5EPHA 2IWBA 1NJ4A 2FFYA 2WGIA 4GKUA 5CHUA 1BTLA 5GLBA 5HAIA 5CEDA 5A93A 1L0EA 1W79A 4WYYA 3VFFA 1HTZA 4KENB 2JC7A 4P0MA 2DNSA 2Y91A 3IWQA 3VP0A 2PU2A 3WS5A 1HZOA 2VGJA 1YMXA 3BEBA 1YLTA 3S1YA 1K6SA 5M18A 1HVBA 3BLMA 2XD5A 4OP8A 3O87A 2ZM0A 5KSHA 3SS3A 1M40A 3HLGA 2H0TA 4WBGA 1KGEA 3IWOA 1TEMA 1SKFA 1PZPA 1SDEA 2WAFA 5FA7A 3ZVWA 4N1HA 5J8XA 3FV7A 3WS2A 3G31A 4RVAA 3HVFA 5FASA 2WKHA 3W4OA 4MBKA 5EVLA 3HUNA 4FH4A 1MXOA 1YLWA 2OSUA 4FD8A 5HFOA 4B88A 4KZ6A 1KE4A 5HW3A 3IH8A 3LY3A 3PAEA 3BFGA 3QNCA 2JCHA 2J9PA 1YMSA 4M3KA 4OLGA 1PYYA 4X53A 5GLDA 4KQOA 3IXGA 5HAPA 4JF6A 2RL3A 5DF8A 1FOFA 3G4PA 2A3UA 2WKEA 2OV5A 3HUOA 2Y2GA 2Y2QA 1QMFA 4NETA 3A3FA 4GNUA 1RCJA 3MXSA 1E3UD 3M6BA 4PMAA 2ZC7A 2Y2PA 1K56A 1JVJA 3PBQA 5L2FA 1Q2PA 3C4PA 5U47A 5CGXA 2JE5A 2Y2HA 2X01A 1JTGA 4DE3A 4BD1A 1LL9A 3GSGA 4PPRA 2ZMAA 2ZQ7A 2ZM2A 3VOZA 3VP4A 3ZNTA 5CHMA 2ZC6B 2JBFA 3TSGA 4QY5A 1GHPA 2HDUA 1LHYA 2Y59A 4PM7A 1YQSA 2VGKA 1EROA 4P87A 1S6RA 3FKWA 5E43A 4ZAMA 1PWDA 3LO7A 3W4PA 3EQUA 4UA6A 2ZJ9A 5HX9A 4E3IA 3C4OA 1S0WA 1ONGA 1ZKJA 4HBTA 5CECA 1K25A 3BECA 3G30A 5BOHA 3PBTA 3MZEA 1L0DA 3OZHA 4OOYA 1RP5A 2QPNA 4OQGA 4WEKA 3UPPA 1N4OA 3BFFA 2CC1A 4PM9A 5HAQA 4GD8A 1PW1A 2OLUA 4EV4A 4X68A 4QD4A 4S2MA 3UE3A 4F94A 1L0FA 3A3DA 3ISGA 2V20A 1MKIA 1MPLA 1TVFA 3BRMA 1WYCA 5FQ9A 4UA9A 4WMCD 3G32A 1K4FA 5IHVA 4OH0A 1XX2A 3VMAA 3BFEA 3GV9A 1IYPA 2Z2LB 3HL9A 4OONA 2J7VA 5FQQA 4KZ7A 5E2FA 4HESA 5FI2A 2DRWA 3UY6A 2ZQAA 1KGGA 2Y2KA 4GN2A 3C7VA 1IEMA 4A5RA 2WGVA 2WKIA 1ES5A 3HUMA 3OCLA 4OQ0A 1K55A 3ZGAB 3SH9A 1FR1A 4D2OA 4ZDXA 2DCFA 3DWKA 1HD8A 3GRJA 1W5DA 1M6KA 5CGWA 1FQGA 4Z9QA 3P98A 3UDXA 4WELA 1U60A 5KZHA 1EI5A 5GLAA 4KZBA 4LENA 3E2KA 4OPQA 5F82A 1JWPA 1ESIA 5FAQA 2ZLYA 2QZ6A 3D4FA 3PBSA 3AGFA 5FQKA 2E8IA 1H5XA 1SCWA 3HLFA 4ZJ1A 3BLSA 3SH7A 4KZ4A 4DE2A 1Z6FA 3A3IA 4E3LA 2IWCA 3ZHHA 5GHYA 2ZD8A 4LV2A 3ITAA 1RGZA 3RXXA 3HLEA 2EX6A 3Q07A 1H8YA 1MWRA 1SDNA 2QMIA 4EBLA 4MNRA 2HP5A 4P85A 4IVKA 4XXRA 3PBRA 3PBNA 4ZTKA 1XXMA 2EX2A 3MKEA 1C3BA 3LEZA 3WS4A 1W8YA 1YLJA 2XD1A 4FSFA 5CGSA 4YINA 4UA7A 4YFMA 5EE8A 3ZG8B 2ZC5B 4L0LA 4X69A 5FSRA 1KE3A 5M1AA 4BLMA 3O3VA 1PIOA 3DWZA 3PAGA 4K0XA 4QJGA 4NK3A 2X71A 1PWCA 3O86A 4LCMA 1CK3A 2R9WA 2WADA 1PZOA 5EVID 1LLBA 3FKVA 3MKFA 5F1GA 1JWZA 1ALQA 3O88A 3IWIA 3NCKA 4KZ9A 3RXWA 2EFUA 4GDBA 3W4QA 1ES4A 3Q82A 4Y0OA 2GDNA 2XQZA 2WAEA 4X55A 3MZFA 3DW0A 4XUZA 3ZG0A 1WE4A 4KG6A 4KQQA 4GDNA 1I5QA 3V3RA 4JLFA 5HARA 4DKIA 4U3TA 3RJUA 2ZQDA 3TOIA 4B4ZA 1NZUA 2ZQCA 2EXBA 4H8RA 1K55C 1LI0A 1SHVA 4BQMA 1GHIA 4GOGA 4LV1A 4QY6A 4E3OA 3HLCA 1XKZA 4OPYA 3VFHA 2Y2JA 4KQRA 1PI4A 1Y54A 4KG2A 5FATA 4DXBA 4Y0TA 3UPNA 4RX2A 2XEPA 5FQIA 1E3UA 1JWVA 3AGDA 1BT5A 3G2YA 4LV3A 4E3JA 5DF9A 4R3JA 1IYSA 2WZXA 3WS0A 5CHJA 1ZG6A 5EUAA 3IF5A 4U0XA 1MBLA 4JBFA 3IXBA 1G6AA 3NBLA 1BUEA 1KDSA 2X02A 5TFQA 3ZVTA 3WRTA 4MEZA 4DE0A 2HDQA 3NI9A 4WZ5A 3AGEA 5AQ7A 3UPOA 4JXGA 5GL9A 1KGFA 2HDRA 2WYXA 1GCEA 4R23A 3TG9A 1K54A 4N9KA 3IT9A 2WGWA 3ZG5A 3WWXA 4CJNA 2EXAA 2EX8A 2Z2MB 4S2NA 3GTCA 5CTNA 3UE1A 4B4XA 4DXCA 1ES2A 1IKGA 2WUQA 2Q9MA 1BLPA 2I72A 2ZQ9A
chains in the Genus database with same CATH superfamily
3S7NA 2ZC3B 3FZCA 3CI6A 2O9AA 4ZBEA 4E3NA 1O7EA 3ZG9B 1KVMA 1XJ2A 3C5AA 4LRYC 2J8YA 3OC2A 2K7SA 3MQQA 2HP9A 1E4DA 5FQMA 4K91A 1FCMA 2JKTI 4S2JA 3MQOA 4QB8A 2VGLS 2OWJA 3W2ZA 3UNWA 1SKOA 1GSWA 4CPKA 1QMEA 4Q0IA 4HJ3A 1J3WA 3VE4A 1FILA 5M19A 2ACGA 1ZC2A 1E25A 3PYPA 4IUHA 4PM8A 4HBUA 4BL3A 3ZQ5A 1W8QA 3V5MA 3NOUC 1ERQA 1XFQA 3N8SA 2C5WB 3HREA 4GHIB 5FEFA 2PT7A 3DAVA 3IBRA 5TBMB 4OOLA 3VSLA 1NZOA 3A3JA 5F6AA 1LSVA 4WF0A 4DF6A 4EWFA 4N9LA 1IELA 3NOTC 4HJ4A 5KSCA 4Y17A 4PKYG 3CPTA 4K0WA 4KG5A 4WZ4A 4RX3A 4UQIM 2G7UA 4S2NC 1S1ZA 2W3EA 4R3BA 3P09A 5J4EA 3NECA 4XUXA 1I2SA 4F3LB 3UB8A 3VP1A 3N8LA 2W3FA 1MY8A 4G3VA 3R7WA 3PR6A 1G68A 3SS4A 2XGNA 4M4XA 1Y4OA 2WZZA 1K57C 3BYDA 4KZ8A 2VGLM 3UDFA 3BY8A 4JXVA 4ETZA 2IA2A 2VX8A 1O07A 1DY6A 1FR6A 5L10A 4UAAA 2JKRI 2G2WA 5HDSA 3SS5A 4Y13A 2XK1A 3IF6A 4IBRA 1W63Q 3IX8A 3C38A 4PM6A 2HPBA 3NC8A 5D3OA 2VV6A 2Z6DA 5DF7A 1ACFA 3CITA 3T4TA 4EQIA 1K6RA 1BZAA 1WYBA 1K4EA 3OPHA 3CG5A 2B95A 4DRTA 4IHQA 5A8BA 5FDHA 1IKIA 2MJ6A 3GR2A 4RYEA 1GA0A 5IT5A 3A0RA 4WM9A 3MZDA 4P6BA 4BD0A 2Y2LA 1F2KA 1PI5A 3LY4A 2XDMA 3KSGA 4E6XA 1IYQA 3PHYA 3GVBA 1VEUA 1LL8A 3H9WA 4HEFA 4PHTA 2BG1A 1NYYA 3ZNYA 2V0UA 5AVEA 3IF6C 2OOLA 2VV7A 2INWA 4CQHA 5GLBA 1TS0A 5HAIA 2QYBA 4WYYA 4Z1WA 4KENB 5AVFA 3ULFA 2Y91A 3IWQA 2NUPC 1HZOA 1YMXA 1YLTA 1K6SA 3BLMA 4OP8A 3O87A 5KSHA 5HWWA 4HI4A 3SS3A 1M40A 3LIDA 3HLGA 1SKFA 4JGOA 5FA7A 3HUNA 4FH4A 1MXOA 4FD8A 2J80A 4B88A 1KE4A 4DMZA 4H6JA 3IH8A 3LY3A 1T19A 4M3KA 5GLDA 4KQOA 5HAPA 2RL3A 2GX5A 3G4PA 2V8CA 1VB6A 4GNUA 3LGOA 4PMAA 3SZTA 3HCYA 3C4PA 1S4SA 2Y2HA 3GSGA 1ODVA 2ZC6B 3KSIA 3OOVA 2Y59A 1EROA 1PWDA 4O8GA 1ONGA 4RQ9A 3G30A 5L09A 2QJ7A 1RP5A 4WL9A 5HDCA 5HD3A 4O01A 2CC1A 3EEAA 4EV4A 5DFYA 1MPLA 2WKQA 5FQ9A 4WMCD 4NKPA 3BFEA 3E4PA 4OONA 2ZL1B 4KZ7A 3S7QA 5FI2A 3UY6A 3VV4A 2ZQAA 4HHDA 2Y2KA 4OQ0A 3HUMA 2O0YA 5CGWA 1FQGA 2Y79A 3P98A 3UDXA 1EI5A 5GLAA 4KZBA 3E2KA 4IUKA 2QZ6A 3H7WA 4ZJ1A 2VK3A 4L9FA 3A3IA 4R6LA 3ZHHA 5GHYA 3EGXC 4LV2A 3ITAA 1RGZA 3RXXA 1H8YA 3H82A 1OT6A 4MNRA 3LIFA 3PBNA 3HJKA 4FSFA 2XD1A 4YINA 4YFMA 1H0MA 5EE8A 2K31A 4L0LA 5FSRA 1T18A 5M1AA 3PAGA 4MCWA 2R9WA 5EVID 3FKVA 3MKFA 1JWZA 3IWIA 2A24A 3CLOA 4GDBA 1ES4A 2XQZA 3VOLA 5DJUA 2W3DA 4MN5A 3V3RA 3BJNA 2B02A 2VLGA 3IX4A 4Q0HA 3TOIA 3R4KA 4H8RA 1LI0A 2W0NA 4QY6A 4EERA 1Y54A 4DXBA 5FATA 4RX2A 5FQIA 1JWVA 3AGDA 4Y15A 3IF5A 2W1TB 1KDSA 4EEUA 3ZVTA 1F5MA 4WZ5A 2HDRA 2WYXA 1K54A 3ZG5A 3B42A 2Z2MB 4ETXA 3GTCA 4B4XA 1ES2A 2WUQA 1BLHA 2Z6CA 1N9OA 2L4RA 5CXWA 4PM5A 2Y55A 4BBTA 3KSHA 5FQJA 3UB9A 4OP5A 1PWGA 5A91A 4B93A 1NLYA 3SOIA 4OQIA 3FC7A 4WMCA 4YNRA 3LR4A 4O7DA 1NWZA 4X56A 4LFUA 3DTIA 1BLSA 4C75A 1OTDA 1CI8A 4S2KA 2V1ZA 5JYPA 4QHCA 1TD5A 3N7WA 3JPUA 3E0YA 4JPMA 2Y4AA 4P6ZM 5FI6A 3IHBA 2RCXA 4HH2A 3C8CA 4WZ5C 1JNUA 2YKHA 4HJ6A 1I2WA 3WRZA 1K54C 3G2ZA 3F1OA 4RA7A 1ES3A 2Q9NA 4S2IA 2Y2IA 1ZG4A 2JN7A 4ZJ3A 2PU4A 3V39A 1GHMA 3T50A 5G18A 4OKPA 4XT2B 3ICYA 3MS6A 5EVIA 2H0YA 2XF3A 4EEPA 3BY9A 1GA9A 2FFFB 5J3WA 3TJZC 4EESA 4KUOA 4JF4A 1ONHA 4O0PA 5E2GA 2P9VA 3O5YA 4X6TA 2HDSA 3MXQA 3QP5A 1XA1A 2QWSA 2QHKA 1DP6A 3ZG7B 3VP3A 5GHXA 5KMWA 1G6OA 1PRQA 1NYMA 1TS7A 4Q8IA 3LIBA 3Q81A 1N9NA 3QP1A 5K5BA 4ID4A 4E3MA 3M6HA 4UQIS 1NRJA 4Y7PA 4EU0A 2XH9A 1JTDA 5C5KA 4NEED 1W7FA 5EM0A 3UO9A 4HP4A 1KVLA 3B3XA 4CLCE 3ZYTA 1K57A 1NLZA 3QNBA 2O99A 3PBOA 4N92A 5E2EA 3E2LA 1BYWA 3B33A 3OPRA 5FL3A 5A90A 3BFDA 5DVAA 3Q7VA 2L0WA 1ESUA 3FPVA 4PKYA 5AQAA 5EVIC 2XROA 3LIEA 3A3EA 3JYIA 4FH2A 3M2JA 2W1RA 3T4OA 5F68A 3UN7A 4JKTA 2EWWA 4IJGA 1S66L 2P74A 3M2KA 3TW8A 2V9AA 3T4QA 1Z09A 3F1PB 1X0OA 5HD5A 4R4RA 2V1AA 1H8ZA 2OWHA 4BENA 3UMEA 1AWIA 1OMEA 3I7JA 4DJ3A 4WUJA 4X25A 5A93A 1L0EA 1W79A 3VFFA 2JC7A 2DNSA 3NHQA 3WS5A 3D3OA 2VGJA 5KIZA 3S1YA 5M18A 2XD5A 5EV0A 1YSPA 1CQAA 2W3GA 2H0TA 1PZPA 2WAFA 3ZVWA 4N1HA 3EOIA 4I5SA 2Y8HA 4ESPA 5EVLA 2OSUA 1YLWA 3PAEA 2JCHA 5G4YA 1UGUA 3FG8A 3IXGA 4JF6A 3F1NB 5DF8A 4ARZB 3HUOA 2D01A 4NETA 3A3FA 3PBQA 5FDSA 1Q2PA 4G3KA 2OAP1 4YWZA 5U47A 2ZMVA 1JTGA 4GS9A 2ZQ7A 1OT9A 1TF1A 5CHMA 1YAXA 3BW6A 3S7PA 2PYPA 2V0WA 3FKWA 2A2LA 3LO7A 1OJ5A 3EQUA 3K3CA 2EA9A 4UA6A 1ZKJA 5CECA 3BECA 1S67L 2M7VA 1EW0A 2OLUA 4X68A 4QD4A 1L0FA 3A3DA 2XRNA 2V20A 3TE8A 1MKIA 1G5UA 4UA9A 3G32A 5CX7A 4OH0A 1D06A 1KGGA 4A5RA 1IEMA 2WKIA 3SH9A 4ZDXA 2KDKA 1HD8A 1M6KA 1S4RA 1GSXA 3B47A 1T1BA 2V8FA 5F82A 3NOPC 3D4FA 1A0KA 3HLFA 1XJ4A 1ZHHB 3BLSA 5HPIA 3EEHA 1Z6FA 2IWCA 1T1CA 3Q07A 5HWVA 2QMIA 4AFIA 2JHEA 2BTFP 3T4KA 3WS4A 1W8YA 4UA7A 2ZC5B 5HPFA 5HSQA 1KE3A 4LCMA 2WADA 2VA0A 4R70A 3IS2A 1OTBA 3RXWA 2EFUA 3Q82A 3QP4A 3KO6A 2WAEA 3DW0A 4XUZA 1WE4A 4KG6A 4KQQA 5HARA 1SZVA 3RJUA 2PBDP 1NZUA 2EXBA 1OJGA 4LV1A 2Y2JA 3UPNA 1VETB 4E3JA 1IYSA 2WZXA 4CLCB 4MMNA 4U0XA 1MBLA 1G6AA 1BUEA 5TFQA 3WRTA 3AGEA 2J3TD 4EETB 4L9GA 1KGFA 4R23A 3T1XA 3IBJA 3IT9A 1KOUA 2FH5A 3MMHA 1V9YA 3QP6A 2I72A 2ZMFA 2WGWB 4EW7A 1NY0A 2JKGA 3KYZA 4LV0A 4JGQA 1YM1A 4I3IA 2XFTA 1TDLA 1NRFA 3MXRA 4E6WA 1P9RA 5TR7A 3PXPA 3G34A 4BJPA 3RFBA 3Q1FA 5DTTA 3UB5P 4GD6A 1NXYA 3LFVA 4KZ5A 1FCOA 1AXBA 5CERA 5FAPA 1LSXA 3S4XA 2EFXA 1XP4A 4GHIA 2OAQ1 3LEQA 3DTMA 5TBMA 5TGFA 1SKOB 1P9WA 2VEAA 4IVIA 1F9IA 2H5SA 4EBNA 4HQAA 3CUEA 3NDEA 4MBFA 2I9VA 1FSWA 5A92A 5DJTA 2R78A 4EUZA 2HZ5A 2G2UA 1VM1A 1LSWA 4F3LA 4IBXA 3VE3A 3HBRA 3JVVA 3MSHA 3V3SA 1PFLA 4S2OA 4HH3A 3K2NA 3CZDA 3OPLA 3OPPA 2V2FF 3IXDA 4JXWA 4L9EA 3CPTB 4DDSA 3MR0A 3C2WA 4KQDA 2IWDA 3HLBA 3KYQA 4JGRA 3BFCA 1ERMA 3ZCZA 4MBHA 4N1XA 4OVDA 1MWUA 5GHZA 1YLZA 4FCFA 3NIAA 3R7WB 1MWTA 5I5LA 4EXOA 1MWSA 3E98A 5E2HA 5HL6A 2P08A 4P6ZS 4BBUA 4NXGA 3ITBA 3HLWA 2C6WB 5I94A 3GMWA 3LCEA 3VP2A 2GZAA 3NDGA 3N6IA 4E3KA 1EWZA 4NXFA 1XA7A 3G35A 3IF6B 3V50A 3CUEC 2W27A 2WK0A 2Q0OA 3BM6A 4MN7A 2J9OA 3MQ0A 5DTSA 4KZAA 4ME4A 5JYOA 2PD7A 1CEGA 4FOFA 2ZM8A 5AQBA 3VOYA 5F83A 4I3AA 3FWLA 1IYOA 4GZBA 1L2SA 4DDYA 2ZQ8A 3LYXA 4S2PA 3IH9A 1LI9A 2PRFA 3MFDA 5DTKA 4II7A 2Y2NA 4GJ4A 2P7JA 3D9YA 1VHMA 1LL5A 5IS1A 5J7EA 3L7HA 3A0SA 1N9LA 3EWKA 5HL1A 2EX9A 3UB6A 3BQ8A 3Q7ZA 4IEDA 4GB7A 1UWPX 3ZFZA 2XR0A 1DJCA 1TDGA 1VEUB 2HV1A 3IQAA 4MN6A 2IWBA 1NJ4A 5CHUA 1BTLA 5CEDA 3BWLA 3VP0A 4NXBA 2J3TC 3G6OA 1L3LA 3E4QA 4X1MA 4WBGA 1KGEA 1SDEA 2B18A 5J8XA 3G31A 3HVFA 2KX6A 4MBKA 4KZ6A 3BFGA 3QNCA 2J9PA 1YMSA 4OLGA 4X53A 4DN0A 2OV5A 2A3UA 2WKEA 3NULA 2Y2QA 1RCJA 1E3UD 3M6BA 4BMWA 4H6JB 2Y2PA 4HP9A 1JVJA 5CGXA 2X01A 2PYRA 1YSQA 4WN5A 5EM1A 3VOZA 3ZNTA 2WKRA 2JBFA 3OBFA 4QY5A 3TSGA 2HDUA 4PM7A 1YQSA 2VGKA 4P87A 2DMWA 5E43A 3W4PA 4E3IA 1YPRA 4HNBA 3MZEA 1L0DA 4OOYA 3LICA 2QPNA 3UPPA 1N4OA 3BFFA 4B9OA 3KX0X 3P01A 4D60A 4S2MA 3UE3A 4F94A 4LGWA 4X1LA 2ZL1A 3ISGA 4I38A 4UEYA 3BRMA 1WYCA 2PR5A 3IX3A 3A0VA 1WA9A 1K4FA 1XX2A 4QPRA 1HLUP 3GV9A 1IYPA 3HL9A 2J7VA 5FQQA 4HESA 2J3WA 5DFXA 4GN2A 2PDRA 2WGVA 1DRMA 4D2OA 3OCLA 3ZGAB 1K55A 1FR1A 4E04A 2DCFA 3D72A 3DWKA 4R38A 2P04A 3GRJA 1W5DA 2VZWA 1U60A 1JWPA 5FAQA 3JVUA 2ZLYA 5DKKA 3PBSA 3AGFA 3FPWA 4KZ4A 2PD8A 4Q0JA 4DE2A 4E3LA 4CLCC 2PAVP 2O9BA 1SDNA 3H7WB 4EBLA 2AVXA 4IVKA 4XXRA 4ZTKA 1XXMA 4I39A 3EGDC 1IOUA 3MKEA 3P7NA 1G28A 3LR3A 5DKLA 1MKMA 5CGSA 3ZG8B 2VJWA 3H82B 3O3VA 3MFXA 4PAUA 3DWZA 4BBVA 3O86A 2LB9A 5F1GA 3O88A 3NCKA 5AJGA 3W4QA 2GDNA 2HJ9C 4X55A 4EQ1A 2A24B 1CJFA 1I5QA 1H3QA 3DBAA 1YKDA 2ZQDA 4NXEA 2ZQCA 1K55C 1SHVA 4BQMA 1GHIA 4GOGA 4E3OA 2W1TA 3LIAA 3CAXA 3VFHA 4Y0TA 1E3UA 4LPZA 2QKPA 5IU1A 3KYEA 5DF9A 4R3JA 5CHJA 5EUAA 1DP9A 4JBFA 3IXBA 3NBLA 2H28A 2X02A 1OPXA 4MEZA 4DE0A 2HDQA 5AQ7A 3UPOA 4JXGA 5LBRA 5GL9A 1GCEA 3TG9A 1S1YA 2XA7S 1OTAA 2EXAA 4NG2A 1PNEA 5CTNA 3UE1A 3U4LP 4DXCA 1IKGA 2Q9MA 2ZQ9A 3UDIA 2PR6A 1P0ZA 1DJBA 3S22A 1F98A 4U0TA 5FI7A 4R0QA 5HDDA 2Y2MA 1YLYA 4FTXA 1KE0A 2H10A 4YOFA 3ZDJA 3WS1A 5F1FA 1V9ZA 4R3AA 3SW1A 1BSGA 3IHAA 3LR0A 1TS6A 1YLPA 1XGIA 4DJ2A 3BQAA 5GLCA 3T1RA 4GCZA 5CEBA 1DJAA 4JXSA 4KZ3A 5G4ZA 5AQ9A 3MBZA 1T1AA 2E8JA 4OQHA 3UE0A 3LI8A 2R9XA 1STZA 3U2AA 4ZJ2A 4R4SA 5F69A 3GECA 3PTEA 2WKPA 4HOIA 3QHYA 2XA7M 4GW9A 5EOEA 5CTMA 5EFWA 4XT2A 4BL2A 2ZOHA 2VV8A 4Y5FA 4JF5A 4G3WA 3F1OB 1GSVA 2OLVA 2HP6A 2ZBBA 3QP2A 1RGYA 3TRCA 3OLOA 3C7UA 4EBPA 2UWXA 1L0GA 2B5RA 1MZUA 2HF6A 2A49A 4UHUA 1YT4A 4I3JA 4QU3A 5EVIB 1K56D 3SH8A 4DE1A 1N9BA 3DTKA 4EUVA 4Y2FA 4C3QA 5HWTA 4LCLA 1XJ6A 1ZTUA 1XGJA 3W8KA 1Y28A 1FCNA 1J9MA 3LR5A 4JGPA 4MLLA 1CEFA 3LI9A 1P97A 5EECA 4OPRA 2GJ3A 2P9VB 3S7OA 3CJMA 1CI9A 2HJEA 2FZ0A 3UE6A 3GQZA 4HIAA 1XPBA 3HJIA 5FAOA 3EQVA 1XJ3A 4R1GA 2W3HA 4Y3IA 4WEJA 3IXHA 1BULA 1FSYA 3HLDA 2M7UA 4LRXC 2D02A 4LRZE 2VKSA 1LT0A 1VQQA 3UMDA 3VSKA 1PW8A 5EVEA 4S2LA 1Q2QA 4FUWA 3NJAA 5FEGA 1H8MA 4OPZA 2XFSA 4KUKA 3N8RA 5CRFA 2XLNA 2ZC4B 1D1JA 2BLSA 1K38A 3RH8B 3DTEA 4C6YA 2NUTC 3F1PA 3Q7VB 3L9KA 4OLDA 2PBYA 3T4JA 3OCNA 1KDWA 2KLIA 4WLAA 3FYZA 3CMZA 4OOMA 4MDZA 2O9CA 3CHWP 1BLCA 2Y2OA 3N4IA 3K3DA 3NY4A 5EOOA 4Y0UA 2M1CA 5EPHA 2BASA 2FFYA 2WGIA 4GKUA 3MF0A 1HTZA 4P0MA 5F5YA 3V67A 2PU2A 3BEBA 1HVBA 4BWIA 2ZM0A 3LUQA 4GLQA 5L07A 3IWOA 1TEMA 3FV7A 3WS2A 4RVAA 5FASA 2HGVA 3F1NA 2WKHA 5TJJA 3W4OA 4ARZA 1W63M 5HFOA 5HW3A 5L8MA 4CLCD 1PYYA 1FOFA 2Y2GA 1QMFA 3MXSA 2ZC7A 1K56A 5L2FA 2JE5A 3RTYA 4LLOB 4DE3A 4BD1A 1LL9A 2JKFA 4PPRA 2ZM2A 3VP4A 1GHPA 1LHYA 3UB7A 3CWFA 1S6RA 4ZAMA 5MC7A 3T1QB 2ZJ9A 5HX9A 4GS9B 3C4OA 1S0WA 4HBTA 1K25A 2L1MA 5BOHA 3PBTA 3OZHA 3T4LA 4OQGA 3QP8A 4WEKA 1D7EA 4PM9A 5HAQA 4GD8A 4QWOA 1PW1A 1TVFA 3T12B 5IHVA 3VMAA 2Z2LB 5E2FA 2DRWA 1UWNX 3C7VA 1ES5A 1BLPA 2V1BA 3MJQA 1DP8A 4Z9QA 5KZHA 5HZHA 4WELA 4LENA 2LB5A 4OPQA 1ESIA 3T1SA 5FQKA 2E8IA 1H5XA 1SCWA 3SH7A 2JKTM 2ZD8A 3HLEA 2EX6A 1MWRA 2ZOIA 1K0KA 3T4SA 2HP5A 4P85A 3PBRA 2EX2A 1C3BA 3LEZA 1YLJA 1CF0A 2EWVA 4X69A 4BLMA 3E4OA 1PIOA 4QJGA 4K0XA 4NK3A 2X71A 1PWCA 1CK3A 1PZOA 1LLBA 4K08A 1ALQA 2KOIA 4KZ9A 2YKFA 3C30A 2PHYA 4HY8A 4Y0OA 3MZFA 1XFNA 3ZG0A 3IS2B 1IFQA 1TS8A 4GDNA 4JLFA 4DKIA 4U3TA 4B4ZA 2K2NA 1VETA 2CMNA 2GNXA 4CLCA 3HLCA 2XSSA 1XKZA 3GDIA 4OPYA 4KQRA 1PI4A 4KG2A 2XEPA 1BT5A 3G2YA 4LV3A 3WS0A 1ZG6A 1MC0A 4ZRRA 3NI9A 4N9KA 2WGWA 3WWXA 4CJNA 2EX8A 1OTEA 4S2NA 2UV0E 1FIKA 1OTIA 2ZMAA 2QJ5A 3KSFA 2JKRM
chains in the Genus database with same CATH topology
2WGWB 3UDIA 2ZC3B 3FZCA 1NY0A 4ZBEA 1BLHA 4E3NA 4LV0A 1DJBA 3S22A 5CXWA 1O7EA 1YM1A 4PM5A 3ZG9B 1KVMA 2Y55A 4U0TA 5FQJA 5FI7A 4OP5A 3C5AA 1PWGA 2J8YA 3OC2A 4R0QA 5A91A 2XFTA 1TDLA 2HP9A 1E4DA 2Y2MA 3SOIA 1NRFA 1YLYA 1KE0A 5FQMA 4OQIA 4K91A 2H10A 3MXRA 4E6WA 1FCMA 4WMCA 5TR7A 3ZDJA 3G34A 4BJPA 4S2JA 3WS1A 5F1FA 4QB8A 4O7DA 3Q1FA 5DTTA 1BSGA 4GD6A 4X56A 3IHAA 1NXYA 3UNWA 4KZ5A 1AXBA 1FCOA 5CERA 4CPKA 1BLSA 1QMEA 1YLPA 4C75A 5FAPA 3S4XA 2EFXA 1XGIA 1CI8A 1XP4A 4S2KA 2V1ZA 5M19A 5JYPA 5GLCA 4QHCA 3N7WA 3DTMA 5CEBA 1DJAA 1E25A 1ZC2A 5TGFA 4PM8A 4BL3A 4HBUA 1W8QA 4IVIA 4JXSA 3V5MA 1ERQA 4JPMA 4KZ3A 3N8SA 3MBZA 2H5SA 2C5WB 2Y4AA 3HREA 5AQ9A 4OQHA 4EBNA 5FI6A 3UE0A 3NDEA 4MBFA 1FSWA 4OOLA 3VSLA 1NZOA 3A3JA 5A92A 3IHBA 2R9XA 2RCXA 4ZJ2A 4R4SA 4DF6A 4WZ5C 3PTEA 3QHYA 4EWFA 1I2WA 3WRZA 4EUZA 4N9LA 1IELA 1K54C 3G2ZA 5KSCA 4RA7A 2G2UA 1VM1A 1ES3A 2Q9NA 5CTMA 5EOEA 4S2IA 2Y2IA 1ZG4A 4K0WA 4IBXA 4ZJ3A 4KG5A 4WZ4A 4RX3A 4BL2A 2PU4A 3HBRA 4S2NC 3V39A 3V3SA 4S2OA 1GHMA 4JF5A 5G18A 3CZDA 4R3BA 3P09A 3OPLA 4XUXA 2OLVA 3OPPA 1I2SA 2V2FF 2HP6A 3IXDA 4JXWA 1RGYA 4OKPA 4DDSA 3VP1A 3N8LA 5EVIA 2H0YA 2XF3A 3C7UA 1MY8A 2IWDA 3HLBA 4EBPA 2UWXA 1L0GA 2B5RA 2A49A 1G68A 1ERMA 3BFCA 3ZCZA 4MBHA 4N1XA 4OVDA 4UHUA 1GA9A 3SS4A 2FFFB 1YT4A 2XGNA 1MWUA 4QU3A 5GHZA 1YLZA 4JF4A 5EVIB 2WZZA 1K56D 1K57C 3SH8A 4DE1A 1N9BA 3BYDA 1ONHA 4FCFA 4KZ8A 3NIAA 4C3QA 3UDFA 1MWTA 4JXVA 5E2GA 4LCLA 2P9VA 1O07A 1DY6A 1XGJA 1FR6A 1MWSA 4X6TA 2HDSA 5E2HA 1XA1A 4UAAA 3W8KA 1FCNA 1J9MA 2G2WA 3ZG7B 3VP3A 4MLLA 5GHXA 5KMWA 1CEFA 5EECA 3ITBA 4OPRA 3HLWA 2C6WB 3SS5A 1NYMA 2XK1A 3GMWA 3IF6A 5I94A 2P9VB 4IBRA 3LCEA 3CJMA 1CI9A 4PM6A 3VP2A 2HPBA 3NDGA 4Q8IA 3NC8A 3Q81A 3N6IA 4E3KA 1EWZA 5D3OA 4ID4A 3GQZA 1XA7A 1XPBA 3G35A 3IF6B 5DF7A 3V50A 4E3MA 5FAOA 3EQVA 3M6HA 4R1GA 2WK0A 3BM6A 4Y7PA 4WEJA 3IXHA 2XH9A 1BULA 4EQIA 2J9OA 1JTDA 1FSYA 1K6RA 3HLDA 1BZAA 1WYBA 1K4EA 1W7FA 3OPHA 5DTSA 4KZAA 3UO9A 5JYOA 1KVLA 3CG5A 3B3XA 1CEGA 1VQQA 4DRTA 2ZM8A 3VSKA 5AQBA 3VOYA 1K57A 1PW8A 3QNBA 4S2LA 5F83A 3PBOA 1Q2QA 4N92A 3FWLA 5E2EA 1IYOA 5FDHA 3E2LA 4GZBA 1IKIA 3GR2A 1L2SA 4RYEA 4OPZA 4DDYA 3OPRA 1GA0A 2ZQ8A 5A90A 3BFDA 4S2PA 4WM9A 5DVAA 3IH9A 3Q7VA 1ESUA 1LI9A 2XFSA 3MZDA 5AQAA 5EVIC 3A3EA 3N8RA 3MFDA 5CRFA 2XLNA 4P6BA 5DTKA 3JYIA 2ZC4B 4FH2A 2Y2NA 4BD0A 2BLSA 3M2JA 1K38A 2Y2LA 4C6YA 1PI5A 1LL5A 3LY4A 3Q7VB 2XDMA 5HL1A 2EX9A 4OLDA 2PBYA 3UN7A 4E6XA 4JKTA 1IYQA 3OCNA 3GVBA 3Q7ZA 1KDWA 4IEDA 3FYZA 2P74A 3CMZA 3M2KA 4GB7A 3ZFZA 2XR0A 4HEFA 4OOMA 2BG1A 1NYYA 4R4RA 1DJCA 1H8ZA 1TDGA 1BLCA 2Y2OA 3ZNYA 3N4IA 4BENA 3NY4A 5EOOA 3IQAA 3IF6C 1OMEA 3I7JA 4Y0UA 5EPHA 2IWBA 1NJ4A 2FFYA 2WGIA 4GKUA 5CHUA 1BTLA 5GLBA 5HAIA 5CEDA 5A93A 1L0EA 1W79A 4WYYA 3VFFA 1HTZA 4KENB 2JC7A 4P0MA 2DNSA 2Y91A 3IWQA 3VP0A 2PU2A 3WS5A 1HZOA 2VGJA 1YMXA 3BEBA 1YLTA 3S1YA 1K6SA 5M18A 1HVBA 3BLMA 2XD5A 4OP8A 3O87A 2ZM0A 5KSHA 3SS3A 1M40A 3HLGA 2H0TA 4WBGA 1KGEA 3IWOA 1TEMA 1SKFA 1PZPA 1SDEA 2WAFA 5FA7A 3ZVWA 4N1HA 5J8XA 3FV7A 3WS2A 3G31A 4RVAA 3HVFA 5FASA 2WKHA 3W4OA 4MBKA 5EVLA 3HUNA 4FH4A 1MXOA 1YLWA 2OSUA 4FD8A 5HFOA 4B88A 4KZ6A 1KE4A 5HW3A 3IH8A 3LY3A 3PAEA 3BFGA 3QNCA 2JCHA 2J9PA 1YMSA 4M3KA 4OLGA 1PYYA 4X53A 5GLDA 4KQOA 3IXGA 5HAPA 4JF6A 2RL3A 5DF8A 1FOFA 3G4PA 2A3UA 2WKEA 2OV5A 3HUOA 2Y2GA 2Y2QA 1QMFA 4NETA 3A3FA 4GNUA 1RCJA 3MXSA 1E3UD 3M6BA 4PMAA 2ZC7A 2Y2PA 1K56A 1JVJA 3PBQA 5L2FA 1Q2PA 3C4PA 5U47A 5CGXA 2JE5A 2Y2HA 2X01A 1JTGA 4DE3A 4BD1A 1LL9A 3GSGA 4PPRA 2ZMAA 2ZQ7A 2ZM2A 3VOZA 3VP4A 3ZNTA 5CHMA 2ZC6B 2JBFA 3TSGA 4QY5A 1GHPA 2HDUA 1LHYA 2Y59A 4PM7A 1YQSA 2VGKA 1EROA 4P87A 1S6RA 3FKWA 5E43A 4ZAMA 1PWDA 3LO7A 3W4PA 3EQUA 4UA6A 2ZJ9A 5HX9A 4E3IA 3C4OA 1S0WA 1ONGA 1ZKJA 4HBTA 5CECA 1K25A 3BECA 3G30A 5BOHA 3PBTA 3MZEA 1L0DA 3OZHA 4OOYA 1RP5A 2QPNA 4OQGA 4WEKA 3UPPA 1N4OA 3BFFA 2CC1A 4PM9A 5HAQA 4GD8A 1PW1A 2OLUA 4EV4A 4X68A 4QD4A 4S2MA 3UE3A 4F94A 1L0FA 3A3DA 3ISGA 2V20A 1MKIA 1MPLA 1TVFA 3BRMA 1WYCA 5FQ9A 4UA9A 4WMCD 3G32A 1K4FA 5IHVA 4OH0A 1XX2A 3VMAA 3BFEA 3GV9A 1IYPA 2Z2LB 3HL9A 4OONA 2J7VA 5FQQA 4KZ7A 5E2FA 4HESA 5FI2A 2DRWA 3UY6A 2ZQAA 1KGGA 2Y2KA 4GN2A 3C7VA 1IEMA 4A5RA 2WGVA 2WKIA 1ES5A 3HUMA 3OCLA 4OQ0A 1K55A 3ZGAB 3SH9A 1FR1A 4D2OA 4ZDXA 2DCFA 3DWKA 1HD8A 3GRJA 1W5DA 1M6KA 5CGWA 1FQGA 4Z9QA 3P98A 3UDXA 4WELA 1U60A 5KZHA 1EI5A 5GLAA 4KZBA 4LENA 3E2KA 4OPQA 5F82A 1JWPA 1ESIA 5FAQA 2ZLYA 2QZ6A 3D4FA 3PBSA 3AGFA 5FQKA 2E8IA 1H5XA 1SCWA 3HLFA 4ZJ1A 3BLSA 3SH7A 4KZ4A 4DE2A 1Z6FA 3A3IA 4E3LA 2IWCA 3ZHHA 5GHYA 2ZD8A 4LV2A 3ITAA 1RGZA 3RXXA 3HLEA 2EX6A 3Q07A 1H8YA 1MWRA 1SDNA 2QMIA 4EBLA 4MNRA 2HP5A 4P85A 4IVKA 4XXRA 3PBRA 3PBNA 4ZTKA 1XXMA 2EX2A 3MKEA 1C3BA 3LEZA 3WS4A 1W8YA 1YLJA 2XD1A 4FSFA 5CGSA 4YINA 4UA7A 4YFMA 5EE8A 3ZG8B 2ZC5B 4L0LA 4X69A 5FSRA 1KE3A 5M1AA 4BLMA 3O3VA 1PIOA 3DWZA 3PAGA 4K0XA 4QJGA 4NK3A 2X71A 1PWCA 3O86A 4LCMA 1CK3A 2R9WA 2WADA 1PZOA 5EVID 1LLBA 3FKVA 3MKFA 5F1GA 1JWZA 1ALQA 3O88A 3IWIA 3NCKA 4KZ9A 3RXWA 2EFUA 4GDBA 3W4QA 1ES4A 3Q82A 4Y0OA 2GDNA 2XQZA 2WAEA 4X55A 3MZFA 3DW0A 4XUZA 3ZG0A 1WE4A 4KG6A 4KQQA 4GDNA 1I5QA 3V3RA 4JLFA 5HARA 4DKIA 4U3TA 3RJUA 2ZQDA 3TOIA 4B4ZA 1NZUA 2ZQCA 2EXBA 4H8RA 1K55C 1LI0A 1SHVA 4BQMA 1GHIA 4GOGA 4LV1A 4QY6A 4E3OA 3HLCA 1XKZA 4OPYA 3VFHA 2Y2JA 4KQRA 1PI4A 1Y54A 4KG2A 5FATA 4DXBA 4Y0TA 3UPNA 4RX2A 2XEPA 5FQIA 1E3UA 1JWVA 3AGDA 1BT5A 3G2YA 4LV3A 4E3JA 5DF9A 4R3JA 1IYSA 2WZXA 3WS0A 5CHJA 1ZG6A 5EUAA 3IF5A 4U0XA 1MBLA 4JBFA 3IXBA 1G6AA 3NBLA 1BUEA 1KDSA 2X02A 5TFQA 3ZVTA 3WRTA 4MEZA 4DE0A 2HDQA 3NI9A 4WZ5A 3AGEA 5AQ7A 3UPOA 4JXGA 5GL9A 1KGFA 2HDRA 2WYXA 1GCEA 4R23A 3TG9A 1K54A 4N9KA 3IT9A 2WGWA 3ZG5A 3WWXA 4CJNA 2EXAA 2EX8A 2Z2MB 4S2NA 3GTCA 5CTNA 3UE1A 4B4XA 4DXCA 1ES2A 1IKGA 2WUQA 2Q9MA 1BLPA 2I72A 2ZQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WGW B;  3UDI A;  2ZC3 B;  3FZC A;  1NY0 A;  4ZBE A;  1BLH A;  4E3N A;  4LV0 A;  1DJB A;  3S22 A;  5CXW A;  1O7E A;  1YM1 A;  4PM5 A;  3ZG9 B;  1KVM A;  2Y55 A;  4U0T A;  5FQJ A;  5FI7 A;  4OP5 A;  3C5A A;  1PWG A;  2J8Y A;  3OC2 A;  4R0Q A;  5A91 A;  2XFT A;  1TDL A;  2HP9 A;  1E4D A;  2Y2M A;  3SOI A;  1NRF A;  1YLY A;  1KE0 A;  5FQM A;  4OQI A;  4K91 A;  2H10 A;  3MXR A;  4E6W A;  1FCM A;  4WMC A;  5TR7 A;  3ZDJ A;  3G34 A;  4BJP A;  4S2J A;  3WS1 A;  5F1F A;  4QB8 A;  4O7D A;  3Q1F A;  5DTT A;  1BSG A;  4GD6 A;  4X56 A;  3IHA A;  1NXY A;  3UNW A;  4KZ5 A;  1AXB A;  1FCO A;  5CER A;  4CPK A;  1BLS A;  1QME A;  1YLP A;  4C75 A;  5FAP A;  3S4X A;  2EFX A;  1XGI A;  1CI8 A;  1XP4 A;  4S2K A;  2V1Z A;  5M19 A;  5JYP A;  5GLC A;  4QHC A;  3N7W A;  3DTM A;  5CEB A;  1DJA A;  1E25 A;  1ZC2 A;  5TGF A;  4PM8 A;  4BL3 A;  4HBU A;  1W8Q A;  4IVI A;  4JXS A;  3V5M A;  1ERQ A;  4JPM A;  4KZ3 A;  3N8S A;  3MBZ A;  2H5S A;  2C5W B;  2Y4A A;  3HRE A;  5AQ9 A;  4OQH A;  4EBN A;  5FI6 A;  3UE0 A;  3NDE A;  4MBF A;  1FSW A;  4OOL A;  3VSL A;  1NZO A;  3A3J A;  5A92 A;  3IHB A;  2R9X A;  2RCX A;  4ZJ2 A;  4R4S A;  4DF6 A;  4WZ5 C;  3PTE A;  3QHY A;  4EWF A;  1I2W A;  3WRZ A;  4EUZ A;  4N9L A;  1IEL A;  1K54 C;  3G2Z A;  5KSC A;  4RA7 A;  2G2U A;  1VM1 A;  1ES3 A;  2Q9N A;  5CTM A;  5EOE A;  4S2I A;  2Y2I A;  1ZG4 A;  4K0W A;  4IBX A;  4ZJ3 A;  4KG5 A;  4WZ4 A;  4RX3 A;  4BL2 A;  2PU4 A;  3HBR A;  4S2N C;  3V39 A;  3V3S A;  4S2O A;  1GHM A;  4JF5 A;  5G18 A;  3CZD A;  4R3B A;  3P09 A;  3OPL A;  4XUX A;  2OLV A;  3OPP A;  1I2S A;  2V2F F;  2HP6 A;  3IXD A;  4JXW A;  1RGY A;  4OKP A;  4DDS A;  3VP1 A;  3N8L A;  5EVI A;  2H0Y A;  2XF3 A;  3C7U A;  1MY8 A;  2IWD A;  3HLB A;  4EBP A;  2UWX A;  1L0G A;  2B5R A;  2A49 A;  1G68 A;  1ERM A;  3BFC A;  3ZCZ A;  4MBH A;  4N1X A;  4OVD A;  4UHU A;  1GA9 A;  3SS4 A;  2FFF B;  1YT4 A;  2XGN A;  1MWU A;  4QU3 A;  5GHZ A;  1YLZ A;  4JF4 A;  5EVI B;  2WZZ A;  1K56 D;  1K57 C;  3SH8 A;  4DE1 A;  1N9B A;  3BYD A;  1ONH A;  4FCF A;  4KZ8 A;  3NIA A;  4C3Q A;  3UDF A;  1MWT A;  4JXV A;  5E2G A;  4LCL A;  2P9V A;  1O07 A;  1DY6 A;  1XGJ A;  1FR6 A;  1MWS A;  4X6T A;  2HDS A;  5E2H A;  1XA1 A;  4UAA A;  3W8K A;  1FCN A;  1J9M A;  2G2W A;  3ZG7 B;  3VP3 A;  4MLL A;  5GHX A;  5KMW A;  1CEF A;  5EEC A;  3ITB A;  4OPR A;  3HLW A;  2C6W B;  3SS5 A;  1NYM A;  2XK1 A;  3GMW A;  3IF6 A;  5I94 A;  2P9V B;  4IBR A;  3LCE A;  3CJM A;  1CI9 A;  4PM6 A;  3VP2 A;  2HPB A;  3NDG A;  4Q8I A;  3NC8 A;  3Q81 A;  3N6I A;  4E3K A;  1EWZ A;  5D3O A;  4ID4 A;  3GQZ A;  1XA7 A;  1XPB A;  3G35 A;  3IF6 B;  5DF7 A;  3V50 A;  4E3M A;  5FAO A;  3EQV A;  3M6H A;  4R1G A;  2WK0 A;  3BM6 A;  4Y7P A;  4WEJ A;  3IXH A;  2XH9 A;  1BUL A;  4EQI A;  2J9O A;  1JTD A;  1FSY A;  1K6R A;  3HLD A;  1BZA A;  1WYB A;  1K4E A;  1W7F A;  3OPH A;  5DTS A;  4KZA A;  3UO9 A;  5JYO A;  1KVL A;  3CG5 A;  3B3X A;  1CEG A;  1VQQ A;  4DRT A;  2ZM8 A;  3VSK A;  5AQB A;  3VOY A;  1K57 A;  1PW8 A;  3QNB A;  4S2L A;  5F83 A;  3PBO A;  1Q2Q A;  4N92 A;  3FWL A;  5E2E A;  1IYO A;  5FDH A;  3E2L A;  4GZB A;  1IKI A;  3GR2 A;  1L2S A;  4RYE A;  4OPZ A;  4DDY A;  3OPR A;  1GA0 A;  2ZQ8 A;  5A90 A;  3BFD A;  4S2P A;  4WM9 A;  5DVA A;  3IH9 A;  3Q7V A;  1ESU A;  1LI9 A;  2XFS A;  3MZD A;  5AQA A;  5EVI C;  3A3E A;  3N8R A;  3MFD A;  5CRF A;  2XLN A;  4P6B A;  5DTK A;  3JYI A;  2ZC4 B;  4FH2 A;  2Y2N A;  4BD0 A;  2BLS A;  3M2J A;  1K38 A;  2Y2L A;  4C6Y A;  1PI5 A;  1LL5 A;  3LY4 A;  3Q7V B;  2XDM A;  5HL1 A;  2EX9 A;  4OLD A;  2PBY A;  3UN7 A;  4E6X A;  4JKT A;  1IYQ A;  3OCN A;  3GVB A;  3Q7Z A;  1KDW A;  4IED A;  3FYZ A;  2P74 A;  3CMZ A;  3M2K A;  4GB7 A;  3ZFZ A;  2XR0 A;  4HEF A;  4OOM A;  2BG1 A;  1NYY A;  4R4R A;  1DJC A;  1H8Z A;  1TDG A;  1BLC A;  2Y2O A;  3ZNY A;  3N4I A;  4BEN A;  3NY4 A;  5EOO A;  3IQA A;  3IF6 C;  1OME A;  3I7J A;  4Y0U A;  5EPH A;  2IWB A;  1NJ4 A;  2FFY A;  2WGI A;  4GKU A;  5CHU A;  1BTL A;  5GLB A;  5HAI A;  5CED A;  5A93 A;  1L0E A;  1W79 A;  4WYY A;  3VFF A;  1HTZ A;  4KEN B;  2JC7 A;  4P0M A;  2DNS A;  2Y91 A;  3IWQ A;  3VP0 A;  2PU2 A;  3WS5 A;  1HZO A;  2VGJ A;  1YMX A;  3BEB A;  1YLT A;  3S1Y A;  1K6S A;  5M18 A;  1HVB A;  3BLM A;  2XD5 A;  4OP8 A;  3O87 A;  2ZM0 A;  5KSH A;  3SS3 A;  1M40 A;  3HLG A;  2H0T A;  4WBG A;  1KGE A;  3IWO A;  1TEM A;  1SKF A;  1PZP A;  1SDE A;  2WAF A;  5FA7 A;  3ZVW A;  4N1H A;  5J8X A;  3FV7 A;  3WS2 A;  3G31 A;  4RVA A;  3HVF A;  5FAS A;  2WKH A;  3W4O A;  4MBK A;  5EVL A;  3HUN A;  4FH4 A;  1MXO A;  1YLW A;  2OSU A;  4FD8 A;  5HFO A;  4B88 A;  4KZ6 A;  1KE4 A;  5HW3 A;  3IH8 A;  3LY3 A;  3PAE A;  3BFG A;  3QNC A;  2JCH A;  2J9P A;  1YMS A;  4M3K A;  4OLG A;  1PYY A;  4X53 A;  5GLD A;  4KQO A;  3IXG A;  5HAP A;  4JF6 A;  2RL3 A;  5DF8 A;  1FOF A;  3G4P A;  2A3U A;  2WKE A;  2OV5 A;  3HUO A;  2Y2G A;  2Y2Q A;  1QMF A;  4NET A;  3A3F A;  4GNU A;  1RCJ A;  3MXS A;  1E3U D;  3M6B A;  4PMA A;  2ZC7 A;  2Y2P A;  1K56 A;  1JVJ A;  3PBQ A;  5L2F A;  1Q2P A;  3C4P A;  5U47 A;  5CGX A;  2JE5 A;  2Y2H A;  2X01 A;  1JTG A;  4DE3 A;  4BD1 A;  1LL9 A;  3GSG A;  4PPR A;  2ZMA A;  2ZQ7 A;  2ZM2 A;  3VOZ A;  3VP4 A;  3ZNT A;  5CHM A;  2ZC6 B;  2JBF A;  3TSG A;  4QY5 A;  1GHP A;  2HDU A;  1LHY A;  2Y59 A;  4PM7 A;  1YQS A;  2VGK A;  1ERO A;  4P87 A;  1S6R A;  3FKW A;  5E43 A;  4ZAM A;  1PWD A;  3LO7 A;  3W4P A;  3EQU A;  4UA6 A;  2ZJ9 A;  5HX9 A;  4E3I A;  3C4O A;  1S0W A;  1ONG A;  1ZKJ A;  4HBT A;  5CEC A;  1K25 A;  3BEC A;  3G30 A;  5BOH A;  3PBT A;  3MZE A;  1L0D A;  3OZH A;  4OOY A;  1RP5 A;  2QPN A;  4OQG A;  4WEK A;  3UPP A;  1N4O A;  3BFF A;  2CC1 A;  4PM9 A;  5HAQ A;  4GD8 A;  1PW1 A;  2OLU A;  4EV4 A;  4X68 A;  4QD4 A;  4S2M A;  3UE3 A;  4F94 A;  1L0F A;  3A3D A;  3ISG A;  2V20 A;  1MKI A;  1MPL A;  1TVF A;  3BRM A;  1WYC A;  5FQ9 A;  4UA9 A;  4WMC D;  3G32 A;  1K4F A;  5IHV A;  4OH0 A;  1XX2 A;  3VMA A;  3BFE A;  3GV9 A;  1IYP A;  2Z2L B;  3HL9 A;  4OON A;  2J7V A;  5FQQ A;  4KZ7 A;  5E2F A;  4HES A;  5FI2 A;  2DRW A;  3UY6 A;  2ZQA A;  1KGG A;  2Y2K A;  4GN2 A;  3C7V A;  1IEM A;  4A5R A;  2WGV A;  2WKI A;  1ES5 A;  3HUM A;  3OCL A;  4OQ0 A;  1K55 A;  3ZGA B;  3SH9 A;  1FR1 A;  4D2O A;  4ZDX A;  2DCF A;  3DWK A;  1HD8 A;  3GRJ A;  1W5D A;  1M6K A;  5CGW A;  1FQG A;  4Z9Q A;  3P98 A;  3UDX A;  4WEL A;  1U60 A;  5KZH A;  1EI5 A;  5GLA A;  4KZB A;  4LEN A;  3E2K A;  4OPQ A;  5F82 A;  1JWP A;  1ESI A;  5FAQ A;  2ZLY A;  2QZ6 A;  3D4F A;  3PBS A;  3AGF A;  5FQK A;  2E8I A;  1H5X A;  1SCW A;  3HLF A;  4ZJ1 A;  3BLS A;  3SH7 A;  4KZ4 A;  4DE2 A;  1Z6F A;  3A3I A;  4E3L A;  2IWC A;  3ZHH A;  5GHY A;  2ZD8 A;  4LV2 A;  3ITA A;  1RGZ A;  3RXX A;  3HLE A;  2EX6 A;  3Q07 A;  1H8Y A;  1MWR A;  1SDN A;  2QMI A;  4EBL A;  4MNR A;  2HP5 A;  4P85 A;  4IVK A;  4XXR A;  3PBR A;  3PBN A;  4ZTK A;  1XXM A;  2EX2 A;  3MKE A;  1C3B A;  3LEZ A;  3WS4 A;  1W8Y A;  1YLJ A;  2XD1 A;  4FSF A;  5CGS A;  4YIN A;  4UA7 A;  4YFM A;  5EE8 A;  3ZG8 B;  2ZC5 B;  4L0L A;  4X69 A;  5FSR A;  1KE3 A;  5M1A A;  4BLM A;  3O3V A;  1PIO A;  3DWZ A;  3PAG A;  4K0X A;  4QJG A;  4NK3 A;  2X71 A;  1PWC A;  3O86 A;  4LCM A;  1CK3 A;  2R9W A;  2WAD A;  1PZO A;  5EVI D;  1LLB A;  3FKV A;  3MKF A;  5F1G A;  1JWZ A;  1ALQ A;  3O88 A;  3IWI A;  3NCK A;  4KZ9 A;  3RXW A;  2EFU A;  4GDB A;  3W4Q A;  1ES4 A;  3Q82 A;  4Y0O A;  2GDN A;  2XQZ A;  2WAE A;  4X55 A;  3MZF A;  3DW0 A;  4XUZ A;  3ZG0 A;  1WE4 A;  4KG6 A;  4KQQ A;  4GDN A;  1I5Q A;  3V3R A;  4JLF A;  5HAR A;  4DKI A;  4U3T A;  3RJU A;  2ZQD A;  3TOI A;  4B4Z A;  1NZU A;  2ZQC A;  2EXB A;  4H8R A;  1K55 C;  1LI0 A;  1SHV A;  4BQM A;  1GHI A;  4GOG A;  4LV1 A;  4QY6 A;  4E3O A;  3HLC A;  1XKZ A;  4OPY A;  3VFH A;  2Y2J A;  4KQR A;  1PI4 A;  1Y54 A;  4KG2 A;  5FAT A;  4DXB A;  4Y0T A;  3UPN A;  4RX2 A;  2XEP A;  5FQI A;  1E3U A;  1JWV A;  3AGD A;  1BT5 A;  3G2Y A;  4LV3 A;  4E3J A;  5DF9 A;  4R3J A;  1IYS A;  2WZX A;  3WS0 A;  5CHJ A;  1ZG6 A;  5EUA A;  3IF5 A;  4U0X A;  1MBL A;  4JBF A;  3IXB A;  1G6A A;  3NBL A;  1BUE A;  1KDS A;  2X02 A;  5TFQ A;  3ZVT A;  3WRT A;  4MEZ A;  4DE0 A;  2HDQ A;  3NI9 A;  4WZ5 A;  3AGE A;  5AQ7 A;  3UPO A;  4JXG A;  5GL9 A;  1KGF A;  2HDR A;  2WYX A;  1GCE A;  4R23 A;  3TG9 A;  1K54 A;  4N9K A;  3IT9 A;  2WGW A;  3ZG5 A;  3WWX A;  4CJN A;  2EXA A;  2EX8 A;  2Z2M B;  4S2N A;  3GTC A;  5CTN A;  3UE1 A;  4B4X A;  4DXC A;  1ES2 A;  1IKG A;  2WUQ A;  2Q9M A;  1BLP A;  2I72 A;  2ZQ9 A; 
#chains in the Genus database with same CATH topology
 3S7N A;  2ZC3 B;  3FZC A;  3CI6 A;  2O9A A;  4ZBE A;  4E3N A;  1O7E A;  3ZG9 B;  1KVM A;  1XJ2 A;  3C5A A;  4LRY C;  2J8Y A;  3OC2 A;  2K7S A;  3MQQ A;  2HP9 A;  1E4D A;  5FQM A;  4K91 A;  1FCM A;  2JKT I;  4S2J A;  3MQO A;  4QB8 A;  2VGL S;  2OWJ A;  3W2Z A;  3UNW A;  1SKO A;  1GSW A;  4CPK A;  1QME A;  4Q0I A;  4HJ3 A;  1J3W A;  3VE4 A;  1FIL A;  5M19 A;  2ACG A;  1ZC2 A;  1E25 A;  3PYP A;  4IUH A;  4PM8 A;  4HBU A;  4BL3 A;  3ZQ5 A;  1W8Q A;  3V5M A;  3NOU C;  1ERQ A;  1XFQ A;  3N8S A;  2C5W B;  3HRE A;  4GHI B;  5FEF A;  2PT7 A;  3DAV A;  3IBR A;  5TBM B;  4OOL A;  3VSL A;  1NZO A;  3A3J A;  5F6A A;  1LSV A;  4WF0 A;  4DF6 A;  4EWF A;  4N9L A;  1IEL A;  3NOT C;  4HJ4 A;  5KSC A;  4Y17 A;  4PKY G;  3CPT A;  4K0W A;  4KG5 A;  4WZ4 A;  4RX3 A;  4UQI M;  2G7U A;  4S2N C;  1S1Z A;  2W3E A;  4R3B A;  3P09 A;  5J4E A;  3NEC A;  4XUX A;  1I2S A;  4F3L B;  3UB8 A;  3VP1 A;  3N8L A;  2W3F A;  1MY8 A;  4G3V A;  3R7W A;  3PR6 A;  1G68 A;  3SS4 A;  2XGN A;  4M4X A;  1Y4O A;  2WZZ A;  1K57 C;  3BYD A;  4KZ8 A;  2VGL M;  3UDF A;  3BY8 A;  4JXV A;  4ETZ A;  2IA2 A;  2VX8 A;  1O07 A;  1DY6 A;  1FR6 A;  5L10 A;  4UAA A;  2JKR I;  2G2W A;  5HDS A;  3SS5 A;  4Y13 A;  2XK1 A;  3IF6 A;  4IBR A;  1W63 Q;  3IX8 A;  3C38 A;  4PM6 A;  2HPB A;  3NC8 A;  5D3O A;  2VV6 A;  2Z6D A;  5DF7 A;  1ACF A;  3CIT A;  3T4T A;  4EQI A;  1K6R A;  1BZA A;  1WYB A;  1K4E A;  3OPH A;  3CG5 A;  2B95 A;  4DRT A;  4IHQ A;  5A8B A;  5FDH A;  1IKI A;  2MJ6 A;  3GR2 A;  4RYE A;  1GA0 A;  5IT5 A;  3A0R A;  4WM9 A;  3MZD A;  4P6B A;  4BD0 A;  2Y2L A;  1F2K A;  1PI5 A;  3LY4 A;  2XDM A;  3KSG A;  4E6X A;  1IYQ A;  3PHY A;  3GVB A;  1VEU A;  1LL8 A;  3H9W A;  4HEF A;  4PHT A;  2BG1 A;  1NYY A;  3ZNY A;  2V0U A;  5AVE A;  3IF6 C;  2OOL A;  2VV7 A;  2INW A;  4CQH A;  5GLB A;  1TS0 A;  5HAI A;  2QYB A;  4WYY A;  4Z1W A;  4KEN B;  5AVF A;  3ULF A;  2Y91 A;  3IWQ A;  2NUP C;  1HZO A;  1YMX A;  1YLT A;  1K6S A;  3BLM A;  4OP8 A;  3O87 A;  5KSH A;  5HWW A;  4HI4 A;  3SS3 A;  1M40 A;  3LID A;  3HLG A;  1SKF A;  4JGO A;  5FA7 A;  3HUN A;  4FH4 A;  1MXO A;  4FD8 A;  2J80 A;  4B88 A;  1KE4 A;  4DMZ A;  4H6J A;  3IH8 A;  3LY3 A;  1T19 A;  4M3K A;  5GLD A;  4KQO A;  5HAP A;  2RL3 A;  2GX5 A;  3G4P A;  2V8C A;  1VB6 A;  4GNU A;  3LGO A;  4PMA A;  3SZT A;  3HCY A;  3C4P A;  1S4S A;  2Y2H A;  3GSG A;  1ODV A;  2ZC6 B;  3KSI A;  3OOV A;  2Y59 A;  1ERO A;  1PWD A;  4O8G A;  1ONG A;  4RQ9 A;  3G30 A;  5L09 A;  2QJ7 A;  1RP5 A;  4WL9 A;  5HDC A;  5HD3 A;  4O01 A;  2CC1 A;  3EEA A;  4EV4 A;  5DFY A;  1MPL A;  2WKQ A;  5FQ9 A;  4WMC D;  4NKP A;  3BFE A;  3E4P A;  4OON A;  2ZL1 B;  4KZ7 A;  3S7Q A;  5FI2 A;  3UY6 A;  3VV4 A;  2ZQA A;  4HHD A;  2Y2K A;  4OQ0 A;  3HUM A;  2O0Y A;  5CGW A;  1FQG A;  2Y79 A;  3P98 A;  3UDX A;  1EI5 A;  5GLA A;  4KZB A;  3E2K A;  4IUK A;  2QZ6 A;  3H7W A;  4ZJ1 A;  2VK3 A;  4L9F A;  3A3I A;  4R6L A;  3ZHH A;  5GHY A;  3EGX C;  4LV2 A;  3ITA A;  1RGZ A;  3RXX A;  1H8Y A;  3H82 A;  1OT6 A;  4MNR A;  3LIF A;  3PBN A;  3HJK A;  4FSF A;  2XD1 A;  4YIN A;  4YFM A;  1H0M A;  5EE8 A;  2K31 A;  4L0L A;  5FSR A;  1T18 A;  5M1A A;  3PAG A;  4MCW A;  2R9W A;  5EVI D;  3FKV A;  3MKF A;  1JWZ A;  3IWI A;  2A24 A;  3CLO A;  4GDB A;  1ES4 A;  2XQZ A;  3VOL A;  5DJU A;  2W3D A;  4MN5 A;  3V3R A;  3BJN A;  2B02 A;  2VLG A;  3IX4 A;  4Q0H A;  3TOI A;  3R4K A;  4H8R A;  1LI0 A;  2W0N A;  4QY6 A;  4EER A;  1Y54 A;  4DXB A;  5FAT A;  4RX2 A;  5FQI A;  1JWV A;  3AGD A;  4Y15 A;  3IF5 A;  2W1T B;  1KDS A;  4EEU A;  3ZVT A;  1F5M A;  4WZ5 A;  2HDR A;  2WYX A;  1K54 A;  3ZG5 A;  3B42 A;  2Z2M B;  4ETX A;  3GTC A;  4B4X A;  1ES2 A;  2WUQ A;  1BLH A;  2Z6C A;  1N9O A;  2L4R A;  5CXW A;  4PM5 A;  2Y55 A;  4BBT A;  3KSH A;  5FQJ A;  3UB9 A;  4OP5 A;  1PWG A;  5A91 A;  4B93 A;  1NLY A;  3SOI A;  4OQI A;  3FC7 A;  4WMC A;  4YNR A;  3LR4 A;  4O7D A;  1NWZ A;  4X56 A;  4LFU A;  3DTI A;  1BLS A;  4C75 A;  1OTD A;  1CI8 A;  4S2K A;  2V1Z A;  5JYP A;  4QHC A;  1TD5 A;  3N7W A;  3JPU A;  3E0Y A;  4JPM A;  2Y4A A;  4P6Z M;  5FI6 A;  3IHB A;  2RCX A;  4HH2 A;  3C8C A;  4WZ5 C;  1JNU A;  2YKH A;  4HJ6 A;  1I2W A;  3WRZ A;  1K54 C;  3G2Z A;  3F1O A;  4RA7 A;  1ES3 A;  2Q9N A;  4S2I A;  2Y2I A;  1ZG4 A;  2JN7 A;  4ZJ3 A;  2PU4 A;  3V39 A;  1GHM A;  3T50 A;  5G18 A;  4OKP A;  4XT2 B;  3ICY A;  3MS6 A;  5EVI A;  2H0Y A;  2XF3 A;  4EEP A;  3BY9 A;  1GA9 A;  2FFF B;  5J3W A;  3TJZ C;  4EES A;  4KUO A;  4JF4 A;  1ONH A;  4O0P A;  5E2G A;  2P9V A;  3O5Y A;  4X6T A;  2HDS A;  3MXQ A;  3QP5 A;  1XA1 A;  2QWS A;  2QHK A;  1DP6 A;  3ZG7 B;  3VP3 A;  5GHX A;  5KMW A;  1G6O A;  1PRQ A;  1NYM A;  1TS7 A;  4Q8I A;  3LIB A;  3Q81 A;  1N9N A;  3QP1 A;  5K5B A;  4ID4 A;  4E3M A;  3M6H A;  4UQI S;  1NRJ A;  4Y7P A;  4EU0 A;  2XH9 A;  1JTD A;  5C5K A;  4NEE D;  1W7F A;  5EM0 A;  3UO9 A;  4HP4 A;  1KVL A;  3B3X A;  4CLC E;  3ZYT A;  1K57 A;  1NLZ A;  3QNB A;  2O99 A;  3PBO A;  4N92 A;  5E2E A;  3E2L A;  1BYW A;  3B33 A;  3OPR A;  5FL3 A;  5A90 A;  3BFD A;  5DVA A;  3Q7V A;  2L0W A;  1ESU A;  3FPV A;  4PKY A;  5AQA A;  5EVI C;  2XRO A;  3LIE A;  3A3E A;  3JYI A;  4FH2 A;  3M2J A;  2W1R A;  3T4O A;  5F68 A;  3UN7 A;  4JKT A;  2EWW A;  4IJG A;  1S66 L;  2P74 A;  3M2K A;  3TW8 A;  2V9A A;  3T4Q A;  1Z09 A;  3F1P B;  1X0O A;  5HD5 A;  4R4R A;  2V1A A;  1H8Z A;  2OWH A;  4BEN A;  3UME A;  1AWI A;  1OME A;  3I7J A;  4DJ3 A;  4WUJ A;  4X25 A;  5A93 A;  1L0E A;  1W79 A;  3VFF A;  2JC7 A;  2DNS A;  3NHQ A;  3WS5 A;  3D3O A;  2VGJ A;  5KIZ A;  3S1Y A;  5M18 A;  2XD5 A;  5EV0 A;  1YSP A;  1CQA A;  2W3G A;  2H0T A;  1PZP A;  2WAF A;  3ZVW A;  4N1H A;  3EOI A;  4I5S A;  2Y8H A;  4ESP A;  5EVL A;  2OSU A;  1YLW A;  3PAE A;  2JCH A;  5G4Y A;  1UGU A;  3FG8 A;  3IXG A;  4JF6 A;  3F1N B;  5DF8 A;  4ARZ B;  3HUO A;  2D01 A;  4NET A;  3A3F A;  3PBQ A;  5FDS A;  1Q2P A;  4G3K A;  2OAP 1;  4YWZ A;  5U47 A;  2ZMV A;  1JTG A;  4GS9 A;  2ZQ7 A;  1OT9 A;  1TF1 A;  5CHM A;  1YAX A;  3BW6 A;  3S7P A;  2PYP A;  2V0W A;  3FKW A;  2A2L A;  3LO7 A;  1OJ5 A;  3EQU A;  3K3C A;  2EA9 A;  4UA6 A;  1ZKJ A;  5CEC A;  3BEC A;  1S67 L;  2M7V A;  1EW0 A;  2OLU A;  4X68 A;  4QD4 A;  1L0F A;  3A3D A;  2XRN A;  2V20 A;  3TE8 A;  1MKI A;  1G5U A;  4UA9 A;  3G32 A;  5CX7 A;  4OH0 A;  1D06 A;  1KGG A;  4A5R A;  1IEM A;  2WKI A;  3SH9 A;  4ZDX A;  2KDK A;  1HD8 A;  1M6K A;  1S4R A;  1GSX A;  3B47 A;  1T1B A;  2V8F A;  5F82 A;  3NOP C;  3D4F A;  1A0K A;  3HLF A;  1XJ4 A;  1ZHH B;  3BLS A;  5HPI A;  3EEH A;  1Z6F A;  2IWC A;  1T1C A;  3Q07 A;  5HWV A;  2QMI A;  4AFI A;  2JHE A;  2BTF P;  3T4K A;  3WS4 A;  1W8Y A;  4UA7 A;  2ZC5 B;  5HPF A;  5HSQ A;  1KE3 A;  4LCM A;  2WAD A;  2VA0 A;  4R70 A;  3IS2 A;  1OTB A;  3RXW A;  2EFU A;  3Q82 A;  3QP4 A;  3KO6 A;  2WAE A;  3DW0 A;  4XUZ A;  1WE4 A;  4KG6 A;  4KQQ A;  5HAR A;  1SZV A;  3RJU A;  2PBD P;  1NZU A;  2EXB A;  1OJG A;  4LV1 A;  2Y2J A;  3UPN A;  1VET B;  4E3J A;  1IYS A;  2WZX A;  4CLC B;  4MMN A;  4U0X A;  1MBL A;  1G6A A;  1BUE A;  5TFQ A;  3WRT A;  3AGE A;  2J3T D;  4EET B;  4L9G A;  1KGF A;  4R23 A;  3T1X A;  3IBJ A;  3IT9 A;  1KOU A;  2FH5 A;  3MMH A;  1V9Y A;  3QP6 A;  2I72 A;  2ZMF A;  2WGW B;  4EW7 A;  1NY0 A;  2JKG A;  3KYZ A;  4LV0 A;  4JGQ A;  1YM1 A;  4I3I A;  2XFT A;  1TDL A;  1NRF A;  3MXR A;  4E6W A;  1P9R A;  5TR7 A;  3PXP A;  3G34 A;  4BJP A;  3RFB A;  3Q1F A;  5DTT A;  3UB5 P;  4GD6 A;  1NXY A;  3LFV A;  4KZ5 A;  1FCO A;  1AXB A;  5CER A;  5FAP A;  1LSX A;  3S4X A;  2EFX A;  1XP4 A;  4GHI A;  2OAQ 1;  3LEQ A;  3DTM A;  5TBM A;  5TGF A;  1SKO B;  1P9W A;  2VEA A;  4IVI A;  1F9I A;  2H5S A;  4EBN A;  4HQA A;  3CUE A;  3NDE A;  4MBF A;  2I9V A;  1FSW A;  5A92 A;  5DJT A;  2R78 A;  4EUZ A;  2HZ5 A;  2G2U A;  1VM1 A;  1LSW A;  4F3L A;  4IBX A;  3VE3 A;  3HBR A;  3JVV A;  3MSH A;  3V3S A;  1PFL A;  4S2O A;  4HH3 A;  3K2N A;  3CZD A;  3OPL A;  3OPP A;  2V2F F;  3IXD A;  4JXW A;  4L9E A;  3CPT B;  4DDS A;  3MR0 A;  3C2W A;  4KQD A;  2IWD A;  3HLB A;  3KYQ A;  4JGR A;  3BFC A;  1ERM A;  3ZCZ A;  4MBH A;  4N1X A;  4OVD A;  1MWU A;  5GHZ A;  1YLZ A;  4FCF A;  3NIA A;  3R7W B;  1MWT A;  5I5L A;  4EXO A;  1MWS A;  3E98 A;  5E2H A;  5HL6 A;  2P08 A;  4P6Z S;  4BBU A;  4NXG A;  3ITB A;  3HLW A;  2C6W B;  5I94 A;  3GMW A;  3LCE A;  3VP2 A;  2GZA A;  3NDG A;  3N6I A;  4E3K A;  1EWZ A;  4NXF A;  1XA7 A;  3G35 A;  3IF6 B;  3V50 A;  3CUE C;  2W27 A;  2WK0 A;  2Q0O A;  3BM6 A;  4MN7 A;  2J9O A;  3MQ0 A;  5DTS A;  4KZA A;  4ME4 A;  5JYO A;  2PD7 A;  1CEG A;  4FOF A;  2ZM8 A;  5AQB A;  3VOY A;  5F83 A;  4I3A A;  3FWL A;  1IYO A;  4GZB A;  1L2S A;  4DDY A;  2ZQ8 A;  3LYX A;  4S2P A;  3IH9 A;  1LI9 A;  2PRF A;  3MFD A;  5DTK A;  4II7 A;  2Y2N A;  4GJ4 A;  2P7J A;  3D9Y A;  1VHM A;  1LL5 A;  5IS1 A;  5J7E A;  3L7H A;  3A0S A;  1N9L A;  3EWK A;  5HL1 A;  2EX9 A;  3UB6 A;  3BQ8 A;  3Q7Z A;  4IED A;  4GB7 A;  1UWP X;  3ZFZ A;  2XR0 A;  1DJC A;  1TDG A;  1VEU B;  2HV1 A;  3IQA A;  4MN6 A;  2IWB A;  1NJ4 A;  5CHU A;  1BTL A;  5CED A;  3BWL A;  3VP0 A;  4NXB A;  2J3T C;  3G6O A;  1L3L A;  3E4Q A;  4X1M A;  4WBG A;  1KGE A;  1SDE A;  2B18 A;  5J8X A;  3G31 A;  3HVF A;  2KX6 A;  4MBK A;  4KZ6 A;  3BFG A;  3QNC A;  2J9P A;  1YMS A;  4OLG A;  4X53 A;  4DN0 A;  2OV5 A;  2A3U A;  2WKE A;  3NUL A;  2Y2Q A;  1RCJ A;  1E3U D;  3M6B A;  4BMW A;  4H6J B;  2Y2P A;  4HP9 A;  1JVJ A;  5CGX A;  2X01 A;  2PYR A;  1YSQ A;  4WN5 A;  5EM1 A;  3VOZ A;  3ZNT A;  2WKR A;  2JBF A;  3OBF A;  4QY5 A;  3TSG A;  2HDU A;  4PM7 A;  1YQS A;  2VGK A;  4P87 A;  2DMW A;  5E43 A;  3W4P A;  4E3I A;  1YPR A;  4HNB A;  3MZE A;  1L0D A;  4OOY A;  3LIC A;  2QPN A;  3UPP A;  1N4O A;  3BFF A;  4B9O A;  3KX0 X;  3P01 A;  4D60 A;  4S2M A;  3UE3 A;  4F94 A;  4LGW A;  4X1L A;  2ZL1 A;  3ISG A;  4I38 A;  4UEY A;  3BRM A;  1WYC A;  2PR5 A;  3IX3 A;  3A0V A;  1WA9 A;  1K4F A;  1XX2 A;  4QPR A;  1HLU P;  3GV9 A;  1IYP A;  3HL9 A;  2J7V A;  5FQQ A;  4HES A;  2J3W A;  5DFX A;  4GN2 A;  2PDR A;  2WGV A;  1DRM A;  4D2O A;  3OCL A;  3ZGA B;  1K55 A;  1FR1 A;  4E04 A;  2DCF A;  3D72 A;  3DWK A;  4R38 A;  2P04 A;  3GRJ A;  1W5D A;  2VZW A;  1U60 A;  1JWP A;  5FAQ A;  3JVU A;  2ZLY A;  5DKK A;  3PBS A;  3AGF A;  3FPW A;  4KZ4 A;  2PD8 A;  4Q0J A;  4DE2 A;  4E3L A;  4CLC C;  2PAV P;  2O9B A;  1SDN A;  3H7W B;  4EBL A;  2AVX A;  4IVK A;  4XXR A;  4ZTK A;  1XXM A;  4I39 A;  3EGD C;  1IOU A;  3MKE A;  3P7N A;  1G28 A;  3LR3 A;  5DKL A;  1MKM A;  5CGS A;  3ZG8 B;  2VJW A;  3H82 B;  3O3V A;  3MFX A;  4PAU A;  3DWZ A;  4BBV A;  3O86 A;  2LB9 A;  5F1G A;  3O88 A;  3NCK A;  5AJG A;  3W4Q A;  2GDN A;  2HJ9 C;  4X55 A;  4EQ1 A;  2A24 B;  1CJF A;  1I5Q A;  1H3Q A;  3DBA A;  1YKD A;  2ZQD A;  4NXE A;  2ZQC A;  1K55 C;  1SHV A;  4BQM A;  1GHI A;  4GOG A;  4E3O A;  2W1T A;  3LIA A;  3CAX A;  3VFH A;  4Y0T A;  1E3U A;  4LPZ A;  2QKP A;  5IU1 A;  3KYE A;  5DF9 A;  4R3J A;  5CHJ A;  5EUA A;  1DP9 A;  4JBF A;  3IXB A;  3NBL A;  2H28 A;  2X02 A;  1OPX A;  4MEZ A;  4DE0 A;  2HDQ A;  5AQ7 A;  3UPO A;  4JXG A;  5LBR A;  5GL9 A;  1GCE A;  3TG9 A;  1S1Y A;  2XA7 S;  1OTA A;  2EXA A;  4NG2 A;  1PNE A;  5CTN A;  3UE1 A;  3U4L P;  4DXC A;  1IKG A;  2Q9M A;  2ZQ9 A;  3UDI A;  2PR6 A;  1P0Z A;  1DJB A;  3S22 A;  1F98 A;  4U0T A;  5FI7 A;  4R0Q A;  5HDD A;  2Y2M A;  1YLY A;  4FTX A;  1KE0 A;  2H10 A;  4YOF A;  3ZDJ A;  3WS1 A;  5F1F A;  1V9Z A;  4R3A A;  3SW1 A;  1BSG A;  3IHA A;  3LR0 A;  1TS6 A;  1YLP A;  1XGI A;  4DJ2 A;  3BQA A;  5GLC A;  3T1R A;  4GCZ A;  5CEB A;  1DJA A;  4JXS A;  4KZ3 A;  5G4Z A;  5AQ9 A;  3MBZ A;  1T1A A;  2E8J A;  4OQH A;  3UE0 A;  3LI8 A;  2R9X A;  1STZ A;  3U2A A;  4ZJ2 A;  4R4S A;  5F69 A;  3GEC A;  3PTE A;  2WKP A;  4HOI A;  3QHY A;  2XA7 M;  4GW9 A;  5EOE A;  5CTM A;  5EFW A;  4XT2 A;  4BL2 A;  2ZOH A;  2VV8 A;  4Y5F A;  4JF5 A;  4G3W A;  3F1O B;  1GSV A;  2OLV A;  2HP6 A;  2ZBB A;  3QP2 A;  1RGY A;  3TRC A;  3OLO A;  3C7U A;  4EBP A;  2UWX A;  1L0G A;  2B5R A;  1MZU A;  2HF6 A;  2A49 A;  4UHU A;  1YT4 A;  4I3J A;  4QU3 A;  5EVI B;  1K56 D;  3SH8 A;  4DE1 A;  1N9B A;  3DTK A;  4EUV A;  4Y2F A;  4C3Q A;  5HWT A;  4LCL A;  1XJ6 A;  1ZTU A;  1XGJ A;  3W8K A;  1Y28 A;  1FCN A;  1J9M A;  3LR5 A;  4JGP A;  4MLL A;  1CEF A;  3LI9 A;  1P97 A;  5EEC A;  4OPR A;  2GJ3 A;  2P9V B;  3S7O A;  3CJM A;  1CI9 A;  2HJE A;  2FZ0 A;  3UE6 A;  3GQZ A;  4HIA A;  1XPB A;  3HJI A;  5FAO A;  3EQV A;  1XJ3 A;  4R1G A;  2W3H A;  4Y3I A;  4WEJ A;  3IXH A;  1BUL A;  1FSY A;  3HLD A;  2M7U A;  4LRX C;  2D02 A;  4LRZ E;  2VKS A;  1LT0 A;  1VQQ A;  3UMD A;  3VSK A;  1PW8 A;  5EVE A;  4S2L A;  1Q2Q A;  4FUW A;  3NJA A;  5FEG A;  1H8M A;  4OPZ A;  2XFS A;  4KUK A;  3N8R A;  5CRF A;  2XLN A;  2ZC4 B;  1D1J A;  2BLS A;  1K38 A;  3RH8 B;  3DTE A;  4C6Y A;  2NUT C;  3F1P A;  3Q7V B;  3L9K A;  4OLD A;  2PBY A;  3T4J A;  3OCN A;  1KDW A;  2KLI A;  4WLA A;  3FYZ A;  3CMZ A;  4OOM A;  4MDZ A;  2O9C A;  3CHW P;  1BLC A;  2Y2O A;  3N4I A;  3K3D A;  3NY4 A;  5EOO A;  4Y0U A;  2M1C A;  5EPH A;  2BAS A;  2FFY A;  2WGI A;  4GKU A;  3MF0 A;  1HTZ A;  4P0M A;  5F5Y A;  3V67 A;  2PU2 A;  3BEB A;  1HVB A;  4BWI A;  2ZM0 A;  3LUQ A;  4GLQ A;  5L07 A;  3IWO A;  1TEM A;  3FV7 A;  3WS2 A;  4RVA A;  5FAS A;  2HGV A;  3F1N A;  2WKH A;  5TJJ A;  3W4O A;  4ARZ A;  1W63 M;  5HFO A;  5HW3 A;  5L8M A;  4CLC D;  1PYY A;  1FOF A;  2Y2G A;  1QMF A;  3MXS A;  2ZC7 A;  1K56 A;  5L2F A;  2JE5 A;  3RTY A;  4LLO B;  4DE3 A;  4BD1 A;  1LL9 A;  2JKF A;  4PPR A;  2ZM2 A;  3VP4 A;  1GHP A;  1LHY A;  3UB7 A;  3CWF A;  1S6R A;  4ZAM A;  5MC7 A;  3T1Q B;  2ZJ9 A;  5HX9 A;  4GS9 B;  3C4O A;  1S0W A;  4HBT A;  1K25 A;  2L1M A;  5BOH A;  3PBT A;  3OZH A;  3T4L A;  4OQG A;  3QP8 A;  4WEK A;  1D7E A;  4PM9 A;  5HAQ A;  4GD8 A;  4QWO A;  1PW1 A;  1TVF A;  3T12 B;  5IHV A;  3VMA A;  2Z2L B;  5E2F A;  2DRW A;  1UWN X;  3C7V A;  1ES5 A;  1BLP A;  2V1B A;  3MJQ A;  1DP8 A;  4Z9Q A;  5KZH A;  5HZH A;  4WEL A;  4LEN A;  2LB5 A;  4OPQ A;  1ESI A;  3T1S A;  5FQK A;  2E8I A;  1H5X A;  1SCW A;  3SH7 A;  2JKT M;  2ZD8 A;  3HLE A;  2EX6 A;  1MWR A;  2ZOI A;  1K0K A;  3T4S A;  2HP5 A;  4P85 A;  3PBR A;  2EX2 A;  1C3B A;  3LEZ A;  1YLJ A;  1CF0 A;  2EWV A;  4X69 A;  4BLM A;  3E4O A;  1PIO A;  4QJG A;  4K0X A;  4NK3 A;  2X71 A;  1PWC A;  1CK3 A;  1PZO A;  1LLB A;  4K08 A;  1ALQ A;  2KOI A;  4KZ9 A;  2YKF A;  3C30 A;  2PHY A;  4HY8 A;  4Y0O A;  3MZF A;  1XFN A;  3ZG0 A;  3IS2 B;  1IFQ A;  1TS8 A;  4GDN A;  4JLF A;  4DKI A;  4U3T A;  4B4Z A;  2K2N A;  1VET A;  2CMN A;  2GNX A;  4CLC A;  3HLC A;  2XSS A;  1XKZ A;  3GDI A;  4OPY A;  4KQR A;  1PI4 A;  4KG2 A;  2XEP A;  1BT5 A;  3G2Y A;  4LV3 A;  3WS0 A;  1ZG6 A;  1MC0 A;  4ZRR A;  3NI9 A;  4N9K A;  2WGW A;  3WWX A;  4CJN A;  2EX8 A;  1OTE A;  4S2N A;  2UV0 E;  1FIK A;  1OTI A;  2ZMA A;  2QJ5 A;  3KSF A;  2JKR M; 
#chains in the Genus database with same CATH homology
 2WGW B;  3UDI A;  2ZC3 B;  3FZC A;  1NY0 A;  4ZBE A;  1BLH A;  4E3N A;  4LV0 A;  1DJB A;  3S22 A;  5CXW A;  1O7E A;  1YM1 A;  4PM5 A;  3ZG9 B;  1KVM A;  2Y55 A;  4U0T A;  5FQJ A;  5FI7 A;  4OP5 A;  3C5A A;  1PWG A;  2J8Y A;  3OC2 A;  4R0Q A;  5A91 A;  2XFT A;  1TDL A;  2HP9 A;  1E4D A;  2Y2M A;  3SOI A;  1NRF A;  1YLY A;  1KE0 A;  5FQM A;  4OQI A;  4K91 A;  2H10 A;  3MXR A;  4E6W A;  1FCM A;  4WMC A;  5TR7 A;  3ZDJ A;  3G34 A;  4BJP A;  4S2J A;  3WS1 A;  5F1F A;  4QB8 A;  4O7D A;  3Q1F A;  5DTT A;  1BSG A;  4GD6 A;  4X56 A;  3IHA A;  1NXY A;  3UNW A;  4KZ5 A;  1AXB A;  1FCO A;  5CER A;  4CPK A;  1BLS A;  1QME A;  1YLP A;  4C75 A;  5FAP A;  3S4X A;  2EFX A;  1XGI A;  1CI8 A;  1XP4 A;  4S2K A;  2V1Z A;  5M19 A;  5JYP A;  5GLC A;  4QHC A;  3N7W A;  3DTM A;  5CEB A;  1DJA A;  1E25 A;  1ZC2 A;  5TGF A;  4PM8 A;  4BL3 A;  4HBU A;  1W8Q A;  4IVI A;  4JXS A;  3V5M A;  1ERQ A;  4JPM A;  4KZ3 A;  3N8S A;  3MBZ A;  2H5S A;  2C5W B;  2Y4A A;  3HRE A;  5AQ9 A;  4OQH A;  4EBN A;  5FI6 A;  3UE0 A;  3NDE A;  4MBF A;  1FSW A;  4OOL A;  3VSL A;  1NZO A;  3A3J A;  5A92 A;  3IHB A;  2R9X A;  2RCX A;  4ZJ2 A;  4R4S A;  4DF6 A;  4WZ5 C;  3PTE A;  3QHY A;  4EWF A;  1I2W A;  3WRZ A;  4EUZ A;  4N9L A;  1IEL A;  1K54 C;  3G2Z A;  5KSC A;  4RA7 A;  2G2U A;  1VM1 A;  1ES3 A;  2Q9N A;  5CTM A;  5EOE A;  4S2I A;  2Y2I A;  1ZG4 A;  4K0W A;  4IBX A;  4ZJ3 A;  4KG5 A;  4WZ4 A;  4RX3 A;  4BL2 A;  2PU4 A;  3HBR A;  4S2N C;  3V39 A;  3V3S A;  4S2O A;  1GHM A;  4JF5 A;  5G18 A;  3CZD A;  4R3B A;  3P09 A;  3OPL A;  4XUX A;  2OLV A;  3OPP A;  1I2S A;  2V2F F;  2HP6 A;  3IXD A;  4JXW A;  1RGY A;  4OKP A;  4DDS A;  3VP1 A;  3N8L A;  5EVI A;  2H0Y A;  2XF3 A;  3C7U A;  1MY8 A;  2IWD A;  3HLB A;  4EBP A;  2UWX A;  1L0G A;  2B5R A;  2A49 A;  1G68 A;  1ERM A;  3BFC A;  3ZCZ A;  4MBH A;  4N1X A;  4OVD A;  4UHU A;  1GA9 A;  3SS4 A;  2FFF B;  1YT4 A;  2XGN A;  1MWU A;  4QU3 A;  5GHZ A;  1YLZ A;  4JF4 A;  5EVI B;  2WZZ A;  1K56 D;  1K57 C;  3SH8 A;  4DE1 A;  1N9B A;  3BYD A;  1ONH A;  4FCF A;  4KZ8 A;  3NIA A;  4C3Q A;  3UDF A;  1MWT A;  4JXV A;  5E2G A;  4LCL A;  2P9V A;  1O07 A;  1DY6 A;  1XGJ A;  1FR6 A;  1MWS A;  4X6T A;  2HDS A;  5E2H A;  1XA1 A;  4UAA A;  3W8K A;  1FCN A;  1J9M A;  2G2W A;  3ZG7 B;  3VP3 A;  4MLL A;  5GHX A;  5KMW A;  1CEF A;  5EEC A;  3ITB A;  4OPR A;  3HLW A;  2C6W B;  3SS5 A;  1NYM A;  2XK1 A;  3GMW A;  3IF6 A;  5I94 A;  2P9V B;  4IBR A;  3LCE A;  3CJM A;  1CI9 A;  4PM6 A;  3VP2 A;  2HPB A;  3NDG A;  4Q8I A;  3NC8 A;  3Q81 A;  3N6I A;  4E3K A;  1EWZ A;  5D3O A;  4ID4 A;  3GQZ A;  1XA7 A;  1XPB A;  3G35 A;  3IF6 B;  5DF7 A;  3V50 A;  4E3M A;  5FAO A;  3EQV A;  3M6H A;  4R1G A;  2WK0 A;  3BM6 A;  4Y7P A;  4WEJ A;  3IXH A;  2XH9 A;  1BUL A;  4EQI A;  2J9O A;  1JTD A;  1FSY A;  1K6R A;  3HLD A;  1BZA A;  1WYB A;  1K4E A;  1W7F A;  3OPH A;  5DTS A;  4KZA A;  3UO9 A;  5JYO A;  1KVL A;  3CG5 A;  3B3X A;  1CEG A;  1VQQ A;  4DRT A;  2ZM8 A;  3VSK A;  5AQB A;  3VOY A;  1K57 A;  1PW8 A;  3QNB A;  4S2L A;  5F83 A;  3PBO A;  1Q2Q A;  4N92 A;  3FWL A;  5E2E A;  1IYO A;  5FDH A;  3E2L A;  4GZB A;  1IKI A;  3GR2 A;  1L2S A;  4RYE A;  4OPZ A;  4DDY A;  3OPR A;  1GA0 A;  2ZQ8 A;  5A90 A;  3BFD A;  4S2P A;  4WM9 A;  5DVA A;  3IH9 A;  3Q7V A;  1ESU A;  1LI9 A;  2XFS A;  3MZD A;  5AQA A;  5EVI C;  3A3E A;  3N8R A;  3MFD A;  5CRF A;  2XLN A;  4P6B A;  5DTK A;  3JYI A;  2ZC4 B;  4FH2 A;  2Y2N A;  4BD0 A;  2BLS A;  3M2J A;  1K38 A;  2Y2L A;  4C6Y A;  1PI5 A;  1LL5 A;  3LY4 A;  3Q7V B;  2XDM A;  5HL1 A;  2EX9 A;  4OLD A;  2PBY A;  3UN7 A;  4E6X A;  4JKT A;  1IYQ A;  3OCN A;  3GVB A;  3Q7Z A;  1KDW A;  4IED A;  3FYZ A;  2P74 A;  3CMZ A;  3M2K A;  4GB7 A;  3ZFZ A;  2XR0 A;  4HEF A;  4OOM A;  2BG1 A;  1NYY A;  4R4R A;  1DJC A;  1H8Z A;  1TDG A;  1BLC A;  2Y2O A;  3ZNY A;  3N4I A;  4BEN A;  3NY4 A;  5EOO A;  3IQA A;  3IF6 C;  1OME A;  3I7J A;  4Y0U A;  5EPH A;  2IWB A;  1NJ4 A;  2FFY A;  2WGI A;  4GKU A;  5CHU A;  1BTL A;  5GLB A;  5HAI A;  5CED A;  5A93 A;  1L0E A;  1W79 A;  4WYY A;  3VFF A;  1HTZ A;  4KEN B;  2JC7 A;  4P0M A;  2DNS A;  2Y91 A;  3IWQ A;  3VP0 A;  2PU2 A;  3WS5 A;  1HZO A;  2VGJ A;  1YMX A;  3BEB A;  1YLT A;  3S1Y A;  1K6S A;  5M18 A;  1HVB A;  3BLM A;  2XD5 A;  4OP8 A;  3O87 A;  2ZM0 A;  5KSH A;  3SS3 A;  1M40 A;  3HLG A;  2H0T A;  4WBG A;  1KGE A;  3IWO A;  1TEM A;  1SKF A;  1PZP A;  1SDE A;  2WAF A;  5FA7 A;  3ZVW A;  4N1H A;  5J8X A;  3FV7 A;  3WS2 A;  3G31 A;  4RVA A;  3HVF A;  5FAS A;  2WKH A;  3W4O A;  4MBK A;  5EVL A;  3HUN A;  4FH4 A;  1MXO A;  1YLW A;  2OSU A;  4FD8 A;  5HFO A;  4B88 A;  4KZ6 A;  1KE4 A;  5HW3 A;  3IH8 A;  3LY3 A;  3PAE A;  3BFG A;  3QNC A;  2JCH A;  2J9P A;  1YMS A;  4M3K A;  4OLG A;  1PYY A;  4X53 A;  5GLD A;  4KQO A;  3IXG A;  5HAP A;  4JF6 A;  2RL3 A;  5DF8 A;  1FOF A;  3G4P A;  2A3U A;  2WKE A;  2OV5 A;  3HUO A;  2Y2G A;  2Y2Q A;  1QMF A;  4NET A;  3A3F A;  4GNU A;  1RCJ A;  3MXS A;  1E3U D;  3M6B A;  4PMA A;  2ZC7 A;  2Y2P A;  1K56 A;  1JVJ A;  3PBQ A;  5L2F A;  1Q2P A;  3C4P A;  5U47 A;  5CGX A;  2JE5 A;  2Y2H A;  2X01 A;  1JTG A;  4DE3 A;  4BD1 A;  1LL9 A;  3GSG A;  4PPR A;  2ZMA A;  2ZQ7 A;  2ZM2 A;  3VOZ A;  3VP4 A;  3ZNT A;  5CHM A;  2ZC6 B;  2JBF A;  3TSG A;  4QY5 A;  1GHP A;  2HDU A;  1LHY A;  2Y59 A;  4PM7 A;  1YQS A;  2VGK A;  1ERO A;  4P87 A;  1S6R A;  3FKW A;  5E43 A;  4ZAM A;  1PWD A;  3LO7 A;  3W4P A;  3EQU A;  4UA6 A;  2ZJ9 A;  5HX9 A;  4E3I A;  3C4O A;  1S0W A;  1ONG A;  1ZKJ A;  4HBT A;  5CEC A;  1K25 A;  3BEC A;  3G30 A;  5BOH A;  3PBT A;  3MZE A;  1L0D A;  3OZH A;  4OOY A;  1RP5 A;  2QPN A;  4OQG A;  4WEK A;  3UPP A;  1N4O A;  3BFF A;  2CC1 A;  4PM9 A;  5HAQ A;  4GD8 A;  1PW1 A;  2OLU A;  4EV4 A;  4X68 A;  4QD4 A;  4S2M A;  3UE3 A;  4F94 A;  1L0F A;  3A3D A;  3ISG A;  2V20 A;  1MKI A;  1MPL A;  1TVF A;  3BRM A;  1WYC A;  5FQ9 A;  4UA9 A;  4WMC D;  3G32 A;  1K4F A;  5IHV A;  4OH0 A;  1XX2 A;  3VMA A;  3BFE A;  3GV9 A;  1IYP A;  2Z2L B;  3HL9 A;  4OON A;  2J7V A;  5FQQ A;  4KZ7 A;  5E2F A;  4HES A;  5FI2 A;  2DRW A;  3UY6 A;  2ZQA A;  1KGG A;  2Y2K A;  4GN2 A;  3C7V A;  1IEM A;  4A5R A;  2WGV A;  2WKI A;  1ES5 A;  3HUM A;  3OCL A;  4OQ0 A;  1K55 A;  3ZGA B;  3SH9 A;  1FR1 A;  4D2O A;  4ZDX A;  2DCF A;  3DWK A;  1HD8 A;  3GRJ A;  1W5D A;  1M6K A;  5CGW A;  1FQG A;  4Z9Q A;  3P98 A;  3UDX A;  4WEL A;  1U60 A;  5KZH A;  1EI5 A;  5GLA A;  4KZB A;  4LEN A;  3E2K A;  4OPQ A;  5F82 A;  1JWP A;  1ESI A;  5FAQ A;  2ZLY A;  2QZ6 A;  3D4F A;  3PBS A;  3AGF A;  5FQK A;  2E8I A;  1H5X A;  1SCW A;  3HLF A;  4ZJ1 A;  3BLS A;  3SH7 A;  4KZ4 A;  4DE2 A;  1Z6F A;  3A3I A;  4E3L A;  2IWC A;  3ZHH A;  5GHY A;  2ZD8 A;  4LV2 A;  3ITA A;  1RGZ A;  3RXX A;  3HLE A;  2EX6 A;  3Q07 A;  1H8Y A;  1MWR A;  1SDN A;  2QMI A;  4EBL A;  4MNR A;  2HP5 A;  4P85 A;  4IVK A;  4XXR A;  3PBR A;  3PBN A;  4ZTK A;  1XXM A;  2EX2 A;  3MKE A;  1C3B A;  3LEZ A;  3WS4 A;  1W8Y A;  1YLJ A;  2XD1 A;  4FSF A;  5CGS A;  4YIN A;  4UA7 A;  4YFM A;  5EE8 A;  3ZG8 B;  2ZC5 B;  4L0L A;  4X69 A;  5FSR A;  1KE3 A;  5M1A A;  4BLM A;  3O3V A;  1PIO A;  3DWZ A;  3PAG A;  4K0X A;  4QJG A;  4NK3 A;  2X71 A;  1PWC A;  3O86 A;  4LCM A;  1CK3 A;  2R9W A;  2WAD A;  1PZO A;  5EVI D;  1LLB A;  3FKV A;  3MKF A;  5F1G A;  1JWZ A;  1ALQ A;  3O88 A;  3IWI A;  3NCK A;  4KZ9 A;  3RXW A;  2EFU A;  4GDB A;  3W4Q A;  1ES4 A;  3Q82 A;  4Y0O A;  2GDN A;  2XQZ A;  2WAE A;  4X55 A;  3MZF A;  3DW0 A;  4XUZ A;  3ZG0 A;  1WE4 A;  4KG6 A;  4KQQ A;  4GDN A;  1I5Q A;  3V3R A;  4JLF A;  5HAR A;  4DKI A;  4U3T A;  3RJU A;  2ZQD A;  3TOI A;  4B4Z A;  1NZU A;  2ZQC A;  2EXB A;  4H8R A;  1K55 C;  1LI0 A;  1SHV A;  4BQM A;  1GHI A;  4GOG A;  4LV1 A;  4QY6 A;  4E3O A;  3HLC A;  1XKZ A;  4OPY A;  3VFH A;  2Y2J A;  4KQR A;  1PI4 A;  1Y54 A;  4KG2 A;  5FAT A;  4DXB A;  4Y0T A;  3UPN A;  4RX2 A;  2XEP A;  5FQI A;  1E3U A;  1JWV A;  3AGD A;  1BT5 A;  3G2Y A;  4LV3 A;  4E3J A;  5DF9 A;  4R3J A;  1IYS A;  2WZX A;  3WS0 A;  5CHJ A;  1ZG6 A;  5EUA A;  3IF5 A;  4U0X A;  1MBL A;  4JBF A;  3IXB A;  1G6A A;  3NBL A;  1BUE A;  1KDS A;  2X02 A;  5TFQ A;  3ZVT A;  3WRT A;  4MEZ A;  4DE0 A;  2HDQ A;  3NI9 A;  4WZ5 A;  3AGE A;  5AQ7 A;  3UPO A;  4JXG A;  5GL9 A;  1KGF A;  2HDR A;  2WYX A;  1GCE A;  4R23 A;  3TG9 A;  1K54 A;  4N9K A;  3IT9 A;  2WGW A;  3ZG5 A;  3WWX A;  4CJN A;  2EXA A;  2EX8 A;  2Z2M B;  4S2N A;  3GTC A;  5CTN A;  3UE1 A;  4B4X A;  4DXC A;  1ES2 A;  1IKG A;  2WUQ A;  2Q9M A;  1BLP A;  2I72 A;  2ZQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...