3MQQA

The crystal structure of the pas domain in complex with ethanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.65a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LuxR family
publication title The Crystal Structure of the PAS domain in complex with Ethanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.65A
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqqA00
4WL9A 4H6JA 4DJ3A 2Z6CA 1OTAA 3NOUC 2PYRA 5HZHA 1F98A 4EESA 1DP6A 1S1ZA 4XT2B 2PHYA 4F3LB 2PR6A 5HD5A 3FC7A 3P7NA 4HJ4A 2D01A 4DJ2A 3LIDA 1LL8A 4LRXC 3E4PA 5EFWA 4EQ1A 1WA9A 2QHKA 3NJAA 1XJ6A 1TS7A 4KUOA 2L0WA 4GHIA 1OJGA 4RQ9A 1OTEA 3C8CA 1T1AA 3EWKA 3LUQA 1F9IA 1X0OA 3UB7A 2QJ5A 1N9NA 3UMEA 2OOLA 1P0ZA 2PD7A 3LICA 3F1NB 3NHQA 4I3IA 2A24A 4I3JA 2VV8A 3HJKA 5HSQA 4NXBA 3F1PB 1S67L 4EERA 3MFXA 4I5SA 2PR5A 4HJ3A 2L4RA 4GCZA 3RH8B 4HNBA 1LSVA 3H82A 3MR0A 4I39A 2A24B 4PKYA 2HV1A 1ODVA 3K3DA 4F3LA 2OWHA 3BY8A 3CAXA 2JN7A 1GSXA 3E4OA 2V0WA 4HY8A 2V9AA 3UB8A 3GECA 1UWNX 5HDSA 3UB6A 5IS1A 1DP8A 2B02A 5TBMA 2K7SA 4HH3A 2QJ7A 1OJ5A 1VB6A 1GSVA 2H28A 3H82B 2J80A 4GS9B 2WKQA 2W0NA 2ZOHA 1XJ2A 1OTIA 4L9EA 3F1NA 3C2WA 1TS6A 4B9OA 3VE4A 4LLOB 2ZOIA 4R38A 1OT9A 4HH2A 1NWZA 3RTYA 1EW0A 3SW1A 2R78A 5TBMB 3MXQA 3F1PA 3CLOA 3D72A 4JGQA 2L1MA 3VOLA 4BBUA 1T19A 3T50A 5HDCA 1LSWA 1XJ4A 3H7WA 5DJTA 2YKHA 1UGUA 2PD8A 4BBVA 3PHYA 1T1CA 5IU1A 4EW7A 5HWWA 1N9OA 2P7JA 4E04A 2W27A 3LIEA 4NXFA 1LSXA 2ZBBA 2GJ3A 1P97A 2V1AA 4HIAA 3EEHA 3A0RA 2CMNA 2PYPA 3IBRA 3IS2B 4EEPA 4NXGA 3MQQA 3NOPC 5HD3A 3H7WB 4R70A 3VE3A 5G4ZA 4R3AA 4JGOA 4LPZA 4I38A 4GS9A 2PDRA 1XFQA 4EETB 4HJ6A 2VEAA 4GW9A 5J7EA 2WKPA 1T1BA 3UB9A 5HWTA 3PYPA 2VV7A 5J3WA 2WKRA 1TS8A 5F69A 5DKLA 1UWPX 1LT0A 1OTDA 5DJUA 1KOUA 2V1BA 5KIZA 4WF0A 2BASA 1D7EA 3F1OB 3LI8A 1OT6A 3B33A 5G4YA 2INWA 1N9LA 1GSWA 4R6LA 2YKFA 1XJ3A 1JNUA 4KUKA 4LRYC 4WN5A 1XFNA 3LIFA 3MQOA 4HP4A 1G28A 5A8BA 2VV6A 3G6OA 5F68A 4MN6A 4PKYG 2QWSA 4HOIA 3E4QA 2D02A 1S4RA 4HQAA 5AVFA 5HWVA 4HHDA 4WUJA 5F6AA 3IS2A 1DRMA 1T18A 2QKPA 1S4SA 3MJQA 2JHEA 2VLGA 2OWJA 4JGRA 4H6JB 4I3AA 3NOTC 3BY9A 3UE6A 4JGPA 3KX0X 3BWLA 2V0UA 4NXEA 4HI4A 3OLOA 1S1YA 3LYXA 5AVEA 3ZQ5A 3HJIA 5I5LA 4M4XA 4EEUA 1DP9A 3CWFA 3A0VA 3H9WA 4GHIB 1V9ZA 3ICYA 4YWZA 3FG8A 2I9VA 3F1OA 2EA9A 4HP9A 3K3CA 4KQDA 3LIBA 4MN5A 5DKKA 1S66L 4K08A 3A0SA 4XT2A 2M1CA 4L9GA 3LI9A 4BBTA 1V9YA 4LRZE 4EXOA 3UMDA 4L9FA 1OTBA 1Y28A 4WLAA 5J4EA 3GDIA 5HDDA 2Z6DA 3ULFA 2KX6A 3LIAA 2KDKA 1BYWA 1MZUA 5F5YA 1TS0A 1D06A
chains in the Genus database with same CATH superfamily
4H6JA 4CLCE 5KSHA 1F98A 4R3JA 1DP6A 3T1QB 1S1ZA 5HD5A 1ZG6A 2ZQ8A 3VV4A 4E3IA 3LIDA 5CEBA 1Z09A 4P6ZS 1ONGA 4GD6A 5CHJA 3OCLA 5AQ9A 4EU0A 5EOEA 1DJCA 1XJ6A 3P98A 2L0WA 3IF6B 3C4PA 4OOMA 4N1XA 4GHIA 1ACFA 2XA7S 4FOFA 4K0WA 1CI8A 1JTGA 3LUQA 2JKRI 2ZQ7A 3UB7A 3VP4A 2QJ5A 5FQIA 3KSFA 3V3RA 4EBLA 1K6RA 1P0ZA 4DDSA 4FSFA 1HZOA 4I3IA 1ES5A 3LR5A 4I3JA 1IFQA 3BQAA 1P9WA 1YMXA 4UEYA 2ZJ9A 1TDLA 3DTMA 5HSQA 4NXBA 4BENA 3V50A 3Q81A 4O8GA 4ETXA 3QP6A 2XH9A 3GQZA 1LSVA 5CRFA 5EE8A 5HX9A 3H82A 1TD5A 2O9BA 2HJ9C 4Q0HA 4MMNA 2HV1A 3K3DA 2XDMA 2HP6A 3AGFA 4FH2A 3WWXA 5TJJA 3PBSA 2DRWA 1GA0A 4U0XA 5DTKA 1GSXA 1EI5A 3E4OA 3N6IA 4HESA 1MWUA 2V9AA 5M1AA 3UB8A 3BFCA 3GECA 2HDQA 5AQAA 2JKRM 4HH3A 1OJ5A 5HAQA 2VK3A 1OPXA 1I2WA 2Y79A 1VB6A 2GDNA 3ZCZA 3ZG9B 1YLZA 1XGJA 1PWDA 4PM8A 4GS9B 3PBNA 4ARZB 4LCMA 1Q2PA 3EGDC 2OAP1 1W5DA 1YSPA 4E3OA 4L9EA 3PAGA 2J9PA 1G6AA 4B9OA 1W8YA 2ZOIA 1PRQA 3V5MA 4AFIA 1H3QA 2XQZA 3E0YA 4DDYA 2WZZA 1EW0A 5FAPA 5TBMB 1NYMA 2KOIA 1Y4OA 2BTFP 3MXQA 4ID4A 3ZNTA 1SCWA 2UV0E 4DMZA 4CLCA 5GLCA 3D72A 4JGQA 1AWIA 2GX5A 1MKIA 3T4KA 2QYBA 5HDCA 5E2HA 2P9VA 3E98A 3Q07A 3KSGA 1XJ4A 2EFXA 4UAAA 3UPPA 4BL2A 5FDSA 4Y15A 2YKHA 5FI7A 5EM1A 2OAQ1 2EXBA 1T1CA 1MPLA 4OONA 2Y2PA 1FOFA 2Y55A 1CJFA 3Q7VB 5HWWA 2WGWA 1N9OA 4X25A 1JWVA 3UE3A 4E04A 2PT7A 1IOUA 1YM1A 1LSXA 2ZBBA 1LI9A 3GMWA 5U47A 1BULA 1Q2QA 1FSYA 2PBYA 5EVIC 4CQHA 4EEPA 2ZQAA 5L10A 3NOPC 2Y91A 2EWWA 1KE0A 3H7WB 4H8RA 4Y0TA 1GHPA 2WKIA 2ZC7A 2ZMFA 2Y2OA 5A91A 5F83A 3A3FA 2V8FA 1E3UD 1N9BA 1LI0A 3TRCA 3ZYTA 3ZG0A 3Q1FA 2AVXA 3BFDA 3OC2A 2VV7A 1PZOA 4ETZA 4F94A 3S22A 1TS8A 4KZ9A 5DKLA 3NULA 3N8RA 5DJUA 1KOUA 3W2ZA 1M6KA 5I94A 3MF0A 3O5YA 4RVAA 2KLIA 4NK3A 4MCWA 3WS2A 3G2ZA 3B33A 5G4YA 3ZFZA 1DJAA 3C7VA 4LV1A 4KG2A 4ESPA 1YMSA 4KUKA 3VP3A 4LRYC 2IWDA 1SZVA 4HP4A 2VV6A 3G6OA 4MN6A 1KVLA 2PBDP 2ZMAA 5AVFA 1J9MA 5IHVA 3HBRA 4HHDA 4WUJA 5KSCA 4X69A 2QKPA 1JTDA 1S4SA 1KDSA 2HDSA 4X53A 4JGRA 4H6JB 4Y0UA 3FPWA 4D60A 1OMEA 4DE3A 2Z2MB 4NG2A 2W3EA 3T4TA 1NLZA 4HI4A 2W1TA 4WZ5A 1EWZA 3SOIA 3A3JA 4S2NA 4KZAA 4NKPA 3ZQ5A 3DAVA 2VX8A 1LL9A 5G18A 2EXAA 3TOIA 2I72A 3KYEA 4GHIB 1L0FA 5GLBA 3ZGAB 1V9ZA 2JBFA 5FDHA 2ZC6B 3HLDA 3FG8A 4EQIA 2ZC4B 4OPRA 3HL9A 2ZD8A 5HL1A 2JKFA 1SDNA 4KQDA 3W8KA 2H5SA 3TJZC 3G34A 1YKDA 1D1JA 2W3GA 4OPZA 2Q9NA 4K08A 3IXGA 4XT2A 1U60A 2FFFB 4O0PA 1BTLA 1YLJA 4BBTA 1V9YA 2P04A 4EXOA 1Y28A 5F1FA 4PM7A 4WLAA 3T1XA 4S2JA 1GHMA 3IBJA 2Z6DA 1PWGA 3MQ0A 3TSGA 3VSLA 2LB5A 3NIAA 2OV5A 2KDKA 3RJUA 3PBQA 3EQUA 5DTSA 4QJGA 2X71A 2Z6CA 4KZ6A 3WS0A 2O99A 1E25A 3C38A 3LY3A 2K31A 2PHYA 5CXWA 4QB8A 3BLMA 3P7NA 2WGIA 4GKUA 4KZ8A 5EFWA 4DKIA 4EQ1A 1WA9A 2EFUA 4BD1A 3C7UA 3W4PA 4ZAMA 3L7HA 4EV4A 1NZOA 3VMAA 3ITBA 1BLPA 2XD1A 3IF6C 3G35A 4WEKA 3MZEA 2WKEA 2HP5A 4RQ9A 1OTEA 3C8CA 3T4SA 3LR3A 1F9IA 3R4KA 5CGXA 1SKOA 5K5BA 1O7EA 4DF6A 1QMFA 2J7VA 4JXWA 2PD7A 2W3HA 5CX7A 2NUTC 3NC8A 4R4SA 3NHQA 4PMAA 2A24A 4S2OA 4HEFA 4IHQA 2VV8A 1CEFA 3A3EA 3DBAA 3MKEA 3UPOA 3N8LA 1NLYA 2ZL1B 2C5WB 3MBZA 4LFUA 4OH0A 3TW8A 4CLCB 2H10A 1KDWA 3T4JA 3C30A 4E3NA 1K57A 2WUQA 4P6BA 4E3LA 4HJ3A 2L4RA 1H8MA 4GCZA 3RH8B 4HNBA 1Z6FA 2W1RA 4OQIA 3U4LP 2WGWB 3PAEA 3T4OA 3VP1A 5DFXA 4N9KA 4IJGA 3EGXC 1I2SA 3G32A 3P01A 4C3QA 3VOZA 2QZ6A 4ZRRA 2JN7A 1NRJA 4XUXA 3PBTA 4HY8A 2XF3A 2Y2JA 4Y0OA 5IS1A 2Y59A 1AXBA 4OP5A 2B5RA 1PWCA 2IA2A 2V1ZA 3CHWP 3WS1A 5DF7A 2J80A 2CC1A 4PM5A 5DF8A 3UY6A 2XK1A 1YAXA 1OTIA 3O87A 4E3KA 4X55A 3F1NA 3C2WA 3IWIA 3VE4A 3BFGA 4WMCA 4R38A 4KENB 4IBRA 4YINA 2VJWA 3L9KA 2Y2IA 3LY4A 1LHYA 5JYPA 4DXCA 4CPKA 5FAOA 3BEBA 4B4XA 1VETA 3VOLA 3W4OA 1T19A 3T50A 4UA6A 4UA9A 2VGJA 4KZ3A 3E2LA 5AJGA 3N7WA 3BFFA 4KZ7A 1ZTUA 4OQHA 2PD8A 3PHYA 4JXVA 3AGDA 2XD5A 5F1GA 2XLNA 4OPYA 2FH5A 4X1LA 3U2AA 2HGVA 4NXFA 3CUEC 3EEAA 1PFLA 3ISGA 2CMNA 2PYPA 4JBFA 1DJBA 3ZNYA 3IBRA 3IT9A 5A92A 3PTEA 1L2SA 2Y2KA 3UE0A 2V2FF 5G4ZA 1K54C 3B42A 4JGOA 5EUAA 3RFBA 3O86A 4LPZA 4I38A 2PDRA 1XFQA 4IEDA 5L09A 4UHUA 4OKPA 2K2NA 4Q8IA 3VFFA 4UQIS 3LCEA 1YQSA 3HCYA 5DTTA 4X68A 4ZTKA 3PYPA 4P6ZM 1FIKA 2ZLYA 3ZHHA 1W8QA 4Y17A 1JVJA 4GJ4A 3I7JA 4WELA 4N1HA 4YOFA 4U0TA 2EX8A 1YLWA 3VSKA 3UNWA 3FWLA 3OPLA 4Q0JA 2XA7M 5KMWA 3AGEA 3IHAA 3LI8A 3G31A 2EX9A 1ZKJA 4R23A 2INWA 1L0DA 1RGZA 1N9LA 3K2NA 4R6LA 2YKFA 3GVBA 4QWOA 4JF5A 1XFNA 2JE5A 4B93A 1BUEA 1ERQA 1FCNA 3V3SA 3ZDJA 5A8BA 2B18A 4GDNA 4PAUA 4PKYG 4MEZA 4HOIA 3E4QA 3NI9A 4KZ4A 4HQAA 3IXHA 4YNRA 2OLUA 5HWVA 1CI9A 4DE1A 1S6RA 5FAQA 5FQKA 1PW8A 3MJQA 1BZAA 1IEMA 1MWSA 3UO9A 3BY9A 3QNCA 5EVEA 3LO7A 1K56D 4OOYA 3SS4A 3BWLA 4KQRA 3SH7A 5FSRA 2A49A 3FZCA 4ZBEA 5HPFA 3BFEA 2HDUA 2HZ5A 1XP4A 4GN2A 3IX8A 3UN7A 3FPVA 5I5LA 2Y2QA 4HBTA 3UE1A 4MBFA 5AQ7A 4EEUA 3A0VA 4QPRA 3B3XA 4E3MA 2H0YA 5E2GA 2BG1A 2H0TA 3IXDA 1L0EA 4YWZA 1ZHHB 2XSSA 4RA7A 2I9VA 3F1OA 1SKOB 3K3CA 2HPBA 3HLFA 1BLHA 1KGFA 3B47A 4E6WA 3FKVA 3CJMA 4CJNA 5FEFA 3LEZA 5CGSA 1MKMA 3UDFA 1PNEA 4LRZE 1HLUP 2XGNA 3UMDA 3ZVTA 1ESIA 5EM0A 1L3LA 4C6YA 4K91A 3QP4A 3VP2A 3OPPA 2XFSA 3IF6A 3O88A 4GDBA 4WL9A 3CG5A 3S7PA 5EV0A 3MSHA 4Z9QA 5GHZA 2PR6A 4ZJ1A 3HLGA 4UA7A 3FC7A 4HJ4A 2D01A 4U3TA 4DJ2A 3UPNA 1LL8A 2VGLS 1TVFA 2ZC5B 5GHYA 3D4FA 3E4PA 3E2KA 1K55A 1IYQA 1IELA 4BL3A 1XPBA 3NJAA 4B4ZA 4YFMA 2Y2MA 3HUOA 3QHYA 4X1MA 1KGGA 3M6HA 1OJGA 3OZHA 2VKSA 3UDXA 2JC7A 4KG6A 1PW1A 3EWKA 1A0KA 1X0OA 2UWXA 3DW0A 3UMEA 3Q82A 2OOLA 2ZQDA 2ZQ9A 4OVDA 1IYSA 4BWIA 1YPRA 3IWOA 4G3WA 5CHMA 3F1NB 3PXPA 1J3WA 1IKIA 3IF5A 1XA7A 2G2UA 3BM6A 3CZDA 4LGWA 4RX3A 3T1SA 3TG9A 3MFXA 1VETB 3R7WA 3DWZA 2GNXA 4I5SA 3A3DA 3BYDA 2PR5A 2QPNA 3CPTA 1E3UA 2JKGA 3MR0A 4PKYA 1ODVA 4P87A 1TF1A 4NEED 4F3LA 3MMHA 5EOOA 4ARZA 4DE0A 2W3FA 3S4XA 2OWHA 3BY8A 5TGFA 3HLEA 2V0WA 3MS6A 3QP5A 4JXSA 2VGKA 1VHMA 2WZXA 4Y5FA 3HUNA 5HDSA 1DP8A 1MXOA 2B02A 2HF6A 5HFOA 5TBMA 4FD8A 2K7SA 4OOLA 4FTXA 2QJ7A 3OPHA 1STZA 4OQGA 1HVBA 1ES3A 3QNBA 4OLGA 4MBHA 2Q9MA 1GSVA 2H28A 5CTNA 4LCLA 1CEGA 3H82B 4R4RA 2WKQA 2W0NA 1EROA 1IYOA 2ZOHA 2B95A 2ZQCA 2E8JA 3QP8A 3OCNA 2WGVA 1TS6A 3OBFA 4KG5A 2A3UA 3Q7VA 1OT9A 1NWZA 3KYQA 5L07A 4D2OA 3SW1A 2R78A 5HL6A 3PBOA 1C3BA 2Q0OA 4EUVA 3OPRA 3F1PA 3CLOA 3BRMA 2L1MA 1W63Q 2WYXA 2ACGA 3VOYA 1XKZA 4S2PA 3Q7ZA 3A3IA 1ONHA 3S7NA 3BJNA 3H7WA 3UDIA 4DN0A 4BBVA 1K54A 3ZG7B 3CITA 2J3WA 3NDGA 4EW7A 3IHBA 3SS3A 1Y54A 3EOIA 1P97A 4HIAA 3EEHA 2IWBA 5C5KA 3A0RA 3N8SA 5E2FA 2P9VB 4NXGA 1ES4A 1JWPA 4QD4A 3KSIA 3VE3A 4MN7A 5M19A 4Y13A 1E4DA 1CK3A 1FSWA 4MBKA 5IT5A 1SKFA 4R3BA 4HJ6A 3O3VA 2VEAA 4QHCA 3CMZA 4GW9A 5J7EA 2WKPA 1T1BA 1WYBA 4Q0IA 5FQJA 4JF6A 4LV0A 4S2NC 4E6XA 4BQMA 5J3WA 2WKRA 2O9CA 1W63M 1PZPA 1KGEA 1SHVA 2WKHA 4IUKA 4LV2A 1MY8A 2E8IA 1QMEA 2WADA 1W79A 3DTKA 5KIZA 2HDRA 1W7FA 4WF0A 2BASA 4OQ0A 3SH8A 1D7EA 3F1OB 4QU3A 1OT6A 2JCHA 3V67A 2M7VA 3FKWA 3FV7A 1GSWA 1K6SA 1XJ3A 1KE4A 2PU2A 1VQQA 4WN5A 5L2FA 1MBLA 4MDZA 1JWZA 1G28A 4M3KA 5F68A 2QWSA 3JYIA 4O7DA 1DY6A 1GHIA 4E3JA 4KZ5A 4KQOA 3GRJA 3GV9A 5EVIA 3TE8A 1IYPA 2RL3A 1DRMA 3IS2A 2JHEA 3G30A 3T12B 4CLCD 2VLGA 4NETA 4O01A 5E2EA 5AQBA 3LR4A 4PHTA 1CF0A 3UE6A 1VEUA 5GLAA 4MLLA 4WYYA 2DMWA 2V0UA 5FASA 4HBUA 1YSQA 4BMWA 4G3KA 3OLOA 1WE4A 4S2IA 5CHUA 4GOGA 3BW6A 2WAEA 4GZBA 5BOHA 1BSGA 2Z2LB 2O9AA 1XX2A 4IVKA 3KSHA 3JVUA 3ICYA 5TFQA 4RX2A 1MWRA 1WYCA 3OOVA 4HP9A 3ZG5A 5FATA 3ITAA 3LIBA 5A93A 2W1TB 5DKKA 1S66L 1K0KA 2M1CA 1LL5A 2G2WA 5FEGA 4L9GA 4S2KA 4ZJ3A 3LI9A 2PU4A 1P9RA 4KQQA 3T4LA 1NZUA 2P74A 4JF4A 1OTBA 4RYEA 5J4EA 1FILA 3S7OA 2PRFA 1PYYA 4FCFA 2G7UA 3ULFA 3R7WB 2KX6A 1KE3A 2O0YA 1K57C 3LIAA 4QY6A 1BYWA 4B88A 4PM6A 5F5YA 4EWFA 4QY5A 2ZM8A 3CPTB 4X56A 4DJ3A 3GSGA 1S0WA 3HLCA 1OTAA 3NOUC 1ZG4A 2PYRA 5HZHA 4EESA 3DTEA 4XT2B 2X01A 4F3LB 2RCXA 2XROA 1FR1A 3IX3A 3IX4A 1HD8A 2EX6A 4PM9A 3IQAA 4GNUA 4LRXC 3WS5A 2QHKA 4P0MA 4A5RA 4ZJ2A 3HLWA 5HW3A 4JPMA 5FQ9A 2ZM2A 1TS7A 4KUOA 2NUPC 3RXXA 2OLVA 5FI6A 2ZL1A 5CGWA 1CQAA 4WEJA 5FQMA 1T1AA 2Y2NA 1YLYA 5DFYA 5KZHA 1H5XA 1HTZA 1N9NA 3NECA 3LICA 4LENA 5JYOA 5HPIA 3S1YA 5F82A 1FR6A 1ERMA 4UQIM 3T4QA 4DE2A 3GTCA 1ALQA 4EBNA 4EBPA 2VA0A 5GLDA 1K4FA 2BLSA 3HJKA 3ZG8B 1XA1A 3F1PB 2J3TD 1MC0A 5GHXA 1S67L 4EERA 3V39A 4MNRA 1G5UA 4II7A 1RP5A 1NJ4A 1ESUA 3HUMA 3P09A 4I39A 2A24B 1GA9A 4ZDXA 2ZMVA 4G3VA 4WZ4A 4BLMA 3IWQA 3CI6A 4ME4A 4DXBA 3CAXA 1H0MA 4JKTA 3NBLA 3BLSA 1UWNX 1FCMA 3FYZA 3NCKA 3UB6A 3HREA 4XUZA 4X6TA 2PAVP 1G68A 4JXGA 3LEQA 4XXRA 3PBRA 5J8XA 1NYYA 4IBXA 1ES2A 3LGOA 1XJ2A 1PIOA 1GCEA 1RCJA 2Y2LA 4OPQA 3PR6A 4LLOB 4HH2A 3N4IA 3RTYA 4GLQA 2P08A 2EX2A 3KO6A 2IWCA 4GB7A 3QP1A 2QMIA 1K38A 2J8YA 3RXWA 1TDGA 5TR7A 5DVAA 1MWTA 3MZFA 4BBUA 3C5AA 5LBRA 1BT5A 1G6OA 1LSWA 1K56A 5DJTA 1I5QA 3IXBA 1UGUA 4DRTA 4BJPA 5IU1A 3SS5A 4WBGA 4S2MA 1F5MA 2J9OA 1NY0A 3MKFA 2Y4AA 2P7JA 4EUZA 1FCOA 2HJEA 2W27A 3LIEA 1H8ZA 3M6BA 3M2JA 3DWKA 2GJ3A 1VM1A 3VFHA 4C75A 2XEPA 2V1AA 4CLCC 4Z1WA 5EVIB 1K25A 3IS2B 1K4EA 3MQQA 2XRNA 5HD3A 3GR2A 4R70A 5HAPA 3IH8A 1YLPA 4PPRA 3KYZA 4R3AA 3UB5P 3HVFA 4GS9A 1VEUB 5E43A 3W4QA 4EETB 2XFTA 4OP8A 2DNSA 1F2KA 5EVLA 4IVIA 3D9YA 4P85A 2ZM0A 2DCFA 1BLSA 2VGLM 2ZC3B 3SZTA 3UB9A 5HWTA 4R0QA 3WS4A 3EQVA 3G2YA 5FI2A 1XGIA 5F69A 3S7QA 1UWPX 1LT0A 5CECA 1OTDA 3T1RA 2VZWA 2V1BA 2HP9A 4LV3A 5EPHA 5EECA 3LR0A 3LFVA 3JVVA 1LLBA 5FL3A 5D3OA 4GD8A 4L0LA 3IH9A 3WRTA 1XXMA 3M2KA 3JPUA 1PI5A 4N9LA 1JNUA 2R9XA 2W3DA 3NY4A 3LIFA 3MQOA 2JKTI 3ZVWA 1M40A 2WAFA 3CUEA 5CTMA 3DTIA 4FUWA 4WMCD 2D02A 1S4RA 1RGYA 5MC7A 5F6AA 5FQQA 1PI4A 1KVMA 1T18A 2Y2GA 4Y2FA 3SH9A 4N92A 1BLCA 2OWJA 3WRZA 2Y8HA 4I3AA 3NOTC 5EVID 4K0XA 4IUHA 1SDEA 4Y7PA 4JGPA 4KZBA 3KX0X 4NXEA 1IKGA 4Y3IA 1S1YA 1L0GA 1K55C 5HARA 2XR0A 3LYXA 3G4PA 5AVEA 5A90A 3MXSA 4FH4A 2FZ0A 2X02A 5CERA 3HJIA 4M4XA 1O07A 2V8CA 5GL9A 5M18A 1DP9A 3CWFA 4R1GA 3H9WA 2EWVA 3C4OA 1YT4A 2MJ6A 5DF9A 1YLTA 2WK0A 3QP2A 2R9WA 3MFDA 2GZAA 1H8YA 3VP0A 4S2LA 2JKTM 2EA9A 4WM9A 1TEMA 4WZ5C 3MXRA 4MN5A 2M7UA 3A0SA 3D3OA 2Y2HA 5FA7A 1FQGA 2J3TC 4JLFA 1ZC2A 3BECA 4OLDA 3MZDA 2LB9A 4L9FA 1N4OA 5HAIA 2C6WB 2A2LA 3HLBA 5CEDA 1NRFA 2OSUA 3GDIA 5HDDA 5L8MA 3BQ8A 2FFYA 1MZUA 1NXYA 1TS0A 3NDEA 2V20A 4BD0A 1D06A
chains in the Genus database with same CATH topology
4WL9A 4H6JA 4DJ3A 2Z6CA 4CLCE 3S7PA 5KSHA 2O99A 1OTAA 3NOUC 2PYRA 5HZHA 1F98A 4EESA 3C38A 1DP6A 1S1ZA 4XT2B 2K31A 2PHYA 4F3LB 2PR6A 5HD5A 2XROA 3FC7A 3P7NA 4HJ4A 2D01A 3VV4A 4DJ2A 3LIDA 1LL8A 2VGLS 4LRXC 3E4PA 5EFWA 4P6ZS 4EQ1A 1WA9A 2QHKA 3NJAA 3OCLA 4EU0A 1XJ6A 1TS7A 4KUOA 2NUPC 2L0WA 4OOMA 4GHIA 4WEKA 1OJGA 4RQ9A 2VKSA 1OTEA 3C8CA 2XA7S 4WEJA 4FOFA 3T4SA 1T1AA 3LR3A 3EWKA 3LUQA 1F9IA 1X0OA 3R4KA 2JKRI 5DFYA 5K5BA 3UB7A 2QJ5A 1N9NA 3UMEA 2OOLA 3KSFA 1P0ZA 2PD7A 3LICA 2W3HA 5CX7A 4BWIA 2NUTC 4G3WA 5HPIA 4FSFA 3F1NB 3PXPA 3NHQA 4I3IA 2A24A 3LR5A 4I3JA 1IFQA 4UQIM 3BQAA 2VV8A 4IHQA 3T4QA 1P9WA 3DBAA 2VA0A 4UEYA 1NLYA 3HJKA 5HSQA 4NXBA 3TW8A 3F1PB 2J3TD 1MC0A 4CLCB 1S67L 4EERA 3MFXA 3R7WA 4O8GA 3T4JA 3C30A 2GNXA 4ETXA 4I5SA 2PR5A 4II7A 4HJ3A 2L4RA 1H8MA 4GCZA 3RH8B 4HNBA 1LSVA 3H82A 3MR0A 1TD5A 2O9BA 2A24B 2HJ9C 2W1RA 4I39A 4PKYA 4Q0HA 4MMNA 2HV1A 1ODVA 2ZMVA 4G3VA 3K3DA 1TF1A 4NEED 3T4OA 4F3LA 3MMHA 4ARZA 5DFXA 4IJGA 3EGXC 5TJJA 2W3FA 3CI6A 3P01A 3PBSA 4ME4A 2OWHA 3BY8A 4ZRRA 3CAXA 2JN7A 1NRJA 1GSXA 3E4OA 2V0WA 3PBTA 4HY8A 2V9AA 1VHMA 3UB8A 3GECA 1UWNX 4Y5FA 5HDSA 3UB6A 5IS1A 1DP8A 2B02A 2HF6A 2JKRM 5TBMA 2K7SA 4HH3A 4OOLA 2QJ7A 1OJ5A 1STZA 1OPXA 2Y79A 1VB6A 2IA2A 1GSVA 2H28A 3PBRA 3H82B 2J80A 4GS9B 2WKQA 2W0NA 3PBNA 4ARZB 1YAXA 2ZOHA 3EGDC 1XJ2A 2OAP1 1OTIA 3OCNA 1YSPA 4L9EA 3F1NA 3C2WA 1TS6A 3OBFA 3VE4A 4B9OA 3PR6A 4LLOB 2ZOIA 4R38A 1OT9A 4AFIA 4HH2A 1NWZA 1H3QA 3E0YA 3KYQA 2VJWA 1EW0A 3RTYA 4GLQA 3SW1A 2R78A 5TBMB 2P08A 5HL6A 3KO6A 2KOIA 3PBOA 3MXQA 4EUVA 3F1PA 4DMZA 4CLCA 3CLOA 3D72A 4JGQA 2L1MA 3VOLA 4BBUA 2GX5A 1W63Q 5LBRA 1T19A 3T50A 3T4KA 1G6OA 2QYBA 5HDCA 3E98A 1LSWA 3KSGA 5AJGA 1XJ4A 3S7NA 3BJNA 3H7WA 5DJTA 2YKHA 1ZTUA 1UGUA 2PD8A 4DN0A 2OAQ1 4BBVA 3PHYA 1T1CA 4BJPA 5IU1A 3CITA 2J3WA 4EW7A 5HWWA 1N9OA 1F5MA 3UE3A 2FH5A 2P7JA 4E04A 2PT7A 2HJEA 3LIEA 2W27A 3U2AA 1IOUA 2HGVA 4NXFA 3CUEC 1LSXA 2ZBBA 3EEAA 2GJ3A 3EOIA 1P97A 2V1AA 4HIAA 3EEHA 5C5KA 3A0RA 2CMNA 2PYPA 4CLCC 4Z1WA 3IBRA 4CQHA 3IS2B 4EEPA 4NXGA 3MQQA 3NOPC 2XRNA 5HD3A 2EWWA 3H7WB 3KSIA 4R70A 3VE3A 4MN7A 5G4ZA 3KYZA 4R3AA 3B42A 4JGOA 3RFBA 2ZMFA 4LPZA 4I38A 4GS9A 2PDRA 1XFQA 5IT5A 4EETB 4HJ6A 2K2NA 2VEAA 4GW9A 4UQIS 5J7EA 2WKPA 3HCYA 3TRCA 3ZYTA 1T1BA 2VGLM 4Q0IA 3UB9A 5HWTA 3PYPA 4P6ZM 3OC2A 2VV7A 4ETZA 3EQVA 5J3WA 2WKRA 2O9CA 1W63M 1TS8A 4GJ4A 5F69A 5DKLA 4WELA 3S7QA 1UWPX 1LT0A 4IUKA 1OTDA 5DJUA 1KOUA 3W2ZA 4YOFA 2VZWA 2V1BA 3MF0A 5KIZA 3O5YA 3LR0A 4WF0A 2BASA 3LFVA 4Q0JA 2KLIA 2XA7M 1D7EA 3JVVA 3F1OB 3LI8A 1OT6A 5FL3A 4MCWA 4L0LA 3V67A 3B33A 5G4YA 2M7VA 2INWA 1N9LA 3K2NA 1GSWA 4R6LA 2YKFA 1XJ3A 1JNUA 4KUKA 4LRYC 4WN5A 2W3DA 1XFNA 3LIFA 3MQOA 2JKTI 4B93A 4MDZA 4HP4A 1G28A 5A8BA 2VV6A 3CUEA 3G6OA 2B18A 5F68A 4MN6A 4PAUA 4PKYG 2QWSA 4HOIA 3E4QA 2D02A 1S4RA 4HQAA 5AVFA 4YNRA 5MC7A 5HWVA 4KQOA 4HHDA 4WUJA 5F6AA 3TE8A 3IS2A 1DRMA 1T18A 2QKPA 4Y2FA 1S4SA 3MJQA 2JHEA 4CLCD 2VLGA 2OWJA 4JGRA 4O01A 4H6JB 2Y8HA 4I3AA 3FPWA 3NOTC 4IUHA 3LR4A 3BY9A 4PHTA 3UE6A 4JGPA 3KX0X 2DMWA 3BWLA 2W3EA 2V0UA 3T4TA 1NLZA 4NXEA 4HI4A 2W1TA 1YSQA 4BMWA 4G3KA 3OLOA 4Y3IA 5HPFA 1S1YA 3LYXA 5AVEA 4NKPA 3BW6A 3ZQ5A 2VX8A 2FZ0A 3HJIA 3FPVA 5I5LA 4M4XA 2O9AA 4EEUA 1DP9A 3CWFA 3A0VA 4QPRA 3H9WA 4GHIB 3KSHA 2EWVA 2MJ6A 5DF9A 3JVUA 1V9ZA 3ICYA 2GZAA 4YWZA 3FG8A 1ZHHB 2XSSA 2I9VA 3F1OA 3OOVA 2JKTM 2EA9A 4HP9A 3K3CA 4KQDA 3LIBA 3TJZC 2W1TB 4MN5A 5DKKA 1YKDA 2W3GA 3B47A 1S66L 4K08A 2M7UA 3A0SA 3D3OA 4XT2A 2M1CA 2J3TC 4L9GA 4O0PA 1MKMA 3LI9A 4BBTA 1V9YA 1P9RA 2P04A 4LRZE 4EXOA 2LB9A 3T4LA 3UMDA 4L9FA 1OTBA 1Y28A 2A2LA 4WLAA 5J4EA 3S7OA 3GDIA 5HDDA 5L8MA 3IBJA 2G7UA 2Z6DA 3MQ0A 2LB5A 3BQ8A 3ULFA 3R7WB 2KX6A 2O0YA 3LIAA 2KDKA 1BYWA 1MZUA 5F5YA 1TS0A 3PBQA 1D06A 3EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WL9 A;  4H6J A;  4DJ3 A;  2Z6C A;  1OTA A;  3NOU C;  2PYR A;  5HZH A;  1F98 A;  4EES A;  1DP6 A;  1S1Z A;  4XT2 B;  2PHY A;  4F3L B;  2PR6 A;  5HD5 A;  3FC7 A;  3P7N A;  4HJ4 A;  2D01 A;  4DJ2 A;  3LID A;  1LL8 A;  4LRX C;  3E4P A;  5EFW A;  4EQ1 A;  1WA9 A;  2QHK A;  3NJA A;  1XJ6 A;  1TS7 A;  4KUO A;  2L0W A;  4GHI A;  1OJG A;  4RQ9 A;  1OTE A;  3C8C A;  1T1A A;  3EWK A;  3LUQ A;  1F9I A;  1X0O A;  3UB7 A;  2QJ5 A;  1N9N A;  3UME A;  2OOL A;  1P0Z A;  2PD7 A;  3LIC A;  3F1N B;  3NHQ A;  4I3I A;  2A24 A;  4I3J A;  2VV8 A;  3HJK A;  5HSQ A;  4NXB A;  3F1P B;  1S67 L;  4EER A;  3MFX A;  4I5S A;  2PR5 A;  4HJ3 A;  2L4R A;  4GCZ A;  3RH8 B;  4HNB A;  1LSV A;  3H82 A;  3MR0 A;  4I39 A;  2A24 B;  4PKY A;  2HV1 A;  1ODV A;  3K3D A;  4F3L A;  2OWH A;  3BY8 A;  3CAX A;  2JN7 A;  1GSX A;  3E4O A;  2V0W A;  4HY8 A;  2V9A A;  3UB8 A;  3GEC A;  1UWN X;  5HDS A;  3UB6 A;  5IS1 A;  1DP8 A;  2B02 A;  5TBM A;  2K7S A;  4HH3 A;  2QJ7 A;  1OJ5 A;  1VB6 A;  1GSV A;  2H28 A;  3H82 B;  2J80 A;  4GS9 B;  2WKQ A;  2W0N A;  2ZOH A;  1XJ2 A;  1OTI A;  4L9E A;  3F1N A;  3C2W A;  1TS6 A;  4B9O A;  3VE4 A;  4LLO B;  2ZOI A;  4R38 A;  1OT9 A;  4HH2 A;  1NWZ A;  3RTY A;  1EW0 A;  3SW1 A;  2R78 A;  5TBM B;  3MXQ A;  3F1P A;  3CLO A;  3D72 A;  4JGQ A;  2L1M A;  3VOL A;  4BBU A;  1T19 A;  3T50 A;  5HDC A;  1LSW A;  1XJ4 A;  3H7W A;  5DJT A;  2YKH A;  1UGU A;  2PD8 A;  4BBV A;  3PHY A;  1T1C A;  5IU1 A;  4EW7 A;  5HWW A;  1N9O A;  2P7J A;  4E04 A;  2W27 A;  3LIE A;  4NXF A;  1LSX A;  2ZBB A;  2GJ3 A;  1P97 A;  2V1A A;  4HIA A;  3EEH A;  3A0R A;  2CMN A;  2PYP A;  3IBR A;  3IS2 B;  4EEP A;  4NXG A;  3MQQ A;  3NOP C;  5HD3 A;  3H7W B;  4R70 A;  3VE3 A;  5G4Z A;  4R3A A;  4JGO A;  4LPZ A;  4I38 A;  4GS9 A;  2PDR A;  1XFQ A;  4EET B;  4HJ6 A;  2VEA A;  4GW9 A;  5J7E A;  2WKP A;  1T1B A;  3UB9 A;  5HWT A;  3PYP A;  2VV7 A;  5J3W A;  2WKR A;  1TS8 A;  5F69 A;  5DKL A;  1UWP X;  1LT0 A;  1OTD A;  5DJU A;  1KOU A;  2V1B A;  5KIZ A;  4WF0 A;  2BAS A;  1D7E A;  3F1O B;  3LI8 A;  1OT6 A;  3B33 A;  5G4Y A;  2INW A;  1N9L A;  1GSW A;  4R6L A;  2YKF A;  1XJ3 A;  1JNU A;  4KUK A;  4LRY C;  4WN5 A;  1XFN A;  3LIF A;  3MQO A;  4HP4 A;  1G28 A;  5A8B A;  2VV6 A;  3G6O A;  5F68 A;  4MN6 A;  4PKY G;  2QWS A;  4HOI A;  3E4Q A;  2D02 A;  1S4R A;  4HQA A;  5AVF A;  5HWV A;  4HHD A;  4WUJ A;  5F6A A;  3IS2 A;  1DRM A;  1T18 A;  2QKP A;  1S4S A;  3MJQ A;  2JHE A;  2VLG A;  2OWJ A;  4JGR A;  4H6J B;  4I3A A;  3NOT C;  3BY9 A;  3UE6 A;  4JGP A;  3KX0 X;  3BWL A;  2V0U A;  4NXE A;  4HI4 A;  3OLO A;  1S1Y A;  3LYX A;  5AVE A;  3ZQ5 A;  3HJI A;  5I5L A;  4M4X A;  4EEU A;  1DP9 A;  3CWF A;  3A0V A;  3H9W A;  4GHI B;  1V9Z A;  3ICY A;  4YWZ A;  3FG8 A;  2I9V A;  3F1O A;  2EA9 A;  4HP9 A;  3K3C A;  4KQD A;  3LIB A;  4MN5 A;  5DKK A;  1S66 L;  4K08 A;  3A0S A;  4XT2 A;  2M1C A;  4L9G A;  3LI9 A;  4BBT A;  1V9Y A;  4LRZ E;  4EXO A;  3UMD A;  4L9F A;  1OTB A;  1Y28 A;  4WLA A;  5J4E A;  3GDI A;  5HDD A;  2Z6D A;  3ULF A;  2KX6 A;  3LIA A;  2KDK A;  1BYW A;  1MZU A;  5F5Y A;  1TS0 A;  1D06 A; 
#chains in the Genus database with same CATH topology
 4H6J A;  4CLC E;  5KSH A;  1F98 A;  4R3J A;  1DP6 A;  3T1Q B;  1S1Z A;  5HD5 A;  1ZG6 A;  2ZQ8 A;  3VV4 A;  4E3I A;  3LID A;  5CEB A;  1Z09 A;  4P6Z S;  1ONG A;  4GD6 A;  5CHJ A;  3OCL A;  5AQ9 A;  4EU0 A;  5EOE A;  1DJC A;  1XJ6 A;  3P98 A;  2L0W A;  3IF6 B;  3C4P A;  4OOM A;  4N1X A;  4GHI A;  1ACF A;  2XA7 S;  4FOF A;  4K0W A;  1CI8 A;  1JTG A;  3LUQ A;  2JKR I;  2ZQ7 A;  3UB7 A;  3VP4 A;  2QJ5 A;  5FQI A;  3KSF A;  3V3R A;  4EBL A;  1K6R A;  1P0Z A;  4DDS A;  4FSF A;  1HZO A;  4I3I A;  1ES5 A;  3LR5 A;  4I3J A;  1IFQ A;  3BQA A;  1P9W A;  1YMX A;  4UEY A;  2ZJ9 A;  1TDL A;  3DTM A;  5HSQ A;  4NXB A;  4BEN A;  3V50 A;  3Q81 A;  4O8G A;  4ETX A;  3QP6 A;  2XH9 A;  3GQZ A;  1LSV A;  5CRF A;  5EE8 A;  5HX9 A;  3H82 A;  1TD5 A;  2O9B A;  2HJ9 C;  4Q0H A;  4MMN A;  2HV1 A;  3K3D A;  2XDM A;  2HP6 A;  3AGF A;  4FH2 A;  3WWX A;  5TJJ A;  3PBS A;  2DRW A;  1GA0 A;  4U0X A;  5DTK A;  1GSX A;  1EI5 A;  3E4O A;  3N6I A;  4HES A;  1MWU A;  2V9A A;  5M1A A;  3UB8 A;  3BFC A;  3GEC A;  2HDQ A;  5AQA A;  2JKR M;  4HH3 A;  1OJ5 A;  5HAQ A;  2VK3 A;  1OPX A;  1I2W A;  2Y79 A;  1VB6 A;  2GDN A;  3ZCZ A;  3ZG9 B;  1YLZ A;  1XGJ A;  1PWD A;  4PM8 A;  4GS9 B;  3PBN A;  4ARZ B;  4LCM A;  1Q2P A;  3EGD C;  2OAP 1;  1W5D A;  1YSP A;  4E3O A;  4L9E A;  3PAG A;  2J9P A;  1G6A A;  4B9O A;  1W8Y A;  2ZOI A;  1PRQ A;  3V5M A;  4AFI A;  1H3Q A;  2XQZ A;  3E0Y A;  4DDY A;  2WZZ A;  1EW0 A;  5FAP A;  5TBM B;  1NYM A;  2KOI A;  1Y4O A;  2BTF P;  3MXQ A;  4ID4 A;  3ZNT A;  1SCW A;  2UV0 E;  4DMZ A;  4CLC A;  5GLC A;  3D72 A;  4JGQ A;  1AWI A;  2GX5 A;  1MKI A;  3T4K A;  2QYB A;  5HDC A;  5E2H A;  2P9V A;  3E98 A;  3Q07 A;  3KSG A;  1XJ4 A;  2EFX A;  4UAA A;  3UPP A;  4BL2 A;  5FDS A;  4Y15 A;  2YKH A;  5FI7 A;  5EM1 A;  2OAQ 1;  2EXB A;  1T1C A;  1MPL A;  4OON A;  2Y2P A;  1FOF A;  2Y55 A;  1CJF A;  3Q7V B;  5HWW A;  2WGW A;  1N9O A;  4X25 A;  1JWV A;  3UE3 A;  4E04 A;  2PT7 A;  1IOU A;  1YM1 A;  1LSX A;  2ZBB A;  1LI9 A;  3GMW A;  5U47 A;  1BUL A;  1Q2Q A;  1FSY A;  2PBY A;  5EVI C;  4CQH A;  4EEP A;  2ZQA A;  5L10 A;  3NOP C;  2Y91 A;  2EWW A;  1KE0 A;  3H7W B;  4H8R A;  4Y0T A;  1GHP A;  2WKI A;  2ZC7 A;  2ZMF A;  2Y2O A;  5A91 A;  5F83 A;  3A3F A;  2V8F A;  1E3U D;  1N9B A;  1LI0 A;  3TRC A;  3ZYT A;  3ZG0 A;  3Q1F A;  2AVX A;  3BFD A;  3OC2 A;  2VV7 A;  1PZO A;  4ETZ A;  4F94 A;  3S22 A;  1TS8 A;  4KZ9 A;  5DKL A;  3NUL A;  3N8R A;  5DJU A;  1KOU A;  3W2Z A;  1M6K A;  5I94 A;  3MF0 A;  3O5Y A;  4RVA A;  2KLI A;  4NK3 A;  4MCW A;  3WS2 A;  3G2Z A;  3B33 A;  5G4Y A;  3ZFZ A;  1DJA A;  3C7V A;  4LV1 A;  4KG2 A;  4ESP A;  1YMS A;  4KUK A;  3VP3 A;  4LRY C;  2IWD A;  1SZV A;  4HP4 A;  2VV6 A;  3G6O A;  4MN6 A;  1KVL A;  2PBD P;  2ZMA A;  5AVF A;  1J9M A;  5IHV A;  3HBR A;  4HHD A;  4WUJ A;  5KSC A;  4X69 A;  2QKP A;  1JTD A;  1S4S A;  1KDS A;  2HDS A;  4X53 A;  4JGR A;  4H6J B;  4Y0U A;  3FPW A;  4D60 A;  1OME A;  4DE3 A;  2Z2M B;  4NG2 A;  2W3E A;  3T4T A;  1NLZ A;  4HI4 A;  2W1T A;  4WZ5 A;  1EWZ A;  3SOI A;  3A3J A;  4S2N A;  4KZA A;  4NKP A;  3ZQ5 A;  3DAV A;  2VX8 A;  1LL9 A;  5G18 A;  2EXA A;  3TOI A;  2I72 A;  3KYE A;  4GHI B;  1L0F A;  5GLB A;  3ZGA B;  1V9Z A;  2JBF A;  5FDH A;  2ZC6 B;  3HLD A;  3FG8 A;  4EQI A;  2ZC4 B;  4OPR A;  3HL9 A;  2ZD8 A;  5HL1 A;  2JKF A;  1SDN A;  4KQD A;  3W8K A;  2H5S A;  3TJZ C;  3G34 A;  1YKD A;  1D1J A;  2W3G A;  4OPZ A;  2Q9N A;  4K08 A;  3IXG A;  4XT2 A;  1U60 A;  2FFF B;  4O0P A;  1BTL A;  1YLJ A;  4BBT A;  1V9Y A;  2P04 A;  4EXO A;  1Y28 A;  5F1F A;  4PM7 A;  4WLA A;  3T1X A;  4S2J A;  1GHM A;  3IBJ A;  2Z6D A;  1PWG A;  3MQ0 A;  3TSG A;  3VSL A;  2LB5 A;  3NIA A;  2OV5 A;  2KDK A;  3RJU A;  3PBQ A;  3EQU A;  5DTS A;  4QJG A;  2X71 A;  2Z6C A;  4KZ6 A;  3WS0 A;  2O99 A;  1E25 A;  3C38 A;  3LY3 A;  2K31 A;  2PHY A;  5CXW A;  4QB8 A;  3BLM A;  3P7N A;  2WGI A;  4GKU A;  4KZ8 A;  5EFW A;  4DKI A;  4EQ1 A;  1WA9 A;  2EFU A;  4BD1 A;  3C7U A;  3W4P A;  4ZAM A;  3L7H A;  4EV4 A;  1NZO A;  3VMA A;  3ITB A;  1BLP A;  2XD1 A;  3IF6 C;  3G35 A;  4WEK A;  3MZE A;  2WKE A;  2HP5 A;  4RQ9 A;  1OTE A;  3C8C A;  3T4S A;  3LR3 A;  1F9I A;  3R4K A;  5CGX A;  1SKO A;  5K5B A;  1O7E A;  4DF6 A;  1QMF A;  2J7V A;  4JXW A;  2PD7 A;  2W3H A;  5CX7 A;  2NUT C;  3NC8 A;  4R4S A;  3NHQ A;  4PMA A;  2A24 A;  4S2O A;  4HEF A;  4IHQ A;  2VV8 A;  1CEF A;  3A3E A;  3DBA A;  3MKE A;  3UPO A;  3N8L A;  1NLY A;  2ZL1 B;  2C5W B;  3MBZ A;  4LFU A;  4OH0 A;  3TW8 A;  4CLC B;  2H10 A;  1KDW A;  3T4J A;  3C30 A;  4E3N A;  1K57 A;  2WUQ A;  4P6B A;  4E3L A;  4HJ3 A;  2L4R A;  1H8M A;  4GCZ A;  3RH8 B;  4HNB A;  1Z6F A;  2W1R A;  4OQI A;  3U4L P;  2WGW B;  3PAE A;  3T4O A;  3VP1 A;  5DFX A;  4N9K A;  4IJG A;  3EGX C;  1I2S A;  3G32 A;  3P01 A;  4C3Q A;  3VOZ A;  2QZ6 A;  4ZRR A;  2JN7 A;  1NRJ A;  4XUX A;  3PBT A;  4HY8 A;  2XF3 A;  2Y2J A;  4Y0O A;  5IS1 A;  2Y59 A;  1AXB A;  4OP5 A;  2B5R A;  1PWC A;  2IA2 A;  2V1Z A;  3CHW P;  3WS1 A;  5DF7 A;  2J80 A;  2CC1 A;  4PM5 A;  5DF8 A;  3UY6 A;  2XK1 A;  1YAX A;  1OTI A;  3O87 A;  4E3K A;  4X55 A;  3F1N A;  3C2W A;  3IWI A;  3VE4 A;  3BFG A;  4WMC A;  4R38 A;  4KEN B;  4IBR A;  4YIN A;  2VJW A;  3L9K A;  2Y2I A;  3LY4 A;  1LHY A;  5JYP A;  4DXC A;  4CPK A;  5FAO A;  3BEB A;  4B4X A;  1VET A;  3VOL A;  3W4O A;  1T19 A;  3T50 A;  4UA6 A;  4UA9 A;  2VGJ A;  4KZ3 A;  3E2L A;  5AJG A;  3N7W A;  3BFF A;  4KZ7 A;  1ZTU A;  4OQH A;  2PD8 A;  3PHY A;  4JXV A;  3AGD A;  2XD5 A;  5F1G A;  2XLN A;  4OPY A;  2FH5 A;  4X1L A;  3U2A A;  2HGV A;  4NXF A;  3CUE C;  3EEA A;  1PFL A;  3ISG A;  2CMN A;  2PYP A;  4JBF A;  1DJB A;  3ZNY A;  3IBR A;  3IT9 A;  5A92 A;  3PTE A;  1L2S A;  2Y2K A;  3UE0 A;  2V2F F;  5G4Z A;  1K54 C;  3B42 A;  4JGO A;  5EUA A;  3RFB A;  3O86 A;  4LPZ A;  4I38 A;  2PDR A;  1XFQ A;  4IED A;  5L09 A;  4UHU A;  4OKP A;  2K2N A;  4Q8I A;  3VFF A;  4UQI S;  3LCE A;  1YQS A;  3HCY A;  5DTT A;  4X68 A;  4ZTK A;  3PYP A;  4P6Z M;  1FIK A;  2ZLY A;  3ZHH A;  1W8Q A;  4Y17 A;  1JVJ A;  4GJ4 A;  3I7J A;  4WEL A;  4N1H A;  4YOF A;  4U0T A;  2EX8 A;  1YLW A;  3VSK A;  3UNW A;  3FWL A;  3OPL A;  4Q0J A;  2XA7 M;  5KMW A;  3AGE A;  3IHA A;  3LI8 A;  3G31 A;  2EX9 A;  1ZKJ A;  4R23 A;  2INW A;  1L0D A;  1RGZ A;  1N9L A;  3K2N A;  4R6L A;  2YKF A;  3GVB A;  4QWO A;  4JF5 A;  1XFN A;  2JE5 A;  4B93 A;  1BUE A;  1ERQ A;  1FCN A;  3V3S A;  3ZDJ A;  5A8B A;  2B18 A;  4GDN A;  4PAU A;  4PKY G;  4MEZ A;  4HOI A;  3E4Q A;  3NI9 A;  4KZ4 A;  4HQA A;  3IXH A;  4YNR A;  2OLU A;  5HWV A;  1CI9 A;  4DE1 A;  1S6R A;  5FAQ A;  5FQK A;  1PW8 A;  3MJQ A;  1BZA A;  1IEM A;  1MWS A;  3UO9 A;  3BY9 A;  3QNC A;  5EVE A;  3LO7 A;  1K56 D;  4OOY A;  3SS4 A;  3BWL A;  4KQR A;  3SH7 A;  5FSR A;  2A49 A;  3FZC A;  4ZBE A;  5HPF A;  3BFE A;  2HDU A;  2HZ5 A;  1XP4 A;  4GN2 A;  3IX8 A;  3UN7 A;  3FPV A;  5I5L A;  2Y2Q A;  4HBT A;  3UE1 A;  4MBF A;  5AQ7 A;  4EEU A;  3A0V A;  4QPR A;  3B3X A;  4E3M A;  2H0Y A;  5E2G A;  2BG1 A;  2H0T A;  3IXD A;  1L0E A;  4YWZ A;  1ZHH B;  2XSS A;  4RA7 A;  2I9V A;  3F1O A;  1SKO B;  3K3C A;  2HPB A;  3HLF A;  1BLH A;  1KGF A;  3B47 A;  4E6W A;  3FKV A;  3CJM A;  4CJN A;  5FEF A;  3LEZ A;  5CGS A;  1MKM A;  3UDF A;  1PNE A;  4LRZ E;  1HLU P;  2XGN A;  3UMD A;  3ZVT A;  1ESI A;  5EM0 A;  1L3L A;  4C6Y A;  4K91 A;  3QP4 A;  3VP2 A;  3OPP A;  2XFS A;  3IF6 A;  3O88 A;  4GDB A;  4WL9 A;  3CG5 A;  3S7P A;  5EV0 A;  3MSH A;  4Z9Q A;  5GHZ A;  2PR6 A;  4ZJ1 A;  3HLG A;  4UA7 A;  3FC7 A;  4HJ4 A;  2D01 A;  4U3T A;  4DJ2 A;  3UPN A;  1LL8 A;  2VGL S;  1TVF A;  2ZC5 B;  5GHY A;  3D4F A;  3E4P A;  3E2K A;  1K55 A;  1IYQ A;  1IEL A;  4BL3 A;  1XPB A;  3NJA A;  4B4Z A;  4YFM A;  2Y2M A;  3HUO A;  3QHY A;  4X1M A;  1KGG A;  3M6H A;  1OJG A;  3OZH A;  2VKS A;  3UDX A;  2JC7 A;  4KG6 A;  1PW1 A;  3EWK A;  1A0K A;  1X0O A;  2UWX A;  3DW0 A;  3UME A;  3Q82 A;  2OOL A;  2ZQD A;  2ZQ9 A;  4OVD A;  1IYS A;  4BWI A;  1YPR A;  3IWO A;  4G3W A;  5CHM A;  3F1N B;  3PXP A;  1J3W A;  1IKI A;  3IF5 A;  1XA7 A;  2G2U A;  3BM6 A;  3CZD A;  4LGW A;  4RX3 A;  3T1S A;  3TG9 A;  3MFX A;  1VET B;  3R7W A;  3DWZ A;  2GNX A;  4I5S A;  3A3D A;  3BYD A;  2PR5 A;  2QPN A;  3CPT A;  1E3U A;  2JKG A;  3MR0 A;  4PKY A;  1ODV A;  4P87 A;  1TF1 A;  4NEE D;  4F3L A;  3MMH A;  5EOO A;  4ARZ A;  4DE0 A;  2W3F A;  3S4X A;  2OWH A;  3BY8 A;  5TGF A;  3HLE A;  2V0W A;  3MS6 A;  3QP5 A;  4JXS A;  2VGK A;  1VHM A;  2WZX A;  4Y5F A;  3HUN A;  5HDS A;  1DP8 A;  1MXO A;  2B02 A;  2HF6 A;  5HFO A;  5TBM A;  4FD8 A;  2K7S A;  4OOL A;  4FTX A;  2QJ7 A;  3OPH A;  1STZ A;  4OQG A;  1HVB A;  1ES3 A;  3QNB A;  4OLG A;  4MBH A;  2Q9M A;  1GSV A;  2H28 A;  5CTN A;  4LCL A;  1CEG A;  3H82 B;  4R4R A;  2WKQ A;  2W0N A;  1ERO A;  1IYO A;  2ZOH A;  2B95 A;  2ZQC A;  2E8J A;  3QP8 A;  3OCN A;  2WGV A;  1TS6 A;  3OBF A;  4KG5 A;  2A3U A;  3Q7V A;  1OT9 A;  1NWZ A;  3KYQ A;  5L07 A;  4D2O A;  3SW1 A;  2R78 A;  5HL6 A;  3PBO A;  1C3B A;  2Q0O A;  4EUV A;  3OPR A;  3F1P A;  3CLO A;  3BRM A;  2L1M A;  1W63 Q;  2WYX A;  2ACG A;  3VOY A;  1XKZ A;  4S2P A;  3Q7Z A;  3A3I A;  1ONH A;  3S7N A;  3BJN A;  3H7W A;  3UDI A;  4DN0 A;  4BBV A;  1K54 A;  3ZG7 B;  3CIT A;  2J3W A;  3NDG A;  4EW7 A;  3IHB A;  3SS3 A;  1Y54 A;  3EOI A;  1P97 A;  4HIA A;  3EEH A;  2IWB A;  5C5K A;  3A0R A;  3N8S A;  5E2F A;  2P9V B;  4NXG A;  1ES4 A;  1JWP A;  4QD4 A;  3KSI A;  3VE3 A;  4MN7 A;  5M19 A;  4Y13 A;  1E4D A;  1CK3 A;  1FSW A;  4MBK A;  5IT5 A;  1SKF A;  4R3B A;  4HJ6 A;  3O3V A;  2VEA A;  4QHC A;  3CMZ A;  4GW9 A;  5J7E A;  2WKP A;  1T1B A;  1WYB A;  4Q0I A;  5FQJ A;  4JF6 A;  4LV0 A;  4S2N C;  4E6X A;  4BQM A;  5J3W A;  2WKR A;  2O9C A;  1W63 M;  1PZP A;  1KGE A;  1SHV A;  2WKH A;  4IUK A;  4LV2 A;  1MY8 A;  2E8I A;  1QME A;  2WAD A;  1W79 A;  3DTK A;  5KIZ A;  2HDR A;  1W7F A;  4WF0 A;  2BAS A;  4OQ0 A;  3SH8 A;  1D7E A;  3F1O B;  4QU3 A;  1OT6 A;  2JCH A;  3V67 A;  2M7V A;  3FKW A;  3FV7 A;  1GSW A;  1K6S A;  1XJ3 A;  1KE4 A;  2PU2 A;  1VQQ A;  4WN5 A;  5L2F A;  1MBL A;  4MDZ A;  1JWZ A;  1G28 A;  4M3K A;  5F68 A;  2QWS A;  3JYI A;  4O7D A;  1DY6 A;  1GHI A;  4E3J A;  4KZ5 A;  4KQO A;  3GRJ A;  3GV9 A;  5EVI A;  3TE8 A;  1IYP A;  2RL3 A;  1DRM A;  3IS2 A;  2JHE A;  3G30 A;  3T12 B;  4CLC D;  2VLG A;  4NET A;  4O01 A;  5E2E A;  5AQB A;  3LR4 A;  4PHT A;  1CF0 A;  3UE6 A;  1VEU A;  5GLA A;  4MLL A;  4WYY A;  2DMW A;  2V0U A;  5FAS A;  4HBU A;  1YSQ A;  4BMW A;  4G3K A;  3OLO A;  1WE4 A;  4S2I A;  5CHU A;  4GOG A;  3BW6 A;  2WAE A;  4GZB A;  5BOH A;  1BSG A;  2Z2L B;  2O9A A;  1XX2 A;  4IVK A;  3KSH A;  3JVU A;  3ICY A;  5TFQ A;  4RX2 A;  1MWR A;  1WYC A;  3OOV A;  4HP9 A;  3ZG5 A;  5FAT A;  3ITA A;  3LIB A;  5A93 A;  2W1T B;  5DKK A;  1S66 L;  1K0K A;  2M1C A;  1LL5 A;  2G2W A;  5FEG A;  4L9G A;  4S2K A;  4ZJ3 A;  3LI9 A;  2PU4 A;  1P9R A;  4KQQ A;  3T4L A;  1NZU A;  2P74 A;  4JF4 A;  1OTB A;  4RYE A;  5J4E A;  1FIL A;  3S7O A;  2PRF A;  1PYY A;  4FCF A;  2G7U A;  3ULF A;  3R7W B;  2KX6 A;  1KE3 A;  2O0Y A;  1K57 C;  3LIA A;  4QY6 A;  1BYW A;  4B88 A;  4PM6 A;  5F5Y A;  4EWF A;  4QY5 A;  2ZM8 A;  3CPT B;  4X56 A;  4DJ3 A;  3GSG A;  1S0W A;  3HLC A;  1OTA A;  3NOU C;  1ZG4 A;  2PYR A;  5HZH A;  4EES A;  3DTE A;  4XT2 B;  2X01 A;  4F3L B;  2RCX A;  2XRO A;  1FR1 A;  3IX3 A;  3IX4 A;  1HD8 A;  2EX6 A;  4PM9 A;  3IQA A;  4GNU A;  4LRX C;  3WS5 A;  2QHK A;  4P0M A;  4A5R A;  4ZJ2 A;  3HLW A;  5HW3 A;  4JPM A;  5FQ9 A;  2ZM2 A;  1TS7 A;  4KUO A;  2NUP C;  3RXX A;  2OLV A;  5FI6 A;  2ZL1 A;  5CGW A;  1CQA A;  4WEJ A;  5FQM A;  1T1A A;  2Y2N A;  1YLY A;  5DFY A;  5KZH A;  1H5X A;  1HTZ A;  1N9N A;  3NEC A;  3LIC A;  4LEN A;  5JYO A;  5HPI A;  3S1Y A;  5F82 A;  1FR6 A;  1ERM A;  4UQI M;  3T4Q A;  4DE2 A;  3GTC A;  1ALQ A;  4EBN A;  4EBP A;  2VA0 A;  5GLD A;  1K4F A;  2BLS A;  3HJK A;  3ZG8 B;  1XA1 A;  3F1P B;  2J3T D;  1MC0 A;  5GHX A;  1S67 L;  4EER A;  3V39 A;  4MNR A;  1G5U A;  4II7 A;  1RP5 A;  1NJ4 A;  1ESU A;  3HUM A;  3P09 A;  4I39 A;  2A24 B;  1GA9 A;  4ZDX A;  2ZMV A;  4G3V A;  4WZ4 A;  4BLM A;  3IWQ A;  3CI6 A;  4ME4 A;  4DXB A;  3CAX A;  1H0M A;  4JKT A;  3NBL A;  3BLS A;  1UWN X;  1FCM A;  3FYZ A;  3NCK A;  3UB6 A;  3HRE A;  4XUZ A;  4X6T A;  2PAV P;  1G68 A;  4JXG A;  3LEQ A;  4XXR A;  3PBR A;  5J8X A;  1NYY A;  4IBX A;  1ES2 A;  3LGO A;  1XJ2 A;  1PIO A;  1GCE A;  1RCJ A;  2Y2L A;  4OPQ A;  3PR6 A;  4LLO B;  4HH2 A;  3N4I A;  3RTY A;  4GLQ A;  2P08 A;  2EX2 A;  3KO6 A;  2IWC A;  4GB7 A;  3QP1 A;  2QMI A;  1K38 A;  2J8Y A;  3RXW A;  1TDG A;  5TR7 A;  5DVA A;  1MWT A;  3MZF A;  4BBU A;  3C5A A;  5LBR A;  1BT5 A;  1G6O A;  1LSW A;  1K56 A;  5DJT A;  1I5Q A;  3IXB A;  1UGU A;  4DRT A;  4BJP A;  5IU1 A;  3SS5 A;  4WBG A;  4S2M A;  1F5M A;  2J9O A;  1NY0 A;  3MKF A;  2Y4A A;  2P7J A;  4EUZ A;  1FCO A;  2HJE A;  2W27 A;  3LIE A;  1H8Z A;  3M6B A;  3M2J A;  3DWK A;  2GJ3 A;  1VM1 A;  3VFH A;  4C75 A;  2XEP A;  2V1A A;  4CLC C;  4Z1W A;  5EVI B;  1K25 A;  3IS2 B;  1K4E A;  3MQQ A;  2XRN A;  5HD3 A;  3GR2 A;  4R70 A;  5HAP A;  3IH8 A;  1YLP A;  4PPR A;  3KYZ A;  4R3A A;  3UB5 P;  3HVF A;  4GS9 A;  1VEU B;  5E43 A;  3W4Q A;  4EET B;  2XFT A;  4OP8 A;  2DNS A;  1F2K A;  5EVL A;  4IVI A;  3D9Y A;  4P85 A;  2ZM0 A;  2DCF A;  1BLS A;  2VGL M;  2ZC3 B;  3SZT A;  3UB9 A;  5HWT A;  4R0Q A;  3WS4 A;  3EQV A;  3G2Y A;  5FI2 A;  1XGI A;  5F69 A;  3S7Q A;  1UWP X;  1LT0 A;  5CEC A;  1OTD A;  3T1R A;  2VZW A;  2V1B A;  2HP9 A;  4LV3 A;  5EPH A;  5EEC A;  3LR0 A;  3LFV A;  3JVV A;  1LLB A;  5FL3 A;  5D3O A;  4GD8 A;  4L0L A;  3IH9 A;  3WRT A;  1XXM A;  3M2K A;  3JPU A;  1PI5 A;  4N9L A;  1JNU A;  2R9X A;  2W3D A;  3NY4 A;  3LIF A;  3MQO A;  2JKT I;  3ZVW A;  1M40 A;  2WAF A;  3CUE A;  5CTM A;  3DTI A;  4FUW A;  4WMC D;  2D02 A;  1S4R A;  1RGY A;  5MC7 A;  5F6A A;  5FQQ A;  1PI4 A;  1KVM A;  1T18 A;  2Y2G A;  4Y2F A;  3SH9 A;  4N92 A;  1BLC A;  2OWJ A;  3WRZ A;  2Y8H A;  4I3A A;  3NOT C;  5EVI D;  4K0X A;  4IUH A;  1SDE A;  4Y7P A;  4JGP A;  4KZB A;  3KX0 X;  4NXE A;  1IKG A;  4Y3I A;  1S1Y A;  1L0G A;  1K55 C;  5HAR A;  2XR0 A;  3LYX A;  3G4P A;  5AVE A;  5A90 A;  3MXS A;  4FH4 A;  2FZ0 A;  2X02 A;  5CER A;  3HJI A;  4M4X A;  1O07 A;  2V8C A;  5GL9 A;  5M18 A;  1DP9 A;  3CWF A;  4R1G A;  3H9W A;  2EWV A;  3C4O A;  1YT4 A;  2MJ6 A;  5DF9 A;  1YLT A;  2WK0 A;  3QP2 A;  2R9W A;  3MFD A;  2GZA A;  1H8Y A;  3VP0 A;  4S2L A;  2JKT M;  2EA9 A;  4WM9 A;  1TEM A;  4WZ5 C;  3MXR A;  4MN5 A;  2M7U A;  3A0S A;  3D3O A;  2Y2H A;  5FA7 A;  1FQG A;  2J3T C;  4JLF A;  1ZC2 A;  3BEC A;  4OLD A;  3MZD A;  2LB9 A;  4L9F A;  1N4O A;  5HAI A;  2C6W B;  2A2L A;  3HLB A;  5CED A;  1NRF A;  2OSU A;  3GDI A;  5HDD A;  5L8M A;  3BQ8 A;  2FFY A;  1MZU A;  1NXY A;  1TS0 A;  3NDE A;  2V20 A;  4BD0 A;  1D06 A; 
#chains in the Genus database with same CATH homology
 4WL9 A;  4H6J A;  4DJ3 A;  2Z6C A;  4CLC E;  3S7P A;  5KSH A;  2O99 A;  1OTA A;  3NOU C;  2PYR A;  5HZH A;  1F98 A;  4EES A;  3C38 A;  1DP6 A;  1S1Z A;  4XT2 B;  2K31 A;  2PHY A;  4F3L B;  2PR6 A;  5HD5 A;  2XRO A;  3FC7 A;  3P7N A;  4HJ4 A;  2D01 A;  3VV4 A;  4DJ2 A;  3LID A;  1LL8 A;  2VGL S;  4LRX C;  3E4P A;  5EFW A;  4P6Z S;  4EQ1 A;  1WA9 A;  2QHK A;  3NJA A;  3OCL A;  4EU0 A;  1XJ6 A;  1TS7 A;  4KUO A;  2NUP C;  2L0W A;  4OOM A;  4GHI A;  4WEK A;  1OJG A;  4RQ9 A;  2VKS A;  1OTE A;  3C8C A;  2XA7 S;  4WEJ A;  4FOF A;  3T4S A;  1T1A A;  3LR3 A;  3EWK A;  3LUQ A;  1F9I A;  1X0O A;  3R4K A;  2JKR I;  5DFY A;  5K5B A;  3UB7 A;  2QJ5 A;  1N9N A;  3UME A;  2OOL A;  3KSF A;  1P0Z A;  2PD7 A;  3LIC A;  2W3H A;  5CX7 A;  4BWI A;  2NUT C;  4G3W A;  5HPI A;  4FSF A;  3F1N B;  3PXP A;  3NHQ A;  4I3I A;  2A24 A;  3LR5 A;  4I3J A;  1IFQ A;  4UQI M;  3BQA A;  2VV8 A;  4IHQ A;  3T4Q A;  1P9W A;  3DBA A;  2VA0 A;  4UEY A;  1NLY A;  3HJK A;  5HSQ A;  4NXB A;  3TW8 A;  3F1P B;  2J3T D;  1MC0 A;  4CLC B;  1S67 L;  4EER A;  3MFX A;  3R7W A;  4O8G A;  3T4J A;  3C30 A;  2GNX A;  4ETX A;  4I5S A;  2PR5 A;  4II7 A;  4HJ3 A;  2L4R A;  1H8M A;  4GCZ A;  3RH8 B;  4HNB A;  1LSV A;  3H82 A;  3MR0 A;  1TD5 A;  2O9B A;  2A24 B;  2HJ9 C;  2W1R A;  4I39 A;  4PKY A;  4Q0H A;  4MMN A;  2HV1 A;  1ODV A;  2ZMV A;  4G3V A;  3K3D A;  1TF1 A;  4NEE D;  3T4O A;  4F3L A;  3MMH A;  4ARZ A;  5DFX A;  4IJG A;  3EGX C;  5TJJ A;  2W3F A;  3CI6 A;  3P01 A;  3PBS A;  4ME4 A;  2OWH A;  3BY8 A;  4ZRR A;  3CAX A;  2JN7 A;  1NRJ A;  1GSX A;  3E4O A;  2V0W A;  3PBT A;  4HY8 A;  2V9A A;  1VHM A;  3UB8 A;  3GEC A;  1UWN X;  4Y5F A;  5HDS A;  3UB6 A;  5IS1 A;  1DP8 A;  2B02 A;  2HF6 A;  2JKR M;  5TBM A;  2K7S A;  4HH3 A;  4OOL A;  2QJ7 A;  1OJ5 A;  1STZ A;  1OPX A;  2Y79 A;  1VB6 A;  2IA2 A;  1GSV A;  2H28 A;  3PBR A;  3H82 B;  2J80 A;  4GS9 B;  2WKQ A;  2W0N A;  3PBN A;  4ARZ B;  1YAX A;  2ZOH A;  3EGD C;  1XJ2 A;  2OAP 1;  1OTI A;  3OCN A;  1YSP A;  4L9E A;  3F1N A;  3C2W A;  1TS6 A;  3OBF A;  3VE4 A;  4B9O A;  3PR6 A;  4LLO B;  2ZOI A;  4R38 A;  1OT9 A;  4AFI A;  4HH2 A;  1NWZ A;  1H3Q A;  3E0Y A;  3KYQ A;  2VJW A;  1EW0 A;  3RTY A;  4GLQ A;  3SW1 A;  2R78 A;  5TBM B;  2P08 A;  5HL6 A;  3KO6 A;  2KOI A;  3PBO A;  3MXQ A;  4EUV A;  3F1P A;  4DMZ A;  4CLC A;  3CLO A;  3D72 A;  4JGQ A;  2L1M A;  3VOL A;  4BBU A;  2GX5 A;  1W63 Q;  5LBR A;  1T19 A;  3T50 A;  3T4K A;  1G6O A;  2QYB A;  5HDC A;  3E98 A;  1LSW A;  3KSG A;  5AJG A;  1XJ4 A;  3S7N A;  3BJN A;  3H7W A;  5DJT A;  2YKH A;  1ZTU A;  1UGU A;  2PD8 A;  4DN0 A;  2OAQ 1;  4BBV A;  3PHY A;  1T1C A;  4BJP A;  5IU1 A;  3CIT A;  2J3W A;  4EW7 A;  5HWW A;  1N9O A;  1F5M A;  3UE3 A;  2FH5 A;  2P7J A;  4E04 A;  2PT7 A;  2HJE A;  3LIE A;  2W27 A;  3U2A A;  1IOU A;  2HGV A;  4NXF A;  3CUE C;  1LSX A;  2ZBB A;  3EEA A;  2GJ3 A;  3EOI A;  1P97 A;  2V1A A;  4HIA A;  3EEH A;  5C5K A;  3A0R A;  2CMN A;  2PYP A;  4CLC C;  4Z1W A;  3IBR A;  4CQH A;  3IS2 B;  4EEP A;  4NXG A;  3MQQ A;  3NOP C;  2XRN A;  5HD3 A;  2EWW A;  3H7W B;  3KSI A;  4R70 A;  3VE3 A;  4MN7 A;  5G4Z A;  3KYZ A;  4R3A A;  3B42 A;  4JGO A;  3RFB A;  2ZMF A;  4LPZ A;  4I38 A;  4GS9 A;  2PDR A;  1XFQ A;  5IT5 A;  4EET B;  4HJ6 A;  2K2N A;  2VEA A;  4GW9 A;  4UQI S;  5J7E A;  2WKP A;  3HCY A;  3TRC A;  3ZYT A;  1T1B A;  2VGL M;  4Q0I A;  3UB9 A;  5HWT A;  3PYP A;  4P6Z M;  3OC2 A;  2VV7 A;  4ETZ A;  3EQV A;  5J3W A;  2WKR A;  2O9C A;  1W63 M;  1TS8 A;  4GJ4 A;  5F69 A;  5DKL A;  4WEL A;  3S7Q A;  1UWP X;  1LT0 A;  4IUK A;  1OTD A;  5DJU A;  1KOU A;  3W2Z A;  4YOF A;  2VZW A;  2V1B A;  3MF0 A;  5KIZ A;  3O5Y A;  3LR0 A;  4WF0 A;  2BAS A;  3LFV A;  4Q0J A;  2KLI A;  2XA7 M;  1D7E A;  3JVV A;  3F1O B;  3LI8 A;  1OT6 A;  5FL3 A;  4MCW A;  4L0L A;  3V67 A;  3B33 A;  5G4Y A;  2M7V A;  2INW A;  1N9L A;  3K2N A;  1GSW A;  4R6L A;  2YKF A;  1XJ3 A;  1JNU A;  4KUK A;  4LRY C;  4WN5 A;  2W3D A;  1XFN A;  3LIF A;  3MQO A;  2JKT I;  4B93 A;  4MDZ A;  4HP4 A;  1G28 A;  5A8B A;  2VV6 A;  3CUE A;  3G6O A;  2B18 A;  5F68 A;  4MN6 A;  4PAU A;  4PKY G;  2QWS A;  4HOI A;  3E4Q A;  2D02 A;  1S4R A;  4HQA A;  5AVF A;  4YNR A;  5MC7 A;  5HWV A;  4KQO A;  4HHD A;  4WUJ A;  5F6A A;  3TE8 A;  3IS2 A;  1DRM A;  1T18 A;  2QKP A;  4Y2F A;  1S4S A;  3MJQ A;  2JHE A;  4CLC D;  2VLG A;  2OWJ A;  4JGR A;  4O01 A;  4H6J B;  2Y8H A;  4I3A A;  3FPW A;  3NOT C;  4IUH A;  3LR4 A;  3BY9 A;  4PHT A;  3UE6 A;  4JGP A;  3KX0 X;  2DMW A;  3BWL A;  2W3E A;  2V0U A;  3T4T A;  1NLZ A;  4NXE A;  4HI4 A;  2W1T A;  1YSQ A;  4BMW A;  4G3K A;  3OLO A;  4Y3I A;  5HPF A;  1S1Y A;  3LYX A;  5AVE A;  4NKP A;  3BW6 A;  3ZQ5 A;  2VX8 A;  2FZ0 A;  3HJI A;  3FPV A;  5I5L A;  4M4X A;  2O9A A;  4EEU A;  1DP9 A;  3CWF A;  3A0V A;  4QPR A;  3H9W A;  4GHI B;  3KSH A;  2EWV A;  2MJ6 A;  5DF9 A;  3JVU A;  1V9Z A;  3ICY A;  2GZA A;  4YWZ A;  3FG8 A;  1ZHH B;  2XSS A;  2I9V A;  3F1O A;  3OOV A;  2JKT M;  2EA9 A;  4HP9 A;  3K3C A;  4KQD A;  3LIB A;  3TJZ C;  2W1T B;  4MN5 A;  5DKK A;  1YKD A;  2W3G A;  3B47 A;  1S66 L;  4K08 A;  2M7U A;  3A0S A;  3D3O A;  4XT2 A;  2M1C A;  2J3T C;  4L9G A;  4O0P A;  1MKM A;  3LI9 A;  4BBT A;  1V9Y A;  1P9R A;  2P04 A;  4LRZ E;  4EXO A;  2LB9 A;  3T4L A;  3UMD A;  4L9F A;  1OTB A;  1Y28 A;  2A2L A;  4WLA A;  5J4E A;  3S7O A;  3GDI A;  5HDD A;  5L8M A;  3IBJ A;  2G7U A;  2Z6D A;  3MQ0 A;  2LB5 A;  3BQ8 A;  3ULF A;  3R7W B;  2KX6 A;  2O0Y A;  3LIA A;  2KDK A;  1BYW A;  1MZU A;  5F5Y A;  1TS0 A;  3PBQ A;  1D06 A;  3EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...