3MQQA

The crystal structure of the pas domain in complex with ethanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.65a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LuxR family
publication title The Crystal Structure of the PAS domain in complex with Ethanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.65A
rcsb
source organism Burkholderia thailandensis
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqqA00
1OJ5A 3CLOA 4HH3A 2Z6CA 1XJ4A 3MQQA 1DP8A 3LIFA 1T18A 1LL8A 5AVFA 4R3AA 1XJ3A 3CAXA 2YKFA 3ICYA 5HDCA 5F69A 3F1NB 2P7JA 2PDRA 5EFWA 2OWHA 1T19A 4NXBA 5HDSA 4NXFA 3IBRA 4GW9A 5J4EA 1S66L 4EEPA 4R6LA 3E4PA 2J80A 3IS2A 1LSWA 2W27A 4LRZE 2I9VA 5HD3A 4WUJA 3LYXA 5TBMA 4H6JA 2GJ3A 1G28A 4HP4A 3D72A 3PHYA 4I3AA 2VV7A 2A24B 3H7WB 5G4YA 5IU1A 1GSWA 4K08A 1OJGA 1TS6A 4KUOA 1OTEA 3LIBA 4L9GA 1BYWA 3RTYA 4EW7A 4B9OA 1OT9A 4PKYA 3KX0X 4NXEA 3A0VA 5HWWA 3EWKA 2KDKA 1D06A 5TBMB 3LIAA 3T50A 4HNBA 4H6JB 2PR5A 5HD5A 1OT6A 3FC7A 1F98A 4EESA 1S1YA 3LIDA 2VV8A 1DRMA 3MJQA 2L0WA 3C8CA 4JGRA 2L4RA 3NJAA 3RH8B 4EETB 4NXGA 1N9NA 4R38A 4GS9B 2BASA 4HIAA 3LI8A 3B33A 2K7SA 4LPZA 1DP9A 5DKLA 4I5SA 3LI9A 1UGUA 3E4QA 2ZOIA 1V9ZA 2CMNA 5A8BA 4HJ6A 4RQ9A 5KIZA 1OTDA 2L1MA 4EERA 2A24A 5G4ZA 3A0RA 1Y28A 3H7WA 3G6OA 2PHYA 2VEAA 2ZBBA 2PD8A 5HDDA 2HV1A 1S4SA 2WKRA 2V0UA 3BWLA 2D02A 5I5LA 3UB6A 3PYPA 3H82B 1T1BA 3MQOA 3VOLA 5DKKA 4L9EA 1XJ2A 1P97A 2INWA 3A0SA 2VV6A 2WKQA 4JGOA 4MN5A 4R70A 4LLOB 3UMDA 1OTIA 1S1ZA 1T1AA 2H28A 3F1OB 1LSXA 2OOLA 2PR6A 4EEUA 4E04A 1S67L 1D7EA 1GSXA 4WN5A 3LICA 1ODVA 2D01A 4HOIA 5DJUA 4LRYC 2PD7A 4GS9A 3EEHA 4DJ3A 3GECA 2PYRA 2V1AA 3MXQA 4WLAA 3UMEA 3VE4A 3H9WA 3OLOA 3K3CA 2B02A 2W0NA 1JNUA 1MZUA 2M1CA 3HJKA 4I3JA 2EA9A 2PYPA 4YWZA 3UE6A 1DP6A 3NOPC 3SW1A 2VLGA 4GCZA 3VE3A 4GHIA 2QJ5A 4HH2A 1LSVA 3H82A 3P7NA 5F68A 1WA9A 3LIEA 1TS8A 4BBTA 2QHKA 1V9YA 2V1BA 5HZHA 3CWFA 3F1PA 4EQ1A 1XJ6A 1OTAA 2R78A 3F1OA 4HP9A 3NOTC 2KX6A 3UB9A 4EXOA 3K3DA 5F5YA 2QWSA 3HJIA 2QJ7A 4JGQA 3LUQA 4XT2B 3NHQA 2Z6DA 4HJ3A 4GHIB 5HWVA 4MN6A 3BY8A 3UB8A 2JN7A 1LT0A 4I38A 5F6AA 4I3IA 2V0WA 4I39A 4HQAA 4BBUA 5AVEA 4HHDA 1NWZA 4BBVA 1N9OA 4JGPA 1TS0A 3F1PB 3MR0A 1S4RA 1P0ZA 1T1CA 1XFQA 2JHEA 2WKPA 4HJ4A 5J3WA 3UB7A 4DJ2A 1OTBA 1X0OA 3MFXA 5IS1A 4F3LA 4M4XA 4PKYG 4WF0A 1N9LA 4KUKA 1EW0A 1UWPX 2QKPA 1GSVA 1UWNX 5HSQA 2YKHA 4HY8A 3BY9A 2V9AA 1TS7A 5DJTA 1VB6A 3GDIA 3ULFA 1F9IA 2OWJA 3C2WA 4HI4A 3NOUC 5J7EA 3IS2B 2ZOHA 3F1NA 5HWTA 4L9FA 3ZQ5A 1KOUA 4XT2A 1XFNA 4WL9A 3E4OA 4F3LB 4LRXC 4KQDA 3FG8A
chains in the Genus database with same CATH superfamily
1ERQA 1L0EA 4K0WA 2P08A 3CLOA 3S7PA 1N9BA 3EOIA 1MC0A 3ZG0A 2BG1A 3E2KA 5EE8A 1BSGA 3DTMA 4N9KA 1ACFA 4Y0OA 1LL8A 1FCMA 3WS1A 4GN2A 3IXDA 3RXXA 4GKUA 5GL9A 1YKDA 4PHTA 2G2WA 1K57C 3CAXA 1K55C 3A3JA 3OPRA 5HW3A 3ZFZA 5HAQA 1JWZA 4DE0A 3ZCZA 2OLUA 5F69A 1MXOA 2C5WB 4XUXA 5E2GA 5EFWA 1RP5A 3O3VA 5E43A 1GHIA 5J8XA 5FEGA 2PAVP 4NXFA 3BQAA 1LL5A 4PAUA 3IBRA 4GW9A 4B88A 4GNUA 3ZVTA 4KZ5A 1HTZA 4LRZE 5HAIA 3UDXA 3T1XA 1BLSA 4WELA 2GJ3A 2J8YA 2VGJA 1J9MA 1G28A 1ONHA 1P9RA 1D1JA 4MDZA 4HP4A 3R4KA 3PHYA 4BWIA 2VV7A 3RFBA 1K6SA 2PBDP 2W3EA 3DTIA 5E2EA 1NLZA 3H7WB 1AXBA 2C6WB 4K08A 1YLJA 2JKRM 1TS6A 3WS0A 1M6KA 5K5BA 3LIBA 2XROA 2J7VA 4MBHA 2O9AA 2KOIA 2LB9A 3KX0X 3EGDC 3T12B 4UAAA 4E3KA 1L0FA 1GA0A 3T50A 2JKFA 1NZUA 4H6JB 2NUTC 4GB7A 4FTXA 4EESA 4MBFA 1S1YA 4IUHA 2HPBA 3FPVA 3LEQA 3ZG7B 3MFDA 3C8CA 2JE5A 3VV4A 1W8QA 3RH8B 2XR0A 3DBAA 2XF3A 4E3LA 2VKSA 5DF8A 4BD1A 2BASA 3B33A 5EVIB 1NYMA 5CRFA 4QB8A 2J3TC 2ZC7A 3GMWA 5F82A 2GNXA 3HUNA 3E4QA 1BZAA 3IBJA 3G30A 5EECA 4RQ9A 2HDSA 5KIZA 5IT5A 1PFLA 2E8JA 3GTCA 1OTDA 3LFVA 3OBFA 3EGXC 4U0XA 1H0MA 5CHMA 5D3OA 2VEAA 1KGGA 5HDDA 3QHYA 4Q0IA 3MS6A 1L0DA 4JXSA 2V0UA 5FDSA 4IUKA 1IKIA 1PW8A 3MQOA 3M6BA 1KGFA 4DN0A 3G32A 4OLGA 5FI2A 3NDEA 3ZNYA 1PI5A 5M18A 4JGOA 1YLTA 3BQ8A 2ZQAA 3BLMA 4LLOB 3F1OB 3L9KA 2ZM2A 2G7UA 4MLLA 1BUEA 3T4JA 1ODVA 3CITA 4DE1A 2D01A 3OPPA 4E3MA 1PZPA 5FAOA 2Y2HA 2XGNA 2Y4AA 3EEHA 4OLDA 1K57A 1O07A 1BLHA 5BOHA 4OOLA 3FYZA 4WLAA 4WYYA 4JKTA 3UMEA 4Y17A 3IWQA 5EOEA 3E2LA 3H9WA 5L09A 4E6WA 3K3CA 2DCFA 2B02A 2V20A 3CZDA 4MEZA 5CGWA 1HLUP 3IXGA 4WZ5C 2A49A 4DKIA 4UA7A 2FH5A 3C4PA 3HLEA 2EA9A 3T4SA 2XRNA 3S1YA 1XX2A 1KE4A 3UE6A 1DP6A 4LENA 1PWGA 1K25A 4MNRA 1A0KA 3SW1A 1MY8A 2J3TD 2X71A 3Q82A 3VE3A 2QJ5A 4P6BA 1FIKA 4HH2A 1S0WA 1PNEA 1LSVA 3H82A 1GA9A 3N6IA 4JBFA 4FD8A 5F68A 1PYYA 3LIEA 1TS8A 3QP4A 2JC7A 4CQHA 3S7QA 2HJ9C 3WRTA 3IH9A 5HZHA 4R23A 3F1PA 5EVIC 1K54C 4NKPA 5CEDA 2XLNA 4NG2A 1FOFA 5FDHA 5TJJA 4QHCA 4DDSA 1MWUA 2MJ6A 4EXOA 3K3DA 5F5YA 4IVIA 2QJ7A 3AGEA 1TD5A 3I7JA 1SKOA 3HBRA 3O86A 3T4LA 1ES5A 1IEMA 3BFDA 4U3TA 5FQ9A 4GHIB 1W7FA 5C5KA 3GR2A 5HWVA 4MN6A 3UB8A 2JN7A 3A3EA 4I38A 1Z6FA 4I3IA 2V0WA 2P9VA 1H8YA 3BM6A 1IOUA 4Y15A 1K56D 2OAQ1 5A90A 5DFYA 4GDNA 2ZC6B 2BLSA 4KZ7A 3MR0A 3CUEC 3UDIA 2A3UA 3UB5P 5J3WA 4XXRA 2W3DA 1M40A 2WZZA 2ZJ9A 4NK3A 3BEBA 3P01A 1X0OA 3MFXA 4F3LA 1FCOA 3OZHA 2CC1A 2VA0A 4M4XA 4PKYG 1H8ZA 2X01A 1IYSA 5EUAA 2EWVA 4KG2A 1GSVA 5HARA 3MXSA 4ZJ2A 3CMZA 2HJEA 4JF6A 3LR3A 3BY9A 1C3BA 1TS7A 2XA7M 5CTMA 5CTNA 2H5SA 3TSGA 4Z1WA 1DY6A 3V67A 5FI7A 3ISGA 5J7EA 5HWTA 3ZQ5A 3KYZA 4QPRA 5IHVA 2JKRI 1VQQA 1VETB 4Y5FA 4KZ6A 5FL3A 4WL9A 4YNRA 3OCLA 2ZQ8A 3UY6A 5FQKA 2DNSA 3QP8A 4KQDA 2V8FA 4RA7A 4FSFA 4HH3A 3C7VA 5EVID 4KG6A 3SOIA 4S2IA 3LEZA 3SH8A 3WS4A 2OSUA 1SDNA 3MKFA 3T4KA 1SHVA 1I2WA 2PRFA 4DF6A 1Q2QA 4FOFA 3VOYA 2WAFA 4HEFA 2YKFA 5HDCA 4R4RA 3F1NB 2P7JA 3U4LP 2ZL1A 2W1RA 1YAXA 2Q9NA 2OWHA 1NJ4A 4R3JA 1T19A 5HL1A 2XQZA 1NLYA 3LY4A 3V3SA 3W4QA 4NXBA 1MWTA 1SCWA 1NYYA 3FZCA 3TW8A 4PMAA 3RJUA 1S66L 4R6LA 1FQGA 3TE8A 3BRMA 4A5RA 1VM1A 4WZ5A 3U2AA 3IS2A 1TDGA 5CEBA 4E6XA 2JBFA 3LYXA 2FZ0A 4H6JA 2V8CA 4H8RA 4LCMA 2DRWA 2DMWA 4JXGA 2UV0E 3IWOA 4UA6A 2ZM0A 2A24B 3SS5A 2LB5A 3ITBA 3ZG5A 4ETXA 5IU1A 4ARZB 4GOGA 3A3IA 1GSWA 4JLFA 4GD6A 3V5MA 4N9LA 1XKZA 1OTEA 4L9GA 1BYWA 1CQAA 2HDRA 4L0LA 5DF9A 1BTLA 3ZDJA 4OVDA 2XSSA 4PKYA 1STZA 4BJPA 3IXBA 3PBRA 3A0VA 3TRCA 4WBGA 1EWZA 1KDSA 3MZFA 1L3LA 2KDKA 5TBMB 5KSCA 1Y4OA 5TFQA 5HD5A 1OT6A 2QZ6A 1IYQA 3FC7A 4UQIS 3N8LA 4WZ4A 4O7DA 2WZXA 1DRMA 3MJQA 1KGEA 2L0WA 4JGRA 3MXRA 4Y13A 4C75A 1JWPA 2ZD8A 4RYEA 3QP6A 1XXMA 3HLGA 4R38A 4GS9B 2Y8HA 4D2OA 3QP2A 3CUEA 1K0KA 2WYXA 4KZ8A 2Y91A 5EOOA 1FR1A 2IWDA 2CMNA 3OPHA 5EVEA 2O99A 1N4OA 4PM5A 4EERA 1LHYA 4Y7PA 1EROA 1Y28A 2ZBBA 2Y59A 4K0XA 4OP8A 1WE4A 3UB6A 4QJGA 3PYPA 4KQRA 3VOLA 1LLBA 3KSHA 5A91A 3BJNA 4AFIA 1ES3A 5AQ7A 1SDEA 1XJ2A 1CJFA 1P97A 3QNBA 3IX8A 3L7HA 1W8YA 4PM7A 3CI6A 3MF0A 1LSXA 5TR7A 2PR6A 4KQOA 1S67L 1LI0A 2XA7S 1NRFA 4IJGA 1E25A 4HOIA 2H10A 3DWKA 4LRYC 4WEJA 1K4FA 2PD7A 1SZVA 3KYQA 3GECA 3UE3A 1K4EA 2PYRA 4OOYA 1ESIA 5HX9A 1OPXA 1CEFA 3OLOA 4PM8A 4PM6A 3BFCA 2W0NA 3ZYTA 3IF5A 1MKMA 2KLIA 3IF6A 5HAPA 2PYPA 4YWZA 2IWCA 3NOPC 2VLGA 4WMCD 2Y2QA 3WS2A 1YQSA 3W2ZA 4GCZA 2G2UA 5GHXA 4GHIA 1YPRA 2Y2PA 5GLCA 3DW0A 4RX2A 4E3OA 3PBTA 2O9BA 2VGKA 3EEAA 2VJWA 2WAEA 4P6ZM 3JYIA 3CWFA 3UE1A 3VFFA 3ITAA 1AWIA 3R7WB 4FCFA 1P9WA 2NUPC 4IBRA 5FI6A 3Q81A 5FAQA 4HP9A 3P09A 5FASA 4XT2B 4DXCA 5CERA 1VEUA 1GCEA 5FQJA 2Q9MA 1K38A 2Y79A 1IKGA 4GD8A 2PBYA 5DTKA 4EV4A 5DVAA 3PXPA 1Z09A 2Y2LA 1NWZA 1YMSA 4HESA 3DWZA 1MKIA 4YOFA 1CI8A 2ZLYA 1S4RA 1P0ZA 3EQUA 5U47A 2W1TB 1T1CA 5KSHA 2JHEA 2RL3A 1XGIA 4MBKA 4X55A 2ZQCA 3PR6A 3D4FA 3M2KA 5F1GA 4Y0UA 3JVUA 1YLYA 1JTGA 2J9OA 4EUVA 5DF7A 4X69A 5FAPA 3HLWA 4KUKA 1N9LA 4ZBEA 1K55A 1UWPX 4KZBA 3KSIA 4Y3IA 4WMCA 5HPIA 2HGVA 4RX3A 3KSFA 4CPKA 1ERMA 4IVKA 3GDIA 3ULFA 5LBRA 3C2WA 1G6AA 3UNWA 2Y2IA 3NOUC 1BLPA 3F1NA 4OKPA 3OPLA 1YLPA 1KOUA 4II7A 1XFNA 1MWRA 2AVXA 2ZMAA 4JF5A 3SS3A 1L0GA 4ESPA 4FUWA 3BFEA 5CGSA 4JF4A 4X6TA 1XJ4A 1U60A 3MQQA 3TG9A 4UQIM 4IEDA 2RCXA 3FWLA 3LIFA 3HLBA 1VHMA 4R3AA 3UO9A 1XJ3A 4S2MA 5I94A 4DE3A 2XH9A 1PI4A 5FATA 1BULA 5F83A 3GSGA 3Q7VB 1W79A 4ZTKA 2WADA 2PDRA 1W5DA 2W3HA 1HD8A 1F5MA 2XFSA 2ZM8A 2XD1A 2ZC4B 5HDSA 4ARZA 3VP0A 3WRZA 3KSGA 5L07A 4R1GA 3N8RA 3UPNA 1LL9A 5DTTA 4X56A 3E4PA 3UN7A 2HP5A 3LR4A 2J80A 3FKVA 2W27A 4S2OA 2Y2KA 5HD3A 2BTFP 5TBMA 4G3KA 3BFGA 3HL9A 3CHWP 1BT5A 4ZRRA 4D60A 2WKEA 4EQIA 2WKIA 1FSYA 4OPRA 2GX5A 2EXBA 2HF6A 2XD5A 1Y54A 5EPHA 5EM0A 5KZHA 4XUZA 1XGJA 5G4YA 5A93A 3T1QB 3GQZA 3T4QA 2EX8A 4KUOA 1RGYA 3NI9A 3RTYA 4EW7A 4B9OA 1OT9A 1EI5A 3AGFA 4E3NA 4O01A 1MBLA 4EBPA 4NXEA 4S2KA 5HWWA 2J3WA 3EWKA 3LIAA 1CEGA 3G2YA 2PR5A 3IX4A 3TJZC 4GJ4A 1F98A 4QY6A 5MC7A 3LIDA 1SKFA 2VV8A 4P6ZS 2Z2LB 2J9PA 2L4RA 2OAP1 3NJAA 3CG5A 4EETB 1BLCA 1ES2A 4Z9QA 4BL2A 3BW6A 4HIAA 3LI8A 4QY5A 4ZJ3A 4KG5A 4KZ4A 1PWCA 2K7SA 5DKLA 4NEED 2Y55A 4I5SA 3LI9A 1E3UD 1K56A 4N92A 4R4SA 2WGWB 2ZOIA 5A8BA 5E2HA 4HJ6A 1MPLA 1W63M 2K2NA 3IWIA 4DXBA 2W3GA 4KZ9A 3H7WA 3MZEA 3NECA 3G6OA 2HP6A 1DJAA 2WGIA 3VOZA 3LO7A 2HV1A 2IA2A 2WKRA 2PT7A 1S6RA 1DJBA 4ME4A 4UHUA 3IX3A 5I5LA 1G5UA 3H82B 1E4DA 4X68A 5DKKA 4L9EA 5E2FA 5GLBA 4P0MA 3PBQA 3A0SA 2VV6A 2WKQA 3T1SA 4MN5A 3LY3A 3WS5A 2H0TA 4NETA 4OH0A 3K2NA 3MSHA 4M3KA 5CX7A 4R3BA 3LICA 1J3WA 4ZDXA 5EM1A 3LR0A 1G6OA 4PM9A 1PWDA 1IYPA 4QD4A 5EVIA 3NY4A 1K54A 4DJ3A 2WK0A 3A3DA 3MXQA 3B47A 3VE4A 2ZQ7A 3MMHA 4S2NC 4OP5A 2VZWA 2P9VB 3R7WA 1NRJA 4MCWA 4PPRA 4JXWA 1JNUA 1MZUA 3BFFA 5FA7A 4DMZA 3HJKA 4K91A 3IHAA 1E3UA 3N4IA 5L2FA 3C38A 5FQMA 4Q0HA 3ZNTA 3E0YA 1KDWA 2WKHA 3FPWA 4CLCE 5JYPA 4KZ3A 2H0YA 4QWOA 2XEPA 4RVAA 1V9YA 5HFOA 2OV5A 5A92A 2V1BA 3S7NA 1HZOA 2W3FA 1DJCA 2V2FF 2W1TA 1XJ6A 2R78A 4KENB 4B4XA 3F1OA 3NOTC 2KX6A 4ZAMA 3UB9A 2QWSA 2Y2JA 4WM9A 2GDNA 3BLSA 2B95A 4C6YA 3O87A 3SZTA 3NHQA 4LV2A 1NY0A 3HUOA 3W8KA 2P04A 3N7WA 3GVBA 5CXWA 4BD0A 3DAVA 1LT0A 3T4TA 3BYDA 4LV0A 3PAGA 4OQ0A 5F6AA 4CLCB 4I39A 4ZJ1A 1JTDA 4HHDA 3VMAA 4OONA 3M6HA 4JGPA 1TF1A 3CPTB 1TS0A 1XFQA 3A3FA 1H5XA 3HVFA 3HLFA 1OTBA 3IXHA 3NCKA 5HPFA 2ZL1B 4OPYA 5F1FA 5CECA 4WF0A 1FILA 1XP4A 2QKPA 2B5RA 1K6RA 4E3JA 2M7VA 5GHYA 1QMEA 3IT9A 2YKHA 4X1MA 3HUMA 2EX9A 5CHJA 4HY8A 4ID4A 2V9AA 4BQMA 3T1RA 1VB6A 1HVBA 5AJGA 4KZAA 3OCNA 2QPNA 3Q7VA 3IS2B 4UEYA 5FSRA 3RXWA 4CJNA 3NULA 1FSWA 1RGZA 3PBOA 3G4PA 3ZHHA 3S7OA 4YINA 3E4OA 4Y0TA 3FV7A 4BL3A 3V50A 1OMEA 4LRXC 3M2JA 3P98A 2ZQ9A 2Y2GA 1OJ5A 4BLMA 2Z6CA 4E3IA 4Y2FA 1XA1A 5CHUA 1YM1A 1FCNA 1YLWA 4LCLA 1DP8A 5GHZA 1T18A 4GZBA 3MKEA 4LV1A 1ALQA 5AVFA 4IHQA 2EXAA 3Q7ZA 3PTEA 2EWWA 4U0TA 1PRQA 1TEMA 5G18A 3O5YA 3ICYA 2PU2A 1FR6A 2JKTI 1IFQA 3MQ0A 2E8IA 2R9XA 1ZG4A 3C30A 1YMXA 1YSPA 4G3VA 2ZC3B 2EX2A 3VSKA 1GHMA 2WUQA 5J4EA 4EEPA 3B3XA 4OPQA 4JPMA 3C7UA 3PAEA 4S2NA 2WGVA 4CLCC 5AQBA 3D9YA 4IBXA 4JXVA 1LSWA 2GZAA 4ETZA 2I9VA 1TVFA 4WUJA 1VETA 3LGOA 3VP2A 3QNCA 5AQ9A 3QP5A 3JVVA 4EU0A 5L8MA 2VGLM 5EVLA 3D72A 4I3AA 5M1AA 4P85A 3PBNA 1YT4A 4S2LA 3GRJA 4HBUA 2VK3A 4LV3A 5GLAA 4FH2A 1OJGA 3G31A 3W4OA 3NDGA 2Q0OA 4N1HA 2P74A 1ES4A 2K31A 2WGWA 1TDLA 3HCYA 3IQAA 1D06A 1L2SA 3C4OA 3NBLA 4X25A 4HNBA 5FQIA 5KMWA 2ACGA 5M19A 1XA7A 3LCEA 5CGXA 4EBLA 1H8MA 4B93A 4O8GA 4NXGA 1PZOA 1Q2PA 4C3QA 1NXYA 1O7EA 1N9NA 1PW1A 4UA9A 4LPZA 1DP9A 2ZMFA 3SH7A 1UGUA 5FQQA 4S2JA 1KVMA 1V9ZA 3VP3A 3UDFA 4DE2A 1W63Q 3V39A 3B42A 4B4ZA 2L1MA 3UPPA 2A24A 5G4ZA 3A0RA 3CJMA 2HZ5A 2HP9A 3ZGAB 4BENA 3HREA 3O88A 4CLCD 2PHYA 3IF6B 4QU3A 5TGFA 1CF0A 3VP1A 2PD8A 2FFYA 1S4SA 3BWLA 5DFXA 2D02A 3VSLA 3OC2A 3BECA 1T1BA 4O0PA 2Y2OA 4OPZA 3HLCA 1I2SA 4GLQA 3SH9A 4BMWA 3DTEA 4P87A 2INWA 3LR5A 1IYOA 1ZC2A 4OOMA 4R70A 3UMDA 1OTIA 3AGDA 1RCJA 1S1ZA 1KE3A 1T1AA 2H28A 1ESUA 2EFXA 2OOLA 1JWVA 4EEUA 4E04A 1D7EA 1GSXA 4WN5A 3UE0A 3TOIA 2V1ZA 5DJUA 3NC8A 3SS4A 1CK3A 5L10A 2XFTA 4GS9A 2X02A 1MWSA 4X53A 1VEUB 4YFMA 5GLDA 1CI9A 3C5AA 1ZKJA 2V1AA 1JVJA 2ZC5B 2I72A 1GHPA 4F94A 2OLVA 2HDQA 1NZOA 2JCHA 1ZTUA 3GV9A 1ONGA 2M1CA 2O9CA 3Q07A 4I3JA 4MMNA 4GDBA 3HLDA 3NIAA 2EX6A 3G2ZA 2JKTM 2VX8A 5HL6A 3QP1A 3P7NA 1WA9A 2A2LA 3T4OA 3MBZA 4CLCA 4BBTA 2QHKA 4LFUA 2ZQDA 4OQIA 3VFHA 3CPTA 5AQAA 4EQ1A 2HDUA 1G68A 1OTAA 3EQVA 4Q0JA 1H3QA 4LGWA 4FH4A 2QYBA 1ZG6A 1XPBA 1YSQA 3HJIA 3OOVA 3ZG9B 1IELA 4JGQA 3LUQA 3WWXA 3MZDA 3IHBA 3S4XA 1WYBA 2Z6DA 2FFFB 4HJ3A 2XK1A 3E98A 3IF6C 5JYOA 3BY8A 2IWBA 1LI9A 3ZVWA 4HQAA 4BBUA 5AVEA 5EV0A 1ZHHB 2VGLS 4MN7A 4BBVA 1N9OA 4EUZA 4Q8IA 4WEKA 3Q1FA 4EBNA 3F1PB 2WKPA 1KVLA 3PBSA 4HJ4A 4DRTA 4S2PA 1F2KA 3UB7A 4DJ2A 2ZMVA 1SKOB 4EWFA 5DTSA 5IS1A 1PIOA 4R0QA 2Y2NA 5FEFA 4HBTA 1I5QA 3N8SA 2O0YA 1EW0A 3D3OA 2M7UA 3DTKA 1UWNX 5HSQA 4G3WA 1WYCA 2QMIA 3KO6A 4DDYA 2Y2MA 2B18A 3ZG8B 3FKWA 3UPOA 5DJTA 4OQGA 1F9IA 3IH8A 2OWJA 1KE0A 2R9WA 3G34A 3JPUA 4HI4A 3G35A 3VP4A 4OQHA 2UWXA 2ZOHA 2PU4A 3KYEA 4L9FA 1YLZA 3V3RA 4KQQA 4XT2A 3S22A 4N1XA 4X1LA 2JKGA 2EFUA 4F3LB 2XDMA 1QMFA 2Z2MB 3W4PA 3FG8A
chains in the Genus database with same CATH topology
1OJ5A 4FSFA 3S7PA 2P08A 3CLOA 2Z6CA 4HH3A 4Y2FA 3EOIA 1XJ4A 1MC0A 3MQQA 4UQIM 1DP8A 3LIFA 1T18A 1LL8A 3T4KA 5AVFA 4IHQA 1VHMA 2EWWA 4R3AA 1YKDA 4PHTA 1XJ3A 3CAXA 4FOFA 2YKFA 3O5YA 3ICYA 2JKTI 1IFQA 3MQ0A 5HDCA 5F69A 3F1NB 2P7JA 2PDRA 2W1RA 1YAXA 3C30A 5EFWA 2OWHA 2W3HA 1YSPA 1T19A 4G3VA 1F5MA 1NLYA 4NXBA 5HDSA 4ARZA 3TW8A 3KSGA 4NXFA 3BQAA 4PAUA 3IBRA 4GW9A 5J4EA 1S66L 4EEPA 4R6LA 3TE8A 3E4PA 3LR4A 4CLCC 2J80A 3U2AA 3IS2A 1LSWA 2GZAA 2W27A 4LRZE 4ETZA 2I9VA 5HD3A 4WUJA 3LYXA 5TBMA 4G3KA 2FZ0A 3JVVA 4H6JA 4EU0A 4WELA 2GJ3A 5L8MA 1G28A 2VGLM 1P9RA 4ZRRA 2DMWA 4MDZA 4HP4A 3D72A 3R4KA 3PHYA 4I3AA 4BWIA 2VV7A 2GX5A 2A24B 3RFBA 2HF6A 2W3EA 2LB5A 3PBNA 1NLZA 3H7WB 5G4YA 5IU1A 4ARZB 4ETXA 1GSWA 4K08A 1OJGA 3T4QA 2JKRM 1TS6A 4KUOA 5K5BA 1OTEA 3LIBA 2XROA 4L9GA 1BYWA 3RTYA 2O9AA 4EW7A 4B9OA 1OT9A 4L0LA 5DF9A 2KOIA 2LB9A 4O01A 2XSSA 4PKYA 2K31A 1STZA 3KX0X 4BJPA 3PBRA 4NXEA 3A0VA 3EGDC 3HCYA 3TRCA 5HWWA 2J3WA 3EWKA 2KDKA 1D06A 5TBMB 3LIAA 3T50A 4HNBA 4H6JB 2PR5A 2NUTC 5HD5A 1OT6A 3TJZC 3FC7A 4UQIS 4GJ4A 1F98A 4EESA 1S1YA 4IUHA 5MC7A 3FPVA 3LIDA 2VV8A 4P6ZS 1DRMA 3MJQA 2L0WA 3C8CA 4JGRA 3VV4A 2L4RA 2OAP1 3NJAA 3RH8B 1H8MA 3DBAA 4B93A 4EETB 4O8GA 4NXGA 2VKSA 1N9NA 4R38A 4GS9B 2Y8HA 2BASA 3BW6A 3LI8A 4HIAA 3B33A 3CUEA 2K7SA 2J3TC 4LPZA 1DP9A 4NEED 5DKLA 2ZMFA 4I5SA 3LI9A 1UGUA 2GNXA 3E4QA 2ZOIA 1V9ZA 2CMNA 5A8BA 3IBJA 2O99A 4HJ6A 4RQ9A 1W63Q 5KIZA 5IT5A 1W63M 1OTDA 2K2NA 3B42A 3LFVA 3OBFA 2L1MA 4EERA 3EGXC 2A24A 5G4ZA 3A0RA 2W3GA 1Y28A 3H7WA 3G6OA 4CLCD 2PHYA 2VEAA 2ZBBA 2PD8A 5HDDA 4Q0IA 2HV1A 1S4SA 2IA2A 2WKRA 2PT7A 2V0UA 3BWLA 4ME4A 5DFXA 2D02A 5I5LA 3UB6A 3PYPA 3H82B 3OC2A 1T1BA 4IUKA 3MQOA 3VOLA 3KSHA 4O0PA 3BJNA 4AFIA 5DKKA 4DN0A 4L9EA 4GLQA 4BMWA 1XJ2A 1P97A 2INWA 3PBQA 3A0SA 2VV6A 2WKQA 4JGOA 3LR5A 4MN5A 3BQ8A 4OOMA 3CI6A 3MF0A 4LLOB 1OTIA 4R70A 3UMDA 1S1ZA 1T1AA 2H28A 3F1OB 1LSXA 2OOLA 3K2NA 2G7UA 2PR6A 4KQOA 4EEUA 5CX7A 1S67L 1D7EA 1GSXA 4E04A 2XA7S 4WN5A 3T4JA 3LICA 1ODVA 3CITA 2D01A 4IJGA 3LR0A 4HOIA 5DJUA 4LRYC 4WEJA 1G6OA 2PD7A 4GS9A 3EEHA 4DJ3A 3KYQA 3GECA 3UE3A 2PYRA 4OOLA 2V1AA 3MXQA 4WLAA 3B47A 1OPXA 3UMEA 3VE4A 3H9WA 3MMHA 3OLOA 2VZWA 3K3CA 3R7WA 1NRJA 2B02A 4MCWA 1ZTUA 2W0NA 1JNUA 1MZUA 3ZYTA 2FH5A 2M1CA 4DMZA 2O9CA 3HJKA 1MKMA 4I3JA 2KLIA 2EA9A 3T4SA 2PYPA 2XRNA 4MMNA 4YWZA 3UE6A 1DP6A 3NOPC 3SW1A 2VLGA 3W2ZA 2J3TD 3C38A 4GCZA 4Q0HA 2JKTM 2VX8A 3VE3A 4GHIA 2QJ5A 5HL6A 3E0YA 4HH2A 1LSVA 3H82A 3FPWA 3P7NA 4CLCE 5F68A 1WA9A 2A2LA 3T4OA 3LIEA 1TS8A 4CLCA 4BBTA 3PBTA 2QHKA 2O9BA 1V9YA 3EEAA 4CQHA 3S7QA 2HJ9C 2VJWA 4P6ZM 2V1BA 5HZHA 3CWFA 3S7NA 2W3FA 3F1PA 4EQ1A 3R7WB 4NKPA 2W1TA 1XJ6A 1OTAA 1P9WA 2R78A 3EQVA 4Q0JA 5TJJA 2NUPC 1H3QA 3F1OA 2MJ6A 4HP9A 3NOTC 2QYBA 2KX6A 3UB9A 4EXOA 3K3DA 5F5YA 2QWSA 1YSQA 3HJIA 3OOVA 2QJ7A 1TD5A 3T4LA 4JGQA 3LUQA 4XT2B 3NHQA 2Z6DA 2P04A 4HJ3A 4GHIB 5C5KA 3E98A 5HWVA 2Y79A 4MN6A 3BY8A 3UB8A 2JN7A 1LT0A 3T4TA 4I38A 5F6AA 4CLCB 4I3IA 2V0WA 4I39A 4HQAA 3PXPA 4BBUA 5AVEA 1ZHHB 4HHDA 1IOUA 2VGLS 1NWZA 4MN7A 4BBVA 1N9OA 2OAQ1 5DFYA 4YOFA 4WEKA 4JGPA 1TF1A 1TS0A 3F1PB 3MR0A 1S4RA 1P0ZA 3EQUA 3CUEC 2W1TB 1T1CA 5KSHA 1XFQA 2JHEA 2WKPA 3PBSA 4HJ4A 5J3WA 2W3DA 3PR6A 3UB7A 4DJ2A 1OTBA 3P01A 3JVUA 1X0OA 2ZMVA 3MFXA 5IS1A 4F3LA 5HPFA 4EUVA 2VA0A 4M4XA 4PKYG 4WF0A 1N9LA 2O0YA 4KUKA 1EW0A 3D3OA 1UWPX 2EWVA 2QKPA 2M7UA 1GSVA 3KSIA 1UWNX 4Y3IA 2M7VA 5HPIA 5HSQA 2HGVA 4G3WA 2YKHA 2HJEA 3KO6A 4HY8A 3KSFA 3LR3A 3BY9A 2B18A 2V9AA 1TS7A 2XA7M 5DJTA 1VB6A 3GDIA 3ULFA 1F9IA 2OWJA 5AJGA 5LBRA 3OCNA 3C2WA 4HI4A 4Z1WA 3V67A 3NOUC 5J7EA 3IS2B 2ZOHA 3F1NA 4UEYA 4L9FA 5HWTA 3KYZA 3ZQ5A 4QPRA 1KOUA 4II7A 2JKRI 4XT2A 1XFNA 3PBOA 4Y5FA 5FL3A 3S7OA 4WL9A 4YNRA 3E4OA 3OCLA 4F3LB 4LRXC 4KQDA 3FG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ5 A;  3CLO A;  4HH3 A;  2Z6C A;  1XJ4 A;  3MQQ A;  1DP8 A;  3LIF A;  1T18 A;  1LL8 A;  5AVF A;  4R3A A;  1XJ3 A;  3CAX A;  2YKF A;  3ICY A;  5HDC A;  5F69 A;  3F1N B;  2P7J A;  2PDR A;  5EFW A;  2OWH A;  1T19 A;  4NXB A;  5HDS A;  4NXF A;  3IBR A;  4GW9 A;  5J4E A;  1S66 L;  4EEP A;  4R6L A;  3E4P A;  2J80 A;  3IS2 A;  1LSW A;  2W27 A;  4LRZ E;  2I9V A;  5HD3 A;  4WUJ A;  3LYX A;  5TBM A;  4H6J A;  2GJ3 A;  1G28 A;  4HP4 A;  3D72 A;  3PHY A;  4I3A A;  2VV7 A;  2A24 B;  3H7W B;  5G4Y A;  5IU1 A;  1GSW A;  4K08 A;  1OJG A;  1TS6 A;  4KUO A;  1OTE A;  3LIB A;  4L9G A;  1BYW A;  3RTY A;  4EW7 A;  4B9O A;  1OT9 A;  4PKY A;  3KX0 X;  4NXE A;  3A0V A;  5HWW A;  3EWK A;  2KDK A;  1D06 A;  5TBM B;  3LIA A;  3T50 A;  4HNB A;  4H6J B;  2PR5 A;  5HD5 A;  1OT6 A;  3FC7 A;  1F98 A;  4EES A;  1S1Y A;  3LID A;  2VV8 A;  1DRM A;  3MJQ A;  2L0W A;  3C8C A;  4JGR A;  2L4R A;  3NJA A;  3RH8 B;  4EET B;  4NXG A;  1N9N A;  4R38 A;  4GS9 B;  2BAS A;  4HIA A;  3LI8 A;  3B33 A;  2K7S A;  4LPZ A;  1DP9 A;  5DKL A;  4I5S A;  3LI9 A;  1UGU A;  3E4Q A;  2ZOI A;  1V9Z A;  2CMN A;  5A8B A;  4HJ6 A;  4RQ9 A;  5KIZ A;  1OTD A;  2L1M A;  4EER A;  2A24 A;  5G4Z A;  3A0R A;  1Y28 A;  3H7W A;  3G6O A;  2PHY A;  2VEA A;  2ZBB A;  2PD8 A;  5HDD A;  2HV1 A;  1S4S A;  2WKR A;  2V0U A;  3BWL A;  2D02 A;  5I5L A;  3UB6 A;  3PYP A;  3H82 B;  1T1B A;  3MQO A;  3VOL A;  5DKK A;  4L9E A;  1XJ2 A;  1P97 A;  2INW A;  3A0S A;  2VV6 A;  2WKQ A;  4JGO A;  4MN5 A;  4R70 A;  4LLO B;  3UMD A;  1OTI A;  1S1Z A;  1T1A A;  2H28 A;  3F1O B;  1LSX A;  2OOL A;  2PR6 A;  4EEU A;  4E04 A;  1S67 L;  1D7E A;  1GSX A;  4WN5 A;  3LIC A;  1ODV A;  2D01 A;  4HOI A;  5DJU A;  4LRY C;  2PD7 A;  4GS9 A;  3EEH A;  4DJ3 A;  3GEC A;  2PYR A;  2V1A A;  3MXQ A;  4WLA A;  3UME A;  3VE4 A;  3H9W A;  3OLO A;  3K3C A;  2B02 A;  2W0N A;  1JNU A;  1MZU A;  2M1C A;  3HJK A;  4I3J A;  2EA9 A;  2PYP A;  4YWZ A;  3UE6 A;  1DP6 A;  3NOP C;  3SW1 A;  2VLG A;  4GCZ A;  3VE3 A;  4GHI A;  2QJ5 A;  4HH2 A;  1LSV A;  3H82 A;  3P7N A;  5F68 A;  1WA9 A;  3LIE A;  1TS8 A;  4BBT A;  2QHK A;  1V9Y A;  2V1B A;  5HZH A;  3CWF A;  3F1P A;  4EQ1 A;  1XJ6 A;  1OTA A;  2R78 A;  3F1O A;  4HP9 A;  3NOT C;  2KX6 A;  3UB9 A;  4EXO A;  3K3D A;  5F5Y A;  2QWS A;  3HJI A;  2QJ7 A;  4JGQ A;  3LUQ A;  4XT2 B;  3NHQ A;  2Z6D A;  4HJ3 A;  4GHI B;  5HWV A;  4MN6 A;  3BY8 A;  3UB8 A;  2JN7 A;  1LT0 A;  4I38 A;  5F6A A;  4I3I A;  2V0W A;  4I39 A;  4HQA A;  4BBU A;  5AVE A;  4HHD A;  1NWZ A;  4BBV A;  1N9O A;  4JGP A;  1TS0 A;  3F1P B;  3MR0 A;  1S4R A;  1P0Z A;  1T1C A;  1XFQ A;  2JHE A;  2WKP A;  4HJ4 A;  5J3W A;  3UB7 A;  4DJ2 A;  1OTB A;  1X0O A;  3MFX A;  5IS1 A;  4F3L A;  4M4X A;  4PKY G;  4WF0 A;  1N9L A;  4KUK A;  1EW0 A;  1UWP X;  2QKP A;  1GSV A;  1UWN X;  5HSQ A;  2YKH A;  4HY8 A;  3BY9 A;  2V9A A;  1TS7 A;  5DJT A;  1VB6 A;  3GDI A;  3ULF A;  1F9I A;  2OWJ A;  3C2W A;  4HI4 A;  3NOU C;  5J7E A;  3IS2 B;  2ZOH A;  3F1N A;  5HWT A;  4L9F A;  3ZQ5 A;  1KOU A;  4XT2 A;  1XFN A;  4WL9 A;  3E4O A;  4F3L B;  4LRX C;  4KQD A;  3FG8 A; 
#chains in the Genus database with same CATH topology
 1ERQ A;  1L0E A;  4K0W A;  2P08 A;  3CLO A;  3S7P A;  1N9B A;  3EOI A;  1MC0 A;  3ZG0 A;  2BG1 A;  3E2K A;  5EE8 A;  1BSG A;  3DTM A;  4N9K A;  1ACF A;  4Y0O A;  1LL8 A;  1FCM A;  3WS1 A;  4GN2 A;  3IXD A;  3RXX A;  4GKU A;  5GL9 A;  1YKD A;  4PHT A;  2G2W A;  1K57 C;  3CAX A;  1K55 C;  3A3J A;  3OPR A;  5HW3 A;  3ZFZ A;  5HAQ A;  1JWZ A;  4DE0 A;  3ZCZ A;  2OLU A;  5F69 A;  1MXO A;  2C5W B;  4XUX A;  5E2G A;  5EFW A;  1RP5 A;  3O3V A;  5E43 A;  1GHI A;  5J8X A;  5FEG A;  2PAV P;  4NXF A;  3BQA A;  1LL5 A;  4PAU A;  3IBR A;  4GW9 A;  4B88 A;  4GNU A;  3ZVT A;  4KZ5 A;  1HTZ A;  4LRZ E;  5HAI A;  3UDX A;  3T1X A;  1BLS A;  4WEL A;  2GJ3 A;  2J8Y A;  2VGJ A;  1J9M A;  1G28 A;  1ONH A;  1P9R A;  1D1J A;  4MDZ A;  4HP4 A;  3R4K A;  3PHY A;  4BWI A;  2VV7 A;  3RFB A;  1K6S A;  2PBD P;  2W3E A;  3DTI A;  5E2E A;  1NLZ A;  3H7W B;  1AXB A;  2C6W B;  4K08 A;  1YLJ A;  2JKR M;  1TS6 A;  3WS0 A;  1M6K A;  5K5B A;  3LIB A;  2XRO A;  2J7V A;  4MBH A;  2O9A A;  2KOI A;  2LB9 A;  3KX0 X;  3EGD C;  3T12 B;  4UAA A;  4E3K A;  1L0F A;  1GA0 A;  3T50 A;  2JKF A;  1NZU A;  4H6J B;  2NUT C;  4GB7 A;  4FTX A;  4EES A;  4MBF A;  1S1Y A;  4IUH A;  2HPB A;  3FPV A;  3LEQ A;  3ZG7 B;  3MFD A;  3C8C A;  2JE5 A;  3VV4 A;  1W8Q A;  3RH8 B;  2XR0 A;  3DBA A;  2XF3 A;  4E3L A;  2VKS A;  5DF8 A;  4BD1 A;  2BAS A;  3B33 A;  5EVI B;  1NYM A;  5CRF A;  4QB8 A;  2J3T C;  2ZC7 A;  3GMW A;  5F82 A;  2GNX A;  3HUN A;  3E4Q A;  1BZA A;  3IBJ A;  3G30 A;  5EEC A;  4RQ9 A;  2HDS A;  5KIZ A;  5IT5 A;  1PFL A;  2E8J A;  3GTC A;  1OTD A;  3LFV A;  3OBF A;  3EGX C;  4U0X A;  1H0M A;  5CHM A;  5D3O A;  2VEA A;  1KGG A;  5HDD A;  3QHY A;  4Q0I A;  3MS6 A;  1L0D A;  4JXS A;  2V0U A;  5FDS A;  4IUK A;  1IKI A;  1PW8 A;  3MQO A;  3M6B A;  1KGF A;  4DN0 A;  3G32 A;  4OLG A;  5FI2 A;  3NDE A;  3ZNY A;  1PI5 A;  5M18 A;  4JGO A;  1YLT A;  3BQ8 A;  2ZQA A;  3BLM A;  4LLO B;  3F1O B;  3L9K A;  2ZM2 A;  2G7U A;  4MLL A;  1BUE A;  3T4J A;  1ODV A;  3CIT A;  4DE1 A;  2D01 A;  3OPP A;  4E3M A;  1PZP A;  5FAO A;  2Y2H A;  2XGN A;  2Y4A A;  3EEH A;  4OLD A;  1K57 A;  1O07 A;  1BLH A;  5BOH A;  4OOL A;  3FYZ A;  4WLA A;  4WYY A;  4JKT A;  3UME A;  4Y17 A;  3IWQ A;  5EOE A;  3E2L A;  3H9W A;  5L09 A;  4E6W A;  3K3C A;  2DCF A;  2B02 A;  2V20 A;  3CZD A;  4MEZ A;  5CGW A;  1HLU P;  3IXG A;  4WZ5 C;  2A49 A;  4DKI A;  4UA7 A;  2FH5 A;  3C4P A;  3HLE A;  2EA9 A;  3T4S A;  2XRN A;  3S1Y A;  1XX2 A;  1KE4 A;  3UE6 A;  1DP6 A;  4LEN A;  1PWG A;  1K25 A;  4MNR A;  1A0K A;  3SW1 A;  1MY8 A;  2J3T D;  2X71 A;  3Q82 A;  3VE3 A;  2QJ5 A;  4P6B A;  1FIK A;  4HH2 A;  1S0W A;  1PNE A;  1LSV A;  3H82 A;  1GA9 A;  3N6I A;  4JBF A;  4FD8 A;  5F68 A;  1PYY A;  3LIE A;  1TS8 A;  3QP4 A;  2JC7 A;  4CQH A;  3S7Q A;  2HJ9 C;  3WRT A;  3IH9 A;  5HZH A;  4R23 A;  3F1P A;  5EVI C;  1K54 C;  4NKP A;  5CED A;  2XLN A;  4NG2 A;  1FOF A;  5FDH A;  5TJJ A;  4QHC A;  4DDS A;  1MWU A;  2MJ6 A;  4EXO A;  3K3D A;  5F5Y A;  4IVI A;  2QJ7 A;  3AGE A;  1TD5 A;  3I7J A;  1SKO A;  3HBR A;  3O86 A;  3T4L A;  1ES5 A;  1IEM A;  3BFD A;  4U3T A;  5FQ9 A;  4GHI B;  1W7F A;  5C5K A;  3GR2 A;  5HWV A;  4MN6 A;  3UB8 A;  2JN7 A;  3A3E A;  4I38 A;  1Z6F A;  4I3I A;  2V0W A;  2P9V A;  1H8Y A;  3BM6 A;  1IOU A;  4Y15 A;  1K56 D;  2OAQ 1;  5A90 A;  5DFY A;  4GDN A;  2ZC6 B;  2BLS A;  4KZ7 A;  3MR0 A;  3CUE C;  3UDI A;  2A3U A;  3UB5 P;  5J3W A;  4XXR A;  2W3D A;  1M40 A;  2WZZ A;  2ZJ9 A;  4NK3 A;  3BEB A;  3P01 A;  1X0O A;  3MFX A;  4F3L A;  1FCO A;  3OZH A;  2CC1 A;  2VA0 A;  4M4X A;  4PKY G;  1H8Z A;  2X01 A;  1IYS A;  5EUA A;  2EWV A;  4KG2 A;  1GSV A;  5HAR A;  3MXS A;  4ZJ2 A;  3CMZ A;  2HJE A;  4JF6 A;  3LR3 A;  3BY9 A;  1C3B A;  1TS7 A;  2XA7 M;  5CTM A;  5CTN A;  2H5S A;  3TSG A;  4Z1W A;  1DY6 A;  3V67 A;  5FI7 A;  3ISG A;  5J7E A;  5HWT A;  3ZQ5 A;  3KYZ A;  4QPR A;  5IHV A;  2JKR I;  1VQQ A;  1VET B;  4Y5F A;  4KZ6 A;  5FL3 A;  4WL9 A;  4YNR A;  3OCL A;  2ZQ8 A;  3UY6 A;  5FQK A;  2DNS A;  3QP8 A;  4KQD A;  2V8F A;  4RA7 A;  4FSF A;  4HH3 A;  3C7V A;  5EVI D;  4KG6 A;  3SOI A;  4S2I A;  3LEZ A;  3SH8 A;  3WS4 A;  2OSU A;  1SDN A;  3MKF A;  3T4K A;  1SHV A;  1I2W A;  2PRF A;  4DF6 A;  1Q2Q A;  4FOF A;  3VOY A;  2WAF A;  4HEF A;  2YKF A;  5HDC A;  4R4R A;  3F1N B;  2P7J A;  3U4L P;  2ZL1 A;  2W1R A;  1YAX A;  2Q9N A;  2OWH A;  1NJ4 A;  4R3J A;  1T19 A;  5HL1 A;  2XQZ A;  1NLY A;  3LY4 A;  3V3S A;  3W4Q A;  4NXB A;  1MWT A;  1SCW A;  1NYY A;  3FZC A;  3TW8 A;  4PMA A;  3RJU A;  1S66 L;  4R6L A;  1FQG A;  3TE8 A;  3BRM A;  4A5R A;  1VM1 A;  4WZ5 A;  3U2A A;  3IS2 A;  1TDG A;  5CEB A;  4E6X A;  2JBF A;  3LYX A;  2FZ0 A;  4H6J A;  2V8C A;  4H8R A;  4LCM A;  2DRW A;  2DMW A;  4JXG A;  2UV0 E;  3IWO A;  4UA6 A;  2ZM0 A;  2A24 B;  3SS5 A;  2LB5 A;  3ITB A;  3ZG5 A;  4ETX A;  5IU1 A;  4ARZ B;  4GOG A;  3A3I A;  1GSW A;  4JLF A;  4GD6 A;  3V5M A;  4N9L A;  1XKZ A;  1OTE A;  4L9G A;  1BYW A;  1CQA A;  2HDR A;  4L0L A;  5DF9 A;  1BTL A;  3ZDJ A;  4OVD A;  2XSS A;  4PKY A;  1STZ A;  4BJP A;  3IXB A;  3PBR A;  3A0V A;  3TRC A;  4WBG A;  1EWZ A;  1KDS A;  3MZF A;  1L3L A;  2KDK A;  5TBM B;  5KSC A;  1Y4O A;  5TFQ A;  5HD5 A;  1OT6 A;  2QZ6 A;  1IYQ A;  3FC7 A;  4UQI S;  3N8L A;  4WZ4 A;  4O7D A;  2WZX A;  1DRM A;  3MJQ A;  1KGE A;  2L0W A;  4JGR A;  3MXR A;  4Y13 A;  4C75 A;  1JWP A;  2ZD8 A;  4RYE A;  3QP6 A;  1XXM A;  3HLG A;  4R38 A;  4GS9 B;  2Y8H A;  4D2O A;  3QP2 A;  3CUE A;  1K0K A;  2WYX A;  4KZ8 A;  2Y91 A;  5EOO A;  1FR1 A;  2IWD A;  2CMN A;  3OPH A;  5EVE A;  2O99 A;  1N4O A;  4PM5 A;  4EER A;  1LHY A;  4Y7P A;  1ERO A;  1Y28 A;  2ZBB A;  2Y59 A;  4K0X A;  4OP8 A;  1WE4 A;  3UB6 A;  4QJG A;  3PYP A;  4KQR A;  3VOL A;  1LLB A;  3KSH A;  5A91 A;  3BJN A;  4AFI A;  1ES3 A;  5AQ7 A;  1SDE A;  1XJ2 A;  1CJF A;  1P97 A;  3QNB A;  3IX8 A;  3L7H A;  1W8Y A;  4PM7 A;  3CI6 A;  3MF0 A;  1LSX A;  5TR7 A;  2PR6 A;  4KQO A;  1S67 L;  1LI0 A;  2XA7 S;  1NRF A;  4IJG A;  1E25 A;  4HOI A;  2H10 A;  3DWK A;  4LRY C;  4WEJ A;  1K4F A;  2PD7 A;  1SZV A;  3KYQ A;  3GEC A;  3UE3 A;  1K4E A;  2PYR A;  4OOY A;  1ESI A;  5HX9 A;  1OPX A;  1CEF A;  3OLO A;  4PM8 A;  4PM6 A;  3BFC A;  2W0N A;  3ZYT A;  3IF5 A;  1MKM A;  2KLI A;  3IF6 A;  5HAP A;  2PYP A;  4YWZ A;  2IWC A;  3NOP C;  2VLG A;  4WMC D;  2Y2Q A;  3WS2 A;  1YQS A;  3W2Z A;  4GCZ A;  2G2U A;  5GHX A;  4GHI A;  1YPR A;  2Y2P A;  5GLC A;  3DW0 A;  4RX2 A;  4E3O A;  3PBT A;  2O9B A;  2VGK A;  3EEA A;  2VJW A;  2WAE A;  4P6Z M;  3JYI A;  3CWF A;  3UE1 A;  3VFF A;  3ITA A;  1AWI A;  3R7W B;  4FCF A;  1P9W A;  2NUP C;  4IBR A;  5FI6 A;  3Q81 A;  5FAQ A;  4HP9 A;  3P09 A;  5FAS A;  4XT2 B;  4DXC A;  5CER A;  1VEU A;  1GCE A;  5FQJ A;  2Q9M A;  1K38 A;  2Y79 A;  1IKG A;  4GD8 A;  2PBY A;  5DTK A;  4EV4 A;  5DVA A;  3PXP A;  1Z09 A;  2Y2L A;  1NWZ A;  1YMS A;  4HES A;  3DWZ A;  1MKI A;  4YOF A;  1CI8 A;  2ZLY A;  1S4R A;  1P0Z A;  3EQU A;  5U47 A;  2W1T B;  1T1C A;  5KSH A;  2JHE A;  2RL3 A;  1XGI A;  4MBK A;  4X55 A;  2ZQC A;  3PR6 A;  3D4F A;  3M2K A;  5F1G A;  4Y0U A;  3JVU A;  1YLY A;  1JTG A;  2J9O A;  4EUV A;  5DF7 A;  4X69 A;  5FAP A;  3HLW A;  4KUK A;  1N9L A;  4ZBE A;  1K55 A;  1UWP X;  4KZB A;  3KSI A;  4Y3I A;  4WMC A;  5HPI A;  2HGV A;  4RX3 A;  3KSF A;  4CPK A;  1ERM A;  4IVK A;  3GDI A;  3ULF A;  5LBR A;  3C2W A;  1G6A A;  3UNW A;  2Y2I A;  3NOU C;  1BLP A;  3F1N A;  4OKP A;  3OPL A;  1YLP A;  1KOU A;  4II7 A;  1XFN A;  1MWR A;  2AVX A;  2ZMA A;  4JF5 A;  3SS3 A;  1L0G A;  4ESP A;  4FUW A;  3BFE A;  5CGS A;  4JF4 A;  4X6T A;  1XJ4 A;  1U60 A;  3MQQ A;  3TG9 A;  4UQI M;  4IED A;  2RCX A;  3FWL A;  3LIF A;  3HLB A;  1VHM A;  4R3A A;  3UO9 A;  1XJ3 A;  4S2M A;  5I94 A;  4DE3 A;  2XH9 A;  1PI4 A;  5FAT A;  1BUL A;  5F83 A;  3GSG A;  3Q7V B;  1W79 A;  4ZTK A;  2WAD A;  2PDR A;  1W5D A;  2W3H A;  1HD8 A;  1F5M A;  2XFS A;  2ZM8 A;  2XD1 A;  2ZC4 B;  5HDS A;  4ARZ A;  3VP0 A;  3WRZ A;  3KSG A;  5L07 A;  4R1G A;  3N8R A;  3UPN A;  1LL9 A;  5DTT A;  4X56 A;  3E4P A;  3UN7 A;  2HP5 A;  3LR4 A;  2J80 A;  3FKV A;  2W27 A;  4S2O A;  2Y2K A;  5HD3 A;  2BTF P;  5TBM A;  4G3K A;  3BFG A;  3HL9 A;  3CHW P;  1BT5 A;  4ZRR A;  4D60 A;  2WKE A;  4EQI A;  2WKI A;  1FSY A;  4OPR A;  2GX5 A;  2EXB A;  2HF6 A;  2XD5 A;  1Y54 A;  5EPH A;  5EM0 A;  5KZH A;  4XUZ A;  1XGJ A;  5G4Y A;  5A93 A;  3T1Q B;  3GQZ A;  3T4Q A;  2EX8 A;  4KUO A;  1RGY A;  3NI9 A;  3RTY A;  4EW7 A;  4B9O A;  1OT9 A;  1EI5 A;  3AGF A;  4E3N A;  4O01 A;  1MBL A;  4EBP A;  4NXE A;  4S2K A;  5HWW A;  2J3W A;  3EWK A;  3LIA A;  1CEG A;  3G2Y A;  2PR5 A;  3IX4 A;  3TJZ C;  4GJ4 A;  1F98 A;  4QY6 A;  5MC7 A;  3LID A;  1SKF A;  2VV8 A;  4P6Z S;  2Z2L B;  2J9P A;  2L4R A;  2OAP 1;  3NJA A;  3CG5 A;  4EET B;  1BLC A;  1ES2 A;  4Z9Q A;  4BL2 A;  3BW6 A;  4HIA A;  3LI8 A;  4QY5 A;  4ZJ3 A;  4KG5 A;  4KZ4 A;  1PWC A;  2K7S A;  5DKL A;  4NEE D;  2Y55 A;  4I5S A;  3LI9 A;  1E3U D;  1K56 A;  4N92 A;  4R4S A;  2WGW B;  2ZOI A;  5A8B A;  5E2H A;  4HJ6 A;  1MPL A;  1W63 M;  2K2N A;  3IWI A;  4DXB A;  2W3G A;  4KZ9 A;  3H7W A;  3MZE A;  3NEC A;  3G6O A;  2HP6 A;  1DJA A;  2WGI A;  3VOZ A;  3LO7 A;  2HV1 A;  2IA2 A;  2WKR A;  2PT7 A;  1S6R A;  1DJB A;  4ME4 A;  4UHU A;  3IX3 A;  5I5L A;  1G5U A;  3H82 B;  1E4D A;  4X68 A;  5DKK A;  4L9E A;  5E2F A;  5GLB A;  4P0M A;  3PBQ A;  3A0S A;  2VV6 A;  2WKQ A;  3T1S A;  4MN5 A;  3LY3 A;  3WS5 A;  2H0T A;  4NET A;  4OH0 A;  3K2N A;  3MSH A;  4M3K A;  5CX7 A;  4R3B A;  3LIC A;  1J3W A;  4ZDX A;  5EM1 A;  3LR0 A;  1G6O A;  4PM9 A;  1PWD A;  1IYP A;  4QD4 A;  5EVI A;  3NY4 A;  1K54 A;  4DJ3 A;  2WK0 A;  3A3D A;  3MXQ A;  3B47 A;  3VE4 A;  2ZQ7 A;  3MMH A;  4S2N C;  4OP5 A;  2VZW A;  2P9V B;  3R7W A;  1NRJ A;  4MCW A;  4PPR A;  4JXW A;  1JNU A;  1MZU A;  3BFF A;  5FA7 A;  4DMZ A;  3HJK A;  4K91 A;  3IHA A;  1E3U A;  3N4I A;  5L2F A;  3C38 A;  5FQM A;  4Q0H A;  3ZNT A;  3E0Y A;  1KDW A;  2WKH A;  3FPW A;  4CLC E;  5JYP A;  4KZ3 A;  2H0Y A;  4QWO A;  2XEP A;  4RVA A;  1V9Y A;  5HFO A;  2OV5 A;  5A92 A;  2V1B A;  3S7N A;  1HZO A;  2W3F A;  1DJC A;  2V2F F;  2W1T A;  1XJ6 A;  2R78 A;  4KEN B;  4B4X A;  3F1O A;  3NOT C;  2KX6 A;  4ZAM A;  3UB9 A;  2QWS A;  2Y2J A;  4WM9 A;  2GDN A;  3BLS A;  2B95 A;  4C6Y A;  3O87 A;  3SZT A;  3NHQ A;  4LV2 A;  1NY0 A;  3HUO A;  3W8K A;  2P04 A;  3N7W A;  3GVB A;  5CXW A;  4BD0 A;  3DAV A;  1LT0 A;  3T4T A;  3BYD A;  4LV0 A;  3PAG A;  4OQ0 A;  5F6A A;  4CLC B;  4I39 A;  4ZJ1 A;  1JTD A;  4HHD A;  3VMA A;  4OON A;  3M6H A;  4JGP A;  1TF1 A;  3CPT B;  1TS0 A;  1XFQ A;  3A3F A;  1H5X A;  3HVF A;  3HLF A;  1OTB A;  3IXH A;  3NCK A;  5HPF A;  2ZL1 B;  4OPY A;  5F1F A;  5CEC A;  4WF0 A;  1FIL A;  1XP4 A;  2QKP A;  2B5R A;  1K6R A;  4E3J A;  2M7V A;  5GHY A;  1QME A;  3IT9 A;  2YKH A;  4X1M A;  3HUM A;  2EX9 A;  5CHJ A;  4HY8 A;  4ID4 A;  2V9A A;  4BQM A;  3T1R A;  1VB6 A;  1HVB A;  5AJG A;  4KZA A;  3OCN A;  2QPN A;  3Q7V A;  3IS2 B;  4UEY A;  5FSR A;  3RXW A;  4CJN A;  3NUL A;  1FSW A;  1RGZ A;  3PBO A;  3G4P A;  3ZHH A;  3S7O A;  4YIN A;  3E4O A;  4Y0T A;  3FV7 A;  4BL3 A;  3V50 A;  1OME A;  4LRX C;  3M2J A;  3P98 A;  2ZQ9 A;  2Y2G A;  1OJ5 A;  4BLM A;  2Z6C A;  4E3I A;  4Y2F A;  1XA1 A;  5CHU A;  1YM1 A;  1FCN A;  1YLW A;  4LCL A;  1DP8 A;  5GHZ A;  1T18 A;  4GZB A;  3MKE A;  4LV1 A;  1ALQ A;  5AVF A;  4IHQ A;  2EXA A;  3Q7Z A;  3PTE A;  2EWW A;  4U0T A;  1PRQ A;  1TEM A;  5G18 A;  3O5Y A;  3ICY A;  2PU2 A;  1FR6 A;  2JKT I;  1IFQ A;  3MQ0 A;  2E8I A;  2R9X A;  1ZG4 A;  3C30 A;  1YMX A;  1YSP A;  4G3V A;  2ZC3 B;  2EX2 A;  3VSK A;  1GHM A;  2WUQ A;  5J4E A;  4EEP A;  3B3X A;  4OPQ A;  4JPM A;  3C7U A;  3PAE A;  4S2N A;  2WGV A;  4CLC C;  5AQB A;  3D9Y A;  4IBX A;  4JXV A;  1LSW A;  2GZA A;  4ETZ A;  2I9V A;  1TVF A;  4WUJ A;  1VET A;  3LGO A;  3VP2 A;  3QNC A;  5AQ9 A;  3QP5 A;  3JVV A;  4EU0 A;  5L8M A;  2VGL M;  5EVL A;  3D72 A;  4I3A A;  5M1A A;  4P85 A;  3PBN A;  1YT4 A;  4S2L A;  3GRJ A;  4HBU A;  2VK3 A;  4LV3 A;  5GLA A;  4FH2 A;  1OJG A;  3G31 A;  3W4O A;  3NDG A;  2Q0O A;  4N1H A;  2P74 A;  1ES4 A;  2K31 A;  2WGW A;  1TDL A;  3HCY A;  3IQA A;  1D06 A;  1L2S A;  3C4O A;  3NBL A;  4X25 A;  4HNB A;  5FQI A;  5KMW A;  2ACG A;  5M19 A;  1XA7 A;  3LCE A;  5CGX A;  4EBL A;  1H8M A;  4B93 A;  4O8G A;  4NXG A;  1PZO A;  1Q2P A;  4C3Q A;  1NXY A;  1O7E A;  1N9N A;  1PW1 A;  4UA9 A;  4LPZ A;  1DP9 A;  2ZMF A;  3SH7 A;  1UGU A;  5FQQ A;  4S2J A;  1KVM A;  1V9Z A;  3VP3 A;  3UDF A;  4DE2 A;  1W63 Q;  3V39 A;  3B42 A;  4B4Z A;  2L1M A;  3UPP A;  2A24 A;  5G4Z A;  3A0R A;  3CJM A;  2HZ5 A;  2HP9 A;  3ZGA B;  4BEN A;  3HRE A;  3O88 A;  4CLC D;  2PHY A;  3IF6 B;  4QU3 A;  5TGF A;  1CF0 A;  3VP1 A;  2PD8 A;  2FFY A;  1S4S A;  3BWL A;  5DFX A;  2D02 A;  3VSL A;  3OC2 A;  3BEC A;  1T1B A;  4O0P A;  2Y2O A;  4OPZ A;  3HLC A;  1I2S A;  4GLQ A;  3SH9 A;  4BMW A;  3DTE A;  4P87 A;  2INW A;  3LR5 A;  1IYO A;  1ZC2 A;  4OOM A;  4R70 A;  3UMD A;  1OTI A;  3AGD A;  1RCJ A;  1S1Z A;  1KE3 A;  1T1A A;  2H28 A;  1ESU A;  2EFX A;  2OOL A;  1JWV A;  4EEU A;  4E04 A;  1D7E A;  1GSX A;  4WN5 A;  3UE0 A;  3TOI A;  2V1Z A;  5DJU A;  3NC8 A;  3SS4 A;  1CK3 A;  5L10 A;  2XFT A;  4GS9 A;  2X02 A;  1MWS A;  4X53 A;  1VEU B;  4YFM A;  5GLD A;  1CI9 A;  3C5A A;  1ZKJ A;  2V1A A;  1JVJ A;  2ZC5 B;  2I72 A;  1GHP A;  4F94 A;  2OLV A;  2HDQ A;  1NZO A;  2JCH A;  1ZTU A;  3GV9 A;  1ONG A;  2M1C A;  2O9C A;  3Q07 A;  4I3J A;  4MMN A;  4GDB A;  3HLD A;  3NIA A;  2EX6 A;  3G2Z A;  2JKT M;  2VX8 A;  5HL6 A;  3QP1 A;  3P7N A;  1WA9 A;  2A2L A;  3T4O A;  3MBZ A;  4CLC A;  4BBT A;  2QHK A;  4LFU A;  2ZQD A;  4OQI A;  3VFH A;  3CPT A;  5AQA A;  4EQ1 A;  2HDU A;  1G68 A;  1OTA A;  3EQV A;  4Q0J A;  1H3Q A;  4LGW A;  4FH4 A;  2QYB A;  1ZG6 A;  1XPB A;  1YSQ A;  3HJI A;  3OOV A;  3ZG9 B;  1IEL A;  4JGQ A;  3LUQ A;  3WWX A;  3MZD A;  3IHB A;  3S4X A;  1WYB A;  2Z6D A;  2FFF B;  4HJ3 A;  2XK1 A;  3E98 A;  3IF6 C;  5JYO A;  3BY8 A;  2IWB A;  1LI9 A;  3ZVW A;  4HQA A;  4BBU A;  5AVE A;  5EV0 A;  1ZHH B;  2VGL S;  4MN7 A;  4BBV A;  1N9O A;  4EUZ A;  4Q8I A;  4WEK A;  3Q1F A;  4EBN A;  3F1P B;  2WKP A;  1KVL A;  3PBS A;  4HJ4 A;  4DRT A;  4S2P A;  1F2K A;  3UB7 A;  4DJ2 A;  2ZMV A;  1SKO B;  4EWF A;  5DTS A;  5IS1 A;  1PIO A;  4R0Q A;  2Y2N A;  5FEF A;  4HBT A;  1I5Q A;  3N8S A;  2O0Y A;  1EW0 A;  3D3O A;  2M7U A;  3DTK A;  1UWN X;  5HSQ A;  4G3W A;  1WYC A;  2QMI A;  3KO6 A;  4DDY A;  2Y2M A;  2B18 A;  3ZG8 B;  3FKW A;  3UPO A;  5DJT A;  4OQG A;  1F9I A;  3IH8 A;  2OWJ A;  1KE0 A;  2R9W A;  3G34 A;  3JPU A;  4HI4 A;  3G35 A;  3VP4 A;  4OQH A;  2UWX A;  2ZOH A;  2PU4 A;  3KYE A;  4L9F A;  1YLZ A;  3V3R A;  4KQQ A;  4XT2 A;  3S22 A;  4N1X A;  4X1L A;  2JKG A;  2EFU A;  4F3L B;  2XDM A;  1QMF A;  2Z2M B;  3W4P A;  3FG8 A; 
#chains in the Genus database with same CATH homology
 1OJ5 A;  4FSF A;  3S7P A;  2P08 A;  3CLO A;  2Z6C A;  4HH3 A;  4Y2F A;  3EOI A;  1XJ4 A;  1MC0 A;  3MQQ A;  4UQI M;  1DP8 A;  3LIF A;  1T18 A;  1LL8 A;  3T4K A;  5AVF A;  4IHQ A;  1VHM A;  2EWW A;  4R3A A;  1YKD A;  4PHT A;  1XJ3 A;  3CAX A;  4FOF A;  2YKF A;  3O5Y A;  3ICY A;  2JKT I;  1IFQ A;  3MQ0 A;  5HDC A;  5F69 A;  3F1N B;  2P7J A;  2PDR A;  2W1R A;  1YAX A;  3C30 A;  5EFW A;  2OWH A;  2W3H A;  1YSP A;  1T19 A;  4G3V A;  1F5M A;  1NLY A;  4NXB A;  5HDS A;  4ARZ A;  3TW8 A;  3KSG A;  4NXF A;  3BQA A;  4PAU A;  3IBR A;  4GW9 A;  5J4E A;  1S66 L;  4EEP A;  4R6L A;  3TE8 A;  3E4P A;  3LR4 A;  4CLC C;  2J80 A;  3U2A A;  3IS2 A;  1LSW A;  2GZA A;  2W27 A;  4LRZ E;  4ETZ A;  2I9V A;  5HD3 A;  4WUJ A;  3LYX A;  5TBM A;  4G3K A;  2FZ0 A;  3JVV A;  4H6J A;  4EU0 A;  4WEL A;  2GJ3 A;  5L8M A;  1G28 A;  2VGL M;  1P9R A;  4ZRR A;  2DMW A;  4MDZ A;  4HP4 A;  3D72 A;  3R4K A;  3PHY A;  4I3A A;  4BWI A;  2VV7 A;  2GX5 A;  2A24 B;  3RFB A;  2HF6 A;  2W3E A;  2LB5 A;  3PBN A;  1NLZ A;  3H7W B;  5G4Y A;  5IU1 A;  4ARZ B;  4ETX A;  1GSW A;  4K08 A;  1OJG A;  3T4Q A;  2JKR M;  1TS6 A;  4KUO A;  5K5B A;  1OTE A;  3LIB A;  2XRO A;  4L9G A;  1BYW A;  3RTY A;  2O9A A;  4EW7 A;  4B9O A;  1OT9 A;  4L0L A;  5DF9 A;  2KOI A;  2LB9 A;  4O01 A;  2XSS A;  4PKY A;  2K31 A;  1STZ A;  3KX0 X;  4BJP A;  3PBR A;  4NXE A;  3A0V A;  3EGD C;  3HCY A;  3TRC A;  5HWW A;  2J3W A;  3EWK A;  2KDK A;  1D06 A;  5TBM B;  3LIA A;  3T50 A;  4HNB A;  4H6J B;  2PR5 A;  2NUT C;  5HD5 A;  1OT6 A;  3TJZ C;  3FC7 A;  4UQI S;  4GJ4 A;  1F98 A;  4EES A;  1S1Y A;  4IUH A;  5MC7 A;  3FPV A;  3LID A;  2VV8 A;  4P6Z S;  1DRM A;  3MJQ A;  2L0W A;  3C8C A;  4JGR A;  3VV4 A;  2L4R A;  2OAP 1;  3NJA A;  3RH8 B;  1H8M A;  3DBA A;  4B93 A;  4EET B;  4O8G A;  4NXG A;  2VKS A;  1N9N A;  4R38 A;  4GS9 B;  2Y8H A;  2BAS A;  3BW6 A;  3LI8 A;  4HIA A;  3B33 A;  3CUE A;  2K7S A;  2J3T C;  4LPZ A;  1DP9 A;  4NEE D;  5DKL A;  2ZMF A;  4I5S A;  3LI9 A;  1UGU A;  2GNX A;  3E4Q A;  2ZOI A;  1V9Z A;  2CMN A;  5A8B A;  3IBJ A;  2O99 A;  4HJ6 A;  4RQ9 A;  1W63 Q;  5KIZ A;  5IT5 A;  1W63 M;  1OTD A;  2K2N A;  3B42 A;  3LFV A;  3OBF A;  2L1M A;  4EER A;  3EGX C;  2A24 A;  5G4Z A;  3A0R A;  2W3G A;  1Y28 A;  3H7W A;  3G6O A;  4CLC D;  2PHY A;  2VEA A;  2ZBB A;  2PD8 A;  5HDD A;  4Q0I A;  2HV1 A;  1S4S A;  2IA2 A;  2WKR A;  2PT7 A;  2V0U A;  3BWL A;  4ME4 A;  5DFX A;  2D02 A;  5I5L A;  3UB6 A;  3PYP A;  3H82 B;  3OC2 A;  1T1B A;  4IUK A;  3MQO A;  3VOL A;  3KSH A;  4O0P A;  3BJN A;  4AFI A;  5DKK A;  4DN0 A;  4L9E A;  4GLQ A;  4BMW A;  1XJ2 A;  1P97 A;  2INW A;  3PBQ A;  3A0S A;  2VV6 A;  2WKQ A;  4JGO A;  3LR5 A;  4MN5 A;  3BQ8 A;  4OOM A;  3CI6 A;  3MF0 A;  4LLO B;  1OTI A;  4R70 A;  3UMD A;  1S1Z A;  1T1A A;  2H28 A;  3F1O B;  1LSX A;  2OOL A;  3K2N A;  2G7U A;  2PR6 A;  4KQO A;  4EEU A;  5CX7 A;  1S67 L;  1D7E A;  1GSX A;  4E04 A;  2XA7 S;  4WN5 A;  3T4J A;  3LIC A;  1ODV A;  3CIT A;  2D01 A;  4IJG A;  3LR0 A;  4HOI A;  5DJU A;  4LRY C;  4WEJ A;  1G6O A;  2PD7 A;  4GS9 A;  3EEH A;  4DJ3 A;  3KYQ A;  3GEC A;  3UE3 A;  2PYR A;  4OOL A;  2V1A A;  3MXQ A;  4WLA A;  3B47 A;  1OPX A;  3UME A;  3VE4 A;  3H9W A;  3MMH A;  3OLO A;  2VZW A;  3K3C A;  3R7W A;  1NRJ A;  2B02 A;  4MCW A;  1ZTU A;  2W0N A;  1JNU A;  1MZU A;  3ZYT A;  2FH5 A;  2M1C A;  4DMZ A;  2O9C A;  3HJK A;  1MKM A;  4I3J A;  2KLI A;  2EA9 A;  3T4S A;  2PYP A;  2XRN A;  4MMN A;  4YWZ A;  3UE6 A;  1DP6 A;  3NOP C;  3SW1 A;  2VLG A;  3W2Z A;  2J3T D;  3C38 A;  4GCZ A;  4Q0H A;  2JKT M;  2VX8 A;  3VE3 A;  4GHI A;  2QJ5 A;  5HL6 A;  3E0Y A;  4HH2 A;  1LSV A;  3H82 A;  3FPW A;  3P7N A;  4CLC E;  5F68 A;  1WA9 A;  2A2L A;  3T4O A;  3LIE A;  1TS8 A;  4CLC A;  4BBT A;  3PBT A;  2QHK A;  2O9B A;  1V9Y A;  3EEA A;  4CQH A;  3S7Q A;  2HJ9 C;  2VJW A;  4P6Z M;  2V1B A;  5HZH A;  3CWF A;  3S7N A;  2W3F A;  3F1P A;  4EQ1 A;  3R7W B;  4NKP A;  2W1T A;  1XJ6 A;  1OTA A;  1P9W A;  2R78 A;  3EQV A;  4Q0J A;  5TJJ A;  2NUP C;  1H3Q A;  3F1O A;  2MJ6 A;  4HP9 A;  3NOT C;  2QYB A;  2KX6 A;  3UB9 A;  4EXO A;  3K3D A;  5F5Y A;  2QWS A;  1YSQ A;  3HJI A;  3OOV A;  2QJ7 A;  1TD5 A;  3T4L A;  4JGQ A;  3LUQ A;  4XT2 B;  3NHQ A;  2Z6D A;  2P04 A;  4HJ3 A;  4GHI B;  5C5K A;  3E98 A;  5HWV A;  2Y79 A;  4MN6 A;  3BY8 A;  3UB8 A;  2JN7 A;  1LT0 A;  3T4T A;  4I38 A;  5F6A A;  4CLC B;  4I3I A;  2V0W A;  4I39 A;  4HQA A;  3PXP A;  4BBU A;  5AVE A;  1ZHH B;  4HHD A;  1IOU A;  2VGL S;  1NWZ A;  4MN7 A;  4BBV A;  1N9O A;  2OAQ 1;  5DFY A;  4YOF A;  4WEK A;  4JGP A;  1TF1 A;  1TS0 A;  3F1P B;  3MR0 A;  1S4R A;  1P0Z A;  3EQU A;  3CUE C;  2W1T B;  1T1C A;  5KSH A;  1XFQ A;  2JHE A;  2WKP A;  3PBS A;  4HJ4 A;  5J3W A;  2W3D A;  3PR6 A;  3UB7 A;  4DJ2 A;  1OTB A;  3P01 A;  3JVU A;  1X0O A;  2ZMV A;  3MFX A;  5IS1 A;  4F3L A;  5HPF A;  4EUV A;  2VA0 A;  4M4X A;  4PKY G;  4WF0 A;  1N9L A;  2O0Y A;  4KUK A;  1EW0 A;  3D3O A;  1UWP X;  2EWV A;  2QKP A;  2M7U A;  1GSV A;  3KSI A;  1UWN X;  4Y3I A;  2M7V A;  5HPI A;  5HSQ A;  2HGV A;  4G3W A;  2YKH A;  2HJE A;  3KO6 A;  4HY8 A;  3KSF A;  3LR3 A;  3BY9 A;  2B18 A;  2V9A A;  1TS7 A;  2XA7 M;  5DJT A;  1VB6 A;  3GDI A;  3ULF A;  1F9I A;  2OWJ A;  5AJG A;  5LBR A;  3OCN A;  3C2W A;  4HI4 A;  4Z1W A;  3V67 A;  3NOU C;  5J7E A;  3IS2 B;  2ZOH A;  3F1N A;  4UEY A;  4L9F A;  5HWT A;  3KYZ A;  3ZQ5 A;  4QPR A;  1KOU A;  4II7 A;  2JKR I;  4XT2 A;  1XFN A;  3PBO A;  4Y5F A;  5FL3 A;  3S7O A;  4WL9 A;  4YNR A;  3E4O A;  3OCL A;  4F3L B;  4LRX C;  4KQD A;  3FG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...