4OPYA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Extended spectrum beta-lactamase TEM-63
total genus 99
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opyA00
3ISGA 1HVBA 2A49A 4HEFA 2RCXA 1KE4A 1MWSA 4LV0A 3G2YA 3HBRA 4WEKA 1KE3A 1RGYA 2HDRA 2PU4A 2A3UA 4BD1A 2Y2GA 4XUXA 4LV3A 5KZHA 5JYOA 3BFCA 5FI2A 4KQQA 2XQZA 2JC7A 4S2OA 3ZFZA 1BLHA 4KG5A 2ZQDA 2X01A 3SS4A 1JWZA 5TR7A 3BM6A 3Q82A 3AGDA 3ITAA 4LV1A 5FSRA 3ZDJA 2Y2HA 4QJGA 4JPMA 1ESUA 5CRFA 3IH9A 3G30A 4DXCA 4IBRA 1PI4A 2P9VA 5FQJA 3FKWA 4F94A 3UO9A 2IWDA 1K56D 1PI5A 5HAPA 3JYIA 2RL3A 4S2IA 2JBFA 5CHMA 4WM9A 3VSKA 1FQGA 4GD6A 4OPRA 2V1ZA 1FR6A 3HLEA 3IH8A 2FFFB 3LO7A 5KSCA 4S2NA 3V39A 3PBTA 1NZUA 1J9MA 3QNBA 2HDSA 5FQ9A 1IEMA 1K55C 2I72A 5GLCA 1ES3A 3S1YA 3WWXA 1PYYA 1CI9A 3PBQA 1CK3A 1FCNA 2Y2LA 3ZG7B 4NETA 1KGGA 1XP4A 1K38A 1E4DA 1FOFA 5JYPA 1ZG6A 2Y4AA 3G32A 4B4ZA 2ZM0A 3MKFA 3HLCA 5HAQA 4WZ5A 5CEBA 4ZJ3A 4RVAA 4K0WA 4Y7PA 3P09A 2WUQA 3C7VA 3G34A 5GLBA 2WKHA 4KQOA 3MZEA 3SS3A 2WGIA 2R9WA 4R23A 1YLJA 3HLGA 4MBFA 3GV9A 1EWZA 4DE3A 1YLTA 3FWLA 5FDHA 4UA7A 3Q7VA 3CMZA 1IYOA 4DE2A 3G35A 1DJBA 2WZXA 4P85A 3WS2A 1GHMA 3A3DA 3FKVA 4LCLA 4WMCA 4DXBA 3UDFA 1M40A 2XFSA 2UWXA 1ONGA 1MWRA 3IXDA 2Z2LB 1IKIA 1E3UD 2BG1A 1XA7A 5L2FA 4UA9A 3PAGA 2XD5A 4OLDA 1SDEA 5J8XA 3E2LA 2C6WB 4QY6A 4WMCD 3BRMA 3OZHA 3Q7ZA 5DF8A 5FQIA 3GSGA 3VP0A 1RGZA 2ZC5B 2CC1A 3LCEA 5FAQA 2XF3A 4N92A 1K56A 3N4IA 2VGKA 1VQQA 4DDYA 1XKZA 4OVDA 3VSLA 2ZQ8A 1GCEA 3GR2A 5FATA 5GHYA 5HL1A 3PBOA 3PAEA 3ZNTA 4BL2A 2H10A 1MWUA 3OCLA 4QY5A 2H0TA 5DF9A 3UPNA 1K55A 5FQQA 3ZG0A 4E3IA 3DWZA 2OLUA 5GHXA 3NDGA 1I5QA 3IF5A 4MNRA 1LL9A 4E3JA 4QU3A 4K0XA 1GHIA 3G31A 3VOYA 3RXXA 3O86A 4N1HA 3M6HA 3I7JA 2H5SA 2XGNA 4KQRA 1LLBA 1NXYA 1I2WA 4PMAA 3V50A 5FASA 4ID4A 5CTNA 4OQ0A 3HUOA 1ERMA 3QNCA 4QB8A 4LENA 3WS0A 3ZG9B 1PWCA 3Q7VB 3A3JA 1AXBA 2X71A 3NBLA 1NRFA 1S6RA 4S2LA 3HL9A 4S2MA 1RP5A 4H8RA 3VFHA 3FYZA 2XD1A 3UY6A 2JE5A 2EX9A 2H0YA 4FSFA 1TEMA 1U60A 4EV4A 4OP5A 1KE0A 3A3FA 2HP6A 4RA7A 3S4XA 3GMWA 4BQMA 3DTMA 3VP4A 1Q2QA 3IF6C 5GL9A 3W4QA 4R0QA 3AGEA 4R3BA 2ZC6B 3OPPA 3OPRA 1IKGA 2Y91A 3RXWA 3B3XA 5CHJA 2XFTA 1YLWA 2ZQ9A 4KZ6A 1RCJA 1SCWA 1ONHA 1XPBA 3GTCA 4WELA 3OPHA 1E3UA 1YLYA 2HP9A 3MXRA 4PPRA 4X69A 4S2PA 1IYPA 1GHPA 3OPLA 1NYYA 3OC2A 5AQ7A 2ZQCA 4UAAA 1DJCA 1ERQA 2ZM8A 3SH7A 1K4EA 3ITBA 2WK0A 1LI0A 3IF6B 3NC8A 4U3TA 4BD0A 3UDXA 4OPZA 3SS5A 1EI5A 1HZOA 1JVJA 1DJAA 1KDWA 1XX2A 1O07A 4JF6A 2Y2KA 3MXSA 5EVIA 3HLDA 3EQVA 2Y2OA 5GLDA 4DE0A 1NJ4A 1H8YA 3VFFA 3HLWA 3BYDA 3OCNA 5KMWA 3TSGA 3ZVTA 3IQAA 3V3RA 2HDUA 1BT5A 2HP5A 2XR0A 5EVID 2OLVA 3G4PA 2DNSA 3AGFA 1CI8A 1MBLA 4OPYA 5F1GA 1JWPA 1BULA 3NCKA 3PTEA 3W4OA 5FI6A 4R3JA 1KVLA 5A92A 2IWCA 5U47A 2P74A 1W5DA 1SDNA 3ZG5A 4U0TA 1WYCA 4OOMA 4DDSA 1K4FA 1DY6A 1K54A 3N8LA 1N9BA 2P9VB 4P87A 1QMEA 4B88A 4MBHA 3IHAA 4IBXA 4ZTKA 4X68A 5M18A 3Q07A 1LI9A 4KG6A 4GB7A 4E3LA 2Y59A 2PU2A 4N9KA 4QHCA 1YLZA 2Y2PA 3BFFA 1HD8A 1Z6FA 4JF4A 1L0GA 1SKFA 4OONA 1PZPA 1IYQA 3HLBA 4OP8A 4E3MA 4IVIA 2XH9A 2ZLYA 3C5AA 3HUMA 4S2JA 2DRWA 3A3IA 4RX2A 4CPKA 4K91A 4KZ5A 3S22A 4DF6A 3O87A 1FCMA 4OQHA 3D4FA 1KDSA 4JKTA 4RX3A 2WGWB 5TFQA 4ZDXA 2EFUA 4X56A 4GOGA 3C4PA 1KGEA 3CZDA 1BLCA 5EPHA 2WAFA 4KZ4A 4LCMA 4DE1A 5AQBA 5FAPA 1SHVA 1JTGA 2Y2JA 3M2JA 3SOIA 4EBNA 2OSUA 2ZMAA 1YT4A 5M19A 2Y55A 5CTMA 3BECA 3P98A 1FSWA 5DF7A 4DRTA 3UE1A 5EECA 1MXOA 5CHUA 2EX8A 4KZBA 4P6BA 4R4RA 1O7EA 1C3BA 4JF5A 4GDBA 3O88A 2XLNA 1JTDA 5KSHA 1ZC2A 3BFEA 1W8QA 1HTZA 1WE4A 3WS4A 3CJMA 2EXAA 2Y2IA 2QZ6A 3IWQA 4OQIA 3TOIA 1Y54A 1PW1A 4OLGA 2QMIA 3FZCA 4JXWA 1YMXA 1L0EA 1MKIA 3WS1A 4UHUA 5TGFA 3NY4A 5EOOA 4MBKA 4E6XA 4ZJ2A 5FQKA 3O3VA 5CXWA 1S0WA 2QPNA 4YINA 5AQ9A 5FI7A 1XGIA 4UA6A 3SH9A 3N6IA 4M3KA 3GQZA 1N4OA 1Q2PA 4PM6A 3SH8A 5E43A 5D3OA 1GA9A 4E3KA 1H5XA 1XGJA 3BFDA 3IXGA 3ZHHA 4JLFA 1W79A 4Q8IA 1H8ZA 4KZ8A 2X02A 1MPLA 4X6TA 2J9OA 4KZ9A 3M2KA 1YM1A 2WKEA 1YMSA 3WRTA 2WGWA 4C3QA 5EVLA 5FQMA 1ES4A 1YLPA 1K57A 4ZBEA 4FD8A 5CEDA 4PM7A 3UDIA 1ALQA 2G2WA 4Y0TA 1K25A 4BL3A 4OOYA 3W8KA 5IHVA 4D2OA 4CJNA 2WYXA 4RYEA 5F82A 4EBPA 2B5RA 1ES2A 2HPBA 4JXGA 3VP2A 3LEZA 1ESIA 5HX9A 3UE3A 4N9LA 5EVIB 2BLSA 2ZQAA 3ZG8B 4BLMA 1CEFA 3C4OA 5E2FA 3N7WA 1K54C 2J7VA 2JCHA 2VGJA 4GD8A 3UPPA 3E2KA 4YFMA 2EX6A 4GNUA 2C5WB 3TG9A 2V20A 4JXVA 5F1FA 4GKUA 2OV5A 3N8RA 1PZOA 1TDLA 3BLSA 4OPQA 3MBZA 4FH2A 4E6WA 5E2HA 4NK3A 3WRZA 3ZCZA 1TVFA 5BOHA 4LV2A 5GLAA 1EROA 2WZZA 3MZDA 5DTTA 3V5MA 4XUZA 1KGFA 4IVKA 4X53A 1NYMA 1G68A 1PWGA 2ZQ7A 3V3SA 5HAIA 5M1AA 5HFOA 5E2EA 1ZKJA 1JWVA 3MZFA 3UE0A 1W8YA 2EX2A 4PM5A 2GDNA 4GN2A 3ZVWA 3ZGAB 3IHBA 2WKIA 3IWIA 4P0MA 4PM9A 1YQSA 5EOEA 3IXHA 4MLLA 1M6KA 3LY3A 2ZM2A 3NDEA 3W4PA 2XK1A 4EUZA 5HW3A 1K57C 5EE8A 1I2SA 3GRJA 3HREA 4B4XA 4N1XA 3RJUA 2HDQA 4KZ3A 2ZC3B 1NZOA 4KZ7A 2DCFA 4KENB 2G2UA 2E8IA 4HBUA 5F83A 5A93A 5DTKA 2J8YA 3VOZA 4OQGA 3NIAA 1K6SA 1XXMA 1CEGA 4OOLA 2WADA 4WEJA 4S2NC 1FR1A 5DTSA 3ZNYA 4BENA 1PW8A 1FCOA 1E25A 1W7FA 1IYSA 2ZD8A 2IWBA 4C75A 4E3NA 3FV7A 3VMAA 4QD4A 1L2SA 5I94A 1ES5A 2XDMA 2Y2NA 5EUAA 1FSYA 3M6BA 4WBGA 4A5RA 2PBYA 1TDGA 3PBSA 1QMFA 3Q1FA 3HLFA 1MWTA 2ZC4B 3DW0A 4OH0A 1VM1A 4MEZA 4BJPA 1PIOA 4EQIA 4KZAA 1L0FA 4WZ5C 2WGVA 5E2GA 3UNWA 5HARA 3PBNA 2ZJ9A 1KVMA 2Y2MA 2FFYA 1NY0A 3EQUA 1LHYA 3IF6A 1IELA 3C7UA 3BLMA 4EBLA 3Q81A 4L0LA 4C6YA 3A3EA 3PBRA 1OMEA 2V2FF 3VP1A 4E3OA 2EFXA 2Y2QA 4GZBA 2ZC7A 5CGXA 4ZAMA 3BEBA 4JBFA 1GA0A 1ZG4A 4PM8A 5G18A 4KG2A 4IEDA 5CECA 3N8SA 4OKPA 4R1GA 2R9XA 4XXRA 3VP3A 3IT9A 2Z2MB 2Q9NA 1PWDA 3HVFA 4S2KA 1G6AA 4DKIA 1K6RA 3G2ZA 3NI9A 3HUNA 5DVAA 1MY8A 1WYBA 4GDNA 3MKEA 3QHYA 1BZAA 3IWOA 5FAOA 1BUEA 4JXSA 4Y0OA 4Y0UA 4ZJ1A 5CERA 4HBTA 4WYYA 4X55A 5EVIC 5CGSA 4FH4A 3LY4A 1BTLA 1BLSA 1L0DA 1LL5A 4FCFA 3MFDA 3WS5A 5CGWA 5FA7A 4U0XA 3IXBA 1BLPA 4EWFA 2J9PA 5A90A 4O7DA 2EXBA 2XEPA 2Q9MA 3BFGA 3GVBA 2WAEA 4Z9QA 1BSGA 3UN7A 5AQAA 4HESA 3CG5A 4R4SA 3DWKA 1XA1A 4WZ4A 5GHZA 5A91A 3UPOA
chains in the Genus database with same CATH superfamily
2A49A 1KE4A 1PRQA 2VZWA 2ZL1A 2HDRA 2R78A 4XUXA 4LV3A 2W3DA 3BFCA 3RH8B 3Q82A 4HI4A 4X25A 1ESUA 3EGXC 1CF0A 1PI4A 2P9VA 3LIDA 3FKWA 1VETB 3VSKA 1FR6A 3IH8A 3LO7A 4S2NA 5EM0A 2XSSA 3S1YA 1PYYA 1CK3A 5F68A 1DP8A 1KGGA 3K3CA 3LIBA 1K38A 3C8CA 2NUPC 3EEHA 5HPIA 1L3LA 3MQ0A 5GLBA 2WKHA 3SS3A 2WGIA 4R23A 5TBMB 3GV9A 4EETB 1YLTA 2VV8A 2PT7A 2JN7A 1DJBA 2B18A 4LGWA 4DXBA 1P9RA 2VK3A 3KSFA 1NRJA 1ONGA 5HL6A 1E3UD 2J3TC 2W3HA 2JKGA 4UA9A 3PAGA 3O5YA 4HH2A 2W1RA 4WMCD 3OZHA 3T1QB 3GSGA 3VP0A 2CC1A 1ZTUA 2VGKA 3VSLA 1GCEA 5GHYA 3PBOA 3PAEA 3BY8A 2H10A 2W1TA 3ZG0A 4E3IA 3DWZA 3NDGA 1I5QA 1GHIA 2W3EA 3O86A 3IX3A 4KQRA 4BBUA 3V50A 4ID4A 5CTNA 3QNCA 3ZG9B 1PWCA 3A3JA 1AXBA 1NRFA 2B02A 3G6OA 3HL9A 4FOFA 5HD5A 1RP5A 3JPUA 4RQ9A 2JE5A 3E4QA 2H0YA 2VKSA 2HP6A 4BQMA 5EM1A 4AFIA 4EW7A 4UQIM 2ZC6B 3OPPA 2PRFA 3NHQA 1Y4OA 1VEUB 5CHJA 2XFTA 3QP1A 5TBMA 3CAXA 1XPBA 3GTCA 4EXOA 1YLYA 2HP9A 4Y13A 3MXRA 4HJ6A 1NYYA 3OC2A 1YPRA 3S7OA 3ITBA 4BD0A 2V8CA 3SS5A 4WUJA 1XFQA 5HSQA 1JVJA 1KDWA 4G3WA 4JF6A 4MN5A 2OAP1 3HLDA 2Y2OA 4EEPA 4ME4A 4DE0A 1UWNX 4II7A 2XR0A 2L1MA 3T12B 1BULA 2GJ3A 3W4OA 5FI6A 5A92A 4DDSA 4U0TA 1K4FA 2A24A 1N9BA 4ARZA 2P9VB 4MBHA 3IHAA 4IBXA 3Q07A 2Y59A 2PU2A 3L7HA 3L9KA 3BFFA 1HD8A 1Z6FA 1N9LA 3MJQA 1PZPA 1XJ2A 3HLBA 4OP8A 2ZL1B 3LEQA 4KZ5A 3S22A 1FCMA 4RX3A 2EFUA 4X56A 4G3KA 1OTBA 3SOIA 3M2JA 2OSUA 2ZMAA 5M19A 3LIEA 5CTMA 2LB5A 3P7NA 2EX8A 4KZBA 2XA7S 4GDBA 3O88A 3LIFA 1ZC2A 5KSHA 1WE4A 3CJMA 2Y2IA 2B95A 4JXWA 3WS1A 1L0EA 4P6ZM 5TGFA 3NY4A 4MBKA 4P6ZS 3O3VA 1S0WA 2HGVA 3IX4A 1XGIA 3CHWP 1PNEA 3LUQA 4HJ4A 1GA9A 4E3KA 1XGJA 3ZHHA 1H8ZA 4KZ8A 2V1BA 1GSVA 1YLPA 1ALQA 4Y0TA 4BL3A 4OOYA 4BBVA 2XRNA 5IHVA 4D2OA 4JXGA 1ES2A 3VP2A 4NG2A 1ESIA 5HX9A 5EVIB 4BLMA 3T1SA 3C4OA 4YNRA 2VGJA 2JCHA 3E2KA 4GNUA 2C5WB 2M7VA 4JXVA 1V9ZA 4GKUA 2OV5A 3OLOA 1PZOA 3SZTA 4FH2A 4NK3A 3WRZA 3FG8A 5F5YA 5J3WA 4LV2A 1VB6A 3MZDA 2ZOHA 2V1AA 3KO6A 2ZQ7A 5HAIA 4GN2A 1BYWA 3ZGAB 3IXHA 1M6KA 4HNBA 3LY3A 2ZM2A 3EOIA 4EUZA 5HW3A 4B4XA 3GRJA 5HPFA 5HWWA 2J8YA 3TJZC 3FPWA 3ZNYA 4CQHA 1E25A 1W7FA 3FV7A 4QD4A 2K2NA 5F69A 1ES5A 1DP6A 5EUAA 4A5RA 4HY8A 2D02A 1VEUA 3DW0A 4OH0A 4H6JA 4MEZA 4D60A 4KZAA 2FFYA 3IF6A 5LBRA 1LHYA 1IELA 3C7UA 3H82B 3A3EA 3PBRA 1FILA 2V2FF 3D72A 4GZBA 2ZC7A 5CGXA 3NECA 1CJFA 3IBRA 4KG2A 5CECA 4OKPA 2UV0E 3VP3A 4Y17A 2VA0A 1Z09A 4L9FA 3NI9A 3G2ZA 3HUNA 1MY8A 3MKEA 3CUEA 3QHYA 2J3TD 3IWOA 5FAOA 1BUEA 4JXSA 5DJUA 4X55A 1N9NA 1LL5A 4FCFA 3MFDA 4U0XA 4GS9B 4MN6A 2Q9MA 2K7SA 5AQAA 3LFVA 1TS7A 1OJ5A 2PR5A 5GHZA 3ISGA 2O99A 4EU0A 4WEKA 3E98A 4EERA 5KZHA 3OBFA 4S2OA 1BLHA 3BM6A 5FSRA 3ITAA 4LV1A 3TE8A 3IH9A 2INWA 2XROA 2JBFA 2ACGA 2J3WA 4WL9A 3HLEA 2FFFB 5KSCA 3PBTA 1J9MA 5FQ9A 2AVXA 5GLCA 2Y2LA 1G6OA 2Y4AA 3G32A 2D01A 2HJ9C 3PR6A 5HAQA 3QP4A 4NKPA 4K0WA 4Y7PA 3P09A 3C2WA 3KYZA 2W3GA 2R9WA 3HLGA 4Y15A 4UA7A 3Q7VA 3CMZA 2WZXA 3A3DA 4LCLA 4WF0A 4E04A 5L07A 5HWVA 3IXDA 3MQOA 3EGDC 3E2LA 3EWKA 1T1AA 4QY6A 3UMDA 3BRMA 1ODVA 5FQIA 1RGZA 2ZC5B 3LCEA 5FAQA 3ICYA 1VQQA 4DDYA 1XKZA 2DMWA 5HL1A 3ZNTA 4BL2A 1MWUA 5DF9A 3TRCA 3IF5A 2A2LA 3F1PB 2M1CA 4GHIA 2XGNA 1NXYA 1UGUA 3R7WB 4QB8A 1N9OA 1SKOB 2X71A 4S2MA 1S6RA 3A0RA 3VFHA 3CPTB 3UY6A 2EX9A 1S67L 2PHYA 1TEMA 4RA7A 2Y79A 3D3OA 2OWJA 4R3BA 3OPRA 1IKGA 3KSGA 4JGOA 1SCWA 4PAUA 3MSHA 3OPHA 4YWZA 1E3UA 1IYPA 1OTAA 5AQ7A 2ZQCA 4UAAA 4GJ4A 1ERQA 2VGLM 2WK0A 1LI0A 3IF6B 3NC8A 4OPZA 1JNUA 3B42A 1EI5A 1XX2A 2JKRM 3EQVA 3IS2A 3VFFA 3BYDA 3ZVTA 4Y2FA 3DTIA 4LFUA 2HP5A 3G4PA 1T18A 2L4RA 1JWPA 3NCKA 3PTEA 2PD7A 5FEGA 1KVLA 5U47A 5AVFA 2P74A 3ZG5A 1K54A 3N8LA 4ETXA 4P87A 1TS8A 4ZTKA 4X68A 1LI9A 3BY9A 4GB7A 1S4RA 4Y5FA 2L0WA 1L0GA 1G5UA 4OONA 4E3MA 2XH9A 2ZLYA 3HUMA 3A3IA 4CLCC 4OQHA 5TFQA 4GOGA 1KGEA 1LL8A 3PXPA 4LCMA 5AQBA 1SHVA 4EBNA 1YT4A 3P98A 1OT6A 3QP2A 4CLCA 3ZYTA 3RFBA 2KOIA 1O7EA 1C3BA 4I3JA 2XLNA 3WS4A 1GSWA 4OLGA 2BTFP 5EOOA 4E6XA 5FQKA 3LI9A 3C38A 3LI8A 3DTEA 3N6IA 3GQZA 3T4LA 2JKTM 2O9CA 1N4OA 2YKFA 4PM6A 2OOLA 2V9AA 4DN0A 3T4TA 4ZBEA 3LR5A 5CEDA 2NUTC 2QJ7A 1K25A 2G7UA 4CJNA 3VE3A 2WYXA 4RYEA 5F82A 2B5RA 2HPBA 3LEZA 2ZQAA 3FPVA 1CEFA 3JVVA 1K54C 4GW9A 3S7PA 5F1FA 3N8RA 4YOFA 4HQAA 5L10A 1W63M 3P01A 4F3LA 4H6JB 4XUZA 4IVKA 4X53A 1PWGA 5HFOA 2QWSA 3U4LP 1P9WA 4JGQA 3H82A 4MMNA 2GDNA 3ZVWA 3IWIA 5EOEA 5EE8A 3HREA 1S66L 4KZ3A 4KENB 2E8IA 2GNXA 4HBUA 2OAQ1 3CPTA 4OQGA 3VOZA 2BASA 1XXMA 4OOLA 1FR1A 4BENA 1PW8A 3SW1A 2ZD8A 4E3NA 3VMAA 5KIZA 4BWIA 1YKDA 5I94A 2XDMA 4WBGA 2PBYA 3PBSA 2ZC4B 1LSXA 4BJPA 5E2GA 2Y2MA 1S1ZA 3Q81A 4EBLA 4C6YA 3VP1A 1OMEA 2EFXA 2Y2QA 3E0YA 4B93A 1OTDA 1GA0A 1ZG4A 1D7EA 4IUHA 2W27A 3N8SA 3DAVA 4BMWA 1PWDA 3HVFA 3KSIA 1AWIA 2FH5A 2WKRA 2JHEA 4NXBA 5CERA 1LSVA 1NLZA 5FA7A 3IXBA 2E8JA 4WN5A 4EWFA 4BBTA 3BFGA 3D9YA 3GVBA 3UN7A 3QP5A 4LRZE 1XA1A 5A8BA 1XFNA 3UPOA 4HEFA 2RCXA 4IHQA 3G2YA 4KUOA 3GECA 1KE3A 1RGYA 2Y2GA 5JYOA 4KQQA 3ZFZA 2JC7A 4KG5A 2ZQDA 2X01A 4NXFA 3SS4A 3ZDJA 3AGDA 5CRFA 3G30A 4I3IA 4IBRA 4PHTA 3KYEA 3UO9A 2P7JA 2IWDA 1K56D 1PI5A 3VV4A 3JYIA 5CX7A 5HAPA 1FQGA 4GD6A 4OPRA 2V1ZA 2WKPA 3V39A 2PYPA 1IFQA 2HDSA 3R7WA 1K55C 2I72A 3WWXA 3K2NA 1CI9A 4EQ1A 4NETA 1XP4A 5J7EA 5JYPA 1ZG6A 4B4ZA 2W1TB 1H3QA 4IUKA 3E4OA 3MKFA 4WZ5A 1WA9A 4DJ3A 4RVAA 2WUQA 3G34A 4L9EA 4XT2B 1YLJA 4DE3A 3FWLA 4DE2A 3G35A 4P85A 5G4ZA 3WS2A 2WKQA 1GHMA 4WLAA 2XFSA 1H8MA 1MWRA 3KSHA 1IKIA 2BG1A 1XA7A 5L2FA 2XD5A 4OLDA 1SDEA 1XJ6A 3VOLA 5DF8A 4N92A 3N4IA 3NOUC 4OVDA 5EFWA 3GR2A 5FATA 1OTIA 5AVEA 3CLOA 3UPNA 2H0TA 1K55A 5FQQA 5GHXA 4O0PA 1LL9A 4K0XA 1VETA 3M6HA 3I7JA 2MJ6A 1F98A 5EV0A 5FASA 1ERMA 4LENA 3NBLA 3MMHA 2XD1A 4HH3A 4FSFA 4EV4A 1HLUP 4OP5A 1UWPX 3A3FA 3S4XA 1TD5A 3GMWA 3MR0A 1P97A 1Q2QA 3IF6C 5GL9A 4R0QA 3AGEA 4X1MA 4QWOA 3RXWA 3H9WA 4KZ6A 1RCJA 4X69A 4S2PA 1GHPA 4HIAA 1X0OA 3HCYA 2ZM8A 1T1BA 3UDXA 1HZOA 1DJAA 2Y2KA 3MXSA 5EVIA 5GLDA 1NJ4A 3UB9A 5L8MA 3HLWA 3OCNA 5KMWA 1W63Q 3IQAA 2HDUA 3V3RA 4ETZA 2O9AA 2DNSA 4O01A 4OPYA 2I9VA 4NXEA 4UEYA 4Q0IA 2KX6A 1WYCA 4OOMA 3UMEA 3F1PA 2HV1A 4B88A 2VX8A 5M18A 2GX5A 4E3LA 2ZOIA 4HJ3A 4QHCA 1FIKA 2Y2PA 3UB7A 2PR6A 1OJGA 1P0ZA 1SKFA 4PKYG 4IVIA 2QHKA 4S2JA 3T4OA 4RX2A 3S7NA 4CPKA 4K91A 5G4YA 3O87A 4PKYA 4JKTA 2WGWB 3LICA 5I5LA 1BLCA 3HJKA 1YSPA 5FAPA 5TJJA 4HOIA 1F2KA 2K31A 3BECA 1EW0A 1FSWA 5DF7A 5EECA 1MXOA 4R4RA 1OT9A 4JF5A 3BFEA 1W8QA 1HTZA 3BQ8A 1SKOA 2QZ6A 4NXGA 3TOIA 1Y54A 1PW1A 2QMIA 3FZCA 1YMXA 1MKIA 2VLGA 3CWFA 1XJ3A 4UA6A 3SH9A 4M3KA 3SH8A 2ZMVA 1H5XA 3FC7A 4JLFA 1W79A 4Q8IA 4X6TA 3W2ZA 1YM1A 2WKEA 1YMSA 2WGWA 5EVLA 5FQMA 1ES4A 1K57A 3K3DA 2EWWA 2ZBBA 4CLCE 4EBPA 3UE3A 3ZG8B 3NOTC 4I3AA 4YFMA 2EX6A 3TG9A 2V20A 1TDLA 3HJIA 4E6WA 3ZCZA 1TVFA 4JGRA 5BOHA 5GLAA 1EROA 2WZZA 5DTTA 1KGFA 1G68A 4FTXA 3QP6A 4IJGA 4GS9A 4FUWA 1ZKJA 1JWVA 3MZFA 1W8YA 2EX2A 4ESPA 2OWHA 3IHBA 2WKIA 4PM9A 1YQSA 4JGPA 3NULA 3W4PA 3NDEA 4Z1WA 2XK1A 1K57C 2W0NA 1I2SA 3T50A 2HDQA 2ZC3B 1NZOA 2G2UA 2Z6CA 5DTKA 3NIAA 3V67A 1K6SA 1CEGA 3LGOA 4S2NC 5DTSA 1FCOA 1L2SA 4I39A 1QMFA 3HLFA 4EQIA 2YKHA 1L0FA 4WZ5C 3VE4A 2WGVA 3UNWA 3U2AA 3H7WB 1KVMA 3BLMA 3LR4A 4L0LA 2JKRI 4E3OA 3CUEC 3T1RA 3BEBA 4JBFA 4PM8A 5G18A 4IEDA 4R1GA 1Y28A 4XXRA 3T4JA 3IT9A 2V8FA 4DKIA 5DVAA 1K6RA 4GDNA 1WYBA 1MZUA 5DJTA 3S7QA 5IU1A 1BZAA 4KUKA 4Y0UA 4Y0OA 3OOVA 5EVIC 4FH4A 3LY4A 1BTLA 3WS5A 5CGWA 4G3VA 5AJGA 3F1NB 2FZ0A 1BLPA 5A90A 2J9PA 1MKMA 2XEPA 2WAEA 4EUVA 4Z9QA 1BSGA 3MFXA 4HESA 4R4SA 4WZ4A 3CITA 3IS2B 1HVBA 2HZ5A 1MWSA 1STZA 4LV0A 3HBRA 1SZVA 2PU4A 2A3UA 4BD1A 2O9BA 1H0MA 5FI2A 2XQZA 4XT2A 1JWZA 5TR7A 4QJGA 2P04A 2Y2HA 4JPMA 4DXCA 5K5BA 5FQJA 4F94A 4I5SA 2RL3A 4S2IA 5CHMA 4WM9A 3H7WA 2IA2A 2M7UA 5DFXA 3ULFA 3F1NA 1NZUA 3QNBA 1IEMA 2HJEA 1ES3A 5HDCA 3PBQA 1K0KA 1FCNA 3ZG7B 1E4DA 1FOFA 4HP9A 2ZM0A 2JKFA 5HZHA 3HLCA 4O8GA 5CEBA 4ZJ3A 4ZRRA 3C7VA 3DTKA 4KQOA 3MZEA 4MBFA 1EWZA 4K08A 3LR0A 3T4QA 5FDHA 1IYOA 3FKVA 4WMCA 3UDFA 1M40A 2EA9A 5DFYA 2UWXA 2V0UA 2Z2LB 2Q0OA 4DJ2A 5J8XA 2C6WB 3KYQA 3Q7ZA 2XF3A 1K56A 3JVUA 3LIAA 1LT0A 1D06A 2ZQ8A 4GHIB 3OCLA 4QY5A 2OLUA 4MNRA 4X1LA 4E3JA 4QU3A 3B33A 1T1CA 3G31A 3VOYA 3RXXA 4N1HA 1G28A 2H5SA 3F1OA 1LLBA 1I2WA 1TS6A 4PMAA 1YAXA 4OQ0A 3HUOA 3WS0A 3Q7VB 4S2LA 3BWLA 1LSWA 4H8RA 3FYZA 4LRYC 1IOUA 1U60A 1KE0A 4LPZA 5EVEA 2H28A 4EEUA 2PBDP 2HF6A 3DTMA 3ZQ5A 3VP4A 2VEAA 3W4QA 1A0KA 2VV7A 2Y91A 3B3XA 2CMNA 1YLWA 2ZQ9A 3QP8A 1ONHA 4WELA 4PPRA 3OPLA 3TW8A 4R6LA 1DJCA 3SH7A 1K4EA 4U3TA 1F5MA 1O07A 3B47A 1T19A 4LRXC 4MDZA 5DKKA 2P08A 1H8YA 1YSQA 3TSGA 3LR3A 1BT5A 5EVID 2KDKA 2OLVA 4Q0JA 3AGFA 4HP4A 1CI8A 1MBLA 5F1GA 4GCZA 4R3JA 2IWCA 1W5DA 1SDNA 3UB5P 3C30A 1DY6A 4L9GA 4QPRA 3F1OB 1QMEA 2PAVP 4KG6A 2Z6DA 4N9KA 3NOPC 1YLZA 1TF1A 1KOUA 1V9YA 4JF4A 4MN7A 1IYQA 3KX0X 5L09A 3C5AA 3DBAA 2DRWA 1GSXA 2QJ5A 4R38A 4DMZA 4DF6A 2JKTI 3D4FA 1KDSA 4ZDXA 3C4PA 3CZDA 5EPHA 2WAFA 4KZ4A 4DE1A 2VGLS 1JTGA 2Y2JA 1XJ4A 2Y55A 4DRTA 3UE1A 4F3LB 5CHUA 4P6BA 1JTDA 1S1YA 2EXAA 4R3AA 1DP9A 3IWQA 3UB6A 4OQIA 3IBJA 3T4SA 3BW6A 4UHUA 1S4SA 4ZJ2A 3GDIA 4I38A 5CXWA 2V0WA 2QKPA 2QPNA 4YINA 5AQ9A 5FI7A 1NWZA 4LLOB 3A0VA 1ZHHB 1J3WA 1Q2PA 4CLCD 5E43A 5D3OA 3BFDA 3IXGA 5HDDA 2EWVA 1MPLA 2X02A 2J9OA 4KZ9A 3M2KA 4B9OA 3MS6A 3WRTA 3MF0A 4R70A 4C3QA 1DRMA 4FD8A 4PM7A 3UDIA 1F9IA 2G2WA 1D1JA 3W8KA 2VJWA 4M4XA 4EESA 5HD3A 4N9LA 2BLSA 3T4KA 5E2FA 3PYPA 3N7WA 2J7VA 4GD8A 3UPPA 4KQDA 5IT5A 3BLSA 4OPQA 4Y3IA 1VHMA 5J4EA 3IX8A 3MBZA 5E2HA 4Q0HA 3V5MA 4CLCB 1NYMA 4NEED 3V3SA 2PD8A 1ACFA 5M1AA 5E2EA 5HWTA 3LYXA 3UE0A 2PDRA 1TS0A 4PM5A 3UE6A 5DKLA 4P0MA 2W3FA 5IS1A 3NJAA 4MLLA 3MXQA 5F6AA 3R4KA 4N1XA 3RJUA 3E4PA 5F83A 4KZ7A 2DCFA 5A93A 1NLYA 4WEJA 2WADA 3EEAA 1IYSA 2IWBA 4C75A 4UQIS 2Y2NA 1FSYA 2VV6A 3M6BA 3A0SA 2J80A 1TDGA 3Q1FA 5FL3A 1MWTA 1PFLA 1VM1A 1PIOA 2PYRA 2XA7M 5HARA 3PBNA 2ZJ9A 3EQUA 1NY0A 3PHYA 3UB8A 5C5KA 5HDSA 2O0YA 4GLQA 4ZAMA 4MCWA 2Y8HA 5MC7A 5FDSA 2R9XA 2Z2MB 2Q9NA 4S2KA 1G6AA 3CI6A 2ZMFA 1CQAA 4ZJ1A 4HBTA 4WYYA 5CGSA 1BLSA 1L0DA 2A24B 3MQQA 1OTEA 2GZAA 3BQAA 1OPXA 2KLIA 5FEFA 2LB9A 3RTYA 1MC0A 4O7DA 2EXBA 4ARZB 3CG5A 4HHDA 3DWKA 3BJNA 5A91A 3T1XA 2QYBA
chains in the Genus database with same CATH topology
3ISGA 1HVBA 2A49A 4HEFA 2RCXA 1KE4A 1MWSA 4LV0A 3G2YA 3HBRA 4WEKA 1KE3A 1RGYA 2HDRA 2PU4A 2A3UA 4BD1A 2Y2GA 4XUXA 4LV3A 5KZHA 5JYOA 3BFCA 5FI2A 4KQQA 2XQZA 2JC7A 4S2OA 3ZFZA 1BLHA 4KG5A 2ZQDA 2X01A 3SS4A 1JWZA 5TR7A 3BM6A 3Q82A 3AGDA 3ITAA 4LV1A 5FSRA 3ZDJA 2Y2HA 4QJGA 4JPMA 1ESUA 5CRFA 3IH9A 3G30A 4DXCA 4IBRA 1PI4A 2P9VA 5FQJA 3FKWA 4F94A 3UO9A 2IWDA 1K56D 1PI5A 5HAPA 3JYIA 2RL3A 4S2IA 2JBFA 5CHMA 4WM9A 3VSKA 1FQGA 4GD6A 4OPRA 2V1ZA 1FR6A 3HLEA 3IH8A 2FFFB 3LO7A 5KSCA 4S2NA 3V39A 3PBTA 1NZUA 1J9MA 3QNBA 2HDSA 5FQ9A 1IEMA 1K55C 2I72A 5GLCA 1ES3A 3S1YA 3WWXA 1PYYA 1CI9A 3PBQA 1CK3A 1FCNA 2Y2LA 3ZG7B 4NETA 1KGGA 1XP4A 1K38A 1E4DA 1FOFA 5JYPA 1ZG6A 2Y4AA 3G32A 4B4ZA 2ZM0A 3MKFA 3HLCA 5HAQA 4WZ5A 5CEBA 4ZJ3A 4RVAA 4K0WA 4Y7PA 3P09A 2WUQA 3C7VA 3G34A 5GLBA 2WKHA 4KQOA 3MZEA 3SS3A 2WGIA 2R9WA 4R23A 1YLJA 3HLGA 4MBFA 3GV9A 1EWZA 4DE3A 1YLTA 3FWLA 5FDHA 4UA7A 3Q7VA 3CMZA 1IYOA 4DE2A 3G35A 1DJBA 2WZXA 4P85A 3WS2A 1GHMA 3A3DA 3FKVA 4LCLA 4WMCA 4DXBA 3UDFA 1M40A 2XFSA 2UWXA 1ONGA 1MWRA 3IXDA 2Z2LB 1IKIA 1E3UD 2BG1A 1XA7A 5L2FA 4UA9A 3PAGA 2XD5A 4OLDA 1SDEA 5J8XA 3E2LA 2C6WB 4QY6A 4WMCD 3BRMA 3OZHA 3Q7ZA 5DF8A 5FQIA 3GSGA 3VP0A 1RGZA 2ZC5B 2CC1A 3LCEA 5FAQA 2XF3A 4N92A 1K56A 3N4IA 2VGKA 1VQQA 4DDYA 1XKZA 4OVDA 3VSLA 2ZQ8A 1GCEA 3GR2A 5FATA 5GHYA 5HL1A 3PBOA 3PAEA 3ZNTA 4BL2A 2H10A 1MWUA 3OCLA 4QY5A 2H0TA 5DF9A 3UPNA 1K55A 5FQQA 3ZG0A 4E3IA 3DWZA 2OLUA 5GHXA 3NDGA 1I5QA 3IF5A 4MNRA 1LL9A 4E3JA 4QU3A 4K0XA 1GHIA 3G31A 3VOYA 3RXXA 3O86A 4N1HA 3M6HA 3I7JA 2H5SA 2XGNA 4KQRA 1LLBA 1NXYA 1I2WA 4PMAA 3V50A 5FASA 4ID4A 5CTNA 4OQ0A 3HUOA 1ERMA 3QNCA 4QB8A 4LENA 3WS0A 3ZG9B 1PWCA 3Q7VB 3A3JA 1AXBA 2X71A 3NBLA 1NRFA 1S6RA 4S2LA 3HL9A 4S2MA 1RP5A 4H8RA 3VFHA 3FYZA 2XD1A 3UY6A 2JE5A 2EX9A 2H0YA 4FSFA 1TEMA 1U60A 4EV4A 4OP5A 1KE0A 3A3FA 2HP6A 4RA7A 3S4XA 3GMWA 4BQMA 3DTMA 3VP4A 1Q2QA 3IF6C 5GL9A 3W4QA 4R0QA 3AGEA 4R3BA 2ZC6B 3OPPA 3OPRA 1IKGA 2Y91A 3RXWA 3B3XA 5CHJA 2XFTA 1YLWA 2ZQ9A 4KZ6A 1RCJA 1SCWA 1ONHA 1XPBA 3GTCA 4WELA 3OPHA 1E3UA 1YLYA 2HP9A 3MXRA 4PPRA 4X69A 4S2PA 1IYPA 1GHPA 3OPLA 1NYYA 3OC2A 5AQ7A 2ZQCA 4UAAA 1DJCA 1ERQA 2ZM8A 3SH7A 1K4EA 3ITBA 2WK0A 1LI0A 3IF6B 3NC8A 4U3TA 4BD0A 3UDXA 4OPZA 3SS5A 1EI5A 1HZOA 1JVJA 1DJAA 1KDWA 1XX2A 1O07A 4JF6A 2Y2KA 3MXSA 5EVIA 3HLDA 3EQVA 2Y2OA 5GLDA 4DE0A 1NJ4A 1H8YA 3VFFA 3HLWA 3BYDA 3OCNA 5KMWA 3TSGA 3ZVTA 3IQAA 3V3RA 2HDUA 1BT5A 2HP5A 2XR0A 5EVID 2OLVA 3G4PA 2DNSA 3AGFA 1CI8A 1MBLA 4OPYA 5F1GA 1JWPA 1BULA 3NCKA 3PTEA 3W4OA 5FI6A 4R3JA 1KVLA 5A92A 2IWCA 5U47A 2P74A 1W5DA 1SDNA 3ZG5A 4U0TA 1WYCA 4OOMA 4DDSA 1K4FA 1DY6A 1K54A 3N8LA 1N9BA 2P9VB 4P87A 1QMEA 4B88A 4MBHA 3IHAA 4IBXA 4ZTKA 4X68A 5M18A 3Q07A 1LI9A 4KG6A 4GB7A 4E3LA 2Y59A 2PU2A 4N9KA 4QHCA 1YLZA 2Y2PA 3BFFA 1HD8A 1Z6FA 4JF4A 1L0GA 1SKFA 4OONA 1PZPA 1IYQA 3HLBA 4OP8A 4E3MA 4IVIA 2XH9A 2ZLYA 3C5AA 3HUMA 4S2JA 2DRWA 3A3IA 4RX2A 4CPKA 4K91A 4KZ5A 3S22A 4DF6A 3O87A 1FCMA 4OQHA 3D4FA 1KDSA 4JKTA 4RX3A 2WGWB 5TFQA 4ZDXA 2EFUA 4X56A 4GOGA 3C4PA 1KGEA 3CZDA 1BLCA 5EPHA 2WAFA 4KZ4A 4LCMA 4DE1A 5AQBA 5FAPA 1SHVA 1JTGA 2Y2JA 3M2JA 3SOIA 4EBNA 2OSUA 2ZMAA 1YT4A 5M19A 2Y55A 5CTMA 3BECA 3P98A 1FSWA 5DF7A 4DRTA 3UE1A 5EECA 1MXOA 5CHUA 2EX8A 4KZBA 4P6BA 4R4RA 1O7EA 1C3BA 4JF5A 4GDBA 3O88A 2XLNA 1JTDA 5KSHA 1ZC2A 3BFEA 1W8QA 1HTZA 1WE4A 3WS4A 3CJMA 2EXAA 2Y2IA 2QZ6A 3IWQA 4OQIA 3TOIA 1Y54A 1PW1A 4OLGA 2QMIA 3FZCA 4JXWA 1YMXA 1L0EA 1MKIA 3WS1A 4UHUA 5TGFA 3NY4A 5EOOA 4MBKA 4E6XA 4ZJ2A 5FQKA 3O3VA 5CXWA 1S0WA 2QPNA 4YINA 5AQ9A 5FI7A 1XGIA 4UA6A 3SH9A 3N6IA 4M3KA 3GQZA 1N4OA 1Q2PA 4PM6A 3SH8A 5E43A 5D3OA 1GA9A 4E3KA 1H5XA 1XGJA 3BFDA 3IXGA 3ZHHA 4JLFA 1W79A 4Q8IA 1H8ZA 4KZ8A 2X02A 1MPLA 4X6TA 2J9OA 4KZ9A 3M2KA 1YM1A 2WKEA 1YMSA 3WRTA 2WGWA 4C3QA 5EVLA 5FQMA 1ES4A 1YLPA 1K57A 4ZBEA 4FD8A 5CEDA 4PM7A 3UDIA 1ALQA 2G2WA 4Y0TA 1K25A 4BL3A 4OOYA 3W8KA 5IHVA 4D2OA 4CJNA 2WYXA 4RYEA 5F82A 4EBPA 2B5RA 1ES2A 2HPBA 4JXGA 3VP2A 3LEZA 1ESIA 5HX9A 3UE3A 4N9LA 5EVIB 2BLSA 2ZQAA 3ZG8B 4BLMA 1CEFA 3C4OA 5E2FA 3N7WA 1K54C 2J7VA 2JCHA 2VGJA 4GD8A 3UPPA 3E2KA 4YFMA 2EX6A 4GNUA 2C5WB 3TG9A 2V20A 4JXVA 5F1FA 4GKUA 2OV5A 3N8RA 1PZOA 1TDLA 3BLSA 4OPQA 3MBZA 4FH2A 4E6WA 5E2HA 4NK3A 3WRZA 3ZCZA 1TVFA 5BOHA 4LV2A 5GLAA 1EROA 2WZZA 3MZDA 5DTTA 3V5MA 4XUZA 1KGFA 4IVKA 4X53A 1NYMA 1G68A 1PWGA 2ZQ7A 3V3SA 5HAIA 5M1AA 5HFOA 5E2EA 1ZKJA 1JWVA 3MZFA 3UE0A 1W8YA 2EX2A 4PM5A 2GDNA 4GN2A 3ZVWA 3ZGAB 3IHBA 2WKIA 3IWIA 4P0MA 4PM9A 1YQSA 5EOEA 3IXHA 4MLLA 1M6KA 3LY3A 2ZM2A 3NDEA 3W4PA 2XK1A 4EUZA 5HW3A 1K57C 5EE8A 1I2SA 3GRJA 3HREA 4B4XA 4N1XA 3RJUA 2HDQA 4KZ3A 2ZC3B 1NZOA 4KZ7A 2DCFA 4KENB 2G2UA 2E8IA 4HBUA 5F83A 5A93A 5DTKA 2J8YA 3VOZA 4OQGA 3NIAA 1K6SA 1XXMA 1CEGA 4OOLA 2WADA 4WEJA 4S2NC 1FR1A 5DTSA 3ZNYA 4BENA 1PW8A 1FCOA 1E25A 1W7FA 1IYSA 2ZD8A 2IWBA 4C75A 4E3NA 3FV7A 3VMAA 4QD4A 1L2SA 5I94A 1ES5A 2XDMA 2Y2NA 5EUAA 1FSYA 3M6BA 4WBGA 4A5RA 2PBYA 1TDGA 3PBSA 1QMFA 3Q1FA 3HLFA 1MWTA 2ZC4B 3DW0A 4OH0A 1VM1A 4MEZA 4BJPA 1PIOA 4EQIA 4KZAA 1L0FA 4WZ5C 2WGVA 5E2GA 3UNWA 5HARA 3PBNA 2ZJ9A 1KVMA 2Y2MA 2FFYA 1NY0A 3EQUA 1LHYA 3IF6A 1IELA 3C7UA 3BLMA 4EBLA 3Q81A 4L0LA 4C6YA 3A3EA 3PBRA 1OMEA 2V2FF 3VP1A 4E3OA 2EFXA 2Y2QA 4GZBA 2ZC7A 5CGXA 4ZAMA 3BEBA 4JBFA 1GA0A 1ZG4A 4PM8A 5G18A 4KG2A 4IEDA 5CECA 3N8SA 4OKPA 4R1GA 2R9XA 4XXRA 3VP3A 3IT9A 2Z2MB 2Q9NA 1PWDA 3HVFA 4S2KA 1G6AA 4DKIA 1K6RA 3G2ZA 3NI9A 3HUNA 5DVAA 1MY8A 1WYBA 4GDNA 3MKEA 3QHYA 1BZAA 3IWOA 5FAOA 1BUEA 4JXSA 4Y0OA 4Y0UA 4ZJ1A 5CERA 4HBTA 4WYYA 4X55A 5EVIC 5CGSA 4FH4A 3LY4A 1BTLA 1BLSA 1L0DA 1LL5A 4FCFA 3MFDA 3WS5A 5CGWA 5FA7A 4U0XA 3IXBA 1BLPA 4EWFA 2J9PA 5A90A 4O7DA 2EXBA 2XEPA 2Q9MA 3BFGA 3GVBA 2WAEA 4Z9QA 1BSGA 3UN7A 5AQAA 4HESA 3CG5A 4R4SA 3DWKA 1XA1A 4WZ4A 5GHZA 5A91A 3UPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISG A;  1HVB A;  2A49 A;  4HEF A;  2RCX A;  1KE4 A;  1MWS A;  4LV0 A;  3G2Y A;  3HBR A;  4WEK A;  1KE3 A;  1RGY A;  2HDR A;  2PU4 A;  2A3U A;  4BD1 A;  2Y2G A;  4XUX A;  4LV3 A;  5KZH A;  5JYO A;  3BFC A;  5FI2 A;  4KQQ A;  2XQZ A;  2JC7 A;  4S2O A;  3ZFZ A;  1BLH A;  4KG5 A;  2ZQD A;  2X01 A;  3SS4 A;  1JWZ A;  5TR7 A;  3BM6 A;  3Q82 A;  3AGD A;  3ITA A;  4LV1 A;  5FSR A;  3ZDJ A;  2Y2H A;  4QJG A;  4JPM A;  1ESU A;  5CRF A;  3IH9 A;  3G30 A;  4DXC A;  4IBR A;  1PI4 A;  2P9V A;  5FQJ A;  3FKW A;  4F94 A;  3UO9 A;  2IWD A;  1K56 D;  1PI5 A;  5HAP A;  3JYI A;  2RL3 A;  4S2I A;  2JBF A;  5CHM A;  4WM9 A;  3VSK A;  1FQG A;  4GD6 A;  4OPR A;  2V1Z A;  1FR6 A;  3HLE A;  3IH8 A;  2FFF B;  3LO7 A;  5KSC A;  4S2N A;  3V39 A;  3PBT A;  1NZU A;  1J9M A;  3QNB A;  2HDS A;  5FQ9 A;  1IEM A;  1K55 C;  2I72 A;  5GLC A;  1ES3 A;  3S1Y A;  3WWX A;  1PYY A;  1CI9 A;  3PBQ A;  1CK3 A;  1FCN A;  2Y2L A;  3ZG7 B;  4NET A;  1KGG A;  1XP4 A;  1K38 A;  1E4D A;  1FOF A;  5JYP A;  1ZG6 A;  2Y4A A;  3G32 A;  4B4Z A;  2ZM0 A;  3MKF A;  3HLC A;  5HAQ A;  4WZ5 A;  5CEB A;  4ZJ3 A;  4RVA A;  4K0W A;  4Y7P A;  3P09 A;  2WUQ A;  3C7V A;  3G34 A;  5GLB A;  2WKH A;  4KQO A;  3MZE A;  3SS3 A;  2WGI A;  2R9W A;  4R23 A;  1YLJ A;  3HLG A;  4MBF A;  3GV9 A;  1EWZ A;  4DE3 A;  1YLT A;  3FWL A;  5FDH A;  4UA7 A;  3Q7V A;  3CMZ A;  1IYO A;  4DE2 A;  3G35 A;  1DJB A;  2WZX A;  4P85 A;  3WS2 A;  1GHM A;  3A3D A;  3FKV A;  4LCL A;  4WMC A;  4DXB A;  3UDF A;  1M40 A;  2XFS A;  2UWX A;  1ONG A;  1MWR A;  3IXD A;  2Z2L B;  1IKI A;  1E3U D;  2BG1 A;  1XA7 A;  5L2F A;  4UA9 A;  3PAG A;  2XD5 A;  4OLD A;  1SDE A;  5J8X A;  3E2L A;  2C6W B;  4QY6 A;  4WMC D;  3BRM A;  3OZH A;  3Q7Z A;  5DF8 A;  5FQI A;  3GSG A;  3VP0 A;  1RGZ A;  2ZC5 B;  2CC1 A;  3LCE A;  5FAQ A;  2XF3 A;  4N92 A;  1K56 A;  3N4I A;  2VGK A;  1VQQ A;  4DDY A;  1XKZ A;  4OVD A;  3VSL A;  2ZQ8 A;  1GCE A;  3GR2 A;  5FAT A;  5GHY A;  5HL1 A;  3PBO A;  3PAE A;  3ZNT A;  4BL2 A;  2H10 A;  1MWU A;  3OCL A;  4QY5 A;  2H0T A;  5DF9 A;  3UPN A;  1K55 A;  5FQQ A;  3ZG0 A;  4E3I A;  3DWZ A;  2OLU A;  5GHX A;  3NDG A;  1I5Q A;  3IF5 A;  4MNR A;  1LL9 A;  4E3J A;  4QU3 A;  4K0X A;  1GHI A;  3G31 A;  3VOY A;  3RXX A;  3O86 A;  4N1H A;  3M6H A;  3I7J A;  2H5S A;  2XGN A;  4KQR A;  1LLB A;  1NXY A;  1I2W A;  4PMA A;  3V50 A;  5FAS A;  4ID4 A;  5CTN A;  4OQ0 A;  3HUO A;  1ERM A;  3QNC A;  4QB8 A;  4LEN A;  3WS0 A;  3ZG9 B;  1PWC A;  3Q7V B;  3A3J A;  1AXB A;  2X71 A;  3NBL A;  1NRF A;  1S6R A;  4S2L A;  3HL9 A;  4S2M A;  1RP5 A;  4H8R A;  3VFH A;  3FYZ A;  2XD1 A;  3UY6 A;  2JE5 A;  2EX9 A;  2H0Y A;  4FSF A;  1TEM A;  1U60 A;  4EV4 A;  4OP5 A;  1KE0 A;  3A3F A;  2HP6 A;  4RA7 A;  3S4X A;  3GMW A;  4BQM A;  3DTM A;  3VP4 A;  1Q2Q A;  3IF6 C;  5GL9 A;  3W4Q A;  4R0Q A;  3AGE A;  4R3B A;  2ZC6 B;  3OPP A;  3OPR A;  1IKG A;  2Y91 A;  3RXW A;  3B3X A;  5CHJ A;  2XFT A;  1YLW A;  2ZQ9 A;  4KZ6 A;  1RCJ A;  1SCW A;  1ONH A;  1XPB A;  3GTC A;  4WEL A;  3OPH A;  1E3U A;  1YLY A;  2HP9 A;  3MXR A;  4PPR A;  4X69 A;  4S2P A;  1IYP A;  1GHP A;  3OPL A;  1NYY A;  3OC2 A;  5AQ7 A;  2ZQC A;  4UAA A;  1DJC A;  1ERQ A;  2ZM8 A;  3SH7 A;  1K4E A;  3ITB A;  2WK0 A;  1LI0 A;  3IF6 B;  3NC8 A;  4U3T A;  4BD0 A;  3UDX A;  4OPZ A;  3SS5 A;  1EI5 A;  1HZO A;  1JVJ A;  1DJA A;  1KDW A;  1XX2 A;  1O07 A;  4JF6 A;  2Y2K A;  3MXS A;  5EVI A;  3HLD A;  3EQV A;  2Y2O A;  5GLD A;  4DE0 A;  1NJ4 A;  1H8Y A;  3VFF A;  3HLW A;  3BYD A;  3OCN A;  5KMW A;  3TSG A;  3ZVT A;  3IQA A;  3V3R A;  2HDU A;  1BT5 A;  2HP5 A;  2XR0 A;  5EVI D;  2OLV A;  3G4P A;  2DNS A;  3AGF A;  1CI8 A;  1MBL A;  4OPY A;  5F1G A;  1JWP A;  1BUL A;  3NCK A;  3PTE A;  3W4O A;  5FI6 A;  4R3J A;  1KVL A;  5A92 A;  2IWC A;  5U47 A;  2P74 A;  1W5D A;  1SDN A;  3ZG5 A;  4U0T A;  1WYC A;  4OOM A;  4DDS A;  1K4F A;  1DY6 A;  1K54 A;  3N8L A;  1N9B A;  2P9V B;  4P87 A;  1QME A;  4B88 A;  4MBH A;  3IHA A;  4IBX A;  4ZTK A;  4X68 A;  5M18 A;  3Q07 A;  1LI9 A;  4KG6 A;  4GB7 A;  4E3L A;  2Y59 A;  2PU2 A;  4N9K A;  4QHC A;  1YLZ A;  2Y2P A;  3BFF A;  1HD8 A;  1Z6F A;  4JF4 A;  1L0G A;  1SKF A;  4OON A;  1PZP A;  1IYQ A;  3HLB A;  4OP8 A;  4E3M A;  4IVI A;  2XH9 A;  2ZLY A;  3C5A A;  3HUM A;  4S2J A;  2DRW A;  3A3I A;  4RX2 A;  4CPK A;  4K91 A;  4KZ5 A;  3S22 A;  4DF6 A;  3O87 A;  1FCM A;  4OQH A;  3D4F A;  1KDS A;  4JKT A;  4RX3 A;  2WGW B;  5TFQ A;  4ZDX A;  2EFU A;  4X56 A;  4GOG A;  3C4P A;  1KGE A;  3CZD A;  1BLC A;  5EPH A;  2WAF A;  4KZ4 A;  4LCM A;  4DE1 A;  5AQB A;  5FAP A;  1SHV A;  1JTG A;  2Y2J A;  3M2J A;  3SOI A;  4EBN A;  2OSU A;  2ZMA A;  1YT4 A;  5M19 A;  2Y55 A;  5CTM A;  3BEC A;  3P98 A;  1FSW A;  5DF7 A;  4DRT A;  3UE1 A;  5EEC A;  1MXO A;  5CHU A;  2EX8 A;  4KZB A;  4P6B A;  4R4R A;  1O7E A;  1C3B A;  4JF5 A;  4GDB A;  3O88 A;  2XLN A;  1JTD A;  5KSH A;  1ZC2 A;  3BFE A;  1W8Q A;  1HTZ A;  1WE4 A;  3WS4 A;  3CJM A;  2EXA A;  2Y2I A;  2QZ6 A;  3IWQ A;  4OQI A;  3TOI A;  1Y54 A;  1PW1 A;  4OLG A;  2QMI A;  3FZC A;  4JXW A;  1YMX A;  1L0E A;  1MKI A;  3WS1 A;  4UHU A;  5TGF A;  3NY4 A;  5EOO A;  4MBK A;  4E6X A;  4ZJ2 A;  5FQK A;  3O3V A;  5CXW A;  1S0W A;  2QPN A;  4YIN A;  5AQ9 A;  5FI7 A;  1XGI A;  4UA6 A;  3SH9 A;  3N6I A;  4M3K A;  3GQZ A;  1N4O A;  1Q2P A;  4PM6 A;  3SH8 A;  5E43 A;  5D3O A;  1GA9 A;  4E3K A;  1H5X A;  1XGJ A;  3BFD A;  3IXG A;  3ZHH A;  4JLF A;  1W79 A;  4Q8I A;  1H8Z A;  4KZ8 A;  2X02 A;  1MPL A;  4X6T A;  2J9O A;  4KZ9 A;  3M2K A;  1YM1 A;  2WKE A;  1YMS A;  3WRT A;  2WGW A;  4C3Q A;  5EVL A;  5FQM A;  1ES4 A;  1YLP A;  1K57 A;  4ZBE A;  4FD8 A;  5CED A;  4PM7 A;  3UDI A;  1ALQ A;  2G2W A;  4Y0T A;  1K25 A;  4BL3 A;  4OOY A;  3W8K A;  5IHV A;  4D2O A;  4CJN A;  2WYX A;  4RYE A;  5F82 A;  4EBP A;  2B5R A;  1ES2 A;  2HPB A;  4JXG A;  3VP2 A;  3LEZ A;  1ESI A;  5HX9 A;  3UE3 A;  4N9L A;  5EVI B;  2BLS A;  2ZQA A;  3ZG8 B;  4BLM A;  1CEF A;  3C4O A;  5E2F A;  3N7W A;  1K54 C;  2J7V A;  2JCH A;  2VGJ A;  4GD8 A;  3UPP A;  3E2K A;  4YFM A;  2EX6 A;  4GNU A;  2C5W B;  3TG9 A;  2V20 A;  4JXV A;  5F1F A;  4GKU A;  2OV5 A;  3N8R A;  1PZO A;  1TDL A;  3BLS A;  4OPQ A;  3MBZ A;  4FH2 A;  4E6W A;  5E2H A;  4NK3 A;  3WRZ A;  3ZCZ A;  1TVF A;  5BOH A;  4LV2 A;  5GLA A;  1ERO A;  2WZZ A;  3MZD A;  5DTT A;  3V5M A;  4XUZ A;  1KGF A;  4IVK A;  4X53 A;  1NYM A;  1G68 A;  1PWG A;  2ZQ7 A;  3V3S A;  5HAI A;  5M1A A;  5HFO A;  5E2E A;  1ZKJ A;  1JWV A;  3MZF A;  3UE0 A;  1W8Y A;  2EX2 A;  4PM5 A;  2GDN A;  4GN2 A;  3ZVW A;  3ZGA B;  3IHB A;  2WKI A;  3IWI A;  4P0M A;  4PM9 A;  1YQS A;  5EOE A;  3IXH A;  4MLL A;  1M6K A;  3LY3 A;  2ZM2 A;  3NDE A;  3W4P A;  2XK1 A;  4EUZ A;  5HW3 A;  1K57 C;  5EE8 A;  1I2S A;  3GRJ A;  3HRE A;  4B4X A;  4N1X A;  3RJU A;  2HDQ A;  4KZ3 A;  2ZC3 B;  1NZO A;  4KZ7 A;  2DCF A;  4KEN B;  2G2U A;  2E8I A;  4HBU A;  5F83 A;  5A93 A;  5DTK A;  2J8Y A;  3VOZ A;  4OQG A;  3NIA A;  1K6S A;  1XXM A;  1CEG A;  4OOL A;  2WAD A;  4WEJ A;  4S2N C;  1FR1 A;  5DTS A;  3ZNY A;  4BEN A;  1PW8 A;  1FCO A;  1E25 A;  1W7F A;  1IYS A;  2ZD8 A;  2IWB A;  4C75 A;  4E3N A;  3FV7 A;  3VMA A;  4QD4 A;  1L2S A;  5I94 A;  1ES5 A;  2XDM A;  2Y2N A;  5EUA A;  1FSY A;  3M6B A;  4WBG A;  4A5R A;  2PBY A;  1TDG A;  3PBS A;  1QMF A;  3Q1F A;  3HLF A;  1MWT A;  2ZC4 B;  3DW0 A;  4OH0 A;  1VM1 A;  4MEZ A;  4BJP A;  1PIO A;  4EQI A;  4KZA A;  1L0F A;  4WZ5 C;  2WGV A;  5E2G A;  3UNW A;  5HAR A;  3PBN A;  2ZJ9 A;  1KVM A;  2Y2M A;  2FFY A;  1NY0 A;  3EQU A;  1LHY A;  3IF6 A;  1IEL A;  3C7U A;  3BLM A;  4EBL A;  3Q81 A;  4L0L A;  4C6Y A;  3A3E A;  3PBR A;  1OME A;  2V2F F;  3VP1 A;  4E3O A;  2EFX A;  2Y2Q A;  4GZB A;  2ZC7 A;  5CGX A;  4ZAM A;  3BEB A;  4JBF A;  1GA0 A;  1ZG4 A;  4PM8 A;  5G18 A;  4KG2 A;  4IED A;  5CEC A;  3N8S A;  4OKP A;  4R1G A;  2R9X A;  4XXR A;  3VP3 A;  3IT9 A;  2Z2M B;  2Q9N A;  1PWD A;  3HVF A;  4S2K A;  1G6A A;  4DKI A;  1K6R A;  3G2Z A;  3NI9 A;  3HUN A;  5DVA A;  1MY8 A;  1WYB A;  4GDN A;  3MKE A;  3QHY A;  1BZA A;  3IWO A;  5FAO A;  1BUE A;  4JXS A;  4Y0O A;  4Y0U A;  4ZJ1 A;  5CER A;  4HBT A;  4WYY A;  4X55 A;  5EVI C;  5CGS A;  4FH4 A;  3LY4 A;  1BTL A;  1BLS A;  1L0D A;  1LL5 A;  4FCF A;  3MFD A;  3WS5 A;  5CGW A;  5FA7 A;  4U0X A;  3IXB A;  1BLP A;  4EWF A;  2J9P A;  5A90 A;  4O7D A;  2EXB A;  2XEP A;  2Q9M A;  3BFG A;  3GVB A;  2WAE A;  4Z9Q A;  1BSG A;  3UN7 A;  5AQA A;  4HES A;  3CG5 A;  4R4S A;  3DWK A;  1XA1 A;  4WZ4 A;  5GHZ A;  5A91 A;  3UPO A; 
#chains in the Genus database with same CATH topology
 2A49 A;  1KE4 A;  1PRQ A;  2VZW A;  2ZL1 A;  2HDR A;  2R78 A;  4XUX A;  4LV3 A;  2W3D A;  3BFC A;  3RH8 B;  3Q82 A;  4HI4 A;  4X25 A;  1ESU A;  3EGX C;  1CF0 A;  1PI4 A;  2P9V A;  3LID A;  3FKW A;  1VET B;  3VSK A;  1FR6 A;  3IH8 A;  3LO7 A;  4S2N A;  5EM0 A;  2XSS A;  3S1Y A;  1PYY A;  1CK3 A;  5F68 A;  1DP8 A;  1KGG A;  3K3C A;  3LIB A;  1K38 A;  3C8C A;  2NUP C;  3EEH A;  5HPI A;  1L3L A;  3MQ0 A;  5GLB A;  2WKH A;  3SS3 A;  2WGI A;  4R23 A;  5TBM B;  3GV9 A;  4EET B;  1YLT A;  2VV8 A;  2PT7 A;  2JN7 A;  1DJB A;  2B18 A;  4LGW A;  4DXB A;  1P9R A;  2VK3 A;  3KSF A;  1NRJ A;  1ONG A;  5HL6 A;  1E3U D;  2J3T C;  2W3H A;  2JKG A;  4UA9 A;  3PAG A;  3O5Y A;  4HH2 A;  2W1R A;  4WMC D;  3OZH A;  3T1Q B;  3GSG A;  3VP0 A;  2CC1 A;  1ZTU A;  2VGK A;  3VSL A;  1GCE A;  5GHY A;  3PBO A;  3PAE A;  3BY8 A;  2H10 A;  2W1T A;  3ZG0 A;  4E3I A;  3DWZ A;  3NDG A;  1I5Q A;  1GHI A;  2W3E A;  3O86 A;  3IX3 A;  4KQR A;  4BBU A;  3V50 A;  4ID4 A;  5CTN A;  3QNC A;  3ZG9 B;  1PWC A;  3A3J A;  1AXB A;  1NRF A;  2B02 A;  3G6O A;  3HL9 A;  4FOF A;  5HD5 A;  1RP5 A;  3JPU A;  4RQ9 A;  2JE5 A;  3E4Q A;  2H0Y A;  2VKS A;  2HP6 A;  4BQM A;  5EM1 A;  4AFI A;  4EW7 A;  4UQI M;  2ZC6 B;  3OPP A;  2PRF A;  3NHQ A;  1Y4O A;  1VEU B;  5CHJ A;  2XFT A;  3QP1 A;  5TBM A;  3CAX A;  1XPB A;  3GTC A;  4EXO A;  1YLY A;  2HP9 A;  4Y13 A;  3MXR A;  4HJ6 A;  1NYY A;  3OC2 A;  1YPR A;  3S7O A;  3ITB A;  4BD0 A;  2V8C A;  3SS5 A;  4WUJ A;  1XFQ A;  5HSQ A;  1JVJ A;  1KDW A;  4G3W A;  4JF6 A;  4MN5 A;  2OAP 1;  3HLD A;  2Y2O A;  4EEP A;  4ME4 A;  4DE0 A;  1UWN X;  4II7 A;  2XR0 A;  2L1M A;  3T12 B;  1BUL A;  2GJ3 A;  3W4O A;  5FI6 A;  5A92 A;  4DDS A;  4U0T A;  1K4F A;  2A24 A;  1N9B A;  4ARZ A;  2P9V B;  4MBH A;  3IHA A;  4IBX A;  3Q07 A;  2Y59 A;  2PU2 A;  3L7H A;  3L9K A;  3BFF A;  1HD8 A;  1Z6F A;  1N9L A;  3MJQ A;  1PZP A;  1XJ2 A;  3HLB A;  4OP8 A;  2ZL1 B;  3LEQ A;  4KZ5 A;  3S22 A;  1FCM A;  4RX3 A;  2EFU A;  4X56 A;  4G3K A;  1OTB A;  3SOI A;  3M2J A;  2OSU A;  2ZMA A;  5M19 A;  3LIE A;  5CTM A;  2LB5 A;  3P7N A;  2EX8 A;  4KZB A;  2XA7 S;  4GDB A;  3O88 A;  3LIF A;  1ZC2 A;  5KSH A;  1WE4 A;  3CJM A;  2Y2I A;  2B95 A;  4JXW A;  3WS1 A;  1L0E A;  4P6Z M;  5TGF A;  3NY4 A;  4MBK A;  4P6Z S;  3O3V A;  1S0W A;  2HGV A;  3IX4 A;  1XGI A;  3CHW P;  1PNE A;  3LUQ A;  4HJ4 A;  1GA9 A;  4E3K A;  1XGJ A;  3ZHH A;  1H8Z A;  4KZ8 A;  2V1B A;  1GSV A;  1YLP A;  1ALQ A;  4Y0T A;  4BL3 A;  4OOY A;  4BBV A;  2XRN A;  5IHV A;  4D2O A;  4JXG A;  1ES2 A;  3VP2 A;  4NG2 A;  1ESI A;  5HX9 A;  5EVI B;  4BLM A;  3T1S A;  3C4O A;  4YNR A;  2VGJ A;  2JCH A;  3E2K A;  4GNU A;  2C5W B;  2M7V A;  4JXV A;  1V9Z A;  4GKU A;  2OV5 A;  3OLO A;  1PZO A;  3SZT A;  4FH2 A;  4NK3 A;  3WRZ A;  3FG8 A;  5F5Y A;  5J3W A;  4LV2 A;  1VB6 A;  3MZD A;  2ZOH A;  2V1A A;  3KO6 A;  2ZQ7 A;  5HAI A;  4GN2 A;  1BYW A;  3ZGA B;  3IXH A;  1M6K A;  4HNB A;  3LY3 A;  2ZM2 A;  3EOI A;  4EUZ A;  5HW3 A;  4B4X A;  3GRJ A;  5HPF A;  5HWW A;  2J8Y A;  3TJZ C;  3FPW A;  3ZNY A;  4CQH A;  1E25 A;  1W7F A;  3FV7 A;  4QD4 A;  2K2N A;  5F69 A;  1ES5 A;  1DP6 A;  5EUA A;  4A5R A;  4HY8 A;  2D02 A;  1VEU A;  3DW0 A;  4OH0 A;  4H6J A;  4MEZ A;  4D60 A;  4KZA A;  2FFY A;  3IF6 A;  5LBR A;  1LHY A;  1IEL A;  3C7U A;  3H82 B;  3A3E A;  3PBR A;  1FIL A;  2V2F F;  3D72 A;  4GZB A;  2ZC7 A;  5CGX A;  3NEC A;  1CJF A;  3IBR A;  4KG2 A;  5CEC A;  4OKP A;  2UV0 E;  3VP3 A;  4Y17 A;  2VA0 A;  1Z09 A;  4L9F A;  3NI9 A;  3G2Z A;  3HUN A;  1MY8 A;  3MKE A;  3CUE A;  3QHY A;  2J3T D;  3IWO A;  5FAO A;  1BUE A;  4JXS A;  5DJU A;  4X55 A;  1N9N A;  1LL5 A;  4FCF A;  3MFD A;  4U0X A;  4GS9 B;  4MN6 A;  2Q9M A;  2K7S A;  5AQA A;  3LFV A;  1TS7 A;  1OJ5 A;  2PR5 A;  5GHZ A;  3ISG A;  2O99 A;  4EU0 A;  4WEK A;  3E98 A;  4EER A;  5KZH A;  3OBF A;  4S2O A;  1BLH A;  3BM6 A;  5FSR A;  3ITA A;  4LV1 A;  3TE8 A;  3IH9 A;  2INW A;  2XRO A;  2JBF A;  2ACG A;  2J3W A;  4WL9 A;  3HLE A;  2FFF B;  5KSC A;  3PBT A;  1J9M A;  5FQ9 A;  2AVX A;  5GLC A;  2Y2L A;  1G6O A;  2Y4A A;  3G32 A;  2D01 A;  2HJ9 C;  3PR6 A;  5HAQ A;  3QP4 A;  4NKP A;  4K0W A;  4Y7P A;  3P09 A;  3C2W A;  3KYZ A;  2W3G A;  2R9W A;  3HLG A;  4Y15 A;  4UA7 A;  3Q7V A;  3CMZ A;  2WZX A;  3A3D A;  4LCL A;  4WF0 A;  4E04 A;  5L07 A;  5HWV A;  3IXD A;  3MQO A;  3EGD C;  3E2L A;  3EWK A;  1T1A A;  4QY6 A;  3UMD A;  3BRM A;  1ODV A;  5FQI A;  1RGZ A;  2ZC5 B;  3LCE A;  5FAQ A;  3ICY A;  1VQQ A;  4DDY A;  1XKZ A;  2DMW A;  5HL1 A;  3ZNT A;  4BL2 A;  1MWU A;  5DF9 A;  3TRC A;  3IF5 A;  2A2L A;  3F1P B;  2M1C A;  4GHI A;  2XGN A;  1NXY A;  1UGU A;  3R7W B;  4QB8 A;  1N9O A;  1SKO B;  2X71 A;  4S2M A;  1S6R A;  3A0R A;  3VFH A;  3CPT B;  3UY6 A;  2EX9 A;  1S67 L;  2PHY A;  1TEM A;  4RA7 A;  2Y79 A;  3D3O A;  2OWJ A;  4R3B A;  3OPR A;  1IKG A;  3KSG A;  4JGO A;  1SCW A;  4PAU A;  3MSH A;  3OPH A;  4YWZ A;  1E3U A;  1IYP A;  1OTA A;  5AQ7 A;  2ZQC A;  4UAA A;  4GJ4 A;  1ERQ A;  2VGL M;  2WK0 A;  1LI0 A;  3IF6 B;  3NC8 A;  4OPZ A;  1JNU A;  3B42 A;  1EI5 A;  1XX2 A;  2JKR M;  3EQV A;  3IS2 A;  3VFF A;  3BYD A;  3ZVT A;  4Y2F A;  3DTI A;  4LFU A;  2HP5 A;  3G4P A;  1T18 A;  2L4R A;  1JWP A;  3NCK A;  3PTE A;  2PD7 A;  5FEG A;  1KVL A;  5U47 A;  5AVF A;  2P74 A;  3ZG5 A;  1K54 A;  3N8L A;  4ETX A;  4P87 A;  1TS8 A;  4ZTK A;  4X68 A;  1LI9 A;  3BY9 A;  4GB7 A;  1S4R A;  4Y5F A;  2L0W A;  1L0G A;  1G5U A;  4OON A;  4E3M A;  2XH9 A;  2ZLY A;  3HUM A;  3A3I A;  4CLC C;  4OQH A;  5TFQ A;  4GOG A;  1KGE A;  1LL8 A;  3PXP A;  4LCM A;  5AQB A;  1SHV A;  4EBN A;  1YT4 A;  3P98 A;  1OT6 A;  3QP2 A;  4CLC A;  3ZYT A;  3RFB A;  2KOI A;  1O7E A;  1C3B A;  4I3J A;  2XLN A;  3WS4 A;  1GSW A;  4OLG A;  2BTF P;  5EOO A;  4E6X A;  5FQK A;  3LI9 A;  3C38 A;  3LI8 A;  3DTE A;  3N6I A;  3GQZ A;  3T4L A;  2JKT M;  2O9C A;  1N4O A;  2YKF A;  4PM6 A;  2OOL A;  2V9A A;  4DN0 A;  3T4T A;  4ZBE A;  3LR5 A;  5CED A;  2NUT C;  2QJ7 A;  1K25 A;  2G7U A;  4CJN A;  3VE3 A;  2WYX A;  4RYE A;  5F82 A;  2B5R A;  2HPB A;  3LEZ A;  2ZQA A;  3FPV A;  1CEF A;  3JVV A;  1K54 C;  4GW9 A;  3S7P A;  5F1F A;  3N8R A;  4YOF A;  4HQA A;  5L10 A;  1W63 M;  3P01 A;  4F3L A;  4H6J B;  4XUZ A;  4IVK A;  4X53 A;  1PWG A;  5HFO A;  2QWS A;  3U4L P;  1P9W A;  4JGQ A;  3H82 A;  4MMN A;  2GDN A;  3ZVW A;  3IWI A;  5EOE A;  5EE8 A;  3HRE A;  1S66 L;  4KZ3 A;  4KEN B;  2E8I A;  2GNX A;  4HBU A;  2OAQ 1;  3CPT A;  4OQG A;  3VOZ A;  2BAS A;  1XXM A;  4OOL A;  1FR1 A;  4BEN A;  1PW8 A;  3SW1 A;  2ZD8 A;  4E3N A;  3VMA A;  5KIZ A;  4BWI A;  1YKD A;  5I94 A;  2XDM A;  4WBG A;  2PBY A;  3PBS A;  2ZC4 B;  1LSX A;  4BJP A;  5E2G A;  2Y2M A;  1S1Z A;  3Q81 A;  4EBL A;  4C6Y A;  3VP1 A;  1OME A;  2EFX A;  2Y2Q A;  3E0Y A;  4B93 A;  1OTD A;  1GA0 A;  1ZG4 A;  1D7E A;  4IUH A;  2W27 A;  3N8S A;  3DAV A;  4BMW A;  1PWD A;  3HVF A;  3KSI A;  1AWI A;  2FH5 A;  2WKR A;  2JHE A;  4NXB A;  5CER A;  1LSV A;  1NLZ A;  5FA7 A;  3IXB A;  2E8J A;  4WN5 A;  4EWF A;  4BBT A;  3BFG A;  3D9Y A;  3GVB A;  3UN7 A;  3QP5 A;  4LRZ E;  1XA1 A;  5A8B A;  1XFN A;  3UPO A;  4HEF A;  2RCX A;  4IHQ A;  3G2Y A;  4KUO A;  3GEC A;  1KE3 A;  1RGY A;  2Y2G A;  5JYO A;  4KQQ A;  3ZFZ A;  2JC7 A;  4KG5 A;  2ZQD A;  2X01 A;  4NXF A;  3SS4 A;  3ZDJ A;  3AGD A;  5CRF A;  3G30 A;  4I3I A;  4IBR A;  4PHT A;  3KYE A;  3UO9 A;  2P7J A;  2IWD A;  1K56 D;  1PI5 A;  3VV4 A;  3JYI A;  5CX7 A;  5HAP A;  1FQG A;  4GD6 A;  4OPR A;  2V1Z A;  2WKP A;  3V39 A;  2PYP A;  1IFQ A;  2HDS A;  3R7W A;  1K55 C;  2I72 A;  3WWX A;  3K2N A;  1CI9 A;  4EQ1 A;  4NET A;  1XP4 A;  5J7E A;  5JYP A;  1ZG6 A;  4B4Z A;  2W1T B;  1H3Q A;  4IUK A;  3E4O A;  3MKF A;  4WZ5 A;  1WA9 A;  4DJ3 A;  4RVA A;  2WUQ A;  3G34 A;  4L9E A;  4XT2 B;  1YLJ A;  4DE3 A;  3FWL A;  4DE2 A;  3G35 A;  4P85 A;  5G4Z A;  3WS2 A;  2WKQ A;  1GHM A;  4WLA A;  2XFS A;  1H8M A;  1MWR A;  3KSH A;  1IKI A;  2BG1 A;  1XA7 A;  5L2F A;  2XD5 A;  4OLD A;  1SDE A;  1XJ6 A;  3VOL A;  5DF8 A;  4N92 A;  3N4I A;  3NOU C;  4OVD A;  5EFW A;  3GR2 A;  5FAT A;  1OTI A;  5AVE A;  3CLO A;  3UPN A;  2H0T A;  1K55 A;  5FQQ A;  5GHX A;  4O0P A;  1LL9 A;  4K0X A;  1VET A;  3M6H A;  3I7J A;  2MJ6 A;  1F98 A;  5EV0 A;  5FAS A;  1ERM A;  4LEN A;  3NBL A;  3MMH A;  2XD1 A;  4HH3 A;  4FSF A;  4EV4 A;  1HLU P;  4OP5 A;  1UWP X;  3A3F A;  3S4X A;  1TD5 A;  3GMW A;  3MR0 A;  1P97 A;  1Q2Q A;  3IF6 C;  5GL9 A;  4R0Q A;  3AGE A;  4X1M A;  4QWO A;  3RXW A;  3H9W A;  4KZ6 A;  1RCJ A;  4X69 A;  4S2P A;  1GHP A;  4HIA A;  1X0O A;  3HCY A;  2ZM8 A;  1T1B A;  3UDX A;  1HZO A;  1DJA A;  2Y2K A;  3MXS A;  5EVI A;  5GLD A;  1NJ4 A;  3UB9 A;  5L8M A;  3HLW A;  3OCN A;  5KMW A;  1W63 Q;  3IQA A;  2HDU A;  3V3R A;  4ETZ A;  2O9A A;  2DNS A;  4O01 A;  4OPY A;  2I9V A;  4NXE A;  4UEY A;  4Q0I A;  2KX6 A;  1WYC A;  4OOM A;  3UME A;  3F1P A;  2HV1 A;  4B88 A;  2VX8 A;  5M18 A;  2GX5 A;  4E3L A;  2ZOI A;  4HJ3 A;  4QHC A;  1FIK A;  2Y2P A;  3UB7 A;  2PR6 A;  1OJG A;  1P0Z A;  1SKF A;  4PKY G;  4IVI A;  2QHK A;  4S2J A;  3T4O A;  4RX2 A;  3S7N A;  4CPK A;  4K91 A;  5G4Y A;  3O87 A;  4PKY A;  4JKT A;  2WGW B;  3LIC A;  5I5L A;  1BLC A;  3HJK A;  1YSP A;  5FAP A;  5TJJ A;  4HOI A;  1F2K A;  2K31 A;  3BEC A;  1EW0 A;  1FSW A;  5DF7 A;  5EEC A;  1MXO A;  4R4R A;  1OT9 A;  4JF5 A;  3BFE A;  1W8Q A;  1HTZ A;  3BQ8 A;  1SKO A;  2QZ6 A;  4NXG A;  3TOI A;  1Y54 A;  1PW1 A;  2QMI A;  3FZC A;  1YMX A;  1MKI A;  2VLG A;  3CWF A;  1XJ3 A;  4UA6 A;  3SH9 A;  4M3K A;  3SH8 A;  2ZMV A;  1H5X A;  3FC7 A;  4JLF A;  1W79 A;  4Q8I A;  4X6T A;  3W2Z A;  1YM1 A;  2WKE A;  1YMS A;  2WGW A;  5EVL A;  5FQM A;  1ES4 A;  1K57 A;  3K3D A;  2EWW A;  2ZBB A;  4CLC E;  4EBP A;  3UE3 A;  3ZG8 B;  3NOT C;  4I3A A;  4YFM A;  2EX6 A;  3TG9 A;  2V20 A;  1TDL A;  3HJI A;  4E6W A;  3ZCZ A;  1TVF A;  4JGR A;  5BOH A;  5GLA A;  1ERO A;  2WZZ A;  5DTT A;  1KGF A;  1G68 A;  4FTX A;  3QP6 A;  4IJG A;  4GS9 A;  4FUW A;  1ZKJ A;  1JWV A;  3MZF A;  1W8Y A;  2EX2 A;  4ESP A;  2OWH A;  3IHB A;  2WKI A;  4PM9 A;  1YQS A;  4JGP A;  3NUL A;  3W4P A;  3NDE A;  4Z1W A;  2XK1 A;  1K57 C;  2W0N A;  1I2S A;  3T50 A;  2HDQ A;  2ZC3 B;  1NZO A;  2G2U A;  2Z6C A;  5DTK A;  3NIA A;  3V67 A;  1K6S A;  1CEG A;  3LGO A;  4S2N C;  5DTS A;  1FCO A;  1L2S A;  4I39 A;  1QMF A;  3HLF A;  4EQI A;  2YKH A;  1L0F A;  4WZ5 C;  3VE4 A;  2WGV A;  3UNW A;  3U2A A;  3H7W B;  1KVM A;  3BLM A;  3LR4 A;  4L0L A;  2JKR I;  4E3O A;  3CUE C;  3T1R A;  3BEB A;  4JBF A;  4PM8 A;  5G18 A;  4IED A;  4R1G A;  1Y28 A;  4XXR A;  3T4J A;  3IT9 A;  2V8F A;  4DKI A;  5DVA A;  1K6R A;  4GDN A;  1WYB A;  1MZU A;  5DJT A;  3S7Q A;  5IU1 A;  1BZA A;  4KUK A;  4Y0U A;  4Y0O A;  3OOV A;  5EVI C;  4FH4 A;  3LY4 A;  1BTL A;  3WS5 A;  5CGW A;  4G3V A;  5AJG A;  3F1N B;  2FZ0 A;  1BLP A;  5A90 A;  2J9P A;  1MKM A;  2XEP A;  2WAE A;  4EUV A;  4Z9Q A;  1BSG A;  3MFX A;  4HES A;  4R4S A;  4WZ4 A;  3CIT A;  3IS2 B;  1HVB A;  2HZ5 A;  1MWS A;  1STZ A;  4LV0 A;  3HBR A;  1SZV A;  2PU4 A;  2A3U A;  4BD1 A;  2O9B A;  1H0M A;  5FI2 A;  2XQZ A;  4XT2 A;  1JWZ A;  5TR7 A;  4QJG A;  2P04 A;  2Y2H A;  4JPM A;  4DXC A;  5K5B A;  5FQJ A;  4F94 A;  4I5S A;  2RL3 A;  4S2I A;  5CHM A;  4WM9 A;  3H7W A;  2IA2 A;  2M7U A;  5DFX A;  3ULF A;  3F1N A;  1NZU A;  3QNB A;  1IEM A;  2HJE A;  1ES3 A;  5HDC A;  3PBQ A;  1K0K A;  1FCN A;  3ZG7 B;  1E4D A;  1FOF A;  4HP9 A;  2ZM0 A;  2JKF A;  5HZH A;  3HLC A;  4O8G A;  5CEB A;  4ZJ3 A;  4ZRR A;  3C7V A;  3DTK A;  4KQO A;  3MZE A;  4MBF A;  1EWZ A;  4K08 A;  3LR0 A;  3T4Q A;  5FDH A;  1IYO A;  3FKV A;  4WMC A;  3UDF A;  1M40 A;  2EA9 A;  5DFY A;  2UWX A;  2V0U A;  2Z2L B;  2Q0O A;  4DJ2 A;  5J8X A;  2C6W B;  3KYQ A;  3Q7Z A;  2XF3 A;  1K56 A;  3JVU A;  3LIA A;  1LT0 A;  1D06 A;  2ZQ8 A;  4GHI B;  3OCL A;  4QY5 A;  2OLU A;  4MNR A;  4X1L A;  4E3J A;  4QU3 A;  3B33 A;  1T1C A;  3G31 A;  3VOY A;  3RXX A;  4N1H A;  1G28 A;  2H5S A;  3F1O A;  1LLB A;  1I2W A;  1TS6 A;  4PMA A;  1YAX A;  4OQ0 A;  3HUO A;  3WS0 A;  3Q7V B;  4S2L A;  3BWL A;  1LSW A;  4H8R A;  3FYZ A;  4LRY C;  1IOU A;  1U60 A;  1KE0 A;  4LPZ A;  5EVE A;  2H28 A;  4EEU A;  2PBD P;  2HF6 A;  3DTM A;  3ZQ5 A;  3VP4 A;  2VEA A;  3W4Q A;  1A0K A;  2VV7 A;  2Y91 A;  3B3X A;  2CMN A;  1YLW A;  2ZQ9 A;  3QP8 A;  1ONH A;  4WEL A;  4PPR A;  3OPL A;  3TW8 A;  4R6L A;  1DJC A;  3SH7 A;  1K4E A;  4U3T A;  1F5M A;  1O07 A;  3B47 A;  1T19 A;  4LRX C;  4MDZ A;  5DKK A;  2P08 A;  1H8Y A;  1YSQ A;  3TSG A;  3LR3 A;  1BT5 A;  5EVI D;  2KDK A;  2OLV A;  4Q0J A;  3AGF A;  4HP4 A;  1CI8 A;  1MBL A;  5F1G A;  4GCZ A;  4R3J A;  2IWC A;  1W5D A;  1SDN A;  3UB5 P;  3C30 A;  1DY6 A;  4L9G A;  4QPR A;  3F1O B;  1QME A;  2PAV P;  4KG6 A;  2Z6D A;  4N9K A;  3NOP C;  1YLZ A;  1TF1 A;  1KOU A;  1V9Y A;  4JF4 A;  4MN7 A;  1IYQ A;  3KX0 X;  5L09 A;  3C5A A;  3DBA A;  2DRW A;  1GSX A;  2QJ5 A;  4R38 A;  4DMZ A;  4DF6 A;  2JKT I;  3D4F A;  1KDS A;  4ZDX A;  3C4P A;  3CZD A;  5EPH A;  2WAF A;  4KZ4 A;  4DE1 A;  2VGL S;  1JTG A;  2Y2J A;  1XJ4 A;  2Y55 A;  4DRT A;  3UE1 A;  4F3L B;  5CHU A;  4P6B A;  1JTD A;  1S1Y A;  2EXA A;  4R3A A;  1DP9 A;  3IWQ A;  3UB6 A;  4OQI A;  3IBJ A;  3T4S A;  3BW6 A;  4UHU A;  1S4S A;  4ZJ2 A;  3GDI A;  4I38 A;  5CXW A;  2V0W A;  2QKP A;  2QPN A;  4YIN A;  5AQ9 A;  5FI7 A;  1NWZ A;  4LLO B;  3A0V A;  1ZHH B;  1J3W A;  1Q2P A;  4CLC D;  5E43 A;  5D3O A;  3BFD A;  3IXG A;  5HDD A;  2EWV A;  1MPL A;  2X02 A;  2J9O A;  4KZ9 A;  3M2K A;  4B9O A;  3MS6 A;  3WRT A;  3MF0 A;  4R70 A;  4C3Q A;  1DRM A;  4FD8 A;  4PM7 A;  3UDI A;  1F9I A;  2G2W A;  1D1J A;  3W8K A;  2VJW A;  4M4X A;  4EES A;  5HD3 A;  4N9L A;  2BLS A;  3T4K A;  5E2F A;  3PYP A;  3N7W A;  2J7V A;  4GD8 A;  3UPP A;  4KQD A;  5IT5 A;  3BLS A;  4OPQ A;  4Y3I A;  1VHM A;  5J4E A;  3IX8 A;  3MBZ A;  5E2H A;  4Q0H A;  3V5M A;  4CLC B;  1NYM A;  4NEE D;  3V3S A;  2PD8 A;  1ACF A;  5M1A A;  5E2E A;  5HWT A;  3LYX A;  3UE0 A;  2PDR A;  1TS0 A;  4PM5 A;  3UE6 A;  5DKL A;  4P0M A;  2W3F A;  5IS1 A;  3NJA A;  4MLL A;  3MXQ A;  5F6A A;  3R4K A;  4N1X A;  3RJU A;  3E4P A;  5F83 A;  4KZ7 A;  2DCF A;  5A93 A;  1NLY A;  4WEJ A;  2WAD A;  3EEA A;  1IYS A;  2IWB A;  4C75 A;  4UQI S;  2Y2N A;  1FSY A;  2VV6 A;  3M6B A;  3A0S A;  2J80 A;  1TDG A;  3Q1F A;  5FL3 A;  1MWT A;  1PFL A;  1VM1 A;  1PIO A;  2PYR A;  2XA7 M;  5HAR A;  3PBN A;  2ZJ9 A;  3EQU A;  1NY0 A;  3PHY A;  3UB8 A;  5C5K A;  5HDS A;  2O0Y A;  4GLQ A;  4ZAM A;  4MCW A;  2Y8H A;  5MC7 A;  5FDS A;  2R9X A;  2Z2M B;  2Q9N A;  4S2K A;  1G6A A;  3CI6 A;  2ZMF A;  1CQA A;  4ZJ1 A;  4HBT A;  4WYY A;  5CGS A;  1BLS A;  1L0D A;  2A24 B;  3MQQ A;  1OTE A;  2GZA A;  3BQA A;  1OPX A;  2KLI A;  5FEF A;  2LB9 A;  3RTY A;  1MC0 A;  4O7D A;  2EXB A;  4ARZ B;  3CG5 A;  4HHD A;  3DWK A;  3BJN A;  5A91 A;  3T1X A;  2QYB A; 
#chains in the Genus database with same CATH homology
 3ISG A;  1HVB A;  2A49 A;  4HEF A;  2RCX A;  1KE4 A;  1MWS A;  4LV0 A;  3G2Y A;  3HBR A;  4WEK A;  1KE3 A;  1RGY A;  2HDR A;  2PU4 A;  2A3U A;  4BD1 A;  2Y2G A;  4XUX A;  4LV3 A;  5KZH A;  5JYO A;  3BFC A;  5FI2 A;  4KQQ A;  2XQZ A;  2JC7 A;  4S2O A;  3ZFZ A;  1BLH A;  4KG5 A;  2ZQD A;  2X01 A;  3SS4 A;  1JWZ A;  5TR7 A;  3BM6 A;  3Q82 A;  3AGD A;  3ITA A;  4LV1 A;  5FSR A;  3ZDJ A;  2Y2H A;  4QJG A;  4JPM A;  1ESU A;  5CRF A;  3IH9 A;  3G30 A;  4DXC A;  4IBR A;  1PI4 A;  2P9V A;  5FQJ A;  3FKW A;  4F94 A;  3UO9 A;  2IWD A;  1K56 D;  1PI5 A;  5HAP A;  3JYI A;  2RL3 A;  4S2I A;  2JBF A;  5CHM A;  4WM9 A;  3VSK A;  1FQG A;  4GD6 A;  4OPR A;  2V1Z A;  1FR6 A;  3HLE A;  3IH8 A;  2FFF B;  3LO7 A;  5KSC A;  4S2N A;  3V39 A;  3PBT A;  1NZU A;  1J9M A;  3QNB A;  2HDS A;  5FQ9 A;  1IEM A;  1K55 C;  2I72 A;  5GLC A;  1ES3 A;  3S1Y A;  3WWX A;  1PYY A;  1CI9 A;  3PBQ A;  1CK3 A;  1FCN A;  2Y2L A;  3ZG7 B;  4NET A;  1KGG A;  1XP4 A;  1K38 A;  1E4D A;  1FOF A;  5JYP A;  1ZG6 A;  2Y4A A;  3G32 A;  4B4Z A;  2ZM0 A;  3MKF A;  3HLC A;  5HAQ A;  4WZ5 A;  5CEB A;  4ZJ3 A;  4RVA A;  4K0W A;  4Y7P A;  3P09 A;  2WUQ A;  3C7V A;  3G34 A;  5GLB A;  2WKH A;  4KQO A;  3MZE A;  3SS3 A;  2WGI A;  2R9W A;  4R23 A;  1YLJ A;  3HLG A;  4MBF A;  3GV9 A;  1EWZ A;  4DE3 A;  1YLT A;  3FWL A;  5FDH A;  4UA7 A;  3Q7V A;  3CMZ A;  1IYO A;  4DE2 A;  3G35 A;  1DJB A;  2WZX A;  4P85 A;  3WS2 A;  1GHM A;  3A3D A;  3FKV A;  4LCL A;  4WMC A;  4DXB A;  3UDF A;  1M40 A;  2XFS A;  2UWX A;  1ONG A;  1MWR A;  3IXD A;  2Z2L B;  1IKI A;  1E3U D;  2BG1 A;  1XA7 A;  5L2F A;  4UA9 A;  3PAG A;  2XD5 A;  4OLD A;  1SDE A;  5J8X A;  3E2L A;  2C6W B;  4QY6 A;  4WMC D;  3BRM A;  3OZH A;  3Q7Z A;  5DF8 A;  5FQI A;  3GSG A;  3VP0 A;  1RGZ A;  2ZC5 B;  2CC1 A;  3LCE A;  5FAQ A;  2XF3 A;  4N92 A;  1K56 A;  3N4I A;  2VGK A;  1VQQ A;  4DDY A;  1XKZ A;  4OVD A;  3VSL A;  2ZQ8 A;  1GCE A;  3GR2 A;  5FAT A;  5GHY A;  5HL1 A;  3PBO A;  3PAE A;  3ZNT A;  4BL2 A;  2H10 A;  1MWU A;  3OCL A;  4QY5 A;  2H0T A;  5DF9 A;  3UPN A;  1K55 A;  5FQQ A;  3ZG0 A;  4E3I A;  3DWZ A;  2OLU A;  5GHX A;  3NDG A;  1I5Q A;  3IF5 A;  4MNR A;  1LL9 A;  4E3J A;  4QU3 A;  4K0X A;  1GHI A;  3G31 A;  3VOY A;  3RXX A;  3O86 A;  4N1H A;  3M6H A;  3I7J A;  2H5S A;  2XGN A;  4KQR A;  1LLB A;  1NXY A;  1I2W A;  4PMA A;  3V50 A;  5FAS A;  4ID4 A;  5CTN A;  4OQ0 A;  3HUO A;  1ERM A;  3QNC A;  4QB8 A;  4LEN A;  3WS0 A;  3ZG9 B;  1PWC A;  3Q7V B;  3A3J A;  1AXB A;  2X71 A;  3NBL A;  1NRF A;  1S6R A;  4S2L A;  3HL9 A;  4S2M A;  1RP5 A;  4H8R A;  3VFH A;  3FYZ A;  2XD1 A;  3UY6 A;  2JE5 A;  2EX9 A;  2H0Y A;  4FSF A;  1TEM A;  1U60 A;  4EV4 A;  4OP5 A;  1KE0 A;  3A3F A;  2HP6 A;  4RA7 A;  3S4X A;  3GMW A;  4BQM A;  3DTM A;  3VP4 A;  1Q2Q A;  3IF6 C;  5GL9 A;  3W4Q A;  4R0Q A;  3AGE A;  4R3B A;  2ZC6 B;  3OPP A;  3OPR A;  1IKG A;  2Y91 A;  3RXW A;  3B3X A;  5CHJ A;  2XFT A;  1YLW A;  2ZQ9 A;  4KZ6 A;  1RCJ A;  1SCW A;  1ONH A;  1XPB A;  3GTC A;  4WEL A;  3OPH A;  1E3U A;  1YLY A;  2HP9 A;  3MXR A;  4PPR A;  4X69 A;  4S2P A;  1IYP A;  1GHP A;  3OPL A;  1NYY A;  3OC2 A;  5AQ7 A;  2ZQC A;  4UAA A;  1DJC A;  1ERQ A;  2ZM8 A;  3SH7 A;  1K4E A;  3ITB A;  2WK0 A;  1LI0 A;  3IF6 B;  3NC8 A;  4U3T A;  4BD0 A;  3UDX A;  4OPZ A;  3SS5 A;  1EI5 A;  1HZO A;  1JVJ A;  1DJA A;  1KDW A;  1XX2 A;  1O07 A;  4JF6 A;  2Y2K A;  3MXS A;  5EVI A;  3HLD A;  3EQV A;  2Y2O A;  5GLD A;  4DE0 A;  1NJ4 A;  1H8Y A;  3VFF A;  3HLW A;  3BYD A;  3OCN A;  5KMW A;  3TSG A;  3ZVT A;  3IQA A;  3V3R A;  2HDU A;  1BT5 A;  2HP5 A;  2XR0 A;  5EVI D;  2OLV A;  3G4P A;  2DNS A;  3AGF A;  1CI8 A;  1MBL A;  4OPY A;  5F1G A;  1JWP A;  1BUL A;  3NCK A;  3PTE A;  3W4O A;  5FI6 A;  4R3J A;  1KVL A;  5A92 A;  2IWC A;  5U47 A;  2P74 A;  1W5D A;  1SDN A;  3ZG5 A;  4U0T A;  1WYC A;  4OOM A;  4DDS A;  1K4F A;  1DY6 A;  1K54 A;  3N8L A;  1N9B A;  2P9V B;  4P87 A;  1QME A;  4B88 A;  4MBH A;  3IHA A;  4IBX A;  4ZTK A;  4X68 A;  5M18 A;  3Q07 A;  1LI9 A;  4KG6 A;  4GB7 A;  4E3L A;  2Y59 A;  2PU2 A;  4N9K A;  4QHC A;  1YLZ A;  2Y2P A;  3BFF A;  1HD8 A;  1Z6F A;  4JF4 A;  1L0G A;  1SKF A;  4OON A;  1PZP A;  1IYQ A;  3HLB A;  4OP8 A;  4E3M A;  4IVI A;  2XH9 A;  2ZLY A;  3C5A A;  3HUM A;  4S2J A;  2DRW A;  3A3I A;  4RX2 A;  4CPK A;  4K91 A;  4KZ5 A;  3S22 A;  4DF6 A;  3O87 A;  1FCM A;  4OQH A;  3D4F A;  1KDS A;  4JKT A;  4RX3 A;  2WGW B;  5TFQ A;  4ZDX A;  2EFU A;  4X56 A;  4GOG A;  3C4P A;  1KGE A;  3CZD A;  1BLC A;  5EPH A;  2WAF A;  4KZ4 A;  4LCM A;  4DE1 A;  5AQB A;  5FAP A;  1SHV A;  1JTG A;  2Y2J A;  3M2J A;  3SOI A;  4EBN A;  2OSU A;  2ZMA A;  1YT4 A;  5M19 A;  2Y55 A;  5CTM A;  3BEC A;  3P98 A;  1FSW A;  5DF7 A;  4DRT A;  3UE1 A;  5EEC A;  1MXO A;  5CHU A;  2EX8 A;  4KZB A;  4P6B A;  4R4R A;  1O7E A;  1C3B A;  4JF5 A;  4GDB A;  3O88 A;  2XLN A;  1JTD A;  5KSH A;  1ZC2 A;  3BFE A;  1W8Q A;  1HTZ A;  1WE4 A;  3WS4 A;  3CJM A;  2EXA A;  2Y2I A;  2QZ6 A;  3IWQ A;  4OQI A;  3TOI A;  1Y54 A;  1PW1 A;  4OLG A;  2QMI A;  3FZC A;  4JXW A;  1YMX A;  1L0E A;  1MKI A;  3WS1 A;  4UHU A;  5TGF A;  3NY4 A;  5EOO A;  4MBK A;  4E6X A;  4ZJ2 A;  5FQK A;  3O3V A;  5CXW A;  1S0W A;  2QPN A;  4YIN A;  5AQ9 A;  5FI7 A;  1XGI A;  4UA6 A;  3SH9 A;  3N6I A;  4M3K A;  3GQZ A;  1N4O A;  1Q2P A;  4PM6 A;  3SH8 A;  5E43 A;  5D3O A;  1GA9 A;  4E3K A;  1H5X A;  1XGJ A;  3BFD A;  3IXG A;  3ZHH A;  4JLF A;  1W79 A;  4Q8I A;  1H8Z A;  4KZ8 A;  2X02 A;  1MPL A;  4X6T A;  2J9O A;  4KZ9 A;  3M2K A;  1YM1 A;  2WKE A;  1YMS A;  3WRT A;  2WGW A;  4C3Q A;  5EVL A;  5FQM A;  1ES4 A;  1YLP A;  1K57 A;  4ZBE A;  4FD8 A;  5CED A;  4PM7 A;  3UDI A;  1ALQ A;  2G2W A;  4Y0T A;  1K25 A;  4BL3 A;  4OOY A;  3W8K A;  5IHV A;  4D2O A;  4CJN A;  2WYX A;  4RYE A;  5F82 A;  4EBP A;  2B5R A;  1ES2 A;  2HPB A;  4JXG A;  3VP2 A;  3LEZ A;  1ESI A;  5HX9 A;  3UE3 A;  4N9L A;  5EVI B;  2BLS A;  2ZQA A;  3ZG8 B;  4BLM A;  1CEF A;  3C4O A;  5E2F A;  3N7W A;  1K54 C;  2J7V A;  2JCH A;  2VGJ A;  4GD8 A;  3UPP A;  3E2K A;  4YFM A;  2EX6 A;  4GNU A;  2C5W B;  3TG9 A;  2V20 A;  4JXV A;  5F1F A;  4GKU A;  2OV5 A;  3N8R A;  1PZO A;  1TDL A;  3BLS A;  4OPQ A;  3MBZ A;  4FH2 A;  4E6W A;  5E2H A;  4NK3 A;  3WRZ A;  3ZCZ A;  1TVF A;  5BOH A;  4LV2 A;  5GLA A;  1ERO A;  2WZZ A;  3MZD A;  5DTT A;  3V5M A;  4XUZ A;  1KGF A;  4IVK A;  4X53 A;  1NYM A;  1G68 A;  1PWG A;  2ZQ7 A;  3V3S A;  5HAI A;  5M1A A;  5HFO A;  5E2E A;  1ZKJ A;  1JWV A;  3MZF A;  3UE0 A;  1W8Y A;  2EX2 A;  4PM5 A;  2GDN A;  4GN2 A;  3ZVW A;  3ZGA B;  3IHB A;  2WKI A;  3IWI A;  4P0M A;  4PM9 A;  1YQS A;  5EOE A;  3IXH A;  4MLL A;  1M6K A;  3LY3 A;  2ZM2 A;  3NDE A;  3W4P A;  2XK1 A;  4EUZ A;  5HW3 A;  1K57 C;  5EE8 A;  1I2S A;  3GRJ A;  3HRE A;  4B4X A;  4N1X A;  3RJU A;  2HDQ A;  4KZ3 A;  2ZC3 B;  1NZO A;  4KZ7 A;  2DCF A;  4KEN B;  2G2U A;  2E8I A;  4HBU A;  5F83 A;  5A93 A;  5DTK A;  2J8Y A;  3VOZ A;  4OQG A;  3NIA A;  1K6S A;  1XXM A;  1CEG A;  4OOL A;  2WAD A;  4WEJ A;  4S2N C;  1FR1 A;  5DTS A;  3ZNY A;  4BEN A;  1PW8 A;  1FCO A;  1E25 A;  1W7F A;  1IYS A;  2ZD8 A;  2IWB A;  4C75 A;  4E3N A;  3FV7 A;  3VMA A;  4QD4 A;  1L2S A;  5I94 A;  1ES5 A;  2XDM A;  2Y2N A;  5EUA A;  1FSY A;  3M6B A;  4WBG A;  4A5R A;  2PBY A;  1TDG A;  3PBS A;  1QMF A;  3Q1F A;  3HLF A;  1MWT A;  2ZC4 B;  3DW0 A;  4OH0 A;  1VM1 A;  4MEZ A;  4BJP A;  1PIO A;  4EQI A;  4KZA A;  1L0F A;  4WZ5 C;  2WGV A;  5E2G A;  3UNW A;  5HAR A;  3PBN A;  2ZJ9 A;  1KVM A;  2Y2M A;  2FFY A;  1NY0 A;  3EQU A;  1LHY A;  3IF6 A;  1IEL A;  3C7U A;  3BLM A;  4EBL A;  3Q81 A;  4L0L A;  4C6Y A;  3A3E A;  3PBR A;  1OME A;  2V2F F;  3VP1 A;  4E3O A;  2EFX A;  2Y2Q A;  4GZB A;  2ZC7 A;  5CGX A;  4ZAM A;  3BEB A;  4JBF A;  1GA0 A;  1ZG4 A;  4PM8 A;  5G18 A;  4KG2 A;  4IED A;  5CEC A;  3N8S A;  4OKP A;  4R1G A;  2R9X A;  4XXR A;  3VP3 A;  3IT9 A;  2Z2M B;  2Q9N A;  1PWD A;  3HVF A;  4S2K A;  1G6A A;  4DKI A;  1K6R A;  3G2Z A;  3NI9 A;  3HUN A;  5DVA A;  1MY8 A;  1WYB A;  4GDN A;  3MKE A;  3QHY A;  1BZA A;  3IWO A;  5FAO A;  1BUE A;  4JXS A;  4Y0O A;  4Y0U A;  4ZJ1 A;  5CER A;  4HBT A;  4WYY A;  4X55 A;  5EVI C;  5CGS A;  4FH4 A;  3LY4 A;  1BTL A;  1BLS A;  1L0D A;  1LL5 A;  4FCF A;  3MFD A;  3WS5 A;  5CGW A;  5FA7 A;  4U0X A;  3IXB A;  1BLP A;  4EWF A;  2J9P A;  5A90 A;  4O7D A;  2EXB A;  2XEP A;  2Q9M A;  3BFG A;  3GVB A;  2WAE A;  4Z9Q A;  1BSG A;  3UN7 A;  5AQA A;  4HES A;  3CG5 A;  4R4S A;  3DWK A;  1XA1 A;  4WZ4 A;  5GHZ A;  5A91 A;  3UPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...