3MQQA

The crystal structure of the pas domain in complex with ethanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.65a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
b'IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LuxR family
publication title The Crystal Structure of the PAS domain in complex with Ethanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.65A
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqqA00
5KIZA 2ZBBA 2QKPA 5F6AA 3FC7A 1LSVA 4HJ6A 1OTEA 1D7EA 1X0OA 5HDCA 4GS9B 3F1PB 3NHQA 5HD5A 2GJ3A 4HP4A 2V9AA 4HJ4A 3CAXA 4M4XA 5F68A 4HNBA 2YKFA 4I38A 3H7WB 5IU1A 3NOPC 2I9VA 2PYRA 5DJUA 4GW9A 2PD7A 3KX0X 2OWJA 2A24B 3F1NA 1GSVA 4RQ9A 1NWZA 5DKKA 1OTAA 2B02A 4GCZA 2BASA 3MJQA 5J4EA 2M1CA 2KDKA 4GHIB 5F5YA 4H6JA 4EESA 3VOLA 1OJ5A 4KUOA 4WL9A 2VEAA 1JNUA 5IS1A 4I3IA 1UWPX 4BBVA 4NXEA 3K3DA 3E4QA 3LYXA 1T1BA 2Z6DA 3CWFA 1EW0A 3LIDA 1XFNA 1DP8A 3CLOA 4GS9A 3A0VA 2PYPA 4BBUA 1ODVA 3MFXA 2KX6A 1OT9A 1GSWA 4EERA 3NOTC 4I3AA 4I5SA 4KQDA 3H7WA 1T18A 2D01A 1S1YA 4JGPA 3H82A 3IBRA 4BBTA 2QJ7A 2Z6CA 3A0RA 4JGRA 3RH8B 2QJ5A 2A24A 3H9WA 4R6LA 5G4ZA 1F98A 1DP9A 4LRXC 2CMNA 4HOIA 4HIAA 3VE4A 1TS6A 4HHDA 4L9FA 1LSXA 4GHIA 4WUJA 4HH3A 1LSWA 2W0NA 3SW1A 1N9NA 5HDDA 4XT2B 4E04A 3BY9A 3T50A 2QWSA 3C2WA 3GDIA 1TS0A 2PHYA 2W27A 5HDSA 4LLOB 5A8BA 2P7JA 4EXOA 2D02A 4HP9A 2PR5A 3E4OA 2YKHA 2JN7A 4L9EA 4LPZA 4LRYC 3H82B 4MN5A 1T1AA 2PDRA 3HJIA 3PYPA 3K3CA 1BYWA 1UGUA 3UMEA 5HWWA 4JGQA 1N9LA 4EETB 1Y28A 5F69A 4DJ3A 2OOLA 4MN6A 3LIAA 1T1CA 2HV1A 4I3JA 4NXGA 1V9YA 4PKYA 1OTDA 3B33A 1DP6A 3ICYA 3ULFA 5I5LA 3PHYA 4XT2A 4PKYG 3F1OB 4NXFA 3UB6A 2V1BA 4EQ1A 5HD3A 3A0SA 5J3WA 4EW7A 3GECA 1KOUA 4R38A 3LUQA 1S66L 3MR0A 2V0WA 2ZOIA 1S4SA 4B9OA 4K08A 3HJKA 1S67L 5HSQA 1MZUA 2PR6A 2VV8A 3IS2B 1XJ3A 2V1AA 1LT0A 2JHEA 4NXBA 2VV7A 5HWVA 3BWLA 2QHKA 4HY8A 1TS7A 1S1ZA 2L1MA 4F3LB 5DKLA 4R3AA 5AVEA 3VE3A 5DJTA 4LRZE 5HZHA 5J7EA 2L4RA 1OTIA 1S4RA 1WA9A 3F1OA 1LL8A 3UMDA 2R78A 2V0UA 4R70A 3MXQA 3LI9A 3LIBA 4L9GA 4EEPA 3LIFA 1VB6A 5TBMB 1OT6A 2EA9A 3BY8A 1XJ4A 3EWKA 1P0ZA 2H28A 5EFWA 3IS2A 2VV6A 1XJ6A 3LI8A 3RTYA 3D72A 1P97A 4HI4A 2PD8A 1N9OA 3MQQA 3NJAA 3UB8A 4HH2A 4WN5A 5AVFA 3FG8A 4F3LA 3C8CA 2VLGA 1OJGA 4KUKA 2WKQA 1F9IA 2INWA 4HQAA 2K7SA 1DRMA 1G28A 3G6OA 3P7NA 4WF0A 1GSXA 1UWNX 3E4PA 3LIEA 3F1PA 3NOUC 4EEUA 3LICA 5G4YA 3UB7A 5HWTA 1D06A 3ZQ5A 4JGOA 4I39A 1OTBA 3OLOA 2WKPA 5TBMA 1T19A 2L0WA 1V9ZA 3F1NB 2OWHA 3UB9A 3MQOA 2WKRA 4YWZA 3EEHA 1XJ2A 2J80A 3UE6A 1XFQA 4DJ2A 4H6JB 2ZOHA 4WLAA 4HJ3A 1TS8A
chains in the Genus database with same CATH superfamily
2ZBBA 5EVLA 1ZHHB 2QKPA 2JE5A 2VX8A 1LSVA 2V2FF 3HLFA 3T4SA 3W4PA 4ESPA 3NDEA 2H5SA 4S2PA 3T1RA 2J8YA 2V9AA 4HJ4A 1KGEA 3CAXA 1OMEA 2Q9NA 4OKPA 5TGFA 1GA9A 3V39A 4I38A 3E2KA 4BWIA 1W63M 4EUZA 4ID4A 5DJUA 3SS4A 4LGWA 3IH8A 2PD7A 1XXMA 3F1NA 2A24B 1GSVA 1K54A 1NWZA 3VOZA 3V50A 3KSFA 2W1RA 2W3EA 5FDHA 1GHIA 2DCFA 5J4EA 4KZ4A 5CGSA 2JCHA 2KDKA 4KUOA 2PAVP 4KQOA 4ZJ3A 2KLIA 4I3IA 2ZJ9A 4BBVA 3G31A 3E4QA 2HF6A 2Y2OA 4LV3A 3UPOA 5E2EA 5EV0A 4WMCD 4BBUA 3MFXA 5DF7A 3SS3A 4X1LA 3Q82A 3UDFA 1VEUB 1BZAA 5GLDA 3CPTB 1IKGA 2D01A 4JGPA 1KGFA 4WZ4A 3N8LA 2VA0A 3RH8B 1H3QA 4P6ZM 3IWIA 1PZPA 3EEAA 3FZCA 3IX8A 4IJGA 2WUQA 4HIAA 1TS6A 4BENA 4GHIA 3FKVA 3PXPA 4KZ6A 4KG5A 4EBLA 2HDRA 3JVUA 1N9NA 3GR2A 1ERMA 3UDIA 3E98A 5DFXA 3T50A 4WEJA 2QWSA 4P0MA 3GDIA 2W1TA 2W27A 4OOLA 2XK1A 4FUWA 3PR6A 2ZQ7A 3T4OA 2P7JA 2Y91A 3EQUA 3BJNA 2YKHA 3V67A 2WYXA 4LPZA 1L3LA 2J3TC 3JVVA 4UAAA 1T1AA 4IVKA 2ZMFA 3K3CA 4BQMA 2WGIA 1YMSA 3PBQA 4JXWA 1KGGA 4NKPA 4JGQA 4D60A 2JKFA 4LCLA 3QP1A 1PI4A 4DJ3A 3VSKA 2V1ZA 3UO9A 4I3JA 4GZBA 3T4KA 1I5QA 3IXDA 1QMFA 1V9YA 2EX8A 5EVIC 3B3XA 4KZ8A 4XT2A 3OZHA 4PKYG 1SHVA 2ZMVA 3GTCA 4EQ1A 5J8XA 1NZUA 1ZTUA 2QZ6A 3G30A 4E6XA 3A0SA 4XXRA 2EFUA 1YLJA 3MBZA 4PM6A 4AFIA 3EOIA 5FQIA 5HAIA 3EGDC 5DF8A 3UPNA 4GKUA 2OLVA 1K4FA 3WRZA 4BMWA 1W7FA 1FOFA 3SH9A 3MMHA 3IF6B 3C4OA 4OLGA 1KE0A 4JBFA 3PBOA 2XLNA 1PW8A 4D2OA 2WZZA 5HL1A 3P98A 2BTFP 3C38A 1ES3A 4DE1A 3MZDA 1PWGA 1MKIA 1IKIA 1STZA 2JKRI 3LEQA 4R4SA 5DKLA 2WGVA 4WYYA 1HZOA 3MSHA 3ZYTA 3HLBA 2ZLYA 3DWKA 3AGFA 2R9WA 3SOIA 5DTKA 2QPNA 3TE8A 4IVIA 3FKWA 2V0UA 3MXQA 3A3EA 1BLSA 5AQ7A 3LIBA 3IT9A 2QMIA 1EI5A 3E2LA 5CEDA 2J9OA 4OPZA 2DNSA 2ZL1A 1O07A 2VZWA 3R7WA 1XJ4A 3MXSA 3PTEA 2Y8HA 3IHBA 4R0QA 5EFWA 3D3OA 5DVAA 3S7OA 2JC7A 3ITAA 1VETA 3OCLA 1K55C 3IXBA 4LFUA 2WAEA 3UDXA 4CLCC 3ISGA 4N9LA 1YLTA 4HH2A 5FA7A 5AVFA 3V3SA 3BEBA 3FG8A 4MNRA 4N1XA 4F3LA 5CGXA 3BRMA 2PBYA 2Y2LA 4HQAA 4OLDA 3HUMA 1G28A 4JF4A 3P7NA 1QMEA 5FQ9A 1FSYA 1WE4A 1Z09A 4GDNA 3LIEA 4EEUA 4KENB 3ZQ5A 4JGOA 3N8RA 1VQQA 2O9AA 2Q9MA 3ZG7B 5BOHA 3ZDJA 1E4DA 2VGLS 4ZAMA 2HJ9C 1ESIA 1YPRA 1YSPA 4WEKA 1MC0A 4KZ5A 4PM5A 3MQOA 4DE2A 1L0GA 2XEPA 4Y5FA 4BD1A 5EVIA 4H6JB 4EU0A 2Y4AA 2ZQCA 5LBRA 3IF6C 1MWSA 3U4LP 4IUKA 3IH9A 5A93A 2HZ5A 4HJ6A 1OTEA 5EUAA 3P01A 2O99A 5AJGA 4GS9B 3F1PB 2K2NA 1PFLA 3SS5A 2PU4A 4IHQA 4S2IA 2GJ3A 4S2NA 4HP4A 1FSWA 3C5AA 3VV4A 3VFFA 3B42A 2OSUA 1BTLA 4Q0IA 5F68A 2YKFA 4FTXA 3MKEA 3NOPC 2PYRA 5L8MA 2VGKA 3JPUA 4GW9A 1IYSA 3GV9A 3S1YA 3BLSA 1YSQA 3JYIA 3C30A 2XRNA 2FZ0A 4RQ9A 1M40A 5F1FA 4PM7A 1MPLA 2B02A 3HBRA 3IWOA 2M1CA 1E3UD 3PAEA 5GHYA 4R3BA 5F5YA 5L07A 4ETZA 4WL9A 2VEAA 1MY8A 5CGWA 1YLZA 1UWPX 1NZOA 4NXEA 1TVFA 3K3DA 1T1BA 3BFEA 3CWFA 3VP4A 1EW0A 1XFNA 1Y4OA 4UA9A 3O86A 1FR1A 5CEBA 2Y2GA 3DAVA 3GSGA 4OVDA 1K6SA 2Y2JA 1FILA 4DXBA 2A49A 1ODVA 3ZVTA 2J7VA 1YT4A 4I5SA 4KQDA 3VP1A 3NULA 4X53A 3H7WA 4KG6A 2Y2PA 1NXYA 1K55A 3NDGA 4E3KA 2OAP1 4CLCA 3L7HA 5G4ZA 1H8ZA 1F98A 2XA7S 1DP9A 4BJPA 2CMNA 3BECA 4YINA 2ZC6B 4HESA 2O9BA 4BD0A 4WUJA 2P08A 2W0NA 4ETXA 3CI6A 4ZTKA 4B4XA 2XFSA 5HDDA 1YLWA 2QYBA 1PWDA 4GJ4A 3MZFA 4U3TA 3FPWA 4OP8A 2PHYA 3IX4A 4MBHA 5FEGA 1W8QA 5HDSA 2OV5A 5A8BA 5FEFA 5KZHA 4EXOA 4WBGA 3G32A 1DJAA 3WWXA 4S2MA 4L9EA 1JTGA 1VHMA 2O0YA 3GVBA 5TFQA 4ARZA 3H82B 4MN5A 1C3BA 2PDRA 3ZG0A 3DTEA 1CI9A 3VOYA 1RCJA 2P9VB 5HWWA 2M7VA 4UHUA 1Y28A 3BFCA 5E43A 3IHAA 1NYYA 3IF6A 5F69A 2OOLA 4MN6A 1T1CA 2ZC4B 5DTTA 3BLMA 5DF9A 2Z2MB 3B33A 4G3KA 2EX2A 3ULFA 3S4XA 1ONHA 5I5LA 5G18A 3HLCA 3B47A 4PAUA 5C5KA 3AGDA 3N6IA 4E3IA 3UB6A 2V1BA 3A3IA 1DY6A 1U60A 5KMWA 1MWTA 5MC7A 5M18A 2ZQAA 1CF0A 2V8FA 2V20A 2WGWB 3OCNA 4R38A 3SH8A 1S66L 2XR0A 3RXWA 3OPRA 1CEGA 4JF5A 4Y13A 3Q1FA 1Z6FA 2V0WA 4L0LA 4Y0TA 3BYDA 1NRJA 4Z9QA 1S4SA 2P74A 3HJKA 1YQSA 1SKOB 1S67L 4Q0HA 2PR6A 3IS2B 3O3VA 5FQMA 4Y0OA 2V1AA 5DTSA 4WM9A 4NXBA 5I94A 1TDLA 4OPRA 2VV7A 5HWVA 4UA7A 2QHKA 4HY8A 4O8GA 1TS7A 3OC2A 4NETA 3IXHA 1S1ZA 1IELA 2HP9A 4S2OA 1IFQA 4R4RA 3DW0A 4LRZE 5HZHA 3RXXA 2WKHA 4B93A 1WYCA 1WA9A 3F1OA 4IUHA 4WZ5C 2R78A 2IWBA 1YAXA 4R70A 3FWLA 5FI6A 2V8CA 4O0PA 1CEFA 1WYBA 2Y2KA 4EEPA 1XP4A 5FI2A 4EQIA 2EX6A 3BY8A 5TJJA 3IBJA 2JKTM 2VV6A 3LI8A 1CK3A 5K5BA 2CC1A 3G2YA 3LY4A 1P97A 4E3NA 1NJ4A 3W4QA 2XDMA 3IX3A 4DXCA 1HLUP 1N9OA 2Z2LB 3ZG5A 3MQQA 5GLAA 3UB5P 3BW6A 1K0KA 4X6TA 1L0FA 3TSGA 1SDNA 2XF3A 3UE1A 5GLBA 2OLUA 3CJMA 2UWXA 2WKQA 1F9IA 2A2LA 5FI7A 1BUEA 3MFDA 1H8MA 1W79A 2INWA 4QPRA 3PBTA 3E0YA 4KG2A 4QU3A 4WF0A 1LL5A 5FATA 4S2JA 5FL3A 5F1GA 3WRTA 1GSXA 3F1PA 3NOUC 4LV2A 3LICA 5FSRA 4S2KA 3UB7A 4CLCE 4A5RA 3A3DA 4E6WA 4JF6A 4Y7PA 1OTBA 3GMWA 3BM6A 3OPHA 5TBMA 4HBTA 1W63Q 1LLBA 1CJFA 3F1NB 3UPPA 5L2FA 5CERA 5FQKA 1G6OA 2WAFA 3UB9A 1K25A 2WKRA 3EEHA 3UE6A 2W3GA 4DJ2A 4OQIA 1TEMA 3KO6A 3QNCA 3Q7VB 4DE0A 4FSFA 1LI9A 3MQ0A 2ZOHA 4HJ3A 4IBRA 5KIZA 2E8IA 3CG5A 2FFFB 5F6AA 3FC7A 3MF0A 3PBSA 4X55A 1D7EA 2EFXA 3V5MA 3ZNYA 3NCKA 3NHQA 1IOUA 3G4PA 4E3MA 1SKFA 3FYZA 2XD5A 3ZHHA 1E25A 1XPBA 3IWQA 2HP6A 4RYEA 4EBNA 1MKMA 1K56A 4P87A 1BT5A 2NUTC 5L10A 4CJNA 3OOVA 3RJUA 1I2WA 5TR7A 1ALQA 1HVBA 3T12B 1DJCA 3HLWA 4GCZA 3MJQA 3PAGA 2X71A 3T4QA 4OH0A 4GHIB 4EESA 1OJ5A 2ZM0A 1YKDA 5IS1A 5FAQA 5EVID 2ZC7A 3NI9A 3R4KA 2C5WB 1FQGA 1XA1A 3Q7ZA 2Y2HA 3LYXA 4OOMA 2ZQ8A 1NY0A 1DP8A 1ZC2A 2XD1A 4G3VA 1RGZA 3HREA 3HL9A 3QHYA 3I7JA 5EM1A 1RGYA 4MBFA 3DTKA 5F83A 3P09A 3VP2A 2PU2A 5L09A 1W8YA 1OT9A 2VGLM 4EERA 5AQAA 1FIKA 4I3AA 5CX7A 2X02A 5FAOA 1PWCA 1T18A 3WS1A 3S7PA 2H0TA 1F2KA 2Y79A 5HX9A 3H82A 1ACFA 3IBRA 4BBTA 1J3WA 2Z6CA 3A0RA 3CITA 1FR6A 3WS2A 2A24A 4PHTA 1IEMA 4LRXC 4HOIA 3QP5A 1Y54A 4L9FA 1LSXA 5CHJA 5GHXA 4O7DA 1K54C 3CZDA 3SW1A 5U47A 5HPIA 3Q07A 3BQAA 4XT2B 4MDZA 5A90A 4E04A 3C2WA 1TS0A 3BFFA 4OPYA 3ZG9B 4X68A 4DDYA 3KYQA 1DJBA 3N4IA 2BLSA 1G6AA 3S7QA 3KSHA 3OPLA 1AWIA 3E4OA 2BG1A 2JN7A 2H10A 2HP5A 4LRYC 4RA7A 3W2ZA 4DRTA 3A3JA 1VEUA 3O87A 3HJIA 3CPTA 3UNWA 4K91A 2ZMAA 4ZBEA 5KSCA 3WS4A 5F82A 3TG9A 2LB5A 4P6BA 1UGUA 1MWUA 4RVAA 2W3HA 4F94A 3NIAA 4QD4A 1F5MA 1GCEA 3BFGA 3D9YA 4DDSA 2B95A 4R23A 3T1QB 5FAPA 3LIAA 3HLGA 5GHZA 2HV1A 1BLHA 3TW8A 4CLCD 2XH9A 1FCOA 4QHCA 1OTDA 3QNBA 4O01A 1DP6A 5GL9A 2X01A 2Y2QA 5E2GA 2XROA 1NLYA 5AQ9A 1W5DA 4MCWA 3ITBA 4YNRA 5J3WA 3BFDA 4EW7A 1ZG4A 2HDSA 1KOUA 4MEZA 2WZXA 3LUQA 3C7UA 2ZQDA 3M2KA 5E2HA 3T4JA 2ZL1B 3MXRA 4CQHA 4JPMA 1TD5A 3LY3A 3HVFA 3R7WB 4K0WA 5EECA 2PRFA 1M6KA 4GN2A 4UQIS 5FQQA 5HSQA 1N9BA 3WS0A 2XA7M 2VJWA 2VKSA 1LT0A 1KVLA 3HUNA 3ZVWA 1VETB 5FDSA 2ZM8A 4GOGA 2JHEA 1MWRA 4PM8A 4PPRA 4KZ9A 4C6YA 3BWLA 4C75A 4S2LA 3HCYA 4LV1A 2L1MA 1K57C 1PIOA 4F3LB 5AVEA 3VE3A 3M2JA 4EWFA 1BLPA 4E3JA 5J7EA 5CXWA 1LL8A 2G2WA 3UMDA 3N8SA 5EOEA 4QB8A 1PYYA 2HDUA 1RP5A 4RX3A 3DTMA 3LIFA 3HLDA 4JKTA 4LCMA 1P9RA 1IYQA 1OPXA 3EWKA 2Q0OA 3LO7A 1Q2QA 1P0ZA 5A92A 1MXOA 5HARA 1XJ6A 1Q2PA 4UEYA 3D72A 1YLPA 3DWZA 3O5YA 4HI4A 5EVIB 2I72A 1J9MA 5CTMA 3NJAA 3UB8A 1AXBA 2WADA 4H8RA 4OQGA 3SH7A 4JLFA 2VGJA 1OJGA 4KUKA 4JXGA 3Q7VA 3MS6A 4IBXA 4XUXA 3UY6A 5EM0A 1DRMA 3CMZA 1NLZA 1XKZA 5EE8A 2E8JA 3GQZA 4KZAA 3G2ZA 4N1HA 3TJZC 1UWNX 3E4PA 1ONGA 2ZQ9A 1GHMA 5G4YA 3LR3A 2JKGA 5JYOA 4ME4A 4UA6A 4I39A 3OLOA 2WKPA 1CI8A 4EV4A 1XGIA 4FD8A 4IEDA 5FASA 3DBAA 1NYMA 1V9ZA 1GA0A 3LCEA 1JWZA 2AVXA 1G5UA 3FV7A 1YMXA 2IA2A 2Y2MA 5HL6A 2NUPC 2OWHA 3LFVA 5CHMA 1JVJA 1XX2A 1HTZA 4NK3A 2ZM2A 1LL9A 4QY5A 2ZD8A 2B5RA 1L0DA 5EVEA 3G35A 3ZGAB 4P6ZS 2EWWA 5EOOA 4EUVA 3QP8A 4RX2A 1JTDA 1PNEA 5CTNA 2W3DA 3WS5A 4Y3IA 4MMNA 4DF6A 4MLLA 1TS8A 3QP4A 4WMCA 4K0XA 1X0OA 4OP5A 5HDCA 2Y55A 2HPBA 1MBLA 2ACGA 3EGXC 4X1MA 4GLQA 1ERQA 1ES4A 1L2SA 5HD5A 1L0EA 4BLMA 1KVMA 4HBUA 1PW1A 3IXGA 2WK0A 5JYPA 3NY4A 4M4XA 4HNBA 3H7WB 5IU1A 2H0YA 1GHPA 4Y0UA 1N4OA 2I9VA 4BL3A 1YLYA 3KX0X 2OWJA 2XGNA 4CLCB 2HGVA 3L9KA 3KSIA 5DKKA 1OTAA 1K57A 1YM1A 1ESUA 1ZG6A 2BASA 2IWDA 3ZCZA 1PZOA 5D3OA 4H6JA 2LB9A 3VOLA 3TOIA 2EWVA 3VP0A 1JNUA 1JWVA 4GDBA 5GLCA 4R3JA 2VK3A 4ZJ2A 3M6BA 2Z6DA 3LIDA 3PBNA 4JXSA 3CLOA 4Y17A 4GS9A 4MN7A 3A0VA 2PYPA 3Q81A 2KX6A 4ARZB 2A3UA 1GSWA 3NOTC 4OQHA 2GDNA 1NRFA 3EQVA 1S1YA 4S2NC 3NBLA 4FCFA 1XA7A 2O9CA 2G2UA 3KYEA 1FCMA 2QJ7A 4HEFA 3KSGA 4JGRA 2QJ5A 3V3RA 3ZFZA 3IF5A 4N9KA 1K56D 4GNUA 2UV0E 3H9WA 5HAPA 4YOFA 4R6LA 2HJEA 1BLCA 4X56A 4Y15A 3VE4A 2G7UA 4HHDA 1P9WA 4OONA 4HH3A 4GD6A 1LSWA 2HDQA 2PBDP 2K31A 4FOFA 3LR5A 3NC8A 3CUEC 3BY9A 2FFYA 4PM9A 1VM1A 3T1XA 5M19A 4Q8IA 4YFMA 1KDWA 3G34A 4LLOB 5HAQA 4QY6A 4KZ7A 4FH2A 2D02A 4HP9A 3OPPA 2PR5A 2J3TD 1CQAA 4OQ0A 2M7UA 4LV0A 1KDSA 4ZDXA 3PYPA 3RFBA 4KZ3A 1BYWA 3UMEA 2Y2NA 4XUZA 1N9LA 4EETB 5M1AA 2FH5A 1HD8A 1S0WA 5CRFA 1PI5A 4Y2FA 2P04A 4C3QA 4OPQA 3LR4A 3HLEA 4QJGA 4P85A 4FH4A 4NXGA 3VSLA 4WZ5A 1ES2A 4PKYA 4KZBA 4ZJ1A 2RCXA 3ICYA 2W1TB 3PHYA 3BQ8A 5IHVA 2C6WB 3F1OB 2DMWA 3TRCA 4NXFA 3OBFA 1ZKJA 4NG2A 5HD3A 4G3WA 1G68A 4N92A 3DTIA 3GECA 4E3OA 3KYZA 5A91A 3T4LA 2OAQ1 3GRJA 2XQZA 1SZVA 1H0MA 5CECA 4Q0JA 1SCWA 3MR0A 5HW3A 1LI0A 3T4TA 3HUOA 3D4FA 3LR0A 1KE3A 2ZC3B 2ZOIA 5DFYA 4E3LA 4B9OA 4K08A 4JXVA 1K4EA 1MZUA 3C4PA 2P9VA 2VV8A 1XJ3A 2KOIA 1FCNA 4Z1WA 2EXBA 4U0TA 4WELA 2GNXA 1PRQA 2GZAA 3QP2A 2WKIA 3UE0A 1XGJA 2XFTA 5CHUA 2R9XA 4R3AA 3VFHA 5DJTA 2WKEA 4ZRRA 3QP6A 4R1GA 1IYPA 2L4RA 3FPVA 3T1SA 1LHYA 1OTIA 4DKIA 1S4RA 3ZG8B 2Y2IA 4NEED 3U2AA 5E2FA 5EPHA 3LI9A 2EXAA 3C7VA 3VP3A 2WGWA 2JBFA 4L9GA 2IWCA 1O7EA 1TDGA 2PT7A 1TF1A 1VB6A 5TBMB 3N7WA 1OT6A 3MZEA 2EA9A 5AQBA 3MKFA 2EX9A 3UE3A 3VMAA 1SKOA 4BL2A 1KE4A 2H28A 3IQAA 3IS2A 1I2SA 4X25A 3RTYA 3UN7A 3LGOA 2PD8A 1S6RA 2JKTI 2Y59A 4M3KA 2DRWA 3LEZA 3CUEA 1A0KA 4WN5A 4KQRA 4KQQA 3PBRA 4QWOA 3C8CA 4GB7A 4EBPA 2VLGA 4DMZA 2MJ6A 4B4ZA 4MBKA 1JWPA 1BULA 2B18A 4CPKA 2K7SA 2J3WA 3G6OA 4B88A 2ZC5B 5HFOA 3K2NA 4UQIM 3S7NA 1K6RA 5IT5A 5HWTA 4U0XA 1D06A 3A3FA 3ZNTA 3M6HA 1EWZA 1H8YA 1T19A 1IYOA 5KSHA 1SDEA 4PMAA 2L0WA 2JKRM 2J9PA 2XSSA 2RL3A 4LENA 1E3UA 2W3FA 3NECA 3W8KA 4DN0A 1K38A 3CHWP 3AGEA 5HPFA 4YWZA 4X69A 1XJ2A 2J80A 4DE3A 1EROA 1XFQA 3O88A 2GX5A 5FQJA 4II7A 4OOYA 1H5XA 3SZTA 1ES5A 1D1JA 4WLAA 1BSGA 3S22A 4GD8A 3W4OA
chains in the Genus database with same CATH topology
5KIZA 2ZBBA 1ZHHB 2QKPA 4IUKA 5F6AA 3FC7A 3MF0A 2VX8A 1LSVA 3PBSA 1OTEA 4HJ6A 3T4SA 1D7EA 1X0OA 3P01A 5HDCA 2O99A 3EGXC 5AJGA 4GS9B 3F1PB 2K2NA 4GLQA 3NHQA 4IHQA 5HD5A 2GJ3A 1IOUA 4HP4A 3VV4A 2V9AA 4HJ4A 3B42A 3CAXA 4Q0IA 4M4XA 5F68A 4HNBA 2YKFA 4I38A 3H7WB 5IU1A 4BWIA 1W63M 1MKMA 3NOPC 2I9VA 2NUTC 2PYRA 3OOVA 5L8MA 5DJUA 4GW9A 2PD7A 3KX0X 1YSQA 2OWJA 2A24B 3F1NA 4CLCB 2HGVA 3C30A 1GSVA 2XRNA 2FZ0A 4RQ9A 1NWZA 3KSFA 3KSIA 1OTAA 5DKKA 2B02A 2W1RA 4GCZA 2BASA 2W3EA 3MJQA 5J4EA 3T4QA 2M1CA 2KDKA 4GHIB 5F5YA 4ETZA 4H6JA 2LB9A 4EESA 3VOLA 1OJ5A 4KUOA 4WL9A 2VEAA 2EWVA 1YKDA 4KQOA 1JNUA 5IS1A 2KLIA 4I3IA 1UWPX 3R4KA 4BBVA 4NXEA 3K3DA 3E4QA 2HF6A 3LYXA 1T1BA 2Z6DA 3CWFA 1EW0A 3LIDA 4OOMA 1XFNA 1DP8A 3PBNA 4G3VA 3CLOA 4GS9A 4MN7A 3A0VA 2PYPA 4BBUA 1ODVA 3MFXA 2KX6A 1OT9A 4ARZB 2VGLM 1GSWA 4EERA 3NOTC 4I3AA 5CX7A 4I5SA 4KQDA 3EQVA 3H7WA 1T18A 2D01A 1S1YA 4JGPA 3S7PA 2Y79A 2O9CA 3H82A 3IBRA 4BBTA 2QJ7A 2Z6CA 3A0RA 3KSGA 2VA0A 4JGRA 3RH8B 1H3QA 3CITA 4P6ZM 2QJ5A 2OAP1 3EEAA 2A24A 4CLCA 3H9WA 4YOFA 4R6LA 2HJEA 4PHTA 5G4ZA 2XA7S 1F98A 4IJGA 1DP9A 4LRXC 4BJPA 2CMNA 4HOIA 4HIAA 3VE4A 1TS6A 2O9BA 2G7UA 4HHDA 1P9WA 1LSXA 4L9FA 4GHIA 3PXPA 4WUJA 4HH3A 2P08A 3JVUA 1LSWA 2W0NA 4ETXA 3SW1A 3CI6A 2K31A 1N9NA 4FOFA 5HPIA 5HDDA 3LR5A 3BQAA 4XT2B 4MDZA 3CUEC 2QYBA 3E98A 4E04A 3BY9A 5DFXA 3T50A 4WEJA 4GJ4A 2QWSA 3C2WA 3FPWA 3GDIA 1TS0A 2PHYA 2W1TA 2W27A 4OOLA 5HDSA 3KYQA 3PR6A 4LLOB 5A8BA 3T4OA 2P7JA 4EXOA 3S7QA 3KSHA 3EQUA 2D02A 4HP9A 3BJNA 2PR5A 2J3TD 3E4OA 2YKHA 2JN7A 3V67A 4L9EA 1VHMA 2O0YA 4LPZA 4LRYC 4ARZA 2J3TC 3JVVA 3H82B 2M7UA 4MN5A 3W2ZA 1T1AA 2PDRA 3HJIA 3PYPA 3RFBA 2ZMFA 3K3CA 1BYWA 2LB5A 1UGUA 3PBQA 3UMEA 2W3HA 5HWWA 4NKPA 4JGQA 1N9LA 4EETB 2M7VA 1F5MA 2FH5A 1Y28A 4Y2FA 2P04A 5F69A 4DJ3A 2OOLA 3LR4A 4MN6A 3LIAA 1T1CA 2HV1A 4I3JA 4NXGA 3TW8A 4CLCD 3T4KA 5DF9A 1V9YA 4PKYA 1OTDA 3B33A 4G3KA 4O01A 1DP6A 3ICYA 3ULFA 5I5LA 2W1TB 3PHYA 3BQ8A 4XT2A 4PKYG 3B47A 3F1OB 2DMWA 4PAUA 4NXFA 5C5KA 3TRCA 2ZMVA 3UB6A 3OBFA 1NLYA 2V1BA 4EQ1A 2XROA 5HD3A 5MC7A 4MCWA 4G3WA 1ZTUA 4YNRA 3A0SA 5J3WA 4EW7A 3GECA 1KOUA 3KYZA 3T4LA 2OAQ1 3OCNA 4R38A 3LUQA 1S66L 4AFIA 3EOIA 3T4JA 4Q0JA 3EGDC 3MR0A 4CQHA 3T4TA 2V0WA 1TD5A 4L0LA 3LR0A 3R7WB 2ZOIA 5DFYA 1NRJA 4BMWA 1S4SA 4UQIS 4B9OA 4K08A 3HJKA 1S67L 5HSQA 4Q0HA 3MMHA 1MZUA 2PR6A 2XA7M 2VJWA 2VV8A 3IS2B 2VKSA 1XJ3A 2V1AA 1LT0A 2KOIA 4Z1WA 3PBOA 2JHEA 4NXBA 4WELA 2VV7A 5HWVA 3BWLA 2QHKA 4HY8A 4O8GA 1TS7A 2GNXA 3OC2A 3C38A 3HCYA 2GZAA 1S1ZA 2L1MA 1STZA 2JKRI 4F3LB 5DKLA 4R3AA 1IFQA 5AVEA 3VE3A 3ZYTA 5DJTA 4LRZE 5HZHA 4ZRRA 4B93A 5J7EA 2L4RA 3FPVA 1OTIA 1S4RA 1WA9A 3F1OA 4IUHA 1LL8A 3UMDA 3TE8A 2R78A 1YAXA 2V0UA 4NEED 4R70A 3U2AA 3MXQA 3LI9A 3LIBA 4L9GA 4O0PA 4EEPA 2PT7A 3LIFA 1TF1A 2VZWA 1VB6A 5TBMB 1OT6A 1P9RA 2EA9A 3R7WA 1OPXA 3BY8A 1XJ4A 3EWKA 5TJJA 2Y8HA 3UE3A 1P0ZA 2H28A 3IBJA 5EFWA 2JKTM 3IS2A 3D3OA 2VV6A 1XJ6A 3LI8A 3S7OA 4UEYA 3RTYA 5K5BA 3OCLA 3D72A 1P97A 3O5YA 4HI4A 2PD8A 1N9OA 3MQQA 4CLCC 2JKTI 3BW6A 3NJAA 3UB8A 4HH2A 3CUEA 4WN5A 5AVFA 3PBRA 3FG8A 4F3LA 3C8CA 2VLGA 1OJGA 4KUKA 2WKQA 4DMZA 1F9IA 2A2LA 2MJ6A 1H8MA 2INWA 4QPRA 3PBTA 2B18A 4HQAA 2K7SA 3E0YA 1DRMA 1G28A 2J3WA 3G6OA 3P7NA 1NLZA 4WF0A 5FL3A 1GSXA 3TJZC 1UWNX 3LIEA 3E4PA 3F1PA 3K2NA 3NOUC 4UQIM 3S7NA 3LICA 4EEUA 5G4YA 3LR3A 3UB7A 4CLCE 5IT5A 4ME4A 5HWTA 1D06A 3ZQ5A 4JGOA 4I39A 1OTBA 3OLOA 2WKPA 5TBMA 2O9AA 1T19A 1W63Q 5KSHA 2VGLS 3DBAA 2HJ9C 2L0WA 1V9ZA 2JKRM 3F1NB 2XSSA 2IA2A 1YSPA 5HL6A 2NUPC 2OWHA 4WEKA 1MC0A 1G6OA 2W3FA 3LFVA 3UB9A 4DN0A 3MQOA 5HPFA 2WKRA 4YWZA 3EEHA 1XJ2A 2J80A 3UE6A 4Y5FA 1XFQA 2GX5A 2W3GA 4P6ZS 4DJ2A 2EWWA 4EUVA 4II7A 4H6JB 4EU0A 3KO6A 5LBRA 4FSFA 2W3DA 3MQ0A 2ZOHA 4WLAA 4Y3IA 4MMNA 4HJ3A 1TS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIZ A;  2ZBB A;  2QKP A;  5F6A A;  3FC7 A;  1LSV A;  4HJ6 A;  1OTE A;  1D7E A;  1X0O A;  5HDC A;  4GS9 B;  3F1P B;  3NHQ A;  5HD5 A;  2GJ3 A;  4HP4 A;  2V9A A;  4HJ4 A;  3CAX A;  4M4X A;  5F68 A;  4HNB A;  2YKF A;  4I38 A;  3H7W B;  5IU1 A;  3NOP C;  2I9V A;  2PYR A;  5DJU A;  4GW9 A;  2PD7 A;  3KX0 X;  2OWJ A;  2A24 B;  3F1N A;  1GSV A;  4RQ9 A;  1NWZ A;  5DKK A;  1OTA A;  2B02 A;  4GCZ A;  2BAS A;  3MJQ A;  5J4E A;  2M1C A;  2KDK A;  4GHI B;  5F5Y A;  4H6J A;  4EES A;  3VOL A;  1OJ5 A;  4KUO A;  4WL9 A;  2VEA A;  1JNU A;  5IS1 A;  4I3I A;  1UWP X;  4BBV A;  4NXE A;  3K3D A;  3E4Q A;  3LYX A;  1T1B A;  2Z6D A;  3CWF A;  1EW0 A;  3LID A;  1XFN A;  1DP8 A;  3CLO A;  4GS9 A;  3A0V A;  2PYP A;  4BBU A;  1ODV A;  3MFX A;  2KX6 A;  1OT9 A;  1GSW A;  4EER A;  3NOT C;  4I3A A;  4I5S A;  4KQD A;  3H7W A;  1T18 A;  2D01 A;  1S1Y A;  4JGP A;  3H82 A;  3IBR A;  4BBT A;  2QJ7 A;  2Z6C A;  3A0R A;  4JGR A;  3RH8 B;  2QJ5 A;  2A24 A;  3H9W A;  4R6L A;  5G4Z A;  1F98 A;  1DP9 A;  4LRX C;  2CMN A;  4HOI A;  4HIA A;  3VE4 A;  1TS6 A;  4HHD A;  4L9F A;  1LSX A;  4GHI A;  4WUJ A;  4HH3 A;  1LSW A;  2W0N A;  3SW1 A;  1N9N A;  5HDD A;  4XT2 B;  4E04 A;  3BY9 A;  3T50 A;  2QWS A;  3C2W A;  3GDI A;  1TS0 A;  2PHY A;  2W27 A;  5HDS A;  4LLO B;  5A8B A;  2P7J A;  4EXO A;  2D02 A;  4HP9 A;  2PR5 A;  3E4O A;  2YKH A;  2JN7 A;  4L9E A;  4LPZ A;  4LRY C;  3H82 B;  4MN5 A;  1T1A A;  2PDR A;  3HJI A;  3PYP A;  3K3C A;  1BYW A;  1UGU A;  3UME A;  5HWW A;  4JGQ A;  1N9L A;  4EET B;  1Y28 A;  5F69 A;  4DJ3 A;  2OOL A;  4MN6 A;  3LIA A;  1T1C A;  2HV1 A;  4I3J A;  4NXG A;  1V9Y A;  4PKY A;  1OTD A;  3B33 A;  1DP6 A;  3ICY A;  3ULF A;  5I5L A;  3PHY A;  4XT2 A;  4PKY G;  3F1O B;  4NXF A;  3UB6 A;  2V1B A;  4EQ1 A;  5HD3 A;  3A0S A;  5J3W A;  4EW7 A;  3GEC A;  1KOU A;  4R38 A;  3LUQ A;  1S66 L;  3MR0 A;  2V0W A;  2ZOI A;  1S4S A;  4B9O A;  4K08 A;  3HJK A;  1S67 L;  5HSQ A;  1MZU A;  2PR6 A;  2VV8 A;  3IS2 B;  1XJ3 A;  2V1A A;  1LT0 A;  2JHE A;  4NXB A;  2VV7 A;  5HWV A;  3BWL A;  2QHK A;  4HY8 A;  1TS7 A;  1S1Z A;  2L1M A;  4F3L B;  5DKL A;  4R3A A;  5AVE A;  3VE3 A;  5DJT A;  4LRZ E;  5HZH A;  5J7E A;  2L4R A;  1OTI A;  1S4R A;  1WA9 A;  3F1O A;  1LL8 A;  3UMD A;  2R78 A;  2V0U A;  4R70 A;  3MXQ A;  3LI9 A;  3LIB A;  4L9G A;  4EEP A;  3LIF A;  1VB6 A;  5TBM B;  1OT6 A;  2EA9 A;  3BY8 A;  1XJ4 A;  3EWK A;  1P0Z A;  2H28 A;  5EFW A;  3IS2 A;  2VV6 A;  1XJ6 A;  3LI8 A;  3RTY A;  3D72 A;  1P97 A;  4HI4 A;  2PD8 A;  1N9O A;  3MQQ A;  3NJA A;  3UB8 A;  4HH2 A;  4WN5 A;  5AVF A;  3FG8 A;  4F3L A;  3C8C A;  2VLG A;  1OJG A;  4KUK A;  2WKQ A;  1F9I A;  2INW A;  4HQA A;  2K7S A;  1DRM A;  1G28 A;  3G6O A;  3P7N A;  4WF0 A;  1GSX A;  1UWN X;  3E4P A;  3LIE A;  3F1P A;  3NOU C;  4EEU A;  3LIC A;  5G4Y A;  3UB7 A;  5HWT A;  1D06 A;  3ZQ5 A;  4JGO A;  4I39 A;  1OTB A;  3OLO A;  2WKP A;  5TBM A;  1T19 A;  2L0W A;  1V9Z A;  3F1N B;  2OWH A;  3UB9 A;  3MQO A;  2WKR A;  4YWZ A;  3EEH A;  1XJ2 A;  2J80 A;  3UE6 A;  1XFQ A;  4DJ2 A;  4H6J B;  2ZOH A;  4WLA A;  4HJ3 A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 2ZBB A;  5EVL A;  1ZHH B;  2QKP A;  2JE5 A;  2VX8 A;  1LSV A;  2V2F F;  3HLF A;  3T4S A;  3W4P A;  4ESP A;  3NDE A;  2H5S A;  4S2P A;  3T1R A;  2J8Y A;  2V9A A;  4HJ4 A;  1KGE A;  3CAX A;  1OME A;  2Q9N A;  4OKP A;  5TGF A;  1GA9 A;  3V39 A;  4I38 A;  3E2K A;  4BWI A;  1W63 M;  4EUZ A;  4ID4 A;  5DJU A;  3SS4 A;  4LGW A;  3IH8 A;  2PD7 A;  1XXM A;  3F1N A;  2A24 B;  1GSV A;  1K54 A;  1NWZ A;  3VOZ A;  3V50 A;  3KSF A;  2W1R A;  2W3E A;  5FDH A;  1GHI A;  2DCF A;  5J4E A;  4KZ4 A;  5CGS A;  2JCH A;  2KDK A;  4KUO A;  2PAV P;  4KQO A;  4ZJ3 A;  2KLI A;  4I3I A;  2ZJ9 A;  4BBV A;  3G31 A;  3E4Q A;  2HF6 A;  2Y2O A;  4LV3 A;  3UPO A;  5E2E A;  5EV0 A;  4WMC D;  4BBU A;  3MFX A;  5DF7 A;  3SS3 A;  4X1L A;  3Q82 A;  3UDF A;  1VEU B;  1BZA A;  5GLD A;  3CPT B;  1IKG A;  2D01 A;  4JGP A;  1KGF A;  4WZ4 A;  3N8L A;  2VA0 A;  3RH8 B;  1H3Q A;  4P6Z M;  3IWI A;  1PZP A;  3EEA A;  3FZC A;  3IX8 A;  4IJG A;  2WUQ A;  4HIA A;  1TS6 A;  4BEN A;  4GHI A;  3FKV A;  3PXP A;  4KZ6 A;  4KG5 A;  4EBL A;  2HDR A;  3JVU A;  1N9N A;  3GR2 A;  1ERM A;  3UDI A;  3E98 A;  5DFX A;  3T50 A;  4WEJ A;  2QWS A;  4P0M A;  3GDI A;  2W1T A;  2W27 A;  4OOL A;  2XK1 A;  4FUW A;  3PR6 A;  2ZQ7 A;  3T4O A;  2P7J A;  2Y91 A;  3EQU A;  3BJN A;  2YKH A;  3V67 A;  2WYX A;  4LPZ A;  1L3L A;  2J3T C;  3JVV A;  4UAA A;  1T1A A;  4IVK A;  2ZMF A;  3K3C A;  4BQM A;  2WGI A;  1YMS A;  3PBQ A;  4JXW A;  1KGG A;  4NKP A;  4JGQ A;  4D60 A;  2JKF A;  4LCL A;  3QP1 A;  1PI4 A;  4DJ3 A;  3VSK A;  2V1Z A;  3UO9 A;  4I3J A;  4GZB A;  3T4K A;  1I5Q A;  3IXD A;  1QMF A;  1V9Y A;  2EX8 A;  5EVI C;  3B3X A;  4KZ8 A;  4XT2 A;  3OZH A;  4PKY G;  1SHV A;  2ZMV A;  3GTC A;  4EQ1 A;  5J8X A;  1NZU A;  1ZTU A;  2QZ6 A;  3G30 A;  4E6X A;  3A0S A;  4XXR A;  2EFU A;  1YLJ A;  3MBZ A;  4PM6 A;  4AFI A;  3EOI A;  5FQI A;  5HAI A;  3EGD C;  5DF8 A;  3UPN A;  4GKU A;  2OLV A;  1K4F A;  3WRZ A;  4BMW A;  1W7F A;  1FOF A;  3SH9 A;  3MMH A;  3IF6 B;  3C4O A;  4OLG A;  1KE0 A;  4JBF A;  3PBO A;  2XLN A;  1PW8 A;  4D2O A;  2WZZ A;  5HL1 A;  3P98 A;  2BTF P;  3C38 A;  1ES3 A;  4DE1 A;  3MZD A;  1PWG A;  1MKI A;  1IKI A;  1STZ A;  2JKR I;  3LEQ A;  4R4S A;  5DKL A;  2WGV A;  4WYY A;  1HZO A;  3MSH A;  3ZYT A;  3HLB A;  2ZLY A;  3DWK A;  3AGF A;  2R9W A;  3SOI A;  5DTK A;  2QPN A;  3TE8 A;  4IVI A;  3FKW A;  2V0U A;  3MXQ A;  3A3E A;  1BLS A;  5AQ7 A;  3LIB A;  3IT9 A;  2QMI A;  1EI5 A;  3E2L A;  5CED A;  2J9O A;  4OPZ A;  2DNS A;  2ZL1 A;  1O07 A;  2VZW A;  3R7W A;  1XJ4 A;  3MXS A;  3PTE A;  2Y8H A;  3IHB A;  4R0Q A;  5EFW A;  3D3O A;  5DVA A;  3S7O A;  2JC7 A;  3ITA A;  1VET A;  3OCL A;  1K55 C;  3IXB A;  4LFU A;  2WAE A;  3UDX A;  4CLC C;  3ISG A;  4N9L A;  1YLT A;  4HH2 A;  5FA7 A;  5AVF A;  3V3S A;  3BEB A;  3FG8 A;  4MNR A;  4N1X A;  4F3L A;  5CGX A;  3BRM A;  2PBY A;  2Y2L A;  4HQA A;  4OLD A;  3HUM A;  1G28 A;  4JF4 A;  3P7N A;  1QME A;  5FQ9 A;  1FSY A;  1WE4 A;  1Z09 A;  4GDN A;  3LIE A;  4EEU A;  4KEN B;  3ZQ5 A;  4JGO A;  3N8R A;  1VQQ A;  2O9A A;  2Q9M A;  3ZG7 B;  5BOH A;  3ZDJ A;  1E4D A;  2VGL S;  4ZAM A;  2HJ9 C;  1ESI A;  1YPR A;  1YSP A;  4WEK A;  1MC0 A;  4KZ5 A;  4PM5 A;  3MQO A;  4DE2 A;  1L0G A;  2XEP A;  4Y5F A;  4BD1 A;  5EVI A;  4H6J B;  4EU0 A;  2Y4A A;  2ZQC A;  5LBR A;  3IF6 C;  1MWS A;  3U4L P;  4IUK A;  3IH9 A;  5A93 A;  2HZ5 A;  4HJ6 A;  1OTE A;  5EUA A;  3P01 A;  2O99 A;  5AJG A;  4GS9 B;  3F1P B;  2K2N A;  1PFL A;  3SS5 A;  2PU4 A;  4IHQ A;  4S2I A;  2GJ3 A;  4S2N A;  4HP4 A;  1FSW A;  3C5A A;  3VV4 A;  3VFF A;  3B42 A;  2OSU A;  1BTL A;  4Q0I A;  5F68 A;  2YKF A;  4FTX A;  3MKE A;  3NOP C;  2PYR A;  5L8M A;  2VGK A;  3JPU A;  4GW9 A;  1IYS A;  3GV9 A;  3S1Y A;  3BLS A;  1YSQ A;  3JYI A;  3C30 A;  2XRN A;  2FZ0 A;  4RQ9 A;  1M40 A;  5F1F A;  4PM7 A;  1MPL A;  2B02 A;  3HBR A;  3IWO A;  2M1C A;  1E3U D;  3PAE A;  5GHY A;  4R3B A;  5F5Y A;  5L07 A;  4ETZ A;  4WL9 A;  2VEA A;  1MY8 A;  5CGW A;  1YLZ A;  1UWP X;  1NZO A;  4NXE A;  1TVF A;  3K3D A;  1T1B A;  3BFE A;  3CWF A;  3VP4 A;  1EW0 A;  1XFN A;  1Y4O A;  4UA9 A;  3O86 A;  1FR1 A;  5CEB A;  2Y2G A;  3DAV A;  3GSG A;  4OVD A;  1K6S A;  2Y2J A;  1FIL A;  4DXB A;  2A49 A;  1ODV A;  3ZVT A;  2J7V A;  1YT4 A;  4I5S A;  4KQD A;  3VP1 A;  3NUL A;  4X53 A;  3H7W A;  4KG6 A;  2Y2P A;  1NXY A;  1K55 A;  3NDG A;  4E3K A;  2OAP 1;  4CLC A;  3L7H A;  5G4Z A;  1H8Z A;  1F98 A;  2XA7 S;  1DP9 A;  4BJP A;  2CMN A;  3BEC A;  4YIN A;  2ZC6 B;  4HES A;  2O9B A;  4BD0 A;  4WUJ A;  2P08 A;  2W0N A;  4ETX A;  3CI6 A;  4ZTK A;  4B4X A;  2XFS A;  5HDD A;  1YLW A;  2QYB A;  1PWD A;  4GJ4 A;  3MZF A;  4U3T A;  3FPW A;  4OP8 A;  2PHY A;  3IX4 A;  4MBH A;  5FEG A;  1W8Q A;  5HDS A;  2OV5 A;  5A8B A;  5FEF A;  5KZH A;  4EXO A;  4WBG A;  3G32 A;  1DJA A;  3WWX A;  4S2M A;  4L9E A;  1JTG A;  1VHM A;  2O0Y A;  3GVB A;  5TFQ A;  4ARZ A;  3H82 B;  4MN5 A;  1C3B A;  2PDR A;  3ZG0 A;  3DTE A;  1CI9 A;  3VOY A;  1RCJ A;  2P9V B;  5HWW A;  2M7V A;  4UHU A;  1Y28 A;  3BFC A;  5E43 A;  3IHA A;  1NYY A;  3IF6 A;  5F69 A;  2OOL A;  4MN6 A;  1T1C A;  2ZC4 B;  5DTT A;  3BLM A;  5DF9 A;  2Z2M B;  3B33 A;  4G3K A;  2EX2 A;  3ULF A;  3S4X A;  1ONH A;  5I5L A;  5G18 A;  3HLC A;  3B47 A;  4PAU A;  5C5K A;  3AGD A;  3N6I A;  4E3I A;  3UB6 A;  2V1B A;  3A3I A;  1DY6 A;  1U60 A;  5KMW A;  1MWT A;  5MC7 A;  5M18 A;  2ZQA A;  1CF0 A;  2V8F A;  2V20 A;  2WGW B;  3OCN A;  4R38 A;  3SH8 A;  1S66 L;  2XR0 A;  3RXW A;  3OPR A;  1CEG A;  4JF5 A;  4Y13 A;  3Q1F A;  1Z6F A;  2V0W A;  4L0L A;  4Y0T A;  3BYD A;  1NRJ A;  4Z9Q A;  1S4S A;  2P74 A;  3HJK A;  1YQS A;  1SKO B;  1S67 L;  4Q0H A;  2PR6 A;  3IS2 B;  3O3V A;  5FQM A;  4Y0O A;  2V1A A;  5DTS A;  4WM9 A;  4NXB A;  5I94 A;  1TDL A;  4OPR A;  2VV7 A;  5HWV A;  4UA7 A;  2QHK A;  4HY8 A;  4O8G A;  1TS7 A;  3OC2 A;  4NET A;  3IXH A;  1S1Z A;  1IEL A;  2HP9 A;  4S2O A;  1IFQ A;  4R4R A;  3DW0 A;  4LRZ E;  5HZH A;  3RXX A;  2WKH A;  4B93 A;  1WYC A;  1WA9 A;  3F1O A;  4IUH A;  4WZ5 C;  2R78 A;  2IWB A;  1YAX A;  4R70 A;  3FWL A;  5FI6 A;  2V8C A;  4O0P A;  1CEF A;  1WYB A;  2Y2K A;  4EEP A;  1XP4 A;  5FI2 A;  4EQI A;  2EX6 A;  3BY8 A;  5TJJ A;  3IBJ A;  2JKT M;  2VV6 A;  3LI8 A;  1CK3 A;  5K5B A;  2CC1 A;  3G2Y A;  3LY4 A;  1P97 A;  4E3N A;  1NJ4 A;  3W4Q A;  2XDM A;  3IX3 A;  4DXC A;  1HLU P;  1N9O A;  2Z2L B;  3ZG5 A;  3MQQ A;  5GLA A;  3UB5 P;  3BW6 A;  1K0K A;  4X6T A;  1L0F A;  3TSG A;  1SDN A;  2XF3 A;  3UE1 A;  5GLB A;  2OLU A;  3CJM A;  2UWX A;  2WKQ A;  1F9I A;  2A2L A;  5FI7 A;  1BUE A;  3MFD A;  1H8M A;  1W79 A;  2INW A;  4QPR A;  3PBT A;  3E0Y A;  4KG2 A;  4QU3 A;  4WF0 A;  1LL5 A;  5FAT A;  4S2J A;  5FL3 A;  5F1G A;  3WRT A;  1GSX A;  3F1P A;  3NOU C;  4LV2 A;  3LIC A;  5FSR A;  4S2K A;  3UB7 A;  4CLC E;  4A5R A;  3A3D A;  4E6W A;  4JF6 A;  4Y7P A;  1OTB A;  3GMW A;  3BM6 A;  3OPH A;  5TBM A;  4HBT A;  1W63 Q;  1LLB A;  1CJF A;  3F1N B;  3UPP A;  5L2F A;  5CER A;  5FQK A;  1G6O A;  2WAF A;  3UB9 A;  1K25 A;  2WKR A;  3EEH A;  3UE6 A;  2W3G A;  4DJ2 A;  4OQI A;  1TEM A;  3KO6 A;  3QNC A;  3Q7V B;  4DE0 A;  4FSF A;  1LI9 A;  3MQ0 A;  2ZOH A;  4HJ3 A;  4IBR A;  5KIZ A;  2E8I A;  3CG5 A;  2FFF B;  5F6A A;  3FC7 A;  3MF0 A;  3PBS A;  4X55 A;  1D7E A;  2EFX A;  3V5M A;  3ZNY A;  3NCK A;  3NHQ A;  1IOU A;  3G4P A;  4E3M A;  1SKF A;  3FYZ A;  2XD5 A;  3ZHH A;  1E25 A;  1XPB A;  3IWQ A;  2HP6 A;  4RYE A;  4EBN A;  1MKM A;  1K56 A;  4P87 A;  1BT5 A;  2NUT C;  5L10 A;  4CJN A;  3OOV A;  3RJU A;  1I2W A;  5TR7 A;  1ALQ A;  1HVB A;  3T12 B;  1DJC A;  3HLW A;  4GCZ A;  3MJQ A;  3PAG A;  2X71 A;  3T4Q A;  4OH0 A;  4GHI B;  4EES A;  1OJ5 A;  2ZM0 A;  1YKD A;  5IS1 A;  5FAQ A;  5EVI D;  2ZC7 A;  3NI9 A;  3R4K A;  2C5W B;  1FQG A;  1XA1 A;  3Q7Z A;  2Y2H A;  3LYX A;  4OOM A;  2ZQ8 A;  1NY0 A;  1DP8 A;  1ZC2 A;  2XD1 A;  4G3V A;  1RGZ A;  3HRE A;  3HL9 A;  3QHY A;  3I7J A;  5EM1 A;  1RGY A;  4MBF A;  3DTK A;  5F83 A;  3P09 A;  3VP2 A;  2PU2 A;  5L09 A;  1W8Y A;  1OT9 A;  2VGL M;  4EER A;  5AQA A;  1FIK A;  4I3A A;  5CX7 A;  2X02 A;  5FAO A;  1PWC A;  1T18 A;  3WS1 A;  3S7P A;  2H0T A;  1F2K A;  2Y79 A;  5HX9 A;  3H82 A;  1ACF A;  3IBR A;  4BBT A;  1J3W A;  2Z6C A;  3A0R A;  3CIT A;  1FR6 A;  3WS2 A;  2A24 A;  4PHT A;  1IEM A;  4LRX C;  4HOI A;  3QP5 A;  1Y54 A;  4L9F A;  1LSX A;  5CHJ A;  5GHX A;  4O7D A;  1K54 C;  3CZD A;  3SW1 A;  5U47 A;  5HPI A;  3Q07 A;  3BQA A;  4XT2 B;  4MDZ A;  5A90 A;  4E04 A;  3C2W A;  1TS0 A;  3BFF A;  4OPY A;  3ZG9 B;  4X68 A;  4DDY A;  3KYQ A;  1DJB A;  3N4I A;  2BLS A;  1G6A A;  3S7Q A;  3KSH A;  3OPL A;  1AWI A;  3E4O A;  2BG1 A;  2JN7 A;  2H10 A;  2HP5 A;  4LRY C;  4RA7 A;  3W2Z A;  4DRT A;  3A3J A;  1VEU A;  3O87 A;  3HJI A;  3CPT A;  3UNW A;  4K91 A;  2ZMA A;  4ZBE A;  5KSC A;  3WS4 A;  5F82 A;  3TG9 A;  2LB5 A;  4P6B A;  1UGU A;  1MWU A;  4RVA A;  2W3H A;  4F94 A;  3NIA A;  4QD4 A;  1F5M A;  1GCE A;  3BFG A;  3D9Y A;  4DDS A;  2B95 A;  4R23 A;  3T1Q B;  5FAP A;  3LIA A;  3HLG A;  5GHZ A;  2HV1 A;  1BLH A;  3TW8 A;  4CLC D;  2XH9 A;  1FCO A;  4QHC A;  1OTD A;  3QNB A;  4O01 A;  1DP6 A;  5GL9 A;  2X01 A;  2Y2Q A;  5E2G A;  2XRO A;  1NLY A;  5AQ9 A;  1W5D A;  4MCW A;  3ITB A;  4YNR A;  5J3W A;  3BFD A;  4EW7 A;  1ZG4 A;  2HDS A;  1KOU A;  4MEZ A;  2WZX A;  3LUQ A;  3C7U A;  2ZQD A;  3M2K A;  5E2H A;  3T4J A;  2ZL1 B;  3MXR A;  4CQH A;  4JPM A;  1TD5 A;  3LY3 A;  3HVF A;  3R7W B;  4K0W A;  5EEC A;  2PRF A;  1M6K A;  4GN2 A;  4UQI S;  5FQQ A;  5HSQ A;  1N9B A;  3WS0 A;  2XA7 M;  2VJW A;  2VKS A;  1LT0 A;  1KVL A;  3HUN A;  3ZVW A;  1VET B;  5FDS A;  2ZM8 A;  4GOG A;  2JHE A;  1MWR A;  4PM8 A;  4PPR A;  4KZ9 A;  4C6Y A;  3BWL A;  4C75 A;  4S2L A;  3HCY A;  4LV1 A;  2L1M A;  1K57 C;  1PIO A;  4F3L B;  5AVE A;  3VE3 A;  3M2J A;  4EWF A;  1BLP A;  4E3J A;  5J7E A;  5CXW A;  1LL8 A;  2G2W A;  3UMD A;  3N8S A;  5EOE A;  4QB8 A;  1PYY A;  2HDU A;  1RP5 A;  4RX3 A;  3DTM A;  3LIF A;  3HLD A;  4JKT A;  4LCM A;  1P9R A;  1IYQ A;  1OPX A;  3EWK A;  2Q0O A;  3LO7 A;  1Q2Q A;  1P0Z A;  5A92 A;  1MXO A;  5HAR A;  1XJ6 A;  1Q2P A;  4UEY A;  3D72 A;  1YLP A;  3DWZ A;  3O5Y A;  4HI4 A;  5EVI B;  2I72 A;  1J9M A;  5CTM A;  3NJA A;  3UB8 A;  1AXB A;  2WAD A;  4H8R A;  4OQG A;  3SH7 A;  4JLF A;  2VGJ A;  1OJG A;  4KUK A;  4JXG A;  3Q7V A;  3MS6 A;  4IBX A;  4XUX A;  3UY6 A;  5EM0 A;  1DRM A;  3CMZ A;  1NLZ A;  1XKZ A;  5EE8 A;  2E8J A;  3GQZ A;  4KZA A;  3G2Z A;  4N1H A;  3TJZ C;  1UWN X;  3E4P A;  1ONG A;  2ZQ9 A;  1GHM A;  5G4Y A;  3LR3 A;  2JKG A;  5JYO A;  4ME4 A;  4UA6 A;  4I39 A;  3OLO A;  2WKP A;  1CI8 A;  4EV4 A;  1XGI A;  4FD8 A;  4IED A;  5FAS A;  3DBA A;  1NYM A;  1V9Z A;  1GA0 A;  3LCE A;  1JWZ A;  2AVX A;  1G5U A;  3FV7 A;  1YMX A;  2IA2 A;  2Y2M A;  5HL6 A;  2NUP C;  2OWH A;  3LFV A;  5CHM A;  1JVJ A;  1XX2 A;  1HTZ A;  4NK3 A;  2ZM2 A;  1LL9 A;  4QY5 A;  2ZD8 A;  2B5R A;  1L0D A;  5EVE A;  3G35 A;  3ZGA B;  4P6Z S;  2EWW A;  5EOO A;  4EUV A;  3QP8 A;  4RX2 A;  1JTD A;  1PNE A;  5CTN A;  2W3D A;  3WS5 A;  4Y3I A;  4MMN A;  4DF6 A;  4MLL A;  1TS8 A;  3QP4 A;  4WMC A;  4K0X A;  1X0O A;  4OP5 A;  5HDC A;  2Y55 A;  2HPB A;  1MBL A;  2ACG A;  3EGX C;  4X1M A;  4GLQ A;  1ERQ A;  1ES4 A;  1L2S A;  5HD5 A;  1L0E A;  4BLM A;  1KVM A;  4HBU A;  1PW1 A;  3IXG A;  2WK0 A;  5JYP A;  3NY4 A;  4M4X A;  4HNB A;  3H7W B;  5IU1 A;  2H0Y A;  1GHP A;  4Y0U A;  1N4O A;  2I9V A;  4BL3 A;  1YLY A;  3KX0 X;  2OWJ A;  2XGN A;  4CLC B;  2HGV A;  3L9K A;  3KSI A;  5DKK A;  1OTA A;  1K57 A;  1YM1 A;  1ESU A;  1ZG6 A;  2BAS A;  2IWD A;  3ZCZ A;  1PZO A;  5D3O A;  4H6J A;  2LB9 A;  3VOL A;  3TOI A;  2EWV A;  3VP0 A;  1JNU A;  1JWV A;  4GDB A;  5GLC A;  4R3J A;  2VK3 A;  4ZJ2 A;  3M6B A;  2Z6D A;  3LID A;  3PBN A;  4JXS A;  3CLO A;  4Y17 A;  4GS9 A;  4MN7 A;  3A0V A;  2PYP A;  3Q81 A;  2KX6 A;  4ARZ B;  2A3U A;  1GSW A;  3NOT C;  4OQH A;  2GDN A;  1NRF A;  3EQV A;  1S1Y A;  4S2N C;  3NBL A;  4FCF A;  1XA7 A;  2O9C A;  2G2U A;  3KYE A;  1FCM A;  2QJ7 A;  4HEF A;  3KSG A;  4JGR A;  2QJ5 A;  3V3R A;  3ZFZ A;  3IF5 A;  4N9K A;  1K56 D;  4GNU A;  2UV0 E;  3H9W A;  5HAP A;  4YOF A;  4R6L A;  2HJE A;  1BLC A;  4X56 A;  4Y15 A;  3VE4 A;  2G7U A;  4HHD A;  1P9W A;  4OON A;  4HH3 A;  4GD6 A;  1LSW A;  2HDQ A;  2PBD P;  2K31 A;  4FOF A;  3LR5 A;  3NC8 A;  3CUE C;  3BY9 A;  2FFY A;  4PM9 A;  1VM1 A;  3T1X A;  5M19 A;  4Q8I A;  4YFM A;  1KDW A;  3G34 A;  4LLO B;  5HAQ A;  4QY6 A;  4KZ7 A;  4FH2 A;  2D02 A;  4HP9 A;  3OPP A;  2PR5 A;  2J3T D;  1CQA A;  4OQ0 A;  2M7U A;  4LV0 A;  1KDS A;  4ZDX A;  3PYP A;  3RFB A;  4KZ3 A;  1BYW A;  3UME A;  2Y2N A;  4XUZ A;  1N9L A;  4EET B;  5M1A A;  2FH5 A;  1HD8 A;  1S0W A;  5CRF A;  1PI5 A;  4Y2F A;  2P04 A;  4C3Q A;  4OPQ A;  3LR4 A;  3HLE A;  4QJG A;  4P85 A;  4FH4 A;  4NXG A;  3VSL A;  4WZ5 A;  1ES2 A;  4PKY A;  4KZB A;  4ZJ1 A;  2RCX A;  3ICY A;  2W1T B;  3PHY A;  3BQ8 A;  5IHV A;  2C6W B;  3F1O B;  2DMW A;  3TRC A;  4NXF A;  3OBF A;  1ZKJ A;  4NG2 A;  5HD3 A;  4G3W A;  1G68 A;  4N92 A;  3DTI A;  3GEC A;  4E3O A;  3KYZ A;  5A91 A;  3T4L A;  2OAQ 1;  3GRJ A;  2XQZ A;  1SZV A;  1H0M A;  5CEC A;  4Q0J A;  1SCW A;  3MR0 A;  5HW3 A;  1LI0 A;  3T4T A;  3HUO A;  3D4F A;  3LR0 A;  1KE3 A;  2ZC3 B;  2ZOI A;  5DFY A;  4E3L A;  4B9O A;  4K08 A;  4JXV A;  1K4E A;  1MZU A;  3C4P A;  2P9V A;  2VV8 A;  1XJ3 A;  2KOI A;  1FCN A;  4Z1W A;  2EXB A;  4U0T A;  4WEL A;  2GNX A;  1PRQ A;  2GZA A;  3QP2 A;  2WKI A;  3UE0 A;  1XGJ A;  2XFT A;  5CHU A;  2R9X A;  4R3A A;  3VFH A;  5DJT A;  2WKE A;  4ZRR A;  3QP6 A;  4R1G A;  1IYP A;  2L4R A;  3FPV A;  3T1S A;  1LHY A;  1OTI A;  4DKI A;  1S4R A;  3ZG8 B;  2Y2I A;  4NEE D;  3U2A A;  5E2F A;  5EPH A;  3LI9 A;  2EXA A;  3C7V A;  3VP3 A;  2WGW A;  2JBF A;  4L9G A;  2IWC A;  1O7E A;  1TDG A;  2PT7 A;  1TF1 A;  1VB6 A;  5TBM B;  3N7W A;  1OT6 A;  3MZE A;  2EA9 A;  5AQB A;  3MKF A;  2EX9 A;  3UE3 A;  3VMA A;  1SKO A;  4BL2 A;  1KE4 A;  2H28 A;  3IQA A;  3IS2 A;  1I2S A;  4X25 A;  3RTY A;  3UN7 A;  3LGO A;  2PD8 A;  1S6R A;  2JKT I;  2Y59 A;  4M3K A;  2DRW A;  3LEZ A;  3CUE A;  1A0K A;  4WN5 A;  4KQR A;  4KQQ A;  3PBR A;  4QWO A;  3C8C A;  4GB7 A;  4EBP A;  2VLG A;  4DMZ A;  2MJ6 A;  4B4Z A;  4MBK A;  1JWP A;  1BUL A;  2B18 A;  4CPK A;  2K7S A;  2J3W A;  3G6O A;  4B88 A;  2ZC5 B;  5HFO A;  3K2N A;  4UQI M;  3S7N A;  1K6R A;  5IT5 A;  5HWT A;  4U0X A;  1D06 A;  3A3F A;  3ZNT A;  3M6H A;  1EWZ A;  1H8Y A;  1T19 A;  1IYO A;  5KSH A;  1SDE A;  4PMA A;  2L0W A;  2JKR M;  2J9P A;  2XSS A;  2RL3 A;  4LEN A;  1E3U A;  2W3F A;  3NEC A;  3W8K A;  4DN0 A;  1K38 A;  3CHW P;  3AGE A;  5HPF A;  4YWZ A;  4X69 A;  1XJ2 A;  2J80 A;  4DE3 A;  1ERO A;  1XFQ A;  3O88 A;  2GX5 A;  5FQJ A;  4II7 A;  4OOY A;  1H5X A;  3SZT A;  1ES5 A;  1D1J A;  4WLA A;  1BSG A;  3S22 A;  4GD8 A;  3W4O A; 
#chains in the Genus database with same CATH homology
 5KIZ A;  2ZBB A;  1ZHH B;  2QKP A;  4IUK A;  5F6A A;  3FC7 A;  3MF0 A;  2VX8 A;  1LSV A;  3PBS A;  1OTE A;  4HJ6 A;  3T4S A;  1D7E A;  1X0O A;  3P01 A;  5HDC A;  2O99 A;  3EGX C;  5AJG A;  4GS9 B;  3F1P B;  2K2N A;  4GLQ A;  3NHQ A;  4IHQ A;  5HD5 A;  2GJ3 A;  1IOU A;  4HP4 A;  3VV4 A;  2V9A A;  4HJ4 A;  3B42 A;  3CAX A;  4Q0I A;  4M4X A;  5F68 A;  4HNB A;  2YKF A;  4I38 A;  3H7W B;  5IU1 A;  4BWI A;  1W63 M;  1MKM A;  3NOP C;  2I9V A;  2NUT C;  2PYR A;  3OOV A;  5L8M A;  5DJU A;  4GW9 A;  2PD7 A;  3KX0 X;  1YSQ A;  2OWJ A;  2A24 B;  3F1N A;  4CLC B;  2HGV A;  3C30 A;  1GSV A;  2XRN A;  2FZ0 A;  4RQ9 A;  1NWZ A;  3KSF A;  3KSI A;  1OTA A;  5DKK A;  2B02 A;  2W1R A;  4GCZ A;  2BAS A;  2W3E A;  3MJQ A;  5J4E A;  3T4Q A;  2M1C A;  2KDK A;  4GHI B;  5F5Y A;  4ETZ A;  4H6J A;  2LB9 A;  4EES A;  3VOL A;  1OJ5 A;  4KUO A;  4WL9 A;  2VEA A;  2EWV A;  1YKD A;  4KQO A;  1JNU A;  5IS1 A;  2KLI A;  4I3I A;  1UWP X;  3R4K A;  4BBV A;  4NXE A;  3K3D A;  3E4Q A;  2HF6 A;  3LYX A;  1T1B A;  2Z6D A;  3CWF A;  1EW0 A;  3LID A;  4OOM A;  1XFN A;  1DP8 A;  3PBN A;  4G3V A;  3CLO A;  4GS9 A;  4MN7 A;  3A0V A;  2PYP A;  4BBU A;  1ODV A;  3MFX A;  2KX6 A;  1OT9 A;  4ARZ B;  2VGL M;  1GSW A;  4EER A;  3NOT C;  4I3A A;  5CX7 A;  4I5S A;  4KQD A;  3EQV A;  3H7W A;  1T18 A;  2D01 A;  1S1Y A;  4JGP A;  3S7P A;  2Y79 A;  2O9C A;  3H82 A;  3IBR A;  4BBT A;  2QJ7 A;  2Z6C A;  3A0R A;  3KSG A;  2VA0 A;  4JGR A;  3RH8 B;  1H3Q A;  3CIT A;  4P6Z M;  2QJ5 A;  2OAP 1;  3EEA A;  2A24 A;  4CLC A;  3H9W A;  4YOF A;  4R6L A;  2HJE A;  4PHT A;  5G4Z A;  2XA7 S;  1F98 A;  4IJG A;  1DP9 A;  4LRX C;  4BJP A;  2CMN A;  4HOI A;  4HIA A;  3VE4 A;  1TS6 A;  2O9B A;  2G7U A;  4HHD A;  1P9W A;  1LSX A;  4L9F A;  4GHI A;  3PXP A;  4WUJ A;  4HH3 A;  2P08 A;  3JVU A;  1LSW A;  2W0N A;  4ETX A;  3SW1 A;  3CI6 A;  2K31 A;  1N9N A;  4FOF A;  5HPI A;  5HDD A;  3LR5 A;  3BQA A;  4XT2 B;  4MDZ A;  3CUE C;  2QYB A;  3E98 A;  4E04 A;  3BY9 A;  5DFX A;  3T50 A;  4WEJ A;  4GJ4 A;  2QWS A;  3C2W A;  3FPW A;  3GDI A;  1TS0 A;  2PHY A;  2W1T A;  2W27 A;  4OOL A;  5HDS A;  3KYQ A;  3PR6 A;  4LLO B;  5A8B A;  3T4O A;  2P7J A;  4EXO A;  3S7Q A;  3KSH A;  3EQU A;  2D02 A;  4HP9 A;  3BJN A;  2PR5 A;  2J3T D;  3E4O A;  2YKH A;  2JN7 A;  3V67 A;  4L9E A;  1VHM A;  2O0Y A;  4LPZ A;  4LRY C;  4ARZ A;  2J3T C;  3JVV A;  3H82 B;  2M7U A;  4MN5 A;  3W2Z A;  1T1A A;  2PDR A;  3HJI A;  3PYP A;  3RFB A;  2ZMF A;  3K3C A;  1BYW A;  2LB5 A;  1UGU A;  3PBQ A;  3UME A;  2W3H A;  5HWW A;  4NKP A;  4JGQ A;  1N9L A;  4EET B;  2M7V A;  1F5M A;  2FH5 A;  1Y28 A;  4Y2F A;  2P04 A;  5F69 A;  4DJ3 A;  2OOL A;  3LR4 A;  4MN6 A;  3LIA A;  1T1C A;  2HV1 A;  4I3J A;  4NXG A;  3TW8 A;  4CLC D;  3T4K A;  5DF9 A;  1V9Y A;  4PKY A;  1OTD A;  3B33 A;  4G3K A;  4O01 A;  1DP6 A;  3ICY A;  3ULF A;  5I5L A;  2W1T B;  3PHY A;  3BQ8 A;  4XT2 A;  4PKY G;  3B47 A;  3F1O B;  2DMW A;  4PAU A;  4NXF A;  5C5K A;  3TRC A;  2ZMV A;  3UB6 A;  3OBF A;  1NLY A;  2V1B A;  4EQ1 A;  2XRO A;  5HD3 A;  5MC7 A;  4MCW A;  4G3W A;  1ZTU A;  4YNR A;  3A0S A;  5J3W A;  4EW7 A;  3GEC A;  1KOU A;  3KYZ A;  3T4L A;  2OAQ 1;  3OCN A;  4R38 A;  3LUQ A;  1S66 L;  4AFI A;  3EOI A;  3T4J A;  4Q0J A;  3EGD C;  3MR0 A;  4CQH A;  3T4T A;  2V0W A;  1TD5 A;  4L0L A;  3LR0 A;  3R7W B;  2ZOI A;  5DFY A;  1NRJ A;  4BMW A;  1S4S A;  4UQI S;  4B9O A;  4K08 A;  3HJK A;  1S67 L;  5HSQ A;  4Q0H A;  3MMH A;  1MZU A;  2PR6 A;  2XA7 M;  2VJW A;  2VV8 A;  3IS2 B;  2VKS A;  1XJ3 A;  2V1A A;  1LT0 A;  2KOI A;  4Z1W A;  3PBO A;  2JHE A;  4NXB A;  4WEL A;  2VV7 A;  5HWV A;  3BWL A;  2QHK A;  4HY8 A;  4O8G A;  1TS7 A;  2GNX A;  3OC2 A;  3C38 A;  3HCY A;  2GZA A;  1S1Z A;  2L1M A;  1STZ A;  2JKR I;  4F3L B;  5DKL A;  4R3A A;  1IFQ A;  5AVE A;  3VE3 A;  3ZYT A;  5DJT A;  4LRZ E;  5HZH A;  4ZRR A;  4B93 A;  5J7E A;  2L4R A;  3FPV A;  1OTI A;  1S4R A;  1WA9 A;  3F1O A;  4IUH A;  1LL8 A;  3UMD A;  3TE8 A;  2R78 A;  1YAX A;  2V0U A;  4NEE D;  4R70 A;  3U2A A;  3MXQ A;  3LI9 A;  3LIB A;  4L9G A;  4O0P A;  4EEP A;  2PT7 A;  3LIF A;  1TF1 A;  2VZW A;  1VB6 A;  5TBM B;  1OT6 A;  1P9R A;  2EA9 A;  3R7W A;  1OPX A;  3BY8 A;  1XJ4 A;  3EWK A;  5TJJ A;  2Y8H A;  3UE3 A;  1P0Z A;  2H28 A;  3IBJ A;  5EFW A;  2JKT M;  3IS2 A;  3D3O A;  2VV6 A;  1XJ6 A;  3LI8 A;  3S7O A;  4UEY A;  3RTY A;  5K5B A;  3OCL A;  3D72 A;  1P97 A;  3O5Y A;  4HI4 A;  2PD8 A;  1N9O A;  3MQQ A;  4CLC C;  2JKT I;  3BW6 A;  3NJA A;  3UB8 A;  4HH2 A;  3CUE A;  4WN5 A;  5AVF A;  3PBR A;  3FG8 A;  4F3L A;  3C8C A;  2VLG A;  1OJG A;  4KUK A;  2WKQ A;  4DMZ A;  1F9I A;  2A2L A;  2MJ6 A;  1H8M A;  2INW A;  4QPR A;  3PBT A;  2B18 A;  4HQA A;  2K7S A;  3E0Y A;  1DRM A;  1G28 A;  2J3W A;  3G6O A;  3P7N A;  1NLZ A;  4WF0 A;  5FL3 A;  1GSX A;  3TJZ C;  1UWN X;  3LIE A;  3E4P A;  3F1P A;  3K2N A;  3NOU C;  4UQI M;  3S7N A;  3LIC A;  4EEU A;  5G4Y A;  3LR3 A;  3UB7 A;  4CLC E;  5IT5 A;  4ME4 A;  5HWT A;  1D06 A;  3ZQ5 A;  4JGO A;  4I39 A;  1OTB A;  3OLO A;  2WKP A;  5TBM A;  2O9A A;  1T19 A;  1W63 Q;  5KSH A;  2VGL S;  3DBA A;  2HJ9 C;  2L0W A;  1V9Z A;  2JKR M;  3F1N B;  2XSS A;  2IA2 A;  1YSP A;  5HL6 A;  2NUP C;  2OWH A;  4WEK A;  1MC0 A;  1G6O A;  2W3F A;  3LFV A;  3UB9 A;  4DN0 A;  3MQO A;  5HPF A;  2WKR A;  4YWZ A;  3EEH A;  1XJ2 A;  2J80 A;  3UE6 A;  4Y5F A;  1XFQ A;  2GX5 A;  2W3G A;  4P6Z S;  4DJ2 A;  2EWW A;  4EUV A;  4II7 A;  4H6J B;  4EU0 A;  3KO6 A;  5LBR A;  4FSF A;  2W3D A;  3MQ0 A;  2ZOH A;  4WLA A;  4Y3I A;  4MMN A;  4HJ3 A;  1TS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...