4OPYA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extended spectrum beta-lactamase TEM-63
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opyA00
1VM1A 1K54C 3PBOA 5CEDA 3C7VA 2WZZA 4PPRA 5E43A 4EQIA 3GSGA 3OPRA 1BUEA 1BLCA 2H5SA 3GR2A 3RXWA 3NI9A 1NYYA 2Y4AA 3W4PA 5TR7A 5CGXA 3DW0A 3BFDA 3HLCA 4DXBA 1PI5A 2V2FF 1XGJA 3ZNYA 3G2YA 2J9PA 1DJBA 4KG5A 3C7UA 4OLGA 4KG6A 3D4FA 4OOLA 1CK3A 1IEMA 2OLUA 4FD8A 1H5XA 5CTNA 1NZOA 3WWXA 1L0EA 4IVKA 3LCEA 3S4XA 5F1FA 3RXXA 2EXBA 2XD5A 2HDSA 1WE4A 4R0QA 4C3QA 4S2JA 4IVIA 3V3SA 4PM8A 1BLHA 4R3JA 1HD8A 4MBKA 3CJMA 3HLDA 4JXVA 4X56A 4UA9A 5CHUA 1SDNA 1K55A 3IHAA 4X69A 5GHXA 1NRFA 5EOEA 1GHIA 3ZHHA 4Q8IA 3ITBA 4DE2A 4WELA 3E2KA 1K25A 1PYYA 1K6SA 3OC2A 1I2SA 4BQMA 3BLMA 1XGIA 3IF6B 1BULA 3WRTA 3M6HA 2GDNA 1KDSA 1K38A 2XH9A 2Y2LA 1ERQA 1IKGA 4JXSA 1CI9A 1N9BA 3LY4A 4QD4A 5HAIA 4MBHA 3UE0A 4OQGA 3LO7A 1E3UA 3IXGA 2QPNA 4FH4A 5EOOA 2HPBA 1YLWA 3CZDA 4Y0UA 1O7EA 3AGDA 1ESIA 4FCFA 4NETA 1W79A 1HVBA 2JBFA 1ES3A 1ES4A 3A3JA 4UA6A 3IWOA 3ZVTA 4E3IA 3O86A 4MBFA 1IKIA 4JPMA 2WGVA 1XXMA 2WUQA 1MPLA 1MY8A 2HDUA 5A91A 4P6BA 3HVFA 4OVDA 5EVID 3SS4A 5FA7A 1JTDA 1K4EA 1MBLA 3GQZA 1EI5A 4KZAA 1MKIA 3P98A 5DF9A 1ONHA 4LV1A 4QY5A 2PU4A 5J8XA 3UY6A 4OP5A 3G32A 4K0XA 4WEKA 3UPPA 3VSLA 3GV9A 2R9WA 3ZNTA 4KZ9A 1PWGA 1J9MA 1LLBA 2ZC3B 4S2NC 4OH0A 4QB8A 4XUZA 4ZDXA 3Q7VB 1C3BA 2G2WA 2QZ6A 1CEGA 1Y54A 1EROA 4B4XA 1MWTA 1ZG6A 5KSCA 1FSWA 1TDGA 5E2GA 1ZKJA 5EVIC 1JTGA 2ZQCA 3PAEA 4N1XA 3WS2A 5FAQA 2HDQA 4Y0OA 2X01A 1NYMA 5CTMA 4E3OA 4XXRA 5CXWA 4S2PA 3WS5A 4DDYA 3Q82A 3O3VA 4GDNA 4U0TA 1MWSA 4L0LA 1FCNA 4PMAA 1IYOA 4K91A 4OOYA 4EV4A 3SH8A 1YT4A 4K0WA 1LL9A 5GHYA 5GHZA 2V1ZA 2XGNA 5EE8A 2R9XA 5HAPA 3I7JA 4ZJ3A 1PWCA 1FR6A 4WZ4A 3EQVA 3HLBA 3N6IA 1ESUA 1WYCA 3C4PA 2Y2NA 1RGYA 3IF5A 3BFGA 3MFDA 4LENA 4D2OA 2C5WB 3N8SA 1SKFA 3N7WA 5JYPA 3ZG0A 1BLPA 3PAGA 2WAFA 1L0GA 3WRZA 3UPOA 4KZ8A 2XFTA 2Y2JA 5F82A 3NDGA 4JF4A 2X02A 5DTKA 5AQBA 5HFOA 2VGJA 1H8ZA 1XP4A 5A93A 1Q2QA 1KGGA 3FYZA 4ZBEA 3LY3A 1CI8A 2XFSA 1XA1A 4KZ4A 3VP0A 3CMZA 2DNSA 3VMAA 4JF5A 2WADA 3PBRA 5A92A 2Q9MA 2XQZA 1YLZA 2EFXA 1E4DA 2Y2PA 3IXBA 3OCNA 4RX2A 4S2NA 2JCHA 5TGFA 4JKTA 3SH7A 3HLWA 2Y2HA 3SOIA 1ES5A 2XLNA 1GCEA 4B88A 5CHJA 4C75A 1L2SA 3N4IA 3UNWA 3MZFA 3VP2A 1TEMA 2J8YA 4LV0A 3G34A 4YINA 1YQSA 2Y91A 4R4SA 5EVIA 4GOGA 5GL9A 3ZG9B 3VFHA 3TG9A 1XA7A 3O88A 4OQ0A 5L2FA 4QJGA 2ZQ7A 3HUMA 4GD6A 4E6WA 1MWRA 5DTSA 5GLCA 3ZG5A 1JWPA 4OP8A 4KQQA 2A3UA 1SDEA 4HEFA 4DE3A 4WEJA 2OV5A 1QMFA 3HLEA 4DDSA 3IQAA 3IWQA 5FQ9A 3UDFA 2Y55A 3PTEA 1QMEA 3BLSA 3HL9A 3VP4A 3C5AA 3BEBA 5FATA 3ZGAB 1CEFA 1KDWA 3NC8A 1TVFA 1OMEA 1BT5A 2Y59A 3ITAA 2WGWA 4E3MA 1ZG4A 4KQRA 3HBRA 2EX8A 4P0MA 1S0WA 3HREA 4OLDA 2B5RA 1L0DA 2EX9A 4BL3A 4CPKA 1LI9A 1PIOA 3MZEA 4LV2A 2ZC7A 4OQIA 3G31A 2Y2OA 3VSKA 1TDLA 3OPLA 1E25A 3Q81A 1RGZA 2JE5A 4OKPA 4R23A 4S2IA 1W8QA 2JC7A 3PBSA 4KZ6A 4KZ7A 1BTLA 2ZQ8A 5CRFA 4YFMA 5M1AA 5DVAA 3Q7VA 5G18A 2V20A 1K57C 2WKEA 3LEZA 5AQ9A 1RCJA 3S1YA 1I5QA 5FQIA 3IHBA 1YMSA 2EFUA 1I2WA 1W8YA 1JVJA 4OONA 4E6XA 1K6RA 2X71A 3W4QA 3A3DA 2J9OA 3N8LA 2WZXA 3NIAA 4R1GA 2HP9A 1O07A 4OPRA 1H8YA 4WYYA 3ISGA 5DF8A 4RVAA 1XX2A 4MLLA 1FR1A 1IYPA 1ES2A 2HP6A 2Y2IA 5FQMA 2ZQDA 4KQOA 3JYIA 1KGFA 4EBPA 3G2ZA 4X6TA 3NCKA 4B4ZA 3IH8A 2FFYA 3G35A 4UA7A 4N1HA 3V3RA 3M2KA 2XD1A 1K56D 3EQUA 5EVLA 3DWKA 3MXRA 2Y2QA 4E3NA 3WS0A 4DE1A 1KE3A 4OPQA 3W8KA 1YLPA 2WKIA 3ZFZA 4E3KA 1FSYA 4JXWA 4U0XA 2E8IA 4OQHA 5IHVA 4KZBA 3HUNA 1GHMA 4CJNA 5A90A 3Q1FA 4EWFA 3TSGA 3C4OA 1HTZA 5BOHA 1K4FA 4BJPA 1MWUA 2XF3A 5FDHA 2OLVA 5DTTA 3DWZA 1S6RA 2G2UA 2QMIA 4WM9A 5EVIB 3WS1A 2ZC6B 2J7VA 1Q2PA 3SS3A 1K57A 5AQAA 4DF6A 4S2MA 4Y7PA 4A5RA 5HW3A 5AQ7A 4QHCA 1W7FA 5F83A 3Q07A 4QY6A 1LI0A 4PM7A 3MZDA 4XUXA 3BFFA 1WYBA 2XR0A 5M19A 1KVMA 1YLYA 3P09A 1NZUA 3S22A 2WAEA 3BFEA 4KZ3A 5CERA 4C6YA 1PWDA 4HBUA 2P9VA 2Z2LB 4LCLA 3BRMA 2ZM2A 3FZCA 3UDXA 4EBLA 3FKWA 1BSGA 1NY0A 4JLFA 5U47A 3UN7A 1SHVA 2CC1A 4KENB 5FAPA 5JYOA 3FWLA 4GDBA 5CHMA 4Y0TA 5CGSA 4X55A 2WGWB 3A3IA 4WMCD 4ZAMA 2OSUA 4UHUA 3HLGA 3PBTA 4WZ5A 5E2FA 3E2LA 5GLBA 3B3XA 3UO9A 4FH2A 3ZCZA 4N9LA 3MKEA 4X68A 3G30A 4N9KA 2IWCA 3UDIA 1IELA 3ZG7B 1BLSA 1IYQA 1ALQA 3OCLA 3W4OA 4BLMA 4JF6A 4UAAA 1PW8A 1G68A 3QNBA 3IWIA 3FKVA 5HL1A 1KGEA 3SS5A 1JWZA 3OZHA 5FQQA 2I72A 4X53A 3BM6A 4R3BA 3BECA 3A3FA 3BFCA 2BG1A 4EUZA 1K56A 3RJUA 4RYEA 3A3EA 4KG2A 3O87A 3OPPA 1M40A 1XPBA 3V50A 1GA9A 3IF6C 4BL2A 1U60A 3NDEA 4PM6A 4Z9QA 5FI6A 1XKZA 2ZC4B 2IWBA 3QNCA 3IT9A 4GD8A 4JXGA 5FI7A 4M3KA 1PZOA 2C6WB 2FFFB 2ZQAA 2EX6A 4IBXA 4P85A 3MKFA 1FCMA 5FQKA 4RA7A 3SH9A 4ZJ2A 3WS4A 3G4PA 2Y2KA 3VFFA 5HARA 2Y2GA 2ZLYA 3M2JA 1RP5A 5E2HA 3N8RA 4E3JA 3M6BA 4ZJ1A 5EECA 3QHYA 1JWVA 1VQQA 1Z6FA 1K54A 4HESA 1GHPA 2P74A 1BZAA 2DCFA 2HP5A 2RL3A 5GLAA 1AXBA 4OPZA 4S2KA 3IXHA 3HLFA 5HAQA 3FV7A 4GZBA 1LHYA 5GLDA 3TOIA 1DY6A 3HUOA 4GNUA 3AGEA 4FSFA 5CEBA 1MXOA 5EUAA 1YMXA 4H8RA 4EBNA 1N4OA 1FOFA 2DRWA 4R4RA 1YLTA 5FAOA 2Y2MA 1IYSA 4PM9A 2WYXA 2EXAA 5FSRA 2WGIA 4WMCA 3VOYA 5M18A 3MBZA 5KZHA 5FASA 4MEZA 5FI2A 3GRJA 1FCOA 1NXYA 2ZJ9A 4OOMA 4WZ5C 2P9VB 4F94A 3IF6A 1L0FA 2HDRA 3VP3A 1KVLA 4ZTKA 1SCWA 4ID4A 3V39A 2PBYA 2PU2A 1PI4A 4HBTA 4BD0A 3NBLA 2ZQ9A 2XDMA 4O7DA 2ZM0A 3ZDJA 3UE1A 4IBRA 4IEDA 5HX9A 3UE3A 4LV3A 2H0TA 2ZMAA 3PBNA 4U3TA 4RX3A 1YM1A 3IH9A 4LCMA 2XEPA 1HZOA 4JBFA 1GA0A 4S2OA 2RCXA 4GKUA 5FQJA 3UPNA 2H0YA 2ZD8A 4BENA 4DE0A 3GVBA 5TFQA 4P87A 3ZG8B 2WKHA 3VP1A 2WK0A 1KE0A 3GMWA 1KE4A 2XK1A 2UWXA 3NY4A 5DF7A 1YLJA 1W5DA 1M6KA 3BYDA 4KZ5A 2Q9NA 1E3UD 4S2LA 5CECA 1NJ4A 5D3OA 1LL5A 1PZPA 4GN2A 3MXSA 5E2EA 1DJAA 2EX2A 3V5MA 2H10A 2VGKA 4DRTA 5KMWA 1K55C 2IWDA 3PBQA 5F1GA 1ERMA 2Z2MB 4E3LA 5I94A 1ZC2A 4NK3A 1G6AA 5KSHA 3DTMA 4BD1A 4QU3A 2BLSA 4N92A 3VOZA 2ZM8A 1DJCA 3GTCA 3IXDA 2A49A 3AGFA 4MNRA 1ONGA 5CGWA 4PM5A 4OPYA 5EPHA 2ZC5B 1PW1A 4GB7A 3Q7ZA 3ZVWA 4DXCA 3CG5A 1FQGA 4WBGA 3OPHA 1EWZA 4DKIA
chains in the Genus database with same CATH superfamily
1K54C 3PBOA 2WZZA 5AVEA 3UB7A 1P97A 1EW0A 4YWZA 2H5SA 3RXWA 5TR7A 2QJ5A 2PAVP 5MC7A 1PI5A 1XGJA 4BBVA 3G2YA 2J9PA 1DJBA 1D1JA 3C7UA 1H5XA 5CTNA 1NZOA 1L0EA 2P04A 3RXXA 1WE4A 4C3QA 1D06A 4IVIA 4PM8A 4MBKA 3HLDA 4X56A 3T4QA 5EOEA 1YAXA 2VJWA 3MF0A 1TS7A 2L1MA 4WELA 3H9WA 4UEYA 1K25A 1DP9A 3OC2A 1I2SA 4BQMA 3CPTB 3BLMA 1BULA 3SZTA 1NLYA 2Y2LA 1CI9A 3LY4A 4ETZA 4K08A 4MBHA 5DJTA 3ZQ5A 4Y0UA 2XA7S 1O7EA 1HVBA 1ES4A 4GS9A 3A3JA 4UA6A 3IWOA 3ZVTA 1IKIA 2WGVA 2WUQA 1MY8A 2HDUA 5A91A 5EVID 5EM1A 1JTDA 2VLGA 4GCZA 5DF9A 4X1LA 3UB6A 2O9BA 3GV9A 4ESPA 3EEAA 4KZ9A 1J9MA 2ZC3B 4P6ZS 4S2NC 1W63M 4QB8A 4XUZA 1C3BA 2G2WA 2QZ6A 1Y54A 4B4XA 1ZKJA 5EVIC 3P01A 1JTGA 2ZQCA 2X01A 3RFBA 4JGQA 4XXRA 4S2PA 4DDYA 3V67A 2PHYA 4L0LA 1FCNA 4HJ3A 4HY8A 3NOUC 5GHYA 1LL9A 1MKMA 3E0YA 2XGNA 3K3DA 3HLBA 4Y3IA 3N6IA 1ESUA 3C4PA 3IF5A 3BFGA 4LENA 2C5WB 1MC0A 3N7WA 2HJ9C 5JYPA 1L0GA 2XA7M 2Y2JA 1V9ZA 4JF4A 3F1OA 4MN6A 4WUJA 2K31A 3KSGA 2ZOHA 1KGGA 3FYZA 3IX8A 3LY3A 4ZBEA 2XFSA 2L0WA 1XA1A 1OTAA 3CMZA 2WADA 5A92A 4WL9A 2EFXA 3IXBA 2Y2HA 1S4RA 3SOIA 4C75A 4DJ2A 3VP2A 4HIAA 3TG9A 4I3IA 3O88A 1AWIA 4QJGA 2PDRA 3H82B 3ZG5A 1JWPA 4P6ZM 4FUWA 5HD3A 1SDEA 4DDSA 5TBMA 3PTEA 1F9IA 2WKQA 3LR0A 5F68A 3NC8A 1DP8A 1KOUA 4E3MA 3LIAA 4KQRA 4P0MA 3NOTC 3TRCA 3HREA 4OLDA 3MZEA 2Y2OA 4MN5A 1TDLA 3E4OA 3T4OA 3KSHA 1YPRA 4O0PA 1RGZA 2JE5A 1UGUA 3T50A 2JC7A 4KZ6A 3KYEA 2JKTM 1S1YA 4ARZB 2EFUA 2YKFA 2OWJA 4IUHA 3NIAA 2WZXA 1O07A 3T12B 4RVAA 3VV4A 1ES2A 5FQMA 4I3JA 3JYIA 4EBPA 3G2ZA 4X6TA 3NCKA 4B4ZA 4UA7A 3M2KA 3BWLA 3DWKA 3MXRA 4NKPA 4DMZA 1CF0A 4E3KA 1GHMA 3C4OA 2R78A 1MWUA 3PR6A 1S6RA 1Q2PA 4Y7PA 4QY6A 3MZDA 3BFFA 1WYBA 1XJ6A 1YLYA 3P09A 4HOIA 2P9VA 2Z2LB 5L09A 2O9CA 3S7PA 3FKWA 1PRQA 4GW9A 2CMNA 3QP8A 5DFYA 4Y0TA 2OSUA 1F5MA 3G6OA 4WZ5A 3MQ0A 5C5KA 3E2LA 3UO9A 4FH2A 3ZCZA 4X68A 4ZRRA 2G7UA 3UDIA 3MJQA 3OCLA 3LR4A 1NWZA 4UAAA 1PW8A 1G68A 3QNBA 3SS5A 5FQQA 1D7EA 1VB6A 3BECA 2B02A 3T4SA 3ZYTA 2BG1A 1K56A 4RYEA 3OPPA 4O01A 3V50A 1OTBA 4BL2A 3NDEA 2IWBA 2Z6DA 3IT9A 4GD8A 5FI7A 2UV0E 4HI4A 1FCMA 3G4PA 2Y2KA 3E4QA 3CUEA 5HARA 2AVXA 5J3WA 4DN0A 1IFQA 3VOLA 4ZJ1A 1LT0A 5CX7A 2FZ0A 1Z6FA 1LSWA 1AXBA 2IA2A 4B93A 3HUOA 4FTXA 1PNEA 3AGEA 1UWNX 5EUAA 1YMXA 2K7SA 3HJKA 1N4OA 1FOFA 5FAOA 3BQ8A 1IYSA 3DAVA 4LRZE 4WMCA 4MEZA 2QWSA 1NXYA 3CPTA 1L0FA 2HDRA 2ZOIA 4ZTKA 1PI4A 2YKHA 3ZDJA 5HX9A 4R3AA 3PBNA 1ZHHB 2O99A 2W3HA 4RX3A 5DFXA 1YM1A 4LCMA 5FQJA 4JBFA 2RCXA 3IX3A 5HL6A 4L9FA 2WKHA 4QPRA 1KE0A 3NJAA 5DJUA 4S2LA 2BASA 1LL8A 1LL5A 3MXSA 5TBMB 2IWDA 5F1GA 1ERMA 1ZC2A 3UB5P 1DP6A 3RTYA 3DTMA 3VOZA 2ZM8A 1DJCA 3AGFA 3K2NA 4MNRA 1H3QA 5EPHA 5EV0A 1PW1A 1FQGA 1STZA 5CEDA 2JKRI 5E43A 3GSGA 3OPRA 1BLCA 3GR2A 1NYYA 2Y4AA 3W4PA 5CGXA 3DW0A 4WN5A 3ZNYA 4KG5A 3D4FA 3WWXA 5HZHA 2HDSA 4KUOA 3V3SA 4BBTA 4R3JA 2V8FA 4DJ3A 5CHUA 2Z6CA 4X69A 1BYWA 3ITBA 2H28A 1K6SA 2KX6A 1XGIA 1K38A 2HV1A 3LIDA 5KIZA 3UE0A 4OQGA 3LO7A 2QPNA 4FH4A 5HDSA 1YLWA 1H8MA 3H7WB 4NXGA 3H82A 4FCFA 4NETA 2LB9A 1W79A 1ES3A 3EGXC 3QP6A 4MBFA 4XT2B 1XXMA 2JN7A 3SS4A 4CLCB 1K4EA 1P9WA 3GQZA 3B42A 1MKIA 3P98A 1ONHA 4LV1A 4QY5A 2PU4A 5J8XA 4L9GA 4OP5A 4K0XA 2XRNA 4LRYC 2A24B 2JKTI 2R9WA 1PWGA 1LLBA 2GZAA 5F5YA 4OH0A 2M7UA 1CEGA 1MWTA 1ZG6A 1FSWA 5E2GA 3KSFA 4ARZA 2HDQA 4Y0OA 2O0YA 2W1TB 4U0TA 4GDNA 2V0WA 1LSVA 3SH8A 5GHZA 1YKDA 5EE8A 2R9XA 4GHIB 4ZJ3A 1FR6A 2Y2NA 1RGYA 3PXPA 4D60A 4D2OA 1SKFA 3WRZA 1VEUB 1FIKA 5HFOA 2VGJA 2W1RA 4IHQA 2OOLA 4KZ4A 3VP0A 2Q9MA 4EERA 1F2KA 4JKTA 3SH7A 3HLWA 3TE8A 1ES5A 3GDIA 4B88A 5CHJA 3MZFA 1TEMA 4JGOA 3TJZC 3VFHA 3ZG9B 1XA7A 4OQ0A 3QP1A 4GD6A 2J80A 2KDKA 5GLCA 4NG2A 1YSQA 2PRFA 2OV5A 1QMFA 3HLEA 4X1MA 5FQ9A 2WKRA 3U4LP 3UDFA 3BLSA 3HL9A 5FATA 1OMEA 1BT5A 4WLAA 2VGLS 5FDSA 3IS2B 3HBRA 2W3EA 2ZC7A 3G31A 2M1CA 3KYZA 1OTDA 1W8QA 5HWVA 1TS0A 5CRFA 5M1AA 2B18A 5DVAA 5G18A 3LEZA 3S1YA 2NUPC 1JVJA 4OONA 5F6AA 3A3DA 3T4TA 2QJ7A 3LICA 5DF8A 1FR1A 4JGPA 4M4XA 2ZQDA 4HJ4A 1KGFA 5DKLA 2FFYA 2XD1A 1K56D 1HLUP 4JGRA 5AJGA 2Y2QA 1TS6A 4BWIA 1KE3A 3NOPC 4OPQA 1VETB 3W8KA 2VV6A 3Q1FA 4EWFA 3TSGA 1HTZA 1K4FA 2JKRM 5DTTA 3DWZA 2VGLM 3CWFA 2G2UA 2QMIA 4II7A 1GSWA 2ZC6B 1F98A 2A2LA 5HW3A 5AQ7A 3BW6A 5F83A 3Q07A 1LI0A 4PM7A 3S7OA 2XR0A 3S22A 5CERA 4C6YA 1PWDA 2HJEA 4LCLA 1OT6A 3T1SA 1G28A 1NY0A 1SHVA 4KENB 5FAPA 4GDBA 5CGSA 4X55A 1OJGA 2WGWB 4WMCD 4UHUA 5E2FA 3B3XA 3NULA 3MKEA 3G30A 5HSQA 1BLSA 1IYQA 3IX4A 3W4OA 4JF6A 1TF1A 4G3VA 3IWIA 3FKVA 5HL1A 3OZHA 2VX8A 3BFCA 4IJGA 2EWWA 3RJUA 2VK3A 1X0OA 3CITA 2QYBA 3T4LA 1XKZA 3UMEA 4M3KA 2C6WB 2FFFB 2ZQAA 2EX6A 4IBXA 5FQKA 3SH9A 3WS4A 2OWHA 3M2JA 3N8RA 3D9YA 3E98A 5EECA 3QHYA 1JWVA 1VQQA 2PBDP 5TJJA 1K54A 4HESA 1GHPA 1L3LA 3C8CA 1ZTUA 2HP5A 2RL3A 4OPZA 4S2KA 3W2ZA 1DY6A 1MXOA 3MQOA 4H8RA 4EBNA 2DRWA 1GSVA 3MR0A 2JHEA 4PM9A 3EEHA 3VOYA 3MBZA 5KZHA 3O5YA 2ZJ9A 4F94A 2J3TD 4LPZA 3LYXA 4H6JB 3V39A 3F1PA 4GLQA 4BD0A 4HBTA 3NBLA 4Y5FA 4ME4A 2XDMA 3T4JA 2W0NA 3UE3A 4LV3A 2H0TA 4U3TA 1J3WA 1XFNA 3H7WA 3ICYA 3IH9A 1HZOA 2GX5A 4GKUA 2H0YA 2ZD8A 4Q0HA 5TFQA 5EVEA 1KE4A 4XT2A 4CQHA 2J3TC 3LFVA 1W5DA 2VA0A 1CQAA 4MMNA 5CECA 5D3OA 4CLCA 1PZPA 5E2EA 1OTEA 1DJAA 2EX2A 3V5MA 2Z2MB 4E3LA 5I94A 5G4ZA 5KSHA 2V9AA 2Y8HA 2A24A 4PM5A 5CGWA 3CAXA 3U2AA 3A0SA 5HPIA 4DXCA 4WBGA 3HJIA 1EWZA 5L10A 1VM1A 3C7VA 4PPRA 1OJ5A 2W3GA 3NI9A 2W1TA 1PFLA 3JPUA 2D02A 3T4KA 3BFDA 4DXBA 3UMDA 2V2FF 4EXOA 4GHIA 1CK3A 3QP4A 3LCEA 5F1FA 4R0QA 4S2JA 5FL3A 4JXVA 1K55A 3D72A 1VEUA 4Q8IA 3FG8A 4DE2A 1TS8A 1PYYA 3KYQA 1G6OA 1GSXA 3OOVA 3IF6B 2JKGA 3M6HA 2GDNA 4EETB 1KDSA 1OTIA 3MS6A 1IKGA 4JXSA 1N9BA 4G3KA 4QD4A 4HNBA 3GECA 2I9VA 3IXGA 5EOOA 1Y4OA 3MQQA 1OT9A 4E3IA 2M7VA 1MPLA 4PHTA 3LEQA 4P6BA 2PYPA 1EI5A 3B47A 4I39A 5K5BA 3UY6A 3IS2A 1T1BA 4WEKA 3UPPA 3VSLA 3ZNTA 4F3LB 3OBFA 1S4SA 2INWA 4BMWA 2PR5A 3PAEA 2W3DA 4N1XA 5FAQA 5CXWA 3QP2A 3WS5A 1MWSA 4K91A 2XROA 4OOYA 1YT4A 2V1ZA 5HAPA 3EQVA 3MFDA 1T1CA 1BLPA 2E8JA 3PAGA 4KZ8A 4Y2FA 3C30A 1H8ZA 4I5SA 1XP4A 1Q2QA 1VETA 2DNSA 2V1BA 4JF5A 3VMAA 3PBRA 2XQZA 1YLZA 2Y2PA 5TGFA 1GCEA 3UNWA 2OAP1 4FOFA 4UQIM 4YINA 2Y91A 4R4SA 5L2FA 2VKSA 3K3CA 3E4PA 3HUMA 4E6WA 2OAQ1 5DTSA 4L9EA 2A3UA 5EFWA 2VEAA 3OLOA 4DE3A 4WEJA 1DRMA 3IQAA 2ZMFA 2Y55A 3VP4A 5I5LA 3C5AA 1LSXA 3ZGAB 4B9OA 3ITAA 3MMHA 2WGWA 4EEPA 3F1PB 5HWWA 4HP9A 2EX8A 1S0WA 2GJ3A 1L0DA 2EX9A 2VZWA 1PIOA 4LV2A 4OQIA 1E25A 2PYRA 3Q81A 1TD5A 4OKPA 3PBSA 5LBRA 1BTLA 2ZQ8A 4ETXA 2WKEA 1I5QA 3IHBA 1I2WA 3EWKA 4E6XA 3W4QA 4Q0JA 2J9OA 1WA9A 4R1GA 2HP9A 4WYYA 4HP4A 3ISGA 1XX2A 4MLLA 1IYPA 4KQOA 3G35A 3V3RA 3JVUA 5EVLA 4PKYG 1SKOB 4DE1A 2ZBBA 1YLPA 2HZ5A 3R7WB 4JXWA 4U0XA 5A90A 2EWVA 4HJ6A 4MDZA 5BOHA 2OLVA 5EVIB 1N9OA 1K57A 2J3WA 5AQAA 4A5RA 1W7FA 2KLIA 5M19A 1NZUA 4KZ3A 2ZM2A 3UDXA 4H6JA 5U47A 2CC1A 4YOFA 2VV8A 3A3IA 4ZAMA 3HLGA 1JNUA 2ZMVA 5L07A 3FPWA 2HF6A 3MSHA 4N9LA 3BY9A 4N9KA 3C38A 1IELA 3BJNA 4LRXC 2XSSA 1KGEA 3IBRA 2ZL1B 2I72A 3BM6A 3UB9A 4EEUA 3FC7A 1ACFA 4EUZA 4KG2A 5L8MA 5IU1A 5HD5A 5A8BA 4Z9QA 5FI6A 2JKFA 4CLCD 5IS1A 4P85A 3MKFA 4RA7A 2B95A 5J4EA 3F1NB 2ZLYA 4E3JA 4KUKA 2DCFA 5GLAA 4Q0IA 3IXHA 3CLOA 3HLFA 5HAQA 4PKYA 3FV7A 4GZBA 1LHYA 4GNUA 4CLCC 5CEBA 1T18A 2WYXA 4EUVA 5FASA 5FI2A 4WZ5C 2EA9A 2K2NA 3JVVA 3IF6A 3D3OA 3SW1A 1SCWA 4G3WA 2PBYA 2ZM0A 5EM0A 3UE1A 4IBRA 4IEDA 2ZMAA 4Y17A 4S2OA 1GA0A 1W63Q 4P87A 3ZG8B 3VP1A 3EOIA 3GMWA 2XK1A 3NY4A 3S7QA 5DF7A 1YLJA 3A0VA 3BY8A 4KZ5A 3LR3A 3UE6A 1NJ4A 1ODVA 3KSIA 4GN2A 5AVFA 2H10A 2VGKA 4DRTA 5KMWA 1K55C 3PBQA 4NK3A 3LGOA 1G6AA 4EQ1A 4BD1A 2BLSA 3IXDA 4F3LA 2A49A 3CUEC 3PYPA 1NLZA 4GB7A 3ZVWA 4R6LA 5HDDA 4EQIA 1BUEA 4HHDA 3LIBA 4KQDA 4AFIA 3HLCA 1VHMA 4OLGA 4KG6A 4OOLA 1N9NA 1IEMA 2OLUA 4FD8A 4IVKA 3S4XA 2EXBA 5HDCA 2XD5A 4R38A 1BLHA 2NUTC 1HD8A 3CJMA 4UA9A 1SDNA 3IHAA 5GHXA 2WKPA 1NRFA 1GHIA 3ZHHA 1Z09A 5FEFA 2QKPA 3E2KA 4E04A 2QHKA 1SZVA 2DMWA 3WRTA 4EU0A 2XH9A 2V0UA 1ERQA 4BBUA 5HAIA 4LFUA 1S67L 3LUQA 1E3UA 2HPBA 2W27A 3CZDA 4NXEA 5DKKA 3AGDA 1ESIA 2JBFA 3O86A 4JPMA 1K0KA 3HVFA 4OVDA 3CHWP 5FA7A 1MBLA 3L7HA 4KZAA 2PD7A 3G32A 4NEED 4ZDXA 3Q7VB 1EROA 2P08A 5KSCA 1TDGA 3WS2A 4E3OA 1NYMA 5CTMA 4O8GA 3NECA 3O3VA 3Q82A 4PMAA 1IYOA 4EV4A 4K0WA 4NXFA 3I7JA 1PWCA 4WZ4A 3DBAA 1WYCA 4I3AA 3N8SA 3EGDC 3ZG0A 3VE4A 3UPOA 2WAFA 4EESA 2XFTA 5F82A 3NDGA 2X02A 5DTKA 5AQBA 3KO6A 3T1QB 5A93A 1SKOA 1CI8A 4HH3A 3R7WA 1E4DA 4RX2A 3OCNA 4S2NA 2JCHA 1S1ZA 2XLNA 1L2SA 3N4IA 1G5UA 2J8YA 4LV0A 3G34A 1YQSA 3NHQA 5EVIA 4GOGA 5GL9A 2ZQ7A 1MWRA 4OP8A 3PHYA 4KQQA 4YNRA 4GS9B 4HEFA 1Y28A 5HPFA 4PAUA 3IWQA 3MFXA 1QMEA 3FPVA 2ACGA 4MCWA 3DTKA 3BEBA 3DTIA 1CEFA 1KDWA 1TVFA 2Y59A 4RQ9A 1ZG4A 1IOUA 2B5RA 4CPKA 4BL3A 1LI9A 4GJ4A 3VSKA 3OPLA 1T1AA 4R23A 4S2IA 4KZ7A 4YFMA 2V20A 1K57C 2ZL1A 4R70A 5AQ9A 1RCJA 5FQIA 1YMSA 4X25A 3HCYA 1W8YA 3TW8A 1K6RA 1V9YA 2X71A 3N8LA 2D01A 4UQIS 5G4YA 4OPRA 1H8YA 3LIEA 3T1RA 2HP6A 3MXQA 2Y2IA 2HGVA 3BQAA 3LR5A 3IH8A 4N1HA 3F1NA 4HH2A 3F1OB 3EQUA 3ULFA 4E3NA 3WS0A 2W3FA 2WKIA 3ZFZA 1FSYA 2E8IA 4OQHA 5IHVA 4KZBA 3HUNA 4CJNA 3CI6A 3S7NA 4BJPA 4WF0A 5FDHA 2XF3A 4WM9A 1H0MA 3WS1A 2J7VA 3SS3A 4DF6A 1S66L 4S2MA 4QHCA 3L9KA 4XUXA 1KVMA 3R4KA 2WAEA 3BFEA 4HBUA 3BRMA 2GNXA 3FZCA 4EBLA 2L4RA 1BSGA 4JLFA 2Q0OA 3DTEA 3UN7A 5JYOA 3FWLA 5CHMA 2PR6A 1XJ4A 1CJFA 5F69A 3P7NA 3PBTA 2P7JA 5GLBA 4CLCE 2V1AA 2IWCA 3T1XA 3ZG7B 1ALQA 4BLMA 1A0KA 3VE3A 1JWZA 4MN7A 4X53A 4Y13A 4R3BA 3UB8A 3A3FA 3A3EA 3O87A 1M40A 1XPBA 1XFQA 2V8CA 1GA9A 3IF6C 2VV7A 1U60A 4PM6A 3IBJA 2ZC4B 1YSPA 3C2WA 3QNCA 4JXGA 1NRJA 1PZOA 5FEGA 2MJ6A 4ZJ2A 2PD8A 3VFFA 3LI9A 2Y2GA 5E2HA 1RP5A 2O9AA 3M6BA 1P0ZA 4QWOA 2PT7A 3QP5A 1N9LA 1FILA 2P74A 1BZAA 4Z1WA 3A0RA 4EW7A 5GLDA 1XJ2A 3TOIA 3LI8A 4FSFA 3RH8B 4I38A 4R4RA 1YLTA 4NXBA 2Y2MA 2EXAA 5FSRA 2WGIA 1MZUA 5M18A 1OPXA 3GRJA 1FCOA 4OOMA 2P9VB 1XJ3A 3VP3A 1P9RA 1KVLA 3KX0X 2Y79A 3B33A 4ID4A 4LLOB 2PU2A 2BTFP 2ZQ9A 4O7DA 4HQAA 2LB5A 2XEPA 3UPNA 4BENA 4DE0A 3GVBA 1UWPX 2WK0A 1T19A 2UWXA 1M6KA 3BYDA 2Q9NA 1E3UD 5J7EA 4Y15A 4LGWA 4IUKA 5HWTA 2KOIA 2FH5A 4QU3A 4N92A 3GTCA 1ONGA 5IT5A 4OPYA 3LIFA 2ZC5B 3Q7ZA 3CG5A 3OPHA 3Q7VA 4DKIA
chains in the Genus database with same CATH topology
1VM1A 1K54C 3PBOA 5CEDA 3C7VA 2WZZA 4PPRA 5E43A 4EQIA 3GSGA 3OPRA 1BUEA 1BLCA 2H5SA 3GR2A 3RXWA 3NI9A 1NYYA 2Y4AA 3W4PA 5TR7A 5CGXA 3DW0A 3BFDA 3HLCA 4DXBA 1PI5A 2V2FF 1XGJA 3ZNYA 3G2YA 2J9PA 1DJBA 4KG5A 3C7UA 4OLGA 4KG6A 3D4FA 4OOLA 1CK3A 1IEMA 2OLUA 4FD8A 1H5XA 5CTNA 1NZOA 3WWXA 1L0EA 4IVKA 3LCEA 3S4XA 5F1FA 3RXXA 2EXBA 2XD5A 2HDSA 1WE4A 4R0QA 4C3QA 4S2JA 4IVIA 3V3SA 4PM8A 1BLHA 4R3JA 1HD8A 4MBKA 3CJMA 3HLDA 4JXVA 4X56A 4UA9A 5CHUA 1SDNA 1K55A 3IHAA 4X69A 5GHXA 1NRFA 5EOEA 1GHIA 3ZHHA 4Q8IA 3ITBA 4DE2A 4WELA 3E2KA 1K25A 1PYYA 1K6SA 3OC2A 1I2SA 4BQMA 3BLMA 1XGIA 3IF6B 1BULA 3WRTA 3M6HA 2GDNA 1KDSA 1K38A 2XH9A 2Y2LA 1ERQA 1IKGA 4JXSA 1CI9A 1N9BA 3LY4A 4QD4A 5HAIA 4MBHA 3UE0A 4OQGA 3LO7A 1E3UA 3IXGA 2QPNA 4FH4A 5EOOA 2HPBA 1YLWA 3CZDA 4Y0UA 1O7EA 3AGDA 1ESIA 4FCFA 4NETA 1W79A 1HVBA 2JBFA 1ES3A 1ES4A 3A3JA 4UA6A 3IWOA 3ZVTA 4E3IA 3O86A 4MBFA 1IKIA 4JPMA 2WGVA 1XXMA 2WUQA 1MPLA 1MY8A 2HDUA 5A91A 4P6BA 3HVFA 4OVDA 5EVID 3SS4A 5FA7A 1JTDA 1K4EA 1MBLA 3GQZA 1EI5A 4KZAA 1MKIA 3P98A 5DF9A 1ONHA 4LV1A 4QY5A 2PU4A 5J8XA 3UY6A 4OP5A 3G32A 4K0XA 4WEKA 3UPPA 3VSLA 3GV9A 2R9WA 3ZNTA 4KZ9A 1PWGA 1J9MA 1LLBA 2ZC3B 4S2NC 4OH0A 4QB8A 4XUZA 4ZDXA 3Q7VB 1C3BA 2G2WA 2QZ6A 1CEGA 1Y54A 1EROA 4B4XA 1MWTA 1ZG6A 5KSCA 1FSWA 1TDGA 5E2GA 1ZKJA 5EVIC 1JTGA 2ZQCA 3PAEA 4N1XA 3WS2A 5FAQA 2HDQA 4Y0OA 2X01A 1NYMA 5CTMA 4E3OA 4XXRA 5CXWA 4S2PA 3WS5A 4DDYA 3Q82A 3O3VA 4GDNA 4U0TA 1MWSA 4L0LA 1FCNA 4PMAA 1IYOA 4K91A 4OOYA 4EV4A 3SH8A 1YT4A 4K0WA 1LL9A 5GHYA 5GHZA 2V1ZA 2XGNA 5EE8A 2R9XA 5HAPA 3I7JA 4ZJ3A 1PWCA 1FR6A 4WZ4A 3EQVA 3HLBA 3N6IA 1ESUA 1WYCA 3C4PA 2Y2NA 1RGYA 3IF5A 3BFGA 3MFDA 4LENA 4D2OA 2C5WB 3N8SA 1SKFA 3N7WA 5JYPA 3ZG0A 1BLPA 3PAGA 2WAFA 1L0GA 3WRZA 3UPOA 4KZ8A 2XFTA 2Y2JA 5F82A 3NDGA 4JF4A 2X02A 5DTKA 5AQBA 5HFOA 2VGJA 1H8ZA 1XP4A 5A93A 1Q2QA 1KGGA 3FYZA 4ZBEA 3LY3A 1CI8A 2XFSA 1XA1A 4KZ4A 3VP0A 3CMZA 2DNSA 3VMAA 4JF5A 2WADA 3PBRA 5A92A 2Q9MA 2XQZA 1YLZA 2EFXA 1E4DA 2Y2PA 3IXBA 3OCNA 4RX2A 4S2NA 2JCHA 5TGFA 4JKTA 3SH7A 3HLWA 2Y2HA 3SOIA 1ES5A 2XLNA 1GCEA 4B88A 5CHJA 4C75A 1L2SA 3N4IA 3UNWA 3MZFA 3VP2A 1TEMA 2J8YA 4LV0A 3G34A 4YINA 1YQSA 2Y91A 4R4SA 5EVIA 4GOGA 5GL9A 3ZG9B 3VFHA 3TG9A 1XA7A 3O88A 4OQ0A 5L2FA 4QJGA 2ZQ7A 3HUMA 4GD6A 4E6WA 1MWRA 5DTSA 5GLCA 3ZG5A 1JWPA 4OP8A 4KQQA 2A3UA 1SDEA 4HEFA 4DE3A 4WEJA 2OV5A 1QMFA 3HLEA 4DDSA 3IQAA 3IWQA 5FQ9A 3UDFA 2Y55A 3PTEA 1QMEA 3BLSA 3HL9A 3VP4A 3C5AA 3BEBA 5FATA 3ZGAB 1CEFA 1KDWA 3NC8A 1TVFA 1OMEA 1BT5A 2Y59A 3ITAA 2WGWA 4E3MA 1ZG4A 4KQRA 3HBRA 2EX8A 4P0MA 1S0WA 3HREA 4OLDA 2B5RA 1L0DA 2EX9A 4BL3A 4CPKA 1LI9A 1PIOA 3MZEA 4LV2A 2ZC7A 4OQIA 3G31A 2Y2OA 3VSKA 1TDLA 3OPLA 1E25A 3Q81A 1RGZA 2JE5A 4OKPA 4R23A 4S2IA 1W8QA 2JC7A 3PBSA 4KZ6A 4KZ7A 1BTLA 2ZQ8A 5CRFA 4YFMA 5M1AA 5DVAA 3Q7VA 5G18A 2V20A 1K57C 2WKEA 3LEZA 5AQ9A 1RCJA 3S1YA 1I5QA 5FQIA 3IHBA 1YMSA 2EFUA 1I2WA 1W8YA 1JVJA 4OONA 4E6XA 1K6RA 2X71A 3W4QA 3A3DA 2J9OA 3N8LA 2WZXA 3NIAA 4R1GA 2HP9A 1O07A 4OPRA 1H8YA 4WYYA 3ISGA 5DF8A 4RVAA 1XX2A 4MLLA 1FR1A 1IYPA 1ES2A 2HP6A 2Y2IA 5FQMA 2ZQDA 4KQOA 3JYIA 1KGFA 4EBPA 3G2ZA 4X6TA 3NCKA 4B4ZA 3IH8A 2FFYA 3G35A 4UA7A 4N1HA 3V3RA 3M2KA 2XD1A 1K56D 3EQUA 5EVLA 3DWKA 3MXRA 2Y2QA 4E3NA 3WS0A 4DE1A 1KE3A 4OPQA 3W8KA 1YLPA 2WKIA 3ZFZA 4E3KA 1FSYA 4JXWA 4U0XA 2E8IA 4OQHA 5IHVA 4KZBA 3HUNA 1GHMA 4CJNA 5A90A 3Q1FA 4EWFA 3TSGA 3C4OA 1HTZA 5BOHA 1K4FA 4BJPA 1MWUA 2XF3A 5FDHA 2OLVA 5DTTA 3DWZA 1S6RA 2G2UA 2QMIA 4WM9A 5EVIB 3WS1A 2ZC6B 2J7VA 1Q2PA 3SS3A 1K57A 5AQAA 4DF6A 4S2MA 4Y7PA 4A5RA 5HW3A 5AQ7A 4QHCA 1W7FA 5F83A 3Q07A 4QY6A 1LI0A 4PM7A 3MZDA 4XUXA 3BFFA 1WYBA 2XR0A 5M19A 1KVMA 1YLYA 3P09A 1NZUA 3S22A 2WAEA 3BFEA 4KZ3A 5CERA 4C6YA 1PWDA 4HBUA 2P9VA 2Z2LB 4LCLA 3BRMA 2ZM2A 3FZCA 3UDXA 4EBLA 3FKWA 1BSGA 1NY0A 4JLFA 5U47A 3UN7A 1SHVA 2CC1A 4KENB 5FAPA 5JYOA 3FWLA 4GDBA 5CHMA 4Y0TA 5CGSA 4X55A 2WGWB 3A3IA 4WMCD 4ZAMA 2OSUA 4UHUA 3HLGA 3PBTA 4WZ5A 5E2FA 3E2LA 5GLBA 3B3XA 3UO9A 4FH2A 3ZCZA 4N9LA 3MKEA 4X68A 3G30A 4N9KA 2IWCA 3UDIA 1IELA 3ZG7B 1BLSA 1IYQA 1ALQA 3OCLA 3W4OA 4BLMA 4JF6A 4UAAA 1PW8A 1G68A 3QNBA 3IWIA 3FKVA 5HL1A 1KGEA 3SS5A 1JWZA 3OZHA 5FQQA 2I72A 4X53A 3BM6A 4R3BA 3BECA 3A3FA 3BFCA 2BG1A 4EUZA 1K56A 3RJUA 4RYEA 3A3EA 4KG2A 3O87A 3OPPA 1M40A 1XPBA 3V50A 1GA9A 3IF6C 4BL2A 1U60A 3NDEA 4PM6A 4Z9QA 5FI6A 1XKZA 2ZC4B 2IWBA 3QNCA 3IT9A 4GD8A 4JXGA 5FI7A 4M3KA 1PZOA 2C6WB 2FFFB 2ZQAA 2EX6A 4IBXA 4P85A 3MKFA 1FCMA 5FQKA 4RA7A 3SH9A 4ZJ2A 3WS4A 3G4PA 2Y2KA 3VFFA 5HARA 2Y2GA 2ZLYA 3M2JA 1RP5A 5E2HA 3N8RA 4E3JA 3M6BA 4ZJ1A 5EECA 3QHYA 1JWVA 1VQQA 1Z6FA 1K54A 4HESA 1GHPA 2P74A 1BZAA 2DCFA 2HP5A 2RL3A 5GLAA 1AXBA 4OPZA 4S2KA 3IXHA 3HLFA 5HAQA 3FV7A 4GZBA 1LHYA 5GLDA 3TOIA 1DY6A 3HUOA 4GNUA 3AGEA 4FSFA 5CEBA 1MXOA 5EUAA 1YMXA 4H8RA 4EBNA 1N4OA 1FOFA 2DRWA 4R4RA 1YLTA 5FAOA 2Y2MA 1IYSA 4PM9A 2WYXA 2EXAA 5FSRA 2WGIA 4WMCA 3VOYA 5M18A 3MBZA 5KZHA 5FASA 4MEZA 5FI2A 3GRJA 1FCOA 1NXYA 2ZJ9A 4OOMA 4WZ5C 2P9VB 4F94A 3IF6A 1L0FA 2HDRA 3VP3A 1KVLA 4ZTKA 1SCWA 4ID4A 3V39A 2PBYA 2PU2A 1PI4A 4HBTA 4BD0A 3NBLA 2ZQ9A 2XDMA 4O7DA 2ZM0A 3ZDJA 3UE1A 4IBRA 4IEDA 5HX9A 3UE3A 4LV3A 2H0TA 2ZMAA 3PBNA 4U3TA 4RX3A 1YM1A 3IH9A 4LCMA 2XEPA 1HZOA 4JBFA 1GA0A 4S2OA 2RCXA 4GKUA 5FQJA 3UPNA 2H0YA 2ZD8A 4BENA 4DE0A 3GVBA 5TFQA 4P87A 3ZG8B 2WKHA 3VP1A 2WK0A 1KE0A 3GMWA 1KE4A 2XK1A 2UWXA 3NY4A 5DF7A 1YLJA 1W5DA 1M6KA 3BYDA 4KZ5A 2Q9NA 1E3UD 4S2LA 5CECA 1NJ4A 5D3OA 1LL5A 1PZPA 4GN2A 3MXSA 5E2EA 1DJAA 2EX2A 3V5MA 2H10A 2VGKA 4DRTA 5KMWA 1K55C 2IWDA 3PBQA 5F1GA 1ERMA 2Z2MB 4E3LA 5I94A 1ZC2A 4NK3A 1G6AA 5KSHA 3DTMA 4BD1A 4QU3A 2BLSA 4N92A 3VOZA 2ZM8A 1DJCA 3GTCA 3IXDA 2A49A 3AGFA 4MNRA 1ONGA 5CGWA 4PM5A 4OPYA 5EPHA 2ZC5B 1PW1A 4GB7A 3Q7ZA 3ZVWA 4DXCA 3CG5A 1FQGA 4WBGA 3OPHA 1EWZA 4DKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM1 A;  1K54 C;  3PBO A;  5CED A;  3C7V A;  2WZZ A;  4PPR A;  5E43 A;  4EQI A;  3GSG A;  3OPR A;  1BUE A;  1BLC A;  2H5S A;  3GR2 A;  3RXW A;  3NI9 A;  1NYY A;  2Y4A A;  3W4P A;  5TR7 A;  5CGX A;  3DW0 A;  3BFD A;  3HLC A;  4DXB A;  1PI5 A;  2V2F F;  1XGJ A;  3ZNY A;  3G2Y A;  2J9P A;  1DJB A;  4KG5 A;  3C7U A;  4OLG A;  4KG6 A;  3D4F A;  4OOL A;  1CK3 A;  1IEM A;  2OLU A;  4FD8 A;  1H5X A;  5CTN A;  1NZO A;  3WWX A;  1L0E A;  4IVK A;  3LCE A;  3S4X A;  5F1F A;  3RXX A;  2EXB A;  2XD5 A;  2HDS A;  1WE4 A;  4R0Q A;  4C3Q A;  4S2J A;  4IVI A;  3V3S A;  4PM8 A;  1BLH A;  4R3J A;  1HD8 A;  4MBK A;  3CJM A;  3HLD A;  4JXV A;  4X56 A;  4UA9 A;  5CHU A;  1SDN A;  1K55 A;  3IHA A;  4X69 A;  5GHX A;  1NRF A;  5EOE A;  1GHI A;  3ZHH A;  4Q8I A;  3ITB A;  4DE2 A;  4WEL A;  3E2K A;  1K25 A;  1PYY A;  1K6S A;  3OC2 A;  1I2S A;  4BQM A;  3BLM A;  1XGI A;  3IF6 B;  1BUL A;  3WRT A;  3M6H A;  2GDN A;  1KDS A;  1K38 A;  2XH9 A;  2Y2L A;  1ERQ A;  1IKG A;  4JXS A;  1CI9 A;  1N9B A;  3LY4 A;  4QD4 A;  5HAI A;  4MBH A;  3UE0 A;  4OQG A;  3LO7 A;  1E3U A;  3IXG A;  2QPN A;  4FH4 A;  5EOO A;  2HPB A;  1YLW A;  3CZD A;  4Y0U A;  1O7E A;  3AGD A;  1ESI A;  4FCF A;  4NET A;  1W79 A;  1HVB A;  2JBF A;  1ES3 A;  1ES4 A;  3A3J A;  4UA6 A;  3IWO A;  3ZVT A;  4E3I A;  3O86 A;  4MBF A;  1IKI A;  4JPM A;  2WGV A;  1XXM A;  2WUQ A;  1MPL A;  1MY8 A;  2HDU A;  5A91 A;  4P6B A;  3HVF A;  4OVD A;  5EVI D;  3SS4 A;  5FA7 A;  1JTD A;  1K4E A;  1MBL A;  3GQZ A;  1EI5 A;  4KZA A;  1MKI A;  3P98 A;  5DF9 A;  1ONH A;  4LV1 A;  4QY5 A;  2PU4 A;  5J8X A;  3UY6 A;  4OP5 A;  3G32 A;  4K0X A;  4WEK A;  3UPP A;  3VSL A;  3GV9 A;  2R9W A;  3ZNT A;  4KZ9 A;  1PWG A;  1J9M A;  1LLB A;  2ZC3 B;  4S2N C;  4OH0 A;  4QB8 A;  4XUZ A;  4ZDX A;  3Q7V B;  1C3B A;  2G2W A;  2QZ6 A;  1CEG A;  1Y54 A;  1ERO A;  4B4X A;  1MWT A;  1ZG6 A;  5KSC A;  1FSW A;  1TDG A;  5E2G A;  1ZKJ A;  5EVI C;  1JTG A;  2ZQC A;  3PAE A;  4N1X A;  3WS2 A;  5FAQ A;  2HDQ A;  4Y0O A;  2X01 A;  1NYM A;  5CTM A;  4E3O A;  4XXR A;  5CXW A;  4S2P A;  3WS5 A;  4DDY A;  3Q82 A;  3O3V A;  4GDN A;  4U0T A;  1MWS A;  4L0L A;  1FCN A;  4PMA A;  1IYO A;  4K91 A;  4OOY A;  4EV4 A;  3SH8 A;  1YT4 A;  4K0W A;  1LL9 A;  5GHY A;  5GHZ A;  2V1Z A;  2XGN A;  5EE8 A;  2R9X A;  5HAP A;  3I7J A;  4ZJ3 A;  1PWC A;  1FR6 A;  4WZ4 A;  3EQV A;  3HLB A;  3N6I A;  1ESU A;  1WYC A;  3C4P A;  2Y2N A;  1RGY A;  3IF5 A;  3BFG A;  3MFD A;  4LEN A;  4D2O A;  2C5W B;  3N8S A;  1SKF A;  3N7W A;  5JYP A;  3ZG0 A;  1BLP A;  3PAG A;  2WAF A;  1L0G A;  3WRZ A;  3UPO A;  4KZ8 A;  2XFT A;  2Y2J A;  5F82 A;  3NDG A;  4JF4 A;  2X02 A;  5DTK A;  5AQB A;  5HFO A;  2VGJ A;  1H8Z A;  1XP4 A;  5A93 A;  1Q2Q A;  1KGG A;  3FYZ A;  4ZBE A;  3LY3 A;  1CI8 A;  2XFS A;  1XA1 A;  4KZ4 A;  3VP0 A;  3CMZ A;  2DNS A;  3VMA A;  4JF5 A;  2WAD A;  3PBR A;  5A92 A;  2Q9M A;  2XQZ A;  1YLZ A;  2EFX A;  1E4D A;  2Y2P A;  3IXB A;  3OCN A;  4RX2 A;  4S2N A;  2JCH A;  5TGF A;  4JKT A;  3SH7 A;  3HLW A;  2Y2H A;  3SOI A;  1ES5 A;  2XLN A;  1GCE A;  4B88 A;  5CHJ A;  4C75 A;  1L2S A;  3N4I A;  3UNW A;  3MZF A;  3VP2 A;  1TEM A;  2J8Y A;  4LV0 A;  3G34 A;  4YIN A;  1YQS A;  2Y91 A;  4R4S A;  5EVI A;  4GOG A;  5GL9 A;  3ZG9 B;  3VFH A;  3TG9 A;  1XA7 A;  3O88 A;  4OQ0 A;  5L2F A;  4QJG A;  2ZQ7 A;  3HUM A;  4GD6 A;  4E6W A;  1MWR A;  5DTS A;  5GLC A;  3ZG5 A;  1JWP A;  4OP8 A;  4KQQ A;  2A3U A;  1SDE A;  4HEF A;  4DE3 A;  4WEJ A;  2OV5 A;  1QMF A;  3HLE A;  4DDS A;  3IQA A;  3IWQ A;  5FQ9 A;  3UDF A;  2Y55 A;  3PTE A;  1QME A;  3BLS A;  3HL9 A;  3VP4 A;  3C5A A;  3BEB A;  5FAT A;  3ZGA B;  1CEF A;  1KDW A;  3NC8 A;  1TVF A;  1OME A;  1BT5 A;  2Y59 A;  3ITA A;  2WGW A;  4E3M A;  1ZG4 A;  4KQR A;  3HBR A;  2EX8 A;  4P0M A;  1S0W A;  3HRE A;  4OLD A;  2B5R A;  1L0D A;  2EX9 A;  4BL3 A;  4CPK A;  1LI9 A;  1PIO A;  3MZE A;  4LV2 A;  2ZC7 A;  4OQI A;  3G31 A;  2Y2O A;  3VSK A;  1TDL A;  3OPL A;  1E25 A;  3Q81 A;  1RGZ A;  2JE5 A;  4OKP A;  4R23 A;  4S2I A;  1W8Q A;  2JC7 A;  3PBS A;  4KZ6 A;  4KZ7 A;  1BTL A;  2ZQ8 A;  5CRF A;  4YFM A;  5M1A A;  5DVA A;  3Q7V A;  5G18 A;  2V20 A;  1K57 C;  2WKE A;  3LEZ A;  5AQ9 A;  1RCJ A;  3S1Y A;  1I5Q A;  5FQI A;  3IHB A;  1YMS A;  2EFU A;  1I2W A;  1W8Y A;  1JVJ A;  4OON A;  4E6X A;  1K6R A;  2X71 A;  3W4Q A;  3A3D A;  2J9O A;  3N8L A;  2WZX A;  3NIA A;  4R1G A;  2HP9 A;  1O07 A;  4OPR A;  1H8Y A;  4WYY A;  3ISG A;  5DF8 A;  4RVA A;  1XX2 A;  4MLL A;  1FR1 A;  1IYP A;  1ES2 A;  2HP6 A;  2Y2I A;  5FQM A;  2ZQD A;  4KQO A;  3JYI A;  1KGF A;  4EBP A;  3G2Z A;  4X6T A;  3NCK A;  4B4Z A;  3IH8 A;  2FFY A;  3G35 A;  4UA7 A;  4N1H A;  3V3R A;  3M2K A;  2XD1 A;  1K56 D;  3EQU A;  5EVL A;  3DWK A;  3MXR A;  2Y2Q A;  4E3N A;  3WS0 A;  4DE1 A;  1KE3 A;  4OPQ A;  3W8K A;  1YLP A;  2WKI A;  3ZFZ A;  4E3K A;  1FSY A;  4JXW A;  4U0X A;  2E8I A;  4OQH A;  5IHV A;  4KZB A;  3HUN A;  1GHM A;  4CJN A;  5A90 A;  3Q1F A;  4EWF A;  3TSG A;  3C4O A;  1HTZ A;  5BOH A;  1K4F A;  4BJP A;  1MWU A;  2XF3 A;  5FDH A;  2OLV A;  5DTT A;  3DWZ A;  1S6R A;  2G2U A;  2QMI A;  4WM9 A;  5EVI B;  3WS1 A;  2ZC6 B;  2J7V A;  1Q2P A;  3SS3 A;  1K57 A;  5AQA A;  4DF6 A;  4S2M A;  4Y7P A;  4A5R A;  5HW3 A;  5AQ7 A;  4QHC A;  1W7F A;  5F83 A;  3Q07 A;  4QY6 A;  1LI0 A;  4PM7 A;  3MZD A;  4XUX A;  3BFF A;  1WYB A;  2XR0 A;  5M19 A;  1KVM A;  1YLY A;  3P09 A;  1NZU A;  3S22 A;  2WAE A;  3BFE A;  4KZ3 A;  5CER A;  4C6Y A;  1PWD A;  4HBU A;  2P9V A;  2Z2L B;  4LCL A;  3BRM A;  2ZM2 A;  3FZC A;  3UDX A;  4EBL A;  3FKW A;  1BSG A;  1NY0 A;  4JLF A;  5U47 A;  3UN7 A;  1SHV A;  2CC1 A;  4KEN B;  5FAP A;  5JYO A;  3FWL A;  4GDB A;  5CHM A;  4Y0T A;  5CGS A;  4X55 A;  2WGW B;  3A3I A;  4WMC D;  4ZAM A;  2OSU A;  4UHU A;  3HLG A;  3PBT A;  4WZ5 A;  5E2F A;  3E2L A;  5GLB A;  3B3X A;  3UO9 A;  4FH2 A;  3ZCZ A;  4N9L A;  3MKE A;  4X68 A;  3G30 A;  4N9K A;  2IWC A;  3UDI A;  1IEL A;  3ZG7 B;  1BLS A;  1IYQ A;  1ALQ A;  3OCL A;  3W4O A;  4BLM A;  4JF6 A;  4UAA A;  1PW8 A;  1G68 A;  3QNB A;  3IWI A;  3FKV A;  5HL1 A;  1KGE A;  3SS5 A;  1JWZ A;  3OZH A;  5FQQ A;  2I72 A;  4X53 A;  3BM6 A;  4R3B A;  3BEC A;  3A3F A;  3BFC A;  2BG1 A;  4EUZ A;  1K56 A;  3RJU A;  4RYE A;  3A3E A;  4KG2 A;  3O87 A;  3OPP A;  1M40 A;  1XPB A;  3V50 A;  1GA9 A;  3IF6 C;  4BL2 A;  1U60 A;  3NDE A;  4PM6 A;  4Z9Q A;  5FI6 A;  1XKZ A;  2ZC4 B;  2IWB A;  3QNC A;  3IT9 A;  4GD8 A;  4JXG A;  5FI7 A;  4M3K A;  1PZO A;  2C6W B;  2FFF B;  2ZQA A;  2EX6 A;  4IBX A;  4P85 A;  3MKF A;  1FCM A;  5FQK A;  4RA7 A;  3SH9 A;  4ZJ2 A;  3WS4 A;  3G4P A;  2Y2K A;  3VFF A;  5HAR A;  2Y2G A;  2ZLY A;  3M2J A;  1RP5 A;  5E2H A;  3N8R A;  4E3J A;  3M6B A;  4ZJ1 A;  5EEC A;  3QHY A;  1JWV A;  1VQQ A;  1Z6F A;  1K54 A;  4HES A;  1GHP A;  2P74 A;  1BZA A;  2DCF A;  2HP5 A;  2RL3 A;  5GLA A;  1AXB A;  4OPZ A;  4S2K A;  3IXH A;  3HLF A;  5HAQ A;  3FV7 A;  4GZB A;  1LHY A;  5GLD A;  3TOI A;  1DY6 A;  3HUO A;  4GNU A;  3AGE A;  4FSF A;  5CEB A;  1MXO A;  5EUA A;  1YMX A;  4H8R A;  4EBN A;  1N4O A;  1FOF A;  2DRW A;  4R4R A;  1YLT A;  5FAO A;  2Y2M A;  1IYS A;  4PM9 A;  2WYX A;  2EXA A;  5FSR A;  2WGI A;  4WMC A;  3VOY A;  5M18 A;  3MBZ A;  5KZH A;  5FAS A;  4MEZ A;  5FI2 A;  3GRJ A;  1FCO A;  1NXY A;  2ZJ9 A;  4OOM A;  4WZ5 C;  2P9V B;  4F94 A;  3IF6 A;  1L0F A;  2HDR A;  3VP3 A;  1KVL A;  4ZTK A;  1SCW A;  4ID4 A;  3V39 A;  2PBY A;  2PU2 A;  1PI4 A;  4HBT A;  4BD0 A;  3NBL A;  2ZQ9 A;  2XDM A;  4O7D A;  2ZM0 A;  3ZDJ A;  3UE1 A;  4IBR A;  4IED A;  5HX9 A;  3UE3 A;  4LV3 A;  2H0T A;  2ZMA A;  3PBN A;  4U3T A;  4RX3 A;  1YM1 A;  3IH9 A;  4LCM A;  2XEP A;  1HZO A;  4JBF A;  1GA0 A;  4S2O A;  2RCX A;  4GKU A;  5FQJ A;  3UPN A;  2H0Y A;  2ZD8 A;  4BEN A;  4DE0 A;  3GVB A;  5TFQ A;  4P87 A;  3ZG8 B;  2WKH A;  3VP1 A;  2WK0 A;  1KE0 A;  3GMW A;  1KE4 A;  2XK1 A;  2UWX A;  3NY4 A;  5DF7 A;  1YLJ A;  1W5D A;  1M6K A;  3BYD A;  4KZ5 A;  2Q9N A;  1E3U D;  4S2L A;  5CEC A;  1NJ4 A;  5D3O A;  1LL5 A;  1PZP A;  4GN2 A;  3MXS A;  5E2E A;  1DJA A;  2EX2 A;  3V5M A;  2H10 A;  2VGK A;  4DRT A;  5KMW A;  1K55 C;  2IWD A;  3PBQ A;  5F1G A;  1ERM A;  2Z2M B;  4E3L A;  5I94 A;  1ZC2 A;  4NK3 A;  1G6A A;  5KSH A;  3DTM A;  4BD1 A;  4QU3 A;  2BLS A;  4N92 A;  3VOZ A;  2ZM8 A;  1DJC A;  3GTC A;  3IXD A;  2A49 A;  3AGF A;  4MNR A;  1ONG A;  5CGW A;  4PM5 A;  4OPY A;  5EPH A;  2ZC5 B;  1PW1 A;  4GB7 A;  3Q7Z A;  3ZVW A;  4DXC A;  3CG5 A;  1FQG A;  4WBG A;  3OPH A;  1EWZ A;  4DKI A; 
#chains in the Genus database with same CATH topology
 1K54 C;  3PBO A;  2WZZ A;  5AVE A;  3UB7 A;  1P97 A;  1EW0 A;  4YWZ A;  2H5S A;  3RXW A;  5TR7 A;  2QJ5 A;  2PAV P;  5MC7 A;  1PI5 A;  1XGJ A;  4BBV A;  3G2Y A;  2J9P A;  1DJB A;  1D1J A;  3C7U A;  1H5X A;  5CTN A;  1NZO A;  1L0E A;  2P04 A;  3RXX A;  1WE4 A;  4C3Q A;  1D06 A;  4IVI A;  4PM8 A;  4MBK A;  3HLD A;  4X56 A;  3T4Q A;  5EOE A;  1YAX A;  2VJW A;  3MF0 A;  1TS7 A;  2L1M A;  4WEL A;  3H9W A;  4UEY A;  1K25 A;  1DP9 A;  3OC2 A;  1I2S A;  4BQM A;  3CPT B;  3BLM A;  1BUL A;  3SZT A;  1NLY A;  2Y2L A;  1CI9 A;  3LY4 A;  4ETZ A;  4K08 A;  4MBH A;  5DJT A;  3ZQ5 A;  4Y0U A;  2XA7 S;  1O7E A;  1HVB A;  1ES4 A;  4GS9 A;  3A3J A;  4UA6 A;  3IWO A;  3ZVT A;  1IKI A;  2WGV A;  2WUQ A;  1MY8 A;  2HDU A;  5A91 A;  5EVI D;  5EM1 A;  1JTD A;  2VLG A;  4GCZ A;  5DF9 A;  4X1L A;  3UB6 A;  2O9B A;  3GV9 A;  4ESP A;  3EEA A;  4KZ9 A;  1J9M A;  2ZC3 B;  4P6Z S;  4S2N C;  1W63 M;  4QB8 A;  4XUZ A;  1C3B A;  2G2W A;  2QZ6 A;  1Y54 A;  4B4X A;  1ZKJ A;  5EVI C;  3P01 A;  1JTG A;  2ZQC A;  2X01 A;  3RFB A;  4JGQ A;  4XXR A;  4S2P A;  4DDY A;  3V67 A;  2PHY A;  4L0L A;  1FCN A;  4HJ3 A;  4HY8 A;  3NOU C;  5GHY A;  1LL9 A;  1MKM A;  3E0Y A;  2XGN A;  3K3D A;  3HLB A;  4Y3I A;  3N6I A;  1ESU A;  3C4P A;  3IF5 A;  3BFG A;  4LEN A;  2C5W B;  1MC0 A;  3N7W A;  2HJ9 C;  5JYP A;  1L0G A;  2XA7 M;  2Y2J A;  1V9Z A;  4JF4 A;  3F1O A;  4MN6 A;  4WUJ A;  2K31 A;  3KSG A;  2ZOH A;  1KGG A;  3FYZ A;  3IX8 A;  3LY3 A;  4ZBE A;  2XFS A;  2L0W A;  1XA1 A;  1OTA A;  3CMZ A;  2WAD A;  5A92 A;  4WL9 A;  2EFX A;  3IXB A;  2Y2H A;  1S4R A;  3SOI A;  4C75 A;  4DJ2 A;  3VP2 A;  4HIA A;  3TG9 A;  4I3I A;  3O88 A;  1AWI A;  4QJG A;  2PDR A;  3H82 B;  3ZG5 A;  1JWP A;  4P6Z M;  4FUW A;  5HD3 A;  1SDE A;  4DDS A;  5TBM A;  3PTE A;  1F9I A;  2WKQ A;  3LR0 A;  5F68 A;  3NC8 A;  1DP8 A;  1KOU A;  4E3M A;  3LIA A;  4KQR A;  4P0M A;  3NOT C;  3TRC A;  3HRE A;  4OLD A;  3MZE A;  2Y2O A;  4MN5 A;  1TDL A;  3E4O A;  3T4O A;  3KSH A;  1YPR A;  4O0P A;  1RGZ A;  2JE5 A;  1UGU A;  3T50 A;  2JC7 A;  4KZ6 A;  3KYE A;  2JKT M;  1S1Y A;  4ARZ B;  2EFU A;  2YKF A;  2OWJ A;  4IUH A;  3NIA A;  2WZX A;  1O07 A;  3T12 B;  4RVA A;  3VV4 A;  1ES2 A;  5FQM A;  4I3J A;  3JYI A;  4EBP A;  3G2Z A;  4X6T A;  3NCK A;  4B4Z A;  4UA7 A;  3M2K A;  3BWL A;  3DWK A;  3MXR A;  4NKP A;  4DMZ A;  1CF0 A;  4E3K A;  1GHM A;  3C4O A;  2R78 A;  1MWU A;  3PR6 A;  1S6R A;  1Q2P A;  4Y7P A;  4QY6 A;  3MZD A;  3BFF A;  1WYB A;  1XJ6 A;  1YLY A;  3P09 A;  4HOI A;  2P9V A;  2Z2L B;  5L09 A;  2O9C A;  3S7P A;  3FKW A;  1PRQ A;  4GW9 A;  2CMN A;  3QP8 A;  5DFY A;  4Y0T A;  2OSU A;  1F5M A;  3G6O A;  4WZ5 A;  3MQ0 A;  5C5K A;  3E2L A;  3UO9 A;  4FH2 A;  3ZCZ A;  4X68 A;  4ZRR A;  2G7U A;  3UDI A;  3MJQ A;  3OCL A;  3LR4 A;  1NWZ A;  4UAA A;  1PW8 A;  1G68 A;  3QNB A;  3SS5 A;  5FQQ A;  1D7E A;  1VB6 A;  3BEC A;  2B02 A;  3T4S A;  3ZYT A;  2BG1 A;  1K56 A;  4RYE A;  3OPP A;  4O01 A;  3V50 A;  1OTB A;  4BL2 A;  3NDE A;  2IWB A;  2Z6D A;  3IT9 A;  4GD8 A;  5FI7 A;  2UV0 E;  4HI4 A;  1FCM A;  3G4P A;  2Y2K A;  3E4Q A;  3CUE A;  5HAR A;  2AVX A;  5J3W A;  4DN0 A;  1IFQ A;  3VOL A;  4ZJ1 A;  1LT0 A;  5CX7 A;  2FZ0 A;  1Z6F A;  1LSW A;  1AXB A;  2IA2 A;  4B93 A;  3HUO A;  4FTX A;  1PNE A;  3AGE A;  1UWN X;  5EUA A;  1YMX A;  2K7S A;  3HJK A;  1N4O A;  1FOF A;  5FAO A;  3BQ8 A;  1IYS A;  3DAV A;  4LRZ E;  4WMC A;  4MEZ A;  2QWS A;  1NXY A;  3CPT A;  1L0F A;  2HDR A;  2ZOI A;  4ZTK A;  1PI4 A;  2YKH A;  3ZDJ A;  5HX9 A;  4R3A A;  3PBN A;  1ZHH B;  2O99 A;  2W3H A;  4RX3 A;  5DFX A;  1YM1 A;  4LCM A;  5FQJ A;  4JBF A;  2RCX A;  3IX3 A;  5HL6 A;  4L9F A;  2WKH A;  4QPR A;  1KE0 A;  3NJA A;  5DJU A;  4S2L A;  2BAS A;  1LL8 A;  1LL5 A;  3MXS A;  5TBM B;  2IWD A;  5F1G A;  1ERM A;  1ZC2 A;  3UB5 P;  1DP6 A;  3RTY A;  3DTM A;  3VOZ A;  2ZM8 A;  1DJC A;  3AGF A;  3K2N A;  4MNR A;  1H3Q A;  5EPH A;  5EV0 A;  1PW1 A;  1FQG A;  1STZ A;  5CED A;  2JKR I;  5E43 A;  3GSG A;  3OPR A;  1BLC A;  3GR2 A;  1NYY A;  2Y4A A;  3W4P A;  5CGX A;  3DW0 A;  4WN5 A;  3ZNY A;  4KG5 A;  3D4F A;  3WWX A;  5HZH A;  2HDS A;  4KUO A;  3V3S A;  4BBT A;  4R3J A;  2V8F A;  4DJ3 A;  5CHU A;  2Z6C A;  4X69 A;  1BYW A;  3ITB A;  2H28 A;  1K6S A;  2KX6 A;  1XGI A;  1K38 A;  2HV1 A;  3LID A;  5KIZ A;  3UE0 A;  4OQG A;  3LO7 A;  2QPN A;  4FH4 A;  5HDS A;  1YLW A;  1H8M A;  3H7W B;  4NXG A;  3H82 A;  4FCF A;  4NET A;  2LB9 A;  1W79 A;  1ES3 A;  3EGX C;  3QP6 A;  4MBF A;  4XT2 B;  1XXM A;  2JN7 A;  3SS4 A;  4CLC B;  1K4E A;  1P9W A;  3GQZ A;  3B42 A;  1MKI A;  3P98 A;  1ONH A;  4LV1 A;  4QY5 A;  2PU4 A;  5J8X A;  4L9G A;  4OP5 A;  4K0X A;  2XRN A;  4LRY C;  2A24 B;  2JKT I;  2R9W A;  1PWG A;  1LLB A;  2GZA A;  5F5Y A;  4OH0 A;  2M7U A;  1CEG A;  1MWT A;  1ZG6 A;  1FSW A;  5E2G A;  3KSF A;  4ARZ A;  2HDQ A;  4Y0O A;  2O0Y A;  2W1T B;  4U0T A;  4GDN A;  2V0W A;  1LSV A;  3SH8 A;  5GHZ A;  1YKD A;  5EE8 A;  2R9X A;  4GHI B;  4ZJ3 A;  1FR6 A;  2Y2N A;  1RGY A;  3PXP A;  4D60 A;  4D2O A;  1SKF A;  3WRZ A;  1VEU B;  1FIK A;  5HFO A;  2VGJ A;  2W1R A;  4IHQ A;  2OOL A;  4KZ4 A;  3VP0 A;  2Q9M A;  4EER A;  1F2K A;  4JKT A;  3SH7 A;  3HLW A;  3TE8 A;  1ES5 A;  3GDI A;  4B88 A;  5CHJ A;  3MZF A;  1TEM A;  4JGO A;  3TJZ C;  3VFH A;  3ZG9 B;  1XA7 A;  4OQ0 A;  3QP1 A;  4GD6 A;  2J80 A;  2KDK A;  5GLC A;  4NG2 A;  1YSQ A;  2PRF A;  2OV5 A;  1QMF A;  3HLE A;  4X1M A;  5FQ9 A;  2WKR A;  3U4L P;  3UDF A;  3BLS A;  3HL9 A;  5FAT A;  1OME A;  1BT5 A;  4WLA A;  2VGL S;  5FDS A;  3IS2 B;  3HBR A;  2W3E A;  2ZC7 A;  3G31 A;  2M1C A;  3KYZ A;  1OTD A;  1W8Q A;  5HWV A;  1TS0 A;  5CRF A;  5M1A A;  2B18 A;  5DVA A;  5G18 A;  3LEZ A;  3S1Y A;  2NUP C;  1JVJ A;  4OON A;  5F6A A;  3A3D A;  3T4T A;  2QJ7 A;  3LIC A;  5DF8 A;  1FR1 A;  4JGP A;  4M4X A;  2ZQD A;  4HJ4 A;  1KGF A;  5DKL A;  2FFY A;  2XD1 A;  1K56 D;  1HLU P;  4JGR A;  5AJG A;  2Y2Q A;  1TS6 A;  4BWI A;  1KE3 A;  3NOP C;  4OPQ A;  1VET B;  3W8K A;  2VV6 A;  3Q1F A;  4EWF A;  3TSG A;  1HTZ A;  1K4F A;  2JKR M;  5DTT A;  3DWZ A;  2VGL M;  3CWF A;  2G2U A;  2QMI A;  4II7 A;  1GSW A;  2ZC6 B;  1F98 A;  2A2L A;  5HW3 A;  5AQ7 A;  3BW6 A;  5F83 A;  3Q07 A;  1LI0 A;  4PM7 A;  3S7O A;  2XR0 A;  3S22 A;  5CER A;  4C6Y A;  1PWD A;  2HJE A;  4LCL A;  1OT6 A;  3T1S A;  1G28 A;  1NY0 A;  1SHV A;  4KEN B;  5FAP A;  4GDB A;  5CGS A;  4X55 A;  1OJG A;  2WGW B;  4WMC D;  4UHU A;  5E2F A;  3B3X A;  3NUL A;  3MKE A;  3G30 A;  5HSQ A;  1BLS A;  1IYQ A;  3IX4 A;  3W4O A;  4JF6 A;  1TF1 A;  4G3V A;  3IWI A;  3FKV A;  5HL1 A;  3OZH A;  2VX8 A;  3BFC A;  4IJG A;  2EWW A;  3RJU A;  2VK3 A;  1X0O A;  3CIT A;  2QYB A;  3T4L A;  1XKZ A;  3UME A;  4M3K A;  2C6W B;  2FFF B;  2ZQA A;  2EX6 A;  4IBX A;  5FQK A;  3SH9 A;  3WS4 A;  2OWH A;  3M2J A;  3N8R A;  3D9Y A;  3E98 A;  5EEC A;  3QHY A;  1JWV A;  1VQQ A;  2PBD P;  5TJJ A;  1K54 A;  4HES A;  1GHP A;  1L3L A;  3C8C A;  1ZTU A;  2HP5 A;  2RL3 A;  4OPZ A;  4S2K A;  3W2Z A;  1DY6 A;  1MXO A;  3MQO A;  4H8R A;  4EBN A;  2DRW A;  1GSV A;  3MR0 A;  2JHE A;  4PM9 A;  3EEH A;  3VOY A;  3MBZ A;  5KZH A;  3O5Y A;  2ZJ9 A;  4F94 A;  2J3T D;  4LPZ A;  3LYX A;  4H6J B;  3V39 A;  3F1P A;  4GLQ A;  4BD0 A;  4HBT A;  3NBL A;  4Y5F A;  4ME4 A;  2XDM A;  3T4J A;  2W0N A;  3UE3 A;  4LV3 A;  2H0T A;  4U3T A;  1J3W A;  1XFN A;  3H7W A;  3ICY A;  3IH9 A;  1HZO A;  2GX5 A;  4GKU A;  2H0Y A;  2ZD8 A;  4Q0H A;  5TFQ A;  5EVE A;  1KE4 A;  4XT2 A;  4CQH A;  2J3T C;  3LFV A;  1W5D A;  2VA0 A;  1CQA A;  4MMN A;  5CEC A;  5D3O A;  4CLC A;  1PZP A;  5E2E A;  1OTE A;  1DJA A;  2EX2 A;  3V5M A;  2Z2M B;  4E3L A;  5I94 A;  5G4Z A;  5KSH A;  2V9A A;  2Y8H A;  2A24 A;  4PM5 A;  5CGW A;  3CAX A;  3U2A A;  3A0S A;  5HPI A;  4DXC A;  4WBG A;  3HJI A;  1EWZ A;  5L10 A;  1VM1 A;  3C7V A;  4PPR A;  1OJ5 A;  2W3G A;  3NI9 A;  2W1T A;  1PFL A;  3JPU A;  2D02 A;  3T4K A;  3BFD A;  4DXB A;  3UMD A;  2V2F F;  4EXO A;  4GHI A;  1CK3 A;  3QP4 A;  3LCE A;  5F1F A;  4R0Q A;  4S2J A;  5FL3 A;  4JXV A;  1K55 A;  3D72 A;  1VEU A;  4Q8I A;  3FG8 A;  4DE2 A;  1TS8 A;  1PYY A;  3KYQ A;  1G6O A;  1GSX A;  3OOV A;  3IF6 B;  2JKG A;  3M6H A;  2GDN A;  4EET B;  1KDS A;  1OTI A;  3MS6 A;  1IKG A;  4JXS A;  1N9B A;  4G3K A;  4QD4 A;  4HNB A;  3GEC A;  2I9V A;  3IXG A;  5EOO A;  1Y4O A;  3MQQ A;  1OT9 A;  4E3I A;  2M7V A;  1MPL A;  4PHT A;  3LEQ A;  4P6B A;  2PYP A;  1EI5 A;  3B47 A;  4I39 A;  5K5B A;  3UY6 A;  3IS2 A;  1T1B A;  4WEK A;  3UPP A;  3VSL A;  3ZNT A;  4F3L B;  3OBF A;  1S4S A;  2INW A;  4BMW A;  2PR5 A;  3PAE A;  2W3D A;  4N1X A;  5FAQ A;  5CXW A;  3QP2 A;  3WS5 A;  1MWS A;  4K91 A;  2XRO A;  4OOY A;  1YT4 A;  2V1Z A;  5HAP A;  3EQV A;  3MFD A;  1T1C A;  1BLP A;  2E8J A;  3PAG A;  4KZ8 A;  4Y2F A;  3C30 A;  1H8Z A;  4I5S A;  1XP4 A;  1Q2Q A;  1VET A;  2DNS A;  2V1B A;  4JF5 A;  3VMA A;  3PBR A;  2XQZ A;  1YLZ A;  2Y2P A;  5TGF A;  1GCE A;  3UNW A;  2OAP 1;  4FOF A;  4UQI M;  4YIN A;  2Y91 A;  4R4S A;  5L2F A;  2VKS A;  3K3C A;  3E4P A;  3HUM A;  4E6W A;  2OAQ 1;  5DTS A;  4L9E A;  2A3U A;  5EFW A;  2VEA A;  3OLO A;  4DE3 A;  4WEJ A;  1DRM A;  3IQA A;  2ZMF A;  2Y55 A;  3VP4 A;  5I5L A;  3C5A A;  1LSX A;  3ZGA B;  4B9O A;  3ITA A;  3MMH A;  2WGW A;  4EEP A;  3F1P B;  5HWW A;  4HP9 A;  2EX8 A;  1S0W A;  2GJ3 A;  1L0D A;  2EX9 A;  2VZW A;  1PIO A;  4LV2 A;  4OQI A;  1E25 A;  2PYR A;  3Q81 A;  1TD5 A;  4OKP A;  3PBS A;  5LBR A;  1BTL A;  2ZQ8 A;  4ETX A;  2WKE A;  1I5Q A;  3IHB A;  1I2W A;  3EWK A;  4E6X A;  3W4Q A;  4Q0J A;  2J9O A;  1WA9 A;  4R1G A;  2HP9 A;  4WYY A;  4HP4 A;  3ISG A;  1XX2 A;  4MLL A;  1IYP A;  4KQO A;  3G35 A;  3V3R A;  3JVU A;  5EVL A;  4PKY G;  1SKO B;  4DE1 A;  2ZBB A;  1YLP A;  2HZ5 A;  3R7W B;  4JXW A;  4U0X A;  5A90 A;  2EWV A;  4HJ6 A;  4MDZ A;  5BOH A;  2OLV A;  5EVI B;  1N9O A;  1K57 A;  2J3W A;  5AQA A;  4A5R A;  1W7F A;  2KLI A;  5M19 A;  1NZU A;  4KZ3 A;  2ZM2 A;  3UDX A;  4H6J A;  5U47 A;  2CC1 A;  4YOF A;  2VV8 A;  3A3I A;  4ZAM A;  3HLG A;  1JNU A;  2ZMV A;  5L07 A;  3FPW A;  2HF6 A;  3MSH A;  4N9L A;  3BY9 A;  4N9K A;  3C38 A;  1IEL A;  3BJN A;  4LRX C;  2XSS A;  1KGE A;  3IBR A;  2ZL1 B;  2I72 A;  3BM6 A;  3UB9 A;  4EEU A;  3FC7 A;  1ACF A;  4EUZ A;  4KG2 A;  5L8M A;  5IU1 A;  5HD5 A;  5A8B A;  4Z9Q A;  5FI6 A;  2JKF A;  4CLC D;  5IS1 A;  4P85 A;  3MKF A;  4RA7 A;  2B95 A;  5J4E A;  3F1N B;  2ZLY A;  4E3J A;  4KUK A;  2DCF A;  5GLA A;  4Q0I A;  3IXH A;  3CLO A;  3HLF A;  5HAQ A;  4PKY A;  3FV7 A;  4GZB A;  1LHY A;  4GNU A;  4CLC C;  5CEB A;  1T18 A;  2WYX A;  4EUV A;  5FAS A;  5FI2 A;  4WZ5 C;  2EA9 A;  2K2N A;  3JVV A;  3IF6 A;  3D3O A;  3SW1 A;  1SCW A;  4G3W A;  2PBY A;  2ZM0 A;  5EM0 A;  3UE1 A;  4IBR A;  4IED A;  2ZMA A;  4Y17 A;  4S2O A;  1GA0 A;  1W63 Q;  4P87 A;  3ZG8 B;  3VP1 A;  3EOI A;  3GMW A;  2XK1 A;  3NY4 A;  3S7Q A;  5DF7 A;  1YLJ A;  3A0V A;  3BY8 A;  4KZ5 A;  3LR3 A;  3UE6 A;  1NJ4 A;  1ODV A;  3KSI A;  4GN2 A;  5AVF A;  2H10 A;  2VGK A;  4DRT A;  5KMW A;  1K55 C;  3PBQ A;  4NK3 A;  3LGO A;  1G6A A;  4EQ1 A;  4BD1 A;  2BLS A;  3IXD A;  4F3L A;  2A49 A;  3CUE C;  3PYP A;  1NLZ A;  4GB7 A;  3ZVW A;  4R6L A;  5HDD A;  4EQI A;  1BUE A;  4HHD A;  3LIB A;  4KQD A;  4AFI A;  3HLC A;  1VHM A;  4OLG A;  4KG6 A;  4OOL A;  1N9N A;  1IEM A;  2OLU A;  4FD8 A;  4IVK A;  3S4X A;  2EXB A;  5HDC A;  2XD5 A;  4R38 A;  1BLH A;  2NUT C;  1HD8 A;  3CJM A;  4UA9 A;  1SDN A;  3IHA A;  5GHX A;  2WKP A;  1NRF A;  1GHI A;  3ZHH A;  1Z09 A;  5FEF A;  2QKP A;  3E2K A;  4E04 A;  2QHK A;  1SZV A;  2DMW A;  3WRT A;  4EU0 A;  2XH9 A;  2V0U A;  1ERQ A;  4BBU A;  5HAI A;  4LFU A;  1S67 L;  3LUQ A;  1E3U A;  2HPB A;  2W27 A;  3CZD A;  4NXE A;  5DKK A;  3AGD A;  1ESI A;  2JBF A;  3O86 A;  4JPM A;  1K0K A;  3HVF A;  4OVD A;  3CHW P;  5FA7 A;  1MBL A;  3L7H A;  4KZA A;  2PD7 A;  3G32 A;  4NEE D;  4ZDX A;  3Q7V B;  1ERO A;  2P08 A;  5KSC A;  1TDG A;  3WS2 A;  4E3O A;  1NYM A;  5CTM A;  4O8G A;  3NEC A;  3O3V A;  3Q82 A;  4PMA A;  1IYO A;  4EV4 A;  4K0W A;  4NXF A;  3I7J A;  1PWC A;  4WZ4 A;  3DBA A;  1WYC A;  4I3A A;  3N8S A;  3EGD C;  3ZG0 A;  3VE4 A;  3UPO A;  2WAF A;  4EES A;  2XFT A;  5F82 A;  3NDG A;  2X02 A;  5DTK A;  5AQB A;  3KO6 A;  3T1Q B;  5A93 A;  1SKO A;  1CI8 A;  4HH3 A;  3R7W A;  1E4D A;  4RX2 A;  3OCN A;  4S2N A;  2JCH A;  1S1Z A;  2XLN A;  1L2S A;  3N4I A;  1G5U A;  2J8Y A;  4LV0 A;  3G34 A;  1YQS A;  3NHQ A;  5EVI A;  4GOG A;  5GL9 A;  2ZQ7 A;  1MWR A;  4OP8 A;  3PHY A;  4KQQ A;  4YNR A;  4GS9 B;  4HEF A;  1Y28 A;  5HPF A;  4PAU A;  3IWQ A;  3MFX A;  1QME A;  3FPV A;  2ACG A;  4MCW A;  3DTK A;  3BEB A;  3DTI A;  1CEF A;  1KDW A;  1TVF A;  2Y59 A;  4RQ9 A;  1ZG4 A;  1IOU A;  2B5R A;  4CPK A;  4BL3 A;  1LI9 A;  4GJ4 A;  3VSK A;  3OPL A;  1T1A A;  4R23 A;  4S2I A;  4KZ7 A;  4YFM A;  2V20 A;  1K57 C;  2ZL1 A;  4R70 A;  5AQ9 A;  1RCJ A;  5FQI A;  1YMS A;  4X25 A;  3HCY A;  1W8Y A;  3TW8 A;  1K6R A;  1V9Y A;  2X71 A;  3N8L A;  2D01 A;  4UQI S;  5G4Y A;  4OPR A;  1H8Y A;  3LIE A;  3T1R A;  2HP6 A;  3MXQ A;  2Y2I A;  2HGV A;  3BQA A;  3LR5 A;  3IH8 A;  4N1H A;  3F1N A;  4HH2 A;  3F1O B;  3EQU A;  3ULF A;  4E3N A;  3WS0 A;  2W3F A;  2WKI A;  3ZFZ A;  1FSY A;  2E8I A;  4OQH A;  5IHV A;  4KZB A;  3HUN A;  4CJN A;  3CI6 A;  3S7N A;  4BJP A;  4WF0 A;  5FDH A;  2XF3 A;  4WM9 A;  1H0M A;  3WS1 A;  2J7V A;  3SS3 A;  4DF6 A;  1S66 L;  4S2M A;  4QHC A;  3L9K A;  4XUX A;  1KVM A;  3R4K A;  2WAE A;  3BFE A;  4HBU A;  3BRM A;  2GNX A;  3FZC A;  4EBL A;  2L4R A;  1BSG A;  4JLF A;  2Q0O A;  3DTE A;  3UN7 A;  5JYO A;  3FWL A;  5CHM A;  2PR6 A;  1XJ4 A;  1CJF A;  5F69 A;  3P7N A;  3PBT A;  2P7J A;  5GLB A;  4CLC E;  2V1A A;  2IWC A;  3T1X A;  3ZG7 B;  1ALQ A;  4BLM A;  1A0K A;  3VE3 A;  1JWZ A;  4MN7 A;  4X53 A;  4Y13 A;  4R3B A;  3UB8 A;  3A3F A;  3A3E A;  3O87 A;  1M40 A;  1XPB A;  1XFQ A;  2V8C A;  1GA9 A;  3IF6 C;  2VV7 A;  1U60 A;  4PM6 A;  3IBJ A;  2ZC4 B;  1YSP A;  3C2W A;  3QNC A;  4JXG A;  1NRJ A;  1PZO A;  5FEG A;  2MJ6 A;  4ZJ2 A;  2PD8 A;  3VFF A;  3LI9 A;  2Y2G A;  5E2H A;  1RP5 A;  2O9A A;  3M6B A;  1P0Z A;  4QWO A;  2PT7 A;  3QP5 A;  1N9L A;  1FIL A;  2P74 A;  1BZA A;  4Z1W A;  3A0R A;  4EW7 A;  5GLD A;  1XJ2 A;  3TOI A;  3LI8 A;  4FSF A;  3RH8 B;  4I38 A;  4R4R A;  1YLT A;  4NXB A;  2Y2M A;  2EXA A;  5FSR A;  2WGI A;  1MZU A;  5M18 A;  1OPX A;  3GRJ A;  1FCO A;  4OOM A;  2P9V B;  1XJ3 A;  3VP3 A;  1P9R A;  1KVL A;  3KX0 X;  2Y79 A;  3B33 A;  4ID4 A;  4LLO B;  2PU2 A;  2BTF P;  2ZQ9 A;  4O7D A;  4HQA A;  2LB5 A;  2XEP A;  3UPN A;  4BEN A;  4DE0 A;  3GVB A;  1UWP X;  2WK0 A;  1T19 A;  2UWX A;  1M6K A;  3BYD A;  2Q9N A;  1E3U D;  5J7E A;  4Y15 A;  4LGW A;  4IUK A;  5HWT A;  2KOI A;  2FH5 A;  4QU3 A;  4N92 A;  3GTC A;  1ONG A;  5IT5 A;  4OPY A;  3LIF A;  2ZC5 B;  3Q7Z A;  3CG5 A;  3OPH A;  3Q7V A;  4DKI A; 
#chains in the Genus database with same CATH homology
 1VM1 A;  1K54 C;  3PBO A;  5CED A;  3C7V A;  2WZZ A;  4PPR A;  5E43 A;  4EQI A;  3GSG A;  3OPR A;  1BUE A;  1BLC A;  2H5S A;  3GR2 A;  3RXW A;  3NI9 A;  1NYY A;  2Y4A A;  3W4P A;  5TR7 A;  5CGX A;  3DW0 A;  3BFD A;  3HLC A;  4DXB A;  1PI5 A;  2V2F F;  1XGJ A;  3ZNY A;  3G2Y A;  2J9P A;  1DJB A;  4KG5 A;  3C7U A;  4OLG A;  4KG6 A;  3D4F A;  4OOL A;  1CK3 A;  1IEM A;  2OLU A;  4FD8 A;  1H5X A;  5CTN A;  1NZO A;  3WWX A;  1L0E A;  4IVK A;  3LCE A;  3S4X A;  5F1F A;  3RXX A;  2EXB A;  2XD5 A;  2HDS A;  1WE4 A;  4R0Q A;  4C3Q A;  4S2J A;  4IVI A;  3V3S A;  4PM8 A;  1BLH A;  4R3J A;  1HD8 A;  4MBK A;  3CJM A;  3HLD A;  4JXV A;  4X56 A;  4UA9 A;  5CHU A;  1SDN A;  1K55 A;  3IHA A;  4X69 A;  5GHX A;  1NRF A;  5EOE A;  1GHI A;  3ZHH A;  4Q8I A;  3ITB A;  4DE2 A;  4WEL A;  3E2K A;  1K25 A;  1PYY A;  1K6S A;  3OC2 A;  1I2S A;  4BQM A;  3BLM A;  1XGI A;  3IF6 B;  1BUL A;  3WRT A;  3M6H A;  2GDN A;  1KDS A;  1K38 A;  2XH9 A;  2Y2L A;  1ERQ A;  1IKG A;  4JXS A;  1CI9 A;  1N9B A;  3LY4 A;  4QD4 A;  5HAI A;  4MBH A;  3UE0 A;  4OQG A;  3LO7 A;  1E3U A;  3IXG A;  2QPN A;  4FH4 A;  5EOO A;  2HPB A;  1YLW A;  3CZD A;  4Y0U A;  1O7E A;  3AGD A;  1ESI A;  4FCF A;  4NET A;  1W79 A;  1HVB A;  2JBF A;  1ES3 A;  1ES4 A;  3A3J A;  4UA6 A;  3IWO A;  3ZVT A;  4E3I A;  3O86 A;  4MBF A;  1IKI A;  4JPM A;  2WGV A;  1XXM A;  2WUQ A;  1MPL A;  1MY8 A;  2HDU A;  5A91 A;  4P6B A;  3HVF A;  4OVD A;  5EVI D;  3SS4 A;  5FA7 A;  1JTD A;  1K4E A;  1MBL A;  3GQZ A;  1EI5 A;  4KZA A;  1MKI A;  3P98 A;  5DF9 A;  1ONH A;  4LV1 A;  4QY5 A;  2PU4 A;  5J8X A;  3UY6 A;  4OP5 A;  3G32 A;  4K0X A;  4WEK A;  3UPP A;  3VSL A;  3GV9 A;  2R9W A;  3ZNT A;  4KZ9 A;  1PWG A;  1J9M A;  1LLB A;  2ZC3 B;  4S2N C;  4OH0 A;  4QB8 A;  4XUZ A;  4ZDX A;  3Q7V B;  1C3B A;  2G2W A;  2QZ6 A;  1CEG A;  1Y54 A;  1ERO A;  4B4X A;  1MWT A;  1ZG6 A;  5KSC A;  1FSW A;  1TDG A;  5E2G A;  1ZKJ A;  5EVI C;  1JTG A;  2ZQC A;  3PAE A;  4N1X A;  3WS2 A;  5FAQ A;  2HDQ A;  4Y0O A;  2X01 A;  1NYM A;  5CTM A;  4E3O A;  4XXR A;  5CXW A;  4S2P A;  3WS5 A;  4DDY A;  3Q82 A;  3O3V A;  4GDN A;  4U0T A;  1MWS A;  4L0L A;  1FCN A;  4PMA A;  1IYO A;  4K91 A;  4OOY A;  4EV4 A;  3SH8 A;  1YT4 A;  4K0W A;  1LL9 A;  5GHY A;  5GHZ A;  2V1Z A;  2XGN A;  5EE8 A;  2R9X A;  5HAP A;  3I7J A;  4ZJ3 A;  1PWC A;  1FR6 A;  4WZ4 A;  3EQV A;  3HLB A;  3N6I A;  1ESU A;  1WYC A;  3C4P A;  2Y2N A;  1RGY A;  3IF5 A;  3BFG A;  3MFD A;  4LEN A;  4D2O A;  2C5W B;  3N8S A;  1SKF A;  3N7W A;  5JYP A;  3ZG0 A;  1BLP A;  3PAG A;  2WAF A;  1L0G A;  3WRZ A;  3UPO A;  4KZ8 A;  2XFT A;  2Y2J A;  5F82 A;  3NDG A;  4JF4 A;  2X02 A;  5DTK A;  5AQB A;  5HFO A;  2VGJ A;  1H8Z A;  1XP4 A;  5A93 A;  1Q2Q A;  1KGG A;  3FYZ A;  4ZBE A;  3LY3 A;  1CI8 A;  2XFS A;  1XA1 A;  4KZ4 A;  3VP0 A;  3CMZ A;  2DNS A;  3VMA A;  4JF5 A;  2WAD A;  3PBR A;  5A92 A;  2Q9M A;  2XQZ A;  1YLZ A;  2EFX A;  1E4D A;  2Y2P A;  3IXB A;  3OCN A;  4RX2 A;  4S2N A;  2JCH A;  5TGF A;  4JKT A;  3SH7 A;  3HLW A;  2Y2H A;  3SOI A;  1ES5 A;  2XLN A;  1GCE A;  4B88 A;  5CHJ A;  4C75 A;  1L2S A;  3N4I A;  3UNW A;  3MZF A;  3VP2 A;  1TEM A;  2J8Y A;  4LV0 A;  3G34 A;  4YIN A;  1YQS A;  2Y91 A;  4R4S A;  5EVI A;  4GOG A;  5GL9 A;  3ZG9 B;  3VFH A;  3TG9 A;  1XA7 A;  3O88 A;  4OQ0 A;  5L2F A;  4QJG A;  2ZQ7 A;  3HUM A;  4GD6 A;  4E6W A;  1MWR A;  5DTS A;  5GLC A;  3ZG5 A;  1JWP A;  4OP8 A;  4KQQ A;  2A3U A;  1SDE A;  4HEF A;  4DE3 A;  4WEJ A;  2OV5 A;  1QMF A;  3HLE A;  4DDS A;  3IQA A;  3IWQ A;  5FQ9 A;  3UDF A;  2Y55 A;  3PTE A;  1QME A;  3BLS A;  3HL9 A;  3VP4 A;  3C5A A;  3BEB A;  5FAT A;  3ZGA B;  1CEF A;  1KDW A;  3NC8 A;  1TVF A;  1OME A;  1BT5 A;  2Y59 A;  3ITA A;  2WGW A;  4E3M A;  1ZG4 A;  4KQR A;  3HBR A;  2EX8 A;  4P0M A;  1S0W A;  3HRE A;  4OLD A;  2B5R A;  1L0D A;  2EX9 A;  4BL3 A;  4CPK A;  1LI9 A;  1PIO A;  3MZE A;  4LV2 A;  2ZC7 A;  4OQI A;  3G31 A;  2Y2O A;  3VSK A;  1TDL A;  3OPL A;  1E25 A;  3Q81 A;  1RGZ A;  2JE5 A;  4OKP A;  4R23 A;  4S2I A;  1W8Q A;  2JC7 A;  3PBS A;  4KZ6 A;  4KZ7 A;  1BTL A;  2ZQ8 A;  5CRF A;  4YFM A;  5M1A A;  5DVA A;  3Q7V A;  5G18 A;  2V20 A;  1K57 C;  2WKE A;  3LEZ A;  5AQ9 A;  1RCJ A;  3S1Y A;  1I5Q A;  5FQI A;  3IHB A;  1YMS A;  2EFU A;  1I2W A;  1W8Y A;  1JVJ A;  4OON A;  4E6X A;  1K6R A;  2X71 A;  3W4Q A;  3A3D A;  2J9O A;  3N8L A;  2WZX A;  3NIA A;  4R1G A;  2HP9 A;  1O07 A;  4OPR A;  1H8Y A;  4WYY A;  3ISG A;  5DF8 A;  4RVA A;  1XX2 A;  4MLL A;  1FR1 A;  1IYP A;  1ES2 A;  2HP6 A;  2Y2I A;  5FQM A;  2ZQD A;  4KQO A;  3JYI A;  1KGF A;  4EBP A;  3G2Z A;  4X6T A;  3NCK A;  4B4Z A;  3IH8 A;  2FFY A;  3G35 A;  4UA7 A;  4N1H A;  3V3R A;  3M2K A;  2XD1 A;  1K56 D;  3EQU A;  5EVL A;  3DWK A;  3MXR A;  2Y2Q A;  4E3N A;  3WS0 A;  4DE1 A;  1KE3 A;  4OPQ A;  3W8K A;  1YLP A;  2WKI A;  3ZFZ A;  4E3K A;  1FSY A;  4JXW A;  4U0X A;  2E8I A;  4OQH A;  5IHV A;  4KZB A;  3HUN A;  1GHM A;  4CJN A;  5A90 A;  3Q1F A;  4EWF A;  3TSG A;  3C4O A;  1HTZ A;  5BOH A;  1K4F A;  4BJP A;  1MWU A;  2XF3 A;  5FDH A;  2OLV A;  5DTT A;  3DWZ A;  1S6R A;  2G2U A;  2QMI A;  4WM9 A;  5EVI B;  3WS1 A;  2ZC6 B;  2J7V A;  1Q2P A;  3SS3 A;  1K57 A;  5AQA A;  4DF6 A;  4S2M A;  4Y7P A;  4A5R A;  5HW3 A;  5AQ7 A;  4QHC A;  1W7F A;  5F83 A;  3Q07 A;  4QY6 A;  1LI0 A;  4PM7 A;  3MZD A;  4XUX A;  3BFF A;  1WYB A;  2XR0 A;  5M19 A;  1KVM A;  1YLY A;  3P09 A;  1NZU A;  3S22 A;  2WAE A;  3BFE A;  4KZ3 A;  5CER A;  4C6Y A;  1PWD A;  4HBU A;  2P9V A;  2Z2L B;  4LCL A;  3BRM A;  2ZM2 A;  3FZC A;  3UDX A;  4EBL A;  3FKW A;  1BSG A;  1NY0 A;  4JLF A;  5U47 A;  3UN7 A;  1SHV A;  2CC1 A;  4KEN B;  5FAP A;  5JYO A;  3FWL A;  4GDB A;  5CHM A;  4Y0T A;  5CGS A;  4X55 A;  2WGW B;  3A3I A;  4WMC D;  4ZAM A;  2OSU A;  4UHU A;  3HLG A;  3PBT A;  4WZ5 A;  5E2F A;  3E2L A;  5GLB A;  3B3X A;  3UO9 A;  4FH2 A;  3ZCZ A;  4N9L A;  3MKE A;  4X68 A;  3G30 A;  4N9K A;  2IWC A;  3UDI A;  1IEL A;  3ZG7 B;  1BLS A;  1IYQ A;  1ALQ A;  3OCL A;  3W4O A;  4BLM A;  4JF6 A;  4UAA A;  1PW8 A;  1G68 A;  3QNB A;  3IWI A;  3FKV A;  5HL1 A;  1KGE A;  3SS5 A;  1JWZ A;  3OZH A;  5FQQ A;  2I72 A;  4X53 A;  3BM6 A;  4R3B A;  3BEC A;  3A3F A;  3BFC A;  2BG1 A;  4EUZ A;  1K56 A;  3RJU A;  4RYE A;  3A3E A;  4KG2 A;  3O87 A;  3OPP A;  1M40 A;  1XPB A;  3V50 A;  1GA9 A;  3IF6 C;  4BL2 A;  1U60 A;  3NDE A;  4PM6 A;  4Z9Q A;  5FI6 A;  1XKZ A;  2ZC4 B;  2IWB A;  3QNC A;  3IT9 A;  4GD8 A;  4JXG A;  5FI7 A;  4M3K A;  1PZO A;  2C6W B;  2FFF B;  2ZQA A;  2EX6 A;  4IBX A;  4P85 A;  3MKF A;  1FCM A;  5FQK A;  4RA7 A;  3SH9 A;  4ZJ2 A;  3WS4 A;  3G4P A;  2Y2K A;  3VFF A;  5HAR A;  2Y2G A;  2ZLY A;  3M2J A;  1RP5 A;  5E2H A;  3N8R A;  4E3J A;  3M6B A;  4ZJ1 A;  5EEC A;  3QHY A;  1JWV A;  1VQQ A;  1Z6F A;  1K54 A;  4HES A;  1GHP A;  2P74 A;  1BZA A;  2DCF A;  2HP5 A;  2RL3 A;  5GLA A;  1AXB A;  4OPZ A;  4S2K A;  3IXH A;  3HLF A;  5HAQ A;  3FV7 A;  4GZB A;  1LHY A;  5GLD A;  3TOI A;  1DY6 A;  3HUO A;  4GNU A;  3AGE A;  4FSF A;  5CEB A;  1MXO A;  5EUA A;  1YMX A;  4H8R A;  4EBN A;  1N4O A;  1FOF A;  2DRW A;  4R4R A;  1YLT A;  5FAO A;  2Y2M A;  1IYS A;  4PM9 A;  2WYX A;  2EXA A;  5FSR A;  2WGI A;  4WMC A;  3VOY A;  5M18 A;  3MBZ A;  5KZH A;  5FAS A;  4MEZ A;  5FI2 A;  3GRJ A;  1FCO A;  1NXY A;  2ZJ9 A;  4OOM A;  4WZ5 C;  2P9V B;  4F94 A;  3IF6 A;  1L0F A;  2HDR A;  3VP3 A;  1KVL A;  4ZTK A;  1SCW A;  4ID4 A;  3V39 A;  2PBY A;  2PU2 A;  1PI4 A;  4HBT A;  4BD0 A;  3NBL A;  2ZQ9 A;  2XDM A;  4O7D A;  2ZM0 A;  3ZDJ A;  3UE1 A;  4IBR A;  4IED A;  5HX9 A;  3UE3 A;  4LV3 A;  2H0T A;  2ZMA A;  3PBN A;  4U3T A;  4RX3 A;  1YM1 A;  3IH9 A;  4LCM A;  2XEP A;  1HZO A;  4JBF A;  1GA0 A;  4S2O A;  2RCX A;  4GKU A;  5FQJ A;  3UPN A;  2H0Y A;  2ZD8 A;  4BEN A;  4DE0 A;  3GVB A;  5TFQ A;  4P87 A;  3ZG8 B;  2WKH A;  3VP1 A;  2WK0 A;  1KE0 A;  3GMW A;  1KE4 A;  2XK1 A;  2UWX A;  3NY4 A;  5DF7 A;  1YLJ A;  1W5D A;  1M6K A;  3BYD A;  4KZ5 A;  2Q9N A;  1E3U D;  4S2L A;  5CEC A;  1NJ4 A;  5D3O A;  1LL5 A;  1PZP A;  4GN2 A;  3MXS A;  5E2E A;  1DJA A;  2EX2 A;  3V5M A;  2H10 A;  2VGK A;  4DRT A;  5KMW A;  1K55 C;  2IWD A;  3PBQ A;  5F1G A;  1ERM A;  2Z2M B;  4E3L A;  5I94 A;  1ZC2 A;  4NK3 A;  1G6A A;  5KSH A;  3DTM A;  4BD1 A;  4QU3 A;  2BLS A;  4N92 A;  3VOZ A;  2ZM8 A;  1DJC A;  3GTC A;  3IXD A;  2A49 A;  3AGF A;  4MNR A;  1ONG A;  5CGW A;  4PM5 A;  4OPY A;  5EPH A;  2ZC5 B;  1PW1 A;  4GB7 A;  3Q7Z A;  3ZVW A;  4DXC A;  3CG5 A;  1FQG A;  4WBG A;  3OPH A;  1EWZ A;  4DKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...