4OPYA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extended spectrum beta-lactamase TEM-63
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opyA00
1ES4A 3MZDA 1I2WA 2WGVA 4ZBEA 4S2MA 2X01A 4X68A 5FASA 5M19A 1MWUA 4OPYA 2RCXA 3A3IA 2OSUA 1KVLA 2ZQCA 3UE0A 1CEFA 4X6TA 4DDSA 1RCJA 1L0GA 3OCNA 3D4FA 1LL9A 3M2JA 1YT4A 4OKPA 2E8IA 2ZLYA 3TOIA 4DE1A 3QHYA 5FAQA 2VGKA 2Y59A 3C4OA 4FCFA 4JPMA 1MY8A 2ZM2A 2XF3A 4GDNA 5DF8A 5FQKA 1K38A 2Y55A 4EQIA 3FKVA 2BLSA 4M3KA 4H8RA 3V50A 4WZ5A 3TG9A 5CTNA 3UE1A 5FI2A 4NETA 5EECA 2Y2MA 3C7UA 1MWRA 1DJAA 4OOLA 2ZQDA 5FI7A 1K55A 1PI4A 4GD6A 4FH4A 3SH9A 4X56A 1KVMA 2HDRA 4QJGA 1BLCA 4OQGA 4UHUA 4B88A 1H5XA 3WS1A 1PI5A 4X55A 5BOHA 3BM6A 1XA1A 1IYOA 2WZZA 3ZNTA 2A49A 3AGFA 3NI9A 4WZ5C 2EXAA 5FQMA 3HREA 1EROA 2XEPA 1WYCA 1ALQA 4OH0A 4BL3A 1SKFA 3ITAA 1IYQA 5GLDA 3IWQA 4WM9A 1W8QA 4X53A 1RGZA 2XDMA 5CECA 1XX2A 3O3VA 4KG5A 4A5RA 4F94A 4N1HA 1N4OA 4IBXA 4E3JA 5F82A 1NYMA 5CHMA 3SS3A 5KSHA 4N9LA 5AQ9A 4LV3A 1K6RA 2Q9NA 4PMAA 1GA9A 2XD1A 1G6AA 4FH2A 2J9PA 5FDHA 4ZJ3A 1BULA 1N9BA 1KGEA 4KZBA 3SS5A 5M18A 2ZC6B 2Y2KA 2IWCA 3VSLA 1IELA 1MWTA 4GN2A 2ZC5B 4Y0UA 3C5AA 3LO7A 1BSGA 3A3FA 3ZG8B 3GRJA 3FWLA 3HUOA 3BLMA 5KMWA 3G2ZA 3MFDA 3DW0A 4RYEA 1JTDA 3I7JA 1S6RA 4S2NA 2XGNA 4OOMA 5M1AA 4DE2A 4GKUA 1E4DA 2IWDA 3W4PA 3A3DA 1ZG6A 2WAFA 3HLGA 4KG6A 2J8YA 1ERMA 5FAOA 5DTKA 4R0QA 4XUZA 2XR0A 3O86A 3SS4A 4EWFA 1Q2PA 2ZMAA 4WMCA 3VP4A 3IXHA 2JBFA 1ZC2A 3HUNA 3V39A 4WEKA 1EWZA 4OP8A 3VOZA 3W4OA 3VFFA 5I94A 2Y2HA 5AQBA 5J8XA 3ZCZA 2H0TA 2EX6A 3IF6C 3ZG5A 3M2KA 4QD4A 1CI9A 2HDSA 3G2YA 4JXWA 1IEMA 4IBRA 3NDGA 4LV2A 5EE8A 1K56D 2GDNA 5FQJA 3N6IA 3IQAA 1JVJA 2P9VA 3HBRA 2WKIA 4D2OA 1QMEA 3IHBA 2P9VB 5HAQA 1CK3A 5E2FA 1O07A 5EVID 2DRWA 2HP9A 5TR7A 4YINA 3O88A 5F1GA 2EXBA 5EUAA 3IH9A 3GMWA 5HARA 2Y2QA 5DVAA 3WWXA 1JWVA 4MLLA 2G2WA 4RX2A 5EPHA 1XGJA 3C7VA 3GSGA 2WGWB 4LCLA 2DNSA 3S4XA 5EVIC 5KSCA 2PU2A 2V20A 4EV4A 3MBZA 1YLPA 2HP5A 4DRTA 2C5WB 1NZOA 2X71A 3Q82A 4DXCA 2QMIA 3VOYA 1L0DA 3MXSA 1PW1A 4B4XA 1BLHA 4PPRA 1PYYA 3IXGA 3ZG7B 2H10A 2I72A 5G18A 3S1YA 4E3NA 4NK3A 3BFFA 2Y2PA 5FAPA 1YMXA 4E3LA 1XGIA 1YM1A 1GCEA 2R9XA 1LL5A 2B5RA 4K91A 1HD8A 1LI9A 2VGJA 2ZQ7A 1YLZA 2CC1A 2WK0A 4N1XA 2Y2OA 2R9WA 5A91A 4HBUA 3ISGA 3M6HA 5CGSA 1KDWA 3PBTA 3CZDA 3VSKA 4OLDA 2WAEA 4U0XA 1HTZA 1SCWA 2EX9A 4R23A 4E6XA 1FSWA 5FI6A 3UPPA 2HDUA 3VP1A 2C6WB 4Q8IA 3A3JA 4PM5A 4BENA 2BG1A 5U47A 4DXBA 3OZHA 2H0YA 2IWBA 2ZM0A 1XPBA 5CXWA 3EQUA 1ONHA 3RXXA 3N8SA 1IYSA 3DWKA 5HX9A 5D3OA 4QY5A 2ZM8A 4U3TA 5FATA 4JXVA 5CHUA 5E2EA 1K55C 4E3KA 4HESA 3E2LA 4OVDA 4KQRA 4BJPA 5CEDA 1YMSA 4OPZA 3V5MA 2FFYA 4KZAA 1PWDA 4S2JA 1TDGA 4OQHA 1DY6A 4B4ZA 4Y0TA 4LV0A 1W5DA 3UPOA 1XP4A 5E2GA 5FQIA 4HEFA 2ZQAA 1ES2A 1K4FA 3PBRA 4JKTA 1Z6FA 4P6BA 3O87A 4E3IA 1C3BA 3OCLA 5F1FA 4R3BA 4S2PA 5FQQA 1HVBA 3Q07A 1LI0A 4FD8A 1YQSA 1RP5A 4MBKA 2P74A 3CMZA 4EBLA 4PM7A 4UA6A 3WS0A 1KE4A 2WGIA 5A92A 2FFFB 1L0FA 3N7WA 1G68A 4HBTA 3PAGA 4LV1A 4OPQA 2H5SA 3CJMA 5EOOA 3W8KA 5JYPA 2OLUA 4PM8A 1H8ZA 5AQAA 3WS2A 4S2IA 4WMCD 3V3SA 3MKFA 3UE3A 4KZ5A 3GR2A 4JXGA 1IYPA 3PBNA 3BFDA 4S2NC 4ZDXA 2XD5A 5HAIA 3QNCA 5L2FA 3ZG9B 1H8YA 4GDBA 1WYBA 2XK1A 2JC7A 4P0MA 5GL9A 3VP0A 1FSYA 1L0EA 3HLEA 4JF6A 1U60A 5EVLA 3VFHA 1GA0A 4L0LA 1JWPA 3IWIA 1XXMA 3G35A 4KZ9A 5HAPA 2X02A 1YLJA 3BLSA 1GHPA 4JF5A 1NYYA 3IF6B 1IKIA 5F83A 1TEMA 5FQ9A 3UDFA 4S2OA 2WGWA 3IF5A 3C4PA 3ZNYA 1KE0A 3PTEA 5TGFA 3UY6A 1W79A 2OLVA 3TSGA 1YLYA 4XXRA 2QZ6A 4KQOA 3MZEA 3S22A 4OLGA 3ZFZA 3N8LA 3WRTA 4K0WA 4K0XA 3UDXA 1BLSA 3M6BA 5GHZA 5IHVA 2JE5A 3HLCA 3HLBA 3SOIA 1ERQA 3DTMA 1K57A 3PBOA 1E25A 1K25A 1OMEA 2Y2LA 1EI5A 2Y4AA 3ZHHA 1NRFA 3CG5A 3OPPA 4JXSA 5KZHA 3PAEA 5EVIB 1O7EA 4O7DA 4P87A 1CI8A 1MWSA 2ZQ9A 4MEZA 5CRFA 3QNBA 3BFCA 4QHCA 4DDYA 1KGFA 3FYZA 4BL2A 4E3MA 4KZ6A 3W4QA 5CGWA 3E2KA 3EQVA 3P09A 1SHVA 3BECA 4S2KA 3BEBA 1MKIA 2XQZA 4JF4A 2Y2GA 1IKGA 4OOYA 4PM6A 1E3UA 3NY4A 5GHYA 3OPLA 1FQGA 2ZJ9A 4BQMA 4DE3A 5DTTA 2V2FF 3HUMA 3UN7A 4OPRA 3BFGA 3N8RA 2JCHA 1I5QA 3A3EA 1I2SA 1BLPA 3BFEA 3G30A 1K54A 3FV7A 3N4IA 4YFMA 1M6KA 3UO9A 1XA7A 4DF6A 3Q7VA 3AGDA 4KZ8A 4Y0OA 3AGEA 3NBLA 4OP5A 4EBNA 1BZAA 1FCNA 1FR1A 3Q7VB 1ZKJA 4RVAA 3HVFA 5EOEA 2J7VA 4RX3A 3GV9A 5E43A 3LCEA 1J9MA 3UNWA 3UDIA 5JYOA 1K54C 2Y91A 1YLTA 4MNRA 1PW8A 3LEZA 3VMAA 2QPNA 3ZDJA 1QMFA 2ZC7A 1DJBA 3IH8A 3RXWA 2Z2MB 3LY3A 4R3JA 2HPBA 2ZQ8A 4ZAMA 3ZGAB 1PZPA 2V1ZA 4BLMA 1NZUA 4MBFA 1PWCA 4R4SA 4WELA 4EUZA 1ONGA 2UWXA 3ZG0A 2HDQA 1BTLA 5GHXA 2HP6A 1PZOA 4GOGA 4P85A 5GLAA 3WRZA 1JTGA 4QY6A 5DF7A 4FSFA 3OPHA 4UA9A 3IXDA 2Y2NA 4LENA 1NY0A 3MZFA 3ZVWA 4LCMA 1NJ4A 1LLBA 3RJUA 2PU4A 4QB8A 3GQZA 2WZXA 4R4RA 4IVKA 4GNUA 4UAAA 2ZC4B 4OONA 3WS5A 1PWGA 2ZD8A 4KZ3A 4CPKA 4WEJA 1L2SA 3JYIA 5FSRA 3VP2A 2WKHA 3Q1FA 1K6SA 2DCFA 5AQ7A 1SDEA 5FA7A 1SDNA 4UA7A 4GD8A 4S2LA 2EX8A 3BYDA 1M40A 3PBQA 3NDEA 4RA7A 3WS4A 1AXBA 3NIAA 5DF9A 3IT9A 3SH7A 4WBGA 1FOFA 1KDSA 1GHMA 4ZTKA 1S0WA 4IVIA 3GTCA 5HW3A 2RL3A 4E6WA 3ITBA 1TVFA 5GLBA 3Q7ZA 3IHAA 5E2HA 1MXOA 1ESIA 3MKEA 3V3RA 1VQQA 4DKIA 1MPLA 2EFXA 4CJNA 4WZ4A 4X69A 1XKZA 1BT5A 3IF6A 5CHJA 1ZG4A 4BD0A 4Z9QA 5CGXA 3Q81A 1TDLA 1ES5A 1JWZA 1YLWA 3HL9A 3OPRA 2XH9A 4EBPA 3HLFA 2OV5A 2EX2A 3G32A 2XFTA 4Y7PA 1FCOA 4C6YA 1GHIA 3NCKA 4R1GA 1FCMA 4U0TA 4OQIA 3IWOA 5CEBA 4BD1A 3FKWA 4E3OA 3GVBA 4KENB 1ES3A 2Y2JA 4WYYA 1K56A 3BRMA 4DE0A 3VP3A 4KQQA 5A93A 1HZOA 1RGYA 2G2UA 3NC8A 2WADA 1NXYA 3ZVTA 5CTMA 4N9KA 4N92A 2Q9MA 1Y54A 4IEDA 5EVIA 1FR6A 1Q2QA 2XLNA 3MXRA 1K4EA 4PM9A 5CERA 5TFQA 4ZJ2A 4JBFA 1PIOA 2Y2IA 1WE4A 3IXBA 3FZCA 3G34A 3DWZA 3OC2A 3P98A 4KZ7A 5GLCA 2WKEA 4C3QA 1K57C 3G31A 4GZBA 4KG2A 5HFOA 2WYXA 4ID4A 4ZJ1A 5HL1A 1W7FA 4QU3A 4C75A 3B3XA 1BUEA 3LY4A 4OQ0A 1KGGA 3UPNA 4JLFA 1E3UD 1LHYA 3HLWA 1ESUA 2Z2LB 2WUQA 1CEGA 2PBYA 3PBSA 3G4PA 5DTSA 2A3UA 3HLDA 2ZC3B 4KZ4A 1DJCA 4GB7A 1KE3A 2EFUA 4XUXA 3SH8A 1VM1A 5A90A 2XFSA 1MBLA 4MBHA 2J9OA 1W8YA
chains in the Genus database with same CATH superfamily
1ES4A 1I2WA 4X68A 1MWUA 2RCXA 3IX3A 2ZQCA 3TRCA 3UE0A 1RCJA 3OCNA 3T4QA 2PR6A 4DE1A 3QHYA 2Y59A 4LRYC 2ZM2A 2XF3A 1K38A 2Y55A 2BLSA 1STZA 2VKSA 5EECA 2ZBBA 1JNUA 5FI7A 1K55A 1PI4A 4X56A 3E98A 4QJGA 2EWWA 4I38A 1H5XA 4X55A 3LFVA 1XA1A 1IYOA 2WZZA 1OT6A 3B42A 2A49A 3NI9A 2QYBA 5GLDA 4WM9A 5CECA 4LPZA 4E3JA 1NYMA 5CHMA 2ACGA 3SS3A 3C30A 3ULFA 2EA9A 1G6AA 2VV7A 5M18A 1BULA 3IS2A 1KGEA 3DTEA 4GCZA 2IWCA 4GN2A 4LRZE 4Y0UA 3LO7A 2WKRA 2YKHA 3GRJA 3LIBA 4KQDA 1OTIA 2M7VA 4DE2A 4O0PA 1E4DA 2IWDA 3HLGA 3C2WA 2B18A 3O86A 2ZMAA 1F2KA 4K08A 4LGWA 3MSHA 3KYZA 3VOZA 3W4OA 2Y2HA 4L9FA 1N9NA 1OTDA 5HDDA 2H0TA 3ZG5A 1VEUB 3NDGA 5EE8A 3N6IA 2P9VA 3ZYTA 2WKIA 2V8CA 2P9VB 2Z6CA 5EUAA 4O01A 2PR5A 3RFBA 3C7VA 4Y17A 2WGWB 2DNSA 3S4XA 5TBMB 3KSHA 1YLPA 2C5WB 2X71A 4DXCA 1L0DA 1PYYA 4NK3A 3H7WB 4E3LA 4ETZA 2R9XA 1HD8A 1LI9A 2Y2OA 4HBUA 5L09A 4U0XA 5FL3A 4P6ZS 4R23A 1FSWA 3UPPA 2HDUA 3EOIA 2H0YA 4CLCD 2VGLS 3N8SA 2YKFA 4JXVA 3T4LA 5HWVA 4E3KA 1ACFA 4HESA 4KQRA 1YMSA 4S2JA 1TDGA 4X25A 4B4ZA 2OAQ1 4WUJA 1K4FA 3BY9A 4P6BA 1Z6FA 4L9EA 3O87A 3OCLA 4R3BA 1HVBA 3Q07A 5DFYA 3FPVA 4MBKA 4PM7A 3WS0A 1L0FA 4EUVA 4LV1A 4OPQA 2H5SA 2W3FA 1H8MA 4S2IA 3V3SA 1G5UA 4JXGA 2XD5A 3QNCA 1H8YA 1WYBA 1L0EA 3HLEA 1OTEA 1P0ZA 5EVLA 1XXMA 4KZ9A 3P01A 1GHPA 4MN6A 4PHTA 1NYYA 2OAP1 3UDFA 2FZ0A 3CAXA 3A0RA 4QWOA 5TGFA 2NUPC 3TSGA 3S22A 3N8LA 1P9WA 5GHZA 5IHVA 3HLCA 1EW0A 1XFNA 1ERQA 1K57A 1OMEA 2Y4AA 3K3CA 1NRFA 3CG5A 5KZHA 1CI8A 1MWSA 4DDYA 1DP8A 2QJ7A 2V1AA 3IX4A 1KGFA 4BL2A 2GX5A 5I5LA 3W4QA 2B95A 4Q0JA 3P09A 2B02A 1SHVA 3E4OA 4OOYA 4PM6A 3NY4A 3CHWP 4OPRA 3BFEA 3G30A 3N4IA 1K54A 1TD5A 1P9RA 3UO9A 1XA7A 4DF6A 3Q7VA 1OJ5A 3NBLA 1DP9A 2PAVP 1BZAA 3Q7VB 3GV9A 5E43A 3UNWA 2VX8A 1K54C 4NKPA 3T1RA 4MNRA 1F5MA 3ZDJA 1QMFA 3RXWA 1T1BA 2Z2MB 3LY3A 1VETA 4R3JA 2HPBA 2ZQ8A 4ZAMA 3ZGAB 1PZPA 1TS6A 1VETB 1BTLA 4F3LB 2HP6A 4GOGA 3WRZA 1JTGA 4QPRA 2PDRA 4LENA 4MMNA 2ZD8A 4CPKA 4WEJA 3JYIA 3VP2A 5EVEA 5FDSA 4GD8A 2EX8A 3BYDA 1M40A 3PBQA 1AXBA 2HF6A 2JHEA 3CITA 2RL3A 1TVFA 5GLBA 5G4YA 3IHAA 1MXOA 5F5YA 3LIEA 4DKIA 2GNXA 1XJ6A 1XKZA 2Z6DA 5C5KA 1FIKA 4Z9QA 3Q81A 2OV5A 1D06A 3V67A 4Y7PA 1GHIA 3H82B 5EV0A 4UQIM 4BD1A 4E3OA 1S1ZA 2VJWA 4WYYA 4KQQA 4DN0A 1RGYA 2G2UA 2WADA 4N9KA 5EVIA 5TFQA 2KOIA 4ZJ2A 1PIOA 2Y2IA 5MC7A 3T1QB 3IXBA 4HJ6A 4DJ3A 4GZBA 5HFOA 2WYXA 5HL1A 1W7FA 5IU1A 3B3XA 1BUEA 1E3UD 1G28A 3UB6A 2HJ9C 2WUQA 2PBYA 5DTSA 2ZC3B 4B9OA 2P7JA 1Y28A 4WLAA 4YWZA 2ZOHA 2G7UA 4EXOA 3G32A 1IKGA 1W8YA 3CPTA 4ZBEA 3LIAA 5FASA 3LI8A 4OPYA 3VV4A 1VB6A 1MZUA 3NOTC 4JGRA 2OSUA 1KVLA 4DDSA 1CEFA 1L0GA 2VGKA 3HJIA 2O9BA 4FCFA 4GDNA 3NECA 4EQIA 3LIDA 3V50A 2PRFA 1DJAA 4GD6A 4FH4A 1KVMA 2HDRA 4OQGA 3WS1A 2XA7M 3BM6A 3AGFA 2EXAA 3F1PA 5AVEA 2BTFP 2XEPA 1WYCA 4OH0A 3S7QA 3CLOA 3F1PB 3NOPC 4IBXA 5F82A 2HZ5A 1K6RA 2L4RA 2Q9NA 2XD1A 5FDHA 5HDSA 3F1NA 1IELA 5EM1A 2ZC5B 1BSGA 3ZG8B 3FWLA 1OT9A 3BLMA 5KMWA 3G2ZA 3QP6A 4FTXA 2V1BA 4O8GA 3W4PA 4KG6A 5FAOA 3SS4A 4WMCA 3VP4A 3GECA 3V39A 5TJJA 5I94A 3ZCZA 5HWTA 3IF6C 4QD4A 1CI9A 4IBRA 4LV2A 2VLGA 1A0KA 1JVJA 3HBRA 3IQAA 2D01A 4D2OA 4M4XA 1QMEA 5HAQA 1NWZA 5E2FA 4NG2A 5TR7A 3IH9A 3EGDC 5HARA 2Y2QA 5DVAA 3WWXA 1JWVA 2G2WA 3GSGA 4LCLA 4HNBA 2D02A 5KSCA 3LICA 1S1YA 4EV4A 1NZOA 3Q82A 2V8FA 4B4XA 3ZG7B 5DJUA 2OWHA 5G18A 2A2LA 1IFQA 3S1YA 3SW1A 4E3NA 3BFFA 2Y2PA 2VA0A 4PAUA 4K91A 2VGJA 4JGQA 3ISGA 4CLCE 1KDWA 3PBTA 3S7PA 1H0MA 4HOIA 1SCWA 2EX9A 4E6XA 3SZTA 4Q8IA 3A3JA 4UQIS 3QP5A 5U47A 2IWBA 2ZM0A 2W1RA 4MN5A 5HX9A 5D3OA 4QY5A 3MF0A 5CHUA 1K55C 2GJ3A 1UWPX 4GW9A 1T1CA 4BJPA 4OPZA 4OQHA 1DY6A 2O0YA 1XP4A 3O5YA 5FQIA 4HEFA 4HI4A 1ES2A 1S4SA 3PBRA 1Y4OA 1SZVA 1LI0A 3P7NA 4FD8A 1YQSA 3LGOA 4EBLA 5F68A 2WGIA 1G68A 4HBTA 2VZWA 5JYPA 5EOOA 2OLUA 3FG8A 1XJ2A 3QP2A 3UE3A 1VEUA 1IYPA 3PBNA 3BFDA 4GDBA 4P0MA 4JF6A 4FUWA 5IS1A 4L0LA 3T4KA 5HAPA 4R6LA 2XA7S 4JGPA 3BLSA 1IKIA 2JKTI 5F83A 3R7WB 1TEMA 5FQ9A 1LSXA 2WGWA 5TBMA 3ZNYA 1KE0A 1LL8A 3ZFZA 2W3HA 3UDXA 3M6BA 1OJGA 3SOIA 1K25A 2Y2LA 2H28A 1AWIA 2JKFA 1CQAA 3H7WA 4NXFA 1O7EA 4O7DA 4EU0A 2ZQ9A 5CRFA 3QNBA 3BFCA 1DP6A 4E3MA 4KZ6A 3E2KA 4GS9B 3BECA 5J7EA 5GHYA 2ZJ9A 3D9YA 4DE3A 3UN7A 2ZL1B 3BFGA 3N8RA 1I5QA 3MMHA 1I2SA 1BLPA 1NRJA 3FV7A 2WKPA 3UB5P 5AVFA 4YFMA 1M6KA 1OPXA 4Y0OA 3AGEA 5DKKA 4NXBA 1V9ZA 4EBNA 1FR1A 3HVFA 2J7VA 4RX3A 1X0OA 2GZAA 3LEZA 2QPNA 3IH8A 5HD5A 5HD3A 1ONGA 2UWXA 1PZOA 4P85A 2FH5A 4QY6A 4UA9A 3IXDA 2Y2NA 3QP4A 4CLCB 4QB8A 2WZXA 4UAAA 3WS5A 2WKQA 3KYQA 2PBDP 5FSRA 1J3WA 4E04A 1K6SA 2ZMFA 1SDEA 5FA7A 1SDNA 3IX8A 3EGXC 1N9OA 3NIAA 3SH7A 4ZTKA 1S0WA 4IVIA 1YSQA 4HJ4A 3Q7ZA 1ESIA 3MKEA 4CJNA 4WZ4A 4X69A 4BBTA 1BT5A 1H3QA 5CHJA 1ZG4A 4EBPA 1TDLA 3OPRA 1JWZA 3HL9A 3HLFA 2EX2A 2XFTA 3KSGA 3A0SA 1FCMA 3L9KA 4U0TA 3QP8A 4ETXA 1K56A 3VP3A 3VOLA 2HV1A 3MR0A 4N92A 1Y54A 2Q9MA 1FR6A 4Y3IA 4D60A 4JBFA 1WE4A 1MKMA 4C3QA 2VV6A 5GLCA 1K57C 4KG2A 4ID4A 2MJ6A 4C75A 2VV8A 4H6JB 3MQOA 3PBSA 5HPFA 4EQ1A 2A3UA 4XUXA 3SH8A 1XFQA 5DF8A 2XFSA 1MBLA 3MZDA 4S2MA 2X01A 3E0YA 4WL9A 1TS0A 3A3IA 4X6TA 3S7OA 2V9AA 1LL9A 3M2JA 1YT4A 1N9LA 1D7EA 2E8IA 5FAQA 3C4OA 1NLZA 1MY8A 5J3WA 3PR6A 4WZ5A 4F3LA 3NOUC 5FI2A 4NETA 3C7UA 4OOLA 1PFLA 3SH9A 4GLQA 4B88A 3ZNTA 4WZ5C 1P97A 3UMDA 3BJNA 1T18A 1SKFA 3ITAA 1IYQA 1W8QA 4X53A 4KG5A 2KX6A 5KSHA 5AQ9A 4LV3A 3RH8B 4EESA 2J9PA 3VE4A 1N9BA 3SS5A 2ZC6B 3VSLA 2W3GA 4IJGA 3BQ8A 3C5AA 3A3FA 3HUOA 2P08A 3DW0A 3IBJA 4RYEA 1JTDA 3I7JA 1S6RA 1GSXA 2XGNA 4S2NA 4I3AA 4GKUA 3DTKA 2IA2A 1IOUA 1ZG6A 2LB9A 2J8YA 4XUZA 2XR0A 4EWFA 1Q2PA 3H82A 1L3LA 1ZC2A 1ZHHB 4WEKA 1EWZA 5AQBA 1YPRA 2EWVA 4YNRA 3M2KA 2HDSA 3G2YA 1IEMA 2QHKA 4G3KA 3MQQA 3T4JA 3D72A 3IHBA 5EVID 3O88A 4PKYG 2J3WA 3LI9A 3HCYA 4I3IA 4RX2A 5EPHA 2PYPA 1G6OA 5HL6A 5EVIC 2PU2A 4I5SA 1LT0A 1SKOA 3MBZA 4NXGA 3U2AA 2QMIA 2VEAA 3MXSA 1PW1A 1SKOB 4LFUA 4GHIB 1YMXA 3BQAA 1XGIA 3B47A 2CC1A 2WK0A 4N1XA 4HJ3A 2R9WA 5A91A 1GSWA 3OOVA 3VSKA 2V0UA 2WAEA 1FILA 1HTZA 5AJGA 3VP1A 3TW8A 3R4KA 4DXBA 2R78A 5CXWA 3F1OB 4BBUA 3RXXA 3L7HA 4AFIA 3FPWA 4U3TA 4Z1WA 5E2EA 2OOLA 5KIZA 3EEHA 3CWFA 3KSIA 5CEDA 3DBAA 4XT2B 2FFYA 1PWDA 2HJEA 4Y0TA 4IHQA 1W5DA 5E2GA 2ZQAA 4HHDA 2J3TD 2A24B 5FQQA 3T1XA 4II7A 4R38A 1XJ3A 1RP5A 3B33A 2K31A 2P74A 3CMZA 2VK3A 4UA6A 3LIFA 2FFFB 2J3TC 3T4TA 3PAGA 4ARZB 3W8KA 4BWIA 3CJMA 1PRQA 4PM8A 4WMCD 1V9YA 4Q0HA 4ZDXA 5HAIA 4EEUA 2Y8HA 1K0KA 4MN7A 2XK1A 4HQAA 2JC7A 5GL9A 1Z09A 1U60A 3VFHA 1GA0A 1JWPA 2E8JA 3LUQA 2X02A 4MDZA 3G6OA 5HSQA 1LSWA 1PNEA 3IF6B 2XRNA 1OTBA 3C4PA 3PTEA 3UY6A 1W79A 2OLVA 3WRTA 4K0XA 3MJQA 4X1LA 2PT7A 4EW7A 2JN7A 2JE5A 3HLBA 2M7UA 3DTMA 3PBOA 3ZHHA 5DKLA 3LR5A 3OPPA 2QWSA 4P87A 3CUEA 2DMWA 4S2KA 4RQ9A 4JF4A 2Y2GA 3CUEC 3K2NA 3AGDA 4KZ8A 4UEYA 2XSSA 2Y79A 4IUKA 4RVAA 1ZKJA 4WN5A 1PW8A 3VMAA 2ZC7A 1DJBA 3MS6A 2JKRI 2V1ZA 4BLMA 4R4SA 4EERA 4WELA 4EUZA 3W2ZA 5GLAA 5GHXA 2ZOIA 4Y2FA 5DF7A 5FEFA 4FSFA 5G4ZA 3PXPA 4HY8A 3ZVWA 1LLBA 3RJUA 3LR3A 3IBRA 2PU4A 3GQZA 4LRXC 4R4RA 4GNUA 3KYEA 5LBRA 2ZC4B 4OONA 4KZ3A 5HZHA 3Q1FA 5AQ7A 4R70A 4S2LA 3NDEA 5DF9A 3RTYA 3IS2B 3GDIA 1FOFA 1KDSA 1GHMA 4E6WA 3ITBA 3UB8A 2EFXA 3T1SA 2W27A 4HP4A 3R7WA 2O9CA 4GJ4A 2K2NA 4C6YA 4R1GA 3A0VA 4OQIA 3C38A 4KENB 1ES3A 2I9VA 3T4SA 4DE0A 2CMNA 1HZOA 1NXYA 1XJ4A 1WA9A 2XLNA 3MXRA 1K4EA 5HWWA 4GS9A 3OC2A 4KZ7A 3DWZA 3NULA 2WKEA 4ZJ1A 4HH3A 3KSFA 4OQ0A 2NUTC 1KGGA 2ZL1A 4EETB 1LHYA 1ESUA 2Z2LB 1CEGA 2M1CA 1DJCA 4GB7A 2JKRM 1KE3A 2EFUA 4LLOB 5A90A 3UB9A 1HLUP 2LB5A 2WGVA 4CQHA 5M19A 1UGUA 3ZQ5A 4ZRRA 3D4FA 4OKPA 2ZLYA 3TOIA 4JPMA 5FQKA 3EEAA 3FKVA 4M3KA 4H8RA 3TG9A 3UE1A 1NLYA 3D3OA 5CTNA 2Y2MA 1MWRA 2ZQDA 3OBFA 2O99A 1BLCA 4UHUA 3E4QA 1PI5A 5BOHA 4CLCA 4I3JA 5FQMA 5FEGA 3HREA 3H9WA 2XROA 1EROA 1ALQA 4BL3A 3IWQA 3JPUA 1RGZA 2XDMA 1XX2A 3O3VA 4A5RA 4CLCC 5F69A 4F94A 1CF0A 4N1HA 1N4OA 4N9LA 4PMAA 3FC7A 1GA9A 1DRMA 3C8CA 2JKTM 4FH2A 4ZJ3A 4KZBA 3UE6A 2Y2KA 4G3WA 1MWTA 5HPIA 4KUOA 4Y13A 2QKPA 3MFDA 5M1AA 4OOMA 3A3DA 2WAFA 5IT5A 2K7SA 1ERMA 5DTKA 4R0QA 3LYXA 1S66L 3LEQA 3IXHA 2JBFA 3HUNA 4OP8A 3VFFA 5J8XA 3ICYA 4IUHA 2EX6A 4JXWA 1YAXA 4Q0IA 1K56D 2GDNA 5FQJA 1CK3A 1O07A 2DRWA 2HP9A 4YINA 5F1GA 2EXBA 2V0WA 1MC0A 3GMWA 3LR0A 4HP9A 4MLLA 4BBVA 1XGJA 4H6JA 3KO6A 4HIAA 2V20A 2HP5A 4DRTA 3VOYA 1BLHA 4PPRA 3IXGA 2H10A 2I72A 5FAPA 2KLIA 1ODVA 1YM1A 1GCEA 1LL5A 2B5RA 2ZQ7A 1YLZA 3M6HA 3OLOA 1F98A 5CGSA 3CZDA 4OLDA 1T19A 4PKYA 2P04A 3UB7A 3JVUA 5FI6A 2KDKA 2C6WB 4R3AA 2BASA 3NJAA 4BENA 2BG1A 4PM5A 3OZHA 3HJKA 1XPBA 1TS8A 3EQUA 1ONHA 5EFWA 4NEED 1IYSA 3DWKA 2ZM8A 5L8MA 5FATA 3E2LA 4OVDA 4G3VA 3V5MA 3E4PA 5F6AA 4KZAA 4JGOA 4LV0A 1D1JA 3UPOA 3U4LP 4JKTA 2OWJA 4E3IA 4ME4A 1C3BA 5L07A 2L0WA 5F1FA 4DJ2A 4S2PA 4BMWA 4B93A 1S4RA 2W0NA 1KOUA 2UV0E 1KE4A 5A92A 3N7WA 3T12B 1H8ZA 5AQAA 3WS2A 3MKFA 1LSVA 4KZ5A 3BY8A 3GR2A 4S2NC 5L2FA 3ZG9B 5DJTA 3VP0A 1FSYA 2W1TA 3LR4A 3JVVA 3IWIA 3G35A 2W1TB 1YLJA 4NXEA 4JF5A 4WF0A 5EM0A 4S2OA 3IF5A 4I39A 4DMZA 1YLYA 2W3EA 4XXRA 2QZ6A 1VHMA 4KQOA 3MZEA 5A8BA 4OLGA 3MFXA 4K0WA 4Y5FA 3S7NA 1BLSA 5DFXA 1E25A 4GHIA 1EI5A 2INWA 1F9IA 4JXSA 3PAEA 5EVIB 4MEZA 1W63Q 4QHCA 3FYZA 4L9GA 3VE3A 5CGWA 3EQVA 1BYWA 1W63M 3BEBA 1MKIA 2XQZA 3T50A 1E3UA 3OPLA 1YKDA 1FQGA 4BQMA 5DTTA 2V2FF 3HUMA 2L1MA 4X1MA 2JCHA 3A3EA 2AVXA 3F1OA 3CPTB 4OP5A 1FCNA 5EOEA 1T1AA 3LCEA 1J9MA 5JYOA 3UDIA 2Y91A 1YLTA 2PYRA 3BWLA 1YSPA 4XT2A 4KUKA 1NZUA 4MBFA 5J4EA 4YOFA 1PWCA 4FOFA 3ZG0A 2HDQA 1TS7A 1TF1A 3OPHA 2A24A 1NY0A 3MZFA 4LCMA 1NJ4A 3K3DA 5K5BA 2ZMVA 4IVKA 3NHQA 1PWGA 5L10A 1GSVA 1CJFA 1S67L 1L2SA 4ARZA 2O9AA 2WKHA 4MCWA 2DCFA 3DAVA 3PYPA 4UA7A 3TJZC 3MXQA 3BW6A 3WS4A 4RA7A 4Y15A 2HGVA 3IT9A 4EEPA 4WBGA 3F1NB 3GTCA 5HW3A 1OTAA 2QJ5A 1ZTUA 3V3RA 5E2HA 2W3DA 1VQQA 1MPLA 3IF6A 4BD0A 5CGXA 3UMEA 2PD8A 1ES5A 1YLWA 2XH9A 3DTIA 3TE8A 4P6ZM 1FCOA 3NCKA 2PD7A 3IWOA 5CEBA 3FKWA 3GVBA 2Y2JA 3BRMA 5A93A 3QP1A 3T4OA 1UWNX 3NC8A 2VGLM 3ZVTA 2PHYA 5CTMA 4IEDA 1Q2QA 3MQ0A 4PM9A 5HDCA 5CERA 4HH2A 3FZCA 3G34A 3P98A 3G31A 3CI6A 3PHYA 2Q0OA 4QU3A 3KX0X 4ESPA 3LY4A 3UPNA 4JLFA 3HLWA 3EWKA 2JKGA 3G4PA 3HLDA 2J80A 4KZ4A 5CX7A 1VM1A 4MBHA 2J9OA
chains in the Genus database with same CATH topology
1ES4A 3MZDA 1I2WA 2WGVA 4ZBEA 4S2MA 2X01A 4X68A 5FASA 5M19A 1MWUA 4OPYA 2RCXA 3A3IA 2OSUA 1KVLA 2ZQCA 3UE0A 1CEFA 4X6TA 4DDSA 1RCJA 1L0GA 3OCNA 3D4FA 1LL9A 3M2JA 1YT4A 4OKPA 2E8IA 2ZLYA 3TOIA 4DE1A 3QHYA 5FAQA 2VGKA 2Y59A 3C4OA 4FCFA 4JPMA 1MY8A 2ZM2A 2XF3A 4GDNA 5DF8A 5FQKA 1K38A 2Y55A 4EQIA 3FKVA 2BLSA 4M3KA 4H8RA 3V50A 4WZ5A 3TG9A 5CTNA 3UE1A 5FI2A 4NETA 5EECA 2Y2MA 3C7UA 1MWRA 1DJAA 4OOLA 2ZQDA 5FI7A 1K55A 1PI4A 4GD6A 4FH4A 3SH9A 4X56A 1KVMA 2HDRA 4QJGA 1BLCA 4OQGA 4UHUA 4B88A 1H5XA 3WS1A 1PI5A 4X55A 5BOHA 3BM6A 1XA1A 1IYOA 2WZZA 3ZNTA 2A49A 3AGFA 3NI9A 4WZ5C 2EXAA 5FQMA 3HREA 1EROA 2XEPA 1WYCA 1ALQA 4OH0A 4BL3A 1SKFA 3ITAA 1IYQA 5GLDA 3IWQA 4WM9A 1W8QA 4X53A 1RGZA 2XDMA 5CECA 1XX2A 3O3VA 4KG5A 4A5RA 4F94A 4N1HA 1N4OA 4IBXA 4E3JA 5F82A 1NYMA 5CHMA 3SS3A 5KSHA 4N9LA 5AQ9A 4LV3A 1K6RA 2Q9NA 4PMAA 1GA9A 2XD1A 1G6AA 4FH2A 2J9PA 5FDHA 4ZJ3A 1BULA 1N9BA 1KGEA 4KZBA 3SS5A 5M18A 2ZC6B 2Y2KA 2IWCA 3VSLA 1IELA 1MWTA 4GN2A 2ZC5B 4Y0UA 3C5AA 3LO7A 1BSGA 3A3FA 3ZG8B 3GRJA 3FWLA 3HUOA 3BLMA 5KMWA 3G2ZA 3MFDA 3DW0A 4RYEA 1JTDA 3I7JA 1S6RA 4S2NA 2XGNA 4OOMA 5M1AA 4DE2A 4GKUA 1E4DA 2IWDA 3W4PA 3A3DA 1ZG6A 2WAFA 3HLGA 4KG6A 2J8YA 1ERMA 5FAOA 5DTKA 4R0QA 4XUZA 2XR0A 3O86A 3SS4A 4EWFA 1Q2PA 2ZMAA 4WMCA 3VP4A 3IXHA 2JBFA 1ZC2A 3HUNA 3V39A 4WEKA 1EWZA 4OP8A 3VOZA 3W4OA 3VFFA 5I94A 2Y2HA 5AQBA 5J8XA 3ZCZA 2H0TA 2EX6A 3IF6C 3ZG5A 3M2KA 4QD4A 1CI9A 2HDSA 3G2YA 4JXWA 1IEMA 4IBRA 3NDGA 4LV2A 5EE8A 1K56D 2GDNA 5FQJA 3N6IA 3IQAA 1JVJA 2P9VA 3HBRA 2WKIA 4D2OA 1QMEA 3IHBA 2P9VB 5HAQA 1CK3A 5E2FA 1O07A 5EVID 2DRWA 2HP9A 5TR7A 4YINA 3O88A 5F1GA 2EXBA 5EUAA 3IH9A 3GMWA 5HARA 2Y2QA 5DVAA 3WWXA 1JWVA 4MLLA 2G2WA 4RX2A 5EPHA 1XGJA 3C7VA 3GSGA 2WGWB 4LCLA 2DNSA 3S4XA 5EVIC 5KSCA 2PU2A 2V20A 4EV4A 3MBZA 1YLPA 2HP5A 4DRTA 2C5WB 1NZOA 2X71A 3Q82A 4DXCA 2QMIA 3VOYA 1L0DA 3MXSA 1PW1A 4B4XA 1BLHA 4PPRA 1PYYA 3IXGA 3ZG7B 2H10A 2I72A 5G18A 3S1YA 4E3NA 4NK3A 3BFFA 2Y2PA 5FAPA 1YMXA 4E3LA 1XGIA 1YM1A 1GCEA 2R9XA 1LL5A 2B5RA 4K91A 1HD8A 1LI9A 2VGJA 2ZQ7A 1YLZA 2CC1A 2WK0A 4N1XA 2Y2OA 2R9WA 5A91A 4HBUA 3ISGA 3M6HA 5CGSA 1KDWA 3PBTA 3CZDA 3VSKA 4OLDA 2WAEA 4U0XA 1HTZA 1SCWA 2EX9A 4R23A 4E6XA 1FSWA 5FI6A 3UPPA 2HDUA 3VP1A 2C6WB 4Q8IA 3A3JA 4PM5A 4BENA 2BG1A 5U47A 4DXBA 3OZHA 2H0YA 2IWBA 2ZM0A 1XPBA 5CXWA 3EQUA 1ONHA 3RXXA 3N8SA 1IYSA 3DWKA 5HX9A 5D3OA 4QY5A 2ZM8A 4U3TA 5FATA 4JXVA 5CHUA 5E2EA 1K55C 4E3KA 4HESA 3E2LA 4OVDA 4KQRA 4BJPA 5CEDA 1YMSA 4OPZA 3V5MA 2FFYA 4KZAA 1PWDA 4S2JA 1TDGA 4OQHA 1DY6A 4B4ZA 4Y0TA 4LV0A 1W5DA 3UPOA 1XP4A 5E2GA 5FQIA 4HEFA 2ZQAA 1ES2A 1K4FA 3PBRA 4JKTA 1Z6FA 4P6BA 3O87A 4E3IA 1C3BA 3OCLA 5F1FA 4R3BA 4S2PA 5FQQA 1HVBA 3Q07A 1LI0A 4FD8A 1YQSA 1RP5A 4MBKA 2P74A 3CMZA 4EBLA 4PM7A 4UA6A 3WS0A 1KE4A 2WGIA 5A92A 2FFFB 1L0FA 3N7WA 1G68A 4HBTA 3PAGA 4LV1A 4OPQA 2H5SA 3CJMA 5EOOA 3W8KA 5JYPA 2OLUA 4PM8A 1H8ZA 5AQAA 3WS2A 4S2IA 4WMCD 3V3SA 3MKFA 3UE3A 4KZ5A 3GR2A 4JXGA 1IYPA 3PBNA 3BFDA 4S2NC 4ZDXA 2XD5A 5HAIA 3QNCA 5L2FA 3ZG9B 1H8YA 4GDBA 1WYBA 2XK1A 2JC7A 4P0MA 5GL9A 3VP0A 1FSYA 1L0EA 3HLEA 4JF6A 1U60A 5EVLA 3VFHA 1GA0A 4L0LA 1JWPA 3IWIA 1XXMA 3G35A 4KZ9A 5HAPA 2X02A 1YLJA 3BLSA 1GHPA 4JF5A 1NYYA 3IF6B 1IKIA 5F83A 1TEMA 5FQ9A 3UDFA 4S2OA 2WGWA 3IF5A 3C4PA 3ZNYA 1KE0A 3PTEA 5TGFA 3UY6A 1W79A 2OLVA 3TSGA 1YLYA 4XXRA 2QZ6A 4KQOA 3MZEA 3S22A 4OLGA 3ZFZA 3N8LA 3WRTA 4K0WA 4K0XA 3UDXA 1BLSA 3M6BA 5GHZA 5IHVA 2JE5A 3HLCA 3HLBA 3SOIA 1ERQA 3DTMA 1K57A 3PBOA 1E25A 1K25A 1OMEA 2Y2LA 1EI5A 2Y4AA 3ZHHA 1NRFA 3CG5A 3OPPA 4JXSA 5KZHA 3PAEA 5EVIB 1O7EA 4O7DA 4P87A 1CI8A 1MWSA 2ZQ9A 4MEZA 5CRFA 3QNBA 3BFCA 4QHCA 4DDYA 1KGFA 3FYZA 4BL2A 4E3MA 4KZ6A 3W4QA 5CGWA 3E2KA 3EQVA 3P09A 1SHVA 3BECA 4S2KA 3BEBA 1MKIA 2XQZA 4JF4A 2Y2GA 1IKGA 4OOYA 4PM6A 1E3UA 3NY4A 5GHYA 3OPLA 1FQGA 2ZJ9A 4BQMA 4DE3A 5DTTA 2V2FF 3HUMA 3UN7A 4OPRA 3BFGA 3N8RA 2JCHA 1I5QA 3A3EA 1I2SA 1BLPA 3BFEA 3G30A 1K54A 3FV7A 3N4IA 4YFMA 1M6KA 3UO9A 1XA7A 4DF6A 3Q7VA 3AGDA 4KZ8A 4Y0OA 3AGEA 3NBLA 4OP5A 4EBNA 1BZAA 1FCNA 1FR1A 3Q7VB 1ZKJA 4RVAA 3HVFA 5EOEA 2J7VA 4RX3A 3GV9A 5E43A 3LCEA 1J9MA 3UNWA 3UDIA 5JYOA 1K54C 2Y91A 1YLTA 4MNRA 1PW8A 3LEZA 3VMAA 2QPNA 3ZDJA 1QMFA 2ZC7A 1DJBA 3IH8A 3RXWA 2Z2MB 3LY3A 4R3JA 2HPBA 2ZQ8A 4ZAMA 3ZGAB 1PZPA 2V1ZA 4BLMA 1NZUA 4MBFA 1PWCA 4R4SA 4WELA 4EUZA 1ONGA 2UWXA 3ZG0A 2HDQA 1BTLA 5GHXA 2HP6A 1PZOA 4GOGA 4P85A 5GLAA 3WRZA 1JTGA 4QY6A 5DF7A 4FSFA 3OPHA 4UA9A 3IXDA 2Y2NA 4LENA 1NY0A 3MZFA 3ZVWA 4LCMA 1NJ4A 1LLBA 3RJUA 2PU4A 4QB8A 3GQZA 2WZXA 4R4RA 4IVKA 4GNUA 4UAAA 2ZC4B 4OONA 3WS5A 1PWGA 2ZD8A 4KZ3A 4CPKA 4WEJA 1L2SA 3JYIA 5FSRA 3VP2A 2WKHA 3Q1FA 1K6SA 2DCFA 5AQ7A 1SDEA 5FA7A 1SDNA 4UA7A 4GD8A 4S2LA 2EX8A 3BYDA 1M40A 3PBQA 3NDEA 4RA7A 3WS4A 1AXBA 3NIAA 5DF9A 3IT9A 3SH7A 4WBGA 1FOFA 1KDSA 1GHMA 4ZTKA 1S0WA 4IVIA 3GTCA 5HW3A 2RL3A 4E6WA 3ITBA 1TVFA 5GLBA 3Q7ZA 3IHAA 5E2HA 1MXOA 1ESIA 3MKEA 3V3RA 1VQQA 4DKIA 1MPLA 2EFXA 4CJNA 4WZ4A 4X69A 1XKZA 1BT5A 3IF6A 5CHJA 1ZG4A 4BD0A 4Z9QA 5CGXA 3Q81A 1TDLA 1ES5A 1JWZA 1YLWA 3HL9A 3OPRA 2XH9A 4EBPA 3HLFA 2OV5A 2EX2A 3G32A 2XFTA 4Y7PA 1FCOA 4C6YA 1GHIA 3NCKA 4R1GA 1FCMA 4U0TA 4OQIA 3IWOA 5CEBA 4BD1A 3FKWA 4E3OA 3GVBA 4KENB 1ES3A 2Y2JA 4WYYA 1K56A 3BRMA 4DE0A 3VP3A 4KQQA 5A93A 1HZOA 1RGYA 2G2UA 3NC8A 2WADA 1NXYA 3ZVTA 5CTMA 4N9KA 4N92A 2Q9MA 1Y54A 4IEDA 5EVIA 1FR6A 1Q2QA 2XLNA 3MXRA 1K4EA 4PM9A 5CERA 5TFQA 4ZJ2A 4JBFA 1PIOA 2Y2IA 1WE4A 3IXBA 3FZCA 3G34A 3DWZA 3OC2A 3P98A 4KZ7A 5GLCA 2WKEA 4C3QA 1K57C 3G31A 4GZBA 4KG2A 5HFOA 2WYXA 4ID4A 4ZJ1A 5HL1A 1W7FA 4QU3A 4C75A 3B3XA 1BUEA 3LY4A 4OQ0A 1KGGA 3UPNA 4JLFA 1E3UD 1LHYA 3HLWA 1ESUA 2Z2LB 2WUQA 1CEGA 2PBYA 3PBSA 3G4PA 5DTSA 2A3UA 3HLDA 2ZC3B 4KZ4A 1DJCA 4GB7A 1KE3A 2EFUA 4XUXA 3SH8A 1VM1A 5A90A 2XFSA 1MBLA 4MBHA 2J9OA 1W8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES4 A;  3MZD A;  1I2W A;  2WGV A;  4ZBE A;  4S2M A;  2X01 A;  4X68 A;  5FAS A;  5M19 A;  1MWU A;  4OPY A;  2RCX A;  3A3I A;  2OSU A;  1KVL A;  2ZQC A;  3UE0 A;  1CEF A;  4X6T A;  4DDS A;  1RCJ A;  1L0G A;  3OCN A;  3D4F A;  1LL9 A;  3M2J A;  1YT4 A;  4OKP A;  2E8I A;  2ZLY A;  3TOI A;  4DE1 A;  3QHY A;  5FAQ A;  2VGK A;  2Y59 A;  3C4O A;  4FCF A;  4JPM A;  1MY8 A;  2ZM2 A;  2XF3 A;  4GDN A;  5DF8 A;  5FQK A;  1K38 A;  2Y55 A;  4EQI A;  3FKV A;  2BLS A;  4M3K A;  4H8R A;  3V50 A;  4WZ5 A;  3TG9 A;  5CTN A;  3UE1 A;  5FI2 A;  4NET A;  5EEC A;  2Y2M A;  3C7U A;  1MWR A;  1DJA A;  4OOL A;  2ZQD A;  5FI7 A;  1K55 A;  1PI4 A;  4GD6 A;  4FH4 A;  3SH9 A;  4X56 A;  1KVM A;  2HDR A;  4QJG A;  1BLC A;  4OQG A;  4UHU A;  4B88 A;  1H5X A;  3WS1 A;  1PI5 A;  4X55 A;  5BOH A;  3BM6 A;  1XA1 A;  1IYO A;  2WZZ A;  3ZNT A;  2A49 A;  3AGF A;  3NI9 A;  4WZ5 C;  2EXA A;  5FQM A;  3HRE A;  1ERO A;  2XEP A;  1WYC A;  1ALQ A;  4OH0 A;  4BL3 A;  1SKF A;  3ITA A;  1IYQ A;  5GLD A;  3IWQ A;  4WM9 A;  1W8Q A;  4X53 A;  1RGZ A;  2XDM A;  5CEC A;  1XX2 A;  3O3V A;  4KG5 A;  4A5R A;  4F94 A;  4N1H A;  1N4O A;  4IBX A;  4E3J A;  5F82 A;  1NYM A;  5CHM A;  3SS3 A;  5KSH A;  4N9L A;  5AQ9 A;  4LV3 A;  1K6R A;  2Q9N A;  4PMA A;  1GA9 A;  2XD1 A;  1G6A A;  4FH2 A;  2J9P A;  5FDH A;  4ZJ3 A;  1BUL A;  1N9B A;  1KGE A;  4KZB A;  3SS5 A;  5M18 A;  2ZC6 B;  2Y2K A;  2IWC A;  3VSL A;  1IEL A;  1MWT A;  4GN2 A;  2ZC5 B;  4Y0U A;  3C5A A;  3LO7 A;  1BSG A;  3A3F A;  3ZG8 B;  3GRJ A;  3FWL A;  3HUO A;  3BLM A;  5KMW A;  3G2Z A;  3MFD A;  3DW0 A;  4RYE A;  1JTD A;  3I7J A;  1S6R A;  4S2N A;  2XGN A;  4OOM A;  5M1A A;  4DE2 A;  4GKU A;  1E4D A;  2IWD A;  3W4P A;  3A3D A;  1ZG6 A;  2WAF A;  3HLG A;  4KG6 A;  2J8Y A;  1ERM A;  5FAO A;  5DTK A;  4R0Q A;  4XUZ A;  2XR0 A;  3O86 A;  3SS4 A;  4EWF A;  1Q2P A;  2ZMA A;  4WMC A;  3VP4 A;  3IXH A;  2JBF A;  1ZC2 A;  3HUN A;  3V39 A;  4WEK A;  1EWZ A;  4OP8 A;  3VOZ A;  3W4O A;  3VFF A;  5I94 A;  2Y2H A;  5AQB A;  5J8X A;  3ZCZ A;  2H0T A;  2EX6 A;  3IF6 C;  3ZG5 A;  3M2K A;  4QD4 A;  1CI9 A;  2HDS A;  3G2Y A;  4JXW A;  1IEM A;  4IBR A;  3NDG A;  4LV2 A;  5EE8 A;  1K56 D;  2GDN A;  5FQJ A;  3N6I A;  3IQA A;  1JVJ A;  2P9V A;  3HBR A;  2WKI A;  4D2O A;  1QME A;  3IHB A;  2P9V B;  5HAQ A;  1CK3 A;  5E2F A;  1O07 A;  5EVI D;  2DRW A;  2HP9 A;  5TR7 A;  4YIN A;  3O88 A;  5F1G A;  2EXB A;  5EUA A;  3IH9 A;  3GMW A;  5HAR A;  2Y2Q A;  5DVA A;  3WWX A;  1JWV A;  4MLL A;  2G2W A;  4RX2 A;  5EPH A;  1XGJ A;  3C7V A;  3GSG A;  2WGW B;  4LCL A;  2DNS A;  3S4X A;  5EVI C;  5KSC A;  2PU2 A;  2V20 A;  4EV4 A;  3MBZ A;  1YLP A;  2HP5 A;  4DRT A;  2C5W B;  1NZO A;  2X71 A;  3Q82 A;  4DXC A;  2QMI A;  3VOY A;  1L0D A;  3MXS A;  1PW1 A;  4B4X A;  1BLH A;  4PPR A;  1PYY A;  3IXG A;  3ZG7 B;  2H10 A;  2I72 A;  5G18 A;  3S1Y A;  4E3N A;  4NK3 A;  3BFF A;  2Y2P A;  5FAP A;  1YMX A;  4E3L A;  1XGI A;  1YM1 A;  1GCE A;  2R9X A;  1LL5 A;  2B5R A;  4K91 A;  1HD8 A;  1LI9 A;  2VGJ A;  2ZQ7 A;  1YLZ A;  2CC1 A;  2WK0 A;  4N1X A;  2Y2O A;  2R9W A;  5A91 A;  4HBU A;  3ISG A;  3M6H A;  5CGS A;  1KDW A;  3PBT A;  3CZD A;  3VSK A;  4OLD A;  2WAE A;  4U0X A;  1HTZ A;  1SCW A;  2EX9 A;  4R23 A;  4E6X A;  1FSW A;  5FI6 A;  3UPP A;  2HDU A;  3VP1 A;  2C6W B;  4Q8I A;  3A3J A;  4PM5 A;  4BEN A;  2BG1 A;  5U47 A;  4DXB A;  3OZH A;  2H0Y A;  2IWB A;  2ZM0 A;  1XPB A;  5CXW A;  3EQU A;  1ONH A;  3RXX A;  3N8S A;  1IYS A;  3DWK A;  5HX9 A;  5D3O A;  4QY5 A;  2ZM8 A;  4U3T A;  5FAT A;  4JXV A;  5CHU A;  5E2E A;  1K55 C;  4E3K A;  4HES A;  3E2L A;  4OVD A;  4KQR A;  4BJP A;  5CED A;  1YMS A;  4OPZ A;  3V5M A;  2FFY A;  4KZA A;  1PWD A;  4S2J A;  1TDG A;  4OQH A;  1DY6 A;  4B4Z A;  4Y0T A;  4LV0 A;  1W5D A;  3UPO A;  1XP4 A;  5E2G A;  5FQI A;  4HEF A;  2ZQA A;  1ES2 A;  1K4F A;  3PBR A;  4JKT A;  1Z6F A;  4P6B A;  3O87 A;  4E3I A;  1C3B A;  3OCL A;  5F1F A;  4R3B A;  4S2P A;  5FQQ A;  1HVB A;  3Q07 A;  1LI0 A;  4FD8 A;  1YQS A;  1RP5 A;  4MBK A;  2P74 A;  3CMZ A;  4EBL A;  4PM7 A;  4UA6 A;  3WS0 A;  1KE4 A;  2WGI A;  5A92 A;  2FFF B;  1L0F A;  3N7W A;  1G68 A;  4HBT A;  3PAG A;  4LV1 A;  4OPQ A;  2H5S A;  3CJM A;  5EOO A;  3W8K A;  5JYP A;  2OLU A;  4PM8 A;  1H8Z A;  5AQA A;  3WS2 A;  4S2I A;  4WMC D;  3V3S A;  3MKF A;  3UE3 A;  4KZ5 A;  3GR2 A;  4JXG A;  1IYP A;  3PBN A;  3BFD A;  4S2N C;  4ZDX A;  2XD5 A;  5HAI A;  3QNC A;  5L2F A;  3ZG9 B;  1H8Y A;  4GDB A;  1WYB A;  2XK1 A;  2JC7 A;  4P0M A;  5GL9 A;  3VP0 A;  1FSY A;  1L0E A;  3HLE A;  4JF6 A;  1U60 A;  5EVL A;  3VFH A;  1GA0 A;  4L0L A;  1JWP A;  3IWI A;  1XXM A;  3G35 A;  4KZ9 A;  5HAP A;  2X02 A;  1YLJ A;  3BLS A;  1GHP A;  4JF5 A;  1NYY A;  3IF6 B;  1IKI A;  5F83 A;  1TEM A;  5FQ9 A;  3UDF A;  4S2O A;  2WGW A;  3IF5 A;  3C4P A;  3ZNY A;  1KE0 A;  3PTE A;  5TGF A;  3UY6 A;  1W79 A;  2OLV A;  3TSG A;  1YLY A;  4XXR A;  2QZ6 A;  4KQO A;  3MZE A;  3S22 A;  4OLG A;  3ZFZ A;  3N8L A;  3WRT A;  4K0W A;  4K0X A;  3UDX A;  1BLS A;  3M6B A;  5GHZ A;  5IHV A;  2JE5 A;  3HLC A;  3HLB A;  3SOI A;  1ERQ A;  3DTM A;  1K57 A;  3PBO A;  1E25 A;  1K25 A;  1OME A;  2Y2L A;  1EI5 A;  2Y4A A;  3ZHH A;  1NRF A;  3CG5 A;  3OPP A;  4JXS A;  5KZH A;  3PAE A;  5EVI B;  1O7E A;  4O7D A;  4P87 A;  1CI8 A;  1MWS A;  2ZQ9 A;  4MEZ A;  5CRF A;  3QNB A;  3BFC A;  4QHC A;  4DDY A;  1KGF A;  3FYZ A;  4BL2 A;  4E3M A;  4KZ6 A;  3W4Q A;  5CGW A;  3E2K A;  3EQV A;  3P09 A;  1SHV A;  3BEC A;  4S2K A;  3BEB A;  1MKI A;  2XQZ A;  4JF4 A;  2Y2G A;  1IKG A;  4OOY A;  4PM6 A;  1E3U A;  3NY4 A;  5GHY A;  3OPL A;  1FQG A;  2ZJ9 A;  4BQM A;  4DE3 A;  5DTT A;  2V2F F;  3HUM A;  3UN7 A;  4OPR A;  3BFG A;  3N8R A;  2JCH A;  1I5Q A;  3A3E A;  1I2S A;  1BLP A;  3BFE A;  3G30 A;  1K54 A;  3FV7 A;  3N4I A;  4YFM A;  1M6K A;  3UO9 A;  1XA7 A;  4DF6 A;  3Q7V A;  3AGD A;  4KZ8 A;  4Y0O A;  3AGE A;  3NBL A;  4OP5 A;  4EBN A;  1BZA A;  1FCN A;  1FR1 A;  3Q7V B;  1ZKJ A;  4RVA A;  3HVF A;  5EOE A;  2J7V A;  4RX3 A;  3GV9 A;  5E43 A;  3LCE A;  1J9M A;  3UNW A;  3UDI A;  5JYO A;  1K54 C;  2Y91 A;  1YLT A;  4MNR A;  1PW8 A;  3LEZ A;  3VMA A;  2QPN A;  3ZDJ A;  1QMF A;  2ZC7 A;  1DJB A;  3IH8 A;  3RXW A;  2Z2M B;  3LY3 A;  4R3J A;  2HPB A;  2ZQ8 A;  4ZAM A;  3ZGA B;  1PZP A;  2V1Z A;  4BLM A;  1NZU A;  4MBF A;  1PWC A;  4R4S A;  4WEL A;  4EUZ A;  1ONG A;  2UWX A;  3ZG0 A;  2HDQ A;  1BTL A;  5GHX A;  2HP6 A;  1PZO A;  4GOG A;  4P85 A;  5GLA A;  3WRZ A;  1JTG A;  4QY6 A;  5DF7 A;  4FSF A;  3OPH A;  4UA9 A;  3IXD A;  2Y2N A;  4LEN A;  1NY0 A;  3MZF A;  3ZVW A;  4LCM A;  1NJ4 A;  1LLB A;  3RJU A;  2PU4 A;  4QB8 A;  3GQZ A;  2WZX A;  4R4R A;  4IVK A;  4GNU A;  4UAA A;  2ZC4 B;  4OON A;  3WS5 A;  1PWG A;  2ZD8 A;  4KZ3 A;  4CPK A;  4WEJ A;  1L2S A;  3JYI A;  5FSR A;  3VP2 A;  2WKH A;  3Q1F A;  1K6S A;  2DCF A;  5AQ7 A;  1SDE A;  5FA7 A;  1SDN A;  4UA7 A;  4GD8 A;  4S2L A;  2EX8 A;  3BYD A;  1M40 A;  3PBQ A;  3NDE A;  4RA7 A;  3WS4 A;  1AXB A;  3NIA A;  5DF9 A;  3IT9 A;  3SH7 A;  4WBG A;  1FOF A;  1KDS A;  1GHM A;  4ZTK A;  1S0W A;  4IVI A;  3GTC A;  5HW3 A;  2RL3 A;  4E6W A;  3ITB A;  1TVF A;  5GLB A;  3Q7Z A;  3IHA A;  5E2H A;  1MXO A;  1ESI A;  3MKE A;  3V3R A;  1VQQ A;  4DKI A;  1MPL A;  2EFX A;  4CJN A;  4WZ4 A;  4X69 A;  1XKZ A;  1BT5 A;  3IF6 A;  5CHJ A;  1ZG4 A;  4BD0 A;  4Z9Q A;  5CGX A;  3Q81 A;  1TDL A;  1ES5 A;  1JWZ A;  1YLW A;  3HL9 A;  3OPR A;  2XH9 A;  4EBP A;  3HLF A;  2OV5 A;  2EX2 A;  3G32 A;  2XFT A;  4Y7P A;  1FCO A;  4C6Y A;  1GHI A;  3NCK A;  4R1G A;  1FCM A;  4U0T A;  4OQI A;  3IWO A;  5CEB A;  4BD1 A;  3FKW A;  4E3O A;  3GVB A;  4KEN B;  1ES3 A;  2Y2J A;  4WYY A;  1K56 A;  3BRM A;  4DE0 A;  3VP3 A;  4KQQ A;  5A93 A;  1HZO A;  1RGY A;  2G2U A;  3NC8 A;  2WAD A;  1NXY A;  3ZVT A;  5CTM A;  4N9K A;  4N92 A;  2Q9M A;  1Y54 A;  4IED A;  5EVI A;  1FR6 A;  1Q2Q A;  2XLN A;  3MXR A;  1K4E A;  4PM9 A;  5CER A;  5TFQ A;  4ZJ2 A;  4JBF A;  1PIO A;  2Y2I A;  1WE4 A;  3IXB A;  3FZC A;  3G34 A;  3DWZ A;  3OC2 A;  3P98 A;  4KZ7 A;  5GLC A;  2WKE A;  4C3Q A;  1K57 C;  3G31 A;  4GZB A;  4KG2 A;  5HFO A;  2WYX A;  4ID4 A;  4ZJ1 A;  5HL1 A;  1W7F A;  4QU3 A;  4C75 A;  3B3X A;  1BUE A;  3LY4 A;  4OQ0 A;  1KGG A;  3UPN A;  4JLF A;  1E3U D;  1LHY A;  3HLW A;  1ESU A;  2Z2L B;  2WUQ A;  1CEG A;  2PBY A;  3PBS A;  3G4P A;  5DTS A;  2A3U A;  3HLD A;  2ZC3 B;  4KZ4 A;  1DJC A;  4GB7 A;  1KE3 A;  2EFU A;  4XUX A;  3SH8 A;  1VM1 A;  5A90 A;  2XFS A;  1MBL A;  4MBH A;  2J9O A;  1W8Y A; 
#chains in the Genus database with same CATH topology
 1ES4 A;  1I2W A;  4X68 A;  1MWU A;  2RCX A;  3IX3 A;  2ZQC A;  3TRC A;  3UE0 A;  1RCJ A;  3OCN A;  3T4Q A;  2PR6 A;  4DE1 A;  3QHY A;  2Y59 A;  4LRY C;  2ZM2 A;  2XF3 A;  1K38 A;  2Y55 A;  2BLS A;  1STZ A;  2VKS A;  5EEC A;  2ZBB A;  1JNU A;  5FI7 A;  1K55 A;  1PI4 A;  4X56 A;  3E98 A;  4QJG A;  2EWW A;  4I38 A;  1H5X A;  4X55 A;  3LFV A;  1XA1 A;  1IYO A;  2WZZ A;  1OT6 A;  3B42 A;  2A49 A;  3NI9 A;  2QYB A;  5GLD A;  4WM9 A;  5CEC A;  4LPZ A;  4E3J A;  1NYM A;  5CHM A;  2ACG A;  3SS3 A;  3C30 A;  3ULF A;  2EA9 A;  1G6A A;  2VV7 A;  5M18 A;  1BUL A;  3IS2 A;  1KGE A;  3DTE A;  4GCZ A;  2IWC A;  4GN2 A;  4LRZ E;  4Y0U A;  3LO7 A;  2WKR A;  2YKH A;  3GRJ A;  3LIB A;  4KQD A;  1OTI A;  2M7V A;  4DE2 A;  4O0P A;  1E4D A;  2IWD A;  3HLG A;  3C2W A;  2B18 A;  3O86 A;  2ZMA A;  1F2K A;  4K08 A;  4LGW A;  3MSH A;  3KYZ A;  3VOZ A;  3W4O A;  2Y2H A;  4L9F A;  1N9N A;  1OTD A;  5HDD A;  2H0T A;  3ZG5 A;  1VEU B;  3NDG A;  5EE8 A;  3N6I A;  2P9V A;  3ZYT A;  2WKI A;  2V8C A;  2P9V B;  2Z6C A;  5EUA A;  4O01 A;  2PR5 A;  3RFB A;  3C7V A;  4Y17 A;  2WGW B;  2DNS A;  3S4X A;  5TBM B;  3KSH A;  1YLP A;  2C5W B;  2X71 A;  4DXC A;  1L0D A;  1PYY A;  4NK3 A;  3H7W B;  4E3L A;  4ETZ A;  2R9X A;  1HD8 A;  1LI9 A;  2Y2O A;  4HBU A;  5L09 A;  4U0X A;  5FL3 A;  4P6Z S;  4R23 A;  1FSW A;  3UPP A;  2HDU A;  3EOI A;  2H0Y A;  4CLC D;  2VGL S;  3N8S A;  2YKF A;  4JXV A;  3T4L A;  5HWV A;  4E3K A;  1ACF A;  4HES A;  4KQR A;  1YMS A;  4S2J A;  1TDG A;  4X25 A;  4B4Z A;  2OAQ 1;  4WUJ A;  1K4F A;  3BY9 A;  4P6B A;  1Z6F A;  4L9E A;  3O87 A;  3OCL A;  4R3B A;  1HVB A;  3Q07 A;  5DFY A;  3FPV A;  4MBK A;  4PM7 A;  3WS0 A;  1L0F A;  4EUV A;  4LV1 A;  4OPQ A;  2H5S A;  2W3F A;  1H8M A;  4S2I A;  3V3S A;  1G5U A;  4JXG A;  2XD5 A;  3QNC A;  1H8Y A;  1WYB A;  1L0E A;  3HLE A;  1OTE A;  1P0Z A;  5EVL A;  1XXM A;  4KZ9 A;  3P01 A;  1GHP A;  4MN6 A;  4PHT A;  1NYY A;  2OAP 1;  3UDF A;  2FZ0 A;  3CAX A;  3A0R A;  4QWO A;  5TGF A;  2NUP C;  3TSG A;  3S22 A;  3N8L A;  1P9W A;  5GHZ A;  5IHV A;  3HLC A;  1EW0 A;  1XFN A;  1ERQ A;  1K57 A;  1OME A;  2Y4A A;  3K3C A;  1NRF A;  3CG5 A;  5KZH A;  1CI8 A;  1MWS A;  4DDY A;  1DP8 A;  2QJ7 A;  2V1A A;  3IX4 A;  1KGF A;  4BL2 A;  2GX5 A;  5I5L A;  3W4Q A;  2B95 A;  4Q0J A;  3P09 A;  2B02 A;  1SHV A;  3E4O A;  4OOY A;  4PM6 A;  3NY4 A;  3CHW P;  4OPR A;  3BFE A;  3G30 A;  3N4I A;  1K54 A;  1TD5 A;  1P9R A;  3UO9 A;  1XA7 A;  4DF6 A;  3Q7V A;  1OJ5 A;  3NBL A;  1DP9 A;  2PAV P;  1BZA A;  3Q7V B;  3GV9 A;  5E43 A;  3UNW A;  2VX8 A;  1K54 C;  4NKP A;  3T1R A;  4MNR A;  1F5M A;  3ZDJ A;  1QMF A;  3RXW A;  1T1B A;  2Z2M B;  3LY3 A;  1VET A;  4R3J A;  2HPB A;  2ZQ8 A;  4ZAM A;  3ZGA B;  1PZP A;  1TS6 A;  1VET B;  1BTL A;  4F3L B;  2HP6 A;  4GOG A;  3WRZ A;  1JTG A;  4QPR A;  2PDR A;  4LEN A;  4MMN A;  2ZD8 A;  4CPK A;  4WEJ A;  3JYI A;  3VP2 A;  5EVE A;  5FDS A;  4GD8 A;  2EX8 A;  3BYD A;  1M40 A;  3PBQ A;  1AXB A;  2HF6 A;  2JHE A;  3CIT A;  2RL3 A;  1TVF A;  5GLB A;  5G4Y A;  3IHA A;  1MXO A;  5F5Y A;  3LIE A;  4DKI A;  2GNX A;  1XJ6 A;  1XKZ A;  2Z6D A;  5C5K A;  1FIK A;  4Z9Q A;  3Q81 A;  2OV5 A;  1D06 A;  3V67 A;  4Y7P A;  1GHI A;  3H82 B;  5EV0 A;  4UQI M;  4BD1 A;  4E3O A;  1S1Z A;  2VJW A;  4WYY A;  4KQQ A;  4DN0 A;  1RGY A;  2G2U A;  2WAD A;  4N9K A;  5EVI A;  5TFQ A;  2KOI A;  4ZJ2 A;  1PIO A;  2Y2I A;  5MC7 A;  3T1Q B;  3IXB A;  4HJ6 A;  4DJ3 A;  4GZB A;  5HFO A;  2WYX A;  5HL1 A;  1W7F A;  5IU1 A;  3B3X A;  1BUE A;  1E3U D;  1G28 A;  3UB6 A;  2HJ9 C;  2WUQ A;  2PBY A;  5DTS A;  2ZC3 B;  4B9O A;  2P7J A;  1Y28 A;  4WLA A;  4YWZ A;  2ZOH A;  2G7U A;  4EXO A;  3G32 A;  1IKG A;  1W8Y A;  3CPT A;  4ZBE A;  3LIA A;  5FAS A;  3LI8 A;  4OPY A;  3VV4 A;  1VB6 A;  1MZU A;  3NOT C;  4JGR A;  2OSU A;  1KVL A;  4DDS A;  1CEF A;  1L0G A;  2VGK A;  3HJI A;  2O9B A;  4FCF A;  4GDN A;  3NEC A;  4EQI A;  3LID A;  3V50 A;  2PRF A;  1DJA A;  4GD6 A;  4FH4 A;  1KVM A;  2HDR A;  4OQG A;  3WS1 A;  2XA7 M;  3BM6 A;  3AGF A;  2EXA A;  3F1P A;  5AVE A;  2BTF P;  2XEP A;  1WYC A;  4OH0 A;  3S7Q A;  3CLO A;  3F1P B;  3NOP C;  4IBX A;  5F82 A;  2HZ5 A;  1K6R A;  2L4R A;  2Q9N A;  2XD1 A;  5FDH A;  5HDS A;  3F1N A;  1IEL A;  5EM1 A;  2ZC5 B;  1BSG A;  3ZG8 B;  3FWL A;  1OT9 A;  3BLM A;  5KMW A;  3G2Z A;  3QP6 A;  4FTX A;  2V1B A;  4O8G A;  3W4P A;  4KG6 A;  5FAO A;  3SS4 A;  4WMC A;  3VP4 A;  3GEC A;  3V39 A;  5TJJ A;  5I94 A;  3ZCZ A;  5HWT A;  3IF6 C;  4QD4 A;  1CI9 A;  4IBR A;  4LV2 A;  2VLG A;  1A0K A;  1JVJ A;  3HBR A;  3IQA A;  2D01 A;  4D2O A;  4M4X A;  1QME A;  5HAQ A;  1NWZ A;  5E2F A;  4NG2 A;  5TR7 A;  3IH9 A;  3EGD C;  5HAR A;  2Y2Q A;  5DVA A;  3WWX A;  1JWV A;  2G2W A;  3GSG A;  4LCL A;  4HNB A;  2D02 A;  5KSC A;  3LIC A;  1S1Y A;  4EV4 A;  1NZO A;  3Q82 A;  2V8F A;  4B4X A;  3ZG7 B;  5DJU A;  2OWH A;  5G18 A;  2A2L A;  1IFQ A;  3S1Y A;  3SW1 A;  4E3N A;  3BFF A;  2Y2P A;  2VA0 A;  4PAU A;  4K91 A;  2VGJ A;  4JGQ A;  3ISG A;  4CLC E;  1KDW A;  3PBT A;  3S7P A;  1H0M A;  4HOI A;  1SCW A;  2EX9 A;  4E6X A;  3SZT A;  4Q8I A;  3A3J A;  4UQI S;  3QP5 A;  5U47 A;  2IWB A;  2ZM0 A;  2W1R A;  4MN5 A;  5HX9 A;  5D3O A;  4QY5 A;  3MF0 A;  5CHU A;  1K55 C;  2GJ3 A;  1UWP X;  4GW9 A;  1T1C A;  4BJP A;  4OPZ A;  4OQH A;  1DY6 A;  2O0Y A;  1XP4 A;  3O5Y A;  5FQI A;  4HEF A;  4HI4 A;  1ES2 A;  1S4S A;  3PBR A;  1Y4O A;  1SZV A;  1LI0 A;  3P7N A;  4FD8 A;  1YQS A;  3LGO A;  4EBL A;  5F68 A;  2WGI A;  1G68 A;  4HBT A;  2VZW A;  5JYP A;  5EOO A;  2OLU A;  3FG8 A;  1XJ2 A;  3QP2 A;  3UE3 A;  1VEU A;  1IYP A;  3PBN A;  3BFD A;  4GDB A;  4P0M A;  4JF6 A;  4FUW A;  5IS1 A;  4L0L A;  3T4K A;  5HAP A;  4R6L A;  2XA7 S;  4JGP A;  3BLS A;  1IKI A;  2JKT I;  5F83 A;  3R7W B;  1TEM A;  5FQ9 A;  1LSX A;  2WGW A;  5TBM A;  3ZNY A;  1KE0 A;  1LL8 A;  3ZFZ A;  2W3H A;  3UDX A;  3M6B A;  1OJG A;  3SOI A;  1K25 A;  2Y2L A;  2H28 A;  1AWI A;  2JKF A;  1CQA A;  3H7W A;  4NXF A;  1O7E A;  4O7D A;  4EU0 A;  2ZQ9 A;  5CRF A;  3QNB A;  3BFC A;  1DP6 A;  4E3M A;  4KZ6 A;  3E2K A;  4GS9 B;  3BEC A;  5J7E A;  5GHY A;  2ZJ9 A;  3D9Y A;  4DE3 A;  3UN7 A;  2ZL1 B;  3BFG A;  3N8R A;  1I5Q A;  3MMH A;  1I2S A;  1BLP A;  1NRJ A;  3FV7 A;  2WKP A;  3UB5 P;  5AVF A;  4YFM A;  1M6K A;  1OPX A;  4Y0O A;  3AGE A;  5DKK A;  4NXB A;  1V9Z A;  4EBN A;  1FR1 A;  3HVF A;  2J7V A;  4RX3 A;  1X0O A;  2GZA A;  3LEZ A;  2QPN A;  3IH8 A;  5HD5 A;  5HD3 A;  1ONG A;  2UWX A;  1PZO A;  4P85 A;  2FH5 A;  4QY6 A;  4UA9 A;  3IXD A;  2Y2N A;  3QP4 A;  4CLC B;  4QB8 A;  2WZX A;  4UAA A;  3WS5 A;  2WKQ A;  3KYQ A;  2PBD P;  5FSR A;  1J3W A;  4E04 A;  1K6S A;  2ZMF A;  1SDE A;  5FA7 A;  1SDN A;  3IX8 A;  3EGX C;  1N9O A;  3NIA A;  3SH7 A;  4ZTK A;  1S0W A;  4IVI A;  1YSQ A;  4HJ4 A;  3Q7Z A;  1ESI A;  3MKE A;  4CJN A;  4WZ4 A;  4X69 A;  4BBT A;  1BT5 A;  1H3Q A;  5CHJ A;  1ZG4 A;  4EBP A;  1TDL A;  3OPR A;  1JWZ A;  3HL9 A;  3HLF A;  2EX2 A;  2XFT A;  3KSG A;  3A0S A;  1FCM A;  3L9K A;  4U0T A;  3QP8 A;  4ETX A;  1K56 A;  3VP3 A;  3VOL A;  2HV1 A;  3MR0 A;  4N92 A;  1Y54 A;  2Q9M A;  1FR6 A;  4Y3I A;  4D60 A;  4JBF A;  1WE4 A;  1MKM A;  4C3Q A;  2VV6 A;  5GLC A;  1K57 C;  4KG2 A;  4ID4 A;  2MJ6 A;  4C75 A;  2VV8 A;  4H6J B;  3MQO A;  3PBS A;  5HPF A;  4EQ1 A;  2A3U A;  4XUX A;  3SH8 A;  1XFQ A;  5DF8 A;  2XFS A;  1MBL A;  3MZD A;  4S2M A;  2X01 A;  3E0Y A;  4WL9 A;  1TS0 A;  3A3I A;  4X6T A;  3S7O A;  2V9A A;  1LL9 A;  3M2J A;  1YT4 A;  1N9L A;  1D7E A;  2E8I A;  5FAQ A;  3C4O A;  1NLZ A;  1MY8 A;  5J3W A;  3PR6 A;  4WZ5 A;  4F3L A;  3NOU C;  5FI2 A;  4NET A;  3C7U A;  4OOL A;  1PFL A;  3SH9 A;  4GLQ A;  4B88 A;  3ZNT A;  4WZ5 C;  1P97 A;  3UMD A;  3BJN A;  1T18 A;  1SKF A;  3ITA A;  1IYQ A;  1W8Q A;  4X53 A;  4KG5 A;  2KX6 A;  5KSH A;  5AQ9 A;  4LV3 A;  3RH8 B;  4EES A;  2J9P A;  3VE4 A;  1N9B A;  3SS5 A;  2ZC6 B;  3VSL A;  2W3G A;  4IJG A;  3BQ8 A;  3C5A A;  3A3F A;  3HUO A;  2P08 A;  3DW0 A;  3IBJ A;  4RYE A;  1JTD A;  3I7J A;  1S6R A;  1GSX A;  2XGN A;  4S2N A;  4I3A A;  4GKU A;  3DTK A;  2IA2 A;  1IOU A;  1ZG6 A;  2LB9 A;  2J8Y A;  4XUZ A;  2XR0 A;  4EWF A;  1Q2P A;  3H82 A;  1L3L A;  1ZC2 A;  1ZHH B;  4WEK A;  1EWZ A;  5AQB A;  1YPR A;  2EWV A;  4YNR A;  3M2K A;  2HDS A;  3G2Y A;  1IEM A;  2QHK A;  4G3K A;  3MQQ A;  3T4J A;  3D72 A;  3IHB A;  5EVI D;  3O88 A;  4PKY G;  2J3W A;  3LI9 A;  3HCY A;  4I3I A;  4RX2 A;  5EPH A;  2PYP A;  1G6O A;  5HL6 A;  5EVI C;  2PU2 A;  4I5S A;  1LT0 A;  1SKO A;  3MBZ A;  4NXG A;  3U2A A;  2QMI A;  2VEA A;  3MXS A;  1PW1 A;  1SKO B;  4LFU A;  4GHI B;  1YMX A;  3BQA A;  1XGI A;  3B47 A;  2CC1 A;  2WK0 A;  4N1X A;  4HJ3 A;  2R9W A;  5A91 A;  1GSW A;  3OOV A;  3VSK A;  2V0U A;  2WAE A;  1FIL A;  1HTZ A;  5AJG A;  3VP1 A;  3TW8 A;  3R4K A;  4DXB A;  2R78 A;  5CXW A;  3F1O B;  4BBU A;  3RXX A;  3L7H A;  4AFI A;  3FPW A;  4U3T A;  4Z1W A;  5E2E A;  2OOL A;  5KIZ A;  3EEH A;  3CWF A;  3KSI A;  5CED A;  3DBA A;  4XT2 B;  2FFY A;  1PWD A;  2HJE A;  4Y0T A;  4IHQ A;  1W5D A;  5E2G A;  2ZQA A;  4HHD A;  2J3T D;  2A24 B;  5FQQ A;  3T1X A;  4II7 A;  4R38 A;  1XJ3 A;  1RP5 A;  3B33 A;  2K31 A;  2P74 A;  3CMZ A;  2VK3 A;  4UA6 A;  3LIF A;  2FFF B;  2J3T C;  3T4T A;  3PAG A;  4ARZ B;  3W8K A;  4BWI A;  3CJM A;  1PRQ A;  4PM8 A;  4WMC D;  1V9Y A;  4Q0H A;  4ZDX A;  5HAI A;  4EEU A;  2Y8H A;  1K0K A;  4MN7 A;  2XK1 A;  4HQA A;  2JC7 A;  5GL9 A;  1Z09 A;  1U60 A;  3VFH A;  1GA0 A;  1JWP A;  2E8J A;  3LUQ A;  2X02 A;  4MDZ A;  3G6O A;  5HSQ A;  1LSW A;  1PNE A;  3IF6 B;  2XRN A;  1OTB A;  3C4P A;  3PTE A;  3UY6 A;  1W79 A;  2OLV A;  3WRT A;  4K0X A;  3MJQ A;  4X1L A;  2PT7 A;  4EW7 A;  2JN7 A;  2JE5 A;  3HLB A;  2M7U A;  3DTM A;  3PBO A;  3ZHH A;  5DKL A;  3LR5 A;  3OPP A;  2QWS A;  4P87 A;  3CUE A;  2DMW A;  4S2K A;  4RQ9 A;  4JF4 A;  2Y2G A;  3CUE C;  3K2N A;  3AGD A;  4KZ8 A;  4UEY A;  2XSS A;  2Y79 A;  4IUK A;  4RVA A;  1ZKJ A;  4WN5 A;  1PW8 A;  3VMA A;  2ZC7 A;  1DJB A;  3MS6 A;  2JKR I;  2V1Z A;  4BLM A;  4R4S A;  4EER A;  4WEL A;  4EUZ A;  3W2Z A;  5GLA A;  5GHX A;  2ZOI A;  4Y2F A;  5DF7 A;  5FEF A;  4FSF A;  5G4Z A;  3PXP A;  4HY8 A;  3ZVW A;  1LLB A;  3RJU A;  3LR3 A;  3IBR A;  2PU4 A;  3GQZ A;  4LRX C;  4R4R A;  4GNU A;  3KYE A;  5LBR A;  2ZC4 B;  4OON A;  4KZ3 A;  5HZH A;  3Q1F A;  5AQ7 A;  4R70 A;  4S2L A;  3NDE A;  5DF9 A;  3RTY A;  3IS2 B;  3GDI A;  1FOF A;  1KDS A;  1GHM A;  4E6W A;  3ITB A;  3UB8 A;  2EFX A;  3T1S A;  2W27 A;  4HP4 A;  3R7W A;  2O9C A;  4GJ4 A;  2K2N A;  4C6Y A;  4R1G A;  3A0V A;  4OQI A;  3C38 A;  4KEN B;  1ES3 A;  2I9V A;  3T4S A;  4DE0 A;  2CMN A;  1HZO A;  1NXY A;  1XJ4 A;  1WA9 A;  2XLN A;  3MXR A;  1K4E A;  5HWW A;  4GS9 A;  3OC2 A;  4KZ7 A;  3DWZ A;  3NUL A;  2WKE A;  4ZJ1 A;  4HH3 A;  3KSF A;  4OQ0 A;  2NUT C;  1KGG A;  2ZL1 A;  4EET B;  1LHY A;  1ESU A;  2Z2L B;  1CEG A;  2M1C A;  1DJC A;  4GB7 A;  2JKR M;  1KE3 A;  2EFU A;  4LLO B;  5A90 A;  3UB9 A;  1HLU P;  2LB5 A;  2WGV A;  4CQH A;  5M19 A;  1UGU A;  3ZQ5 A;  4ZRR A;  3D4F A;  4OKP A;  2ZLY A;  3TOI A;  4JPM A;  5FQK A;  3EEA A;  3FKV A;  4M3K A;  4H8R A;  3TG9 A;  3UE1 A;  1NLY A;  3D3O A;  5CTN A;  2Y2M A;  1MWR A;  2ZQD A;  3OBF A;  2O99 A;  1BLC A;  4UHU A;  3E4Q A;  1PI5 A;  5BOH A;  4CLC A;  4I3J A;  5FQM A;  5FEG A;  3HRE A;  3H9W A;  2XRO A;  1ERO A;  1ALQ A;  4BL3 A;  3IWQ A;  3JPU A;  1RGZ A;  2XDM A;  1XX2 A;  3O3V A;  4A5R A;  4CLC C;  5F69 A;  4F94 A;  1CF0 A;  4N1H A;  1N4O A;  4N9L A;  4PMA A;  3FC7 A;  1GA9 A;  1DRM A;  3C8C A;  2JKT M;  4FH2 A;  4ZJ3 A;  4KZB A;  3UE6 A;  2Y2K A;  4G3W A;  1MWT A;  5HPI A;  4KUO A;  4Y13 A;  2QKP A;  3MFD A;  5M1A A;  4OOM A;  3A3D A;  2WAF A;  5IT5 A;  2K7S A;  1ERM A;  5DTK A;  4R0Q A;  3LYX A;  1S66 L;  3LEQ A;  3IXH A;  2JBF A;  3HUN A;  4OP8 A;  3VFF A;  5J8X A;  3ICY A;  4IUH A;  2EX6 A;  4JXW A;  1YAX A;  4Q0I A;  1K56 D;  2GDN A;  5FQJ A;  1CK3 A;  1O07 A;  2DRW A;  2HP9 A;  4YIN A;  5F1G A;  2EXB A;  2V0W A;  1MC0 A;  3GMW A;  3LR0 A;  4HP9 A;  4MLL A;  4BBV A;  1XGJ A;  4H6J A;  3KO6 A;  4HIA A;  2V20 A;  2HP5 A;  4DRT A;  3VOY A;  1BLH A;  4PPR A;  3IXG A;  2H10 A;  2I72 A;  5FAP A;  2KLI A;  1ODV A;  1YM1 A;  1GCE A;  1LL5 A;  2B5R A;  2ZQ7 A;  1YLZ A;  3M6H A;  3OLO A;  1F98 A;  5CGS A;  3CZD A;  4OLD A;  1T19 A;  4PKY A;  2P04 A;  3UB7 A;  3JVU A;  5FI6 A;  2KDK A;  2C6W B;  4R3A A;  2BAS A;  3NJA A;  4BEN A;  2BG1 A;  4PM5 A;  3OZH A;  3HJK A;  1XPB A;  1TS8 A;  3EQU A;  1ONH A;  5EFW A;  4NEE D;  1IYS A;  3DWK A;  2ZM8 A;  5L8M A;  5FAT A;  3E2L A;  4OVD A;  4G3V A;  3V5M A;  3E4P A;  5F6A A;  4KZA A;  4JGO A;  4LV0 A;  1D1J A;  3UPO A;  3U4L P;  4JKT A;  2OWJ A;  4E3I A;  4ME4 A;  1C3B A;  5L07 A;  2L0W A;  5F1F A;  4DJ2 A;  4S2P A;  4BMW A;  4B93 A;  1S4R A;  2W0N A;  1KOU A;  2UV0 E;  1KE4 A;  5A92 A;  3N7W A;  3T12 B;  1H8Z A;  5AQA A;  3WS2 A;  3MKF A;  1LSV A;  4KZ5 A;  3BY8 A;  3GR2 A;  4S2N C;  5L2F A;  3ZG9 B;  5DJT A;  3VP0 A;  1FSY A;  2W1T A;  3LR4 A;  3JVV A;  3IWI A;  3G35 A;  2W1T B;  1YLJ A;  4NXE A;  4JF5 A;  4WF0 A;  5EM0 A;  4S2O A;  3IF5 A;  4I39 A;  4DMZ A;  1YLY A;  2W3E A;  4XXR A;  2QZ6 A;  1VHM A;  4KQO A;  3MZE A;  5A8B A;  4OLG A;  3MFX A;  4K0W A;  4Y5F A;  3S7N A;  1BLS A;  5DFX A;  1E25 A;  4GHI A;  1EI5 A;  2INW A;  1F9I A;  4JXS A;  3PAE A;  5EVI B;  4MEZ A;  1W63 Q;  4QHC A;  3FYZ A;  4L9G A;  3VE3 A;  5CGW A;  3EQV A;  1BYW A;  1W63 M;  3BEB A;  1MKI A;  2XQZ A;  3T50 A;  1E3U A;  3OPL A;  1YKD A;  1FQG A;  4BQM A;  5DTT A;  2V2F F;  3HUM A;  2L1M A;  4X1M A;  2JCH A;  3A3E A;  2AVX A;  3F1O A;  3CPT B;  4OP5 A;  1FCN A;  5EOE A;  1T1A A;  3LCE A;  1J9M A;  5JYO A;  3UDI A;  2Y91 A;  1YLT A;  2PYR A;  3BWL A;  1YSP A;  4XT2 A;  4KUK A;  1NZU A;  4MBF A;  5J4E A;  4YOF A;  1PWC A;  4FOF A;  3ZG0 A;  2HDQ A;  1TS7 A;  1TF1 A;  3OPH A;  2A24 A;  1NY0 A;  3MZF A;  4LCM A;  1NJ4 A;  3K3D A;  5K5B A;  2ZMV A;  4IVK A;  3NHQ A;  1PWG A;  5L10 A;  1GSV A;  1CJF A;  1S67 L;  1L2S A;  4ARZ A;  2O9A A;  2WKH A;  4MCW A;  2DCF A;  3DAV A;  3PYP A;  4UA7 A;  3TJZ C;  3MXQ A;  3BW6 A;  3WS4 A;  4RA7 A;  4Y15 A;  2HGV A;  3IT9 A;  4EEP A;  4WBG A;  3F1N B;  3GTC A;  5HW3 A;  1OTA A;  2QJ5 A;  1ZTU A;  3V3R A;  5E2H A;  2W3D A;  1VQQ A;  1MPL A;  3IF6 A;  4BD0 A;  5CGX A;  3UME A;  2PD8 A;  1ES5 A;  1YLW A;  2XH9 A;  3DTI A;  3TE8 A;  4P6Z M;  1FCO A;  3NCK A;  2PD7 A;  3IWO A;  5CEB A;  3FKW A;  3GVB A;  2Y2J A;  3BRM A;  5A93 A;  3QP1 A;  3T4O A;  1UWN X;  3NC8 A;  2VGL M;  3ZVT A;  2PHY A;  5CTM A;  4IED A;  1Q2Q A;  3MQ0 A;  4PM9 A;  5HDC A;  5CER A;  4HH2 A;  3FZC A;  3G34 A;  3P98 A;  3G31 A;  3CI6 A;  3PHY A;  2Q0O A;  4QU3 A;  3KX0 X;  4ESP A;  3LY4 A;  3UPN A;  4JLF A;  3HLW A;  3EWK A;  2JKG A;  3G4P A;  3HLD A;  2J80 A;  4KZ4 A;  5CX7 A;  1VM1 A;  4MBH A;  2J9O A; 
#chains in the Genus database with same CATH homology
 1ES4 A;  3MZD A;  1I2W A;  2WGV A;  4ZBE A;  4S2M A;  2X01 A;  4X68 A;  5FAS A;  5M19 A;  1MWU A;  4OPY A;  2RCX A;  3A3I A;  2OSU A;  1KVL A;  2ZQC A;  3UE0 A;  1CEF A;  4X6T A;  4DDS A;  1RCJ A;  1L0G A;  3OCN A;  3D4F A;  1LL9 A;  3M2J A;  1YT4 A;  4OKP A;  2E8I A;  2ZLY A;  3TOI A;  4DE1 A;  3QHY A;  5FAQ A;  2VGK A;  2Y59 A;  3C4O A;  4FCF A;  4JPM A;  1MY8 A;  2ZM2 A;  2XF3 A;  4GDN A;  5DF8 A;  5FQK A;  1K38 A;  2Y55 A;  4EQI A;  3FKV A;  2BLS A;  4M3K A;  4H8R A;  3V50 A;  4WZ5 A;  3TG9 A;  5CTN A;  3UE1 A;  5FI2 A;  4NET A;  5EEC A;  2Y2M A;  3C7U A;  1MWR A;  1DJA A;  4OOL A;  2ZQD A;  5FI7 A;  1K55 A;  1PI4 A;  4GD6 A;  4FH4 A;  3SH9 A;  4X56 A;  1KVM A;  2HDR A;  4QJG A;  1BLC A;  4OQG A;  4UHU A;  4B88 A;  1H5X A;  3WS1 A;  1PI5 A;  4X55 A;  5BOH A;  3BM6 A;  1XA1 A;  1IYO A;  2WZZ A;  3ZNT A;  2A49 A;  3AGF A;  3NI9 A;  4WZ5 C;  2EXA A;  5FQM A;  3HRE A;  1ERO A;  2XEP A;  1WYC A;  1ALQ A;  4OH0 A;  4BL3 A;  1SKF A;  3ITA A;  1IYQ A;  5GLD A;  3IWQ A;  4WM9 A;  1W8Q A;  4X53 A;  1RGZ A;  2XDM A;  5CEC A;  1XX2 A;  3O3V A;  4KG5 A;  4A5R A;  4F94 A;  4N1H A;  1N4O A;  4IBX A;  4E3J A;  5F82 A;  1NYM A;  5CHM A;  3SS3 A;  5KSH A;  4N9L A;  5AQ9 A;  4LV3 A;  1K6R A;  2Q9N A;  4PMA A;  1GA9 A;  2XD1 A;  1G6A A;  4FH2 A;  2J9P A;  5FDH A;  4ZJ3 A;  1BUL A;  1N9B A;  1KGE A;  4KZB A;  3SS5 A;  5M18 A;  2ZC6 B;  2Y2K A;  2IWC A;  3VSL A;  1IEL A;  1MWT A;  4GN2 A;  2ZC5 B;  4Y0U A;  3C5A A;  3LO7 A;  1BSG A;  3A3F A;  3ZG8 B;  3GRJ A;  3FWL A;  3HUO A;  3BLM A;  5KMW A;  3G2Z A;  3MFD A;  3DW0 A;  4RYE A;  1JTD A;  3I7J A;  1S6R A;  4S2N A;  2XGN A;  4OOM A;  5M1A A;  4DE2 A;  4GKU A;  1E4D A;  2IWD A;  3W4P A;  3A3D A;  1ZG6 A;  2WAF A;  3HLG A;  4KG6 A;  2J8Y A;  1ERM A;  5FAO A;  5DTK A;  4R0Q A;  4XUZ A;  2XR0 A;  3O86 A;  3SS4 A;  4EWF A;  1Q2P A;  2ZMA A;  4WMC A;  3VP4 A;  3IXH A;  2JBF A;  1ZC2 A;  3HUN A;  3V39 A;  4WEK A;  1EWZ A;  4OP8 A;  3VOZ A;  3W4O A;  3VFF A;  5I94 A;  2Y2H A;  5AQB A;  5J8X A;  3ZCZ A;  2H0T A;  2EX6 A;  3IF6 C;  3ZG5 A;  3M2K A;  4QD4 A;  1CI9 A;  2HDS A;  3G2Y A;  4JXW A;  1IEM A;  4IBR A;  3NDG A;  4LV2 A;  5EE8 A;  1K56 D;  2GDN A;  5FQJ A;  3N6I A;  3IQA A;  1JVJ A;  2P9V A;  3HBR A;  2WKI A;  4D2O A;  1QME A;  3IHB A;  2P9V B;  5HAQ A;  1CK3 A;  5E2F A;  1O07 A;  5EVI D;  2DRW A;  2HP9 A;  5TR7 A;  4YIN A;  3O88 A;  5F1G A;  2EXB A;  5EUA A;  3IH9 A;  3GMW A;  5HAR A;  2Y2Q A;  5DVA A;  3WWX A;  1JWV A;  4MLL A;  2G2W A;  4RX2 A;  5EPH A;  1XGJ A;  3C7V A;  3GSG A;  2WGW B;  4LCL A;  2DNS A;  3S4X A;  5EVI C;  5KSC A;  2PU2 A;  2V20 A;  4EV4 A;  3MBZ A;  1YLP A;  2HP5 A;  4DRT A;  2C5W B;  1NZO A;  2X71 A;  3Q82 A;  4DXC A;  2QMI A;  3VOY A;  1L0D A;  3MXS A;  1PW1 A;  4B4X A;  1BLH A;  4PPR A;  1PYY A;  3IXG A;  3ZG7 B;  2H10 A;  2I72 A;  5G18 A;  3S1Y A;  4E3N A;  4NK3 A;  3BFF A;  2Y2P A;  5FAP A;  1YMX A;  4E3L A;  1XGI A;  1YM1 A;  1GCE A;  2R9X A;  1LL5 A;  2B5R A;  4K91 A;  1HD8 A;  1LI9 A;  2VGJ A;  2ZQ7 A;  1YLZ A;  2CC1 A;  2WK0 A;  4N1X A;  2Y2O A;  2R9W A;  5A91 A;  4HBU A;  3ISG A;  3M6H A;  5CGS A;  1KDW A;  3PBT A;  3CZD A;  3VSK A;  4OLD A;  2WAE A;  4U0X A;  1HTZ A;  1SCW A;  2EX9 A;  4R23 A;  4E6X A;  1FSW A;  5FI6 A;  3UPP A;  2HDU A;  3VP1 A;  2C6W B;  4Q8I A;  3A3J A;  4PM5 A;  4BEN A;  2BG1 A;  5U47 A;  4DXB A;  3OZH A;  2H0Y A;  2IWB A;  2ZM0 A;  1XPB A;  5CXW A;  3EQU A;  1ONH A;  3RXX A;  3N8S A;  1IYS A;  3DWK A;  5HX9 A;  5D3O A;  4QY5 A;  2ZM8 A;  4U3T A;  5FAT A;  4JXV A;  5CHU A;  5E2E A;  1K55 C;  4E3K A;  4HES A;  3E2L A;  4OVD A;  4KQR A;  4BJP A;  5CED A;  1YMS A;  4OPZ A;  3V5M A;  2FFY A;  4KZA A;  1PWD A;  4S2J A;  1TDG A;  4OQH A;  1DY6 A;  4B4Z A;  4Y0T A;  4LV0 A;  1W5D A;  3UPO A;  1XP4 A;  5E2G A;  5FQI A;  4HEF A;  2ZQA A;  1ES2 A;  1K4F A;  3PBR A;  4JKT A;  1Z6F A;  4P6B A;  3O87 A;  4E3I A;  1C3B A;  3OCL A;  5F1F A;  4R3B A;  4S2P A;  5FQQ A;  1HVB A;  3Q07 A;  1LI0 A;  4FD8 A;  1YQS A;  1RP5 A;  4MBK A;  2P74 A;  3CMZ A;  4EBL A;  4PM7 A;  4UA6 A;  3WS0 A;  1KE4 A;  2WGI A;  5A92 A;  2FFF B;  1L0F A;  3N7W A;  1G68 A;  4HBT A;  3PAG A;  4LV1 A;  4OPQ A;  2H5S A;  3CJM A;  5EOO A;  3W8K A;  5JYP A;  2OLU A;  4PM8 A;  1H8Z A;  5AQA A;  3WS2 A;  4S2I A;  4WMC D;  3V3S A;  3MKF A;  3UE3 A;  4KZ5 A;  3GR2 A;  4JXG A;  1IYP A;  3PBN A;  3BFD A;  4S2N C;  4ZDX A;  2XD5 A;  5HAI A;  3QNC A;  5L2F A;  3ZG9 B;  1H8Y A;  4GDB A;  1WYB A;  2XK1 A;  2JC7 A;  4P0M A;  5GL9 A;  3VP0 A;  1FSY A;  1L0E A;  3HLE A;  4JF6 A;  1U60 A;  5EVL A;  3VFH A;  1GA0 A;  4L0L A;  1JWP A;  3IWI A;  1XXM A;  3G35 A;  4KZ9 A;  5HAP A;  2X02 A;  1YLJ A;  3BLS A;  1GHP A;  4JF5 A;  1NYY A;  3IF6 B;  1IKI A;  5F83 A;  1TEM A;  5FQ9 A;  3UDF A;  4S2O A;  2WGW A;  3IF5 A;  3C4P A;  3ZNY A;  1KE0 A;  3PTE A;  5TGF A;  3UY6 A;  1W79 A;  2OLV A;  3TSG A;  1YLY A;  4XXR A;  2QZ6 A;  4KQO A;  3MZE A;  3S22 A;  4OLG A;  3ZFZ A;  3N8L A;  3WRT A;  4K0W A;  4K0X A;  3UDX A;  1BLS A;  3M6B A;  5GHZ A;  5IHV A;  2JE5 A;  3HLC A;  3HLB A;  3SOI A;  1ERQ A;  3DTM A;  1K57 A;  3PBO A;  1E25 A;  1K25 A;  1OME A;  2Y2L A;  1EI5 A;  2Y4A A;  3ZHH A;  1NRF A;  3CG5 A;  3OPP A;  4JXS A;  5KZH A;  3PAE A;  5EVI B;  1O7E A;  4O7D A;  4P87 A;  1CI8 A;  1MWS A;  2ZQ9 A;  4MEZ A;  5CRF A;  3QNB A;  3BFC A;  4QHC A;  4DDY A;  1KGF A;  3FYZ A;  4BL2 A;  4E3M A;  4KZ6 A;  3W4Q A;  5CGW A;  3E2K A;  3EQV A;  3P09 A;  1SHV A;  3BEC A;  4S2K A;  3BEB A;  1MKI A;  2XQZ A;  4JF4 A;  2Y2G A;  1IKG A;  4OOY A;  4PM6 A;  1E3U A;  3NY4 A;  5GHY A;  3OPL A;  1FQG A;  2ZJ9 A;  4BQM A;  4DE3 A;  5DTT A;  2V2F F;  3HUM A;  3UN7 A;  4OPR A;  3BFG A;  3N8R A;  2JCH A;  1I5Q A;  3A3E A;  1I2S A;  1BLP A;  3BFE A;  3G30 A;  1K54 A;  3FV7 A;  3N4I A;  4YFM A;  1M6K A;  3UO9 A;  1XA7 A;  4DF6 A;  3Q7V A;  3AGD A;  4KZ8 A;  4Y0O A;  3AGE A;  3NBL A;  4OP5 A;  4EBN A;  1BZA A;  1FCN A;  1FR1 A;  3Q7V B;  1ZKJ A;  4RVA A;  3HVF A;  5EOE A;  2J7V A;  4RX3 A;  3GV9 A;  5E43 A;  3LCE A;  1J9M A;  3UNW A;  3UDI A;  5JYO A;  1K54 C;  2Y91 A;  1YLT A;  4MNR A;  1PW8 A;  3LEZ A;  3VMA A;  2QPN A;  3ZDJ A;  1QMF A;  2ZC7 A;  1DJB A;  3IH8 A;  3RXW A;  2Z2M B;  3LY3 A;  4R3J A;  2HPB A;  2ZQ8 A;  4ZAM A;  3ZGA B;  1PZP A;  2V1Z A;  4BLM A;  1NZU A;  4MBF A;  1PWC A;  4R4S A;  4WEL A;  4EUZ A;  1ONG A;  2UWX A;  3ZG0 A;  2HDQ A;  1BTL A;  5GHX A;  2HP6 A;  1PZO A;  4GOG A;  4P85 A;  5GLA A;  3WRZ A;  1JTG A;  4QY6 A;  5DF7 A;  4FSF A;  3OPH A;  4UA9 A;  3IXD A;  2Y2N A;  4LEN A;  1NY0 A;  3MZF A;  3ZVW A;  4LCM A;  1NJ4 A;  1LLB A;  3RJU A;  2PU4 A;  4QB8 A;  3GQZ A;  2WZX A;  4R4R A;  4IVK A;  4GNU A;  4UAA A;  2ZC4 B;  4OON A;  3WS5 A;  1PWG A;  2ZD8 A;  4KZ3 A;  4CPK A;  4WEJ A;  1L2S A;  3JYI A;  5FSR A;  3VP2 A;  2WKH A;  3Q1F A;  1K6S A;  2DCF A;  5AQ7 A;  1SDE A;  5FA7 A;  1SDN A;  4UA7 A;  4GD8 A;  4S2L A;  2EX8 A;  3BYD A;  1M40 A;  3PBQ A;  3NDE A;  4RA7 A;  3WS4 A;  1AXB A;  3NIA A;  5DF9 A;  3IT9 A;  3SH7 A;  4WBG A;  1FOF A;  1KDS A;  1GHM A;  4ZTK A;  1S0W A;  4IVI A;  3GTC A;  5HW3 A;  2RL3 A;  4E6W A;  3ITB A;  1TVF A;  5GLB A;  3Q7Z A;  3IHA A;  5E2H A;  1MXO A;  1ESI A;  3MKE A;  3V3R A;  1VQQ A;  4DKI A;  1MPL A;  2EFX A;  4CJN A;  4WZ4 A;  4X69 A;  1XKZ A;  1BT5 A;  3IF6 A;  5CHJ A;  1ZG4 A;  4BD0 A;  4Z9Q A;  5CGX A;  3Q81 A;  1TDL A;  1ES5 A;  1JWZ A;  1YLW A;  3HL9 A;  3OPR A;  2XH9 A;  4EBP A;  3HLF A;  2OV5 A;  2EX2 A;  3G32 A;  2XFT A;  4Y7P A;  1FCO A;  4C6Y A;  1GHI A;  3NCK A;  4R1G A;  1FCM A;  4U0T A;  4OQI A;  3IWO A;  5CEB A;  4BD1 A;  3FKW A;  4E3O A;  3GVB A;  4KEN B;  1ES3 A;  2Y2J A;  4WYY A;  1K56 A;  3BRM A;  4DE0 A;  3VP3 A;  4KQQ A;  5A93 A;  1HZO A;  1RGY A;  2G2U A;  3NC8 A;  2WAD A;  1NXY A;  3ZVT A;  5CTM A;  4N9K A;  4N92 A;  2Q9M A;  1Y54 A;  4IED A;  5EVI A;  1FR6 A;  1Q2Q A;  2XLN A;  3MXR A;  1K4E A;  4PM9 A;  5CER A;  5TFQ A;  4ZJ2 A;  4JBF A;  1PIO A;  2Y2I A;  1WE4 A;  3IXB A;  3FZC A;  3G34 A;  3DWZ A;  3OC2 A;  3P98 A;  4KZ7 A;  5GLC A;  2WKE A;  4C3Q A;  1K57 C;  3G31 A;  4GZB A;  4KG2 A;  5HFO A;  2WYX A;  4ID4 A;  4ZJ1 A;  5HL1 A;  1W7F A;  4QU3 A;  4C75 A;  3B3X A;  1BUE A;  3LY4 A;  4OQ0 A;  1KGG A;  3UPN A;  4JLF A;  1E3U D;  1LHY A;  3HLW A;  1ESU A;  2Z2L B;  2WUQ A;  1CEG A;  2PBY A;  3PBS A;  3G4P A;  5DTS A;  2A3U A;  3HLD A;  2ZC3 B;  4KZ4 A;  1DJC A;  4GB7 A;  1KE3 A;  2EFU A;  4XUX A;  3SH8 A;  1VM1 A;  5A90 A;  2XFS A;  1MBL A;  4MBH A;  2J9O A;  1W8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...