3MQQA

The crystal structure of the pas domain in complex with ethanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.65a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
IDYKTAFHLAPIGLVLSRDRVIEDCNDELAAIFRCARADLIGRSFEVLYPSSDEFERIGERISPVMIAHGSYADDRIMKRAGGELFWCHVTGRALDRTAPLAAGVWTFEDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the PAS domain in complex with Ethanol of a Transcriptional Regulator in the LuxR family from Burkholderia thailandensis to 1.65A
rcsb
source organism Burkholderia thailandensis
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LuxR family
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3mqqA00
2A24A 1XJ6A 1N9LA 2INWA 3MFXA 4HHDA 1N9NA 1NWZA 2OOLA 3C2WA 4XT2B 1UWNX 1UWPX 1V9ZA 2PR6A 3UB9A 4EEPA 3G6OA 4NXEA 1F98A 2OWHA 3EWKA 4I3AA 2L1MA 4EETB 4EQ1A 3LI9A 1S1ZA 3MQQA 4GS9A 1GSXA 5F69A 4NXFA 4HJ4A 5HDDA 3ZQ5A 1T1AA 4WL9A 2H28A 2ZBBA 3GECA 3HJIA 3K3CA 3PHYA 5DKKA 1TS6A 5AVEA 3A0RA 3LIFA 1UGUA 3IS2B 4HJ6A 4L9GA 2L4RA 3CAXA 4I39A 4H6JB 2A24B 4GS9B 4JGQA 4EERA 3EEHA 4MN5A 3H7WB 1LT0A 3RTYA 3F1OA 3OLOA 4BBUA 4DJ3A 1N9OA 4YWZA 3UMDA 1T19A 3H82A 4LRZE 1D7EA 1BYWA 3MJQA 2WKPA 5HD5A 1DP6A 1OT9A 3F1NB 4HIAA 2ZOIA 3D72A 1OTAA 1OJGA 2EA9A 1G28A 2PD7A 5DJTA 1XFQA 2V0WA 1XJ2A 4HI4A 3E4OA 4K08A 4PKYG 2PD8A 2VV6A 4HJ3A 1KOUA 2PYRA 4B9OA 4HP9A 4EESA 4M4XA 2R78A 1XFNA 1OTDA 3FC7A 2WKQA 3UB7A 3VE3A 2QJ5A 2Z6CA 2ZOHA 1LSWA 2YKFA 4L9EA 4R70A 5IU1A 3T50A 2W27A 1S1YA 1VB6A 3A0SA 4WN5A 4RQ9A 2J80A 1S67L 2BASA 3K3DA 2V0UA 3BWLA 3MR0A 4PKYA 2P7JA 1OTIA 1Y28A 2PDRA 2VV7A 4GHIA 1EW0A 1S4RA 3H7WA 1X0OA 3HJKA 4GW9A 4I3JA 5HWTA 4BBTA 5HWWA 1T18A 4HY8A 4I3IA 3CWFA 2GJ3A 4GCZA 3E4PA 5DJUA 3LICA 2I9VA 3FG8A 3ICYA 4KQDA 4NXGA 4EW7A 4JGRA 4HP4A 5G4ZA 1DP9A 1OTEA 3F1NA 4HH3A 5HWVA 5HZHA 3IBRA 2L0WA 4WLAA 1T1BA 3LUQA 4GHIB 2OWJA 4LPZA 1F9IA 3NHQA 5J3WA 1V9YA 3VE4A 2KDKA 2PHYA 1LSVA 1OTBA 2JN7A 2WKRA 4EXOA 4WUJA 4KUKA 5I5LA 3KX0X 2VEAA 4EEUA 3H82B 5HSQA 1LL8A 4JGOA 1S66L 5TBMB 2CMNA 2M1CA 2VLGA 5KIZA 2JHEA 1T1CA 2V1AA 3LIEA 4HOIA 4HQAA 3LIAA 3F1PB 1D06A 2QWSA 3E4QA 2HV1A 1OT6A 4LLOB 4LRYC 3RH8B 5J7EA 1TS8A 3BY8A 3SW1A 4F3LB 3P7NA 3LYXA 5F5YA 4L9FA 4HNBA 5HDCA 5J4EA 2YKHA 3GDIA 5TBMA 2V9AA 3B33A 2Z6DA 5EFWA 4KUOA 2B02A 4R38A 4R6LA 3NOUC 5F6AA 3UE6A 4JGPA 2K7SA 1MZUA 1OJ5A 3LI8A 5HDSA 2KX6A 1P0ZA 2W0NA 3NJAA 1GSVA 2D02A 3MQOA 5DKLA 4F3LA 4DJ2A 2PR5A 4HH2A 5AVFA 5HD3A 4LRXC 4H6JA 3VOLA 1JNUA 3IS2A 5F68A 1DP8A 5A8BA 1WA9A 3LIDA 1DRMA 1GSWA 3NOTC 3PYPA 3UB6A 4BBVA 3BY9A 5IS1A 3MXQA 4R3AA 1XJ4A 2D01A 2PYPA 3C8CA 1TS0A 3F1PA 1S4SA 4E04A 1LSXA 2QHKA 3LIBA 5G4YA 3NOPC 4I5SA 1TS7A 2V1BA 4WF0A 1P97A 1ODVA 3H9WA 4I38A 4XT2A 3A0VA 3F1OB 3CLOA 1XJ3A 4NXBA 3UB8A 3ULFA 2QJ7A 2QKPA 4MN6A 2VV8A 3UMEA
chains in the Genus database with same CATH superfamily
1N9LA 1NWZA 4KG5A 4EV4A 5CGSA 4S2MA 3A3FA 2Y2KA 1FR6A 5HDDA 4O7DA 1PZOA 2H28A 3E2KA 1IYOA 4H6JB 3G4PA 4X1LA 4CLCE 1LT0A 3E2LA 1E3UD 4D60A 5HD5A 1DP6A 5EE8A 3MF0A 5E2GA 3ZG0A 3M6BA 4N1XA 3HUMA 2PRFA 1KOUA 2Y79A 2H5SA 4BD0A 4E3KA 1LSWA 3IF6B 4KG2A 4HBUA 3ISGA 2P7JA 1NY0A 4DE3A 3TSGA 1G6OA 3LFVA 3FZCA 4KQDA 2ZQCA 3OCNA 1Q2QA 2L0WA 4WLAA 5A91A 1ZG6A 4Y0OA 3SZTA 1P9WA 1K6RA 4WUJA 3FPVA 1G6AA 4JKTA 5TBMB 2M1CA 3Q7VB 1LI9A 3CPTA 4HOIA 3ZVWA 3LY4A 2EX2A 2WGWA 2O9AA 4LLOB 1OT6A 2XLNA 5CHUA 3C30A 2V9AA 2Z6DA 4KUOA 1YLZA 2PAVP 1EI5A 5EV0A 3IF6A 5F82A 3T1RA 4DDYA 1GSVA 5DKLA 1CEGA 2J7VA 2Y2QA 1K25A 4OOMA 3ZG8B 2QJ7A 4NXBA 3N8LA 2OV5A 4UQIS 1N9NA 1FSYA 4EETB 1FCOA 4GOGA 2O99A 3BLSA 5FAPA 2X01A 1BLSA 4KG6A 1D7EA 4ETXA 3L9KA 3V5MA 2HF6A 2PD7A 3VMAA 3T4KA 2ZD8A 1MY8A 2NUTC 3DWKA 4UHUA 4B93A 4R70A 4Y0UA 1PNEA 4QU3A 5FA7A 2J3TD 1G5UA 4I3JA 3PBOA 3C4OA 3NBLA 3R7WA 5L09A 1U60A 4KZ7A 3VE4A 3LUQA 3VOLA 2IWDA 1LHYA 4MDZA 3S7OA 5KIZA 3NULA 1T1CA 3LIEA 5CEBA 2XF3A 5FI2A 3TOIA 5FAOA 3GSGA 4JGPA 4UA6A 4GB7A 4WBGA 4DKIA 2XFTA 1ERQA 1VEUB 4XUXA 2D02A 1RP5A 2PR5A 5A92A 4E3NA 4OQGA 1LL5A 2XFSA 4DXCA 4KQOA 1RGYA 3BY9A 2V8CA 2D01A 2PYPA 3C8CA 4GKUA 4E04A 1BUEA 1NYMA 4S2JA 1DJAA 1XXMA 1PWGA 3UMEA 4DE2A 5E43A 3UB9A 1L0EA 1UWNX 5K5BA 3JYIA 4PM9A 1W63M 3M6HA 2ZC3B 1NJ4A 3DTMA 4MBFA 3S22A 1K6SA 2ZC6B 4Q0JA 1ALQA 3OPHA 3F1OA 2ZQ8A 4OPZA 1HLUP 3H82A 2JE5A 4QHCA 1ERMA 1ACFA 1YMSA 2VJWA 5DTTA 4K08A 4HJ3A 3MZFA 4RYEA 5CRFA 1WE4A 3Q7VA 1K4EA 4EBNA 3A0SA 4ID4A 3UNWA 2VGJA 1I2SA 3NECA 4CLCC 4FTXA 3UPPA 3HUNA 3OCLA 1D1JA 2B5RA 3HUOA 4BBTA 4OVDA 4PM5A 4GCZA 4MBKA 3MSHA 5FQJA 3CMZA 3D9YA 4LV3A 4LCLA 3C7VA 3NHQA 4N1HA 1WYCA 2XSSA 4X6TA 3H82B 2VLGA 3HLDA 2JHEA 5FI7A 1H8ZA 3K2NA 5M19A 2VGLS 4R0QA 2IWCA 3BQAA 3VSLA 3WWXA 3MQOA 1CQAA 3KO6A 1AXBA 4GLQA 5KSHA 2DNSA 3VP0A 4I5SA 3EGXC 4WZ4A 4IUHA 3ZFZA 4C3QA 1E25A 2VV8A 4K0WA 3R7WB 3T4TA 5DF7A 1XA7A 2OLUA 4ESPA 2G2UA 5JYOA 1DY6A 4Z9QA 1KGEA 4UEYA 2L4RA 4Y0TA 4MNRA 2XR0A 3NC8A 4B4XA 1ESIA 3G32A 3PAEA 4C75A 4WZ5C 4G3WA 3P01A 1BYWA 4IHQA 2HJEA 3ZYTA 4HIAA 1H5XA 1G28A 1XFQA 1SDNA 1CF0A 1YLTA 2Z6CA 1TDLA 2ZOHA 2KOIA 2H0YA 5IU1A 4BJPA 2W27A 4WN5A 1S67L 2PDRA 3EGDC 1T18A 4I3IA 3TE8A 2GJ3A 5EVIC 2XD1A 3A3DA 3LCEA 2WKEA 4GNUA 1E4DA 1OTBA 1Z09A 3FKWA 2BTFP 3C5AA 1JWZA 5E2HA 4U0TA 1IELA 1D06A 2QWSA 1W8YA 4RA7A 3UN7A 3HCYA 1GA9A 1F5MA 1K56A 2W0NA 3RXWA 1YPRA 1BLCA 1YM1A 1K55A 4ME4A 1PWCA 4R3BA 1H8MA 4WM9A 2V20A 2RCXA 3M2KA 1HZOA 3SS3A 1ODVA 3A0VA 4IVKA 3ULFA 4MN6A 3V39A 3WS2A 4IUKA 2OOLA 5EECA 2PR6A 3LI9A 2Y2LA 4PM7A 3S7QA 2VGLM 2G7UA 3Q82A 3MFDA 5EVIA 5CECA 3OLOA 1MPLA 1J9MA 3MZEA 2OAP1 4LRZE 1AWIA 3KYEA 1ONHA 5EPHA 3O3VA 2W1TA 5EM0A 3IHAA 5HPFA 4KZ8A 2JCHA 4EUVA 4B9OA 3ZG9B 5CEDA 5E2FA 1S1YA 1VB6A 4B88A 3SOIA 1Y28A 2LB5A 4HY8A 1HVBA 1RGZA 3IHBA 2I9VA 4Q0HA 4HP4A 3F1NA 4HH3A 3ZG5A 5C5KA 3HL9A 3TRCA 5HSQA 4S2NA 2A3UA 4O0PA 4WEJA 3KX0X 2A2LA 3N6IA 4EQIA 5AJGA 1SZVA 1SKFA 2XQZA 3RH8B 4JXGA 3PTEA 4OQ0A 5EFWA 4EUZA 2B02A 4R38A 4R6LA 1MZUA 2EX8A 2W3GA 4JXSA 4KZ5A 5HAPA 2P74A 2JKTM 5AVFA 1JNUA 3IS2A 4GD8A 4HBTA 2WKIA 5G4YA 3DBAA 2OSUA 1WYBA 1K57A 3T4SA 4KQQA 2WZZA 3T4QA 2IWBA 2FZ0A 3MFXA 3C2WA 4XT2B 5AQ7A 2P04A 3G6OA 3EWKA 4P6BA 4P87A 1T1AA 1K57C 2FFYA 4UQIM 2EXBA 5CXWA 2QYBA 1MWSA 2Y2PA 3GR2A 3H7WB 4DJ3A 3Q07A 3BQ8A 2WAEA 1EROA 2BLSA 3LR0A 4M4XA 5FDHA 1JTDA 3UB7A 1YLJA 5L07A 2P08A 3BYDA 4R4SA 1ES2A 3O5YA 2Y8HA 3VFHA 5HWWA 5CTNA 1ONGA 3BFCA 4HESA 3VP3A 1ZHHB 4UA9A 4NETA 2ZL1B 4S2NC 2FFFB 2GNXA 4RX2A 4EXOA 1V9YA 1K4FA 5DFXA 3ZNTA 2R9XA 1BSGA 2Y59A 2V1AA 4X1MA 2EFXA 4DRTA 3B3XA 1ESUA 4KQRA 1TS8A 4X25A 4JF5A 5HDCA 4H8RA 2M7VA 3C7UA 5TBMA 1Z6FA 3FKVA 3NOUC 1W79A 4OLDA 3S7NA 3B42A 4HH2A 5D3OA 3EOIA 5F68A 4YOFA 3GTCA 3FV7A 4NK3A 3PYPA 3HLBA 1LSXA 3ZHHA 1PW8A 1N4OA 3S4XA 3UB8A 4KZ4A 2ZC5B 1HD8A 1V9ZA 4R23A 2L1MA 3HLGA 3ZG7B 3K3CA 3DTIA 3MKEA 5AVEA 4OP5A 4LV1A 2Y2MA 3IS2B 3IXDA 3UE0A 3ZVTA 3ZDJA 1XGIA 2HP5A 5EM1A 4IEDA 5I94A 1JWPA 4AFIA 3UMDA 4A5RA 1GA0A 2WKPA 1XP4A 3ITAA 4FSFA 2XH9A 1K55C 4Y13A 4WMCD 4HI4A 2XEPA 1STZA 4Q8IA 3VE3A 2UWXA 1KVMA 5IT5A 4GDBA 3SH9A 3T50A 3WRTA 4RQ9A 1LI0A 5FL3A 3K3DA 2W3HA 5HWTA 3H7WA 5FSRA 2OLVA 2LB9A 4XUZA 4IBRA 1IOUA 1GHPA 2Q0OA 1NRJA 1MBLA 3ICYA 3OC2A 5G4ZA 1FIKA 1S0WA 5HZHA 1YLWA 4ZJ2A 1NXYA 1F9IA 3QP8A 4Y17A 2WKRA 3RJUA 4F94A 2XRNA 2J9PA 3IT9A 2BG1A 2K31A 2HV1A 4S2KA 3P7NA 2HP6A 4HNBA 1KDWA 4OH0A 5FQMA 2Y2GA 3NJAA 4LFUA 3WS0A 3JPUA 3T1XA 2G2WA 4UAAA 3LIDA 4XXRA 3CLOA 5AQAA 3BW6A 2P9VA 1ZC2A 4EBLA 4OOLA 3PXPA 4FOFA 1IFQA 3EQVA 4L0LA 2J9OA 3PBTA 3LIFA 1A0KA 1VETA 2ZMFA 4I39A 4Y2FA 1S6RA 3RTYA 1N9OA 1TD5A 3CJMA 4C6YA 3MJQA 5HL6A 3UPOA 2EA9A 4ZDXA 3HLCA 4MCWA 1FCNA 1BULA 3PBNA 2EXAA 5GLDA 1IKGA 4GN2A 3IXBA 3BM6A 1TDGA 2MJ6A 1K54A 5GHZA 1MXOA 3RFBA 3CITA 4GDNA 5GLAA 4YFMA 4E3LA 4DE0A 1IKIA 4O8GA 4OKPA 2H0TA 1T1BA 3V67A 2JN7A 1O7EA 2O9BA 2M7UA 5M18A 2WZXA 1LL8A 2RL3A 1CI9A 3LIAA 3E4QA 1ZG4A 1JTGA 1FOFA 4E3IA 1SKOB 3TW8A 1JVJA 3GDIA 3ZNYA 4DE1A 3LR4A 3PBRA 5KSCA 1CEFA 5HDSA 2KX6A 3MS6A 4F3LA 3LY3A 4QD4A 1TF1A 4LRXC 3UE3A 1LLBA 3UB6A 2DMWA 4JLFA 4Y15A 4S2IA 3CHWP 2Q9NA 1UWPX 1XGJA 3BRMA 4CLCD 1F98A 4N92A 5F69A 1YMXA 3GECA 1TS6A 3O86A 5HL1A 4HJ6A 2Y91A 2WADA 2KLIA 3O87A 4EERA 4KZ6A 4CJNA 4RX3A 2W1RA 4CQHA 2ZOIA 3S7PA 3G34A 3QP6A 4E6WA 2WAFA 2W1TB 3IQAA 3FC7A 2K2NA 3NDGA 2YKFA 4LV0A 4S2LA 4JF4A 3U4LP 2V8FA 2J80A 1L0DA 3QP2A 2XGNA 1TVFA 5CHMA 5FQ9A 3WS5A 3Q81A 1SCWA 5U47A 1MWUA 2J3WA 1H3QA 4LPZA 4DMZA 2W3EA 4ARZA 2VEAA 2NUPC 5J8XA 3MKFA 5FQIA 2XA7S 5EVIB 4KZBA 4QWOA 3KSIA 4QY5A 3LGOA 2JBFA 5E2EA 3U2AA 1W8QA 3MXRA 1SDEA 1SKOA 2PT7A 3LR5A 3A3IA 3VSKA 4DJ2A 2HDRA 5GHXA 4O01A 1BZAA 1DRMA 4U3TA 3KSGA 3BFDA 4P0MA 4ZJ3A 2QHKA 4S2PA 3NOPC 3PR6A 4OLGA 2VA0A 2C6WB 3BJNA 2JKRI 4BMWA 3OOVA 4E3OA 5A93A 1F2KA 2EX9A 1IYSA 2ZQAA 2W3DA 1GSXA 3B47A 4NXFA 1PIOA 2IA2A 3R4KA 4BD1A 1TEMA 1UGUA 4B4ZA 5DF8A 4WMCA 3VP1A 2UV0E 1T19A 4PPRA 4ETZA 3F1NB 5IHVA 1FCMA 1YLYA 3D72A 5TGFA 4EWFA 3D3OA 3D4FA 3E4OA 5EOEA 1KDSA 4P6ZS 3IF6C 3QNBA 2QJ5A 4PM8A 4X68A 4DN0A 3IWIA 2Y2JA 3UDXA 5MC7A 5DJUA 4RVAA 1L0FA 1YQSA 4WELA 1KE0A 4EW7A 4OPYA 3T1SA 2ZJ9A 2HDQA 5J3WA 1NYYA 2HP9A 2KDKA 4PAUA 5FATA 2JKGA 2Z2MB 1S66L 3W2ZA 3PAGA 5F1FA 5HX9A 4P85A 5CHJA 1PRQA 2ZQDA 2ZM2A 3VP4A 3IH9A 3TJZC 1W5DA 1ZTUA 3GMWA 4Y7PA 2HZ5A 3W8KA 4MN7A 3FPWA 5HD3A 4CLCB 4NKPA 1DP8A 1PWDA 2VZWA 1BLPA 3QHYA 4WEKA 3NDEA 4BLMA 2HDSA 1MKIA 3CG5A 4ZTKA 3JVVA 3NI9A 3G2YA 5JYPA 4EEPA 5HARA 4I3AA 4HJ4A 2WK0A 2ZBBA 5DKKA 3VFFA 3SH7A 1FQGA 5L2FA 3DAVA 4L9GA 2VX8A 4X56A 3IXGA 3UY6A 1JWVA 4MEZA 4X69A 3KYZA 1XJ2A 4FD8A 2J3TC 4JBFA 4HP9A 2WKHA 3HLWA 5FAQA 3ZGAB 2HPBA 2HGVA 3HLEA 2HJ9C 3WS1A 2WGVA 2ZM0A 1S4RA 2ZQ7A 3HJKA 3IBJA 5L8MA 3Q7ZA 2H10A 5DF9A 1DJCA 1KE3A 3V3SA 1YSQA 2C5WB 2B95A 2ZC4B 3ITBA 1LSVA 5EVLA 1M6KA 3GVBA 4KUKA 3W4QA 1W7FA 5CTMA 4JGOA 2V2FF 2ZQ9A 2Y2HA 5EOOA 3BY8A 3N4IA 2X02A 4K91A 4QPRA 2GX5A 1VHMA 4E3MA 4KZ3A 3LI8A 1PFLA 3L7HA 1VQQA 5DTKA 1QMEA 2JKRM 4FUWA 1WA9A 1IYPA 3VOZA 4UA7A 3HVFA 1TS0A 2E8JA 3DTKA 3JVUA 1TS7A 3H9WA 3IX3A 1KE4A 1XJ6A 2INWA 4NEED 4NXEA 4P6ZM 3NCKA 3ZQ5A 2XK1A 3QP4A 3C4PA 4GS9B 3DTEA 2FH5A 4OPQA 3EQUA 1I5QA 1XA1A 5HW3A 4OQHA 3AGFA 4IBXA 1K38A 2PD8A 1XPBA 4CLCA 3A3EA 5LBRA 1YLPA 1KVLA 5A90A 2ACGA 1L2SA 4X55A 4ZRRA 1OTIA 1MKMA 3OPRA 3CWFA 3MXSA 3AGEA 4JGRA 3CUEC 5GL9A 2WYXA 3MMHA 4MMNA 5HAQA 5DTSA 1YT4A 4BWIA 2PHYA 2ZMVA 4LGWA 1GCEA 3KSFA 3G30A 5L10A 3P09A 1YAXA 5TJJA 4DDSA 4EBPA 3B33A 2PU4A 3UE6A 1GHMA 4Y5FA 4JXVA 3IX8A 1NZUA 1PZPA 4OONA 2XROA 3HLFA 1E3UA 4MLLA 1YKDA 1HTZA 1ES3A 2CC1A 3NOTC 4DXBA 4QY6A 3G2ZA 2E8IA 3T4JA 2V1BA 4WF0A 3AGDA 5TFQA 4DF6A 3QNCA 3OPPA 1EWZA 5HPIA 4HEFA 4PM6A 3IH8A 4R4RA 3VOYA 2V1ZA 2OWHA 1I2WA 3MQQA 3WRZA 1ES4A 1BTLA 5GLBA 3N8SA 3PHYA 5CX7A 3S1YA 2A24B 4PHTA 4R3JA 1BT5A 3CPTB 4YWZA 3BFGA 2B18A 5KMWA 1OT9A 5CGWA 3KYQA 5M1AA 3LEQA 1OTAA 2EX6A 1MWRA 2VV6A 4X53A 5FDSA 2R78A 1OTDA 4R1GA 2HDUA 1BLHA 3WS4A 4ZAMA 2DRWA 3NY4A 5F83A 5EUAA 3LR3A 4ZBEA 4GHIA 4E6XA 4GJ4A 4QB8A 2GDNA 1ES5A 2A49A 1Y4OA 1Y54A 3FG8A 1KGGA 5G18A 5HWVA 3OBFA 2VK3A 1C3BA 2ZMAA 2EWVA 3CI6A 4GZBA 2CMNA 1H8YA 3IX4A 4HQAA 2ZC7A 3LEZA 2ZLYA 4S2OA 1CJFA 2VGKA 3BFEA 4F3LB 3SW1A 2X71A 4MBHA 1FR1A 1O07A 2O0YA 1P0ZA 1KGFA 3CZDA 1XX2A 2VKSA 4II7A 5A8BA 1M40A 2XD5A 4FH2A 3VP2A 4EU0A 3QP5A 1XJ3A 3O88A 1IEMA 1P9RA 4WZ5A 2A24A 2XDMA 3Q1FA 4HHDA 3HBRA 4GS9A 4BL3A 1VETB 3FYZA 4YINA 3T4OA 3HJIA 4OQIA 3DWZA 3N7WA 4FH4A 1MC0A 1GHIA 3FWLA 2WUQA 2W3FA 4LCMA 4BQMA 5DJTA 3I7JA 2PYRA 3M2JA 2OAQ1 1NLZA 1XFNA 2QZ6A 3DW0A 2WKQA 2GZAA 4NG2A 3SH8A 4BL2A 5DVAA 4QJGA 5FQQA 1DJBA 2JC7A 3BWLA 3MR0A 4PKYA 3TG9A 3BEBA 1X0OA 2Y4AA 5FASA 4OOYA 3G31A 4NXGA 2PU2A 1FSWA 1PI4A 5FEFA 4EEUA 4ZJ1A 5FQKA 2O9CA 1LL9A 3GRJA 4BENA 3GV9A 4LRYC 4L9FA 5KZHA 2Y2NA 2PBYA 1PW1A 4IJGA 3IWQA 1K54C 4LV2A 2JKFA 3UE1A 1H0MA 1PYYA 4Q0IA 2QPNA 5BOHA 4R3AA 2DCFA 2AVXA 3LIBA 4G3KA 2EFUA 4XT2A 4KZ9A 3V3RA 1FILA 3OPLA 5HFOA 3W4OA 4WL9A 4JXWA 2QMIA 2I72A 3A0RA 5DFYA 4JGQA 4G3VA 4MN5A 3V50A 4BBUA 3BFFA 3ZCZA 5TR7A 3T12B 2Y2OA 1NRFA 4Z1WA 3SS5A 4E3JA 3IXHA 4K0XA 4PKYG 2WGIA 2WGWB 1K56D 4N9KA 1IYQA 4L9EA 5AQ9A 1NZOA 2BASA 1VEUA 2V0UA 2VV7A 5AQBA 4GD6A 4OPRA 1CI8A 3P98A 3E4PA 3GQZA 1QMFA 5GLCA 3PBSA 4GHIB 1YSPA 1ZKJA 4EESA 3OZHA 3MZDA 3UDIA 4JPMA 2J8YA 1OPXA 3KSHA 2JKTI 3LYXA 5F5YA 5EVEA 3BLMA 2YKHA 3RXXA 2Y2IA 3BECA 4JF6A 4CPKA 4PMAA 3VV4A 4D2OA 4H6JA 3E98A 4Y3IA 1Q2PA 3MQ0A 5IS1A 1J3WA 1XJ4A 5FEGA 4N9LA 5CERA 1NLYA 4I38A 3F1OB 3E0YA 2XA7M 4ARZB 4M3KA 4OP8A 4EQ1A 3C38A 1S1ZA 3G35A 3CAXA 1CK3A 3EEHA 4IVIA 3UDFA 3MBZA 1VM1A 3UO9A 3EEAA 1L0GA 3T4LA 5CGXA 1OJGA 2EWWA 2V0WA 3SS4A 1XKZA 2ZL1A 1SHVA 2ZM8A 1PI5A 5GHYA 4GW9A 1EW0A 4KZAA 3UB5P 3HREA 5FI6A 1MWTA 3QP1A 3T1QB 3A3JA 1OMEA 3W4PA 3LICA 4FCFA 1DP9A 1OTEA 3IBRA 2OWJA 4LENA 4KENB 2Z2LB 4YNRA 5I5LA 1W63Q 5F1GA 2Y55A 1G68A 3IF5A 2Q9MA 3LO7A 1N9BA 4U0XA 3F1PB 5J7EA 1K0KA 2R9WA 5J4EA 3CUEA 5F6AA 2K7SA 1OJ5A 5EVID 3PBQA 1RCJA 2PBDP 1GSWA 4BBVA 3IWOA 3MXQA 4WYYA 3F1PA 1S4SA 1P97A 5HAIA 2P9VB 3UPNA 1L3LA 3NIAA 2QKPA 3N8RA
chains in the Genus database with same CATH topology
1N9LA 4IUKA 1NWZA 2OOLA 1UWPX 2PR6A 4CLCD 1F98A 2OWHA 3LI9A 3MQQA 5F69A 5HDDA 2H28A 3GECA 2VGLM 3PHYA 3S7QA 5CX7A 2G7UA 1TS6A 4HJ6A 2KLIA 2A24B 4H6JB 4PHTA 4EERA 4CLCE 1LT0A 3OLOA 4YWZA 2OAP1 4LRZE 2B18A 2W1RA 5HD5A 1DP6A 1OT9A 3MF0A 2W1TA 3KYQA 4CQHA 2ZOIA 1OTAA 3S7PA 5HPFA 2VV6A 1KOUA 4EUVA 4B9OA 2Y79A 2W1TB 2R78A 1OTDA 3FC7A 2K2NA 1LSWA 2YKFA 1S1YA 1VB6A 2J80A 2P7JA 3LR3A 1Y28A 4GHIA 4GJ4A 2LB5A 4HY8A 1G6OA 2I9VA 3LFVA 4Q0HA 3FG8A 4KQDA 4HP4A 3F1NA 2J3WA 4HH3A 5HWVA 1H3QA 3OCNA 5C5KA 3OBFA 2L0WA 4WLAA 4LPZA 3TRCA 4DMZA 5HSQA 1P9WA 2W3EA 4O0PA 4WUJA 2EWVA 4ARZA 3CI6A 3FPVA 2VEAA 3KX0X 4WEJA 2A2LA 2NUPC 5TBMB 2XA7S 2CMNA 2M1CA 4HOIA 4HQAA 5AJGA 2O9AA 4LLOB 1OT6A 3RH8B 3KSIA 3SW1A 4F3LB 3C30A 2V9AA 2Z6DA 5EFWA 4KUOA 2B02A 4R38A 4R6LA 1MZUA 3U2AA 2O0YA 1P0ZA 2W3GA 2PT7A 3LR5A 1GSVA 5DKLA 4DJ2A 2JKTM 5AVFA 2VKSA 1JNUA 4II7A 4O01A 3IS2A 5A8BA 1DRMA 3KSGA 4EU0A 2QHKA 5G4YA 3NOPC 3PR6A 3DBAA 2VA0A 4OOMA 1XJ3A 3BJNA 2QJ7A 1P9RA 4NXBA 2JKRI 3T4SA 2A24A 3OOVA 3T4QA 4BMWA 4HHDA 2FZ0A 3MFXA 1N9NA 3C2WA 4UQIS 4XT2B 2P04A 3G6OA 3EWKA 4EETB 4GS9A 2W3DA 1GSXA 3B47A 4NXFA 1T1AA 2IA2A 3R4KA 3T4OA 3HJIA 2O99A 4UQIM 1UGUA 2QYBA 3H7WB 4DJ3A 1MC0A 1T19A 1D7EA 3BQ8A 4ETXA 2HF6A 2W3FA 4ETZA 3F1NB 5DJTA 3D72A 2PD7A 3T4KA 3D3OA 3E4OA 2PYRA 3LR0A 2OAQ1 4P6ZS 1NLZA 4M4XA 1XFNA 2WKQA 2GZAA 3UB7A 2QJ5A 2NUTC 4B93A 4R70A 2P08A 3O5YA 4DN0A 3BWLA 3MR0A 4PKYA 2Y8HA 2J3TD 1X0OA 4I3JA 3PBOA 5HWWA 5MC7A 5DJUA 1ZHHB 4NXGA 4WELA 4EW7A 3R7WA 2GNXA 5J3WA 3LUQA 3VE4A 3VOLA 4EXOA 1V9YA 2KDKA 5DFXA 4EEUA 4PAUA 4MDZA 1S66L 2O9CA 3S7OA 3W2ZA 5KIZA 1T1CA 2V1AA 3LIEA 4LRYC 1TS8A 4L9FA 5HDCA 2M7VA 3TJZC 5TBMA 3NOUC 4IJGA 4JGPA 1ZTUA 3S7NA 2D02A 4MN7A 3B42A 2PR5A 3FPWA 4HH2A 5HD3A 4CLCB 4NKPA 3EOIA 5F68A 1DP8A 4KQOA 4Q0IA 4YOFA 3PYPA 3BY9A 2VZWA 4R3AA 2D01A 2PYPA 3C8CA 4WEKA 4E04A 1LSXA 3LIBA 4G3KA 3JVVA 4XT2A 3UB8A 3UMEA 3UB9A 4EEPA 1UWNX 1V9ZA 5K5BA 1W63M 4I3AA 2L1MA 4HJ4A 4WL9A 2ZBBA 3K3CA 5DKKA 5AVEA 4Q0JA 3A0RA 3IS2B 4L9GA 5DFYA 4JGQA 4G3VA 4MN5A 4BBUA 3F1OA 4AFIA 2VX8A 3UMDA 3H82A 2WKPA 4FSFA 4Z1WA 3KYZA 1XJ2A 2VJWA 4HI4A 4K08A 4PKYG 4HJ3A 2J3TC 1STZA 4HP9A 3VE3A 2HGVA 2HJ9C 5IT5A 3T50A 4L9EA 3A0SA 4RQ9A 5FL3A 2BASA 3K3DA 2V0UA 4CLCC 2W3HA 2VV7A 3OCLA 5HWTA 1S4RA 3H7WA 3HJKA 4BBTA 3IBJA 5L8MA 2LB9A 4GCZA 3E4PA 5DF9A 1IOUA 1NRJA 3ICYA 3OC2A 5G4ZA 3PBSA 1YSQA 5HZHA 4GHIB 1F9IA 1YSPA 3NHQA 4EESA 1LSVA 2WKRA 4KUKA 2XRNA 2XSSA 3H82B 4JGOA 2VLGA 2JHEA 1OPXA 2K31A 3KSHA 2HV1A 2JKTI 3BY8A 3P7NA 3LYXA 5F5YA 4HNBA 4QPRA 2GX5A 2YKHA 3K2NA 1VHMA 2VGLS 3LI8A 3NJAA 3BQAA 3VV4A 3MQOA 4H6JA 2JKRM 3E98A 4Y3IA 1WA9A 3KO6A 3LIDA 3MQ0A 4GLQA 5IS1A 5KSHA 1XJ4A 1TS0A 1NLYA 3JVUA 4I5SA 1TS7A 3EGXC 3H9WA 4IUHA 4I38A 3F1OB 3CLOA 3E0YA 2XA7M 2VV8A 4ARZB 3BW6A 3R7WB 1XJ6A 3T4TA 2INWA 4NEED 4NXEA 4P6ZM 4EQ1A 3C38A 4OOLA 1S1ZA 3ZQ5A 3PXPA 4FOFA 1IFQA 3EQVA 4L0LA 3PBTA 4UEYA 3LIFA 2ZMFA 2L4RA 3CAXA 4I39A 4Y2FA 4GS9B 3EEHA 2FH5A 3RTYA 1N9OA 1TD5A 3EQUA 4G3WA 3P01A 1BYWA 3MJQA 4IHQA 2HJEA 3EEAA 3T4LA 3ZYTA 5HL6A 4HIAA 1OJGA 2EA9A 1G28A 2EWWA 1XFQA 2V0WA 4MCWA 2PD8A 3PBNA 4CLCA 5LBRA 2Z6CA 2ZOHA 2KOIA 5IU1A 4BJPA 2W27A 4WN5A 1S67L 2MJ6A 4ZRRA 1OTIA 1MKMA 2PDRA 4GW9A 3RFBA 1EW0A 3CITA 3EGDC 1T18A 4I3IA 3TE8A 3CWFA 2GJ3A 3LICA 4JGRA 3CUEC 1DP9A 1OTEA 4O8GA 3MMHA 4MMNA 3IBRA 1T1BA 2OWJA 3V67A 4BWIA 2PHYA 2JN7A 1OTBA 2O9BA 2M7UA 4YNRA 5I5LA 1W63Q 1LL8A 2ZMVA 3KSFA 3LIAA 3F1PB 1D06A 2QWSA 3E4QA 1YAXA 5J7EA 5TJJA 3TW8A 5J4EA 3GDIA 3B33A 3CUEA 3LR4A 3UE6A 3PBRA 5F6AA 4Y5FA 3HCYA 2K7SA 1OJ5A 5HDSA 1F5MA 2KX6A 2W0NA 4F3LA 2XROA 1TF1A 4LRXC 3PBQA 3UE3A 1YKDA 4ME4A 1GSWA 3NOTC 3UB6A 4BBVA 3MXQA 2DMWA 1H8MA 3F1PA 1S4SA 3T4JA 2V1BA 4WF0A 1P97A 1ODVA 3A0VA 3ULFA 2QKPA 4MN6A 5HPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 A;  1XJ6 A;  1N9L A;  2INW A;  3MFX A;  4HHD A;  1N9N A;  1NWZ A;  2OOL A;  3C2W A;  4XT2 B;  1UWN X;  1UWP X;  1V9Z A;  2PR6 A;  3UB9 A;  4EEP A;  3G6O A;  4NXE A;  1F98 A;  2OWH A;  3EWK A;  4I3A A;  2L1M A;  4EET B;  4EQ1 A;  3LI9 A;  1S1Z A;  3MQQ A;  4GS9 A;  1GSX A;  5F69 A;  4NXF A;  4HJ4 A;  5HDD A;  3ZQ5 A;  1T1A A;  4WL9 A;  2H28 A;  2ZBB A;  3GEC A;  3HJI A;  3K3C A;  3PHY A;  5DKK A;  1TS6 A;  5AVE A;  3A0R A;  3LIF A;  1UGU A;  3IS2 B;  4HJ6 A;  4L9G A;  2L4R A;  3CAX A;  4I39 A;  4H6J B;  2A24 B;  4GS9 B;  4JGQ A;  4EER A;  3EEH A;  4MN5 A;  3H7W B;  1LT0 A;  3RTY A;  3F1O A;  3OLO A;  4BBU A;  4DJ3 A;  1N9O A;  4YWZ A;  3UMD A;  1T19 A;  3H82 A;  4LRZ E;  1D7E A;  1BYW A;  3MJQ A;  2WKP A;  5HD5 A;  1DP6 A;  1OT9 A;  3F1N B;  4HIA A;  2ZOI A;  3D72 A;  1OTA A;  1OJG A;  2EA9 A;  1G28 A;  2PD7 A;  5DJT A;  1XFQ A;  2V0W A;  1XJ2 A;  4HI4 A;  3E4O A;  4K08 A;  4PKY G;  2PD8 A;  2VV6 A;  4HJ3 A;  1KOU A;  2PYR A;  4B9O A;  4HP9 A;  4EES A;  4M4X A;  2R78 A;  1XFN A;  1OTD A;  3FC7 A;  2WKQ A;  3UB7 A;  3VE3 A;  2QJ5 A;  2Z6C A;  2ZOH A;  1LSW A;  2YKF A;  4L9E A;  4R70 A;  5IU1 A;  3T50 A;  2W27 A;  1S1Y A;  1VB6 A;  3A0S A;  4WN5 A;  4RQ9 A;  2J80 A;  1S67 L;  2BAS A;  3K3D A;  2V0U A;  3BWL A;  3MR0 A;  4PKY A;  2P7J A;  1OTI A;  1Y28 A;  2PDR A;  2VV7 A;  4GHI A;  1EW0 A;  1S4R A;  3H7W A;  1X0O A;  3HJK A;  4GW9 A;  4I3J A;  5HWT A;  4BBT A;  5HWW A;  1T18 A;  4HY8 A;  4I3I A;  3CWF A;  2GJ3 A;  4GCZ A;  3E4P A;  5DJU A;  3LIC A;  2I9V A;  3FG8 A;  3ICY A;  4KQD A;  4NXG A;  4EW7 A;  4JGR A;  4HP4 A;  5G4Z A;  1DP9 A;  1OTE A;  3F1N A;  4HH3 A;  5HWV A;  5HZH A;  3IBR A;  2L0W A;  4WLA A;  1T1B A;  3LUQ A;  4GHI B;  2OWJ A;  4LPZ A;  1F9I A;  3NHQ A;  5J3W A;  1V9Y A;  3VE4 A;  2KDK A;  2PHY A;  1LSV A;  1OTB A;  2JN7 A;  2WKR A;  4EXO A;  4WUJ A;  4KUK A;  5I5L A;  3KX0 X;  2VEA A;  4EEU A;  3H82 B;  5HSQ A;  1LL8 A;  4JGO A;  1S66 L;  5TBM B;  2CMN A;  2M1C A;  2VLG A;  5KIZ A;  2JHE A;  1T1C A;  2V1A A;  3LIE A;  4HOI A;  4HQA A;  3LIA A;  3F1P B;  1D06 A;  2QWS A;  3E4Q A;  2HV1 A;  1OT6 A;  4LLO B;  4LRY C;  3RH8 B;  5J7E A;  1TS8 A;  3BY8 A;  3SW1 A;  4F3L B;  3P7N A;  3LYX A;  5F5Y A;  4L9F A;  4HNB A;  5HDC A;  5J4E A;  2YKH A;  3GDI A;  5TBM A;  2V9A A;  3B33 A;  2Z6D A;  5EFW A;  4KUO A;  2B02 A;  4R38 A;  4R6L A;  3NOU C;  5F6A A;  3UE6 A;  4JGP A;  2K7S A;  1MZU A;  1OJ5 A;  3LI8 A;  5HDS A;  2KX6 A;  1P0Z A;  2W0N A;  3NJA A;  1GSV A;  2D02 A;  3MQO A;  5DKL A;  4F3L A;  4DJ2 A;  2PR5 A;  4HH2 A;  5AVF A;  5HD3 A;  4LRX C;  4H6J A;  3VOL A;  1JNU A;  3IS2 A;  5F68 A;  1DP8 A;  5A8B A;  1WA9 A;  3LID A;  1DRM A;  1GSW A;  3NOT C;  3PYP A;  3UB6 A;  4BBV A;  3BY9 A;  5IS1 A;  3MXQ A;  4R3A A;  1XJ4 A;  2D01 A;  2PYP A;  3C8C A;  1TS0 A;  3F1P A;  1S4S A;  4E04 A;  1LSX A;  2QHK A;  3LIB A;  5G4Y A;  3NOP C;  4I5S A;  1TS7 A;  2V1B A;  4WF0 A;  1P97 A;  1ODV A;  3H9W A;  4I38 A;  4XT2 A;  3A0V A;  3F1O B;  3CLO A;  1XJ3 A;  4NXB A;  3UB8 A;  3ULF A;  2QJ7 A;  2QKP A;  4MN6 A;  2VV8 A;  3UME A; 
#chains in the Genus database with same CATH topology
 1N9L A;  1NWZ A;  4KG5 A;  4EV4 A;  5CGS A;  4S2M A;  3A3F A;  2Y2K A;  1FR6 A;  5HDD A;  4O7D A;  1PZO A;  2H28 A;  3E2K A;  1IYO A;  4H6J B;  3G4P A;  4X1L A;  4CLC E;  1LT0 A;  3E2L A;  1E3U D;  4D60 A;  5HD5 A;  1DP6 A;  5EE8 A;  3MF0 A;  5E2G A;  3ZG0 A;  3M6B A;  4N1X A;  3HUM A;  2PRF A;  1KOU A;  2Y79 A;  2H5S A;  4BD0 A;  4E3K A;  1LSW A;  3IF6 B;  4KG2 A;  4HBU A;  3ISG A;  2P7J A;  1NY0 A;  4DE3 A;  3TSG A;  1G6O A;  3LFV A;  3FZC A;  4KQD A;  2ZQC A;  3OCN A;  1Q2Q A;  2L0W A;  4WLA A;  5A91 A;  1ZG6 A;  4Y0O A;  3SZT A;  1P9W A;  1K6R A;  4WUJ A;  3FPV A;  1G6A A;  4JKT A;  5TBM B;  2M1C A;  3Q7V B;  1LI9 A;  3CPT A;  4HOI A;  3ZVW A;  3LY4 A;  2EX2 A;  2WGW A;  2O9A A;  4LLO B;  1OT6 A;  2XLN A;  5CHU A;  3C30 A;  2V9A A;  2Z6D A;  4KUO A;  1YLZ A;  2PAV P;  1EI5 A;  5EV0 A;  3IF6 A;  5F82 A;  3T1R A;  4DDY A;  1GSV A;  5DKL A;  1CEG A;  2J7V A;  2Y2Q A;  1K25 A;  4OOM A;  3ZG8 B;  2QJ7 A;  4NXB A;  3N8L A;  2OV5 A;  4UQI S;  1N9N A;  1FSY A;  4EET B;  1FCO A;  4GOG A;  2O99 A;  3BLS A;  5FAP A;  2X01 A;  1BLS A;  4KG6 A;  1D7E A;  4ETX A;  3L9K A;  3V5M A;  2HF6 A;  2PD7 A;  3VMA A;  3T4K A;  2ZD8 A;  1MY8 A;  2NUT C;  3DWK A;  4UHU A;  4B93 A;  4R70 A;  4Y0U A;  1PNE A;  4QU3 A;  5FA7 A;  2J3T D;  1G5U A;  4I3J A;  3PBO A;  3C4O A;  3NBL A;  3R7W A;  5L09 A;  1U60 A;  4KZ7 A;  3VE4 A;  3LUQ A;  3VOL A;  2IWD A;  1LHY A;  4MDZ A;  3S7O A;  5KIZ A;  3NUL A;  1T1C A;  3LIE A;  5CEB A;  2XF3 A;  5FI2 A;  3TOI A;  5FAO A;  3GSG A;  4JGP A;  4UA6 A;  4GB7 A;  4WBG A;  4DKI A;  2XFT A;  1ERQ A;  1VEU B;  4XUX A;  2D02 A;  1RP5 A;  2PR5 A;  5A92 A;  4E3N A;  4OQG A;  1LL5 A;  2XFS A;  4DXC A;  4KQO A;  1RGY A;  3BY9 A;  2V8C A;  2D01 A;  2PYP A;  3C8C A;  4GKU A;  4E04 A;  1BUE A;  1NYM A;  4S2J A;  1DJA A;  1XXM A;  1PWG A;  3UME A;  4DE2 A;  5E43 A;  3UB9 A;  1L0E A;  1UWN X;  5K5B A;  3JYI A;  4PM9 A;  1W63 M;  3M6H A;  2ZC3 B;  1NJ4 A;  3DTM A;  4MBF A;  3S22 A;  1K6S A;  2ZC6 B;  4Q0J A;  1ALQ A;  3OPH A;  3F1O A;  2ZQ8 A;  4OPZ A;  1HLU P;  3H82 A;  2JE5 A;  4QHC A;  1ERM A;  1ACF A;  1YMS A;  2VJW A;  5DTT A;  4K08 A;  4HJ3 A;  3MZF A;  4RYE A;  5CRF A;  1WE4 A;  3Q7V A;  1K4E A;  4EBN A;  3A0S A;  4ID4 A;  3UNW A;  2VGJ A;  1I2S A;  3NEC A;  4CLC C;  4FTX A;  3UPP A;  3HUN A;  3OCL A;  1D1J A;  2B5R A;  3HUO A;  4BBT A;  4OVD A;  4PM5 A;  4GCZ A;  4MBK A;  3MSH A;  5FQJ A;  3CMZ A;  3D9Y A;  4LV3 A;  4LCL A;  3C7V A;  3NHQ A;  4N1H A;  1WYC A;  2XSS A;  4X6T A;  3H82 B;  2VLG A;  3HLD A;  2JHE A;  5FI7 A;  1H8Z A;  3K2N A;  5M19 A;  2VGL S;  4R0Q A;  2IWC A;  3BQA A;  3VSL A;  3WWX A;  3MQO A;  1CQA A;  3KO6 A;  1AXB A;  4GLQ A;  5KSH A;  2DNS A;  3VP0 A;  4I5S A;  3EGX C;  4WZ4 A;  4IUH A;  3ZFZ A;  4C3Q A;  1E25 A;  2VV8 A;  4K0W A;  3R7W B;  3T4T A;  5DF7 A;  1XA7 A;  2OLU A;  4ESP A;  2G2U A;  5JYO A;  1DY6 A;  4Z9Q A;  1KGE A;  4UEY A;  2L4R A;  4Y0T A;  4MNR A;  2XR0 A;  3NC8 A;  4B4X A;  1ESI A;  3G32 A;  3PAE A;  4C75 A;  4WZ5 C;  4G3W A;  3P01 A;  1BYW A;  4IHQ A;  2HJE A;  3ZYT A;  4HIA A;  1H5X A;  1G28 A;  1XFQ A;  1SDN A;  1CF0 A;  1YLT A;  2Z6C A;  1TDL A;  2ZOH A;  2KOI A;  2H0Y A;  5IU1 A;  4BJP A;  2W27 A;  4WN5 A;  1S67 L;  2PDR A;  3EGD C;  1T18 A;  4I3I A;  3TE8 A;  2GJ3 A;  5EVI C;  2XD1 A;  3A3D A;  3LCE A;  2WKE A;  4GNU A;  1E4D A;  1OTB A;  1Z09 A;  3FKW A;  2BTF P;  3C5A A;  1JWZ A;  5E2H A;  4U0T A;  1IEL A;  1D06 A;  2QWS A;  1W8Y A;  4RA7 A;  3UN7 A;  3HCY A;  1GA9 A;  1F5M A;  1K56 A;  2W0N A;  3RXW A;  1YPR A;  1BLC A;  1YM1 A;  1K55 A;  4ME4 A;  1PWC A;  4R3B A;  1H8M A;  4WM9 A;  2V20 A;  2RCX A;  3M2K A;  1HZO A;  3SS3 A;  1ODV A;  3A0V A;  4IVK A;  3ULF A;  4MN6 A;  3V39 A;  3WS2 A;  4IUK A;  2OOL A;  5EEC A;  2PR6 A;  3LI9 A;  2Y2L A;  4PM7 A;  3S7Q A;  2VGL M;  2G7U A;  3Q82 A;  3MFD A;  5EVI A;  5CEC A;  3OLO A;  1MPL A;  1J9M A;  3MZE A;  2OAP 1;  4LRZ E;  1AWI A;  3KYE A;  1ONH A;  5EPH A;  3O3V A;  2W1T A;  5EM0 A;  3IHA A;  5HPF A;  4KZ8 A;  2JCH A;  4EUV A;  4B9O A;  3ZG9 B;  5CED A;  5E2F A;  1S1Y A;  1VB6 A;  4B88 A;  3SOI A;  1Y28 A;  2LB5 A;  4HY8 A;  1HVB A;  1RGZ A;  3IHB A;  2I9V A;  4Q0H A;  4HP4 A;  3F1N A;  4HH3 A;  3ZG5 A;  5C5K A;  3HL9 A;  3TRC A;  5HSQ A;  4S2N A;  2A3U A;  4O0P A;  4WEJ A;  3KX0 X;  2A2L A;  3N6I A;  4EQI A;  5AJG A;  1SZV A;  1SKF A;  2XQZ A;  3RH8 B;  4JXG A;  3PTE A;  4OQ0 A;  5EFW A;  4EUZ A;  2B02 A;  4R38 A;  4R6L A;  1MZU A;  2EX8 A;  2W3G A;  4JXS A;  4KZ5 A;  5HAP A;  2P74 A;  2JKT M;  5AVF A;  1JNU A;  3IS2 A;  4GD8 A;  4HBT A;  2WKI A;  5G4Y A;  3DBA A;  2OSU A;  1WYB A;  1K57 A;  3T4S A;  4KQQ A;  2WZZ A;  3T4Q A;  2IWB A;  2FZ0 A;  3MFX A;  3C2W A;  4XT2 B;  5AQ7 A;  2P04 A;  3G6O A;  3EWK A;  4P6B A;  4P87 A;  1T1A A;  1K57 C;  2FFY A;  4UQI M;  2EXB A;  5CXW A;  2QYB A;  1MWS A;  2Y2P A;  3GR2 A;  3H7W B;  4DJ3 A;  3Q07 A;  3BQ8 A;  2WAE A;  1ERO A;  2BLS A;  3LR0 A;  4M4X A;  5FDH A;  1JTD A;  3UB7 A;  1YLJ A;  5L07 A;  2P08 A;  3BYD A;  4R4S A;  1ES2 A;  3O5Y A;  2Y8H A;  3VFH A;  5HWW A;  5CTN A;  1ONG A;  3BFC A;  4HES A;  3VP3 A;  1ZHH B;  4UA9 A;  4NET A;  2ZL1 B;  4S2N C;  2FFF B;  2GNX A;  4RX2 A;  4EXO A;  1V9Y A;  1K4F A;  5DFX A;  3ZNT A;  2R9X A;  1BSG A;  2Y59 A;  2V1A A;  4X1M A;  2EFX A;  4DRT A;  3B3X A;  1ESU A;  4KQR A;  1TS8 A;  4X25 A;  4JF5 A;  5HDC A;  4H8R A;  2M7V A;  3C7U A;  5TBM A;  1Z6F A;  3FKV A;  3NOU C;  1W79 A;  4OLD A;  3S7N A;  3B42 A;  4HH2 A;  5D3O A;  3EOI A;  5F68 A;  4YOF A;  3GTC A;  3FV7 A;  4NK3 A;  3PYP A;  3HLB A;  1LSX A;  3ZHH A;  1PW8 A;  1N4O A;  3S4X A;  3UB8 A;  4KZ4 A;  2ZC5 B;  1HD8 A;  1V9Z A;  4R23 A;  2L1M A;  3HLG A;  3ZG7 B;  3K3C A;  3DTI A;  3MKE A;  5AVE A;  4OP5 A;  4LV1 A;  2Y2M A;  3IS2 B;  3IXD A;  3UE0 A;  3ZVT A;  3ZDJ A;  1XGI A;  2HP5 A;  5EM1 A;  4IED A;  5I94 A;  1JWP A;  4AFI A;  3UMD A;  4A5R A;  1GA0 A;  2WKP A;  1XP4 A;  3ITA A;  4FSF A;  2XH9 A;  1K55 C;  4Y13 A;  4WMC D;  4HI4 A;  2XEP A;  1STZ A;  4Q8I A;  3VE3 A;  2UWX A;  1KVM A;  5IT5 A;  4GDB A;  3SH9 A;  3T50 A;  3WRT A;  4RQ9 A;  1LI0 A;  5FL3 A;  3K3D A;  2W3H A;  5HWT A;  3H7W A;  5FSR A;  2OLV A;  2LB9 A;  4XUZ A;  4IBR A;  1IOU A;  1GHP A;  2Q0O A;  1NRJ A;  1MBL A;  3ICY A;  3OC2 A;  5G4Z A;  1FIK A;  1S0W A;  5HZH A;  1YLW A;  4ZJ2 A;  1NXY A;  1F9I A;  3QP8 A;  4Y17 A;  2WKR A;  3RJU A;  4F94 A;  2XRN A;  2J9P A;  3IT9 A;  2BG1 A;  2K31 A;  2HV1 A;  4S2K A;  3P7N A;  2HP6 A;  4HNB A;  1KDW A;  4OH0 A;  5FQM A;  2Y2G A;  3NJA A;  4LFU A;  3WS0 A;  3JPU A;  3T1X A;  2G2W A;  4UAA A;  3LID A;  4XXR A;  3CLO A;  5AQA A;  3BW6 A;  2P9V A;  1ZC2 A;  4EBL A;  4OOL A;  3PXP A;  4FOF A;  1IFQ A;  3EQV A;  4L0L A;  2J9O A;  3PBT A;  3LIF A;  1A0K A;  1VET A;  2ZMF A;  4I39 A;  4Y2F A;  1S6R A;  3RTY A;  1N9O A;  1TD5 A;  3CJM A;  4C6Y A;  3MJQ A;  5HL6 A;  3UPO A;  2EA9 A;  4ZDX A;  3HLC A;  4MCW A;  1FCN A;  1BUL A;  3PBN A;  2EXA A;  5GLD A;  1IKG A;  4GN2 A;  3IXB A;  3BM6 A;  1TDG A;  2MJ6 A;  1K54 A;  5GHZ A;  1MXO A;  3RFB A;  3CIT A;  4GDN A;  5GLA A;  4YFM A;  4E3L A;  4DE0 A;  1IKI A;  4O8G A;  4OKP A;  2H0T A;  1T1B A;  3V67 A;  2JN7 A;  1O7E A;  2O9B A;  2M7U A;  5M18 A;  2WZX A;  1LL8 A;  2RL3 A;  1CI9 A;  3LIA A;  3E4Q A;  1ZG4 A;  1JTG A;  1FOF A;  4E3I A;  1SKO B;  3TW8 A;  1JVJ A;  3GDI A;  3ZNY A;  4DE1 A;  3LR4 A;  3PBR A;  5KSC A;  1CEF A;  5HDS A;  2KX6 A;  3MS6 A;  4F3L A;  3LY3 A;  4QD4 A;  1TF1 A;  4LRX C;  3UE3 A;  1LLB A;  3UB6 A;  2DMW A;  4JLF A;  4Y15 A;  4S2I A;  3CHW P;  2Q9N A;  1UWP X;  1XGJ A;  3BRM A;  4CLC D;  1F98 A;  4N92 A;  5F69 A;  1YMX A;  3GEC A;  1TS6 A;  3O86 A;  5HL1 A;  4HJ6 A;  2Y91 A;  2WAD A;  2KLI A;  3O87 A;  4EER A;  4KZ6 A;  4CJN A;  4RX3 A;  2W1R A;  4CQH A;  2ZOI A;  3S7P A;  3G34 A;  3QP6 A;  4E6W A;  2WAF A;  2W1T B;  3IQA A;  3FC7 A;  2K2N A;  3NDG A;  2YKF A;  4LV0 A;  4S2L A;  4JF4 A;  3U4L P;  2V8F A;  2J80 A;  1L0D A;  3QP2 A;  2XGN A;  1TVF A;  5CHM A;  5FQ9 A;  3WS5 A;  3Q81 A;  1SCW A;  5U47 A;  1MWU A;  2J3W A;  1H3Q A;  4LPZ A;  4DMZ A;  2W3E A;  4ARZ A;  2VEA A;  2NUP C;  5J8X A;  3MKF A;  5FQI A;  2XA7 S;  5EVI B;  4KZB A;  4QWO A;  3KSI A;  4QY5 A;  3LGO A;  2JBF A;  5E2E A;  3U2A A;  1W8Q A;  3MXR A;  1SDE A;  1SKO A;  2PT7 A;  3LR5 A;  3A3I A;  3VSK A;  4DJ2 A;  2HDR A;  5GHX A;  4O01 A;  1BZA A;  1DRM A;  4U3T A;  3KSG A;  3BFD A;  4P0M A;  4ZJ3 A;  2QHK A;  4S2P A;  3NOP C;  3PR6 A;  4OLG A;  2VA0 A;  2C6W B;  3BJN A;  2JKR I;  4BMW A;  3OOV A;  4E3O A;  5A93 A;  1F2K A;  2EX9 A;  1IYS A;  2ZQA A;  2W3D A;  1GSX A;  3B47 A;  4NXF A;  1PIO A;  2IA2 A;  3R4K A;  4BD1 A;  1TEM A;  1UGU A;  4B4Z A;  5DF8 A;  4WMC A;  3VP1 A;  2UV0 E;  1T19 A;  4PPR A;  4ETZ A;  3F1N B;  5IHV A;  1FCM A;  1YLY A;  3D72 A;  5TGF A;  4EWF A;  3D3O A;  3D4F A;  3E4O A;  5EOE A;  1KDS A;  4P6Z S;  3IF6 C;  3QNB A;  2QJ5 A;  4PM8 A;  4X68 A;  4DN0 A;  3IWI A;  2Y2J A;  3UDX A;  5MC7 A;  5DJU A;  4RVA A;  1L0F A;  1YQS A;  4WEL A;  1KE0 A;  4EW7 A;  4OPY A;  3T1S A;  2ZJ9 A;  2HDQ A;  5J3W A;  1NYY A;  2HP9 A;  2KDK A;  4PAU A;  5FAT A;  2JKG A;  2Z2M B;  1S66 L;  3W2Z A;  3PAG A;  5F1F A;  5HX9 A;  4P85 A;  5CHJ A;  1PRQ A;  2ZQD A;  2ZM2 A;  3VP4 A;  3IH9 A;  3TJZ C;  1W5D A;  1ZTU A;  3GMW A;  4Y7P A;  2HZ5 A;  3W8K A;  4MN7 A;  3FPW A;  5HD3 A;  4CLC B;  4NKP A;  1DP8 A;  1PWD A;  2VZW A;  1BLP A;  3QHY A;  4WEK A;  3NDE A;  4BLM A;  2HDS A;  1MKI A;  3CG5 A;  4ZTK A;  3JVV A;  3NI9 A;  3G2Y A;  5JYP A;  4EEP A;  5HAR A;  4I3A A;  4HJ4 A;  2WK0 A;  2ZBB A;  5DKK A;  3VFF A;  3SH7 A;  1FQG A;  5L2F A;  3DAV A;  4L9G A;  2VX8 A;  4X56 A;  3IXG A;  3UY6 A;  1JWV A;  4MEZ A;  4X69 A;  3KYZ A;  1XJ2 A;  4FD8 A;  2J3T C;  4JBF A;  4HP9 A;  2WKH A;  3HLW A;  5FAQ A;  3ZGA B;  2HPB A;  2HGV A;  3HLE A;  2HJ9 C;  3WS1 A;  2WGV A;  2ZM0 A;  1S4R A;  2ZQ7 A;  3HJK A;  3IBJ A;  5L8M A;  3Q7Z A;  2H10 A;  5DF9 A;  1DJC A;  1KE3 A;  3V3S A;  1YSQ A;  2C5W B;  2B95 A;  2ZC4 B;  3ITB A;  1LSV A;  5EVL A;  1M6K A;  3GVB A;  4KUK A;  3W4Q A;  1W7F A;  5CTM A;  4JGO A;  2V2F F;  2ZQ9 A;  2Y2H A;  5EOO A;  3BY8 A;  3N4I A;  2X02 A;  4K91 A;  4QPR A;  2GX5 A;  1VHM A;  4E3M A;  4KZ3 A;  3LI8 A;  1PFL A;  3L7H A;  1VQQ A;  5DTK A;  1QME A;  2JKR M;  4FUW A;  1WA9 A;  1IYP A;  3VOZ A;  4UA7 A;  3HVF A;  1TS0 A;  2E8J A;  3DTK A;  3JVU A;  1TS7 A;  3H9W A;  3IX3 A;  1KE4 A;  1XJ6 A;  2INW A;  4NEE D;  4NXE A;  4P6Z M;  3NCK A;  3ZQ5 A;  2XK1 A;  3QP4 A;  3C4P A;  4GS9 B;  3DTE A;  2FH5 A;  4OPQ A;  3EQU A;  1I5Q A;  1XA1 A;  5HW3 A;  4OQH A;  3AGF A;  4IBX A;  1K38 A;  2PD8 A;  1XPB A;  4CLC A;  3A3E A;  5LBR A;  1YLP A;  1KVL A;  5A90 A;  2ACG A;  1L2S A;  4X55 A;  4ZRR A;  1OTI A;  1MKM A;  3OPR A;  3CWF A;  3MXS A;  3AGE A;  4JGR A;  3CUE C;  5GL9 A;  2WYX A;  3MMH A;  4MMN A;  5HAQ A;  5DTS A;  1YT4 A;  4BWI A;  2PHY A;  2ZMV A;  4LGW A;  1GCE A;  3KSF A;  3G30 A;  5L10 A;  3P09 A;  1YAX A;  5TJJ A;  4DDS A;  4EBP A;  3B33 A;  2PU4 A;  3UE6 A;  1GHM A;  4Y5F A;  4JXV A;  3IX8 A;  1NZU A;  1PZP A;  4OON A;  2XRO A;  3HLF A;  1E3U A;  4MLL A;  1YKD A;  1HTZ A;  1ES3 A;  2CC1 A;  3NOT C;  4DXB A;  4QY6 A;  3G2Z A;  2E8I A;  3T4J A;  2V1B A;  4WF0 A;  3AGD A;  5TFQ A;  4DF6 A;  3QNC A;  3OPP A;  1EWZ A;  5HPI A;  4HEF A;  4PM6 A;  3IH8 A;  4R4R A;  3VOY A;  2V1Z A;  2OWH A;  1I2W A;  3MQQ A;  3WRZ A;  1ES4 A;  1BTL A;  5GLB A;  3N8S A;  3PHY A;  5CX7 A;  3S1Y A;  2A24 B;  4PHT A;  4R3J A;  1BT5 A;  3CPT B;  4YWZ A;  3BFG A;  2B18 A;  5KMW A;  1OT9 A;  5CGW A;  3KYQ A;  5M1A A;  3LEQ A;  1OTA A;  2EX6 A;  1MWR A;  2VV6 A;  4X53 A;  5FDS A;  2R78 A;  1OTD A;  4R1G A;  2HDU A;  1BLH A;  3WS4 A;  4ZAM A;  2DRW A;  3NY4 A;  5F83 A;  5EUA A;  3LR3 A;  4ZBE A;  4GHI A;  4E6X A;  4GJ4 A;  4QB8 A;  2GDN A;  1ES5 A;  2A49 A;  1Y4O A;  1Y54 A;  3FG8 A;  1KGG A;  5G18 A;  5HWV A;  3OBF A;  2VK3 A;  1C3B A;  2ZMA A;  2EWV A;  3CI6 A;  4GZB A;  2CMN A;  1H8Y A;  3IX4 A;  4HQA A;  2ZC7 A;  3LEZ A;  2ZLY A;  4S2O A;  1CJF A;  2VGK A;  3BFE A;  4F3L B;  3SW1 A;  2X71 A;  4MBH A;  1FR1 A;  1O07 A;  2O0Y A;  1P0Z A;  1KGF A;  3CZD A;  1XX2 A;  2VKS A;  4II7 A;  5A8B A;  1M40 A;  2XD5 A;  4FH2 A;  3VP2 A;  4EU0 A;  3QP5 A;  1XJ3 A;  3O88 A;  1IEM A;  1P9R A;  4WZ5 A;  2A24 A;  2XDM A;  3Q1F A;  4HHD A;  3HBR A;  4GS9 A;  4BL3 A;  1VET B;  3FYZ A;  4YIN A;  3T4O A;  3HJI A;  4OQI A;  3DWZ A;  3N7W A;  4FH4 A;  1MC0 A;  1GHI A;  3FWL A;  2WUQ A;  2W3F A;  4LCM A;  4BQM A;  5DJT A;  3I7J A;  2PYR A;  3M2J A;  2OAQ 1;  1NLZ A;  1XFN A;  2QZ6 A;  3DW0 A;  2WKQ A;  2GZA A;  4NG2 A;  3SH8 A;  4BL2 A;  5DVA A;  4QJG A;  5FQQ A;  1DJB A;  2JC7 A;  3BWL A;  3MR0 A;  4PKY A;  3TG9 A;  3BEB A;  1X0O A;  2Y4A A;  5FAS A;  4OOY A;  3G31 A;  4NXG A;  2PU2 A;  1FSW A;  1PI4 A;  5FEF A;  4EEU A;  4ZJ1 A;  5FQK A;  2O9C A;  1LL9 A;  3GRJ A;  4BEN A;  3GV9 A;  4LRY C;  4L9F A;  5KZH A;  2Y2N A;  2PBY A;  1PW1 A;  4IJG A;  3IWQ A;  1K54 C;  4LV2 A;  2JKF A;  3UE1 A;  1H0M A;  1PYY A;  4Q0I A;  2QPN A;  5BOH A;  4R3A A;  2DCF A;  2AVX A;  3LIB A;  4G3K A;  2EFU A;  4XT2 A;  4KZ9 A;  3V3R A;  1FIL A;  3OPL A;  5HFO A;  3W4O A;  4WL9 A;  4JXW A;  2QMI A;  2I72 A;  3A0R A;  5DFY A;  4JGQ A;  4G3V A;  4MN5 A;  3V50 A;  4BBU A;  3BFF A;  3ZCZ A;  5TR7 A;  3T12 B;  2Y2O A;  1NRF A;  4Z1W A;  3SS5 A;  4E3J A;  3IXH A;  4K0X A;  4PKY G;  2WGI A;  2WGW B;  1K56 D;  4N9K A;  1IYQ A;  4L9E A;  5AQ9 A;  1NZO A;  2BAS A;  1VEU A;  2V0U A;  2VV7 A;  5AQB A;  4GD6 A;  4OPR A;  1CI8 A;  3P98 A;  3E4P A;  3GQZ A;  1QMF A;  5GLC A;  3PBS A;  4GHI B;  1YSP A;  1ZKJ A;  4EES A;  3OZH A;  3MZD A;  3UDI A;  4JPM A;  2J8Y A;  1OPX A;  3KSH A;  2JKT I;  3LYX A;  5F5Y A;  5EVE A;  3BLM A;  2YKH A;  3RXX A;  2Y2I A;  3BEC A;  4JF6 A;  4CPK A;  4PMA A;  3VV4 A;  4D2O A;  4H6J A;  3E98 A;  4Y3I A;  1Q2P A;  3MQ0 A;  5IS1 A;  1J3W A;  1XJ4 A;  5FEG A;  4N9L A;  5CER A;  1NLY A;  4I38 A;  3F1O B;  3E0Y A;  2XA7 M;  4ARZ B;  4M3K A;  4OP8 A;  4EQ1 A;  3C38 A;  1S1Z A;  3G35 A;  3CAX A;  1CK3 A;  3EEH A;  4IVI A;  3UDF A;  3MBZ A;  1VM1 A;  3UO9 A;  3EEA A;  1L0G A;  3T4L A;  5CGX A;  1OJG A;  2EWW A;  2V0W A;  3SS4 A;  1XKZ A;  2ZL1 A;  1SHV A;  2ZM8 A;  1PI5 A;  5GHY A;  4GW9 A;  1EW0 A;  4KZA A;  3UB5 P;  3HRE A;  5FI6 A;  1MWT A;  3QP1 A;  3T1Q B;  3A3J A;  1OME A;  3W4P A;  3LIC A;  4FCF A;  1DP9 A;  1OTE A;  3IBR A;  2OWJ A;  4LEN A;  4KEN B;  2Z2L B;  4YNR A;  5I5L A;  1W63 Q;  5F1G A;  2Y55 A;  1G68 A;  3IF5 A;  2Q9M A;  3LO7 A;  1N9B A;  4U0X A;  3F1P B;  5J7E A;  1K0K A;  2R9W A;  5J4E A;  3CUE A;  5F6A A;  2K7S A;  1OJ5 A;  5EVI D;  3PBQ A;  1RCJ A;  2PBD P;  1GSW A;  4BBV A;  3IWO A;  3MXQ A;  4WYY A;  3F1P A;  1S4S A;  1P97 A;  5HAI A;  2P9V B;  3UPN A;  1L3L A;  3NIA A;  2QKP A;  3N8R A; 
#chains in the Genus database with same CATH homology
 1N9L A;  4IUK A;  1NWZ A;  2OOL A;  1UWP X;  2PR6 A;  4CLC D;  1F98 A;  2OWH A;  3LI9 A;  3MQQ A;  5F69 A;  5HDD A;  2H28 A;  3GEC A;  2VGL M;  3PHY A;  3S7Q A;  5CX7 A;  2G7U A;  1TS6 A;  4HJ6 A;  2KLI A;  2A24 B;  4H6J B;  4PHT A;  4EER A;  4CLC E;  1LT0 A;  3OLO A;  4YWZ A;  2OAP 1;  4LRZ E;  2B18 A;  2W1R A;  5HD5 A;  1DP6 A;  1OT9 A;  3MF0 A;  2W1T A;  3KYQ A;  4CQH A;  2ZOI A;  1OTA A;  3S7P A;  5HPF A;  2VV6 A;  1KOU A;  4EUV A;  4B9O A;  2Y79 A;  2W1T B;  2R78 A;  1OTD A;  3FC7 A;  2K2N A;  1LSW A;  2YKF A;  1S1Y A;  1VB6 A;  2J80 A;  2P7J A;  3LR3 A;  1Y28 A;  4GHI A;  4GJ4 A;  2LB5 A;  4HY8 A;  1G6O A;  2I9V A;  3LFV A;  4Q0H A;  3FG8 A;  4KQD A;  4HP4 A;  3F1N A;  2J3W A;  4HH3 A;  5HWV A;  1H3Q A;  3OCN A;  5C5K A;  3OBF A;  2L0W A;  4WLA A;  4LPZ A;  3TRC A;  4DMZ A;  5HSQ A;  1P9W A;  2W3E A;  4O0P A;  4WUJ A;  2EWV A;  4ARZ A;  3CI6 A;  3FPV A;  2VEA A;  3KX0 X;  4WEJ A;  2A2L A;  2NUP C;  5TBM B;  2XA7 S;  2CMN A;  2M1C A;  4HOI A;  4HQA A;  5AJG A;  2O9A A;  4LLO B;  1OT6 A;  3RH8 B;  3KSI A;  3SW1 A;  4F3L B;  3C30 A;  2V9A A;  2Z6D A;  5EFW A;  4KUO A;  2B02 A;  4R38 A;  4R6L A;  1MZU A;  3U2A A;  2O0Y A;  1P0Z A;  2W3G A;  2PT7 A;  3LR5 A;  1GSV A;  5DKL A;  4DJ2 A;  2JKT M;  5AVF A;  2VKS A;  1JNU A;  4II7 A;  4O01 A;  3IS2 A;  5A8B A;  1DRM A;  3KSG A;  4EU0 A;  2QHK A;  5G4Y A;  3NOP C;  3PR6 A;  3DBA A;  2VA0 A;  4OOM A;  1XJ3 A;  3BJN A;  2QJ7 A;  1P9R A;  4NXB A;  2JKR I;  3T4S A;  2A24 A;  3OOV A;  3T4Q A;  4BMW A;  4HHD A;  2FZ0 A;  3MFX A;  1N9N A;  3C2W A;  4UQI S;  4XT2 B;  2P04 A;  3G6O A;  3EWK A;  4EET B;  4GS9 A;  2W3D A;  1GSX A;  3B47 A;  4NXF A;  1T1A A;  2IA2 A;  3R4K A;  3T4O A;  3HJI A;  2O99 A;  4UQI M;  1UGU A;  2QYB A;  3H7W B;  4DJ3 A;  1MC0 A;  1T19 A;  1D7E A;  3BQ8 A;  4ETX A;  2HF6 A;  2W3F A;  4ETZ A;  3F1N B;  5DJT A;  3D72 A;  2PD7 A;  3T4K A;  3D3O A;  3E4O A;  2PYR A;  3LR0 A;  2OAQ 1;  4P6Z S;  1NLZ A;  4M4X A;  1XFN A;  2WKQ A;  2GZA A;  3UB7 A;  2QJ5 A;  2NUT C;  4B93 A;  4R70 A;  2P08 A;  3O5Y A;  4DN0 A;  3BWL A;  3MR0 A;  4PKY A;  2Y8H A;  2J3T D;  1X0O A;  4I3J A;  3PBO A;  5HWW A;  5MC7 A;  5DJU A;  1ZHH B;  4NXG A;  4WEL A;  4EW7 A;  3R7W A;  2GNX A;  5J3W A;  3LUQ A;  3VE4 A;  3VOL A;  4EXO A;  1V9Y A;  2KDK A;  5DFX A;  4EEU A;  4PAU A;  4MDZ A;  1S66 L;  2O9C A;  3S7O A;  3W2Z A;  5KIZ A;  1T1C A;  2V1A A;  3LIE A;  4LRY C;  1TS8 A;  4L9F A;  5HDC A;  2M7V A;  3TJZ C;  5TBM A;  3NOU C;  4IJG A;  4JGP A;  1ZTU A;  3S7N A;  2D02 A;  4MN7 A;  3B42 A;  2PR5 A;  3FPW A;  4HH2 A;  5HD3 A;  4CLC B;  4NKP A;  3EOI A;  5F68 A;  1DP8 A;  4KQO A;  4Q0I A;  4YOF A;  3PYP A;  3BY9 A;  2VZW A;  4R3A A;  2D01 A;  2PYP A;  3C8C A;  4WEK A;  4E04 A;  1LSX A;  3LIB A;  4G3K A;  3JVV A;  4XT2 A;  3UB8 A;  3UME A;  3UB9 A;  4EEP A;  1UWN X;  1V9Z A;  5K5B A;  1W63 M;  4I3A A;  2L1M A;  4HJ4 A;  4WL9 A;  2ZBB A;  3K3C A;  5DKK A;  5AVE A;  4Q0J A;  3A0R A;  3IS2 B;  4L9G A;  5DFY A;  4JGQ A;  4G3V A;  4MN5 A;  4BBU A;  3F1O A;  4AFI A;  2VX8 A;  3UMD A;  3H82 A;  2WKP A;  4FSF A;  4Z1W A;  3KYZ A;  1XJ2 A;  2VJW A;  4HI4 A;  4K08 A;  4PKY G;  4HJ3 A;  2J3T C;  1STZ A;  4HP9 A;  3VE3 A;  2HGV A;  2HJ9 C;  5IT5 A;  3T50 A;  4L9E A;  3A0S A;  4RQ9 A;  5FL3 A;  2BAS A;  3K3D A;  2V0U A;  4CLC C;  2W3H A;  2VV7 A;  3OCL A;  5HWT A;  1S4R A;  3H7W A;  3HJK A;  4BBT A;  3IBJ A;  5L8M A;  2LB9 A;  4GCZ A;  3E4P A;  5DF9 A;  1IOU A;  1NRJ A;  3ICY A;  3OC2 A;  5G4Z A;  3PBS A;  1YSQ A;  5HZH A;  4GHI B;  1F9I A;  1YSP A;  3NHQ A;  4EES A;  1LSV A;  2WKR A;  4KUK A;  2XRN A;  2XSS A;  3H82 B;  4JGO A;  2VLG A;  2JHE A;  1OPX A;  2K31 A;  3KSH A;  2HV1 A;  2JKT I;  3BY8 A;  3P7N A;  3LYX A;  5F5Y A;  4HNB A;  4QPR A;  2GX5 A;  2YKH A;  3K2N A;  1VHM A;  2VGL S;  3LI8 A;  3NJA A;  3BQA A;  3VV4 A;  3MQO A;  4H6J A;  2JKR M;  3E98 A;  4Y3I A;  1WA9 A;  3KO6 A;  3LID A;  3MQ0 A;  4GLQ A;  5IS1 A;  5KSH A;  1XJ4 A;  1TS0 A;  1NLY A;  3JVU A;  4I5S A;  1TS7 A;  3EGX C;  3H9W A;  4IUH A;  4I38 A;  3F1O B;  3CLO A;  3E0Y A;  2XA7 M;  2VV8 A;  4ARZ B;  3BW6 A;  3R7W B;  1XJ6 A;  3T4T A;  2INW A;  4NEE D;  4NXE A;  4P6Z M;  4EQ1 A;  3C38 A;  4OOL A;  1S1Z A;  3ZQ5 A;  3PXP A;  4FOF A;  1IFQ A;  3EQV A;  4L0L A;  3PBT A;  4UEY A;  3LIF A;  2ZMF A;  2L4R A;  3CAX A;  4I39 A;  4Y2F A;  4GS9 B;  3EEH A;  2FH5 A;  3RTY A;  1N9O A;  1TD5 A;  3EQU A;  4G3W A;  3P01 A;  1BYW A;  3MJQ A;  4IHQ A;  2HJE A;  3EEA A;  3T4L A;  3ZYT A;  5HL6 A;  4HIA A;  1OJG A;  2EA9 A;  1G28 A;  2EWW A;  1XFQ A;  2V0W A;  4MCW A;  2PD8 A;  3PBN A;  4CLC A;  5LBR A;  2Z6C A;  2ZOH A;  2KOI A;  5IU1 A;  4BJP A;  2W27 A;  4WN5 A;  1S67 L;  2MJ6 A;  4ZRR A;  1OTI A;  1MKM A;  2PDR A;  4GW9 A;  3RFB A;  1EW0 A;  3CIT A;  3EGD C;  1T18 A;  4I3I A;  3TE8 A;  3CWF A;  2GJ3 A;  3LIC A;  4JGR A;  3CUE C;  1DP9 A;  1OTE A;  4O8G A;  3MMH A;  4MMN A;  3IBR A;  1T1B A;  2OWJ A;  3V67 A;  4BWI A;  2PHY A;  2JN7 A;  1OTB A;  2O9B A;  2M7U A;  4YNR A;  5I5L A;  1W63 Q;  1LL8 A;  2ZMV A;  3KSF A;  3LIA A;  3F1P B;  1D06 A;  2QWS A;  3E4Q A;  1YAX A;  5J7E A;  5TJJ A;  3TW8 A;  5J4E A;  3GDI A;  3B33 A;  3CUE A;  3LR4 A;  3UE6 A;  3PBR A;  5F6A A;  4Y5F A;  3HCY A;  2K7S A;  1OJ5 A;  5HDS A;  1F5M A;  2KX6 A;  2W0N A;  4F3L A;  2XRO A;  1TF1 A;  4LRX C;  3PBQ A;  3UE3 A;  1YKD A;  4ME4 A;  1GSW A;  3NOT C;  3UB6 A;  4BBV A;  3MXQ A;  2DMW A;  1H8M A;  3F1P A;  1S4S A;  3T4J A;  2V1B A;  4WF0 A;  1P97 A;  1ODV A;  3A0V A;  3ULF A;  2QKP A;  4MN6 A;  5HPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...