4EERA

Crystal structure of lov2 domain of arabidopsis thaliana phototropin 2 c426a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
EKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 34
structure length 106
sequence length 106
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eerA00
2B02A 4KQDA 4KUKA 3PYPA 4L9FA 2Z6CA 1D06A 3EEHA 5F5YA 2V0UA 4LPZA 4BBTA 1BYWA 4GS9A 1S1YA 2VV8A 1T1BA 3P7NA 1DP8A 4XT2B 2KDKA 4F3LB 3A0VA 3UMDA 2V1BA 3LIAA 5J7EA 1OT6A 1OTDA 4BBVA 4GS9B 3HJIA 3HJKA 4L9EA 2PYRA 4EEPA 3CWFA 1N9LA 1LSWA 2I9VA 3ZQ5A 3GDIA 2J80A 3SW1A 4WUJA 4HOIA 4DJ3A 5DJUA 2GJ3A 3OLOA 2ZOIA 3EWKA 3RTYA 1LSVA 4KUOA 3F1PA 3MR0A 5A8BA 4HI4A 3F1OA 3LIDA 3MQQA 4HY8A 3E4PA 5DKLA 5G4ZA 3A0SA 4JGOA 2H28A 1XJ2A 3F1PB 3MQOA 5F6AA 4EQ1A 3F1OB 2INWA 3UB8A 4LRXC 4I3AA 2ZBBA 3MJQA 1P0ZA 3UMEA 2EA9A 2R78A 5DJTA 4GW9A 1XFNA 1V9ZA 2V9AA 3UB6A 4WL9A 1XFQA 3LIBA 5HWWA 3PHYA 2Z6DA 3NOTC 1UWPX 3VE3A 1S66L 3E4QA 5KIZA 1X0OA 3ULFA 2L4RA 2M1CA 3KX0X 3LIFA 1XJ3A 3BWLA 1DRMA 1TS0A 1LSXA 4GCZA 1OTIA 4L9GA 5HWVA 2D01A 2ZOHA 4I3JA 1Y28A 3LUQA 4HJ4A 1WA9A 4WLAA 4LRYC 3VOLA 2PR5A 4MN6A 1EW0A 5DKKA 2QJ7A 5TBMA 5F68A 3IBRA 5EFWA 2V1AA 4H6JA 1T1CA 4I39A 3UE6A 2W0NA 2VV6A 1F9IA 1GSWA 5J4EA 1MZUA 2CMNA 1UWNX 4HH2A 5TBMB 2HV1A 2KX6A 2V0WA 2PD8A 2QJ5A 5HDDA 2PYPA 4H6JB 5G4YA 5HD5A 4R3AA 1OTBA 2OWHA 3BY8A 1S1ZA 4HP4A 1GSVA 4I38A 1OT9A 2PR6A 4R6LA 1XJ6A 4HNBA 3NOPC 3C2WA 4DJ2A 2JHEA 5HDCA 2JN7A 2L1MA 2PDRA 1TS6A 1LT0A 2WKPA 1T1AA 3LICA 1D7EA 1S4SA 3H7WA 4HJ3A 1ODVA 3K3DA 3T50A 1S67L 5I5LA 2QWSA 4B9OA 4PKYG 2YKHA 3LI8A 3H7WB 2WKQA 3ICYA 5HSQA 5HDSA 1T19A 5IS1A 3E4OA 3CLOA 3A0RA 4MN5A 3FC7A 1N9NA 1V9YA 2QHKA 2OWJA 4I3IA 4EESA 2VEAA 2VLGA 1T18A 1OTAA 4I5SA 3G6OA 4M4XA 4R38A 4EXOA 4RQ9A 2K7SA 3C8CA 2OOLA 3LIEA 1F98A 4PKYA 2YKFA 1KOUA 5AVFA 1VB6A 2WKRA 4WN5A 1S4RA 3H9WA 5HD3A 1LL8A 4HIAA 1XJ4A 5AVEA 1OJ5A 4JGPA 4EEUA 3IS2A 3VE4A 2W27A 3B33A 1JNUA 4HH3A 1DP9A 4HJ6A 3IS2B 4EW7A 3NHQA 2BASA 2QKPA 3FG8A 3H82A 4WF0A 4EETB 4JGRA 1OTEA 2D02A 3GECA 1GSXA 3MXQA 4YWZA 1DP6A 2PD7A 2PHYA 3CAXA 4LLOB 1G28A 4JGQA 4HHDA 4NXEA 4K08A 3MFXA 3K3CA 4EERA 4GHIA 3H82B 2P7JA 4E04A 4HP9A 2L0WA 3LYXA 4NXBA 2A24A 5IU1A 1OJGA 3F1NA 4GHIB 4NXGA 1P97A 5HWTA 3NOUC 3RH8B 1TS8A 5HZHA 1N9OA 4HQAA 2A24B 3BY9A 4BBUA 1UGUA 4LRZE 1TS7A 4NXFA 3UB9A 5F69A 3NJAA 3F1NB 1NWZA 2VV7A 3UB7A 4R70A 4XT2A 3D72A 3LI9A 5J3WA 4F3LA
chains in the Genus database with same CATH superfamily
2Y2QA 2B02A 1G6OA 3CITA 3CUEA 2Z6CA 3EQVA 1D06A 3EEHA 3OOVA 1D1JA 4L9FA 4EUZA 4WELA 2JKRI 2NUTC 3T1XA 4QU3A 4LPZA 1BYWA 3LFVA 3T4SA 2JKGA 2W1TA 2VV8A 2KDKA 5EVIB 5HAPA 3UMDA 4JF5A 1VQQA 2C6WB 1AWIA 5TJJA 2EWWA 1W8QA 4GS9B 3A3IA 5EPHA 3IXGA 4S2MA 3CWFA 1LSWA 4CPKA 2I9VA 3ZQ5A 3LR0A 1ZG4A 3BJNA 5A90A 4OP8A 2XFTA 4ZDXA 2J80A 3T4QA 4JXGA 3SW1A 4MN7A 2HDUA 2GJ3A 1KE0A 3TOIA 1NYMA 3MZFA 3DTKA 2V8CA 3F1PA 2I72A 2B18A 3MR0A 4WMCD 4Q0IA 4WZ5C 3LIDA 3SZTA 3CJMA 3NDEA 2ZJ9A 2P04A 3D3OA 5E43A 1KGFA 5DKLA 2DMWA 3G2YA 5G4ZA 2WADA 2IWCA 1PNEA 4JGOA 1FQGA 3DBAA 2M7UA 4FUWA 1ACFA 2Y2KA 3IT9A 5F6AA 2XK1A 3UB8A 2WGWB 1K0KA 4LRXC 4I3AA 4DDYA 3WRTA 3JVVA 3UMEA 2G2WA 1XX2A 4K0XA 4IEDA 4GW9A 4Q8IA 1XFNA 4B4ZA 1G5UA 1P9WA 3IXHA 4EUVA 4R3JA 3V5MA 1UWPX 3CUEC 1YLYA 3VE3A 1KGEA 1WYCA 3ULFA 3C4OA 3VSLA 1W5DA 3KX0X 3G32A 3LIFA 5EVLA 2Q9MA 1SKOB 5EVIA 3I7JA 1DRMA 1TS0A 4GD6A 1PWCA 2DRWA 4OQIA 3HLFA 1GA9A 4N92A 1BSGA 2Y55A 2QZ6A 5JYOA 2D01A 1HLUP 5HPIA 2MJ6A 5GLAA 4HJ4A 3IWIA 2EX2A 4RA7A 1K6SA 4PPRA 5IHVA 1L0GA 5TR7A 3S7QA 4Y2FA 1K6RA 3PBSA 5FASA 5F68A 4DE3A 2ZL1A 3ZYTA 4I39A 2VGJA 4FSFA 2W0NA 3UE6A 2XDMA 4OLGA 4FH2A 2OV5A 2CMNA 3M2JA 1UWNX 3E2KA 4HH2A 5CEBA 1QMEA 2HV1A 4R4RA 4CLCD 2QJ5A 4GOGA 3DAVA 3BRMA 2PYPA 1ES2A 3RXXA 4ZRRA 3TRCA 2OWHA 5M18A 2Z2LB 3HLDA 4MBKA 2Y8HA 4PM7A 1NJ4A 1AXBA 5CX7A 2ZM2A 3NECA 1I2SA 1GSVA 1VEUA 1TEMA 1PIOA 4R6LA 4OQ0A 3IF6C 4FD8A 1J3WA 3C2WA 2JHEA 4X68A 5FQ9A 2HGVA 5HDCA 2WKEA 5L10A 2L1MA 4S2IA 5LBRA 3IHBA 5FL3A 4LV3A 1SDEA 3BECA 4ZBEA 5C5KA 3H7WA 4DN0A 3K3DA 3A3JA 3T12B 4LGWA 4MEZA 5GLCA 1K56D 1PI4A 2QMIA 1C3BA 3BQ8A 3DWZA 4OOLA 5TFQA 4E3KA 3CI6A 5HDSA 3MMHA 4DMZA 2XSSA 4PM9A 3FC7A 4EBPA 1N9NA 5DFYA 1V9YA 2OWJA 3HVFA 2VLGA 4I5SA 1O7EA 1LI0A 3GSGA 4E3MA 4EXOA 2BG1A 2XD5A 2C5WB 2W3GA 3C8CA 4PM5A 2YKFA 3OPPA 3R7WB 1VB6A 4WBGA 2VA0A 3KYQA 3S7PA 3PBTA 4WN5A 3DW0A 5DF7A 5HD3A 1FIKA 3MZDA 4G3VA 4OPRA 1ZKJA 3O5YA 2G2UA 3BFEA 4JGPA 4B4XA 4S2KA 3Q7ZA 5EM1A 4CJNA 4UQIS 4P6BA 2W27A 2HJ9C 3B33A 4Q0JA 5CGSA 3A3DA 3GRJA 1JNUA 4HH3A 1DP9A 1EROA 4BENA 3H82A 1VHMA 3O88A 2ZC6B 3N6IA 4JGRA 3GECA 1GSXA 4YWZA 1HZOA 1JWPA 5A92A 5EECA 5HFOA 3ISGA 4JGQA 3ZNTA 4K08A 3TG9A 3MFXA 1G68A 1K54C 3NBLA 3OZHA 3WS2A 4EERA 4GHIA 1H8ZA 4LCMA 5GLBA 5KMWA 5CHMA 1K25A 4E04A 4HP9A 2L0WA 3HLGA 4X1LA 1MBLA 2A24A 3PBQA 5EVID 4GN2A 1ALQA 3O87A 1BT5A 4R0QA 3RH8B 4JF4A 1IFQA 1UGUA 4E3IA 4E6XA 3L7HA 3E2LA 2WAEA 2HDRA 5DTTA 1ZC2A 4X55A 4LV1A 3VSKA 1N4OA 2O9BA 1F5MA 2QYBA 4R70A 4L0LA 3IH9A 3D72A 4KUKA 3FYZA 3PYPA 5F5YA 2PT7A 4KENB 1H5XA 4BBTA 1PWGA 1S1YA 3UE3A 1NLZA 4N9KA 4Y5FA 2V1BA 3N8RA 3GVBA 1OT6A 1KDSA 1YAXA 3PBNA 1GCEA 4E3OA 1W7FA 2W1TB 3HJIA 2PYRA 5CECA 1LL9A 1M40A 4M3KA 4JPMA 3G4PA 1PFLA 1E3UD 1I2WA 3QNCA 5FA7A 3UE1A 2X02A 5K5BA 3FPVA 5DJUA 4ZJ1A 1EWZA 2ZOIA 1DY6A 1OPXA 2P08A 4RVAA 4RX2A 2ZQ9A 4D60A 3OPLA 4KUOA 3HCYA 4HI4A 3F1OA 3U2AA 4OPZA 3MQQA 2QPNA 1BLCA 3E4PA 2Y2PA 1RGZA 2W3DA 3A3EA 1K38A 2UWXA 3C7VA 3N7WA 3A0SA 1PZOA 2Y2GA 5DVAA 3F1PB 3MQOA 1NRJA 2INWA 4KZ6A 1YQSA 1KGGA 1MWSA 2GDNA 3L9KA 4WZ5A 1NZUA 2PU4A 1P0ZA 4IBXA 2M7VA 5DJTA 1K57C 2VGLS 5DF9A 4ESPA 5GL9A 5EOEA 3MKEA 4PMAA 3BFCA 5HWWA 3G34A 5E2EA 3WWXA 1LI9A 3E4QA 3VP0A 4MBHA 3VMAA 2HP6A 4AFIA 2DNSA 5FAPA 2L4RA 4MNRA 5FQKA 4G3WA 4U3TA 1YPRA 1XJ3A 2JE5A 2XH9A 1GHMA 2H0TA 2XD1A 1YLWA 5HWVA 1W79A 5AJGA 3GTCA 1LL5A 2ZOHA 4I3JA 3NDGA 3T1QB 2A3UA 1BLSA 3CZDA 3S7NA 4BWIA 4WLAA 3VOLA 1PW8A 2ZC5B 5KSHA 4LCLA 1KVMA 2H0YA 4MDZA 1Q2PA 2HDSA 3KSHA 4DKIA 5DKKA 3EQUA 5JYPA 5GHZA 3K2NA 3BFFA 5TBMA 3IWOA 4KZ9A 3IBRA 4Y0UA 4R23A 4H6JA 1FR6A 2KOIA 2JBFA 3M6HA 3HLBA 5GLDA 4ARZA 2O0YA 1IYQA 4OP5A 1TDLA 1F9IA 2V2FF 5J4EA 1FSYA 1FCNA 2EWVA 4PAUA 2KX6A 2ZL1B 1L0DA 1OTBA 3EOIA 4CLCC 2EX8A 3DTEA 4ETZA 1S1ZA 3MFDA 3TSGA 3ZVWA 1K4FA 3Q07A 1OT9A 2PR6A 2Y91A 4GDBA 3D4FA 3W8KA 3N4IA 5EE8A 1MWUA 4ME4A 1H0MA 2O9CA 3O86A 4X56A 2ACGA 3AGDA 4II7A 3W4OA 1GA0A 1VEUB 3S22A 3FPWA 5CTMA 3G2ZA 3JPUA 1MPLA 4JXSA 3IF6A 1S4SA 1BTLA 5DFXA 4Y15A 3KYZA 4WZ4A 4K0WA 2QWSA 5I5LA 3MZEA 4B9OA 4PKYG 4U0TA 4DXBA 2G7UA 1ZG6A 3LI8A 3H7WB 1FSWA 4S2JA 3LR3A 4H8RA 3QP6A 5IS1A 3FKVA 4IVKA 1L2SA 3A0RA 4MN5A 1ZHHB 1J9MA 5L07A 4BL3A 4XUXA 2QHKA 1OTAA 3V3SA 4KZ4A 5FI6A 4RQ9A 4X1MA 4C6YA 2OOLA 3LO7A 2BTFP 1TVFA 1G6AA 1LLBA 3WS0A 2ZD8A 3HBRA 1VETA 2DCFA 2WKRA 2EFUA 1KE4A 2KLIA 2PRFA 2V1ZA 5EUAA 3GV9A 4OH0A 1LL8A 4JXWA 4P6ZM 2W3HA 2ZQ8A 5AVEA 1OJ5A 2ZQ7A 4EEUA 4KZAA 4R3BA 3OPHA 1SZVA 2CC1A 2WGIA 2IA2A 3VE4A 3CPTA 4E3LA 2XEPA 4EBLA 4XUZA 4Z9QA 5FQIA 3PBOA 2Y4AA 3NIAA 5CGWA 4U0XA 3P98A 1YT4A 2RL3A 2PU2A 1GHIA 2QKPA 3BEBA 3QP2A 4S2NA 4EETB 4N9LA 1OTEA 2D02A 3MXQA 1DP6A 3C38A 2PHYA 2ZQAA 3CAXA 5KZHA 4ZJ3A 4KG2A 1FOFA 3H82B 1YLPA 2JKFA 1ES4A 4KQRA 2WGVA 1FILA 4QPRA 4E6WA 1YM1A 4B88A 1OJGA 1CI9A 2WYXA 1P9RA 3LCEA 3V39A 3VOZA 4GHIB 1MC0A 1PRQA 3F1NA 2FZ0A 1K54A 1YMXA 5HWTA 3NOUC 1TS8A 1BULA 1N9OA 4HQAA 5E2GA 2A24B 3BY9A 2ZMAA 4S2OA 1XGJA 4OVDA 5HPFA 1TS7A 4NXFA 5F69A 4IVIA 1I5QA 5TGFA 4WEJA 4XT2A 3WS4A 3C5AA 4DDSA 4F3LA 3LI9A 5J3WA 3RXWA 3JYIA 5A93A 4Y3IA 3KSIA 3S7OA 1CEGA 4OOMA 2P74A 2V0UA 1MKIA 1PW1A 3BM6A 5CTNA 4GJ4A 4F94A 1ESUA 3SS3A 4S2PA 1DJAA 3MXRA 4KZ7A 4CLCE 5U47A 4Q0HA 1XA7A 1DJCA 1FR1A 1OTDA 3SH9A 1XGIA 5FSRA 4BBVA 3GR2A 5FQJA 3HJKA 3NC8A 1WE4A 4L9EA 4EEPA 4E3NA 1SKFA 3ZNYA 1N9LA 4S2NC 4R4SA 3ZFZA 5CXWA 3GDIA 1Z09A 1K55A 1NZOA 1NXYA 5F83A 4WUJA 4HOIA 3VFHA 4DJ3A 2EFXA 2GNXA 4IHQA 3RTYA 1LSVA 3OPRA 5A8BA 4KQQA 1MY8A 3FWLA 2JKTI 1RP5A 3G31A 2EX6A 4CQHA 1ES5A 2XA7M 2XF3A 2Y2MA 3FV7A 2R9WA 3HLEA 3F1OB 4ZAMA 3NULA 5J8XA 1XA1A 2ZBBA 5HL1A 5HW3A 2J7VA 2R78A 4WMCA 1KDWA 1V9ZA 2V9AA 3UB6A 1IOUA 3PHYA 4O0PA 5M1AA 4LENA 1S66L 2OLUA 1NRFA 4EU0A 2XR0A 2VK3A 3ITAA 4UHUA 3VP2A 1ONHA 3G30A 2RCXA 2E8IA 3CHWP 5E2FA 4NG2A 2XLNA 4O7DA 4PM6A 1BLHA 4EBNA 1K57A 2GX5A 1JTGA 3M6BA 4DRTA 1YLZA 1LSXA 4JF6A 2JC7A 2ZQDA 2J3TD 3BFDA 3S1YA 3T4TA 4DE0A 3R4KA 4UA7A 3IF5A 5HAIA 3UB5P 4LFUA 1Y28A 3LUQA 3N8LA 4OPYA 3Q1FA 3IBJA 3UNWA 3UO9A 4LRYC 2LB9A 1TDGA 4FOFA 2B95A 2OLVA 4Y17A 1K55C 2LB5A 4LV2A 4Z1WA 2HP9A 4MN6A 1H3QA 4BD0A 5EFWA 5HX9A 2V1AA 1T1CA 4YOFA 2Y2LA 5FAOA 3V3RA 1IKGA 2VV6A 4O8GA 4BD1A 1MZUA 2X71A 4B93A 3ZVTA 4JBFA 5TBMB 2V0WA 2PD8A 2AVXA 3C4PA 4H6JB 5G4YA 3V67A 3TE8A 4ARZB 2V8FA 2IWDA 1Z6FA 1KVLA 2P9VA 5FQMA 4HBTA 1RGYA 5GHYA 4ZJ2A 2J9PA 2ZC7A 4HBUA 3IQAA 2XQZA 3SH8A 4CLCA 1S0WA 3T4OA 5DTKA 2PBYA 2PDRA 1TS6A 1XXMA 3EGXC 3B3XA 1D7EA 4O01A 4HJ3A 3HUOA 3ITBA 4BLMA 1W63M 4YFMA 1PYYA 2Y2JA 4EV4A 2B5RA 4WYYA 1RCJA 1S67L 1NLYA 4WM9A 4EWFA 2JKTM 3IXBA 2ZC3B 1CF0A 4QY6A 3PAGA 4GLQA 1FCMA 4GNUA 4ZTKA 4C3QA 1XKZA 3Q82A 3IF6B 2WKQA 1CEFA 3PAEA 2VX8A 1W8YA 1T19A 4KG6A 3E4OA 3CLOA 3FKWA 4OPQA 5FEFA 1YLJA 4P0MA 4OKPA 1HVBA 1K56A 4DXCA 3C7UA 5MC7A 2HDQA 3T1RA 3BLMA 2K7SA 3S4XA 3LIEA 2Y2IA 2OAQ1 1F98A 3U4LP 1KOUA 5AVFA 5CHUA 4QJGA 3HREA 3IWQA 3MXSA 3BYDA 1S4RA 1ES3A 4D2OA 4HIAA 3A3FA 1XJ4A 1E4DA 1VETB 1QMFA 2EXBA 1JWZA 3DTMA 5FI7A 3IS2A 3ZCZA 2HZ5A 4DE2A 4UA6A 3OC2A 1WYBA 2XROA 5E2HA 1NY0A 4GD8A 4HJ6A 1M6KA 1L0FA 3NHQA 4ID4A 3ZGAB 1ESIA 3CPTB 1DJBA 2HPBA 3QNBA 4WF0A 3KO6A 3EEAA 4OQHA 1PI5A 4YNRA 3HLWA 2PD7A 3OBFA 4N1XA 5M19A 3VOYA 3EGDC 4LLOB 1G28A 2K2NA 2Z2MB 3K3CA 3Q81A 3G35A 2FH5A 2HP5A 2P7JA 2J9OA 3W4PA 3QP5A 3V50A 3Q7VB 4IBRA 4RYEA 1MWRA 5IU1A 5L09A 3LY3A 3PBRA 1W63Q 4P87A 4A5RA 3UPPA 3C30A 2Y59A 2WK0A 3QP8A 1OMEA 2ZC4B 5CERA 4QB8A 2IWBA 2Y2NA 3HUMA 4NKPA 4BBUA 2H5SA 3BFGA 3ZHHA 3SS5A 3UB9A 1CJFA 4UEYA 3F1NB 4WEKA 4NEED 2GZAA 2Y79A 2VZWA 2VV7A 3UB7A 5L2FA 1HD8A 2V20A 1SHVA 1PZPA 3T1SA 5FATA 3OCLA 4OOYA 4KQDA 3HUNA 3GQZA 1NYYA 4OLDA 2ZMVA 4GS9A 4JXVA 1T1BA 3P7NA 1DP8A 4XT2B 4UQIM 1CK3A 3UPNA 2WZXA 4F3LB 3A0VA 5FQQA 4UA9A 3LIAA 5FI2A 2PBDP 5J7EA 4XXRA 2WUQA 2WKHA 4X69A 5FDSA 4G3KA 5KSCA 3AGEA 3ZG0A 1SCWA 1YSPA 4Y0OA 3GMWA 3BLSA 2WAFA 4BQMA 5G18A 2JKRM 5AQ9A 2Y2HA 3OLOA 2JCHA 2VKSA 3ZG5A 3EWKA 3MF0A 3HLCA 3NCKA 3CG5A 3D9YA 3P09A 3TW8A 2WGWA 3Q7VA 3QP4A 3BW6A 3UDIA 3VFFA 1Y54A 5EV0A 2J3WA 3VV4A 4HY8A 1ERQA 4BL2A 1E3UA 3MKFA 1O07A 1FCOA 3LY4A 5I94A 2H28A 3E0YA 1XJ2A 3RJUA 1ZTUA 4EQ1A 4QWOA 5A91A 2OSUA 3MJQA 3AGFA 4NETA 2X01A 1H8MA 3B47A 3LEZA 2EA9A 5AQ7A 4IUHA 5DF8A 5EVIC 4WL9A 1XFQA 3SOIA 3LIBA 5CHJA 3T4JA 2Z6DA 1SKOA 3NOTC 2R9XA 3IX4A 1HTZA 3KSFA 3IX3A 1N9BA 5F1GA 5KIZA 1LHYA 1X0OA 1YLTA 3JVUA 3RFBA 2M1CA 1BZAA 1ONGA 2W3FA 1BLPA 2EXAA 3OCNA 4KZ8A 3BWLA 2XRNA 4KG5A 5HL6A 4GCZA 4OONA 4UAAA 1F2KA 1OTIA 2W1RA 4C75A 4L9GA 3NI9A 3BQAA 3P01A 1BUEA 2J3TC 4FCFA 3ZG9B 2ZMFA 1WA9A 1ERMA 3ZDJA 2PR5A 4HEFA 4EQIA 5EOOA 3LGOA 3QP1A 4FTXA 4X53A 5CRFA 5IT5A 1EW0A 5FEGA 2QJ7A 4MLLA 1TD5A 3QHYA 2OAP1 2Y2OA 4LV0A 2O9AA 1EI5A 3N8SA 3WS5A 4KZ5A 4X25A 1VM1A 3MQ0A 1GSWA 1L3LA 2VJWA 4GZBA 4QHCA 4BJPA 1E25A 1KE3A 2UV0E 2ZQCA 4GDNA 5HDDA 1IEMA 5CEDA 1JWVA 4IUKA 5HD5A 4R3AA 4S2LA 4P6ZS 2K31A 3BY8A 5EM0A 4QY5A 1CQAA 3PXPA 1MWTA 4E3JA 4HP4A 4FH4A 4I38A 4KZBA 3UY6A 3W4QA 1XJ6A 3PR6A 1IKIA 3TJZC 2VGLM 4HNBA 3NOPC 1JTDA 4DJ2A 3UE0A 5FDHA 4BMWA 4ETXA 2JN7A 2Q9NA 1LT0A 5L8MA 2WKPA 2P9VB 4KZ3A 1T1AA 3LICA 3WRZA 1ODVA 1STZA 4Y0TA 2J8YA 4CLCB 4P85A 3T50A 1H8YA 1SDNA 3ZG7B 2HF6A 1Q2QA 1TF1A 1K4EA 2YKHA 4NK3A 3ZG8B 5AQAA 1MKMA 3ICYA 4K91A 5HSQA 3W2ZA 3NY4A 3LR5A 2ZM0A 3DWKA 1YSQA 2EX9A 2HJEA 1XP4A 3R7WA 4I3IA 4EESA 2VEAA 1T18A 4KQOA 4IJGA 4YINA 3G6OA 4M4XA 1JVJA 4R38A 4X6TA 1Y4OA 2WZZA 1A0KA 5GHXA 5HARA 3VP3A 3B42A 2XGNA 4GB7A 2PAVP 4PKYA 4RX3A 3DTIA 3MSHA 2W3EA 1IYSA 2A49A 3H9WA 4JLFA 4N1HA 4PM8A 5F1FA 1GHPA 4Y7PA 3IH8A 2ZLYA 3PTEA 3IX8A 4OQGA 3UN7A 4HESA 2E8JA 1S6RA 5FAQA 4GKUA 1IELA 2Q0OA 5BOHA 3WS1A 4DE1A 3IS2B 4EW7A 2XFSA 3MBZA 4JKTA 2BASA 1PWDA 3FG8A 2NUPC 3HL9A 1YKDA 5EVEA 5HAQA 4MBFA 2FFFB 4MCWA 3KYEA 3M2KA 3IXDA 3T4LA 2BLSA 3VP4A 3VP1A 4HHDA 4NXEA 5F82A 5DTSA 5AQBA 1L0EA 2A2LA 3KSGA 3E98A 3LYXA 5CGXA 4NXBA 3FZCA 2WKIA 1U60A 3O3VA 1IYPA 3LEQA 4R1GA 2XA7S 4QD4A 4NXGA 2ZM8A 2H10A 3MS6A 1P97A 2FFYA 5D3OA 3T4KA 3CMZA 5HZHA 3UPOA 3UDXA 4LRZE 4PHTA 1XPBA 3UDFA 2O99A 1YMSA 3NJAA 2VGKA 4DF6A 1MXOA 1NWZA 4MMNA 4Y13A 1IYOA 3IHAA 3LR4A 1CI8A 3SS4A 3SH7A
chains in the Genus database with same CATH topology
2B02A 4KQDA 4KUKA 3PYPA 1G6OA 3CITA 3CUEA 2Z6CA 3EQVA 1D06A 3EEHA 3OOVA 2PT7A 4L9FA 5F5YA 4WELA 4Y3IA 3KSIA 2JKRI 3S7OA 2NUTC 4OOMA 2V0UA 4LPZA 4BBTA 1BYWA 3LFVA 3T4SA 2ZMVA 4GS9A 1S1YA 2W1TA 2VV8A 1T1BA 3P7NA 4GJ4A 3UE3A 1DP8A 1NLZA 2KDKA 4XT2B 4UQIM 4F3LB 3A0VA 4Y5FA 3UMDA 4CLCE 4Q0HA 2V1BA 3LIAA 5J7EA 1OT6A 1OTDA 1YAXA 3PBNA 5TJJA 4G3KA 2EWWA 4BBVA 4GS9B 2W1TB 3HJIA 3HJKA 4L9EA 2PYRA 4EEPA 1YSPA 3CWFA 1N9LA 1LSWA 2I9VA 3ZQ5A 3LR0A 3BJNA 3GDIA 2J80A 3T4QA 3SW1A 2JKRM 4MN7A 4WUJA 5K5BA 4HOIA 3FPVA 4DJ3A 5DJUA 2GJ3A 3OLOA 2GNXA 2VKSA 2ZOIA 2P08A 1OPXA 4IHQA 3EWKA 3RTYA 3MF0A 1LSVA 4KUOA 3F1PA 2B18A 3HCYA 3MR0A 5A8BA 4HI4A 4Q0IA 3F1OA 3TW8A 3U2AA 2JKTI 3BW6A 3LIDA 3MQQA 2J3WA 2P04A 3D3OA 3VV4A 4HY8A 3E4PA 4CQHA 2W3DA 5DKLA 2DMWA 5G4ZA 2XA7M 3A0SA 4JGOA 3DBAA 2M7UA 2H28A 3E0YA 1XJ2A 3F1PB 3MQOA 1NRJA 1ZTUA 5F6AA 4EQ1A 3F1OB 2INWA 3UB8A 4LRXC 4I3AA 2ZBBA 3MJQA 1P0ZA 3JVVA 3UMEA 1H8MA 3B47A 2EA9A 2M7VA 2R78A 5DJTA 5DF9A 2VGLS 4GW9A 4IUHA 1XFNA 1V9ZA 2V9AA 3UB6A 4WL9A 1XFQA 1P9WA 1IOUA 3LIBA 4EUVA 3T4JA 5HWWA 3PHYA 2Z6DA 3NOTC 4O0PA 1UWPX 3CUEC 3KSFA 3VE3A 1S66L 4EU0A 3E4QA 5KIZA 1X0OA 3ULFA 3JVUA 3RFBA 4AFIA 2L4RA 2M1CA 2W3FA 3KX0X 4G3WA 3LIFA 2GX5A 1XJ3A 3OCNA 3BWLA 2XRNA 1DRMA 1TS0A 5HL6A 1LSXA 4GCZA 2J3TD 3T4TA 1OTIA 2W1RA 3R4KA 4L9GA 5HWVA 5AJGA 3BQAA 2D01A 3P01A 2ZOHA 4I3JA 2J3TC 5HPIA 1Y28A 2MJ6A 3LUQA 4HJ4A 3S7NA 2ZMFA 4BWIA 3IBJA 1WA9A 4WLAA 4LRYC 2LB9A 3VOLA 4FOFA 5KSHA 2PR5A 2LB5A 4MDZA 3S7QA 4Y2FA 5IT5A 4Z1WA 3KSHA 4MN6A 1EW0A 5DKKA 3EQUA 3PBSA 3K2NA 2QJ7A 5TBMA 1TD5A 1H3QA 5F68A 3IBRA 5EFWA 2OAP1 2V1AA 4H6JA 1T1CA 3ZYTA 4I39A 2KOIA 4FSFA 4YOFA 2W0NA 3UE6A 2VV6A 2O9AA 4O8GA 4ARZA 2O0YA 3MQ0A 1F9IA 1GSWA 2VJWA 5J4EA 1MZUA 4B93A 2CMNA 4BJPA 1UWNX 4HH2A 2EWVA 4PAUA 5TBMB 2HV1A 2KX6A 2V0WA 2PD8A 4CLCD 2QJ5A 5HDDA 2PYPA 4H6JB 5G4YA 3V67A 4IUKA 5HD5A 4R3AA 4ZRRA 3TE8A 3TRCA 4P6ZS 1OTBA 3EOIA 2OWHA 4ARZB 2K31A 4CLCC 3BY8A 2Y8HA 4ETZA 3PXPA 1S1ZA 5CX7A 4HP4A 1GSVA 4I38A 1OT9A 2PR6A 4R6LA 1XJ6A 3PR6A 3TJZC 2VGLM 4HNBA 3NOPC 3C2WA 4DJ2A 2JHEA 4ME4A 2O9CA 2HGVA 5HDCA 4CLCA 3T4OA 4BMWA 4ETXA 2JN7A 4II7A 2L1MA 2PDRA 1TS6A 1LT0A 5LBRA 5L8MA 3FPWA 5FL3A 2WKPA 3EGXC 5C5KA 1T1AA 3LICA 1D7EA 1S4SA 3H7WA 4O01A 4DN0A 4HJ3A 1ODVA 3K3DA 1STZA 5DFXA 1W63M 4CLCB 3KYZA 3T50A 1S67L 5I5LA 2QWSA 1NLYA 2JKTM 4B9OA 4PKYG 2HF6A 4GLQA 3BQ8A 1TF1A 2G7UA 2YKHA 3LI8A 3H7WB 2WKQA 4OOLA 1MKMA 3ICYA 3LR3A 5HSQA 3CI6A 2VX8A 5HDSA 3W2ZA 1T19A 3MMHA 5IS1A 3E4OA 3CLOA 3LR5A 4DMZA 1YSQA 3A0RA 4MN5A 2XSSA 3FC7A 1ZHHB 1N9NA 2HJEA 1V9YA 5DFYA 2QHKA 2OWJA 3R7WA 4I3IA 4EESA 2VEAA 2VLGA 1T18A 1OTAA 4KQOA 4I5SA 4IJGA 3G6OA 5MC7A 4M4XA 4R38A 4EXOA 4RQ9A 2K7SA 2W3GA 3C8CA 2OOLA 3B42A 3LIEA 2OAQ1 1F98A 4PKYA 2YKFA 3R7WB 1KOUA 5AVFA 1VB6A 2WKRA 2VA0A 3KYQA 2KLIA 3S7PA 3PBTA 2W3EA 4WN5A 1S4RA 3H9WA 5HD3A 1LL8A 4P6ZM 2W3HA 4G3VA 4HIAA 1XJ4A 3O5YA 5AVEA 1OJ5A 4JGPA 4EEUA 3IS2A 4UQIS 2IA2A 3VE4A 2W27A 3OC2A 2HJ9C 3B33A 2XROA 4Q0JA 3PBOA 1JNUA 4HH3A 1DP9A 4HJ6A 3IS2B 4EW7A 3NHQA 2BASA 2QKPA 3FG8A 3H82A 2NUPC 1YKDA 1VHMA 4WF0A 4EETB 3KO6A 4JGRA 3EEAA 1OTEA 2D02A 3GECA 1GSXA 4MCWA 4YNRA 3MXQA 4YWZA 1DP6A 3C38A 2PD7A 2PHYA 3OBFA 3T4LA 3CAXA 3EGDC 4LLOB 1G28A 2K2NA 4JGQA 4HHDA 4NXEA 4K08A 3MFXA 3K3CA 4EERA 4GHIA 2FH5A 3H82B 2P7JA 4E04A 2A2LA 3KSGA 3E98A 4HP9A 2L0WA 3LYXA 4NXBA 2A24A 5IU1A 4QPRA 3PBQA 3PBRA 1W63Q 1OJGA 1P9RA 3C30A 2XA7S 1MC0A 3F1NA 4GHIB 4NXGA 2FZ0A 1P97A 3T4KA 5HWTA 3NOUC 3RH8B 1TS8A 4NKPA 1N9OA 5HZHA 4HQAA 2A24B 3BY9A 4BBUA 1IFQA 1UGUA 5HPFA 4LRZE 1TS7A 4PHTA 4NXFA 3UB9A 2O99A 4UEYA 5F69A 3NJAA 3F1NB 4WEKA 4NEED 1NWZA 4MMNA 2GZAA 2Y79A 2O9BA 1F5MA 2QYBA 2VZWA 2VV7A 3UB7A 4R70A 4WEJA 4XT2A 3LR4A 4L0LA 3D72A 3LI9A 5J3WA 4F3LA 3OCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B02 A;  4KQD A;  4KUK A;  3PYP A;  4L9F A;  2Z6C A;  1D06 A;  3EEH A;  5F5Y A;  2V0U A;  4LPZ A;  4BBT A;  1BYW A;  4GS9 A;  1S1Y A;  2VV8 A;  1T1B A;  3P7N A;  1DP8 A;  4XT2 B;  2KDK A;  4F3L B;  3A0V A;  3UMD A;  2V1B A;  3LIA A;  5J7E A;  1OT6 A;  1OTD A;  4BBV A;  4GS9 B;  3HJI A;  3HJK A;  4L9E A;  2PYR A;  4EEP A;  3CWF A;  1N9L A;  1LSW A;  2I9V A;  3ZQ5 A;  3GDI A;  2J80 A;  3SW1 A;  4WUJ A;  4HOI A;  4DJ3 A;  5DJU A;  2GJ3 A;  3OLO A;  2ZOI A;  3EWK A;  3RTY A;  1LSV A;  4KUO A;  3F1P A;  3MR0 A;  5A8B A;  4HI4 A;  3F1O A;  3LID A;  3MQQ A;  4HY8 A;  3E4P A;  5DKL A;  5G4Z A;  3A0S A;  4JGO A;  2H28 A;  1XJ2 A;  3F1P B;  3MQO A;  5F6A A;  4EQ1 A;  3F1O B;  2INW A;  3UB8 A;  4LRX C;  4I3A A;  2ZBB A;  3MJQ A;  1P0Z A;  3UME A;  2EA9 A;  2R78 A;  5DJT A;  4GW9 A;  1XFN A;  1V9Z A;  2V9A A;  3UB6 A;  4WL9 A;  1XFQ A;  3LIB A;  5HWW A;  3PHY A;  2Z6D A;  3NOT C;  1UWP X;  3VE3 A;  1S66 L;  3E4Q A;  5KIZ A;  1X0O A;  3ULF A;  2L4R A;  2M1C A;  3KX0 X;  3LIF A;  1XJ3 A;  3BWL A;  1DRM A;  1TS0 A;  1LSX A;  4GCZ A;  1OTI A;  4L9G A;  5HWV A;  2D01 A;  2ZOH A;  4I3J A;  1Y28 A;  3LUQ A;  4HJ4 A;  1WA9 A;  4WLA A;  4LRY C;  3VOL A;  2PR5 A;  4MN6 A;  1EW0 A;  5DKK A;  2QJ7 A;  5TBM A;  5F68 A;  3IBR A;  5EFW A;  2V1A A;  4H6J A;  1T1C A;  4I39 A;  3UE6 A;  2W0N A;  2VV6 A;  1F9I A;  1GSW A;  5J4E A;  1MZU A;  2CMN A;  1UWN X;  4HH2 A;  5TBM B;  2HV1 A;  2KX6 A;  2V0W A;  2PD8 A;  2QJ5 A;  5HDD A;  2PYP A;  4H6J B;  5G4Y A;  5HD5 A;  4R3A A;  1OTB A;  2OWH A;  3BY8 A;  1S1Z A;  4HP4 A;  1GSV A;  4I38 A;  1OT9 A;  2PR6 A;  4R6L A;  1XJ6 A;  4HNB A;  3NOP C;  3C2W A;  4DJ2 A;  2JHE A;  5HDC A;  2JN7 A;  2L1M A;  2PDR A;  1TS6 A;  1LT0 A;  2WKP A;  1T1A A;  3LIC A;  1D7E A;  1S4S A;  3H7W A;  4HJ3 A;  1ODV A;  3K3D A;  3T50 A;  1S67 L;  5I5L A;  2QWS A;  4B9O A;  4PKY G;  2YKH A;  3LI8 A;  3H7W B;  2WKQ A;  3ICY A;  5HSQ A;  5HDS A;  1T19 A;  5IS1 A;  3E4O A;  3CLO A;  3A0R A;  4MN5 A;  3FC7 A;  1N9N A;  1V9Y A;  2QHK A;  2OWJ A;  4I3I A;  4EES A;  2VEA A;  2VLG A;  1T18 A;  1OTA A;  4I5S A;  3G6O A;  4M4X A;  4R38 A;  4EXO A;  4RQ9 A;  2K7S A;  3C8C A;  2OOL A;  3LIE A;  1F98 A;  4PKY A;  2YKF A;  1KOU A;  5AVF A;  1VB6 A;  2WKR A;  4WN5 A;  1S4R A;  3H9W A;  5HD3 A;  1LL8 A;  4HIA A;  1XJ4 A;  5AVE A;  1OJ5 A;  4JGP A;  4EEU A;  3IS2 A;  3VE4 A;  2W27 A;  3B33 A;  1JNU A;  4HH3 A;  1DP9 A;  4HJ6 A;  3IS2 B;  4EW7 A;  3NHQ A;  2BAS A;  2QKP A;  3FG8 A;  3H82 A;  4WF0 A;  4EET B;  4JGR A;  1OTE A;  2D02 A;  3GEC A;  1GSX A;  3MXQ A;  4YWZ A;  1DP6 A;  2PD7 A;  2PHY A;  3CAX A;  4LLO B;  1G28 A;  4JGQ A;  4HHD A;  4NXE A;  4K08 A;  3MFX A;  3K3C A;  4EER A;  4GHI A;  3H82 B;  2P7J A;  4E04 A;  4HP9 A;  2L0W A;  3LYX A;  4NXB A;  2A24 A;  5IU1 A;  1OJG A;  3F1N A;  4GHI B;  4NXG A;  1P97 A;  5HWT A;  3NOU C;  3RH8 B;  1TS8 A;  5HZH A;  1N9O A;  4HQA A;  2A24 B;  3BY9 A;  4BBU A;  1UGU A;  4LRZ E;  1TS7 A;  4NXF A;  3UB9 A;  5F69 A;  3NJA A;  3F1N B;  1NWZ A;  2VV7 A;  3UB7 A;  4R70 A;  4XT2 A;  3D72 A;  3LI9 A;  5J3W A;  4F3L A; 
#chains in the Genus database with same CATH topology
 2Y2Q A;  2B02 A;  1G6O A;  3CIT A;  3CUE A;  2Z6C A;  3EQV A;  1D06 A;  3EEH A;  3OOV A;  1D1J A;  4L9F A;  4EUZ A;  4WEL A;  2JKR I;  2NUT C;  3T1X A;  4QU3 A;  4LPZ A;  1BYW A;  3LFV A;  3T4S A;  2JKG A;  2W1T A;  2VV8 A;  2KDK A;  5EVI B;  5HAP A;  3UMD A;  4JF5 A;  1VQQ A;  2C6W B;  1AWI A;  5TJJ A;  2EWW A;  1W8Q A;  4GS9 B;  3A3I A;  5EPH A;  3IXG A;  4S2M A;  3CWF A;  1LSW A;  4CPK A;  2I9V A;  3ZQ5 A;  3LR0 A;  1ZG4 A;  3BJN A;  5A90 A;  4OP8 A;  2XFT A;  4ZDX A;  2J80 A;  3T4Q A;  4JXG A;  3SW1 A;  4MN7 A;  2HDU A;  2GJ3 A;  1KE0 A;  3TOI A;  1NYM A;  3MZF A;  3DTK A;  2V8C A;  3F1P A;  2I72 A;  2B18 A;  3MR0 A;  4WMC D;  4Q0I A;  4WZ5 C;  3LID A;  3SZT A;  3CJM A;  3NDE A;  2ZJ9 A;  2P04 A;  3D3O A;  5E43 A;  1KGF A;  5DKL A;  2DMW A;  3G2Y A;  5G4Z A;  2WAD A;  2IWC A;  1PNE A;  4JGO A;  1FQG A;  3DBA A;  2M7U A;  4FUW A;  1ACF A;  2Y2K A;  3IT9 A;  5F6A A;  2XK1 A;  3UB8 A;  2WGW B;  1K0K A;  4LRX C;  4I3A A;  4DDY A;  3WRT A;  3JVV A;  3UME A;  2G2W A;  1XX2 A;  4K0X A;  4IED A;  4GW9 A;  4Q8I A;  1XFN A;  4B4Z A;  1G5U A;  1P9W A;  3IXH A;  4EUV A;  4R3J A;  3V5M A;  1UWP X;  3CUE C;  1YLY A;  3VE3 A;  1KGE A;  1WYC A;  3ULF A;  3C4O A;  3VSL A;  1W5D A;  3KX0 X;  3G32 A;  3LIF A;  5EVL A;  2Q9M A;  1SKO B;  5EVI A;  3I7J A;  1DRM A;  1TS0 A;  4GD6 A;  1PWC A;  2DRW A;  4OQI A;  3HLF A;  1GA9 A;  4N92 A;  1BSG A;  2Y55 A;  2QZ6 A;  5JYO A;  2D01 A;  1HLU P;  5HPI A;  2MJ6 A;  5GLA A;  4HJ4 A;  3IWI A;  2EX2 A;  4RA7 A;  1K6S A;  4PPR A;  5IHV A;  1L0G A;  5TR7 A;  3S7Q A;  4Y2F A;  1K6R A;  3PBS A;  5FAS A;  5F68 A;  4DE3 A;  2ZL1 A;  3ZYT A;  4I39 A;  2VGJ A;  4FSF A;  2W0N A;  3UE6 A;  2XDM A;  4OLG A;  4FH2 A;  2OV5 A;  2CMN A;  3M2J A;  1UWN X;  3E2K A;  4HH2 A;  5CEB A;  1QME A;  2HV1 A;  4R4R A;  4CLC D;  2QJ5 A;  4GOG A;  3DAV A;  3BRM A;  2PYP A;  1ES2 A;  3RXX A;  4ZRR A;  3TRC A;  2OWH A;  5M18 A;  2Z2L B;  3HLD A;  4MBK A;  2Y8H A;  4PM7 A;  1NJ4 A;  1AXB A;  5CX7 A;  2ZM2 A;  3NEC A;  1I2S A;  1GSV A;  1VEU A;  1TEM A;  1PIO A;  4R6L A;  4OQ0 A;  3IF6 C;  4FD8 A;  1J3W A;  3C2W A;  2JHE A;  4X68 A;  5FQ9 A;  2HGV A;  5HDC A;  2WKE A;  5L10 A;  2L1M A;  4S2I A;  5LBR A;  3IHB A;  5FL3 A;  4LV3 A;  1SDE A;  3BEC A;  4ZBE A;  5C5K A;  3H7W A;  4DN0 A;  3K3D A;  3A3J A;  3T12 B;  4LGW A;  4MEZ A;  5GLC A;  1K56 D;  1PI4 A;  2QMI A;  1C3B A;  3BQ8 A;  3DWZ A;  4OOL A;  5TFQ A;  4E3K A;  3CI6 A;  5HDS A;  3MMH A;  4DMZ A;  2XSS A;  4PM9 A;  3FC7 A;  4EBP A;  1N9N A;  5DFY A;  1V9Y A;  2OWJ A;  3HVF A;  2VLG A;  4I5S A;  1O7E A;  1LI0 A;  3GSG A;  4E3M A;  4EXO A;  2BG1 A;  2XD5 A;  2C5W B;  2W3G A;  3C8C A;  4PM5 A;  2YKF A;  3OPP A;  3R7W B;  1VB6 A;  4WBG A;  2VA0 A;  3KYQ A;  3S7P A;  3PBT A;  4WN5 A;  3DW0 A;  5DF7 A;  5HD3 A;  1FIK A;  3MZD A;  4G3V A;  4OPR A;  1ZKJ A;  3O5Y A;  2G2U A;  3BFE A;  4JGP A;  4B4X A;  4S2K A;  3Q7Z A;  5EM1 A;  4CJN A;  4UQI S;  4P6B A;  2W27 A;  2HJ9 C;  3B33 A;  4Q0J A;  5CGS A;  3A3D A;  3GRJ A;  1JNU A;  4HH3 A;  1DP9 A;  1ERO A;  4BEN A;  3H82 A;  1VHM A;  3O88 A;  2ZC6 B;  3N6I A;  4JGR A;  3GEC A;  1GSX A;  4YWZ A;  1HZO A;  1JWP A;  5A92 A;  5EEC A;  5HFO A;  3ISG A;  4JGQ A;  3ZNT A;  4K08 A;  3TG9 A;  3MFX A;  1G68 A;  1K54 C;  3NBL A;  3OZH A;  3WS2 A;  4EER A;  4GHI A;  1H8Z A;  4LCM A;  5GLB A;  5KMW A;  5CHM A;  1K25 A;  4E04 A;  4HP9 A;  2L0W A;  3HLG A;  4X1L A;  1MBL A;  2A24 A;  3PBQ A;  5EVI D;  4GN2 A;  1ALQ A;  3O87 A;  1BT5 A;  4R0Q A;  3RH8 B;  4JF4 A;  1IFQ A;  1UGU A;  4E3I A;  4E6X A;  3L7H A;  3E2L A;  2WAE A;  2HDR A;  5DTT A;  1ZC2 A;  4X55 A;  4LV1 A;  3VSK A;  1N4O A;  2O9B A;  1F5M A;  2QYB A;  4R70 A;  4L0L A;  3IH9 A;  3D72 A;  4KUK A;  3FYZ A;  3PYP A;  5F5Y A;  2PT7 A;  4KEN B;  1H5X A;  4BBT A;  1PWG A;  1S1Y A;  3UE3 A;  1NLZ A;  4N9K A;  4Y5F A;  2V1B A;  3N8R A;  3GVB A;  1OT6 A;  1KDS A;  1YAX A;  3PBN A;  1GCE A;  4E3O A;  1W7F A;  2W1T B;  3HJI A;  2PYR A;  5CEC A;  1LL9 A;  1M40 A;  4M3K A;  4JPM A;  3G4P A;  1PFL A;  1E3U D;  1I2W A;  3QNC A;  5FA7 A;  3UE1 A;  2X02 A;  5K5B A;  3FPV A;  5DJU A;  4ZJ1 A;  1EWZ A;  2ZOI A;  1DY6 A;  1OPX A;  2P08 A;  4RVA A;  4RX2 A;  2ZQ9 A;  4D60 A;  3OPL A;  4KUO A;  3HCY A;  4HI4 A;  3F1O A;  3U2A A;  4OPZ A;  3MQQ A;  2QPN A;  1BLC A;  3E4P A;  2Y2P A;  1RGZ A;  2W3D A;  3A3E A;  1K38 A;  2UWX A;  3C7V A;  3N7W A;  3A0S A;  1PZO A;  2Y2G A;  5DVA A;  3F1P B;  3MQO A;  1NRJ A;  2INW A;  4KZ6 A;  1YQS A;  1KGG A;  1MWS A;  2GDN A;  3L9K A;  4WZ5 A;  1NZU A;  2PU4 A;  1P0Z A;  4IBX A;  2M7V A;  5DJT A;  1K57 C;  2VGL S;  5DF9 A;  4ESP A;  5GL9 A;  5EOE A;  3MKE A;  4PMA A;  3BFC A;  5HWW A;  3G34 A;  5E2E A;  3WWX A;  1LI9 A;  3E4Q A;  3VP0 A;  4MBH A;  3VMA A;  2HP6 A;  4AFI A;  2DNS A;  5FAP A;  2L4R A;  4MNR A;  5FQK A;  4G3W A;  4U3T A;  1YPR A;  1XJ3 A;  2JE5 A;  2XH9 A;  1GHM A;  2H0T A;  2XD1 A;  1YLW A;  5HWV A;  1W79 A;  5AJG A;  3GTC A;  1LL5 A;  2ZOH A;  4I3J A;  3NDG A;  3T1Q B;  2A3U A;  1BLS A;  3CZD A;  3S7N A;  4BWI A;  4WLA A;  3VOL A;  1PW8 A;  2ZC5 B;  5KSH A;  4LCL A;  1KVM A;  2H0Y A;  4MDZ A;  1Q2P A;  2HDS A;  3KSH A;  4DKI A;  5DKK A;  3EQU A;  5JYP A;  5GHZ A;  3K2N A;  3BFF A;  5TBM A;  3IWO A;  4KZ9 A;  3IBR A;  4Y0U A;  4R23 A;  4H6J A;  1FR6 A;  2KOI A;  2JBF A;  3M6H A;  3HLB A;  5GLD A;  4ARZ A;  2O0Y A;  1IYQ A;  4OP5 A;  1TDL A;  1F9I A;  2V2F F;  5J4E A;  1FSY A;  1FCN A;  2EWV A;  4PAU A;  2KX6 A;  2ZL1 B;  1L0D A;  1OTB A;  3EOI A;  4CLC C;  2EX8 A;  3DTE A;  4ETZ A;  1S1Z A;  3MFD A;  3TSG A;  3ZVW A;  1K4F A;  3Q07 A;  1OT9 A;  2PR6 A;  2Y91 A;  4GDB A;  3D4F A;  3W8K A;  3N4I A;  5EE8 A;  1MWU A;  4ME4 A;  1H0M A;  2O9C A;  3O86 A;  4X56 A;  2ACG A;  3AGD A;  4II7 A;  3W4O A;  1GA0 A;  1VEU B;  3S22 A;  3FPW A;  5CTM A;  3G2Z A;  3JPU A;  1MPL A;  4JXS A;  3IF6 A;  1S4S A;  1BTL A;  5DFX A;  4Y15 A;  3KYZ A;  4WZ4 A;  4K0W A;  2QWS A;  5I5L A;  3MZE A;  4B9O A;  4PKY G;  4U0T A;  4DXB A;  2G7U A;  1ZG6 A;  3LI8 A;  3H7W B;  1FSW A;  4S2J A;  3LR3 A;  4H8R A;  3QP6 A;  5IS1 A;  3FKV A;  4IVK A;  1L2S A;  3A0R A;  4MN5 A;  1ZHH B;  1J9M A;  5L07 A;  4BL3 A;  4XUX A;  2QHK A;  1OTA A;  3V3S A;  4KZ4 A;  5FI6 A;  4RQ9 A;  4X1M A;  4C6Y A;  2OOL A;  3LO7 A;  2BTF P;  1TVF A;  1G6A A;  1LLB A;  3WS0 A;  2ZD8 A;  3HBR A;  1VET A;  2DCF A;  2WKR A;  2EFU A;  1KE4 A;  2KLI A;  2PRF A;  2V1Z A;  5EUA A;  3GV9 A;  4OH0 A;  1LL8 A;  4JXW A;  4P6Z M;  2W3H A;  2ZQ8 A;  5AVE A;  1OJ5 A;  2ZQ7 A;  4EEU A;  4KZA A;  4R3B A;  3OPH A;  1SZV A;  2CC1 A;  2WGI A;  2IA2 A;  3VE4 A;  3CPT A;  4E3L A;  2XEP A;  4EBL A;  4XUZ A;  4Z9Q A;  5FQI A;  3PBO A;  2Y4A A;  3NIA A;  5CGW A;  4U0X A;  3P98 A;  1YT4 A;  2RL3 A;  2PU2 A;  1GHI A;  2QKP A;  3BEB A;  3QP2 A;  4S2N A;  4EET B;  4N9L A;  1OTE A;  2D02 A;  3MXQ A;  1DP6 A;  3C38 A;  2PHY A;  2ZQA A;  3CAX A;  5KZH A;  4ZJ3 A;  4KG2 A;  1FOF A;  3H82 B;  1YLP A;  2JKF A;  1ES4 A;  4KQR A;  2WGV A;  1FIL A;  4QPR A;  4E6W A;  1YM1 A;  4B88 A;  1OJG A;  1CI9 A;  2WYX A;  1P9R A;  3LCE A;  3V39 A;  3VOZ A;  4GHI B;  1MC0 A;  1PRQ A;  3F1N A;  2FZ0 A;  1K54 A;  1YMX A;  5HWT A;  3NOU C;  1TS8 A;  1BUL A;  1N9O A;  4HQA A;  5E2G A;  2A24 B;  3BY9 A;  2ZMA A;  4S2O A;  1XGJ A;  4OVD A;  5HPF A;  1TS7 A;  4NXF A;  5F69 A;  4IVI A;  1I5Q A;  5TGF A;  4WEJ A;  4XT2 A;  3WS4 A;  3C5A A;  4DDS A;  4F3L A;  3LI9 A;  5J3W A;  3RXW A;  3JYI A;  5A93 A;  4Y3I A;  3KSI A;  3S7O A;  1CEG A;  4OOM A;  2P74 A;  2V0U A;  1MKI A;  1PW1 A;  3BM6 A;  5CTN A;  4GJ4 A;  4F94 A;  1ESU A;  3SS3 A;  4S2P A;  1DJA A;  3MXR A;  4KZ7 A;  4CLC E;  5U47 A;  4Q0H A;  1XA7 A;  1DJC A;  1FR1 A;  1OTD A;  3SH9 A;  1XGI A;  5FSR A;  4BBV A;  3GR2 A;  5FQJ A;  3HJK A;  3NC8 A;  1WE4 A;  4L9E A;  4EEP A;  4E3N A;  1SKF A;  3ZNY A;  1N9L A;  4S2N C;  4R4S A;  3ZFZ A;  5CXW A;  3GDI A;  1Z09 A;  1K55 A;  1NZO A;  1NXY A;  5F83 A;  4WUJ A;  4HOI A;  3VFH A;  4DJ3 A;  2EFX A;  2GNX A;  4IHQ A;  3RTY A;  1LSV A;  3OPR A;  5A8B A;  4KQQ A;  1MY8 A;  3FWL A;  2JKT I;  1RP5 A;  3G31 A;  2EX6 A;  4CQH A;  1ES5 A;  2XA7 M;  2XF3 A;  2Y2M A;  3FV7 A;  2R9W A;  3HLE A;  3F1O B;  4ZAM A;  3NUL A;  5J8X A;  1XA1 A;  2ZBB A;  5HL1 A;  5HW3 A;  2J7V A;  2R78 A;  4WMC A;  1KDW A;  1V9Z A;  2V9A A;  3UB6 A;  1IOU A;  3PHY A;  4O0P A;  5M1A A;  4LEN A;  1S66 L;  2OLU A;  1NRF A;  4EU0 A;  2XR0 A;  2VK3 A;  3ITA A;  4UHU A;  3VP2 A;  1ONH A;  3G30 A;  2RCX A;  2E8I A;  3CHW P;  5E2F A;  4NG2 A;  2XLN A;  4O7D A;  4PM6 A;  1BLH A;  4EBN A;  1K57 A;  2GX5 A;  1JTG A;  3M6B A;  4DRT A;  1YLZ A;  1LSX A;  4JF6 A;  2JC7 A;  2ZQD A;  2J3T D;  3BFD A;  3S1Y A;  3T4T A;  4DE0 A;  3R4K A;  4UA7 A;  3IF5 A;  5HAI A;  3UB5 P;  4LFU A;  1Y28 A;  3LUQ A;  3N8L A;  4OPY A;  3Q1F A;  3IBJ A;  3UNW A;  3UO9 A;  4LRY C;  2LB9 A;  1TDG A;  4FOF A;  2B95 A;  2OLV A;  4Y17 A;  1K55 C;  2LB5 A;  4LV2 A;  4Z1W A;  2HP9 A;  4MN6 A;  1H3Q A;  4BD0 A;  5EFW A;  5HX9 A;  2V1A A;  1T1C A;  4YOF A;  2Y2L A;  5FAO A;  3V3R A;  1IKG A;  2VV6 A;  4O8G A;  4BD1 A;  1MZU A;  2X71 A;  4B93 A;  3ZVT A;  4JBF A;  5TBM B;  2V0W A;  2PD8 A;  2AVX A;  3C4P A;  4H6J B;  5G4Y A;  3V67 A;  3TE8 A;  4ARZ B;  2V8F A;  2IWD A;  1Z6F A;  1KVL A;  2P9V A;  5FQM A;  4HBT A;  1RGY A;  5GHY A;  4ZJ2 A;  2J9P A;  2ZC7 A;  4HBU A;  3IQA A;  2XQZ A;  3SH8 A;  4CLC A;  1S0W A;  3T4O A;  5DTK A;  2PBY A;  2PDR A;  1TS6 A;  1XXM A;  3EGX C;  3B3X A;  1D7E A;  4O01 A;  4HJ3 A;  3HUO A;  3ITB A;  4BLM A;  1W63 M;  4YFM A;  1PYY A;  2Y2J A;  4EV4 A;  2B5R A;  4WYY A;  1RCJ A;  1S67 L;  1NLY A;  4WM9 A;  4EWF A;  2JKT M;  3IXB A;  2ZC3 B;  1CF0 A;  4QY6 A;  3PAG A;  4GLQ A;  1FCM A;  4GNU A;  4ZTK A;  4C3Q A;  1XKZ A;  3Q82 A;  3IF6 B;  2WKQ A;  1CEF A;  3PAE A;  2VX8 A;  1W8Y A;  1T19 A;  4KG6 A;  3E4O A;  3CLO A;  3FKW A;  4OPQ A;  5FEF A;  1YLJ A;  4P0M A;  4OKP A;  1HVB A;  1K56 A;  4DXC A;  3C7U A;  5MC7 A;  2HDQ A;  3T1R A;  3BLM A;  2K7S A;  3S4X A;  3LIE A;  2Y2I A;  2OAQ 1;  1F98 A;  3U4L P;  1KOU A;  5AVF A;  5CHU A;  4QJG A;  3HRE A;  3IWQ A;  3MXS A;  3BYD A;  1S4R A;  1ES3 A;  4D2O A;  4HIA A;  3A3F A;  1XJ4 A;  1E4D A;  1VET B;  1QMF A;  2EXB A;  1JWZ A;  3DTM A;  5FI7 A;  3IS2 A;  3ZCZ A;  2HZ5 A;  4DE2 A;  4UA6 A;  3OC2 A;  1WYB A;  2XRO A;  5E2H A;  1NY0 A;  4GD8 A;  4HJ6 A;  1M6K A;  1L0F A;  3NHQ A;  4ID4 A;  3ZGA B;  1ESI A;  3CPT B;  1DJB A;  2HPB A;  3QNB A;  4WF0 A;  3KO6 A;  3EEA A;  4OQH A;  1PI5 A;  4YNR A;  3HLW A;  2PD7 A;  3OBF A;  4N1X A;  5M19 A;  3VOY A;  3EGD C;  4LLO B;  1G28 A;  2K2N A;  2Z2M B;  3K3C A;  3Q81 A;  3G35 A;  2FH5 A;  2HP5 A;  2P7J A;  2J9O A;  3W4P A;  3QP5 A;  3V50 A;  3Q7V B;  4IBR A;  4RYE A;  1MWR A;  5IU1 A;  5L09 A;  3LY3 A;  3PBR A;  1W63 Q;  4P87 A;  4A5R A;  3UPP A;  3C30 A;  2Y59 A;  2WK0 A;  3QP8 A;  1OME A;  2ZC4 B;  5CER A;  4QB8 A;  2IWB A;  2Y2N A;  3HUM A;  4NKP A;  4BBU A;  2H5S A;  3BFG A;  3ZHH A;  3SS5 A;  3UB9 A;  1CJF A;  4UEY A;  3F1N B;  4WEK A;  4NEE D;  2GZA A;  2Y79 A;  2VZW A;  2VV7 A;  3UB7 A;  5L2F A;  1HD8 A;  2V20 A;  1SHV A;  1PZP A;  3T1S A;  5FAT A;  3OCL A;  4OOY A;  4KQD A;  3HUN A;  3GQZ A;  1NYY A;  4OLD A;  2ZMV A;  4GS9 A;  4JXV A;  1T1B A;  3P7N A;  1DP8 A;  4XT2 B;  4UQI M;  1CK3 A;  3UPN A;  2WZX A;  4F3L B;  3A0V A;  5FQQ A;  4UA9 A;  3LIA A;  5FI2 A;  2PBD P;  5J7E A;  4XXR A;  2WUQ A;  2WKH A;  4X69 A;  5FDS A;  4G3K A;  5KSC A;  3AGE A;  3ZG0 A;  1SCW A;  1YSP A;  4Y0O A;  3GMW A;  3BLS A;  2WAF A;  4BQM A;  5G18 A;  2JKR M;  5AQ9 A;  2Y2H A;  3OLO A;  2JCH A;  2VKS A;  3ZG5 A;  3EWK A;  3MF0 A;  3HLC A;  3NCK A;  3CG5 A;  3D9Y A;  3P09 A;  3TW8 A;  2WGW A;  3Q7V A;  3QP4 A;  3BW6 A;  3UDI A;  3VFF A;  1Y54 A;  5EV0 A;  2J3W A;  3VV4 A;  4HY8 A;  1ERQ A;  4BL2 A;  1E3U A;  3MKF A;  1O07 A;  1FCO A;  3LY4 A;  5I94 A;  2H28 A;  3E0Y A;  1XJ2 A;  3RJU A;  1ZTU A;  4EQ1 A;  4QWO A;  5A91 A;  2OSU A;  3MJQ A;  3AGF A;  4NET A;  2X01 A;  1H8M A;  3B47 A;  3LEZ A;  2EA9 A;  5AQ7 A;  4IUH A;  5DF8 A;  5EVI C;  4WL9 A;  1XFQ A;  3SOI A;  3LIB A;  5CHJ A;  3T4J A;  2Z6D A;  1SKO A;  3NOT C;  2R9X A;  3IX4 A;  1HTZ A;  3KSF A;  3IX3 A;  1N9B A;  5F1G A;  5KIZ A;  1LHY A;  1X0O A;  1YLT A;  3JVU A;  3RFB A;  2M1C A;  1BZA A;  1ONG A;  2W3F A;  1BLP A;  2EXA A;  3OCN A;  4KZ8 A;  3BWL A;  2XRN A;  4KG5 A;  5HL6 A;  4GCZ A;  4OON A;  4UAA A;  1F2K A;  1OTI A;  2W1R A;  4C75 A;  4L9G A;  3NI9 A;  3BQA A;  3P01 A;  1BUE A;  2J3T C;  4FCF A;  3ZG9 B;  2ZMF A;  1WA9 A;  1ERM A;  3ZDJ A;  2PR5 A;  4HEF A;  4EQI A;  5EOO A;  3LGO A;  3QP1 A;  4FTX A;  4X53 A;  5CRF A;  5IT5 A;  1EW0 A;  5FEG A;  2QJ7 A;  4MLL A;  1TD5 A;  3QHY A;  2OAP 1;  2Y2O A;  4LV0 A;  2O9A A;  1EI5 A;  3N8S A;  3WS5 A;  4KZ5 A;  4X25 A;  1VM1 A;  3MQ0 A;  1GSW A;  1L3L A;  2VJW A;  4GZB A;  4QHC A;  4BJP A;  1E25 A;  1KE3 A;  2UV0 E;  2ZQC A;  4GDN A;  5HDD A;  1IEM A;  5CED A;  1JWV A;  4IUK A;  5HD5 A;  4R3A A;  4S2L A;  4P6Z S;  2K31 A;  3BY8 A;  5EM0 A;  4QY5 A;  1CQA A;  3PXP A;  1MWT A;  4E3J A;  4HP4 A;  4FH4 A;  4I38 A;  4KZB A;  3UY6 A;  3W4Q A;  1XJ6 A;  3PR6 A;  1IKI A;  3TJZ C;  2VGL M;  4HNB A;  3NOP C;  1JTD A;  4DJ2 A;  3UE0 A;  5FDH A;  4BMW A;  4ETX A;  2JN7 A;  2Q9N A;  1LT0 A;  5L8M A;  2WKP A;  2P9V B;  4KZ3 A;  1T1A A;  3LIC A;  3WRZ A;  1ODV A;  1STZ A;  4Y0T A;  2J8Y A;  4CLC B;  4P85 A;  3T50 A;  1H8Y A;  1SDN A;  3ZG7 B;  2HF6 A;  1Q2Q A;  1TF1 A;  1K4E A;  2YKH A;  4NK3 A;  3ZG8 B;  5AQA A;  1MKM A;  3ICY A;  4K91 A;  5HSQ A;  3W2Z A;  3NY4 A;  3LR5 A;  2ZM0 A;  3DWK A;  1YSQ A;  2EX9 A;  2HJE A;  1XP4 A;  3R7W A;  4I3I A;  4EES A;  2VEA A;  1T18 A;  4KQO A;  4IJG A;  4YIN A;  3G6O A;  4M4X A;  1JVJ A;  4R38 A;  4X6T A;  1Y4O A;  2WZZ A;  1A0K A;  5GHX A;  5HAR A;  3VP3 A;  3B42 A;  2XGN A;  4GB7 A;  2PAV P;  4PKY A;  4RX3 A;  3DTI A;  3MSH A;  2W3E A;  1IYS A;  2A49 A;  3H9W A;  4JLF A;  4N1H A;  4PM8 A;  5F1F A;  1GHP A;  4Y7P A;  3IH8 A;  2ZLY A;  3PTE A;  3IX8 A;  4OQG A;  3UN7 A;  4HES A;  2E8J A;  1S6R A;  5FAQ A;  4GKU A;  1IEL A;  2Q0O A;  5BOH A;  3WS1 A;  4DE1 A;  3IS2 B;  4EW7 A;  2XFS A;  3MBZ A;  4JKT A;  2BAS A;  1PWD A;  3FG8 A;  2NUP C;  3HL9 A;  1YKD A;  5EVE A;  5HAQ A;  4MBF A;  2FFF B;  4MCW A;  3KYE A;  3M2K A;  3IXD A;  3T4L A;  2BLS A;  3VP4 A;  3VP1 A;  4HHD A;  4NXE A;  5F82 A;  5DTS A;  5AQB A;  1L0E A;  2A2L A;  3KSG A;  3E98 A;  3LYX A;  5CGX A;  4NXB A;  3FZC A;  2WKI A;  1U60 A;  3O3V A;  1IYP A;  3LEQ A;  4R1G A;  2XA7 S;  4QD4 A;  4NXG A;  2ZM8 A;  2H10 A;  3MS6 A;  1P97 A;  2FFY A;  5D3O A;  3T4K A;  3CMZ A;  5HZH A;  3UPO A;  3UDX A;  4LRZ E;  4PHT A;  1XPB A;  3UDF A;  2O99 A;  1YMS A;  3NJA A;  2VGK A;  4DF6 A;  1MXO A;  1NWZ A;  4MMN A;  4Y13 A;  1IYO A;  3IHA A;  3LR4 A;  1CI8 A;  3SS4 A;  3SH7 A; 
#chains in the Genus database with same CATH homology
 2B02 A;  4KQD A;  4KUK A;  3PYP A;  1G6O A;  3CIT A;  3CUE A;  2Z6C A;  3EQV A;  1D06 A;  3EEH A;  3OOV A;  2PT7 A;  4L9F A;  5F5Y A;  4WEL A;  4Y3I A;  3KSI A;  2JKR I;  3S7O A;  2NUT C;  4OOM A;  2V0U A;  4LPZ A;  4BBT A;  1BYW A;  3LFV A;  3T4S A;  2ZMV A;  4GS9 A;  1S1Y A;  2W1T A;  2VV8 A;  1T1B A;  3P7N A;  4GJ4 A;  3UE3 A;  1DP8 A;  1NLZ A;  2KDK A;  4XT2 B;  4UQI M;  4F3L B;  3A0V A;  4Y5F A;  3UMD A;  4CLC E;  4Q0H A;  2V1B A;  3LIA A;  5J7E A;  1OT6 A;  1OTD A;  1YAX A;  3PBN A;  5TJJ A;  4G3K A;  2EWW A;  4BBV A;  4GS9 B;  2W1T B;  3HJI A;  3HJK A;  4L9E A;  2PYR A;  4EEP A;  1YSP A;  3CWF A;  1N9L A;  1LSW A;  2I9V A;  3ZQ5 A;  3LR0 A;  3BJN A;  3GDI A;  2J80 A;  3T4Q A;  3SW1 A;  2JKR M;  4MN7 A;  4WUJ A;  5K5B A;  4HOI A;  3FPV A;  4DJ3 A;  5DJU A;  2GJ3 A;  3OLO A;  2GNX A;  2VKS A;  2ZOI A;  2P08 A;  1OPX A;  4IHQ A;  3EWK A;  3RTY A;  3MF0 A;  1LSV A;  4KUO A;  3F1P A;  2B18 A;  3HCY A;  3MR0 A;  5A8B A;  4HI4 A;  4Q0I A;  3F1O A;  3TW8 A;  3U2A A;  2JKT I;  3BW6 A;  3LID A;  3MQQ A;  2J3W A;  2P04 A;  3D3O A;  3VV4 A;  4HY8 A;  3E4P A;  4CQH A;  2W3D A;  5DKL A;  2DMW A;  5G4Z A;  2XA7 M;  3A0S A;  4JGO A;  3DBA A;  2M7U A;  2H28 A;  3E0Y A;  1XJ2 A;  3F1P B;  3MQO A;  1NRJ A;  1ZTU A;  5F6A A;  4EQ1 A;  3F1O B;  2INW A;  3UB8 A;  4LRX C;  4I3A A;  2ZBB A;  3MJQ A;  1P0Z A;  3JVV A;  3UME A;  1H8M A;  3B47 A;  2EA9 A;  2M7V A;  2R78 A;  5DJT A;  5DF9 A;  2VGL S;  4GW9 A;  4IUH A;  1XFN A;  1V9Z A;  2V9A A;  3UB6 A;  4WL9 A;  1XFQ A;  1P9W A;  1IOU A;  3LIB A;  4EUV A;  3T4J A;  5HWW A;  3PHY A;  2Z6D A;  3NOT C;  4O0P A;  1UWP X;  3CUE C;  3KSF A;  3VE3 A;  1S66 L;  4EU0 A;  3E4Q A;  5KIZ A;  1X0O A;  3ULF A;  3JVU A;  3RFB A;  4AFI A;  2L4R A;  2M1C A;  2W3F A;  3KX0 X;  4G3W A;  3LIF A;  2GX5 A;  1XJ3 A;  3OCN A;  3BWL A;  2XRN A;  1DRM A;  1TS0 A;  5HL6 A;  1LSX A;  4GCZ A;  2J3T D;  3T4T A;  1OTI A;  2W1R A;  3R4K A;  4L9G A;  5HWV A;  5AJG A;  3BQA A;  2D01 A;  3P01 A;  2ZOH A;  4I3J A;  2J3T C;  5HPI A;  1Y28 A;  2MJ6 A;  3LUQ A;  4HJ4 A;  3S7N A;  2ZMF A;  4BWI A;  3IBJ A;  1WA9 A;  4WLA A;  4LRY C;  2LB9 A;  3VOL A;  4FOF A;  5KSH A;  2PR5 A;  2LB5 A;  4MDZ A;  3S7Q A;  4Y2F A;  5IT5 A;  4Z1W A;  3KSH A;  4MN6 A;  1EW0 A;  5DKK A;  3EQU A;  3PBS A;  3K2N A;  2QJ7 A;  5TBM A;  1TD5 A;  1H3Q A;  5F68 A;  3IBR A;  5EFW A;  2OAP 1;  2V1A A;  4H6J A;  1T1C A;  3ZYT A;  4I39 A;  2KOI A;  4FSF A;  4YOF A;  2W0N A;  3UE6 A;  2VV6 A;  2O9A A;  4O8G A;  4ARZ A;  2O0Y A;  3MQ0 A;  1F9I A;  1GSW A;  2VJW A;  5J4E A;  1MZU A;  4B93 A;  2CMN A;  4BJP A;  1UWN X;  4HH2 A;  2EWV A;  4PAU A;  5TBM B;  2HV1 A;  2KX6 A;  2V0W A;  2PD8 A;  4CLC D;  2QJ5 A;  5HDD A;  2PYP A;  4H6J B;  5G4Y A;  3V67 A;  4IUK A;  5HD5 A;  4R3A A;  4ZRR A;  3TE8 A;  3TRC A;  4P6Z S;  1OTB A;  3EOI A;  2OWH A;  4ARZ B;  2K31 A;  4CLC C;  3BY8 A;  2Y8H A;  4ETZ A;  3PXP A;  1S1Z A;  5CX7 A;  4HP4 A;  1GSV A;  4I38 A;  1OT9 A;  2PR6 A;  4R6L A;  1XJ6 A;  3PR6 A;  3TJZ C;  2VGL M;  4HNB A;  3NOP C;  3C2W A;  4DJ2 A;  2JHE A;  4ME4 A;  2O9C A;  2HGV A;  5HDC A;  4CLC A;  3T4O A;  4BMW A;  4ETX A;  2JN7 A;  4II7 A;  2L1M A;  2PDR A;  1TS6 A;  1LT0 A;  5LBR A;  5L8M A;  3FPW A;  5FL3 A;  2WKP A;  3EGX C;  5C5K A;  1T1A A;  3LIC A;  1D7E A;  1S4S A;  3H7W A;  4O01 A;  4DN0 A;  4HJ3 A;  1ODV A;  3K3D A;  1STZ A;  5DFX A;  1W63 M;  4CLC B;  3KYZ A;  3T50 A;  1S67 L;  5I5L A;  2QWS A;  1NLY A;  2JKT M;  4B9O A;  4PKY G;  2HF6 A;  4GLQ A;  3BQ8 A;  1TF1 A;  2G7U A;  2YKH A;  3LI8 A;  3H7W B;  2WKQ A;  4OOL A;  1MKM A;  3ICY A;  3LR3 A;  5HSQ A;  3CI6 A;  2VX8 A;  5HDS A;  3W2Z A;  1T19 A;  3MMH A;  5IS1 A;  3E4O A;  3CLO A;  3LR5 A;  4DMZ A;  1YSQ A;  3A0R A;  4MN5 A;  2XSS A;  3FC7 A;  1ZHH B;  1N9N A;  2HJE A;  1V9Y A;  5DFY A;  2QHK A;  2OWJ A;  3R7W A;  4I3I A;  4EES A;  2VEA A;  2VLG A;  1T18 A;  1OTA A;  4KQO A;  4I5S A;  4IJG A;  3G6O A;  5MC7 A;  4M4X A;  4R38 A;  4EXO A;  4RQ9 A;  2K7S A;  2W3G A;  3C8C A;  2OOL A;  3B42 A;  3LIE A;  2OAQ 1;  1F98 A;  4PKY A;  2YKF A;  3R7W B;  1KOU A;  5AVF A;  1VB6 A;  2WKR A;  2VA0 A;  3KYQ A;  2KLI A;  3S7P A;  3PBT A;  2W3E A;  4WN5 A;  1S4R A;  3H9W A;  5HD3 A;  1LL8 A;  4P6Z M;  2W3H A;  4G3V A;  4HIA A;  1XJ4 A;  3O5Y A;  5AVE A;  1OJ5 A;  4JGP A;  4EEU A;  3IS2 A;  4UQI S;  2IA2 A;  3VE4 A;  2W27 A;  3OC2 A;  2HJ9 C;  3B33 A;  2XRO A;  4Q0J A;  3PBO A;  1JNU A;  4HH3 A;  1DP9 A;  4HJ6 A;  3IS2 B;  4EW7 A;  3NHQ A;  2BAS A;  2QKP A;  3FG8 A;  3H82 A;  2NUP C;  1YKD A;  1VHM A;  4WF0 A;  4EET B;  3KO6 A;  4JGR A;  3EEA A;  1OTE A;  2D02 A;  3GEC A;  1GSX A;  4MCW A;  4YNR A;  3MXQ A;  4YWZ A;  1DP6 A;  3C38 A;  2PD7 A;  2PHY A;  3OBF A;  3T4L A;  3CAX A;  3EGD C;  4LLO B;  1G28 A;  2K2N A;  4JGQ A;  4HHD A;  4NXE A;  4K08 A;  3MFX A;  3K3C A;  4EER A;  4GHI A;  2FH5 A;  3H82 B;  2P7J A;  4E04 A;  2A2L A;  3KSG A;  3E98 A;  4HP9 A;  2L0W A;  3LYX A;  4NXB A;  2A24 A;  5IU1 A;  4QPR A;  3PBQ A;  3PBR A;  1W63 Q;  1OJG A;  1P9R A;  3C30 A;  2XA7 S;  1MC0 A;  3F1N A;  4GHI B;  4NXG A;  2FZ0 A;  1P97 A;  3T4K A;  5HWT A;  3NOU C;  3RH8 B;  1TS8 A;  4NKP A;  1N9O A;  5HZH A;  4HQA A;  2A24 B;  3BY9 A;  4BBU A;  1IFQ A;  1UGU A;  5HPF A;  4LRZ E;  1TS7 A;  4PHT A;  4NXF A;  3UB9 A;  2O99 A;  4UEY A;  5F69 A;  3NJA A;  3F1N B;  4WEK A;  4NEE D;  1NWZ A;  4MMN A;  2GZA A;  2Y79 A;  2O9B A;  1F5M A;  2QYB A;  2VZW A;  2VV7 A;  3UB7 A;  4R70 A;  4WEJ A;  4XT2 A;  3LR4 A;  4L0L A;  3D72 A;  3LI9 A;  5J3W A;  4F3L A;  3OCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...