3MQQA

The crystal structure of the pas domain in complex with ethanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.65a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
b'IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LuxR family
molecule tags Transcription regulator
source organism Burkholderia thailandensis
publication title The Crystal Structure of the PAS domain in complex with Ethanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.65A
rcsb
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqqA00
1XJ6A 4KUKA 3D72A 1P97A 2H28A 5TBMB 3F1NA 4EEUA 1OTBA 3F1PA 1P0ZA 4R6LA 1T19A 5G4ZA 3NOPC 1S1YA 4I39A 3CLOA 3E4PA 3KX0X 4HY8A 4PKYA 4BBVA 1N9OA 2W0NA 4E04A 2ZOIA 2Z6CA 3IBRA 4WUJA 3MQOA 2V0WA 3E4OA 2I9VA 4GHIB 1X0OA 2VV6A 3H82B 3FC7A 1F9IA 4XT2A 1EW0A 1D7EA 3C8CA 5AVFA 1KOUA 5IU1A 2PYRA 2ZBBA 4GHIA 5HD5A 3LUQA 2WKRA 3LYXA 2CMNA 4EESA 3BWLA 1DP6A 1T1CA 5DKKA 3ZQ5A 3K3CA 4EQ1A 5HWVA 4WL9A 2B02A 1NWZA 2V9AA 5KIZA 3B33A 4B9OA 4I38A 4BBUA 3LIFA 3IS2A 5G4YA 2ZOHA 5HSQA 1DP9A 1OTAA 4L9FA 1MZUA 3NJAA 3UB8A 2M1CA 2YKHA 1UWNX 3PYPA 1OTDA 1F98A 4RQ9A 2A24A 4K08A 1XFQA 1LL8A 3F1OB 1JNUA 1GSWA 2D01A 4M4XA 3UB6A 1S1ZA 2VLGA 3G6OA 5TBMA 4EEPA 4HQAA 4GW9A 4I3JA 1LSXA 5A8BA 5DKLA 4L9EA 3UMDA 3C2WA 5F68A 1WA9A 5HDCA 3MFXA 2V1BA 2VV7A 1BYWA 1ODVA 1S4SA 5HDDA 3VOLA 4HNBA 3A0RA 2VEAA 1XJ2A 3BY9A 4I5SA 4R70A 3CWFA 4EERA 1UWPX 1XJ4A 3LICA 3PHYA 2PDRA 4HIAA 4XT2B 2P7JA 4HH2A 4HP4A 4KQDA 2BASA 1VB6A 3A0VA 1S66L 3GDIA 4F3LA 5J3WA 4GS9B 2QJ5A 4MN5A 1OT6A 4MN6A 2EA9A 4HHDA 1XFNA 1LSVA 4EXOA 4NXGA 2K7SA 4EW7A 1GSVA 2OWJA 3HJIA 4HJ3A 3UB7A 2HV1A 1TS6A 4F3LB 1LT0A 2L4RA 3CAXA 3FG8A 5DJTA 2WKPA 2VV8A 4DJ3A 3SW1A 3EEHA 4DJ2A 3E4QA 2INWA 3IS2B 3LIAA 2V1AA 3MXQA 1XJ3A 3UB9A 1S4RA 4PKYG 5IS1A 2OOLA 3MJQA 4JGOA 2GJ3A 4EETB 5J7EA 4H6JB 4HP9A 2QHKA 4I3AA 5HWTA 2PYPA 3LIBA 3OLOA 3RTYA 5HWWA 2J80A 4LLOB 4HI4A 2PHYA 1TS0A 4R38A 4LPZA 5EFWA 5AVEA 2V0UA 3NHQA 5F69A 3GECA 2WKQA 1T1AA 4H6JA 3ICYA 3H82A 2QJ7A 3F1PB 2KDKA 4R3AA 1G28A 4GCZA 4WF0A 3UE6A 2KX6A 2L0WA 2YKFA 3P7NA 4LRZE 1UGUA 1DP8A 1TS8A 1D06A 1OJ5A 1LSWA 2PR5A 1Y28A 2PR6A 3H7WA 3LIDA 4I3IA 4WN5A 4WLAA 3NOUC 5F5YA 3ULFA 5HZHA 2R78A 3K3DA 4LRXC 2QKPA 3HJKA 5J4EA 3H7WB 2PD8A 3BY8A 4HJ6A 4BBTA 1V9ZA 5F6AA 3EWKA 1S67L 4GS9A 4NXBA 1N9LA 1N9NA 3LI8A 3LI9A 1OT9A 3MR0A 1OJGA 3H9WA 5HDSA 3T50A 3VE4A 3MQQA 1OTIA 4HJ4A 2QWSA 4HH3A 4HOIA 4JGPA 4NXFA 5HD3A 3VE3A 4JGRA 4YWZA 2PD7A 3A0SA 3LIEA 1T1BA 3UMEA 5DJUA 1V9YA 2OWHA 2D02A 2L1MA 4LRYC 4KUOA 1DRMA 3NOTC 2W27A 2JN7A 3F1NB 5I5LA 3RH8B 2A24B 1GSXA 2Z6DA 4JGQA 1OTEA 1TS7A 3F1OA 4NXEA 2JHEA 1T18A 4L9GA
chains in the Genus database with same CATH superfamily
3F1NA 4R3BA 3VOYA 1P0ZA 4KZ9A 3T4LA 2ZQAA 1KGGA 3G31A 4KZBA 4Y0TA 2WYXA 3CITA 4OPZA 2QPNA 3IHBA 1GA9A 4WZ4A 4AFIA 1PIOA 5DKKA 3N8LA 3FPWA 3MSHA 5CTMA 4BBUA 3T4TA 1LHYA 3UB8A 2W1TA 5JYPA 1CEFA 1AWIA 3IF6B 3FKWA 1ZG4A 2OAP1 3B3XA 4EERA 4FSFA 4CQHA 1UWPX 3BQ8A 3ZG9B 3CI6A 4O01A 5AQAA 1XFNA 4EXOA 4EW7A 3HJIA 4HJ3A 3UE1A 5CGXA 2HV1A 2WAEA 3EGDC 1H8YA 3IXGA 4FH4A 1VHMA 4F94A 4DF6A 3CJMA 3OLOA 1QMFA 1ALQA 1G5UA 4KZ4A 2QJ7A 1BUEA 2ZC6B 3P98A 5I94A 1OJ5A 1YLYA 2OAQ1 5KSHA 5E43A 3BY8A 4HJ6A 4GS9A 4HJ4A 4NXFA 4GLQA 2VZWA 1YMXA 3MZFA 2XGNA 2KOIA 1PZOA 2ZJ9A 4L9GA 4UEYA 5FQKA 1K38A 2X01A 3PAGA 1OTBA 2HP9A 1T19A 4KQQA 3IXHA 2LB5A 2ZC5B 2Z6CA 4S2LA 3D4FA 4Q0IA 5M19A 2VV6A 2DNSA 1W7FA 2ZQ9A 5CHUA 3CG5A 4DKIA 2HDRA 1XP4A 5FL3A 1T1CA 3N4IA 4Y0OA 2UWXA 4Y13A 1S6RA 1JNUA 1TEMA 3HLGA 3NULA 3UMDA 3C2WA 1ESIA 1ACFA 3A0RA 4KQDA 3ZG8B 3G32A 3EQUA 3SS4A 4NXGA 1GSVA 2Y55A 2WKPA 3ITAA 3LIAA 1JTGA 2EX2A 1KE0A 2ZL1B 1MC0A 3T4QA 4FUWA 2H0YA 1VETB 1YT4A 2KX6A 1LI0A 4OLDA 1TS8A 1PW1A 3ZGAB 2Y2JA 5AQ7A 4D60A 1N9NA 3DTEA 4FCFA 1IFQA 2Q0OA 4LCMA 2EX6A 1JTDA 3SH9A 2PAVP 2ZD8A 2FH5A 4ESPA 4R4RA 3O86A 1K56D 4ARZA 3K2NA 4I39A 5DF8A 2WGVA 3HUNA 4MCWA 4DDYA 3T4JA 2J7VA 3SH7A 2WGWA 4S2OA 1YQSA 3MBZA 2WKRA 4GDBA 1RCJA 2HP5A 3BRMA 4B9OA 3IS2A 2V8FA 3GVBA 4GN2A 4Z1WA 1D1JA 4P0MA 3V5MA 3DTMA 1TDLA 3VP1A 1NYMA 4R23A 4JF6A 1L0FA 3G34A 2EFXA 1PWDA 3RXWA 3T12B 3UB7A 2Y2KA 3NDEA 3DBAA 4A5RA 3ZG5A 4DJ3A 4DJ2A 1ZG6A 2G2WA 5MC7A 4MEZA 2J9PA 3MXQA 4DRTA 3HUMA 1YLJA 2OOLA 3MJQA 4H6JB 5GLDA 3S1YA 2VK3A 4UHUA 1TS0A 1WYBA 3EGXC 5U47A 2V2FF 3H82A 4B4ZA 4E6WA 3D9YA 3VFFA 1LSWA 5F5YA 4ZAMA 2J3TC 2G7UA 2IA2A 4GNUA 2BTFP 1OT9A 5EM0A 3T50A 2QWSA 1JWZA 2M7VA 3A3FA 3LGOA 3IF6A 5HL1A 3S7PA 2W27A 4MN7A 3O5YA 1IYQA 1OTEA 3KYEA 5L07A 2PU2A 4BD0A 2P04A 2V20A 4KG5A 4OP5A 4JXWA 1MWRA 1Z6FA 3BW6A 2W3GA 3FC7A 4KQOA 2Q9NA 4PM8A 5FQMA 2Y91A 1JWPA 5HD5A 2XRNA 4S2KA 2EWVA 1NWZA 5KIZA 3BLMA 4P6BA 2D01A 4M4XA 4UQIS 3P09A 5AQ9A 1K55C 4JF5A 5DKLA 1WA9A 2W3EA 1NZUA 2VV7A 5HDDA 3VOLA 3TG9A 2JCHA 4JXGA 1ZKJA 5DTSA 1LSVA 2Y2OA 5A93A 4R1GA 1LT0A 2L4RA 3C7UA 3KYZA 4PKYG 4MLLA 1LLBA 3FYZA 5J7EA 5FDSA 4R4SA 1L0GA 4EBNA 3RXXA 2P74A 3O3VA 3DWKA 2ZL1A 4Y5FA 4H6JA 2H5SA 3LO7A 4LRZE 5DFXA 1UGUA 3OPRA 2VKSA 1D06A 4I3IA 4ETZA 3ZG7B 5AQBA 5KMWA 3A3DA 2ZQ7A 4YINA 3BLSA 2VX8A 3LI8A 3LI9A 4DE0A 3O88A 3CPTA 2HP6A 2BG1A 3WS0A 2PD7A 3PAEA 1IEMA 3M2JA 5CHJA 1U60A 3NOTC 4JXSA 3W2ZA 1IKGA 4JGQA 4RVAA 2KLIA 4DXBA 4WBGA 1CQAA 2GDNA 3C5AA 4S2NA 4R6LA 1I2SA 1S1YA 5BOHA 1J3WA 1CK3A 3OPPA 3MQOA 3M2KA 2I9VA 1EW0A 1EWZA 2IWDA 2LB9A 2PYRA 3MKFA 4MBKA 5FAQA 3WWXA 2HGVA 2VGLM 2XA7S 1VEUB 1BZAA 3PBOA 4WZ5C 1DP9A 1MZUA 2XK1A 3S7QA 2HDQA 4IBRA 2XFSA 1J9MA 3HBRA 3ZG0A 1S1ZA 2ZLYA 2ZMAA 3CZDA 4ZJ1A 5TBMA 2QMIA 3G4PA 4KZ3A 4L9EA 4EBLA 2XSSA 1PW8A 1XJ2A 3BY9A 1E3UD 2XR0A 1S66L 4X6TA 3BFFA 4HHDA 4E3KA 3TOIA 1L0DA 1DY6A 3UB5P 3UB9A 5L09A 4O0PA 2PT7A 1K6RA 3C4OA 1T1AA 1MXOA 2RL3A 4GCZA 3W8KA 2Z2MB 3BFCA 2WZZA 3P01A 4N9LA 3NOUC 3ULFA 3PBSA 3OOVA 1K4EA 3VE4A 5HD3A 2JKTM 3NY4A 4Z9QA 4PHTA 5DJUA 3UO9A 4EU0A 2GZAA 4BJPA 5F82A 3ZVTA 2ZBBA 1H8ZA 4CLCE 3WS5A 1NZOA 2CMNA 2RCXA 3KYQA 3IBJA 5GL9A 4I38A 2VA0A 2M1CA 3MXRA 1IOUA 4K08A 3IX4A 4Q8IA 1YSPA 3G6OA 3T1QB 1FILA 3EOIA 4UA6A 1VM1A 3V3RA 4JBFA 5HFOA 4HH2A 3V3SA 4P6ZS 1W8QA 4S2NC 3B47A 5HX9A 3LR3A 3L9KA 2HPBA 1NY0A 4U0TA 2XD5A 3C7VA 5A90A 5CTNA 1W63Q 3A3EA 1Y4OA 3C4PA 1NJ4A 4XXRA 3T1RA 1LL5A 2J80A 4KZ6A 5G18A 4LPZA 3QP5A 4IVKA 2WAFA 4R3AA 4WF0A 2ZQCA 1SKOA 3BFGA 1K6SA 4R0QA 4Q0JA 2ZC3B 1Y28A 2PBDP 4LRXC 4N9KA 3Q7VB 5GHYA 2WADA 4CLCC 2BLSA 1OJGA 1OTIA 1TVFA 5GLAA 4RX3A 4JGPA 3IF6C 3A0SA 4MBHA 1K55A 1G6AA 4LRYC 1EROA 2JKRM 1DRMA 2QZ6A 3BFEA 4IVIA 3W4OA 3TSGA 3F1PA 4XUXA 3JVUA 4IEDA 4BL2A 1DJAA 1FCMA 2W0NA 2ZOIA 3BJNA 4E6XA 2JKGA 3C8CA 1XX2A 2Q9MA 3OC2A 1NRJA 4PM7A 5EVLA 3HLDA 4WMCD 4X56A 2EXAA 5HSQA 1CJFA 4HEFA 4BENA 3VMAA 5CGSA 3IQAA 2C6WB 3FV7A 5DFYA 3UPOA 2VGKA 1YLZA 1FR6A 2HF6A 1ES4A 4YOFA 2PDRA 3GSGA 1O7EA 3ISGA 4IJGA 2M7UA 4LV0A 5E2HA 4N92A 1EI5A 4EBPA 3HREA 4EQIA 1S4RA 3ZHHA 5A91A 4NK3A 3GTCA 5EPHA 2OLVA 3MMHA 5CRFA 2V0UA 1PWGA 4MBFA 2KDKA 4OQIA 1G28A 3UE6A 1G68A 2YKFA 1IYPA 3LIDA 2PR6A 2PD8A 1HZOA 3FWLA 2X02A 3LCEA 2XF3A 4JXVA 1K54A 4HH3A 3QHYA 4YWZA 3GRJA 2W3DA 5GLCA 4RA7A 3F1NB 5FQQA 3JPUA 3HLCA 1YPRA 1T18A 3HLBA 3LFVA 1L3LA 1M6KA 4KUKA 4KZ8A 4KG6A 4UA7A 4FOFA 2QYBA 4E04A 2H0TA 3E4OA 1M40A 1DJBA 1MWTA 3N8RA 1X0OA 3N7WA 4X1LA 1MWUA 3IHAA 1JVJA 4KENB 4JPMA 4HBTA 4QJGA 4Y0UA 4EESA 3LYXA 3V50A 3ZQ5A 5HAPA 3LIFA 4CLCA 1UWNX 1PRQA 3BQAA 4OP8A 1E4DA 1H5XA 1LL8A 5M1AA 4HQAA 3ITBA 1VETA 4ETXA 3NDGA 2V1BA 4FH2A 1BYWA 4BLMA 3CWFA 1ERMA 4OPQA 5FSRA 3EEAA 3MFDA 4XT2B 2HJEA 5FQJA 4HP4A 3UDIA 1W79A 5CECA 3OPLA 4RX2A 3IT9A 2ZM8A 5C5KA 5CEBA 4L0LA 4OQGA 4LLOB 3R7WB 3PTEA 1SHVA 5EFWA 3GECA 2O9BA 1H0MA 1HTZA 3VP4A 1BT5A 1FOFA 4QU3A 5EOOA 4ZBEA 1K4FA 2E8JA 2UV0E 3O87A 2B18A 3VFHA 1KDWA 2A3UA 3UPPA 4LGWA 5D3OA 5I5LA 2Z6DA 4OOYA 5AVEA 4ARZB 2E8IA 4X25A 3CLOA 4HY8A 4QHCA 3VSKA 3ZFZA 3IBRA 1NLYA 3IX8A 2P08A 4WUJA 3GR2A 3C38A 3H82B 1TF1A 3S7OA 1D7EA 3NC8A 1ONGA 4YFMA 4IBXA 2PRFA 4WYYA 1XGIA 3NECA 4EQ1A 5CGWA 2V9AA 1PZPA 1Z09A 3NJAA 2YKHA 4M3KA 3IWOA 1GSWA 3UDXA 4ME4A 4PM6A 2WGIA 4N1XA 2J8YA 3OBFA 2HZ5A 3TE8A 5HL6A 4B88A 2WKEA 4D2OA 1ES5A 4P87A 2MJ6A 3SZTA 2PBYA 4JGOA 3T4OA 4DE3A 4EETB 2QHKA 3LEQA 4Y15A 5HWWA 4GB7A 3WS1A 4OH0A 3JYIA 4CPKA 2VGJA 1PFLA 2J3WA 4X1MA 5HZHA 4QB8A 3M6HA 4OVDA 1DJCA 4NXBA 3H9WA 3MQQA 2EX8A 3VP2A 5EVIB 4PAUA 5FAPA 3HLFA 2DRWA 2D02A 3U4LP 1BULA 3CMZA 5TFQA 3F1OA 3ZDJA 4WEKA 2XQZA 4EEUA 1YKDA 5DF9A 3IF5A 3NOPC 4BBVA 4PKYA 2FZ0A 3MQ0A 5GHXA 1ERQA 3R4KA 5DTKA 4QWOA 5CEDA 3E0YA 4JF4A 1XGJA 4R3JA 1OTAA 1OTDA 4OPYA 4RQ9A 2R9XA 5KZHA 3UB6A 5FQIA 3AGFA 1VQQA 1NYYA 2O9CA 1LSXA 1FIKA 3DW0A 1NRFA 1PI4A 3G2ZA 1HLUP 1FCOA 4E3MA 3FG8A 2ZMFA 5FI6A 3EEHA 4LFUA 2VGLS 4EUZA 1XJ3A 3CUEC 3UE0A 4OPRA 1KGFA 1VEUA 4QY6A 2Y2MA 3CUEA 3R7WA 4GJ4A 2XROA 4IUHA 2G2UA 3H7WA 2R78A 2FFYA 3BEBA 5FEGA 3SS3A 1V9ZA 4CLCB 5CXWA 1BLSA 1RGYA 1SKFA 3TRCA 2IWBA 1XPBA 3D3OA 4Y2FA 5FAOA 2A24B 3RFBA 4CLCD 3D72A 4BMWA 5TBMB 3HL9A 1W8YA 3LR4A 4NETA 5DTTA 3IH8A 1SCWA 3E4PA 4DMZA 3T4KA 1GA0A 5TR7A 5FA7A 4K0XA 2EXBA 4GHIB 4WEJA 3VSLA 3HLEA 2P9VB 3GMWA 4BD1A 2Y2NA 3E2KA 3VV4A 3BWLA 4K91A 4HBUA 5G4YA 3QP4A 2C5WB 5L2FA 3I7JA 5F83A 3LY3A 3U2AA 2ZC4B 4GD8A 3G2YA 2WZXA 2Y59A 4I5SA 2VJWA 1F5MA 1JWVA 1VB6A 2H10A 4MN5A 2B95A 2EA9A 3WRZA 3PBNA 4QD4A 3KSHA 4OLGA 1IYSA 4E3OA 3BFDA 1S0WA 3C30A 3NBLA 4HP9A 3LIBA 3NHQA 4S2JA 2WKQA 3ICYA 3QNCA 3UPNA 5EE8A 4X69A 4WLAA 3IXDA 3S22A 2Y4AA 5CHMA 2JE5A 4WZ5A 1S67L 3GV9A 4PM5A 5EVIA 3IWIA 3KO6A 5EVID 1YLWA 5L8MA 3UN7A 5FASA 3M6BA 1E3UA 4BL3A 2Y79A 2WKHA 1ZTUA 3T1SA 3UNWA 2ZM0A 2ZM2A 5EUAA 3PBQA 3HCYA 1Q2PA 5HARA 5FI7A 1H3QA 3T1XA 3SS5A 1SKOB 1KOUA 4CJNA 4G3KA 3IXBA 1NXYA 3LUQA 4IHQA 1DP6A 5E2GA 3K3CA 4EUVA 4UA9A 1W63M 4ZRRA 4K0WA 4IUKA 1XFQA 3F1OB 2O99A 3Q81A 1LI9A 4EEPA 4JLFA 4KZAA 5HAIA 1ES3A 1K54C 4X55A 3IX3A 1AXBA 1ODVA 4G3WA 3V67A 3PHYA 5LBRA 4F3LA 4MN6A 1IKIA 4ZJ3A 3KSIA 1RGZA 1ESUA 2FFFB 2GNXA 4Y7PA 3ZCZA 1LL9A 2PYPA 3QNBA 5F69A 3ZYTA 3F1PB 1BSGA 5K5BA 4B4XA 5TJJA 4DXCA 1N9BA 3Q7VA 2QKPA 4C3QA 3H7WB 4BBTA 4LV2A 1PYYA 3LR5A 1MKIA 4ID4A 1K56A 4KZ7A 3DAVA 2L1MA 2XEPA 1K25A 2JN7A 3E2LA 2XLNA 2Y2LA 3ZVWA 4NEED 3L7HA 1K57C 3AGEA 2ZQ8A 4N1HA 2A49A 2XH9A 1N9OA 1SDNA 2V1ZA 2V0WA 1NLZA 4E3NA 4X53A 5IU1A 4GHIA 5A92A 4PM9A 1FSWA 1XA7A 2JBFA 3HLWA 2B02A 2HDUA 5HPFA 2EFUA 1CI9A 3OCNA 2A24A 2OSUA 2WUQA 4I3JA 5GLBA 1FR1A 1GCEA 3BM6A 5F68A 5HDCA 1IYOA 2J9OA 5HAQA 4E3LA 1OMEA 5HW3A 3B42A 1YAXA 1N4OA 2K31A 4OOLA 5DVAA 4MMNA 3MXSA 2CC1A 4F3LB 3N6IA 1KVMA 5FEFA 2VV8A 4II7A 5FI2A 3SW1A 2JC7A 2INWA 3HVFA 1RP5A 3IS2B 1XXMA 3MF0A 3DTKA 4OQHA 3T4SA 1CI8A 1KGEA 1C3BA 4KQRA 3TJZC 3LR0A 3RTYA 1F2KA 3HUOA 4HI4A 4MDZA 2V8CA 2W3FA 1L2SA 2A2LA 1SDEA 3QP2A 4KZ5A 5DF7A 4ZJ2A 3KSFA 1PWCA 4EV4A 3K3DA 2I72A 3HJKA 2JKFA 1IELA 1SZVA 4G3VA 5J4EA 3EWKA 2J3TD 1KVLA 5GHZA 3MR0A 5HDSA 4JGRA 1KE3A 1KE4A 4OKPA 3UMEA 1L0EA 2ZQDA 4QY5A 4DN0A 4GOGA 5FQ9A 1TS7A 5E2EA 2JHEA 5CERA 1K0KA 3EQVA 1XKZA 4KG2A 3FZCA 2B5RA 1H8MA 2O9AA 1OPXA 3WS4A 4XT2A 2XDMA 3W4PA 3AGDA 2Y2IA 1ZHHB 2ZC7A 4UQIM 2NUTC 3PBRA 3QP1A 2Y2QA 1I5QA 5JYOA 1ZC2A 2ZMVA 3NI9A 2AVXA 3PYPA 2W1RA 2XA7M 4GW9A 3DTIA 4RYEA 5A8BA 1MBLA 2JKTI 3MFXA 4Y17A 4WELA 3QP8A 2VEAA 1K57A 2P7JA 3A0VA 2QJ5A 2WK0A 1GHPA 2OWJA 2WKIA 3NIAA 1Y54A 3RJUA 3CAXA 5DJTA 4S2PA 1YLTA 3E4QA 3Q07A 4XUZA 2XFTA 1G6OA 3NCKA 2EWWA 5EECA 2EX9A 5HWTA 2X71A 2W3HA 3G35A 4OOMA 1YSQA 4R38A 1MPLA 3SOIA 4GD6A 3MKEA 3P7NA 4PPRA 2PR5A 4YNRA 2OV5A 4WN5A 3PBTA 3ZNTA 2Y2HA 3DWZA 2HJ9C 4DDSA 3LY4A 3A3IA 5J8XA 2DCFA 1I2WA 4WMCA 3VP3A 3WS2A 1PI5A 1FCNA 3CPTB 2PU4A 4B93A 1BLPA 4KUOA 2ACGA 1W5DA 4ZTKA 1GSXA 4GDNA 4LCLA 4NXEA 5F1GA 3VE3A 1XJ6A 2H28A 2IWCA 1A0KA 5G4ZA 1E25A 3MZDA 4E3JA 2XD1A 4NKPA 3UE3A 1F9IA 4FD8A 3OZHA 5HWVA 1STZA 2K2NA 4WL9A 4DE1A 3B33A 5IT5A 2ZOHA 5L10A 4NG2A 1F98A 4MNRA 4LENA 3JVVA 1GHIA 4QPRA 4S2IA 3IH9A 2VLGA 3BYDA 4EWFA 5EVIC 1S4SA 4R70A 5F1FA 1TD5A 4PMAA 4HIAA 1P9RA 3GDIA 4GS9B 2JKRI 1FQGA 5EM1A 2K7SA 3UDFA 5AJGA 3CHWP 1TS6A 5EVEA 4LV3A 1YMSA 1ONHA 2V1AA 2GX5A 1WE4A 3FPVA 4O8GA 2GJ3A 4BQMA 4I3AA 4DE2A 2DMWA 2OLUA 3ZNYA 2PHYA 2R9WA 3VOZA 3PXPA 4H8RA 4LV1A 1PNEA 3UY6A 2L0WA 3PR6A 4C75A 3GQZA 3A3JA 4ZDXA 5E2FA 3IWQA 5F6AA 4P85A 4HOIA 5IHVA 2Z2LB 5FATA 3OCLA 1CF0A 3LIEA 1T1BA 1KDSA 1Q2QA 3Q1FA 4GZBA 1V9YA 2OWHA 3KSGA 1BLCA 3RH8B 4HESA 1TDGA 3E98A 1P97A 3LEZA 4GKUA 3KX0X 3TW8A 1XA1A 4FTXA 5AVFA 3N8SA 1CEGA 3MZEA 4Y3IA 1YM1A 1HVBA 2W1TB 1P9WA 3W4QA 4L9FA 2O0YA 5CX7A 2HDSA 3BECA 5M18A 4E3IA 4O7DA 1O07A 5EV0A 5HPIA 3QP6A 5FDHA 4HNBA 3S7NA 1WYCA 4U3TA 4P6ZM 1XJ4A 3LICA 2BASA 5J3WA 1OT6A 3S4XA 4UAAA 2NUPC 3VP0A 4S2MA 2Y2PA 1HD8A 2WGWB 4C6YA 5IS1A 4BWIA 1BLHA 1GHMA 3OPHA 3SH8A 1QMEA 3Q7ZA 4OONA 2Y8HA 1DP8A 3Q82A 1YLPA 3WRTA 1FSYA 1MKMA 2Y2GA 3FKVA 2P9VA 3G30A 4WM9A 1N9LA 1ES2A 4U0XA 5EOEA 4X68A 3MS6A 1MWSA 4JKTA 5KSCA 4Q0HA 1MY8A 5TGFA 4OQ0A 1BTLA 3V39A
chains in the Genus database with same CATH topology
2KLIA 4ARZB 3F1NA 4NEED 1P0ZA 4R6LA 1S1YA 3T4LA 3CLOA 4HY8A 1N9OA 3IBRA 1NLYA 3MQOA 2P08A 2V0WA 4WUJA 2I9VA 3C38A 3H82B 1TF1A 3CITA 1NLZA 1EW0A 3S7OA 1D7EA 2LB9A 5IU1A 2PYRA 4GHIA 4AFIA 2HGVA 4EQ1A 5DKKA 2VGLM 2XA7S 2B02A 2V9AA 3FPWA 5HPFA 3PBOA 4BBUA 1DP9A 1MZUA 3NJAA 3T4TA 3UB8A 2YKHA 2W1TA 3OCNA 3S7QA 2A24A 1GSWA 1S1ZA 5TBMA 4I3JA 4ME4A 4L9EA 5F68A 5HDCA 2OAP1 2XSSA 4EERA 1XJ2A 3BY9A 4FSFA 4CQHA 1UWPX 3BQ8A 3OBFA 3CI6A 3B42A 1YAXA 1S66L 4HHDA 4O01A 1XFNA 2K31A 4OOLA 5HL6A 3TE8A 4EXOA 4EW7A 3HJIA 4MMNA 4HJ3A 2HV1A 4F3LB 3SW1A 2VV8A 3EGDC 4II7A 2INWA 3IS2B 3UB9A 1VHMA 2MJ6A 3MF0A 3T4SA 4JGOA 3T4OA 4EETB 4O0PA 2QHKA 3TJZC 3LR0A 3OLOA 5HWWA 3RTYA 2PT7A 4HI4A 4MDZA 2W3FA 2A2LA 1T1AA 2QJ7A 4GCZA 3KSFA 1OJ5A 2J3WA 3P01A 3NOUC 3ULFA 5HZHA 2OAQ1 3K3DA 5KSHA 3HJKA 5J4EA 4G3VA 3BY8A 4HJ6A 3PBSA 3EWKA 3OOVA 2J3TD 4GS9A 4NXBA 3MR0A 3VE4A 3H9WA 5HDSA 3MQQA 4HJ4A 4NXFA 5HD3A 2JKTM 4JGRA 4PAUA 4GLQA 2VZWA 4PHTA 3UMEA 5DJUA 2D02A 4DN0A 2KOIA 1TS7A 3F1OA 2JHEA 4L9GA 4UEYA 4WEKA 4EU0A 2GZAA 4BJPA 4EEUA 1OTBA 1YKDA 5DF9A 1T19A 3EQVA 3NOPC 2LB5A 4BBVA 4PKYA 2FZ0A 1H8MA 2O9AA 2Z6CA 3MQ0A 1OPXA 4Q0IA 2VV6A 3R4KA 4XT2A 2ZBBA 3E0YA 4CLCE 2CMNA 5FL3A 1T1CA 1ZHHB 4UQIM 3KYQA 2NUTC 3PBRA 3IBJA 4I38A 1OTAA 2VA0A 2ZMVA 2M1CA 3PYPA 1OTDA 1IOUA 4RQ9A 4K08A 1JNUA 3UB6A 2W1RA 1YSPA 3G6OA 2XA7M 2O9CA 4GW9A 1LSXA 5A8BA 3UMDA 3C2WA 2JKTI 3EOIA 3MFXA 4WELA 3A0RA 2VEAA 2P7JA 4HH2A 4KQDA 4P6ZS 3A0VA 3B47A 2QJ5A 3EQUA 3LR3A 4NXGA 1GSVA 2OWJA 3CAXA 2ZMFA 3FG8A 5DJTA 2WKPA 3EEHA 2VGLS 3E4QA 1W63Q 3LIAA 1XJ3A 3CUEC 1G6OA 2EWWA 5HWTA 1MC0A 4OOMA 2J80A 2W3HA 1YSQA 4R38A 3T4QA 4LPZA 3CUEA 4R3AA 4WF0A 3R7WA 4GJ4A 2XROA 2KX6A 4IUHA 3P7NA 2PR5A 1TS8A 4YNRA 4Q0JA 1Y28A 4WN5A 3H7WA 2R78A 4LRXC 3PBTA 2HJ9C 1V9ZA 4CLCC 4CLCB 1N9NA 1OJGA 1OTIA 4JGPA 3TRCA 1IFQA 3D3OA 3A0SA 4Y2FA 4B93A 4LRYC 4KUOA 2JKRM 1DRMA 2A24B 1GSXA 4NXEA 2FH5A 3RFBA 3VE3A 1XJ6A 4CLCD 3D72A 2H28A 4BMWA 5TBMB 3F1PA 3LR4A 3JVUA 4ARZA 3K2NA 5G4ZA 4I39A 3E4PA 4DMZA 2W0NA 3T4KA 4MCWA 2ZOIA 3BJNA 4NKPA 3UE3A 3T4JA 4GHIB 4WEJA 1F9IA 3C8CA 2WKRA 3VV4A 3OC2A 3BWLA 5HWVA 1NRJA 1STZA 2K2NA 4WL9A 3B33A 4B9OA 5IT5A 3IS2A 5G4YA 2ZOHA 5HSQA 1F98A 3JVVA 5DFYA 4Z1WA 4QPRA 2VLGA 2HF6A 3U2AA 1S4SA 4I5SA 4R70A 2VJWA 4YOFA 1F5MA 1TD5A 2PDRA 4HIAA 1P9RA 1VB6A 3GDIA 4GS9B 4MN5A 2JKRI 2EA9A 3PBNA 4IJGA 2K7SA 5AJGA 3UB7A 2M7UA 3DBAA 1TS6A 3KSHA 4DJ3A 4DJ2A 2V1AA 3MXQA 5MC7A 1S4RA 2GX5A 2OOLA 3FPVA 3C30A 3MJQA 4O8GA 2GJ3A 4H6JB 4HP9A 4I3AA 3LIBA 2DMWA 3MMHA 2PHYA 1TS0A 3EGXC 2V0UA 3NHQA 2WKQA 3ICYA 3H82A 3PXPA 2KDKA 1G28A 3UE6A 2L0WA 2YKFA 3PR6A 3LIDA 1LSWA 2PR6A 5F5YA 4WLAA 2J3TC 2PD8A 2G7UA 5F6AA 2IA2A 1S67L 1OT9A 3T50A 4HOIA 2QWSA 4HH3A 3OCLA 2M7VA 4YWZA 3LIEA 1T1BA 1V9YA 2OWHA 2W3DA 3KSGA 3KO6A 3S7PA 2W27A 4MN7A 3F1NB 3RH8B 3O5YA 5L8MA 1OTEA 1T18A 3LFVA 2Y79A 4KUKA 3E98A 1P97A 2P04A 1ZTUA 3PBQA 3HCYA 3KX0X 4FOFA 2QYBA 3TW8A 4E04A 3BW6A 2W3GA 3E4OA 1X0OA 3FC7A 1H3QA 4KQOA 5AVFA 1KOUA 4G3KA 5HD5A 3LUQA 4EESA 3LYXA 2XRNA 4IHQA 1DP6A 4Y3IA 3ZQ5A 3K3CA 2EWVA 1NWZA 4EUVA 2W1TB 5KIZA 1P9WA 3LIFA 4L9FA 2O0YA 5CX7A 1W63M 4CLCA 1UWNX 3BQAA 4ZRRA 4IUKA 1XFQA 1LL8A 2O99A 3F1OB 2D01A 4M4XA 4UQIS 4EEPA 4HQAA 5HPIA 4ETXA 5DKLA 1WA9A 2W3EA 2V1BA 2VV7A 1BYWA 1ODVA 4G3WA 5HDDA 3VOLA 4HNBA 3S7NA 3V67A 3CWFA 4P6ZM 1XJ4A 3EEAA 3LICA 3PHYA 4XT2B 2HJEA 4HP4A 2BASA 5LBRA 4F3LA 5J3WA 1OT6A 4MN6A 1LSVA 2NUPC 3KSIA 1LT0A 2L4RA 5C5KA 3KYZA 5IS1A 4PKYG 4L0LA 2GNXA 5J7EA 2PYPA 4LLOB 4BWIA 3R7WB 5EFWA 4Y5FA 5F69A 3GECA 2O9BA 4H6JA 3ZYTA 3F1PB 5K5BA 4LRZE 5DFXA 2Y8HA 1UGUA 1DP8A 2VKSA 1D06A 4I3IA 5TJJA 4ETZA 2QKPA 1MKMA 3H7WB 4BBTA 3LR5A 1N9LA 2VX8A 3LI8A 3LI9A 2B18A 2PD7A 2L1MA 4Q0HA 3NOTC 3W2ZA 2JN7A 5I5LA 2Z6DA 4JGQA 5AVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  4KUK A;  3D72 A;  1P97 A;  2H28 A;  5TBM B;  3F1N A;  4EEU A;  1OTB A;  3F1P A;  1P0Z A;  4R6L A;  1T19 A;  5G4Z A;  3NOP C;  1S1Y A;  4I39 A;  3CLO A;  3E4P A;  3KX0 X;  4HY8 A;  4PKY A;  4BBV A;  1N9O A;  2W0N A;  4E04 A;  2ZOI A;  2Z6C A;  3IBR A;  4WUJ A;  3MQO A;  2V0W A;  3E4O A;  2I9V A;  4GHI B;  1X0O A;  2VV6 A;  3H82 B;  3FC7 A;  1F9I A;  4XT2 A;  1EW0 A;  1D7E A;  3C8C A;  5AVF A;  1KOU A;  5IU1 A;  2PYR A;  2ZBB A;  4GHI A;  5HD5 A;  3LUQ A;  2WKR A;  3LYX A;  2CMN A;  4EES A;  3BWL A;  1DP6 A;  1T1C A;  5DKK A;  3ZQ5 A;  3K3C A;  4EQ1 A;  5HWV A;  4WL9 A;  2B02 A;  1NWZ A;  2V9A A;  5KIZ A;  3B33 A;  4B9O A;  4I38 A;  4BBU A;  3LIF A;  3IS2 A;  5G4Y A;  2ZOH A;  5HSQ A;  1DP9 A;  1OTA A;  4L9F A;  1MZU A;  3NJA A;  3UB8 A;  2M1C A;  2YKH A;  1UWN X;  3PYP A;  1OTD A;  1F98 A;  4RQ9 A;  2A24 A;  4K08 A;  1XFQ A;  1LL8 A;  3F1O B;  1JNU A;  1GSW A;  2D01 A;  4M4X A;  3UB6 A;  1S1Z A;  2VLG A;  3G6O A;  5TBM A;  4EEP A;  4HQA A;  4GW9 A;  4I3J A;  1LSX A;  5A8B A;  5DKL A;  4L9E A;  3UMD A;  3C2W A;  5F68 A;  1WA9 A;  5HDC A;  3MFX A;  2V1B A;  2VV7 A;  1BYW A;  1ODV A;  1S4S A;  5HDD A;  3VOL A;  4HNB A;  3A0R A;  2VEA A;  1XJ2 A;  3BY9 A;  4I5S A;  4R70 A;  3CWF A;  4EER A;  1UWP X;  1XJ4 A;  3LIC A;  3PHY A;  2PDR A;  4HIA A;  4XT2 B;  2P7J A;  4HH2 A;  4HP4 A;  4KQD A;  2BAS A;  1VB6 A;  3A0V A;  1S66 L;  3GDI A;  4F3L A;  5J3W A;  4GS9 B;  2QJ5 A;  4MN5 A;  1OT6 A;  4MN6 A;  2EA9 A;  4HHD A;  1XFN A;  1LSV A;  4EXO A;  4NXG A;  2K7S A;  4EW7 A;  1GSV A;  2OWJ A;  3HJI A;  4HJ3 A;  3UB7 A;  2HV1 A;  1TS6 A;  4F3L B;  1LT0 A;  2L4R A;  3CAX A;  3FG8 A;  5DJT A;  2WKP A;  2VV8 A;  4DJ3 A;  3SW1 A;  3EEH A;  4DJ2 A;  3E4Q A;  2INW A;  3IS2 B;  3LIA A;  2V1A A;  3MXQ A;  1XJ3 A;  3UB9 A;  1S4R A;  4PKY G;  5IS1 A;  2OOL A;  3MJQ A;  4JGO A;  2GJ3 A;  4EET B;  5J7E A;  4H6J B;  4HP9 A;  2QHK A;  4I3A A;  5HWT A;  2PYP A;  3LIB A;  3OLO A;  3RTY A;  5HWW A;  2J80 A;  4LLO B;  4HI4 A;  2PHY A;  1TS0 A;  4R38 A;  4LPZ A;  5EFW A;  5AVE A;  2V0U A;  3NHQ A;  5F69 A;  3GEC A;  2WKQ A;  1T1A A;  4H6J A;  3ICY A;  3H82 A;  2QJ7 A;  3F1P B;  2KDK A;  4R3A A;  1G28 A;  4GCZ A;  4WF0 A;  3UE6 A;  2KX6 A;  2L0W A;  2YKF A;  3P7N A;  4LRZ E;  1UGU A;  1DP8 A;  1TS8 A;  1D06 A;  1OJ5 A;  1LSW A;  2PR5 A;  1Y28 A;  2PR6 A;  3H7W A;  3LID A;  4I3I A;  4WN5 A;  4WLA A;  3NOU C;  5F5Y A;  3ULF A;  5HZH A;  2R78 A;  3K3D A;  4LRX C;  2QKP A;  3HJK A;  5J4E A;  3H7W B;  2PD8 A;  3BY8 A;  4HJ6 A;  4BBT A;  1V9Z A;  5F6A A;  3EWK A;  1S67 L;  4GS9 A;  4NXB A;  1N9L A;  1N9N A;  3LI8 A;  3LI9 A;  1OT9 A;  3MR0 A;  1OJG A;  3H9W A;  5HDS A;  3T50 A;  3VE4 A;  3MQQ A;  1OTI A;  4HJ4 A;  2QWS A;  4HH3 A;  4HOI A;  4JGP A;  4NXF A;  5HD3 A;  3VE3 A;  4JGR A;  4YWZ A;  2PD7 A;  3A0S A;  3LIE A;  1T1B A;  3UME A;  5DJU A;  1V9Y A;  2OWH A;  2D02 A;  2L1M A;  4LRY C;  4KUO A;  1DRM A;  3NOT C;  2W27 A;  2JN7 A;  3F1N B;  5I5L A;  3RH8 B;  2A24 B;  1GSX A;  2Z6D A;  4JGQ A;  1OTE A;  1TS7 A;  3F1O A;  4NXE A;  2JHE A;  1T18 A;  4L9G A; 
#chains in the Genus database with same CATH topology
 3F1N A;  4R3B A;  3VOY A;  1P0Z A;  4KZ9 A;  3T4L A;  2ZQA A;  1KGG A;  3G31 A;  4KZB A;  4Y0T A;  2WYX A;  3CIT A;  4OPZ A;  2QPN A;  3IHB A;  1GA9 A;  4WZ4 A;  4AFI A;  1PIO A;  5DKK A;  3N8L A;  3FPW A;  3MSH A;  5CTM A;  4BBU A;  3T4T A;  1LHY A;  3UB8 A;  2W1T A;  5JYP A;  1CEF A;  1AWI A;  3IF6 B;  3FKW A;  1ZG4 A;  2OAP 1;  3B3X A;  4EER A;  4FSF A;  4CQH A;  1UWP X;  3BQ8 A;  3ZG9 B;  3CI6 A;  4O01 A;  5AQA A;  1XFN A;  4EXO A;  4EW7 A;  3HJI A;  4HJ3 A;  3UE1 A;  5CGX A;  2HV1 A;  2WAE A;  3EGD C;  1H8Y A;  3IXG A;  4FH4 A;  1VHM A;  4F94 A;  4DF6 A;  3CJM A;  3OLO A;  1QMF A;  1ALQ A;  1G5U A;  4KZ4 A;  2QJ7 A;  1BUE A;  2ZC6 B;  3P98 A;  5I94 A;  1OJ5 A;  1YLY A;  2OAQ 1;  5KSH A;  5E43 A;  3BY8 A;  4HJ6 A;  4GS9 A;  4HJ4 A;  4NXF A;  4GLQ A;  2VZW A;  1YMX A;  3MZF A;  2XGN A;  2KOI A;  1PZO A;  2ZJ9 A;  4L9G A;  4UEY A;  5FQK A;  1K38 A;  2X01 A;  3PAG A;  1OTB A;  2HP9 A;  1T19 A;  4KQQ A;  3IXH A;  2LB5 A;  2ZC5 B;  2Z6C A;  4S2L A;  3D4F A;  4Q0I A;  5M19 A;  2VV6 A;  2DNS A;  1W7F A;  2ZQ9 A;  5CHU A;  3CG5 A;  4DKI A;  2HDR A;  1XP4 A;  5FL3 A;  1T1C A;  3N4I A;  4Y0O A;  2UWX A;  4Y13 A;  1S6R A;  1JNU A;  1TEM A;  3HLG A;  3NUL A;  3UMD A;  3C2W A;  1ESI A;  1ACF A;  3A0R A;  4KQD A;  3ZG8 B;  3G32 A;  3EQU A;  3SS4 A;  4NXG A;  1GSV A;  2Y55 A;  2WKP A;  3ITA A;  3LIA A;  1JTG A;  2EX2 A;  1KE0 A;  2ZL1 B;  1MC0 A;  3T4Q A;  4FUW A;  2H0Y A;  1VET B;  1YT4 A;  2KX6 A;  1LI0 A;  4OLD A;  1TS8 A;  1PW1 A;  3ZGA B;  2Y2J A;  5AQ7 A;  4D60 A;  1N9N A;  3DTE A;  4FCF A;  1IFQ A;  2Q0O A;  4LCM A;  2EX6 A;  1JTD A;  3SH9 A;  2PAV P;  2ZD8 A;  2FH5 A;  4ESP A;  4R4R A;  3O86 A;  1K56 D;  4ARZ A;  3K2N A;  4I39 A;  5DF8 A;  2WGV A;  3HUN A;  4MCW A;  4DDY A;  3T4J A;  2J7V A;  3SH7 A;  2WGW A;  4S2O A;  1YQS A;  3MBZ A;  2WKR A;  4GDB A;  1RCJ A;  2HP5 A;  3BRM A;  4B9O A;  3IS2 A;  2V8F A;  3GVB A;  4GN2 A;  4Z1W A;  1D1J A;  4P0M A;  3V5M A;  3DTM A;  1TDL A;  3VP1 A;  1NYM A;  4R23 A;  4JF6 A;  1L0F A;  3G34 A;  2EFX A;  1PWD A;  3RXW A;  3T12 B;  3UB7 A;  2Y2K A;  3NDE A;  3DBA A;  4A5R A;  3ZG5 A;  4DJ3 A;  4DJ2 A;  1ZG6 A;  2G2W A;  5MC7 A;  4MEZ A;  2J9P A;  3MXQ A;  4DRT A;  3HUM A;  1YLJ A;  2OOL A;  3MJQ A;  4H6J B;  5GLD A;  3S1Y A;  2VK3 A;  4UHU A;  1TS0 A;  1WYB A;  3EGX C;  5U47 A;  2V2F F;  3H82 A;  4B4Z A;  4E6W A;  3D9Y A;  3VFF A;  1LSW A;  5F5Y A;  4ZAM A;  2J3T C;  2G7U A;  2IA2 A;  4GNU A;  2BTF P;  1OT9 A;  5EM0 A;  3T50 A;  2QWS A;  1JWZ A;  2M7V A;  3A3F A;  3LGO A;  3IF6 A;  5HL1 A;  3S7P A;  2W27 A;  4MN7 A;  3O5Y A;  1IYQ A;  1OTE A;  3KYE A;  5L07 A;  2PU2 A;  4BD0 A;  2P04 A;  2V20 A;  4KG5 A;  4OP5 A;  4JXW A;  1MWR A;  1Z6F A;  3BW6 A;  2W3G A;  3FC7 A;  4KQO A;  2Q9N A;  4PM8 A;  5FQM A;  2Y91 A;  1JWP A;  5HD5 A;  2XRN A;  4S2K A;  2EWV A;  1NWZ A;  5KIZ A;  3BLM A;  4P6B A;  2D01 A;  4M4X A;  4UQI S;  3P09 A;  5AQ9 A;  1K55 C;  4JF5 A;  5DKL A;  1WA9 A;  2W3E A;  1NZU A;  2VV7 A;  5HDD A;  3VOL A;  3TG9 A;  2JCH A;  4JXG A;  1ZKJ A;  5DTS A;  1LSV A;  2Y2O A;  5A93 A;  4R1G A;  1LT0 A;  2L4R A;  3C7U A;  3KYZ A;  4PKY G;  4MLL A;  1LLB A;  3FYZ A;  5J7E A;  5FDS A;  4R4S A;  1L0G A;  4EBN A;  3RXX A;  2P74 A;  3O3V A;  3DWK A;  2ZL1 A;  4Y5F A;  4H6J A;  2H5S A;  3LO7 A;  4LRZ E;  5DFX A;  1UGU A;  3OPR A;  2VKS A;  1D06 A;  4I3I A;  4ETZ A;  3ZG7 B;  5AQB A;  5KMW A;  3A3D A;  2ZQ7 A;  4YIN A;  3BLS A;  2VX8 A;  3LI8 A;  3LI9 A;  4DE0 A;  3O88 A;  3CPT A;  2HP6 A;  2BG1 A;  3WS0 A;  2PD7 A;  3PAE A;  1IEM A;  3M2J A;  5CHJ A;  1U60 A;  3NOT C;  4JXS A;  3W2Z A;  1IKG A;  4JGQ A;  4RVA A;  2KLI A;  4DXB A;  4WBG A;  1CQA A;  2GDN A;  3C5A A;  4S2N A;  4R6L A;  1I2S A;  1S1Y A;  5BOH A;  1J3W A;  1CK3 A;  3OPP A;  3MQO A;  3M2K A;  2I9V A;  1EW0 A;  1EWZ A;  2IWD A;  2LB9 A;  2PYR A;  3MKF A;  4MBK A;  5FAQ A;  3WWX A;  2HGV A;  2VGL M;  2XA7 S;  1VEU B;  1BZA A;  3PBO A;  4WZ5 C;  1DP9 A;  1MZU A;  2XK1 A;  3S7Q A;  2HDQ A;  4IBR A;  2XFS A;  1J9M A;  3HBR A;  3ZG0 A;  1S1Z A;  2ZLY A;  2ZMA A;  3CZD A;  4ZJ1 A;  5TBM A;  2QMI A;  3G4P A;  4KZ3 A;  4L9E A;  4EBL A;  2XSS A;  1PW8 A;  1XJ2 A;  3BY9 A;  1E3U D;  2XR0 A;  1S66 L;  4X6T A;  3BFF A;  4HHD A;  4E3K A;  3TOI A;  1L0D A;  1DY6 A;  3UB5 P;  3UB9 A;  5L09 A;  4O0P A;  2PT7 A;  1K6R A;  3C4O A;  1T1A A;  1MXO A;  2RL3 A;  4GCZ A;  3W8K A;  2Z2M B;  3BFC A;  2WZZ A;  3P01 A;  4N9L A;  3NOU C;  3ULF A;  3PBS A;  3OOV A;  1K4E A;  3VE4 A;  5HD3 A;  2JKT M;  3NY4 A;  4Z9Q A;  4PHT A;  5DJU A;  3UO9 A;  4EU0 A;  2GZA A;  4BJP A;  5F82 A;  3ZVT A;  2ZBB A;  1H8Z A;  4CLC E;  3WS5 A;  1NZO A;  2CMN A;  2RCX A;  3KYQ A;  3IBJ A;  5GL9 A;  4I38 A;  2VA0 A;  2M1C A;  3MXR A;  1IOU A;  4K08 A;  3IX4 A;  4Q8I A;  1YSP A;  3G6O A;  3T1Q B;  1FIL A;  3EOI A;  4UA6 A;  1VM1 A;  3V3R A;  4JBF A;  5HFO A;  4HH2 A;  3V3S A;  4P6Z S;  1W8Q A;  4S2N C;  3B47 A;  5HX9 A;  3LR3 A;  3L9K A;  2HPB A;  1NY0 A;  4U0T A;  2XD5 A;  3C7V A;  5A90 A;  5CTN A;  1W63 Q;  3A3E A;  1Y4O A;  3C4P A;  1NJ4 A;  4XXR A;  3T1R A;  1LL5 A;  2J80 A;  4KZ6 A;  5G18 A;  4LPZ A;  3QP5 A;  4IVK A;  2WAF A;  4R3A A;  4WF0 A;  2ZQC A;  1SKO A;  3BFG A;  1K6S A;  4R0Q A;  4Q0J A;  2ZC3 B;  1Y28 A;  2PBD P;  4LRX C;  4N9K A;  3Q7V B;  5GHY A;  2WAD A;  4CLC C;  2BLS A;  1OJG A;  1OTI A;  1TVF A;  5GLA A;  4RX3 A;  4JGP A;  3IF6 C;  3A0S A;  4MBH A;  1K55 A;  1G6A A;  4LRY C;  1ERO A;  2JKR M;  1DRM A;  2QZ6 A;  3BFE A;  4IVI A;  3W4O A;  3TSG A;  3F1P A;  4XUX A;  3JVU A;  4IED A;  4BL2 A;  1DJA A;  1FCM A;  2W0N A;  2ZOI A;  3BJN A;  4E6X A;  2JKG A;  3C8C A;  1XX2 A;  2Q9M A;  3OC2 A;  1NRJ A;  4PM7 A;  5EVL A;  3HLD A;  4WMC D;  4X56 A;  2EXA A;  5HSQ A;  1CJF A;  4HEF A;  4BEN A;  3VMA A;  5CGS A;  3IQA A;  2C6W B;  3FV7 A;  5DFY A;  3UPO A;  2VGK A;  1YLZ A;  1FR6 A;  2HF6 A;  1ES4 A;  4YOF A;  2PDR A;  3GSG A;  1O7E A;  3ISG A;  4IJG A;  2M7U A;  4LV0 A;  5E2H A;  4N92 A;  1EI5 A;  4EBP A;  3HRE A;  4EQI A;  1S4R A;  3ZHH A;  5A91 A;  4NK3 A;  3GTC A;  5EPH A;  2OLV A;  3MMH A;  5CRF A;  2V0U A;  1PWG A;  4MBF A;  2KDK A;  4OQI A;  1G28 A;  3UE6 A;  1G68 A;  2YKF A;  1IYP A;  3LID A;  2PR6 A;  2PD8 A;  1HZO A;  3FWL A;  2X02 A;  3LCE A;  2XF3 A;  4JXV A;  1K54 A;  4HH3 A;  3QHY A;  4YWZ A;  3GRJ A;  2W3D A;  5GLC A;  4RA7 A;  3F1N B;  5FQQ A;  3JPU A;  3HLC A;  1YPR A;  1T18 A;  3HLB A;  3LFV A;  1L3L A;  1M6K A;  4KUK A;  4KZ8 A;  4KG6 A;  4UA7 A;  4FOF A;  2QYB A;  4E04 A;  2H0T A;  3E4O A;  1M40 A;  1DJB A;  1MWT A;  3N8R A;  1X0O A;  3N7W A;  4X1L A;  1MWU A;  3IHA A;  1JVJ A;  4KEN B;  4JPM A;  4HBT A;  4QJG A;  4Y0U A;  4EES A;  3LYX A;  3V50 A;  3ZQ5 A;  5HAP A;  3LIF A;  4CLC A;  1UWN X;  1PRQ A;  3BQA A;  4OP8 A;  1E4D A;  1H5X A;  1LL8 A;  5M1A A;  4HQA A;  3ITB A;  1VET A;  4ETX A;  3NDG A;  2V1B A;  4FH2 A;  1BYW A;  4BLM A;  3CWF A;  1ERM A;  4OPQ A;  5FSR A;  3EEA A;  3MFD A;  4XT2 B;  2HJE A;  5FQJ A;  4HP4 A;  3UDI A;  1W79 A;  5CEC A;  3OPL A;  4RX2 A;  3IT9 A;  2ZM8 A;  5C5K A;  5CEB A;  4L0L A;  4OQG A;  4LLO B;  3R7W B;  3PTE A;  1SHV A;  5EFW A;  3GEC A;  2O9B A;  1H0M A;  1HTZ A;  3VP4 A;  1BT5 A;  1FOF A;  4QU3 A;  5EOO A;  4ZBE A;  1K4F A;  2E8J A;  2UV0 E;  3O87 A;  2B18 A;  3VFH A;  1KDW A;  2A3U A;  3UPP A;  4LGW A;  5D3O A;  5I5L A;  2Z6D A;  4OOY A;  5AVE A;  4ARZ B;  2E8I A;  4X25 A;  3CLO A;  4HY8 A;  4QHC A;  3VSK A;  3ZFZ A;  3IBR A;  1NLY A;  3IX8 A;  2P08 A;  4WUJ A;  3GR2 A;  3C38 A;  3H82 B;  1TF1 A;  3S7O A;  1D7E A;  3NC8 A;  1ONG A;  4YFM A;  4IBX A;  2PRF A;  4WYY A;  1XGI A;  3NEC A;  4EQ1 A;  5CGW A;  2V9A A;  1PZP A;  1Z09 A;  3NJA A;  2YKH A;  4M3K A;  3IWO A;  1GSW A;  3UDX A;  4ME4 A;  4PM6 A;  2WGI A;  4N1X A;  2J8Y A;  3OBF A;  2HZ5 A;  3TE8 A;  5HL6 A;  4B88 A;  2WKE A;  4D2O A;  1ES5 A;  4P87 A;  2MJ6 A;  3SZT A;  2PBY A;  4JGO A;  3T4O A;  4DE3 A;  4EET B;  2QHK A;  3LEQ A;  4Y15 A;  5HWW A;  4GB7 A;  3WS1 A;  4OH0 A;  3JYI A;  4CPK A;  2VGJ A;  1PFL A;  2J3W A;  4X1M A;  5HZH A;  4QB8 A;  3M6H A;  4OVD A;  1DJC A;  4NXB A;  3H9W A;  3MQQ A;  2EX8 A;  3VP2 A;  5EVI B;  4PAU A;  5FAP A;  3HLF A;  2DRW A;  2D02 A;  3U4L P;  1BUL A;  3CMZ A;  5TFQ A;  3F1O A;  3ZDJ A;  4WEK A;  2XQZ A;  4EEU A;  1YKD A;  5DF9 A;  3IF5 A;  3NOP C;  4BBV A;  4PKY A;  2FZ0 A;  3MQ0 A;  5GHX A;  1ERQ A;  3R4K A;  5DTK A;  4QWO A;  5CED A;  3E0Y A;  4JF4 A;  1XGJ A;  4R3J A;  1OTA A;  1OTD A;  4OPY A;  4RQ9 A;  2R9X A;  5KZH A;  3UB6 A;  5FQI A;  3AGF A;  1VQQ A;  1NYY A;  2O9C A;  1LSX A;  1FIK A;  3DW0 A;  1NRF A;  1PI4 A;  3G2Z A;  1HLU P;  1FCO A;  4E3M A;  3FG8 A;  2ZMF A;  5FI6 A;  3EEH A;  4LFU A;  2VGL S;  4EUZ A;  1XJ3 A;  3CUE C;  3UE0 A;  4OPR A;  1KGF A;  1VEU A;  4QY6 A;  2Y2M A;  3CUE A;  3R7W A;  4GJ4 A;  2XRO A;  4IUH A;  2G2U A;  3H7W A;  2R78 A;  2FFY A;  3BEB A;  5FEG A;  3SS3 A;  1V9Z A;  4CLC B;  5CXW A;  1BLS A;  1RGY A;  1SKF A;  3TRC A;  2IWB A;  1XPB A;  3D3O A;  4Y2F A;  5FAO A;  2A24 B;  3RFB A;  4CLC D;  3D72 A;  4BMW A;  5TBM B;  3HL9 A;  1W8Y A;  3LR4 A;  4NET A;  5DTT A;  3IH8 A;  1SCW A;  3E4P A;  4DMZ A;  3T4K A;  1GA0 A;  5TR7 A;  5FA7 A;  4K0X A;  2EXB A;  4GHI B;  4WEJ A;  3VSL A;  3HLE A;  2P9V B;  3GMW A;  4BD1 A;  2Y2N A;  3E2K A;  3VV4 A;  3BWL A;  4K91 A;  4HBU A;  5G4Y A;  3QP4 A;  2C5W B;  5L2F A;  3I7J A;  5F83 A;  3LY3 A;  3U2A A;  2ZC4 B;  4GD8 A;  3G2Y A;  2WZX A;  2Y59 A;  4I5S A;  2VJW A;  1F5M A;  1JWV A;  1VB6 A;  2H10 A;  4MN5 A;  2B95 A;  2EA9 A;  3WRZ A;  3PBN A;  4QD4 A;  3KSH A;  4OLG A;  1IYS A;  4E3O A;  3BFD A;  1S0W A;  3C30 A;  3NBL A;  4HP9 A;  3LIB A;  3NHQ A;  4S2J A;  2WKQ A;  3ICY A;  3QNC A;  3UPN A;  5EE8 A;  4X69 A;  4WLA A;  3IXD A;  3S22 A;  2Y4A A;  5CHM A;  2JE5 A;  4WZ5 A;  1S67 L;  3GV9 A;  4PM5 A;  5EVI A;  3IWI A;  3KO6 A;  5EVI D;  1YLW A;  5L8M A;  3UN7 A;  5FAS A;  3M6B A;  1E3U A;  4BL3 A;  2Y79 A;  2WKH A;  1ZTU A;  3T1S A;  3UNW A;  2ZM0 A;  2ZM2 A;  5EUA A;  3PBQ A;  3HCY A;  1Q2P A;  5HAR A;  5FI7 A;  1H3Q A;  3T1X A;  3SS5 A;  1SKO B;  1KOU A;  4CJN A;  4G3K A;  3IXB A;  1NXY A;  3LUQ A;  4IHQ A;  1DP6 A;  5E2G A;  3K3C A;  4EUV A;  4UA9 A;  1W63 M;  4ZRR A;  4K0W A;  4IUK A;  1XFQ A;  3F1O B;  2O99 A;  3Q81 A;  1LI9 A;  4EEP A;  4JLF A;  4KZA A;  5HAI A;  1ES3 A;  1K54 C;  4X55 A;  3IX3 A;  1AXB A;  1ODV A;  4G3W A;  3V67 A;  3PHY A;  5LBR A;  4F3L A;  4MN6 A;  1IKI A;  4ZJ3 A;  3KSI A;  1RGZ A;  1ESU A;  2FFF B;  2GNX A;  4Y7P A;  3ZCZ A;  1LL9 A;  2PYP A;  3QNB A;  5F69 A;  3ZYT A;  3F1P B;  1BSG A;  5K5B A;  4B4X A;  5TJJ A;  4DXC A;  1N9B A;  3Q7V A;  2QKP A;  4C3Q A;  3H7W B;  4BBT A;  4LV2 A;  1PYY A;  3LR5 A;  1MKI A;  4ID4 A;  1K56 A;  4KZ7 A;  3DAV A;  2L1M A;  2XEP A;  1K25 A;  2JN7 A;  3E2L A;  2XLN A;  2Y2L A;  3ZVW A;  4NEE D;  3L7H A;  1K57 C;  3AGE A;  2ZQ8 A;  4N1H A;  2A49 A;  2XH9 A;  1N9O A;  1SDN A;  2V1Z A;  2V0W A;  1NLZ A;  4E3N A;  4X53 A;  5IU1 A;  4GHI A;  5A92 A;  4PM9 A;  1FSW A;  1XA7 A;  2JBF A;  3HLW A;  2B02 A;  2HDU A;  5HPF A;  2EFU A;  1CI9 A;  3OCN A;  2A24 A;  2OSU A;  2WUQ A;  4I3J A;  5GLB A;  1FR1 A;  1GCE A;  3BM6 A;  5F68 A;  5HDC A;  1IYO A;  2J9O A;  5HAQ A;  4E3L A;  1OME A;  5HW3 A;  3B42 A;  1YAX A;  1N4O A;  2K31 A;  4OOL A;  5DVA A;  4MMN A;  3MXS A;  2CC1 A;  4F3L B;  3N6I A;  1KVM A;  5FEF A;  2VV8 A;  4II7 A;  5FI2 A;  3SW1 A;  2JC7 A;  2INW A;  3HVF A;  1RP5 A;  3IS2 B;  1XXM A;  3MF0 A;  3DTK A;  4OQH A;  3T4S A;  1CI8 A;  1KGE A;  1C3B A;  4KQR A;  3TJZ C;  3LR0 A;  3RTY A;  1F2K A;  3HUO A;  4HI4 A;  4MDZ A;  2V8C A;  2W3F A;  1L2S A;  2A2L A;  1SDE A;  3QP2 A;  4KZ5 A;  5DF7 A;  4ZJ2 A;  3KSF A;  1PWC A;  4EV4 A;  3K3D A;  2I72 A;  3HJK A;  2JKF A;  1IEL A;  1SZV A;  4G3V A;  5J4E A;  3EWK A;  2J3T D;  1KVL A;  5GHZ A;  3MR0 A;  5HDS A;  4JGR A;  1KE3 A;  1KE4 A;  4OKP A;  3UME A;  1L0E A;  2ZQD A;  4QY5 A;  4DN0 A;  4GOG A;  5FQ9 A;  1TS7 A;  5E2E A;  2JHE A;  5CER A;  1K0K A;  3EQV A;  1XKZ A;  4KG2 A;  3FZC A;  2B5R A;  1H8M A;  2O9A A;  1OPX A;  3WS4 A;  4XT2 A;  2XDM A;  3W4P A;  3AGD A;  2Y2I A;  1ZHH B;  2ZC7 A;  4UQI M;  2NUT C;  3PBR A;  3QP1 A;  2Y2Q A;  1I5Q A;  5JYO A;  1ZC2 A;  2ZMV A;  3NI9 A;  2AVX A;  3PYP A;  2W1R A;  2XA7 M;  4GW9 A;  3DTI A;  4RYE A;  5A8B A;  1MBL A;  2JKT I;  3MFX A;  4Y17 A;  4WEL A;  3QP8 A;  2VEA A;  1K57 A;  2P7J A;  3A0V A;  2QJ5 A;  2WK0 A;  1GHP A;  2OWJ A;  2WKI A;  3NIA A;  1Y54 A;  3RJU A;  3CAX A;  5DJT A;  4S2P A;  1YLT A;  3E4Q A;  3Q07 A;  4XUZ A;  2XFT A;  1G6O A;  3NCK A;  2EWW A;  5EEC A;  2EX9 A;  5HWT A;  2X71 A;  2W3H A;  3G35 A;  4OOM A;  1YSQ A;  4R38 A;  1MPL A;  3SOI A;  4GD6 A;  3MKE A;  3P7N A;  4PPR A;  2PR5 A;  4YNR A;  2OV5 A;  4WN5 A;  3PBT A;  3ZNT A;  2Y2H A;  3DWZ A;  2HJ9 C;  4DDS A;  3LY4 A;  3A3I A;  5J8X A;  2DCF A;  1I2W A;  4WMC A;  3VP3 A;  3WS2 A;  1PI5 A;  1FCN A;  3CPT B;  2PU4 A;  4B93 A;  1BLP A;  4KUO A;  2ACG A;  1W5D A;  4ZTK A;  1GSX A;  4GDN A;  4LCL A;  4NXE A;  5F1G A;  3VE3 A;  1XJ6 A;  2H28 A;  2IWC A;  1A0K A;  5G4Z A;  1E25 A;  3MZD A;  4E3J A;  2XD1 A;  4NKP A;  3UE3 A;  1F9I A;  4FD8 A;  3OZH A;  5HWV A;  1STZ A;  2K2N A;  4WL9 A;  4DE1 A;  3B33 A;  5IT5 A;  2ZOH A;  5L10 A;  4NG2 A;  1F98 A;  4MNR A;  4LEN A;  3JVV A;  1GHI A;  4QPR A;  4S2I A;  3IH9 A;  2VLG A;  3BYD A;  4EWF A;  5EVI C;  1S4S A;  4R70 A;  5F1F A;  1TD5 A;  4PMA A;  4HIA A;  1P9R A;  3GDI A;  4GS9 B;  2JKR I;  1FQG A;  5EM1 A;  2K7S A;  3UDF A;  5AJG A;  3CHW P;  1TS6 A;  5EVE A;  4LV3 A;  1YMS A;  1ONH A;  2V1A A;  2GX5 A;  1WE4 A;  3FPV A;  4O8G A;  2GJ3 A;  4BQM A;  4I3A A;  4DE2 A;  2DMW A;  2OLU A;  3ZNY A;  2PHY A;  2R9W A;  3VOZ A;  3PXP A;  4H8R A;  4LV1 A;  1PNE A;  3UY6 A;  2L0W A;  3PR6 A;  4C75 A;  3GQZ A;  3A3J A;  4ZDX A;  5E2F A;  3IWQ A;  5F6A A;  4P85 A;  4HOI A;  5IHV A;  2Z2L B;  5FAT A;  3OCL A;  1CF0 A;  3LIE A;  1T1B A;  1KDS A;  1Q2Q A;  3Q1F A;  4GZB A;  1V9Y A;  2OWH A;  3KSG A;  1BLC A;  3RH8 B;  4HES A;  1TDG A;  3E98 A;  1P97 A;  3LEZ A;  4GKU A;  3KX0 X;  3TW8 A;  1XA1 A;  4FTX A;  5AVF A;  3N8S A;  1CEG A;  3MZE A;  4Y3I A;  1YM1 A;  1HVB A;  2W1T B;  1P9W A;  3W4Q A;  4L9F A;  2O0Y A;  5CX7 A;  2HDS A;  3BEC A;  5M18 A;  4E3I A;  4O7D A;  1O07 A;  5EV0 A;  5HPI A;  3QP6 A;  5FDH A;  4HNB A;  3S7N A;  1WYC A;  4U3T A;  4P6Z M;  1XJ4 A;  3LIC A;  2BAS A;  5J3W A;  1OT6 A;  3S4X A;  4UAA A;  2NUP C;  3VP0 A;  4S2M A;  2Y2P A;  1HD8 A;  2WGW B;  4C6Y A;  5IS1 A;  4BWI A;  1BLH A;  1GHM A;  3OPH A;  3SH8 A;  1QME A;  3Q7Z A;  4OON A;  2Y8H A;  1DP8 A;  3Q82 A;  1YLP A;  3WRT A;  1FSY A;  1MKM A;  2Y2G A;  3FKV A;  2P9V A;  3G30 A;  4WM9 A;  1N9L A;  1ES2 A;  4U0X A;  5EOE A;  4X68 A;  3MS6 A;  1MWS A;  4JKT A;  5KSC A;  4Q0H A;  1MY8 A;  5TGF A;  4OQ0 A;  1BTL A;  3V39 A; 
#chains in the Genus database with same CATH homology
 2KLI A;  4ARZ B;  3F1N A;  4NEE D;  1P0Z A;  4R6L A;  1S1Y A;  3T4L A;  3CLO A;  4HY8 A;  1N9O A;  3IBR A;  1NLY A;  3MQO A;  2P08 A;  2V0W A;  4WUJ A;  2I9V A;  3C38 A;  3H82 B;  1TF1 A;  3CIT A;  1NLZ A;  1EW0 A;  3S7O A;  1D7E A;  2LB9 A;  5IU1 A;  2PYR A;  4GHI A;  4AFI A;  2HGV A;  4EQ1 A;  5DKK A;  2VGL M;  2XA7 S;  2B02 A;  2V9A A;  3FPW A;  5HPF A;  3PBO A;  4BBU A;  1DP9 A;  1MZU A;  3NJA A;  3T4T A;  3UB8 A;  2YKH A;  2W1T A;  3OCN A;  3S7Q A;  2A24 A;  1GSW A;  1S1Z A;  5TBM A;  4I3J A;  4ME4 A;  4L9E A;  5F68 A;  5HDC A;  2OAP 1;  2XSS A;  4EER A;  1XJ2 A;  3BY9 A;  4FSF A;  4CQH A;  1UWP X;  3BQ8 A;  3OBF A;  3CI6 A;  3B42 A;  1YAX A;  1S66 L;  4HHD A;  4O01 A;  1XFN A;  2K31 A;  4OOL A;  5HL6 A;  3TE8 A;  4EXO A;  4EW7 A;  3HJI A;  4MMN A;  4HJ3 A;  2HV1 A;  4F3L B;  3SW1 A;  2VV8 A;  3EGD C;  4II7 A;  2INW A;  3IS2 B;  3UB9 A;  1VHM A;  2MJ6 A;  3MF0 A;  3T4S A;  4JGO A;  3T4O A;  4EET B;  4O0P A;  2QHK A;  3TJZ C;  3LR0 A;  3OLO A;  5HWW A;  3RTY A;  2PT7 A;  4HI4 A;  4MDZ A;  2W3F A;  2A2L A;  1T1A A;  2QJ7 A;  4GCZ A;  3KSF A;  1OJ5 A;  2J3W A;  3P01 A;  3NOU C;  3ULF A;  5HZH A;  2OAQ 1;  3K3D A;  5KSH A;  3HJK A;  5J4E A;  4G3V A;  3BY8 A;  4HJ6 A;  3PBS A;  3EWK A;  3OOV A;  2J3T D;  4GS9 A;  4NXB A;  3MR0 A;  3VE4 A;  3H9W A;  5HDS A;  3MQQ A;  4HJ4 A;  4NXF A;  5HD3 A;  2JKT M;  4JGR A;  4PAU A;  4GLQ A;  2VZW A;  4PHT A;  3UME A;  5DJU A;  2D02 A;  4DN0 A;  2KOI A;  1TS7 A;  3F1O A;  2JHE A;  4L9G A;  4UEY A;  4WEK A;  4EU0 A;  2GZA A;  4BJP A;  4EEU A;  1OTB A;  1YKD A;  5DF9 A;  1T19 A;  3EQV A;  3NOP C;  2LB5 A;  4BBV A;  4PKY A;  2FZ0 A;  1H8M A;  2O9A A;  2Z6C A;  3MQ0 A;  1OPX A;  4Q0I A;  2VV6 A;  3R4K A;  4XT2 A;  2ZBB A;  3E0Y A;  4CLC E;  2CMN A;  5FL3 A;  1T1C A;  1ZHH B;  4UQI M;  3KYQ A;  2NUT C;  3PBR A;  3IBJ A;  4I38 A;  1OTA A;  2VA0 A;  2ZMV A;  2M1C A;  3PYP A;  1OTD A;  1IOU A;  4RQ9 A;  4K08 A;  1JNU A;  3UB6 A;  2W1R A;  1YSP A;  3G6O A;  2XA7 M;  2O9C A;  4GW9 A;  1LSX A;  5A8B A;  3UMD A;  3C2W A;  2JKT I;  3EOI A;  3MFX A;  4WEL A;  3A0R A;  2VEA A;  2P7J A;  4HH2 A;  4KQD A;  4P6Z S;  3A0V A;  3B47 A;  2QJ5 A;  3EQU A;  3LR3 A;  4NXG A;  1GSV A;  2OWJ A;  3CAX A;  2ZMF A;  3FG8 A;  5DJT A;  2WKP A;  3EEH A;  2VGL S;  3E4Q A;  1W63 Q;  3LIA A;  1XJ3 A;  3CUE C;  1G6O A;  2EWW A;  5HWT A;  1MC0 A;  4OOM A;  2J80 A;  2W3H A;  1YSQ A;  4R38 A;  3T4Q A;  4LPZ A;  3CUE A;  4R3A A;  4WF0 A;  3R7W A;  4GJ4 A;  2XRO A;  2KX6 A;  4IUH A;  3P7N A;  2PR5 A;  1TS8 A;  4YNR A;  4Q0J A;  1Y28 A;  4WN5 A;  3H7W A;  2R78 A;  4LRX C;  3PBT A;  2HJ9 C;  1V9Z A;  4CLC C;  4CLC B;  1N9N A;  1OJG A;  1OTI A;  4JGP A;  3TRC A;  1IFQ A;  3D3O A;  3A0S A;  4Y2F A;  4B93 A;  4LRY C;  4KUO A;  2JKR M;  1DRM A;  2A24 B;  1GSX A;  4NXE A;  2FH5 A;  3RFB A;  3VE3 A;  1XJ6 A;  4CLC D;  3D72 A;  2H28 A;  4BMW A;  5TBM B;  3F1P A;  3LR4 A;  3JVU A;  4ARZ A;  3K2N A;  5G4Z A;  4I39 A;  3E4P A;  4DMZ A;  2W0N A;  3T4K A;  4MCW A;  2ZOI A;  3BJN A;  4NKP A;  3UE3 A;  3T4J A;  4GHI B;  4WEJ A;  1F9I A;  3C8C A;  2WKR A;  3VV4 A;  3OC2 A;  3BWL A;  5HWV A;  1NRJ A;  1STZ A;  2K2N A;  4WL9 A;  3B33 A;  4B9O A;  5IT5 A;  3IS2 A;  5G4Y A;  2ZOH A;  5HSQ A;  1F98 A;  3JVV A;  5DFY A;  4Z1W A;  4QPR A;  2VLG A;  2HF6 A;  3U2A A;  1S4S A;  4I5S A;  4R70 A;  2VJW A;  4YOF A;  1F5M A;  1TD5 A;  2PDR A;  4HIA A;  1P9R A;  1VB6 A;  3GDI A;  4GS9 B;  4MN5 A;  2JKR I;  2EA9 A;  3PBN A;  4IJG A;  2K7S A;  5AJG A;  3UB7 A;  2M7U A;  3DBA A;  1TS6 A;  3KSH A;  4DJ3 A;  4DJ2 A;  2V1A A;  3MXQ A;  5MC7 A;  1S4R A;  2GX5 A;  2OOL A;  3FPV A;  3C30 A;  3MJQ A;  4O8G A;  2GJ3 A;  4H6J B;  4HP9 A;  4I3A A;  3LIB A;  2DMW A;  3MMH A;  2PHY A;  1TS0 A;  3EGX C;  2V0U A;  3NHQ A;  2WKQ A;  3ICY A;  3H82 A;  3PXP A;  2KDK A;  1G28 A;  3UE6 A;  2L0W A;  2YKF A;  3PR6 A;  3LID A;  1LSW A;  2PR6 A;  5F5Y A;  4WLA A;  2J3T C;  2PD8 A;  2G7U A;  5F6A A;  2IA2 A;  1S67 L;  1OT9 A;  3T50 A;  4HOI A;  2QWS A;  4HH3 A;  3OCL A;  2M7V A;  4YWZ A;  3LIE A;  1T1B A;  1V9Y A;  2OWH A;  2W3D A;  3KSG A;  3KO6 A;  3S7P A;  2W27 A;  4MN7 A;  3F1N B;  3RH8 B;  3O5Y A;  5L8M A;  1OTE A;  1T18 A;  3LFV A;  2Y79 A;  4KUK A;  3E98 A;  1P97 A;  2P04 A;  1ZTU A;  3PBQ A;  3HCY A;  3KX0 X;  4FOF A;  2QYB A;  3TW8 A;  4E04 A;  3BW6 A;  2W3G A;  3E4O A;  1X0O A;  3FC7 A;  1H3Q A;  4KQO A;  5AVF A;  1KOU A;  4G3K A;  5HD5 A;  3LUQ A;  4EES A;  3LYX A;  2XRN A;  4IHQ A;  1DP6 A;  4Y3I A;  3ZQ5 A;  3K3C A;  2EWV A;  1NWZ A;  4EUV A;  2W1T B;  5KIZ A;  1P9W A;  3LIF A;  4L9F A;  2O0Y A;  5CX7 A;  1W63 M;  4CLC A;  1UWN X;  3BQA A;  4ZRR A;  4IUK A;  1XFQ A;  1LL8 A;  2O99 A;  3F1O B;  2D01 A;  4M4X A;  4UQI S;  4EEP A;  4HQA A;  5HPI A;  4ETX A;  5DKL A;  1WA9 A;  2W3E A;  2V1B A;  2VV7 A;  1BYW A;  1ODV A;  4G3W A;  5HDD A;  3VOL A;  4HNB A;  3S7N A;  3V67 A;  3CWF A;  4P6Z M;  1XJ4 A;  3EEA A;  3LIC A;  3PHY A;  4XT2 B;  2HJE A;  4HP4 A;  2BAS A;  5LBR A;  4F3L A;  5J3W A;  1OT6 A;  4MN6 A;  1LSV A;  2NUP C;  3KSI A;  1LT0 A;  2L4R A;  5C5K A;  3KYZ A;  5IS1 A;  4PKY G;  4L0L A;  2GNX A;  5J7E A;  2PYP A;  4LLO B;  4BWI A;  3R7W B;  5EFW A;  4Y5F A;  5F69 A;  3GEC A;  2O9B A;  4H6J A;  3ZYT A;  3F1P B;  5K5B A;  4LRZ E;  5DFX A;  2Y8H A;  1UGU A;  1DP8 A;  2VKS A;  1D06 A;  4I3I A;  5TJJ A;  4ETZ A;  2QKP A;  1MKM A;  3H7W B;  4BBT A;  3LR5 A;  1N9L A;  2VX8 A;  3LI8 A;  3LI9 A;  2B18 A;  2PD7 A;  2L1M A;  4Q0H A;  3NOT C;  3W2Z A;  2JN7 A;  5I5L A;  2Z6D A;  4JGQ A;  5AVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...