4OPYA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s mutation
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extended spectrum beta-lactamase TEM-63
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opyA00
4WZ4A 3M6BA 4GZBA 1XPBA 1KGEA 1KVLA 3VP1A 5FQMA 3UDIA 4DXCA 4LV3A 3SOIA 2P9VA 4FH4A 2HDQA 2PU2A 5CERA 2A3UA 4R0QA 2Q9MA 3DWZA 4PM9A 1XKZA 2V20A 2UWXA 4KQRA 3M2KA 1FR1A 5EVIA 1ESUA 2QPNA 5CECA 3LCEA 4OPQA 3ZG7B 3IWIA 1K38A 4PM8A 3BLSA 1K56D 4WYYA 5M19A 4X6TA 4R4SA 3D4FA 5M18A 3PBTA 2XQZA 2IWBA 2CC1A 2DRWA 1IELA 3A3JA 3OPRA 3PBSA 1KVMA 5F1GA 3NDGA 1KDSA 3G35A 3N8SA 1GHPA 1K55C 3ITAA 4WZ5A 3DW0A 5CGSA 1W79A 4GN2A 5A90A 5KMWA 2C5WB 4U3TA 2RL3A 5TR7A 1IYQA 4D2OA 4PPRA 1I2SA 3V39A 1G68A 3MBZA 3VOYA 4IEDA 1KGGA 4R3BA 5J8XA 3HL9A 1I2WA 5FI2A 5FQ9A 4ZJ2A 3SS3A 3VP2A 1OMEA 3W4OA 5A92A 1PWCA 3V50A 5CXWA 4FSFA 4ZDXA 2FFYA 3WS0A 1NRFA 4JLFA 1JTGA 4JF5A 5JYPA 3A3DA 1YT4A 5GLBA 3OPLA 3C7UA 1LLBA 4GDNA 3VOZA 3QNCA 3QNBA 2XD5A 4OOYA 3IH9A 4S2NA 5CTNA 5AQ9A 1ESIA 3V5MA 2Y2GA 3EQVA 2HDRA 3VP0A 1ALQA 3IF6C 3IXHA 1SCWA 4OQ0A 5FI6A 3ZGAB 4HESA 2EFUA 3G32A 3OCLA 2G2UA 3IXDA 4B4ZA 4K0WA 3I7JA 4E6XA 3OPPA 2ZQ9A 1HTZA 3FV7A 2WKIA 3M6HA 1K54C 4FD8A 4LCLA 1MWSA 3G4PA 4LCMA 2OLVA 2V1ZA 3IXGA 1PYYA 3SH8A 4IVKA 1VQQA 3IF6B 3TG9A 3GRJA 3UPNA 1PW1A 4E3IA 4YINA 1YLJA 3G2YA 3GR2A 1E25A 3IHBA 4QY5A 1ERMA 1Q2PA 2Y55A 4N1HA 1NZOA 1GA9A 1IYOA 3HLFA 1XGIA 1L0EA 5F83A 4P87A 2J9OA 1H8YA 1QMFA 4K0XA 4E6WA 2EX6A 2WZXA 5JYOA 2R9XA 5HFOA 4R23A 3BLMA 1SHVA 1NJ4A 4QD4A 5HAQA 1YQSA 2XFTA 5FQJA 1YLWA 3S22A 3TOIA 4BLMA 5GLAA 1M6KA 3O88A 4OKPA 3P09A 1JVJA 4Y7PA 3C5AA 4DE2A 3DTMA 4OOMA 3S4XA 4WELA 3MFDA 3M2JA 2ZMAA 1QMEA 3QHYA 3Q1FA 3N8RA 2Y2NA 3MKFA 3MXRA 1W5DA 5EVIC 3ZFZA 5CEBA 3UPOA 2DCFA 1Q2QA 4OQGA 5HX9A 3RXWA 1K6SA 3VSKA 2C6WB 3LY3A 4DDSA 2WGIA 5FI7A 2QMIA 4L0LA 5A93A 2XDMA 1ONHA 2P9VB 4WZ5C 5FQIA 3ZDJA 3BFGA 3N4IA 4JF4A 3RXXA 4HBTA 3IF5A 5TGFA 3BFEA 1BLPA 5FAPA 1XP4A 5EOEA 4BENA 4PM5A 5GHZA 4P85A 1CEGA 2Y2QA 5E2EA 2GDNA 4X55A 3IWOA 4BL2A 3OCNA 1YMSA 2DNSA 2JC7A 4ZJ3A 3WRZA 4KZ9A 1YLYA 4KENB 3S1YA 1BLSA 5FAQA 3Q82A 3IH8A 4B4XA 1FCMA 2Z2LB 3Q7VA 2XR0A 3UNWA 4OPRA 2ZC3B 4FCFA 3GQZA 3W4PA 2A49A 3HLDA 4S2KA 4WMCA 5GL9A 5L2FA 2HP6A 4E3JA 3GV9A 1LL9A 2ZC4B 3LO7A 4RX2A 4S2NC 1BLCA 3PBQA 1GHMA 1H5XA 1ONGA 1S0WA 5CGXA 3C4OA 4OOLA 2E8IA 4EQIA 1E3UA 5BOHA 4K91A 5HW3A 1J9MA 1EWZA 3CZDA 3VFFA 1HVBA 3NDEA 1GCEA 3MKEA 1XX2A 1BULA 4X56A 4N1XA 4MBHA 3UDXA 4OP8A 2JCHA 2Z2MB 4ZBEA 1FSWA 4EBLA 3O3VA 5EPHA 3A3FA 3MZEA 5KSCA 1ZKJA 1ZG4A 4KZ8A 3OZHA 5I94A 3HUMA 3MZDA 4E3NA 4ID4A 3JYIA 3BEBA 2HDUA 2PBYA 2WK0A 5EOOA 4GKUA 4X69A 3WS4A 3WS2A 3O87A 2XEPA 3BFFA 3V3SA 3ZG8B 4IVIA 3GVBA 2XLNA 3FKVA 2WADA 2J9PA 1TDLA 2JE5A 2Y2JA 3HLEA 1O7EA 2ZLYA 1SKFA 4GD6A 4UA6A 4MBFA 5CHUA 5GHYA 4ZAMA 5EVLA 3VSLA 4EUZA 5KSHA 4OPZA 4JKTA 3SH7A 1ZC2A 3AGFA 1C3BA 1WYCA 4C6YA 3ZG9B 4UA7A 2Y91A 2ZM0A 2WGWA 3GTCA 2EX2A 2ZD8A 4R1GA 5G18A 5U47A 1KE4A 1RGYA 4UAAA 2X01A 4IBXA 4PM7A 5DF8A 3N6IA 4H8RA 1MY8A 3IWQA 1PWGA 4RX3A 5EECA 4XUXA 3UPPA 3HVFA 3O86A 4S2LA 4KZ6A 5CEDA 5AQAA 4X68A 1L0DA 4RYEA 4OPYA 3NC8A 2ZC5B 4B88A 2PU4A 3ZNYA 4Z9QA 2QZ6A 1G6AA 4LV2A 5E2FA 1K56A 4XXRA 4E3KA 1MBLA 1PI5A 2ZC6B 3IT9A 5FAOA 3NBLA 3WWXA 5M1AA 1NYYA 2H10A 4O7DA 1VM1A 5E2HA 2ZJ9A 3HBRA 4MEZA 4DF6A 4DXBA 4JF6A 4JPMA 4CJNA 3VP3A 1KE0A 3ISGA 4KZ4A 2H0TA 3IXBA 1K4EA 5GLCA 4A5RA 4S2OA 3VFHA 1ZG6A 4GB7A 3E2KA 2WZZA 4KZAA 4BL3A 2ZQAA 3HUOA 4M3KA 1ES5A 2Y2HA 4QU3A 4S2MA 4MLLA 3Q7VB 1NXYA 1YLTA 3FYZA 4JXGA 1BZAA 4C3QA 4C75A 2EXBA 2EXAA 2Y2MA 4DDYA 2Y2OA 1BTLA 4DE0A 2R9WA 2Y2KA 4OLDA 4S2PA 1HZOA 3B3XA 1JWVA 2RCXA 1WYBA 5DF9A 1KE3A 2Q9NA 2J7VA 3SH9A 5EVID 4U0TA 3C7VA 4N92A 4OP5A 1L0GA 4QY6A 5EVIB 1MWUA 3PAGA 3LY4A 2WGVA 5E2GA 5CTMA 4JXVA 3ITBA 1WE4A 1IEMA 1PZOA 1N4OA 3UDFA 3WS5A 4QJGA 1PZPA 5DF7A 1XGJA 5AQ7A 3SS5A 4EWFA 2WKEA 4BJPA 2EX9A 2JBFA 3HREA 1EROA 3A3EA 3NCKA 4OVDA 4KG2A 4OONA 1MWTA 2Y2IA 1FCOA 1YM1A 1U60A 4F94A 1BSGA 2ZQCA 1FR6A 2IWCA 1JTDA 4Y0TA 3MXSA 1TDGA 5GHXA 4KZ3A 2B5RA 3BRMA 4S2JA 1ES4A 3PBNA 1IYSA 4MBKA 1BT5A 1JWZA 1L0FA 1TVFA 4KG5A 1RCJA 4OQIA 4YFMA 2ZM8A 1XA1A 4ZTKA 1KDWA 2XD1A 2WKHA 2G2WA 4NETA 5A91A 1N9BA 4E3MA 2X02A 3BFDA 4R4RA 2X71A 5GLDA 1DY6A 2WAEA 1YLPA 4WM9A 3ZVTA 2XH9A 1CK3A 2EX8A 4P0MA 2ZQDA 2ZQ8A 1IYPA 3GMWA 3IHAA 2OSUA 2J8YA 1PIOA 1LL5A 2BLSA 2H5SA 1PI4A 5FQKA 3VP4A 4RA7A 5DTSA 4EBNA 3EQUA 4E3LA 1SDEA 5CGWA 5DVAA 1GA0A 5CRFA 5FSRA 3WRTA 2WUQA 3N8LA 1SDNA 3CMZA 1RP5A 2XK1A 4NK3A 4QB8A 1CI9A 4P6BA 4GD8A 1W7FA 1K57A 3W4QA 3ZVWA 2V2FF 1K4FA 1W8QA 2XGNA 3BFCA 5HARA 3UO9A 4WEKA 3C4PA 1MWRA 2H0YA 3DWKA 3NIAA 1I5QA 4GDBA 4LV0A 4CPKA 3ZCZA 4BD1A 3OC2A 1PW8A 3UN7A 4HBUA 2IWDA 4WBGA 2ZM2A 3UE1A 5KZHA 2BG1A 3A3IA 1TEMA 1PWDA 2FFFB 3G31A 5CHJA 3MZFA 5F82A 2XFSA 5FQQA 1K6RA 4UHUA 1HD8A 3BECA 3PTEA 5IHVA 4KZBA 3Q81A 2HP5A 1IKGA 1DJAA 2VGJA 4DE1A 1CI8A 1NZUA 4JBFA 5FA7A 3E2LA 1BUEA 4N9LA 4S2IA 4U0XA 1Y54A 2WAFA 3HLCA 3W8KA 3ZHHA 4PM6A 3PBRA 1ES3A 4KQOA 2XF3A 4KZ5A 5D3OA 5AQBA 2P74A 5FASA 4HEFA 4JXSA 1W8YA 4X53A 1XA7A 5HAPA 1ES2A 5TFQA 3HUNA 1H8ZA 2VGKA 2ZC7A 3HLGA 3UY6A 3AGEA 3LEZA 2HP9A 3BYDA 1RGZA 1LI9A 1Z6FA 4ZJ1A 2OV5A 3ZG5A 4E3OA 5E43A 2WYXA 4LENA 1CEFA 1FCNA 2HPBA 2ZQ7A 3BM6A 4JXWA 5CHMA 3UE3A 1E4DA 1K55A 4N9KA 5DTTA 1YMXA 1XXMA 1LHYA 1ERQA 4KG6A 4WMCD 1NYMA 3Q7ZA 1YLZA 3SS4A 2Y4AA 4Q8IA 3HLBA 4R3JA 3FKWA 4LV1A 1JWPA 4KQQA 5DTKA 4EBPA 4IBRA 1L2SA 3NI9A 1E3UD 1NY0A 5FATA 5HL1A 3FZCA 1M40A 3N7WA 1FQGA 1EI5A 2OLUA 3ZNTA 5EUAA 4DE3A 3HLWA 3ZG0A 4WEJA 1FSYA 3RJUA 2Y2LA 1MKIA 3WS1A 3GSGA 4OH0A 3UE0A 3NY4A 1K25A 4Y0UA 1DJBA 3IF6A 3OPHA 1BLHA 1K57C 3V3RA 3VMAA 3Q07A 2EFXA 4Y0OA 4OQHA 4PMAA 4DRTA 3CG5A 3PAEA 2I72A 5FDHA 1S6RA 1AXBA 4BQMA 3AGDA 3PBOA 1K54A 3FWLA 1KGFA 5HAIA 5EE8A 1IKIA 2Y59A 1MXOA 4GNUA 4BD0A 1MPLA 1O07A 1FOFA 2Y2PA 3P98A 4FH2A 1LI0A 4OLGA 3CJMA 4UA9A 3TSGA 3G34A 2HDSA 4QHCA 4MNRA 4XUZA 3IQAA 1GHIA 3G2ZA 4RVAA 4DKIA 4EV4A 4KZ7A 5F1FA 4GOGA 3G30A 2WGWB 1DJCA
chains in the Genus database with same CATH superfamily
1XPBA 4LV3A 5CERA 2A3UA 4R0QA 3DWZA 5HPFA 1ESUA 3DBAA 1K56D 3D4FA 2IWBA 2CC1A 2VLGA 2DRWA 2V1AA 5EVEA 3NDGA 1KDSA 3G35A 1GHPA 1K55C 5A90A 5KMWA 3DW0A 2PR6A 4D2OA 3V39A 4Q0IA 4ZJ2A 4WUJA 3RFBA 5CXWA 2FFYA 4JLFA 1JTGA 4Q0JA 4OOYA 2LB9A 3LR4A 4B93A 4DJ2A 4JGPA 3IF6C 3IXHA 4G3WA 3I7JA 2D01A 2WKIA 4LCMA 1PYYA 4IVKA 1YSPA 3IF6B 4LPZA 3UPNA 4CLCD 5F5YA 3IHBA 1E25A 4QY5A 2J3TD 4IHQA 3JVUA 4B9OA 3S7QA 1QMFA 4E6WA 1MZUA 5JYOA 5HFOA 1NJ4A 4QD4A 4BWIA 1M6KA 1SKOB 4DE2A 4R3AA 4OOMA 5EM1A 1AWIA 4O0PA 3Q1FA 3N8RA 2Y2NA 1ZHHB 3MKFA 1W5DA 2JKGA 3MQQA 1XJ3A 5EVIC 4F3LB 2DCFA 4OQGA 3R7WA 1K6SA 4DDSA 5A93A 1ONHA 5FAPA 3O5YA 4PM5A 5GHZA 5E2EA 2PDRA 5IU1A 2P04A 1YMSA 2DNSA 3WRZA 1BLSA 5AVFA 2Z2LB 3Q7VA 3UNWA 4FCFA 4K08A 2A49A 5L2FA 2HP6A 3GV9A 1LL9A 3LO7A 3EOIA 3KSIA 4S2NC 1BLCA 1GHMA 5CGXA 4OOLA 1E3UA 4FOFA 3C8CA 4K91A 2WKQA 3ICYA 4MBHA 3UDXA 1D06A 5EPHA 1ZKJA 4KZ8A 4HOIA 3MZDA 3A0VA 3JYIA 2GJ3A 3QP5A 3WS4A 3BFFA 3ZG8B 3GVBA 1IOUA 4Z1WA 1TDLA 5EM0A 1O7EA 4UA6A 5EVLA 4EUZA 5KSHA 1P0ZA 1WA9A 4OPZA 1ZC2A 1GSVA 1C3BA 2WGWA 4CLCE 3LEQA 4IBXA 3N6IA 5EECA 4RX3A 4XUXA 3UPPA 4X25A 4S2LA 5CEDA 4KZ6A 2VZWA 1V9ZA 4OPYA 2ZC5B 2QZ6A 4LV2A 3NBLA 2H10A 2ZJ9A 2Q0OA 4MEZA 4DXBA 4JF6A 4LRYC 4JPMA 4KZ4A 4DMZA 3VFHA 1ZG6A 4MN6A 4GB7A 3E2KA 1OTDA 2WZZA 4BL3A 4MLLA 3FYZA 1XJ4A 4DDYA 1BTLA 2R9WA 2ZL1B 3UMEA 5L09A 4JGOA 2OOLA 2RCXA 1WYBA 4NXEA 2VA0A 5DF9A 1KE3A 4N92A 4OP5A 3TW8A 3KSFA 4Y2FA 4IUKA 4QY6A 2VKSA 5IS1A 5CTMA 4RQ9A 3ITBA 1N4OA 4QJGA 2GNXA 5DF7A 5AQ7A 4EESA 3HREA 4OONA 2JKRM 1YM1A 1U60A 4HNBA 4F94A 3CUEA 3DAVA 4WL9A 1JTDA 5GHXA 1CF0A 4KZ3A 2B5RA 1IYSA 1TVFA 1SKOA 3ZQ5A 5A91A 2R78A 1N9BA 2X71A 4F3LA 4HJ4A 2WAEA 3ZVTA 4P0MA 2ZQDA 3IHAA 2J8YA 1PIOA 2H5SA 3T1XA 4RA7A 4EBNA 4E3LA 1W63Q 1HLUP 3NOTC 2WUQA 1SDNA 2LB5A 3CMZA 2M7UA 2XK1A 4QWOA 4P6BA 4H6JA 3W4QA 1XFQA 1T19A 3DWKA 2H0YA 4GDBA 3ZCZA 5HWTA 2W0NA 4JGQA 4IUHA 4ZRRA 3UE1A 2BG1A 4EW7A 1PWDA 2FFFB 5CHJA 3EGDC 3BECA 5IHVA 4LLOB 1IKGA 1DJAA 4DE1A 2JN7A 2W1TB 4Q0HA 4U0XA 1Y54A 4KUOA 3HLCA 4ME4A 3DTKA 4PM6A 5FASA 4JXSA 5TFQA 2VGKA 2ZC7A 4LFUA 2OAQ1 3L7HA 2A24B 2J3TC 4ZJ1A 4E3OA 3B33A 5E43A 3MQOA 2E8JA 2ZQ7A 3QP4A 5CHMA 3UE3A 4GS9A 1XXMA 4CLCB 1LHYA 4KG6A 4WMCD 3KSHA 5IT5A 5KIZA 3SS4A 4Q8IA 4R3JA 1DP8A 3FKWA 5DTKA 5TJJA 3E4OA 1M40A 2JKRI 5DKKA 1FQGA 1EI5A 3ZG0A 3CPTB 3RJUA 1MKIA 3OOVA 3NY4A 4Y0UA 3OPHA 1K57C 4EETB 3Q07A 4PMAA 3LR3A 4DRTA 3CG5A 3FWLA 3MF0A 4BD0A 1MPLA 3CJMA 2HDSA 4MNRA 3L9KA 4XUZA 4DKIA 4NXGA 4GOGA 3HJKA 5L07A 1KVLA 2V9AA 4HHDA 3E0YA 3UDIA 2HDQA 2PYRA 4PM9A 1XKZA 2V20A 4KQRA 1Z09A 2QPNA 3LCEA 3ZG7B 3IWIA 3BLSA 4WYYA 5M18A 3A3JA 3OPRA 1PFLA 5F1GA 5CGSA 3VE3A 1W79A 4GN2A 3BY8A 1FILA 1S67L 3BW6A 4U3TA 2RL3A 2P7JA 1G68A 3MBZA 3VOYA 4IEDA 3SS3A 3VP2A 4FSFA 4ZDXA 5G4YA 1NRFA 4JF5A 5JYPA 3A3DA 3OPLA 3CAXA 4MMNA 3TE8A 3V5MA 2Y2GA 2V8FA 3EQVA 2HDRA 1ALQA 2ZMFA 2EFUA 3IXDA 1YKDA 4B4ZA 3E4PA 4K0WA 2ZQ9A 1HTZA 1YSQA 3M6HA 3F1PA 3H9WA 4FD8A 1CQAA 1VQQA 1G6OA 2B95A 1F5MA 1YLJA 5J7EA 4N1HA 2NUPC 1NZOA 4ETXA 3A0RA 4BBTA 3HLFA 1L0EA 5F83A 4K0XA 2R9XA 1SHVA 3QP6A 3S22A 4OKPA 3O88A 4NXFA 3C5AA 3S4XA 4WELA 3M2JA 3ZFZA 3MXRA 5HX9A 2BASA 3VSKA 5F6AA 1G5UA 4UQIS 2QMIA 1S1YA 2XDMA 4WZ5C 2P9VB 3ZDJA 4JF4A 3IF5A 1XP4A 1TS7A 3BQ8A 2A24A 4P85A 3ULFA 2Y2QA 1TD5A 2GDNA 3IWOA 5FL3A 3Q82A 4G3KA 2UV0E 4CLCA 4OPRA 2ZC3B 3GQZA 4NKPA 4PKYA 3EGXC 1K0KA 3PBQA 1ONGA 3UB5P 2E8IA 3TJZC 1J9MA 3CPTA 3MKEA 1BULA 4N1XA 3A3FA 3MZEA 3FG8A 3OZHA 3HUMA 4L9GA 4E3NA 2WK0A 4GKUA 2Y79A 4WN5A 4I3JA 2Z6CA 3O87A 3T4TA 2XEPA 4WLAA 4NXBA 4IVIA 3FKVA 2WADA 2JE5A 3HLEA 3KX0X 2O0YA 5GHYA 1S4RA 4LRZE 4JKTA 3SH7A 3K2NA 1WYCA 3F1NB 4C6YA 4UA7A 2ZM0A 1Y4OA 3GTCA 2EX2A 3UB6A 5U47A 2INWA 2L4RA 4PM7A 5DF8A 4H8RA 1MY8A 3IWQA 1PWGA 1TF1A 4EEPA 1ZTUA 3HVFA 3O86A 1L0DA 2AVXA 2PU4A 4E3KA 1G6AA 4HP9A 3EWKA 5FAOA 3WWXA 5M1AA 1NYYA 1VM1A 3HBRA 2L0WA 2V8CA 3VV4A 1T1AA 1EW0A 3VP3A 5GLCA 3ISGA 2VGLS 4MN7A 3BQAA 2ZQAA 4QU3A 1TS0A 1NXYA 3F1OB 3UPOA 4HJ3A 4I3AA 5FEFA 3KO6A 2EXBA 2EXAA 2Y2OA 4Y3IA 3C2WA 1PNEA 4S2PA 1HZOA 4MCWA 3LIBA 2Q9NA 2J7VA 4O8GA 5EVIB 1MWUA 3PAGA 3UE6A 3H7WB 1IEMA 2O99A 4GW9A 4BJPA 2JBFA 3MMHA 3IS2B 2Y2IA 1FCOA 1TDGA 3BRMA 3UB8A 3OLOA 1ES4A 1L3LA 1BT5A 1JWZA 1N9LA 4YFMA 4KG5A 4OQIA 2ZM8A 1XA1A 2PBDP 2WKHA 2G2WA 3MR0A 2XA7S 4E3MA 5GLDA 3LIFA 1YLPA 3QP2A 1IYPA 4QPRA 5FQKA 3S7OA 2PHYA 5CGWA 5DVAA 1GA0A 3WRTA 3N8LA 3CHWP 1UGUA 3QP1A 1W7FA 2FZ0A 1TS6A 3UO9A 5HARA 4WEKA 5DJUA 1MWRA 3NIAA 1OT6A 1PW8A 4WBGA 5KZHA 3A3IA 1TEMA 5J4EA 2J80A 1HD8A 5HZHA 3NECA 3Q81A 3LYXA 4PKYG 1CI8A 4JBFA 1YAXA 5FA7A 4GCZA 1BYWA 4S2IA 3W8KA 5D3OA 2P74A 1OTEA 1W8YA 4X53A 5HAPA 3H82B 3UY6A 3AGEA 2HP9A 4E04A 1RGZA 1LI9A 2OV5A 3KYQA 3BM6A 4JXWA 3LIEA 1K55A 4N9KA 1ERQA 2PD8A 1NYMA 2PAVP 3T4JA 4IBRA 4FTXA 5HL1A 1E3UD 1OPXA 3FZCA 4Y17A 5EUAA 4DE3A 4L9FA 1FSYA 3BY9A 3GSGA 3R4KA 4OH0A 1F98A 2Y8HA 3IF6A 2QKPA 1LSVA 1TS8A 2I72A 1LT0A 3PBOA 1KGFA 5HAIA 2W3EA 2Y59A 5F69A 4FH2A 4HP4A 3F1OA 3PYPA 3G2ZA 4EV4A 5F1FA 3G30A 3M6BA 1S66L 3SOIA 4FH4A 2PU2A 2VK3A 3NOPC 2Q9MA 3HCYA 3D72A 4HJ6A 1FR1A 5EVIA 1S4SA 4OPQA 1K38A 4PM8A 3LGOA 3H7WA 5M19A 4X6TA 3PBTA 2XQZA 3PBSA 1KVMA 3N8SA 1DRMA 3LIDA 2C5WB 3GDIA 5TR7A 4P6ZS 5J8XA 4R3BA 3HL9A 1I2WA 5FQ9A 3W4OA 5A92A 2W3FA 3MXQA 3WS0A 5EFWA 5GLBA 4EQ1A 4GDNA 4CQHA 3QNBA 3FPWA 1XJ6A 4S2NA 2XRNA 5AQ9A 2M7VA 3HJIA 2D02A 3VP0A 1P9RA 1SCWA 3ZGAB 5I5LA 2G2UA 3KYEA 2G7UA 4E6XA 1K54C 3DTIA 4LCLA 1MWSA 3G4PA 2OLVA 2QHKA 2V1ZA 3D9YA 4WF0A 3IXGA 4E3IA 2KX6A 3PHYA 4YINA 3GR2A 1ERMA 1S1ZA 2Y55A 3NULA 3P01A 5DKLA 1IYOA 1XGIA 3U2AA 1H8YA 5HDCA 2EX6A 1XFNA 2EWVA 2WZXA 2BTFP 5HAQA 1PRQA 1YQSA 3TOIA 5GLAA 2W27A 3P09A 4Y7PA 3DTMA 3MFDA 1QMEA 2M1CA 2EWWA 5LBRA 3ZYTA 3RXWA 3T4QA 4I38A 1F2KA 2WGIA 2YKHA 5FI7A 3T4LA 1P97A 5FQIA 3BFGA 4HBTA 5TGFA 4YWZA 5EOEA 4BENA 1CEGA 1H8MA 5HPIA 4BL2A 3OCNA 4KZ9A 3S1YA 3IH8A 4B4XA 1FCMA 2XR0A 3CWFA 4II7A 3W4PA 4S2KA 4RX2A 2ZL1A 4EQIA 1NWZA 4G3VA 3VFFA 3CZDA 3T1SA 2ZMVA 3NDEA 1XX2A 4X56A 4EU0A 3B47A 4ZBEA 1FSWA 2K7SA 4EBLA 3O3VA 3LICA 4EEUA 1ZG4A 5I94A 2PBYA 3T12B 5EOOA 2VEAA 4X69A 2GX5A 4I39A 2O9AA 4LRXC 3V3SA 2XLNA 3UB7A 4Y5FA 2ZLYA 1SKFA 4GD6A 4MBFA 3KYZA 2PT7A 3AGFA 3ZG9B 2Y91A 1MC0A 2HGVA 2ZD8A 4R1GA 5G18A 3LUQA 1RGYA 4UAAA 3S7NA 3DTEA 2JHEA 5AQAA 3R7WB 4RYEA 3NC8A 4Z9QA 1K56A 4XXRA 4HIAA 1NLZA 1PI5A 2ZC6B 1SZVA 1JNUA 4DF6A 5CX7A 3IXBA 5HDSA 4S2OA 2FH5A 4KZAA 3HUOA 2Y2HA 4S2MA 1MKMA 5DFXA 3Q7VB 4M4XA 4JXGA 2W1TA 1BZAA 4C75A 4GHIB 3NJAA 2Y2KA 4OLDA 3B3XA 1JWVA 3QP8A 1T1CA 3MFXA 3C7VA 3A0SA 1L0GA 5E2GA 2QYBA 4JXVA 4L9EA 3UMDA 2V1BA 4AFIA 3UDFA 3WS5A 2W3HA 1XGJA 3SS5A 4EWFA 2WKEA 1UWPX 3NCKA 3A3EA 4KG2A 1MWTA 3T4OA 2ZQCA 2IWCA 4R38A 5HWWA 4Y0TA 3IX8A 5FDSA 3CLOA 4S2JA 3PBNA 4ZTKA 4XT2B 1KDWA 2MJ6A 2XD1A 3T1QB 3BFDA 4BMWA 2XROA 1GSXA 4WM9A 2XH9A 3NOUC 1CK3A 2EX8A 5FEGA 2ZQ8A 2OSUA 2W3DA 2O9CA 2BLSA 3MQ0A 3VP4A 5DTSA 3EQUA 5HD3A 5FSRA 5AVEA 2J3WA 2CMNA 4NK3A 4QB8A 1CI9A 1K57A 3ZVWA 1DP9A 2XGNA 3SZTA 4HY8A 3C4PA 1OTBA 4CPKA 2IA2A 3UN7A 2JKFA 4HBUA 2IWDA 2ZM2A 3TRCA 1IFQA 5F82A 1K6RA 1ODVA 4KZBA 4YOFA 2VGJA 3E2LA 3BJNA 4N9LA 3ZHHA 3PBRA 5AJGA 5AQBA 2ZOIA 1X0OA 3RTYA 1XA7A 2A2LA 1ES2A 3E4QA 3HUNA 1H8ZA 3HLGA 3CUEC 3LEZA 2O9BA 1CJFA 1Z6FA 3LIAA 1CEFA 1FCNA 2OAP1 3IX3A 3JPUA 1P9WA 3MSHA 3Q7ZA 2Y4AA 3BWLA 3HLBA 4IJGA 4LV1A 3NI9A 5FATA 1VEUB 5MC7A 3ZNTA 3HLWA 1N9OA 3LI8A 4WEJA 2Y2LA 2JKTM 3UE0A 5HSQA 1K25A 3CITA 1Y28A 3V3RA 2EFXA 1OT9A 4Y0OA 3PAEA 5FDHA 1AXBA 3AGDA 2W1RA 2VV8A 5EE8A 4GNUA 5EV0A 4H6JB 3P98A 4I3IA 1W63M 3G6OA 4QHCA 5L8MA 3IQAA 1GHIA 4BQMA 4WZ4A 4GHIA 4EUVA 3UB9A 4GZBA 1KGEA 3VP1A 1KOUA 5FQMA 2HZ5A 1LSXA 3E98A 4DXCA 4KUKA 3T4KA 3K3DA 3T4SA 2P9VA 2UWXA 3M2KA 2KLIA 5CECA 2PD7A 3PXPA 4R4SA 1IELA 1NLYA 3K3CA 3EEHA 1LL8A 4WZ5A 4UQIM 3ITAA 4NEED 2QWSA 1IYQA 4PPRA 1I2SA 4Y13A 2EA9A 5TBMB 1KGGA 2DMWA 5FI2A 1OMEA 1PWCA 3V50A 5HL6A 4GS9B 4XT2A 5HD5A 1YT4A 3C7UA 1LLBA 3VOZA 3QNCA 2XD5A 3IH9A 4O01A 1VETB 5CTNA 1ESIA 4OQ0A 5FI6A 4HESA 3G32A 3OCLA 4NG2A 3OPPA 3MJQA 1XJ2A 3FV7A 3LFVA 5DJTA 3SH8A 4DJ3A 3TG9A 3GRJA 1PW1A 3G2YA 1Q2PA 2JKTI 1GA9A 5A8BA 3T50A 4P87A 2J9OA 3F1NA 4R23A 3BLMA 5F68A 3NHQA 2XFTA 5FQJA 1YLWA 4BLMA 1JVJA 3S7PA 2VV7A 2ZMAA 2W3GA 3QHYA 5CEBA 1Q2QA 1YPRA 3IX4A 1FIKA 2C6WB 3VE4A 3LY3A 1VHMA 4L0LA 1T1BA 2VJWA 3N4IA 3RXXA 2HV1A 3BFEA 1BLPA 4X55A 4ZJ3A 2JC7A 2QJ5A 1YLYA 4KENB 5FAQA 3W2ZA 3V67A 4FUWA 3HLDA 5GL9A 4WMCA 4E3JA 3B42A 2ZC4B 3OBFA 1LSWA 5HWVA 4HH3A 1H5XA 1S0WA 1VEUA 3C4OA 2VGLM 2QJ7A 5BOHA 4MN5A 5HW3A 1EWZA 1T18A 2NUTC 1HVBA 1GCEA 3P7NA 4OP8A 2JCHA 4GJ4A 2Z2MB 2HJ9C 5KSCA 5DFYA 3IS2A 4ID4A 3BEBA 2HDUA 2HJEA 3F1PB 1D7EA 2GZAA 3WS2A 4HQAA 2J9PA 1DP6A 4ARZB 2Y2JA 2OWJA 5CHUA 2KOIA 4ZAMA 3LR5A 3VSLA 3PR6A 2PR5A 4I5SA 3D3OA 1KE4A 2Z6DA 3CI6A 1F9IA 2X01A 3LI9A 5J3WA 2XA7M 2ZBBA 4X68A 4R6LA 4EXOA 4B88A 3ZNYA 5E2FA 1MBLA 4UEYA 3IT9A 3MS6A 4PHTA 4BBVA 4CLCC 4O7DA 5E2HA 5TBMA 4CJNA 1KE0A 2H0TA 1K4EA 4A5RA 1STZA 4M3KA 1ES5A 3FPVA 4D60A 1YLTA 2HF6A 2ZOHA 4C3QA 1NRJA 2H28A 4KQDA 2Y2MA 1UWNX 4DE0A 1VETA 5G4ZA 3SH9A 5EVID 4U0TA 3H82A 1J3WA 4MDZA 3LY4A 2WGVA 1OJGA 1ACFA 4YNRA 1WE4A 3GECA 1PZOA 3FC7A 1PZPA 3C30A 2EX9A 1EROA 2L1MA 4JGRA 2YKFA 4OVDA 3JVVA 4EERA 1BSGA 4LGWA 1FR6A 4DN0A 5L10A 3MXSA 3IBRA 4HH2A 4MBKA 2PYPA 1L0FA 1RCJA 4NETA 3VOLA 2X02A 4R4RA 3C38A 1DY6A 3GMWA 1LL5A 1PI4A 5C5KA 1SDEA 5CRFA 5HDDA 2WKRA 1RP5A 1OJ5A 3KSGA 4GD8A 2OWHA 2V2FF 1K4FA 1W8QA 3BFCA 1D1JA 2ACGA 4ESPA 1I5QA 4LV0A 4BD1A 3OC2A 3G31A 2VV6A 3MZFA 2XFSA 5FQQA 1H3QA 4UHUA 1V9YA 3PTEA 3EEAA 2HP5A 1H0MA 2WKPA 1NZUA 1BUEA 3RH8B 1OTIA 4X1MA 1OTAA 2WAFA 2B18A 1GSWA 3LR0A 1ES3A 4KQOA 2XF3A 4Y15A 4PAUA 4KZ5A 4HEFA 3T1RA 3BYDA 3ZG5A 2V0UA 2WYXA 4LENA 2B02A 2HPBA 2PRFA 1E4DA 5DTTA 2KDKA 1YMXA 2K2NA 4ARZA 4BBUA 1YLZA 2I9VA 1JWPA 2XSSA 4P6ZM 4KQQA 3U4LP 4EBPA 1L2SA 1N9NA 1NY0A 4R70A 3N7WA 1A0KA 2OLUA 2VX8A 1G28A 3WS1A 1VB6A 3SW1A 5K5BA 4GLQA 2K31A 1DJBA 2V0WA 1BLHA 3VMAA 4HI4A 3IBJA 4OQHA 1S6RA 1K54A 1IKIA 1MXOA 4ETZA 1O07A 1FOFA 2Y2PA 1LI0A 4OLGA 4UA9A 3TSGA 2P08A 3G34A 4X1LA 4RVAA 4KZ7A 2WGWB 1DJCA
chains in the Genus database with same CATH topology
4WZ4A 3M6BA 4GZBA 1XPBA 1KGEA 1KVLA 3VP1A 5FQMA 3UDIA 4DXCA 4LV3A 3SOIA 2P9VA 4FH4A 2HDQA 2PU2A 5CERA 2A3UA 4R0QA 2Q9MA 3DWZA 4PM9A 1XKZA 2V20A 2UWXA 4KQRA 3M2KA 1FR1A 5EVIA 1ESUA 2QPNA 5CECA 3LCEA 4OPQA 3ZG7B 3IWIA 1K38A 4PM8A 3BLSA 1K56D 4WYYA 5M19A 4X6TA 4R4SA 3D4FA 5M18A 3PBTA 2XQZA 2IWBA 2CC1A 2DRWA 1IELA 3A3JA 3OPRA 3PBSA 1KVMA 5F1GA 3NDGA 1KDSA 3G35A 3N8SA 1GHPA 1K55C 3ITAA 4WZ5A 3DW0A 5CGSA 1W79A 4GN2A 5A90A 5KMWA 2C5WB 4U3TA 2RL3A 5TR7A 1IYQA 4D2OA 4PPRA 1I2SA 3V39A 1G68A 3MBZA 3VOYA 4IEDA 1KGGA 4R3BA 5J8XA 3HL9A 1I2WA 5FI2A 5FQ9A 4ZJ2A 3SS3A 3VP2A 1OMEA 3W4OA 5A92A 1PWCA 3V50A 5CXWA 4FSFA 4ZDXA 2FFYA 3WS0A 1NRFA 4JLFA 1JTGA 4JF5A 5JYPA 3A3DA 1YT4A 5GLBA 3OPLA 3C7UA 1LLBA 4GDNA 3VOZA 3QNCA 3QNBA 2XD5A 4OOYA 3IH9A 4S2NA 5CTNA 5AQ9A 1ESIA 3V5MA 2Y2GA 3EQVA 2HDRA 3VP0A 1ALQA 3IF6C 3IXHA 1SCWA 4OQ0A 5FI6A 3ZGAB 4HESA 2EFUA 3G32A 3OCLA 2G2UA 3IXDA 4B4ZA 4K0WA 3I7JA 4E6XA 3OPPA 2ZQ9A 1HTZA 3FV7A 2WKIA 3M6HA 1K54C 4FD8A 4LCLA 1MWSA 3G4PA 4LCMA 2OLVA 2V1ZA 3IXGA 1PYYA 3SH8A 4IVKA 1VQQA 3IF6B 3TG9A 3GRJA 3UPNA 1PW1A 4E3IA 4YINA 1YLJA 3G2YA 3GR2A 1E25A 3IHBA 4QY5A 1ERMA 1Q2PA 2Y55A 4N1HA 1NZOA 1GA9A 1IYOA 3HLFA 1XGIA 1L0EA 5F83A 4P87A 2J9OA 1H8YA 1QMFA 4K0XA 4E6WA 2EX6A 2WZXA 5JYOA 2R9XA 5HFOA 4R23A 3BLMA 1SHVA 1NJ4A 4QD4A 5HAQA 1YQSA 2XFTA 5FQJA 1YLWA 3S22A 3TOIA 4BLMA 5GLAA 1M6KA 3O88A 4OKPA 3P09A 1JVJA 4Y7PA 3C5AA 4DE2A 3DTMA 4OOMA 3S4XA 4WELA 3MFDA 3M2JA 2ZMAA 1QMEA 3QHYA 3Q1FA 3N8RA 2Y2NA 3MKFA 3MXRA 1W5DA 5EVIC 3ZFZA 5CEBA 3UPOA 2DCFA 1Q2QA 4OQGA 5HX9A 3RXWA 1K6SA 3VSKA 2C6WB 3LY3A 4DDSA 2WGIA 5FI7A 2QMIA 4L0LA 5A93A 2XDMA 1ONHA 2P9VB 4WZ5C 5FQIA 3ZDJA 3BFGA 3N4IA 4JF4A 3RXXA 4HBTA 3IF5A 5TGFA 3BFEA 1BLPA 5FAPA 1XP4A 5EOEA 4BENA 4PM5A 5GHZA 4P85A 1CEGA 2Y2QA 5E2EA 2GDNA 4X55A 3IWOA 4BL2A 3OCNA 1YMSA 2DNSA 2JC7A 4ZJ3A 3WRZA 4KZ9A 1YLYA 4KENB 3S1YA 1BLSA 5FAQA 3Q82A 3IH8A 4B4XA 1FCMA 2Z2LB 3Q7VA 2XR0A 3UNWA 4OPRA 2ZC3B 4FCFA 3GQZA 3W4PA 2A49A 3HLDA 4S2KA 4WMCA 5GL9A 5L2FA 2HP6A 4E3JA 3GV9A 1LL9A 2ZC4B 3LO7A 4RX2A 4S2NC 1BLCA 3PBQA 1GHMA 1H5XA 1ONGA 1S0WA 5CGXA 3C4OA 4OOLA 2E8IA 4EQIA 1E3UA 5BOHA 4K91A 5HW3A 1J9MA 1EWZA 3CZDA 3VFFA 1HVBA 3NDEA 1GCEA 3MKEA 1XX2A 1BULA 4X56A 4N1XA 4MBHA 3UDXA 4OP8A 2JCHA 2Z2MB 4ZBEA 1FSWA 4EBLA 3O3VA 5EPHA 3A3FA 3MZEA 5KSCA 1ZKJA 1ZG4A 4KZ8A 3OZHA 5I94A 3HUMA 3MZDA 4E3NA 4ID4A 3JYIA 3BEBA 2HDUA 2PBYA 2WK0A 5EOOA 4GKUA 4X69A 3WS4A 3WS2A 3O87A 2XEPA 3BFFA 3V3SA 3ZG8B 4IVIA 3GVBA 2XLNA 3FKVA 2WADA 2J9PA 1TDLA 2JE5A 2Y2JA 3HLEA 1O7EA 2ZLYA 1SKFA 4GD6A 4UA6A 4MBFA 5CHUA 5GHYA 4ZAMA 5EVLA 3VSLA 4EUZA 5KSHA 4OPZA 4JKTA 3SH7A 1ZC2A 3AGFA 1C3BA 1WYCA 4C6YA 3ZG9B 4UA7A 2Y91A 2ZM0A 2WGWA 3GTCA 2EX2A 2ZD8A 4R1GA 5G18A 5U47A 1KE4A 1RGYA 4UAAA 2X01A 4IBXA 4PM7A 5DF8A 3N6IA 4H8RA 1MY8A 3IWQA 1PWGA 4RX3A 5EECA 4XUXA 3UPPA 3HVFA 3O86A 4S2LA 4KZ6A 5CEDA 5AQAA 4X68A 1L0DA 4RYEA 4OPYA 3NC8A 2ZC5B 4B88A 2PU4A 3ZNYA 4Z9QA 2QZ6A 1G6AA 4LV2A 5E2FA 1K56A 4XXRA 4E3KA 1MBLA 1PI5A 2ZC6B 3IT9A 5FAOA 3NBLA 3WWXA 5M1AA 1NYYA 2H10A 4O7DA 1VM1A 5E2HA 2ZJ9A 3HBRA 4MEZA 4DF6A 4DXBA 4JF6A 4JPMA 4CJNA 3VP3A 1KE0A 3ISGA 4KZ4A 2H0TA 3IXBA 1K4EA 5GLCA 4A5RA 4S2OA 3VFHA 1ZG6A 4GB7A 3E2KA 2WZZA 4KZAA 4BL3A 2ZQAA 3HUOA 4M3KA 1ES5A 2Y2HA 4QU3A 4S2MA 4MLLA 3Q7VB 1NXYA 1YLTA 3FYZA 4JXGA 1BZAA 4C3QA 4C75A 2EXBA 2EXAA 2Y2MA 4DDYA 2Y2OA 1BTLA 4DE0A 2R9WA 2Y2KA 4OLDA 4S2PA 1HZOA 3B3XA 1JWVA 2RCXA 1WYBA 5DF9A 1KE3A 2Q9NA 2J7VA 3SH9A 5EVID 4U0TA 3C7VA 4N92A 4OP5A 1L0GA 4QY6A 5EVIB 1MWUA 3PAGA 3LY4A 2WGVA 5E2GA 5CTMA 4JXVA 3ITBA 1WE4A 1IEMA 1PZOA 1N4OA 3UDFA 3WS5A 4QJGA 1PZPA 5DF7A 1XGJA 5AQ7A 3SS5A 4EWFA 2WKEA 4BJPA 2EX9A 2JBFA 3HREA 1EROA 3A3EA 3NCKA 4OVDA 4KG2A 4OONA 1MWTA 2Y2IA 1FCOA 1YM1A 1U60A 4F94A 1BSGA 2ZQCA 1FR6A 2IWCA 1JTDA 4Y0TA 3MXSA 1TDGA 5GHXA 4KZ3A 2B5RA 3BRMA 4S2JA 1ES4A 3PBNA 1IYSA 4MBKA 1BT5A 1JWZA 1L0FA 1TVFA 4KG5A 1RCJA 4OQIA 4YFMA 2ZM8A 1XA1A 4ZTKA 1KDWA 2XD1A 2WKHA 2G2WA 4NETA 5A91A 1N9BA 4E3MA 2X02A 3BFDA 4R4RA 2X71A 5GLDA 1DY6A 2WAEA 1YLPA 4WM9A 3ZVTA 2XH9A 1CK3A 2EX8A 4P0MA 2ZQDA 2ZQ8A 1IYPA 3GMWA 3IHAA 2OSUA 2J8YA 1PIOA 1LL5A 2BLSA 2H5SA 1PI4A 5FQKA 3VP4A 4RA7A 5DTSA 4EBNA 3EQUA 4E3LA 1SDEA 5CGWA 5DVAA 1GA0A 5CRFA 5FSRA 3WRTA 2WUQA 3N8LA 1SDNA 3CMZA 1RP5A 2XK1A 4NK3A 4QB8A 1CI9A 4P6BA 4GD8A 1W7FA 1K57A 3W4QA 3ZVWA 2V2FF 1K4FA 1W8QA 2XGNA 3BFCA 5HARA 3UO9A 4WEKA 3C4PA 1MWRA 2H0YA 3DWKA 3NIAA 1I5QA 4GDBA 4LV0A 4CPKA 3ZCZA 4BD1A 3OC2A 1PW8A 3UN7A 4HBUA 2IWDA 4WBGA 2ZM2A 3UE1A 5KZHA 2BG1A 3A3IA 1TEMA 1PWDA 2FFFB 3G31A 5CHJA 3MZFA 5F82A 2XFSA 5FQQA 1K6RA 4UHUA 1HD8A 3BECA 3PTEA 5IHVA 4KZBA 3Q81A 2HP5A 1IKGA 1DJAA 2VGJA 4DE1A 1CI8A 1NZUA 4JBFA 5FA7A 3E2LA 1BUEA 4N9LA 4S2IA 4U0XA 1Y54A 2WAFA 3HLCA 3W8KA 3ZHHA 4PM6A 3PBRA 1ES3A 4KQOA 2XF3A 4KZ5A 5D3OA 5AQBA 2P74A 5FASA 4HEFA 4JXSA 1W8YA 4X53A 1XA7A 5HAPA 1ES2A 5TFQA 3HUNA 1H8ZA 2VGKA 2ZC7A 3HLGA 3UY6A 3AGEA 3LEZA 2HP9A 3BYDA 1RGZA 1LI9A 1Z6FA 4ZJ1A 2OV5A 3ZG5A 4E3OA 5E43A 2WYXA 4LENA 1CEFA 1FCNA 2HPBA 2ZQ7A 3BM6A 4JXWA 5CHMA 3UE3A 1E4DA 1K55A 4N9KA 5DTTA 1YMXA 1XXMA 1LHYA 1ERQA 4KG6A 4WMCD 1NYMA 3Q7ZA 1YLZA 3SS4A 2Y4AA 4Q8IA 3HLBA 4R3JA 3FKWA 4LV1A 1JWPA 4KQQA 5DTKA 4EBPA 4IBRA 1L2SA 3NI9A 1E3UD 1NY0A 5FATA 5HL1A 3FZCA 1M40A 3N7WA 1FQGA 1EI5A 2OLUA 3ZNTA 5EUAA 4DE3A 3HLWA 3ZG0A 4WEJA 1FSYA 3RJUA 2Y2LA 1MKIA 3WS1A 3GSGA 4OH0A 3UE0A 3NY4A 1K25A 4Y0UA 1DJBA 3IF6A 3OPHA 1BLHA 1K57C 3V3RA 3VMAA 3Q07A 2EFXA 4Y0OA 4OQHA 4PMAA 4DRTA 3CG5A 3PAEA 2I72A 5FDHA 1S6RA 1AXBA 4BQMA 3AGDA 3PBOA 1K54A 3FWLA 1KGFA 5HAIA 5EE8A 1IKIA 2Y59A 1MXOA 4GNUA 4BD0A 1MPLA 1O07A 1FOFA 2Y2PA 3P98A 4FH2A 1LI0A 4OLGA 3CJMA 4UA9A 3TSGA 3G34A 2HDSA 4QHCA 4MNRA 4XUZA 3IQAA 1GHIA 3G2ZA 4RVAA 4DKIA 4EV4A 4KZ7A 5F1FA 4GOGA 3G30A 2WGWB 1DJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ4 A;  3M6B A;  4GZB A;  1XPB A;  1KGE A;  1KVL A;  3VP1 A;  5FQM A;  3UDI A;  4DXC A;  4LV3 A;  3SOI A;  2P9V A;  4FH4 A;  2HDQ A;  2PU2 A;  5CER A;  2A3U A;  4R0Q A;  2Q9M A;  3DWZ A;  4PM9 A;  1XKZ A;  2V20 A;  2UWX A;  4KQR A;  3M2K A;  1FR1 A;  5EVI A;  1ESU A;  2QPN A;  5CEC A;  3LCE A;  4OPQ A;  3ZG7 B;  3IWI A;  1K38 A;  4PM8 A;  3BLS A;  1K56 D;  4WYY A;  5M19 A;  4X6T A;  4R4S A;  3D4F A;  5M18 A;  3PBT A;  2XQZ A;  2IWB A;  2CC1 A;  2DRW A;  1IEL A;  3A3J A;  3OPR A;  3PBS A;  1KVM A;  5F1G A;  3NDG A;  1KDS A;  3G35 A;  3N8S A;  1GHP A;  1K55 C;  3ITA A;  4WZ5 A;  3DW0 A;  5CGS A;  1W79 A;  4GN2 A;  5A90 A;  5KMW A;  2C5W B;  4U3T A;  2RL3 A;  5TR7 A;  1IYQ A;  4D2O A;  4PPR A;  1I2S A;  3V39 A;  1G68 A;  3MBZ A;  3VOY A;  4IED A;  1KGG A;  4R3B A;  5J8X A;  3HL9 A;  1I2W A;  5FI2 A;  5FQ9 A;  4ZJ2 A;  3SS3 A;  3VP2 A;  1OME A;  3W4O A;  5A92 A;  1PWC A;  3V50 A;  5CXW A;  4FSF A;  4ZDX A;  2FFY A;  3WS0 A;  1NRF A;  4JLF A;  1JTG A;  4JF5 A;  5JYP A;  3A3D A;  1YT4 A;  5GLB A;  3OPL A;  3C7U A;  1LLB A;  4GDN A;  3VOZ A;  3QNC A;  3QNB A;  2XD5 A;  4OOY A;  3IH9 A;  4S2N A;  5CTN A;  5AQ9 A;  1ESI A;  3V5M A;  2Y2G A;  3EQV A;  2HDR A;  3VP0 A;  1ALQ A;  3IF6 C;  3IXH A;  1SCW A;  4OQ0 A;  5FI6 A;  3ZGA B;  4HES A;  2EFU A;  3G32 A;  3OCL A;  2G2U A;  3IXD A;  4B4Z A;  4K0W A;  3I7J A;  4E6X A;  3OPP A;  2ZQ9 A;  1HTZ A;  3FV7 A;  2WKI A;  3M6H A;  1K54 C;  4FD8 A;  4LCL A;  1MWS A;  3G4P A;  4LCM A;  2OLV A;  2V1Z A;  3IXG A;  1PYY A;  3SH8 A;  4IVK A;  1VQQ A;  3IF6 B;  3TG9 A;  3GRJ A;  3UPN A;  1PW1 A;  4E3I A;  4YIN A;  1YLJ A;  3G2Y A;  3GR2 A;  1E25 A;  3IHB A;  4QY5 A;  1ERM A;  1Q2P A;  2Y55 A;  4N1H A;  1NZO A;  1GA9 A;  1IYO A;  3HLF A;  1XGI A;  1L0E A;  5F83 A;  4P87 A;  2J9O A;  1H8Y A;  1QMF A;  4K0X A;  4E6W A;  2EX6 A;  2WZX A;  5JYO A;  2R9X A;  5HFO A;  4R23 A;  3BLM A;  1SHV A;  1NJ4 A;  4QD4 A;  5HAQ A;  1YQS A;  2XFT A;  5FQJ A;  1YLW A;  3S22 A;  3TOI A;  4BLM A;  5GLA A;  1M6K A;  3O88 A;  4OKP A;  3P09 A;  1JVJ A;  4Y7P A;  3C5A A;  4DE2 A;  3DTM A;  4OOM A;  3S4X A;  4WEL A;  3MFD A;  3M2J A;  2ZMA A;  1QME A;  3QHY A;  3Q1F A;  3N8R A;  2Y2N A;  3MKF A;  3MXR A;  1W5D A;  5EVI C;  3ZFZ A;  5CEB A;  3UPO A;  2DCF A;  1Q2Q A;  4OQG A;  5HX9 A;  3RXW A;  1K6S A;  3VSK A;  2C6W B;  3LY3 A;  4DDS A;  2WGI A;  5FI7 A;  2QMI A;  4L0L A;  5A93 A;  2XDM A;  1ONH A;  2P9V B;  4WZ5 C;  5FQI A;  3ZDJ A;  3BFG A;  3N4I A;  4JF4 A;  3RXX A;  4HBT A;  3IF5 A;  5TGF A;  3BFE A;  1BLP A;  5FAP A;  1XP4 A;  5EOE A;  4BEN A;  4PM5 A;  5GHZ A;  4P85 A;  1CEG A;  2Y2Q A;  5E2E A;  2GDN A;  4X55 A;  3IWO A;  4BL2 A;  3OCN A;  1YMS A;  2DNS A;  2JC7 A;  4ZJ3 A;  3WRZ A;  4KZ9 A;  1YLY A;  4KEN B;  3S1Y A;  1BLS A;  5FAQ A;  3Q82 A;  3IH8 A;  4B4X A;  1FCM A;  2Z2L B;  3Q7V A;  2XR0 A;  3UNW A;  4OPR A;  2ZC3 B;  4FCF A;  3GQZ A;  3W4P A;  2A49 A;  3HLD A;  4S2K A;  4WMC A;  5GL9 A;  5L2F A;  2HP6 A;  4E3J A;  3GV9 A;  1LL9 A;  2ZC4 B;  3LO7 A;  4RX2 A;  4S2N C;  1BLC A;  3PBQ A;  1GHM A;  1H5X A;  1ONG A;  1S0W A;  5CGX A;  3C4O A;  4OOL A;  2E8I A;  4EQI A;  1E3U A;  5BOH A;  4K91 A;  5HW3 A;  1J9M A;  1EWZ A;  3CZD A;  3VFF A;  1HVB A;  3NDE A;  1GCE A;  3MKE A;  1XX2 A;  1BUL A;  4X56 A;  4N1X A;  4MBH A;  3UDX A;  4OP8 A;  2JCH A;  2Z2M B;  4ZBE A;  1FSW A;  4EBL A;  3O3V A;  5EPH A;  3A3F A;  3MZE A;  5KSC A;  1ZKJ A;  1ZG4 A;  4KZ8 A;  3OZH A;  5I94 A;  3HUM A;  3MZD A;  4E3N A;  4ID4 A;  3JYI A;  3BEB A;  2HDU A;  2PBY A;  2WK0 A;  5EOO A;  4GKU A;  4X69 A;  3WS4 A;  3WS2 A;  3O87 A;  2XEP A;  3BFF A;  3V3S A;  3ZG8 B;  4IVI A;  3GVB A;  2XLN A;  3FKV A;  2WAD A;  2J9P A;  1TDL A;  2JE5 A;  2Y2J A;  3HLE A;  1O7E A;  2ZLY A;  1SKF A;  4GD6 A;  4UA6 A;  4MBF A;  5CHU A;  5GHY A;  4ZAM A;  5EVL A;  3VSL A;  4EUZ A;  5KSH A;  4OPZ A;  4JKT A;  3SH7 A;  1ZC2 A;  3AGF A;  1C3B A;  1WYC A;  4C6Y A;  3ZG9 B;  4UA7 A;  2Y91 A;  2ZM0 A;  2WGW A;  3GTC A;  2EX2 A;  2ZD8 A;  4R1G A;  5G18 A;  5U47 A;  1KE4 A;  1RGY A;  4UAA A;  2X01 A;  4IBX A;  4PM7 A;  5DF8 A;  3N6I A;  4H8R A;  1MY8 A;  3IWQ A;  1PWG A;  4RX3 A;  5EEC A;  4XUX A;  3UPP A;  3HVF A;  3O86 A;  4S2L A;  4KZ6 A;  5CED A;  5AQA A;  4X68 A;  1L0D A;  4RYE A;  4OPY A;  3NC8 A;  2ZC5 B;  4B88 A;  2PU4 A;  3ZNY A;  4Z9Q A;  2QZ6 A;  1G6A A;  4LV2 A;  5E2F A;  1K56 A;  4XXR A;  4E3K A;  1MBL A;  1PI5 A;  2ZC6 B;  3IT9 A;  5FAO A;  3NBL A;  3WWX A;  5M1A A;  1NYY A;  2H10 A;  4O7D A;  1VM1 A;  5E2H A;  2ZJ9 A;  3HBR A;  4MEZ A;  4DF6 A;  4DXB A;  4JF6 A;  4JPM A;  4CJN A;  3VP3 A;  1KE0 A;  3ISG A;  4KZ4 A;  2H0T A;  3IXB A;  1K4E A;  5GLC A;  4A5R A;  4S2O A;  3VFH A;  1ZG6 A;  4GB7 A;  3E2K A;  2WZZ A;  4KZA A;  4BL3 A;  2ZQA A;  3HUO A;  4M3K A;  1ES5 A;  2Y2H A;  4QU3 A;  4S2M A;  4MLL A;  3Q7V B;  1NXY A;  1YLT A;  3FYZ A;  4JXG A;  1BZA A;  4C3Q A;  4C75 A;  2EXB A;  2EXA A;  2Y2M A;  4DDY A;  2Y2O A;  1BTL A;  4DE0 A;  2R9W A;  2Y2K A;  4OLD A;  4S2P A;  1HZO A;  3B3X A;  1JWV A;  2RCX A;  1WYB A;  5DF9 A;  1KE3 A;  2Q9N A;  2J7V A;  3SH9 A;  5EVI D;  4U0T A;  3C7V A;  4N92 A;  4OP5 A;  1L0G A;  4QY6 A;  5EVI B;  1MWU A;  3PAG A;  3LY4 A;  2WGV A;  5E2G A;  5CTM A;  4JXV A;  3ITB A;  1WE4 A;  1IEM A;  1PZO A;  1N4O A;  3UDF A;  3WS5 A;  4QJG A;  1PZP A;  5DF7 A;  1XGJ A;  5AQ7 A;  3SS5 A;  4EWF A;  2WKE A;  4BJP A;  2EX9 A;  2JBF A;  3HRE A;  1ERO A;  3A3E A;  3NCK A;  4OVD A;  4KG2 A;  4OON A;  1MWT A;  2Y2I A;  1FCO A;  1YM1 A;  1U60 A;  4F94 A;  1BSG A;  2ZQC A;  1FR6 A;  2IWC A;  1JTD A;  4Y0T A;  3MXS A;  1TDG A;  5GHX A;  4KZ3 A;  2B5R A;  3BRM A;  4S2J A;  1ES4 A;  3PBN A;  1IYS A;  4MBK A;  1BT5 A;  1JWZ A;  1L0F A;  1TVF A;  4KG5 A;  1RCJ A;  4OQI A;  4YFM A;  2ZM8 A;  1XA1 A;  4ZTK A;  1KDW A;  2XD1 A;  2WKH A;  2G2W A;  4NET A;  5A91 A;  1N9B A;  4E3M A;  2X02 A;  3BFD A;  4R4R A;  2X71 A;  5GLD A;  1DY6 A;  2WAE A;  1YLP A;  4WM9 A;  3ZVT A;  2XH9 A;  1CK3 A;  2EX8 A;  4P0M A;  2ZQD A;  2ZQ8 A;  1IYP A;  3GMW A;  3IHA A;  2OSU A;  2J8Y A;  1PIO A;  1LL5 A;  2BLS A;  2H5S A;  1PI4 A;  5FQK A;  3VP4 A;  4RA7 A;  5DTS A;  4EBN A;  3EQU A;  4E3L A;  1SDE A;  5CGW A;  5DVA A;  1GA0 A;  5CRF A;  5FSR A;  3WRT A;  2WUQ A;  3N8L A;  1SDN A;  3CMZ A;  1RP5 A;  2XK1 A;  4NK3 A;  4QB8 A;  1CI9 A;  4P6B A;  4GD8 A;  1W7F A;  1K57 A;  3W4Q A;  3ZVW A;  2V2F F;  1K4F A;  1W8Q A;  2XGN A;  3BFC A;  5HAR A;  3UO9 A;  4WEK A;  3C4P A;  1MWR A;  2H0Y A;  3DWK A;  3NIA A;  1I5Q A;  4GDB A;  4LV0 A;  4CPK A;  3ZCZ A;  4BD1 A;  3OC2 A;  1PW8 A;  3UN7 A;  4HBU A;  2IWD A;  4WBG A;  2ZM2 A;  3UE1 A;  5KZH A;  2BG1 A;  3A3I A;  1TEM A;  1PWD A;  2FFF B;  3G31 A;  5CHJ A;  3MZF A;  5F82 A;  2XFS A;  5FQQ A;  1K6R A;  4UHU A;  1HD8 A;  3BEC A;  3PTE A;  5IHV A;  4KZB A;  3Q81 A;  2HP5 A;  1IKG A;  1DJA A;  2VGJ A;  4DE1 A;  1CI8 A;  1NZU A;  4JBF A;  5FA7 A;  3E2L A;  1BUE A;  4N9L A;  4S2I A;  4U0X A;  1Y54 A;  2WAF A;  3HLC A;  3W8K A;  3ZHH A;  4PM6 A;  3PBR A;  1ES3 A;  4KQO A;  2XF3 A;  4KZ5 A;  5D3O A;  5AQB A;  2P74 A;  5FAS A;  4HEF A;  4JXS A;  1W8Y A;  4X53 A;  1XA7 A;  5HAP A;  1ES2 A;  5TFQ A;  3HUN A;  1H8Z A;  2VGK A;  2ZC7 A;  3HLG A;  3UY6 A;  3AGE A;  3LEZ A;  2HP9 A;  3BYD A;  1RGZ A;  1LI9 A;  1Z6F A;  4ZJ1 A;  2OV5 A;  3ZG5 A;  4E3O A;  5E43 A;  2WYX A;  4LEN A;  1CEF A;  1FCN A;  2HPB A;  2ZQ7 A;  3BM6 A;  4JXW A;  5CHM A;  3UE3 A;  1E4D A;  1K55 A;  4N9K A;  5DTT A;  1YMX A;  1XXM A;  1LHY A;  1ERQ A;  4KG6 A;  4WMC D;  1NYM A;  3Q7Z A;  1YLZ A;  3SS4 A;  2Y4A A;  4Q8I A;  3HLB A;  4R3J A;  3FKW A;  4LV1 A;  1JWP A;  4KQQ A;  5DTK A;  4EBP A;  4IBR A;  1L2S A;  3NI9 A;  1E3U D;  1NY0 A;  5FAT A;  5HL1 A;  3FZC A;  1M40 A;  3N7W A;  1FQG A;  1EI5 A;  2OLU A;  3ZNT A;  5EUA A;  4DE3 A;  3HLW A;  3ZG0 A;  4WEJ A;  1FSY A;  3RJU A;  2Y2L A;  1MKI A;  3WS1 A;  3GSG A;  4OH0 A;  3UE0 A;  3NY4 A;  1K25 A;  4Y0U A;  1DJB A;  3IF6 A;  3OPH A;  1BLH A;  1K57 C;  3V3R A;  3VMA A;  3Q07 A;  2EFX A;  4Y0O A;  4OQH A;  4PMA A;  4DRT A;  3CG5 A;  3PAE A;  2I72 A;  5FDH A;  1S6R A;  1AXB A;  4BQM A;  3AGD A;  3PBO A;  1K54 A;  3FWL A;  1KGF A;  5HAI A;  5EE8 A;  1IKI A;  2Y59 A;  1MXO A;  4GNU A;  4BD0 A;  1MPL A;  1O07 A;  1FOF A;  2Y2P A;  3P98 A;  4FH2 A;  1LI0 A;  4OLG A;  3CJM A;  4UA9 A;  3TSG A;  3G34 A;  2HDS A;  4QHC A;  4MNR A;  4XUZ A;  3IQA A;  1GHI A;  3G2Z A;  4RVA A;  4DKI A;  4EV4 A;  4KZ7 A;  5F1F A;  4GOG A;  3G30 A;  2WGW B;  1DJC A; 
#chains in the Genus database with same CATH topology
 1XPB A;  4LV3 A;  5CER A;  2A3U A;  4R0Q A;  3DWZ A;  5HPF A;  1ESU A;  3DBA A;  1K56 D;  3D4F A;  2IWB A;  2CC1 A;  2VLG A;  2DRW A;  2V1A A;  5EVE A;  3NDG A;  1KDS A;  3G35 A;  1GHP A;  1K55 C;  5A90 A;  5KMW A;  3DW0 A;  2PR6 A;  4D2O A;  3V39 A;  4Q0I A;  4ZJ2 A;  4WUJ A;  3RFB A;  5CXW A;  2FFY A;  4JLF A;  1JTG A;  4Q0J A;  4OOY A;  2LB9 A;  3LR4 A;  4B93 A;  4DJ2 A;  4JGP A;  3IF6 C;  3IXH A;  4G3W A;  3I7J A;  2D01 A;  2WKI A;  4LCM A;  1PYY A;  4IVK A;  1YSP A;  3IF6 B;  4LPZ A;  3UPN A;  4CLC D;  5F5Y A;  3IHB A;  1E25 A;  4QY5 A;  2J3T D;  4IHQ A;  3JVU A;  4B9O A;  3S7Q A;  1QMF A;  4E6W A;  1MZU A;  5JYO A;  5HFO A;  1NJ4 A;  4QD4 A;  4BWI A;  1M6K A;  1SKO B;  4DE2 A;  4R3A A;  4OOM A;  5EM1 A;  1AWI A;  4O0P A;  3Q1F A;  3N8R A;  2Y2N A;  1ZHH B;  3MKF A;  1W5D A;  2JKG A;  3MQQ A;  1XJ3 A;  5EVI C;  4F3L B;  2DCF A;  4OQG A;  3R7W A;  1K6S A;  4DDS A;  5A93 A;  1ONH A;  5FAP A;  3O5Y A;  4PM5 A;  5GHZ A;  5E2E A;  2PDR A;  5IU1 A;  2P04 A;  1YMS A;  2DNS A;  3WRZ A;  1BLS A;  5AVF A;  2Z2L B;  3Q7V A;  3UNW A;  4FCF A;  4K08 A;  2A49 A;  5L2F A;  2HP6 A;  3GV9 A;  1LL9 A;  3LO7 A;  3EOI A;  3KSI A;  4S2N C;  1BLC A;  1GHM A;  5CGX A;  4OOL A;  1E3U A;  4FOF A;  3C8C A;  4K91 A;  2WKQ A;  3ICY A;  4MBH A;  3UDX A;  1D06 A;  5EPH A;  1ZKJ A;  4KZ8 A;  4HOI A;  3MZD A;  3A0V A;  3JYI A;  2GJ3 A;  3QP5 A;  3WS4 A;  3BFF A;  3ZG8 B;  3GVB A;  1IOU A;  4Z1W A;  1TDL A;  5EM0 A;  1O7E A;  4UA6 A;  5EVL A;  4EUZ A;  5KSH A;  1P0Z A;  1WA9 A;  4OPZ A;  1ZC2 A;  1GSV A;  1C3B A;  2WGW A;  4CLC E;  3LEQ A;  4IBX A;  3N6I A;  5EEC A;  4RX3 A;  4XUX A;  3UPP A;  4X25 A;  4S2L A;  5CED A;  4KZ6 A;  2VZW A;  1V9Z A;  4OPY A;  2ZC5 B;  2QZ6 A;  4LV2 A;  3NBL A;  2H10 A;  2ZJ9 A;  2Q0O A;  4MEZ A;  4DXB A;  4JF6 A;  4LRY C;  4JPM A;  4KZ4 A;  4DMZ A;  3VFH A;  1ZG6 A;  4MN6 A;  4GB7 A;  3E2K A;  1OTD A;  2WZZ A;  4BL3 A;  4MLL A;  3FYZ A;  1XJ4 A;  4DDY A;  1BTL A;  2R9W A;  2ZL1 B;  3UME A;  5L09 A;  4JGO A;  2OOL A;  2RCX A;  1WYB A;  4NXE A;  2VA0 A;  5DF9 A;  1KE3 A;  4N92 A;  4OP5 A;  3TW8 A;  3KSF A;  4Y2F A;  4IUK A;  4QY6 A;  2VKS A;  5IS1 A;  5CTM A;  4RQ9 A;  3ITB A;  1N4O A;  4QJG A;  2GNX A;  5DF7 A;  5AQ7 A;  4EES A;  3HRE A;  4OON A;  2JKR M;  1YM1 A;  1U60 A;  4HNB A;  4F94 A;  3CUE A;  3DAV A;  4WL9 A;  1JTD A;  5GHX A;  1CF0 A;  4KZ3 A;  2B5R A;  1IYS A;  1TVF A;  1SKO A;  3ZQ5 A;  5A91 A;  2R78 A;  1N9B A;  2X71 A;  4F3L A;  4HJ4 A;  2WAE A;  3ZVT A;  4P0M A;  2ZQD A;  3IHA A;  2J8Y A;  1PIO A;  2H5S A;  3T1X A;  4RA7 A;  4EBN A;  4E3L A;  1W63 Q;  1HLU P;  3NOT C;  2WUQ A;  1SDN A;  2LB5 A;  3CMZ A;  2M7U A;  2XK1 A;  4QWO A;  4P6B A;  4H6J A;  3W4Q A;  1XFQ A;  1T19 A;  3DWK A;  2H0Y A;  4GDB A;  3ZCZ A;  5HWT A;  2W0N A;  4JGQ A;  4IUH A;  4ZRR A;  3UE1 A;  2BG1 A;  4EW7 A;  1PWD A;  2FFF B;  5CHJ A;  3EGD C;  3BEC A;  5IHV A;  4LLO B;  1IKG A;  1DJA A;  4DE1 A;  2JN7 A;  2W1T B;  4Q0H A;  4U0X A;  1Y54 A;  4KUO A;  3HLC A;  4ME4 A;  3DTK A;  4PM6 A;  5FAS A;  4JXS A;  5TFQ A;  2VGK A;  2ZC7 A;  4LFU A;  2OAQ 1;  3L7H A;  2A24 B;  2J3T C;  4ZJ1 A;  4E3O A;  3B33 A;  5E43 A;  3MQO A;  2E8J A;  2ZQ7 A;  3QP4 A;  5CHM A;  3UE3 A;  4GS9 A;  1XXM A;  4CLC B;  1LHY A;  4KG6 A;  4WMC D;  3KSH A;  5IT5 A;  5KIZ A;  3SS4 A;  4Q8I A;  4R3J A;  1DP8 A;  3FKW A;  5DTK A;  5TJJ A;  3E4O A;  1M40 A;  2JKR I;  5DKK A;  1FQG A;  1EI5 A;  3ZG0 A;  3CPT B;  3RJU A;  1MKI A;  3OOV A;  3NY4 A;  4Y0U A;  3OPH A;  1K57 C;  4EET B;  3Q07 A;  4PMA A;  3LR3 A;  4DRT A;  3CG5 A;  3FWL A;  3MF0 A;  4BD0 A;  1MPL A;  3CJM A;  2HDS A;  4MNR A;  3L9K A;  4XUZ A;  4DKI A;  4NXG A;  4GOG A;  3HJK A;  5L07 A;  1KVL A;  2V9A A;  4HHD A;  3E0Y A;  3UDI A;  2HDQ A;  2PYR A;  4PM9 A;  1XKZ A;  2V20 A;  4KQR A;  1Z09 A;  2QPN A;  3LCE A;  3ZG7 B;  3IWI A;  3BLS A;  4WYY A;  5M18 A;  3A3J A;  3OPR A;  1PFL A;  5F1G A;  5CGS A;  3VE3 A;  1W79 A;  4GN2 A;  3BY8 A;  1FIL A;  1S67 L;  3BW6 A;  4U3T A;  2RL3 A;  2P7J A;  1G68 A;  3MBZ A;  3VOY A;  4IED A;  3SS3 A;  3VP2 A;  4FSF A;  4ZDX A;  5G4Y A;  1NRF A;  4JF5 A;  5JYP A;  3A3D A;  3OPL A;  3CAX A;  4MMN A;  3TE8 A;  3V5M A;  2Y2G A;  2V8F A;  3EQV A;  2HDR A;  1ALQ A;  2ZMF A;  2EFU A;  3IXD A;  1YKD A;  4B4Z A;  3E4P A;  4K0W A;  2ZQ9 A;  1HTZ A;  1YSQ A;  3M6H A;  3F1P A;  3H9W A;  4FD8 A;  1CQA A;  1VQQ A;  1G6O A;  2B95 A;  1F5M A;  1YLJ A;  5J7E A;  4N1H A;  2NUP C;  1NZO A;  4ETX A;  3A0R A;  4BBT A;  3HLF A;  1L0E A;  5F83 A;  4K0X A;  2R9X A;  1SHV A;  3QP6 A;  3S22 A;  4OKP A;  3O88 A;  4NXF A;  3C5A A;  3S4X A;  4WEL A;  3M2J A;  3ZFZ A;  3MXR A;  5HX9 A;  2BAS A;  3VSK A;  5F6A A;  1G5U A;  4UQI S;  2QMI A;  1S1Y A;  2XDM A;  4WZ5 C;  2P9V B;  3ZDJ A;  4JF4 A;  3IF5 A;  1XP4 A;  1TS7 A;  3BQ8 A;  2A24 A;  4P85 A;  3ULF A;  2Y2Q A;  1TD5 A;  2GDN A;  3IWO A;  5FL3 A;  3Q82 A;  4G3K A;  2UV0 E;  4CLC A;  4OPR A;  2ZC3 B;  3GQZ A;  4NKP A;  4PKY A;  3EGX C;  1K0K A;  3PBQ A;  1ONG A;  3UB5 P;  2E8I A;  3TJZ C;  1J9M A;  3CPT A;  3MKE A;  1BUL A;  4N1X A;  3A3F A;  3MZE A;  3FG8 A;  3OZH A;  3HUM A;  4L9G A;  4E3N A;  2WK0 A;  4GKU A;  2Y79 A;  4WN5 A;  4I3J A;  2Z6C A;  3O87 A;  3T4T A;  2XEP A;  4WLA A;  4NXB A;  4IVI A;  3FKV A;  2WAD A;  2JE5 A;  3HLE A;  3KX0 X;  2O0Y A;  5GHY A;  1S4R A;  4LRZ E;  4JKT A;  3SH7 A;  3K2N A;  1WYC A;  3F1N B;  4C6Y A;  4UA7 A;  2ZM0 A;  1Y4O A;  3GTC A;  2EX2 A;  3UB6 A;  5U47 A;  2INW A;  2L4R A;  4PM7 A;  5DF8 A;  4H8R A;  1MY8 A;  3IWQ A;  1PWG A;  1TF1 A;  4EEP A;  1ZTU A;  3HVF A;  3O86 A;  1L0D A;  2AVX A;  2PU4 A;  4E3K A;  1G6A A;  4HP9 A;  3EWK A;  5FAO A;  3WWX A;  5M1A A;  1NYY A;  1VM1 A;  3HBR A;  2L0W A;  2V8C A;  3VV4 A;  1T1A A;  1EW0 A;  3VP3 A;  5GLC A;  3ISG A;  2VGL S;  4MN7 A;  3BQA A;  2ZQA A;  4QU3 A;  1TS0 A;  1NXY A;  3F1O B;  3UPO A;  4HJ3 A;  4I3A A;  5FEF A;  3KO6 A;  2EXB A;  2EXA A;  2Y2O A;  4Y3I A;  3C2W A;  1PNE A;  4S2P A;  1HZO A;  4MCW A;  3LIB A;  2Q9N A;  2J7V A;  4O8G A;  5EVI B;  1MWU A;  3PAG A;  3UE6 A;  3H7W B;  1IEM A;  2O99 A;  4GW9 A;  4BJP A;  2JBF A;  3MMH A;  3IS2 B;  2Y2I A;  1FCO A;  1TDG A;  3BRM A;  3UB8 A;  3OLO A;  1ES4 A;  1L3L A;  1BT5 A;  1JWZ A;  1N9L A;  4YFM A;  4KG5 A;  4OQI A;  2ZM8 A;  1XA1 A;  2PBD P;  2WKH A;  2G2W A;  3MR0 A;  2XA7 S;  4E3M A;  5GLD A;  3LIF A;  1YLP A;  3QP2 A;  1IYP A;  4QPR A;  5FQK A;  3S7O A;  2PHY A;  5CGW A;  5DVA A;  1GA0 A;  3WRT A;  3N8L A;  3CHW P;  1UGU A;  3QP1 A;  1W7F A;  2FZ0 A;  1TS6 A;  3UO9 A;  5HAR A;  4WEK A;  5DJU A;  1MWR A;  3NIA A;  1OT6 A;  1PW8 A;  4WBG A;  5KZH A;  3A3I A;  1TEM A;  5J4E A;  2J80 A;  1HD8 A;  5HZH A;  3NEC A;  3Q81 A;  3LYX A;  4PKY G;  1CI8 A;  4JBF A;  1YAX A;  5FA7 A;  4GCZ A;  1BYW A;  4S2I A;  3W8K A;  5D3O A;  2P74 A;  1OTE A;  1W8Y A;  4X53 A;  5HAP A;  3H82 B;  3UY6 A;  3AGE A;  2HP9 A;  4E04 A;  1RGZ A;  1LI9 A;  2OV5 A;  3KYQ A;  3BM6 A;  4JXW A;  3LIE A;  1K55 A;  4N9K A;  1ERQ A;  2PD8 A;  1NYM A;  2PAV P;  3T4J A;  4IBR A;  4FTX A;  5HL1 A;  1E3U D;  1OPX A;  3FZC A;  4Y17 A;  5EUA A;  4DE3 A;  4L9F A;  1FSY A;  3BY9 A;  3GSG A;  3R4K A;  4OH0 A;  1F98 A;  2Y8H A;  3IF6 A;  2QKP A;  1LSV A;  1TS8 A;  2I72 A;  1LT0 A;  3PBO A;  1KGF A;  5HAI A;  2W3E A;  2Y59 A;  5F69 A;  4FH2 A;  4HP4 A;  3F1O A;  3PYP A;  3G2Z A;  4EV4 A;  5F1F A;  3G30 A;  3M6B A;  1S66 L;  3SOI A;  4FH4 A;  2PU2 A;  2VK3 A;  3NOP C;  2Q9M A;  3HCY A;  3D72 A;  4HJ6 A;  1FR1 A;  5EVI A;  1S4S A;  4OPQ A;  1K38 A;  4PM8 A;  3LGO A;  3H7W A;  5M19 A;  4X6T A;  3PBT A;  2XQZ A;  3PBS A;  1KVM A;  3N8S A;  1DRM A;  3LID A;  2C5W B;  3GDI A;  5TR7 A;  4P6Z S;  5J8X A;  4R3B A;  3HL9 A;  1I2W A;  5FQ9 A;  3W4O A;  5A92 A;  2W3F A;  3MXQ A;  3WS0 A;  5EFW A;  5GLB A;  4EQ1 A;  4GDN A;  4CQH A;  3QNB A;  3FPW A;  1XJ6 A;  4S2N A;  2XRN A;  5AQ9 A;  2M7V A;  3HJI A;  2D02 A;  3VP0 A;  1P9R A;  1SCW A;  3ZGA B;  5I5L A;  2G2U A;  3KYE A;  2G7U A;  4E6X A;  1K54 C;  3DTI A;  4LCL A;  1MWS A;  3G4P A;  2OLV A;  2QHK A;  2V1Z A;  3D9Y A;  4WF0 A;  3IXG A;  4E3I A;  2KX6 A;  3PHY A;  4YIN A;  3GR2 A;  1ERM A;  1S1Z A;  2Y55 A;  3NUL A;  3P01 A;  5DKL A;  1IYO A;  1XGI A;  3U2A A;  1H8Y A;  5HDC A;  2EX6 A;  1XFN A;  2EWV A;  2WZX A;  2BTF P;  5HAQ A;  1PRQ A;  1YQS A;  3TOI A;  5GLA A;  2W27 A;  3P09 A;  4Y7P A;  3DTM A;  3MFD A;  1QME A;  2M1C A;  2EWW A;  5LBR A;  3ZYT A;  3RXW A;  3T4Q A;  4I38 A;  1F2K A;  2WGI A;  2YKH A;  5FI7 A;  3T4L A;  1P97 A;  5FQI A;  3BFG A;  4HBT A;  5TGF A;  4YWZ A;  5EOE A;  4BEN A;  1CEG A;  1H8M A;  5HPI A;  4BL2 A;  3OCN A;  4KZ9 A;  3S1Y A;  3IH8 A;  4B4X A;  1FCM A;  2XR0 A;  3CWF A;  4II7 A;  3W4P A;  4S2K A;  4RX2 A;  2ZL1 A;  4EQI A;  1NWZ A;  4G3V A;  3VFF A;  3CZD A;  3T1S A;  2ZMV A;  3NDE A;  1XX2 A;  4X56 A;  4EU0 A;  3B47 A;  4ZBE A;  1FSW A;  2K7S A;  4EBL A;  3O3V A;  3LIC A;  4EEU A;  1ZG4 A;  5I94 A;  2PBY A;  3T12 B;  5EOO A;  2VEA A;  4X69 A;  2GX5 A;  4I39 A;  2O9A A;  4LRX C;  3V3S A;  2XLN A;  3UB7 A;  4Y5F A;  2ZLY A;  1SKF A;  4GD6 A;  4MBF A;  3KYZ A;  2PT7 A;  3AGF A;  3ZG9 B;  2Y91 A;  1MC0 A;  2HGV A;  2ZD8 A;  4R1G A;  5G18 A;  3LUQ A;  1RGY A;  4UAA A;  3S7N A;  3DTE A;  2JHE A;  5AQA A;  3R7W B;  4RYE A;  3NC8 A;  4Z9Q A;  1K56 A;  4XXR A;  4HIA A;  1NLZ A;  1PI5 A;  2ZC6 B;  1SZV A;  1JNU A;  4DF6 A;  5CX7 A;  3IXB A;  5HDS A;  4S2O A;  2FH5 A;  4KZA A;  3HUO A;  2Y2H A;  4S2M A;  1MKM A;  5DFX A;  3Q7V B;  4M4X A;  4JXG A;  2W1T A;  1BZA A;  4C75 A;  4GHI B;  3NJA A;  2Y2K A;  4OLD A;  3B3X A;  1JWV A;  3QP8 A;  1T1C A;  3MFX A;  3C7V A;  3A0S A;  1L0G A;  5E2G A;  2QYB A;  4JXV A;  4L9E A;  3UMD A;  2V1B A;  4AFI A;  3UDF A;  3WS5 A;  2W3H A;  1XGJ A;  3SS5 A;  4EWF A;  2WKE A;  1UWP X;  3NCK A;  3A3E A;  4KG2 A;  1MWT A;  3T4O A;  2ZQC A;  2IWC A;  4R38 A;  5HWW A;  4Y0T A;  3IX8 A;  5FDS A;  3CLO A;  4S2J A;  3PBN A;  4ZTK A;  4XT2 B;  1KDW A;  2MJ6 A;  2XD1 A;  3T1Q B;  3BFD A;  4BMW A;  2XRO A;  1GSX A;  4WM9 A;  2XH9 A;  3NOU C;  1CK3 A;  2EX8 A;  5FEG A;  2ZQ8 A;  2OSU A;  2W3D A;  2O9C A;  2BLS A;  3MQ0 A;  3VP4 A;  5DTS A;  3EQU A;  5HD3 A;  5FSR A;  5AVE A;  2J3W A;  2CMN A;  4NK3 A;  4QB8 A;  1CI9 A;  1K57 A;  3ZVW A;  1DP9 A;  2XGN A;  3SZT A;  4HY8 A;  3C4P A;  1OTB A;  4CPK A;  2IA2 A;  3UN7 A;  2JKF A;  4HBU A;  2IWD A;  2ZM2 A;  3TRC A;  1IFQ A;  5F82 A;  1K6R A;  1ODV A;  4KZB A;  4YOF A;  2VGJ A;  3E2L A;  3BJN A;  4N9L A;  3ZHH A;  3PBR A;  5AJG A;  5AQB A;  2ZOI A;  1X0O A;  3RTY A;  1XA7 A;  2A2L A;  1ES2 A;  3E4Q A;  3HUN A;  1H8Z A;  3HLG A;  3CUE C;  3LEZ A;  2O9B A;  1CJF A;  1Z6F A;  3LIA A;  1CEF A;  1FCN A;  2OAP 1;  3IX3 A;  3JPU A;  1P9W A;  3MSH A;  3Q7Z A;  2Y4A A;  3BWL A;  3HLB A;  4IJG A;  4LV1 A;  3NI9 A;  5FAT A;  1VEU B;  5MC7 A;  3ZNT A;  3HLW A;  1N9O A;  3LI8 A;  4WEJ A;  2Y2L A;  2JKT M;  3UE0 A;  5HSQ A;  1K25 A;  3CIT A;  1Y28 A;  3V3R A;  2EFX A;  1OT9 A;  4Y0O A;  3PAE A;  5FDH A;  1AXB A;  3AGD A;  2W1R A;  2VV8 A;  5EE8 A;  4GNU A;  5EV0 A;  4H6J B;  3P98 A;  4I3I A;  1W63 M;  3G6O A;  4QHC A;  5L8M A;  3IQA A;  1GHI A;  4BQM A;  4WZ4 A;  4GHI A;  4EUV A;  3UB9 A;  4GZB A;  1KGE A;  3VP1 A;  1KOU A;  5FQM A;  2HZ5 A;  1LSX A;  3E98 A;  4DXC A;  4KUK A;  3T4K A;  3K3D A;  3T4S A;  2P9V A;  2UWX A;  3M2K A;  2KLI A;  5CEC A;  2PD7 A;  3PXP A;  4R4S A;  1IEL A;  1NLY A;  3K3C A;  3EEH A;  1LL8 A;  4WZ5 A;  4UQI M;  3ITA A;  4NEE D;  2QWS A;  1IYQ A;  4PPR A;  1I2S A;  4Y13 A;  2EA9 A;  5TBM B;  1KGG A;  2DMW A;  5FI2 A;  1OME A;  1PWC A;  3V50 A;  5HL6 A;  4GS9 B;  4XT2 A;  5HD5 A;  1YT4 A;  3C7U A;  1LLB A;  3VOZ A;  3QNC A;  2XD5 A;  3IH9 A;  4O01 A;  1VET B;  5CTN A;  1ESI A;  4OQ0 A;  5FI6 A;  4HES A;  3G32 A;  3OCL A;  4NG2 A;  3OPP A;  3MJQ A;  1XJ2 A;  3FV7 A;  3LFV A;  5DJT A;  3SH8 A;  4DJ3 A;  3TG9 A;  3GRJ A;  1PW1 A;  3G2Y A;  1Q2P A;  2JKT I;  1GA9 A;  5A8B A;  3T50 A;  4P87 A;  2J9O A;  3F1N A;  4R23 A;  3BLM A;  5F68 A;  3NHQ A;  2XFT A;  5FQJ A;  1YLW A;  4BLM A;  1JVJ A;  3S7P A;  2VV7 A;  2ZMA A;  2W3G A;  3QHY A;  5CEB A;  1Q2Q A;  1YPR A;  3IX4 A;  1FIK A;  2C6W B;  3VE4 A;  3LY3 A;  1VHM A;  4L0L A;  1T1B A;  2VJW A;  3N4I A;  3RXX A;  2HV1 A;  3BFE A;  1BLP A;  4X55 A;  4ZJ3 A;  2JC7 A;  2QJ5 A;  1YLY A;  4KEN B;  5FAQ A;  3W2Z A;  3V67 A;  4FUW A;  3HLD A;  5GL9 A;  4WMC A;  4E3J A;  3B42 A;  2ZC4 B;  3OBF A;  1LSW A;  5HWV A;  4HH3 A;  1H5X A;  1S0W A;  1VEU A;  3C4O A;  2VGL M;  2QJ7 A;  5BOH A;  4MN5 A;  5HW3 A;  1EWZ A;  1T18 A;  2NUT C;  1HVB A;  1GCE A;  3P7N A;  4OP8 A;  2JCH A;  4GJ4 A;  2Z2M B;  2HJ9 C;  5KSC A;  5DFY A;  3IS2 A;  4ID4 A;  3BEB A;  2HDU A;  2HJE A;  3F1P B;  1D7E A;  2GZA A;  3WS2 A;  4HQA A;  2J9P A;  1DP6 A;  4ARZ B;  2Y2J A;  2OWJ A;  5CHU A;  2KOI A;  4ZAM A;  3LR5 A;  3VSL A;  3PR6 A;  2PR5 A;  4I5S A;  3D3O A;  1KE4 A;  2Z6D A;  3CI6 A;  1F9I A;  2X01 A;  3LI9 A;  5J3W A;  2XA7 M;  2ZBB A;  4X68 A;  4R6L A;  4EXO A;  4B88 A;  3ZNY A;  5E2F A;  1MBL A;  4UEY A;  3IT9 A;  3MS6 A;  4PHT A;  4BBV A;  4CLC C;  4O7D A;  5E2H A;  5TBM A;  4CJN A;  1KE0 A;  2H0T A;  1K4E A;  4A5R A;  1STZ A;  4M3K A;  1ES5 A;  3FPV A;  4D60 A;  1YLT A;  2HF6 A;  2ZOH A;  4C3Q A;  1NRJ A;  2H28 A;  4KQD A;  2Y2M A;  1UWN X;  4DE0 A;  1VET A;  5G4Z A;  3SH9 A;  5EVI D;  4U0T A;  3H82 A;  1J3W A;  4MDZ A;  3LY4 A;  2WGV A;  1OJG A;  1ACF A;  4YNR A;  1WE4 A;  3GEC A;  1PZO A;  3FC7 A;  1PZP A;  3C30 A;  2EX9 A;  1ERO A;  2L1M A;  4JGR A;  2YKF A;  4OVD A;  3JVV A;  4EER A;  1BSG A;  4LGW A;  1FR6 A;  4DN0 A;  5L10 A;  3MXS A;  3IBR A;  4HH2 A;  4MBK A;  2PYP A;  1L0F A;  1RCJ A;  4NET A;  3VOL A;  2X02 A;  4R4R A;  3C38 A;  1DY6 A;  3GMW A;  1LL5 A;  1PI4 A;  5C5K A;  1SDE A;  5CRF A;  5HDD A;  2WKR A;  1RP5 A;  1OJ5 A;  3KSG A;  4GD8 A;  2OWH A;  2V2F F;  1K4F A;  1W8Q A;  3BFC A;  1D1J A;  2ACG A;  4ESP A;  1I5Q A;  4LV0 A;  4BD1 A;  3OC2 A;  3G31 A;  2VV6 A;  3MZF A;  2XFS A;  5FQQ A;  1H3Q A;  4UHU A;  1V9Y A;  3PTE A;  3EEA A;  2HP5 A;  1H0M A;  2WKP A;  1NZU A;  1BUE A;  3RH8 B;  1OTI A;  4X1M A;  1OTA A;  2WAF A;  2B18 A;  1GSW A;  3LR0 A;  1ES3 A;  4KQO A;  2XF3 A;  4Y15 A;  4PAU A;  4KZ5 A;  4HEF A;  3T1R A;  3BYD A;  3ZG5 A;  2V0U A;  2WYX A;  4LEN A;  2B02 A;  2HPB A;  2PRF A;  1E4D A;  5DTT A;  2KDK A;  1YMX A;  2K2N A;  4ARZ A;  4BBU A;  1YLZ A;  2I9V A;  1JWP A;  2XSS A;  4P6Z M;  4KQQ A;  3U4L P;  4EBP A;  1L2S A;  1N9N A;  1NY0 A;  4R70 A;  3N7W A;  1A0K A;  2OLU A;  2VX8 A;  1G28 A;  3WS1 A;  1VB6 A;  3SW1 A;  5K5B A;  4GLQ A;  2K31 A;  1DJB A;  2V0W A;  1BLH A;  3VMA A;  4HI4 A;  3IBJ A;  4OQH A;  1S6R A;  1K54 A;  1IKI A;  1MXO A;  4ETZ A;  1O07 A;  1FOF A;  2Y2P A;  1LI0 A;  4OLG A;  4UA9 A;  3TSG A;  2P08 A;  3G34 A;  4X1L A;  4RVA A;  4KZ7 A;  2WGW B;  1DJC A; 
#chains in the Genus database with same CATH homology
 4WZ4 A;  3M6B A;  4GZB A;  1XPB A;  1KGE A;  1KVL A;  3VP1 A;  5FQM A;  3UDI A;  4DXC A;  4LV3 A;  3SOI A;  2P9V A;  4FH4 A;  2HDQ A;  2PU2 A;  5CER A;  2A3U A;  4R0Q A;  2Q9M A;  3DWZ A;  4PM9 A;  1XKZ A;  2V20 A;  2UWX A;  4KQR A;  3M2K A;  1FR1 A;  5EVI A;  1ESU A;  2QPN A;  5CEC A;  3LCE A;  4OPQ A;  3ZG7 B;  3IWI A;  1K38 A;  4PM8 A;  3BLS A;  1K56 D;  4WYY A;  5M19 A;  4X6T A;  4R4S A;  3D4F A;  5M18 A;  3PBT A;  2XQZ A;  2IWB A;  2CC1 A;  2DRW A;  1IEL A;  3A3J A;  3OPR A;  3PBS A;  1KVM A;  5F1G A;  3NDG A;  1KDS A;  3G35 A;  3N8S A;  1GHP A;  1K55 C;  3ITA A;  4WZ5 A;  3DW0 A;  5CGS A;  1W79 A;  4GN2 A;  5A90 A;  5KMW A;  2C5W B;  4U3T A;  2RL3 A;  5TR7 A;  1IYQ A;  4D2O A;  4PPR A;  1I2S A;  3V39 A;  1G68 A;  3MBZ A;  3VOY A;  4IED A;  1KGG A;  4R3B A;  5J8X A;  3HL9 A;  1I2W A;  5FI2 A;  5FQ9 A;  4ZJ2 A;  3SS3 A;  3VP2 A;  1OME A;  3W4O A;  5A92 A;  1PWC A;  3V50 A;  5CXW A;  4FSF A;  4ZDX A;  2FFY A;  3WS0 A;  1NRF A;  4JLF A;  1JTG A;  4JF5 A;  5JYP A;  3A3D A;  1YT4 A;  5GLB A;  3OPL A;  3C7U A;  1LLB A;  4GDN A;  3VOZ A;  3QNC A;  3QNB A;  2XD5 A;  4OOY A;  3IH9 A;  4S2N A;  5CTN A;  5AQ9 A;  1ESI A;  3V5M A;  2Y2G A;  3EQV A;  2HDR A;  3VP0 A;  1ALQ A;  3IF6 C;  3IXH A;  1SCW A;  4OQ0 A;  5FI6 A;  3ZGA B;  4HES A;  2EFU A;  3G32 A;  3OCL A;  2G2U A;  3IXD A;  4B4Z A;  4K0W A;  3I7J A;  4E6X A;  3OPP A;  2ZQ9 A;  1HTZ A;  3FV7 A;  2WKI A;  3M6H A;  1K54 C;  4FD8 A;  4LCL A;  1MWS A;  3G4P A;  4LCM A;  2OLV A;  2V1Z A;  3IXG A;  1PYY A;  3SH8 A;  4IVK A;  1VQQ A;  3IF6 B;  3TG9 A;  3GRJ A;  3UPN A;  1PW1 A;  4E3I A;  4YIN A;  1YLJ A;  3G2Y A;  3GR2 A;  1E25 A;  3IHB A;  4QY5 A;  1ERM A;  1Q2P A;  2Y55 A;  4N1H A;  1NZO A;  1GA9 A;  1IYO A;  3HLF A;  1XGI A;  1L0E A;  5F83 A;  4P87 A;  2J9O A;  1H8Y A;  1QMF A;  4K0X A;  4E6W A;  2EX6 A;  2WZX A;  5JYO A;  2R9X A;  5HFO A;  4R23 A;  3BLM A;  1SHV A;  1NJ4 A;  4QD4 A;  5HAQ A;  1YQS A;  2XFT A;  5FQJ A;  1YLW A;  3S22 A;  3TOI A;  4BLM A;  5GLA A;  1M6K A;  3O88 A;  4OKP A;  3P09 A;  1JVJ A;  4Y7P A;  3C5A A;  4DE2 A;  3DTM A;  4OOM A;  3S4X A;  4WEL A;  3MFD A;  3M2J A;  2ZMA A;  1QME A;  3QHY A;  3Q1F A;  3N8R A;  2Y2N A;  3MKF A;  3MXR A;  1W5D A;  5EVI C;  3ZFZ A;  5CEB A;  3UPO A;  2DCF A;  1Q2Q A;  4OQG A;  5HX9 A;  3RXW A;  1K6S A;  3VSK A;  2C6W B;  3LY3 A;  4DDS A;  2WGI A;  5FI7 A;  2QMI A;  4L0L A;  5A93 A;  2XDM A;  1ONH A;  2P9V B;  4WZ5 C;  5FQI A;  3ZDJ A;  3BFG A;  3N4I A;  4JF4 A;  3RXX A;  4HBT A;  3IF5 A;  5TGF A;  3BFE A;  1BLP A;  5FAP A;  1XP4 A;  5EOE A;  4BEN A;  4PM5 A;  5GHZ A;  4P85 A;  1CEG A;  2Y2Q A;  5E2E A;  2GDN A;  4X55 A;  3IWO A;  4BL2 A;  3OCN A;  1YMS A;  2DNS A;  2JC7 A;  4ZJ3 A;  3WRZ A;  4KZ9 A;  1YLY A;  4KEN B;  3S1Y A;  1BLS A;  5FAQ A;  3Q82 A;  3IH8 A;  4B4X A;  1FCM A;  2Z2L B;  3Q7V A;  2XR0 A;  3UNW A;  4OPR A;  2ZC3 B;  4FCF A;  3GQZ A;  3W4P A;  2A49 A;  3HLD A;  4S2K A;  4WMC A;  5GL9 A;  5L2F A;  2HP6 A;  4E3J A;  3GV9 A;  1LL9 A;  2ZC4 B;  3LO7 A;  4RX2 A;  4S2N C;  1BLC A;  3PBQ A;  1GHM A;  1H5X A;  1ONG A;  1S0W A;  5CGX A;  3C4O A;  4OOL A;  2E8I A;  4EQI A;  1E3U A;  5BOH A;  4K91 A;  5HW3 A;  1J9M A;  1EWZ A;  3CZD A;  3VFF A;  1HVB A;  3NDE A;  1GCE A;  3MKE A;  1XX2 A;  1BUL A;  4X56 A;  4N1X A;  4MBH A;  3UDX A;  4OP8 A;  2JCH A;  2Z2M B;  4ZBE A;  1FSW A;  4EBL A;  3O3V A;  5EPH A;  3A3F A;  3MZE A;  5KSC A;  1ZKJ A;  1ZG4 A;  4KZ8 A;  3OZH A;  5I94 A;  3HUM A;  3MZD A;  4E3N A;  4ID4 A;  3JYI A;  3BEB A;  2HDU A;  2PBY A;  2WK0 A;  5EOO A;  4GKU A;  4X69 A;  3WS4 A;  3WS2 A;  3O87 A;  2XEP A;  3BFF A;  3V3S A;  3ZG8 B;  4IVI A;  3GVB A;  2XLN A;  3FKV A;  2WAD A;  2J9P A;  1TDL A;  2JE5 A;  2Y2J A;  3HLE A;  1O7E A;  2ZLY A;  1SKF A;  4GD6 A;  4UA6 A;  4MBF A;  5CHU A;  5GHY A;  4ZAM A;  5EVL A;  3VSL A;  4EUZ A;  5KSH A;  4OPZ A;  4JKT A;  3SH7 A;  1ZC2 A;  3AGF A;  1C3B A;  1WYC A;  4C6Y A;  3ZG9 B;  4UA7 A;  2Y91 A;  2ZM0 A;  2WGW A;  3GTC A;  2EX2 A;  2ZD8 A;  4R1G A;  5G18 A;  5U47 A;  1KE4 A;  1RGY A;  4UAA A;  2X01 A;  4IBX A;  4PM7 A;  5DF8 A;  3N6I A;  4H8R A;  1MY8 A;  3IWQ A;  1PWG A;  4RX3 A;  5EEC A;  4XUX A;  3UPP A;  3HVF A;  3O86 A;  4S2L A;  4KZ6 A;  5CED A;  5AQA A;  4X68 A;  1L0D A;  4RYE A;  4OPY A;  3NC8 A;  2ZC5 B;  4B88 A;  2PU4 A;  3ZNY A;  4Z9Q A;  2QZ6 A;  1G6A A;  4LV2 A;  5E2F A;  1K56 A;  4XXR A;  4E3K A;  1MBL A;  1PI5 A;  2ZC6 B;  3IT9 A;  5FAO A;  3NBL A;  3WWX A;  5M1A A;  1NYY A;  2H10 A;  4O7D A;  1VM1 A;  5E2H A;  2ZJ9 A;  3HBR A;  4MEZ A;  4DF6 A;  4DXB A;  4JF6 A;  4JPM A;  4CJN A;  3VP3 A;  1KE0 A;  3ISG A;  4KZ4 A;  2H0T A;  3IXB A;  1K4E A;  5GLC A;  4A5R A;  4S2O A;  3VFH A;  1ZG6 A;  4GB7 A;  3E2K A;  2WZZ A;  4KZA A;  4BL3 A;  2ZQA A;  3HUO A;  4M3K A;  1ES5 A;  2Y2H A;  4QU3 A;  4S2M A;  4MLL A;  3Q7V B;  1NXY A;  1YLT A;  3FYZ A;  4JXG A;  1BZA A;  4C3Q A;  4C75 A;  2EXB A;  2EXA A;  2Y2M A;  4DDY A;  2Y2O A;  1BTL A;  4DE0 A;  2R9W A;  2Y2K A;  4OLD A;  4S2P A;  1HZO A;  3B3X A;  1JWV A;  2RCX A;  1WYB A;  5DF9 A;  1KE3 A;  2Q9N A;  2J7V A;  3SH9 A;  5EVI D;  4U0T A;  3C7V A;  4N92 A;  4OP5 A;  1L0G A;  4QY6 A;  5EVI B;  1MWU A;  3PAG A;  3LY4 A;  2WGV A;  5E2G A;  5CTM A;  4JXV A;  3ITB A;  1WE4 A;  1IEM A;  1PZO A;  1N4O A;  3UDF A;  3WS5 A;  4QJG A;  1PZP A;  5DF7 A;  1XGJ A;  5AQ7 A;  3SS5 A;  4EWF A;  2WKE A;  4BJP A;  2EX9 A;  2JBF A;  3HRE A;  1ERO A;  3A3E A;  3NCK A;  4OVD A;  4KG2 A;  4OON A;  1MWT A;  2Y2I A;  1FCO A;  1YM1 A;  1U60 A;  4F94 A;  1BSG A;  2ZQC A;  1FR6 A;  2IWC A;  1JTD A;  4Y0T A;  3MXS A;  1TDG A;  5GHX A;  4KZ3 A;  2B5R A;  3BRM A;  4S2J A;  1ES4 A;  3PBN A;  1IYS A;  4MBK A;  1BT5 A;  1JWZ A;  1L0F A;  1TVF A;  4KG5 A;  1RCJ A;  4OQI A;  4YFM A;  2ZM8 A;  1XA1 A;  4ZTK A;  1KDW A;  2XD1 A;  2WKH A;  2G2W A;  4NET A;  5A91 A;  1N9B A;  4E3M A;  2X02 A;  3BFD A;  4R4R A;  2X71 A;  5GLD A;  1DY6 A;  2WAE A;  1YLP A;  4WM9 A;  3ZVT A;  2XH9 A;  1CK3 A;  2EX8 A;  4P0M A;  2ZQD A;  2ZQ8 A;  1IYP A;  3GMW A;  3IHA A;  2OSU A;  2J8Y A;  1PIO A;  1LL5 A;  2BLS A;  2H5S A;  1PI4 A;  5FQK A;  3VP4 A;  4RA7 A;  5DTS A;  4EBN A;  3EQU A;  4E3L A;  1SDE A;  5CGW A;  5DVA A;  1GA0 A;  5CRF A;  5FSR A;  3WRT A;  2WUQ A;  3N8L A;  1SDN A;  3CMZ A;  1RP5 A;  2XK1 A;  4NK3 A;  4QB8 A;  1CI9 A;  4P6B A;  4GD8 A;  1W7F A;  1K57 A;  3W4Q A;  3ZVW A;  2V2F F;  1K4F A;  1W8Q A;  2XGN A;  3BFC A;  5HAR A;  3UO9 A;  4WEK A;  3C4P A;  1MWR A;  2H0Y A;  3DWK A;  3NIA A;  1I5Q A;  4GDB A;  4LV0 A;  4CPK A;  3ZCZ A;  4BD1 A;  3OC2 A;  1PW8 A;  3UN7 A;  4HBU A;  2IWD A;  4WBG A;  2ZM2 A;  3UE1 A;  5KZH A;  2BG1 A;  3A3I A;  1TEM A;  1PWD A;  2FFF B;  3G31 A;  5CHJ A;  3MZF A;  5F82 A;  2XFS A;  5FQQ A;  1K6R A;  4UHU A;  1HD8 A;  3BEC A;  3PTE A;  5IHV A;  4KZB A;  3Q81 A;  2HP5 A;  1IKG A;  1DJA A;  2VGJ A;  4DE1 A;  1CI8 A;  1NZU A;  4JBF A;  5FA7 A;  3E2L A;  1BUE A;  4N9L A;  4S2I A;  4U0X A;  1Y54 A;  2WAF A;  3HLC A;  3W8K A;  3ZHH A;  4PM6 A;  3PBR A;  1ES3 A;  4KQO A;  2XF3 A;  4KZ5 A;  5D3O A;  5AQB A;  2P74 A;  5FAS A;  4HEF A;  4JXS A;  1W8Y A;  4X53 A;  1XA7 A;  5HAP A;  1ES2 A;  5TFQ A;  3HUN A;  1H8Z A;  2VGK A;  2ZC7 A;  3HLG A;  3UY6 A;  3AGE A;  3LEZ A;  2HP9 A;  3BYD A;  1RGZ A;  1LI9 A;  1Z6F A;  4ZJ1 A;  2OV5 A;  3ZG5 A;  4E3O A;  5E43 A;  2WYX A;  4LEN A;  1CEF A;  1FCN A;  2HPB A;  2ZQ7 A;  3BM6 A;  4JXW A;  5CHM A;  3UE3 A;  1E4D A;  1K55 A;  4N9K A;  5DTT A;  1YMX A;  1XXM A;  1LHY A;  1ERQ A;  4KG6 A;  4WMC D;  1NYM A;  3Q7Z A;  1YLZ A;  3SS4 A;  2Y4A A;  4Q8I A;  3HLB A;  4R3J A;  3FKW A;  4LV1 A;  1JWP A;  4KQQ A;  5DTK A;  4EBP A;  4IBR A;  1L2S A;  3NI9 A;  1E3U D;  1NY0 A;  5FAT A;  5HL1 A;  3FZC A;  1M40 A;  3N7W A;  1FQG A;  1EI5 A;  2OLU A;  3ZNT A;  5EUA A;  4DE3 A;  3HLW A;  3ZG0 A;  4WEJ A;  1FSY A;  3RJU A;  2Y2L A;  1MKI A;  3WS1 A;  3GSG A;  4OH0 A;  3UE0 A;  3NY4 A;  1K25 A;  4Y0U A;  1DJB A;  3IF6 A;  3OPH A;  1BLH A;  1K57 C;  3V3R A;  3VMA A;  3Q07 A;  2EFX A;  4Y0O A;  4OQH A;  4PMA A;  4DRT A;  3CG5 A;  3PAE A;  2I72 A;  5FDH A;  1S6R A;  1AXB A;  4BQM A;  3AGD A;  3PBO A;  1K54 A;  3FWL A;  1KGF A;  5HAI A;  5EE8 A;  1IKI A;  2Y59 A;  1MXO A;  4GNU A;  4BD0 A;  1MPL A;  1O07 A;  1FOF A;  2Y2P A;  3P98 A;  4FH2 A;  1LI0 A;  4OLG A;  3CJM A;  4UA9 A;  3TSG A;  3G34 A;  2HDS A;  4QHC A;  4MNR A;  4XUZ A;  3IQA A;  1GHI A;  3G2Z A;  4RVA A;  4DKI A;  4EV4 A;  4KZ7 A;  5F1F A;  4GOG A;  3G30 A;  2WGW B;  1DJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...