4EERA

Crystal structure of lov2 domain of arabidopsis thaliana phototropin 2 c426a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
EKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein, flavoprotein
total genus 34
structure length 106
sequence length 106
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eerA00
4HJ4A 1F98A 1XFNA 2QHKA 3RTYA 5HD3A 5HDCA 2ZOIA 2KDKA 4NXFA 2PR5A 5AVFA 1JNUA 1OTBA 5DJTA 2KX6A 3LI8A 3ULFA 1NWZA 2OWJA 4HIAA 2R78A 4HP4A 2V1AA 3A0VA 1Y28A 3LICA 2Z6CA 4EQ1A 3UB7A 3C8CA 4HHDA 2GJ3A 5HD5A 3HJKA 4GCZA 1S4SA 4WUJA 5J7EA 1DP8A 4NXBA 4M4XA 4EESA 3CAXA 4JGPA 5F69A 3CLOA 5F6AA 4WL9A 3F1NB 1LSWA 4F3LB 3FG8A 3LI9A 2JHEA 4R70A 3VE3A 1XJ2A 3H7WB 2K7SA 3H9WA 3T50A 5DJUA 1OTIA 2W0NA 4RQ9A 5HDDA 1ODVA 3K3DA 3B33A 2VV8A 1DP6A 3F1NA 3FC7A 4F3LA 1TS0A 4HY8A 4R6LA 4EERA 1LL8A 1T18A 3H7WA 1XFQA 5EFWA 1OJ5A 3E4QA 4EXOA 2M1CA 4HOIA 4LRXC 4XT2B 3KX0X 5J3WA 5KIZA 4EEUA 5AVEA 3F1PB 1N9LA 5HWWA 3CWFA 1S1YA 2ZBBA 4HNBA 2B02A 2EA9A 3BWLA 4HQAA 3IS2B 5F5YA 2V0WA 2L1MA 2I9VA 3MFXA 4KQDA 4LPZA 4XT2A 3LIEA 3HJIA 3OLOA 4WLAA 1LSVA 3F1PA 5TBMB 1D06A 3VE4A 2PYPA 1N9NA 3IS2A 1MZUA 2L0WA 1BYWA 1TS8A 2WKPA 4LRYC 2WKQA 1TS6A 2VEAA 3UMEA 5TBMA 3K3CA 3UB9A 4GS9B 3PYPA 4E04A 2YKFA 4I3JA 3SW1A 2CMNA 4EETB 1WA9A 1GSXA 1V9YA 2Z6DA 3LIAA 1S4RA 3MQOA 3MJQA 2ZOHA 4GS9A 3NJAA 3LUQA 2OWHA 1UWPX 2PYRA 3C2WA 2D01A 3A0SA 4NXEA 2QWSA 2QKPA 2V0UA 3F1OB 2JN7A 3NOPC 4HJ3A 3MQQA 2YKHA 4I39A 5G4YA 3MR0A 1OTAA 2PD8A 3P7NA 1P97A 4BBUA 4GHIB 5F68A 2INWA 4HP9A 5DKKA 3BY9A 2PR6A 3F1OA 2W27A 1T1BA 2BASA 4R38A 3GECA 4HI4A 4JGOA 2PD7A 4JGQA 4JGRA 4KUKA 1F9IA 4GHIA 1LT0A 4PKYA 1D7EA 4I3IA 3UB6A 4NXGA 4HJ6A 5IS1A 2VV7A 2H28A 4BBTA 5HDSA 2V9AA 4DJ3A 1XJ4A 3IBRA 1GSWA 3LIDA 1X0OA 1T1CA 1OJGA 1DP9A 1T1AA 4B9OA 2VLGA 3NOUC 4LLOB 4MN6A 5DKLA 4L9FA 2PHYA 2QJ5A 4H6JB 4I3AA 2J80A 3ZQ5A 3H82B 3LYXA 4HH3A 1S66L 3E4PA 3NHQA 3G6OA 1VB6A 4L9GA 1XJ3A 5HZHA 1GSVA 4H6JA 3H82A 5HWTA 1DRMA 3UB8A 4EW7A 3D72A 4R3AA 4YWZA 1OT6A 3RH8B 5A8BA 4DJ2A 2PDRA 3E4OA 3NOTC 2V1BA 3UE6A 4MN5A 1N9OA 3LIFA 2VV6A 3MXQA 1OTEA 5I5LA 4L9EA 5IU1A 1LSXA 3A0RA 1P0ZA 1EW0A 3EEHA 4LRZE 1KOUA 3LIBA 1G28A 4GW9A 4KUOA 3ICYA 1T19A 1S67L 2HV1A 2OOLA 1S1ZA 4K08A 4EEPA 2WKRA 4I38A 3VOLA 3EWKA 3UMDA 4BBVA 2P7JA 4WN5A 4PKYG 2L4RA 2A24B 5G4ZA 2D02A 1UGUA 3BY8A 1XJ6A 1V9ZA 5J4EA 4I5SA 1OT9A 5HSQA 2QJ7A 4HH2A 5HWVA 2A24A 1TS7A 4WF0A 3PHYA 1OTDA 1UWNX 3GDIA
chains in the Genus database with same CATH superfamily
2HDRA 4R3BA 3N8SA 4GZBA 2V8FA 1PWGA 5HD3A 1XKZA 2KDKA 4QPRA 5EUAA 1ZG4A 1YSQA 2B95A 2ZC7A 3ITAA 3VSLA 1ZG6A 2XRNA 3SS4A 5FQ9A 1K55C 1NXYA 4IBRA 1P9WA 4EBPA 5E43A 1TEMA 1FOFA 4HP4A 2V1AA 1GCEA 4S2KA 3WS4A 5TR7A 1BLPA 4U0XA 1MPLA 2ZC3B 4WELA 3UB7A 3VFFA 1Y54A 3C8CA 3EEAA 4K0WA 1PWCA 4IJGA 4OOLA 4S2JA 3HLDA 1KE0A 2J7VA 5J7EA 2H10A 3V5MA 4P85A 5CTNA 5L8MA 3HUNA 3VP2A 2JC7A 3W4PA 3IBJA 1YMXA 1LSWA 4JPMA 3VMAA 3PBTA 3HBRA 5MC7A 2J3TD 3VP0A 1DJAA 3E0YA 5FA7A 1MWUA 1NYYA 2W0NA 3M2KA 3JVVA 2MJ6A 2Q9NA 4XXRA 3TE8A 3DBAA 1ODVA 3HLEA 3K3DA 2HDSA 1JWZA 4N92A 5KSHA 4F3LA 3IXHA 4RA7A 4HY8A 2JBFA 4FTXA 1LL8A 4R0QA 1IEMA 5HPIA 1KGEA 3R4KA 1AWIA 1I2SA 4UQIS 4HBTA 4KZAA 3IF5A 2XF3A 3LGOA 4LRXC 2Q9MA 5KIZA 5M1AA 2ZQAA 5AVEA 1ES2A 3FPWA 1YSPA 4GKUA 3I7JA 3CWFA 5FAOA 3MS6A 2B02A 3BFGA 2EA9A 2O9AA 4EV4A 3S7PA 3IS2B 1PI5A 3NDEA 4E3IA 5TGFA 1NZUA 5KZHA 3SZTA 1H8YA 1ZC2A 4XT2A 3LIEA 1RGZA 3OLOA 2VGKA 2VGLM 5LBRA 1TDLA 1F2KA 4FD8A 4FCFA 5TBMB 4PAUA 4OOMA 4FOFA 4GN2A 1MZUA 1OMEA 3VP3A 2ZMAA 4LRYC 2UWXA 2WKQA 3EQVA 3N8LA 3G2ZA 1NRFA 4B88A 4JXSA 3UMEA 3EGXC 3UN7A 3DWZA 1M6KA 2ZD8A 4QY5A 1WYBA 4Z9QA 5CEDA 2ZQDA 3U2AA 2YKFA 2CMNA 4DE1A 3MXRA 4PMAA 1FCMA 2WGWA 4BD0A 3A3JA 5EOOA 3QP5A 3MJQA 2ZOHA 3NJAA 2XA7S 2OWHA 2PYRA 2D01A 2QWSA 5M18A 1VQQA 2JN7A 3NOPC 4KZ9A 4HJ3A 3MQQA 2IWBA 1K38A 3GMWA 5DF8A 4CLCD 1JTDA 4BBUA 3DTKA 2P9VB 3OPPA 5GLBA 2O0YA 4LFUA 4MMNA 2KOIA 4OPQA 4GD8A 1J3WA 1T1BA 1XP4A 2BASA 2WUQA 2V1ZA 5KMWA 2CC1A 3GECA 4JGOA 4Y5FA 2ZM0A 1F9IA 3SH7A 3IX4A 4QU3A 3ZHHA 4PKYA 1NY0A 4PM6A 2HP5A 3TJZC 1MY8A 1SKFA 4IEDA 4BLMA 4BJPA 1CEFA 3HLWA 1K54A 1IYPA 4BBTA 2PAVP 3TW8A 1GSWA 3JVUA 5DF7A 5HPFA 1KE4A 1DP9A 3G2YA 1ES3A 2HJ9C 1T1AA 3VP1A 2JKTI 4LLOB 4UA6A 3W2ZA 5DKLA 4JXGA 2J80A 5EE8A 4GLQA 4QJGA 3H82B 4Y0TA 5E2FA 5HL1A 4HH3A 1K57A 1S66L 4F94A 1XJ3A 1BSGA 1BLHA 1YKDA 3DWKA 5BOHA 1CJFA 5DTSA 5FQIA 4YOFA 4Y17A 1DRMA 1MWRA 1PWDA 3C7VA 4R3AA 4ME4A 1VETA 1OT6A 3RH8B 3NDGA 4Y0UA 2EFXA 3A3DA 1ES4A 3FWLA 4O0PA 3UE6A 4UEYA 4EU0A 3LIFA 5HL6A 1ONHA 3T4SA 4OKPA 4JBFA 5EVIC 5AJGA 1MC0A 1G6OA 3O87A 3KYEA 1MWSA 3R7WA 1MBLA 1KOUA 3LIBA 4IVKA 4GW9A 4GJ4A 5E2GA 2HV1A 1G68A 2OOLA 2W1TB 4B4ZA 5CEBA 3D3OA 2GDNA 2HP9A 1XA1A 2K31A 3HVFA 2WKRA 3ZG9B 1EROA 3HLCA 1HVBA 4I38A 4IBXA 1YMSA 4K91A 4ARZA 4OQIA 5EVIA 4WN5A 2PU4A 2Y2QA 1YT4A 4H8RA 4YINA 1XJ6A 1PYYA 1PRQA 5J4EA 1PZPA 2VJWA 4MDZA 4OLGA 5EOEA 3T4JA 4QHCA 4WEJA 5HSQA 1K56A 3EGDC 5HAIA 5HWVA 4WMCA 4MEZA 3CITA 3PHYA 4RX2A 2WKHA 2EWWA 2XQZA 3Q7ZA 1F98A 4BL3A 4HESA 3MMHA 2RL3A 5A91A 3RTYA 3ITBA 2G2UA 4NETA 3S7QA 2Y55A 4ESPA 3PBOA 4OPRA 1SDNA 5AVFA 4LV3A 4DXCA 1OTBA 3HLBA 1JWVA 1LL5A 3LI8A 3ULFA 4BQMA 1NWZA 3UPPA 2Y91A 5GHYA 3AGFA 2Z2MB 4KENB 3AGDA 1E4DA 5TJJA 3IX8A 2JE5A 1Y28A 3CUEC 3LICA 1HD8A 4OP8A 1K0KA 3L9KA 3G31A 4HHDA 3TOIA 5HD5A 3QP8A 4GCZA 4S2LA 1IELA 1YLWA 2B18A 3FZCA 1DP8A 2R9XA 2ZL1A 1VEUA 4KZ5A 4UA9A 4M4XA 3BLMA 4X25A 3T4QA 2HP6A 4EESA 4GDNA 1AXBA 4KG6A 4KQQA 2ZQ9A 3GTCA 1P9RA 3FYZA 4GDBA 1WE4A 3KSFA 4F3LB 3FG8A 2JHEA 5CGSA 3OC2A 1H8MA 1FQGA 5JYPA 3UDXA 1XJ2A 3MF0A 3IQAA 3P09A 2WADA 3TG9A 3NIAA 5AQ9A 3T50A 3MKFA 3SS3A 4M3KA 1K4FA 3HUMA 1FR6A 4RQ9A 1L3LA 2WGVA 3S1YA 3ZNYA 3KSGA 2VV8A 1DP6A 3F1NA 2J3TC 4KQOA 3T4LA 4IUHA 5U47A 3H7WA 1NJ4A 4OONA 4X68A 2E8IA 2IWDA 4AFIA 1NYMA 4XT2B 1SZVA 3B42A 2PBDP 2EX8A 2RCXA 5D3OA 1N9LA 5EVLA 3BWLA 4UQIM 5F5YA 3MSHA 3IHBA 2WKEA 3P98A 3MFXA 3HJIA 2VZWA 3HCYA 4WLAA 1TD5A 3ZG8B 1H8ZA 3IXDA 3M2JA 3M6BA 3VE4A 5FI2A 4MN7A 5HX9A 3LY3A 1W63M 2P08A 4O7DA 1IFQA 3WRTA 3A3IA 2WKPA 5DF9A 3O3VA 4X1MA 4EUZA 3LEQA 2O99A 3N6IA 2HGVA 2WGWB 1BLCA 1TS6A 1IKIA 5GHXA 5FAPA 3GV9A 3O88A 4E3LA 3PBRA 3UB9A 1MWTA 5AQBA 1CEGA 4KZ3A 4C6YA 2XD5A 1K55A 5J8XA 2E8JA 2LB9A 3MQ0A 3MXSA 1FR1A 4C3QA 1Z09A 3GQZA 4KZ7A 1V9YA 4S2PA 3E98A 3N4IA 4OLDA 3MQOA 3BYDA 4DXBA 3A0SA 3WS2A 2V0UA 1FCNA 3ZNTA 3QP4A 3KSIA 5CHUA 2YKHA 2QPNA 4Y7PA 1GHMA 1YM1A 4ZJ3A 2PD8A 5FQQA 3PTEA 3P7NA 3LCEA 5CTMA 3OOVA 2XA7M 4WYYA 2W3EA 3T12B 2INWA 2C5WB 3E2LA 2PR6A 4LCLA 2VA0A 4OPYA 3UNWA 1L2SA 4CLCC 4P6ZS 2PBYA 2X02A 3OBFA 2XEPA 3S7OA 3Q7VA 2WZZA 2PD7A 4GNUA 4JGRA 3BW6A 4B93A 1Q2QA 1LT0A 5AQAA 5FATA 3IHAA 4JXVA 3EQUA 1L0DA 4I3IA 1W7FA 4NXGA 3UB5P 4WBGA 4KZ8A 1FCOA 5HDSA 2V9AA 2ZQ8A 4DJ3A 3GR2A 1XJ4A 4CLCA 1BLSA 1OJGA 1KGGA 2ZQ7A 4B9OA 3NOUC 3BFFA 3BECA 3VOZA 4Q8IA 1KGFA 4MN6A 2HZ5A 4ZRRA 3PR6A 4L9FA 2PHYA 3BFCA 3T4KA 3ZQ5A 5FDSA 3DAVA 3E4PA 3NHQA 3ZGAB 1VETB 4GD6A 4JKTA 4FSFA 5HZHA 5CXWA 1GA0A 3UY6A 1VM1A 3IT9A 2EFUA 5M19A 3ZVWA 3C4PA 2ACGA 5F83A 1WYCA 3R7WB 3UE3A 5FASA 3IWIA 2PDRA 3NOTC 2NUPC 4MBHA 2OAP1 1O7EA 4E3KA 4DE0A 1BT5A 4PM8A 1XGIA 4PM9A 4ARZB 5IU1A 1LSXA 3A0RA 3L7HA 1P0ZA 1H5XA 5EVIB 3D4FA 3EEHA 3QNBA 1G28A 2O9CA 3V3SA 3FKVA 2H0YA 4KUOA 1LL9A 2K2NA 2V20A 1W63Q 1JWPA 4EEPA 3TSGA 5L07A 3V39A 4Q0IA 4XUXA 2P74A 3WWXA 3BEBA 3VOLA 4K0XA 3VV4A 1E3UA 1PZOA 3MZDA 4KG5A 5CHMA 4BBVA 3OPRA 2FFFB 2P7JA 4PKYG 2L4RA 3BFEA 3LO7A 1YLZA 4LGWA 4ZJ1A 4A5RA 1V9ZA 4E3MA 5JYOA 3Q07A 1ZKJA 2ZM8A 3ZVTA 1OT9A 3WS0A 1MKIA 2QJ7A 4MNRA 1TS7A 5EM1A 4WF0A 3PBNA 1UWNX 3KYZA 2ZJ9A 5DVAA 3PBQA 2LB5A 4KQRA 4OPZA 2QHKA 3ZYTA 2Y59A 5HDCA 3Q81A 1SKOA 2FH5A 4NXFA 3NY4A 4G3WA 2Q0OA 4DE2A 1K25A 3JYIA 4MCWA 1NLYA 4R23A 5DJTA 2KX6A 1GHPA 3IF6C 4WEKA 2OLUA 3CPTA 4WM9A 2AVXA 3BFDA 3OPLA 1W8QA 2OSUA 4S2MA 3IWQA 4HIAA 4BWIA 4RX3A 2ZL1B 3WS5A 1VEUB 3BLSA 2VK3A 3G32A 4PHTA 1IYQA 3MBZA 2W3HA 3KO6A 2GJ3A 5A93A 2DNSA 4EBLA 5HW3A 3HL9A 1N4OA 3IF6A 1CK3A 3LR3A 5E2HA 4Q0JA 4OQ0A 2W3FA 4GB7A 1YLTA 4NXBA 3HREA 3C5AA 3CAXA 3SOIA 5F69A 3C38A 5EV0A 3F1NB 4P0MA 3IH8A 3VE3A 3C7UA 3NC8A 4CPKA 3RJUA 2EXAA 3H7WB 5CGXA 4E6XA 4Y2FA 3G35A 1OTIA 4WZ5C 4PM7A 3CMZA 3MKEA 5HDDA 3QNCA 4ZBEA 4NG2A 3FC7A 1I2WA 5I94A 4OP5A 2QZ6A 4R6LA 4C75A 1YLPA 4JF4A 3E4QA 2XROA 2R9WA 2Y2LA 5J3WA 3V50A 2JKTM 2UV0E 5F1FA 4WZ4A 4Z1WA 3NULA 4S2IA 5A92A 1JTGA 5HWWA 1S1YA 3IH9A 4LV0A 1GA9A 5EPHA 3LR5A 4HQAA 2L1MA 4KQDA 4RVAA 4D60A 2HDUA 4LPZA 2ZC5B 1H0MA 3T1XA 5GLCA 4N1XA 2A3UA 3C30A 4S2OA 3WS1A 3NECA 4PPRA 3F1PA 1D06A 4RYEA 2HDQA 1NRJA 3OCLA 3KYQA 1LHYA 4X56A 5IHVA 1G6AA 1BYWA 1G5UA 2NUTC 1TS8A 2Y2MA 3SS5A 1PNEA 4X69A 3QP2A 2ZC6B 4DE3A 5EVEA 3K3CA 3HUOA 1NZOA 4XUZA 1IKGA 1EWZA 4YFMA 5FI6A 4IUKA 5EM0A 1C3BA 4EETB 4OQHA 1K4EA 3O86A 1GSXA 3UE0A 5L10A 3CUEA 3FPVA 3LIAA 4DRTA 1S4RA 3CHWP 2Y79A 2JKRM 3NI9A 4GS9A 1BUEA 3T1QB 1CF0A 1UWPX 4R4RA 4DMZA 3W4QA 4S2NC 5DFXA 2DRWA 2QKPA 3BJNA 2WK0A 3AGEA 3ZDJA 1YLYA 4O8GA 3BQAA 3Q7VB 4KZ4A 1TF1A 4E3JA 2Y2NA 5F68A 2W3DA 4HP9A 5DKKA 3F1OA 2Y4AA 4S2NA 4HI4A 3DW0A 3BQ8A 2JKGA 3PAGA 4CLCB 2VKSA 4GHIA 4NK3A 4DF6A 5FQMA 2HPBA 4KZ6A 2VV7A 2ZMFA 1RGYA 2H28A 4FH4A 3RXWA 3IWOA 3G30A 4P6ZM 1DY6A 2OAQ1 3LIDA 1T1CA 2Y2OA 4CLCE 4G3VA 4EUVA 5DTKA 2J8YA 2WZXA 4GOGA 3A3EA 2XH9A 2Y2IA 5FQKA 3EOIA 3S22A 1W79A 4L9GA 3RFBA 2GX5A 5AQ7A 3OPHA 1OPXA 4DN0A 1GSVA 4BMWA 4H6JA 4P6BA 2EX2A 1LI9A 3T4OA 1MKMA 5HWTA 2J9PA 5L2FA 2ZMVA 1ESIA 3UB8A 3DTEA 5A8BA 1HLUP 4CJNA 2XSSA 4DJ2A 2V1BA 3V67A 2QMIA 2VV6A 5FQJA 3MXQA 1OTEA 2XR0A 3ISGA 4ETXA 1IOUA 4L9EA 1RCJA 4Y13A 1S0WA 2BG1A 3K2NA 2QYBA 1EW0A 4LRZE 2FZ0A 1FILA 4KZBA 1T19A 1S67L 4JLFA 3ZG7B 4IVIA 1S1ZA 4K08A 2H5SA 1DJCA 2GNXA 2Z2LB 4EQIA 3VFHA 3W4OA 5HAPA 2H0TA 4E3OA 3UMDA 3V3RA 2VX8A 3S7NA 2D02A 1UGUA 2KLIA 3HLGA 4R1GA 1VHMA 4I5SA 1IYSA 1D1JA 1TDGA 4BENA 1SKOB 2XGNA 5CHJA 2Y2PA 2A24A 5C5KA 1HZOA 1E25A 3VOYA 1PI4A 1W8YA 3NBLA 3DTMA 2PRFA 1ACFA 3GDIA 4HJ4A 1XFNA 3CPTB 3VP4A 2ZOIA 4BL2A 2DMWA 1K6SA 1PW1A 2PR5A 1XGJA 3NCKA 1JNUA 5IT5A 1DJBA 3LY4A 1ERMA 3UDIA 3UO9A 2C6WB 2XK1A 5HAQA 1QMEA 1NLZA 2JCHA 1O07A 1U60A 2WKIA 2OWJA 4KG2A 3Q82A 3IF6B 4EWFA 2R78A 3C4OA 1KDWA 3A0VA 3A3FA 2Z6CA 3ZG5A 4EQ1A 2EWVA 3FKWA 3HJKA 4Y15A 1S4SA 3QP6A 3E2KA 4DDSA 3SH8A 4WUJA 3UPOA 1XA7A 3CI6A 5CRFA 1YQSA 1J9MA 1GHIA 4JGPA 4JXWA 5GHZA 1SDEA 3FV7A 1KVLA 3CLOA 4JF5A 5F6AA 2ZLYA 4WL9A 1ALQA 2ZC4B 5A90A 5FEGA 3LI9A 4N9LA 4R70A 3PBSA 5CERA 1L0EA 5CECA 3RXXA 3JPUA 3IXBA 4U0TA 3WRZA 2K7SA 3B47A 2M7UA 3H9WA 1ES5A 4FH2A 3UPNA 3BM6A 1L0FA 5DJUA 5K5BA 1SHVA 2A49A 3B33A 2W3GA 3QHYA 1TS0A 4QB8A 5GL9A 3W8KA 4LV1A 3Q1FA 3G4PA 1K6RA 4FUWA 4EERA 1Y4OA 2Y2GA 5HFOA 1T18A 3LR0A 1K54C 1FSYA 1LLBA 1XFQA 5EFWA 4ID4A 1OJ5A 3SH9A 4EXOA 5E2EA 5FI7A 2M1CA 2VGJA 4HOIA 1FIKA 3KX0X 2W1RA 2VGLS 1YLJA 1ERQA 4EEUA 3BRMA 1L0GA 4OQGA 3N8RA 3S4XA 1CQAA 1QMFA 3F1PB 4X6TA 4B4XA 4X55A 4E3NA 2ZBBA 4HNBA 1A0KA 2GZAA 4IHQA 5L09A 1EI5A 4PM5A 2V0WA 1K57C 2I9VA 3KSHA 3MZFA 2M7VA 3UE1A 2WAFA 1KDSA 4OOYA 4U3TA 4P87A 1LSVA 4R3JA 2BTFP 4HBUA 3ZFZA 3G34A 4UAAA 2PYPA 4NEED 2DCFA 1YPRA 1N9NA 3IS2A 4UHUA 4MBKA 2WGIA 2L0WA 4NKPA 1ZTUA 2Y2KA 1H3QA 2IA2A 2IWCA 4CQHA 3MFDA 5FEFA 2X71A 4UA7A 3M6HA 2VEAA 5TBMA 2OV5A 1XPBA 4LCMA 4EBNA 4GS9B 2HJEA 3PYPA 4E04A 4I3JA 3SW1A 4OH0A 1PW8A 2G7UA 1E3UD 4DKIA 1WA9A 1W5DA 1BULA 2A2LA 2BLSA 2Z6DA 4II7A 1IYOA 4ZJ2A 5FAQA 5KSCA 1LI0A 4N1HA 3LUQA 4G3KA 2XFTA 3C2WA 4NXEA 3TRCA 3QP1A 1RP5A 4R4SA 3F1OB 2I72A 3PAEA 2JKFA 4I39A 5G4YA 2O9BA 5DTTA 3MR0A 1OTAA 4Y0OA 1KVMA 1P97A 5TFQA 3T1RA 4GHIB 1BZAA 1FSWA 5DFYA 2JKRI 3BY9A 4LV2A 2W27A 4MLLA 3GRJA 4R38A 4O01A 4WZ5A 4JGQA 4KUKA 4MBFA 1ONGA 1CI9A 2P9VA 4HEFA 1STZA 1D7EA 3LR4A 1CI8A 3CG5A 3UB6A 5CX7A 4HJ6A 5IS1A 3GSGA 1M40A 2ZM2A 2X01A 4QD4A 3IBRA 4X53A 1X0OA 5CGWA 2V2FF 3VSKA 1YAXA 2P04A 1TVFA 2VLGA 4QWOA 3CZDA 3HLFA 5GLAA 2QJ5A 4H6JB 2PT7A 4I3AA 5HARA 3LYXA 3U4LP 5F1GA 3O5YA 5G18A 3G6OA 1VB6A 1XXMA 4BD1A 2ZQCA 2Y2HA 2V8CA 1PFLA 4E6WA 3N7WA 1Q2PA 4QY6A 1XX2A 2B5RA 4N9KA 3H82A 2J3WA 2FFYA 1ZHHB 3UDFA 1HTZA 1KE3A 2EX6A 1BTLA 4EW7A 3D72A 4YWZA 4Q0HA 5EVID 2G2WA 1ESUA 2Y8HA 3E4OA 3DTIA 1Z6FA 3OCNA 1S6RA 4MN5A 1N9OA 5EECA 1JVJA 5FSRA 4LENA 4Y3IA 4DDYA 5I5LA 3ZCZA 4ZAMA 2PU2A 3CJMA 3ZG0A 3PXPA 3B3XA 1MXOA 3IX3A 1K56D 3LFVA 2EX9A 4WMCD 3ICYA 3GVBA 3T4TA 5FL3A 2WYXA 3D9YA 5GLDA 3T1SA 2WAEA 4ETZA 3EWKA 2J9OA 1F5MA 5FDHA 1N9BA 2A24B 5G4ZA 4YNRA 2XD1A 4ZTKA 3BY8A 4JF6A 1I5QA 2XLNA 2W1TA 3IXGA 3MZEA 3P01A 2EXBA 2XDMA 2HF6A 4ZDXA 1PIOA 3LEZA 4OVDA 2OLVA 1SCWA 4HH2A 4D2OA 5F82A 3OZHA 4L0LA 2Y2JA 4X1LA 1OTDA 2XFSA
chains in the Genus database with same CATH topology
4HJ4A 1F98A 1XFNA 3PBQA 2LB5A 3MMHA 2QHKA 3RTYA 3ZYTA 5HD3A 5HDCA 2ZOIA 2KDKA 2FH5A 4QPRA 2DMWA 4NXFA 3S7QA 4G3WA 2PR5A 3PBOA 1YSQA 5AVFA 1JNUA 4MCWA 2XRNA 5IT5A 1NLYA 1OTBA 5DJTA 2KX6A 1NLZA 4WEKA 3LI8A 3ULFA 1P9WA 1NWZA 2OWJA 4HIAA 4BWIA 2R78A 4HP4A 2V1AA 5TJJA 3A0VA 1Y28A 3CUEC 3LICA 2Z6CA 4EQ1A 4PHTA 4WELA 3UB7A 3C8CA 2W3HA 4HHDA 3KO6A 2EWVA 2GJ3A 3EEAA 5HD5A 4IJGA 3HJKA 4OOLA 4GCZA 1S4SA 3LR3A 4WUJA 2B18A 5J7EA 5L8MA 1DP8A 3CI6A 4Q0JA 2W3FA 4NXBA 4M4XA 3T4QA 4EESA 3CAXA 4JGPA 5F69A 3CLOA 3C38A 1P9RA 3IBJA 5F6AA 4WL9A 3F1NB 3KSFA 1LSWA 4F3LB 3FG8A 3LI9A 3PBTA 2JHEA 4R70A 3OC2A 3VE3A 3PBSA 1H8MA 5MC7A 1XJ2A 3MF0A 3H7WB 2J3TD 2K7SA 3B47A 2M7UA 3H9WA 3E0YA 3T50A 4Y2FA 5DJUA 1OTIA 2W0NA 4RQ9A 5K5BA 3JVVA 2MJ6A 5HDDA 3TE8A 3DBAA 1ODVA 3K3DA 3B33A 2VV8A 3KSGA 1DP6A 3F1NA 3FC7A 5KSHA 2W3GA 2J3TC 4F3LA 4KQOA 1TS0A 3T4LA 4IUHA 4HY8A 4R6LA 4EERA 1LL8A 5HPIA 1T18A 3H7WA 3R4KA 3LR0A 4UQIS 1XFQA 5EFWA 4AFIA 1OJ5A 3E4QA 4EXOA 2M1CA 4HOIA 2XROA 4LRXC 4XT2B 3KX0X 5J3WA 2W1RA 2VGLS 2JKTM 5KIZA 4EEUA 3B42A 5AVEA 4Z1WA 3FPWA 1YSPA 3F1PB 1N9LA 5HWWA 3CWFA 1S1YA 2ZBBA 4HNBA 2B02A 2GZAA 2EA9A 2O9AA 3BWLA 3LR5A 4IHQA 4UQIM 3S7PA 4HQAA 3IS2B 5F5YA 2V0WA 2L1MA 2I9VA 3MFXA 4KQDA 3KSHA 4LPZA 4XT2A 3LIEA 3HJIA 2M7VA 3OLOA 2VZWA 2VGLM 3C30A 3HCYA 4WLAA 1LSVA 1TD5A 5LBRA 3F1PA 5TBMB 1D06A 3VE4A 4MN7A 4PAUA 2PYPA 4OOMA 1NRJA 4FOFA 4NEED 1N9NA 3IS2A 1MZUA 3OCLA 1W63M 2L0WA 3KYQA 4NKPA 1BYWA 2NUTC 1IFQA 1ZTUA 2P08A 1TS8A 2WKPA 4LRYC 1H3QA 5DF9A 2IA2A 2WKQA 3EQVA 2O99A 4CQHA 2HGVA 1TS6A 2VEAA 3UMEA 5TBMA 3EGXC 3PBRA 3K3CA 3UB9A 4GS9B 2HJEA 3PYPA 4E04A 2LB9A 3U2AA 2YKFA 4IUKA 3MQ0A 4I3JA 3SW1A 2CMNA 2G7UA 4EETB 1WA9A 1GSXA 1V9YA 2A2LA 3CUEA 2Z6DA 3FPVA 3LIAA 1S4RA 3E98A 4II7A 3MQOA 3MJQA 2Y79A 2JKRM 2ZOHA 4GS9A 3NJAA 2XA7S 3LUQA 2OWHA 1UWPX 4G3KA 4DMZA 2PYRA 3C2WA 2D01A 3A0SA 4NXEA 3TRCA 5DFXA 2QWSA 2QKPA 2V0UA 3BJNA 3F1OB 3KSIA 2JN7A 3NOPC 4HJ3A 3MQQA 4O8GA 2YKHA 4I39A 5G4YA 2O9BA 3BQAA 3MR0A 1OTAA 2PD8A 1TF1A 3P7NA 1P97A 4BBUA 4CLCD 4GHIB 2O0YA 3OOVA 2XA7M 2W3DA 5F68A 2W3EA 4MMNA 2INWA 4HP9A 5DKKA 5DFYA 2KOIA 2JKRI 3BY9A 2PR6A 3F1OA 2VA0A 2W27A 1T1BA 4CLCC 2BASA 4P6ZS 3OBFA 4R38A 3GECA 4HI4A 3BQ8A 4O01A 3S7OA 4JGOA 4Y5FA 2PD7A 4JGQA 4JGRA 3BW6A 4B93A 4KUKA 4CLCB 1F9IA 2VKSA 4GHIA 1LT0A 4PKYA 1STZA 1D7EA 3LR4A 3EQUA 3TJZC 4I3IA 3UB6A 4BJPA 5CX7A 4NXGA 4HJ6A 5IS1A 2VV7A 2ZMFA 2H28A 4BBTA 4P6ZM 5HDSA 2V9AA 2OAQ1 4DJ3A 1XJ4A 3TW8A 4CLCA 3IBRA 1GSWA 3LIDA 1X0OA 3JVUA 1T1CA 1OJGA 5HPFA 4CLCE 1DP9A 4G3VA 2HJ9C 1YAXA 1T1AA 4B9OA 4EUVA 2P04A 2JKTI 2VLGA 3NOUC 4LLOB 4MN6A 3W2ZA 5DKLA 4ZRRA 3PR6A 4L9FA 2PHYA 2QJ5A 4H6JB 2PT7A 4I3AA 2J80A 3T4KA 4GLQA 3ZQ5A 3H82B 3LYXA 3EOIA 4HH3A 3O5YA 1S66L 3E4PA 3NHQA 3G6OA 1VB6A 4L9GA 3RFBA 2GX5A 4FSFA 1XJ3A 1OPXA 1YKDA 4DN0A 5HZHA 1GSVA 4BMWA 4H6JA 3H82A 3T4OA 1MKMA 2J3WA 4YOFA 5HWTA 1ZHHB 2ZMVA 1DRMA 3UB8A 4EW7A 3D72A 4R3AA 4ME4A 4YWZA 1OT6A 3R7WB 4Q0HA 3RH8B 5A8BA 2XSSA 3UE3A 4DJ2A 2Y8HA 2PDRA 3E4OA 3NOTC 2NUPC 2V1BA 4O0PA 3OCNA 3UE6A 4UEYA 4EU0A 3V67A 4MN5A 1N9OA 2OAP1 3LIFA 2VV6A 5HL6A 3MXQA 3T4SA 1OTEA 4Y3IA 4ETXA 1IOUA 5I5LA 4L9EA 3PXPA 5AJGA 3K2NA 2QYBA 1MC0A 4ARZB 5IU1A 1G6OA 1LSXA 3A0RA 1P0ZA 3LFVA 1EW0A 3R7WA 3EEHA 4LRZE 1KOUA 3LIBA 1G28A 2O9CA 2FZ0A 4GW9A 4KUOA 3ICYA 4GJ4A 1T19A 2K2NA 1S67L 2HV1A 2OOLA 2W1TB 1W63Q 3D3OA 1S1ZA 4K08A 3T4TA 4EEPA 2K31A 2WKRA 4Q0IA 2GNXA 5FL3A 4I38A 3VOLA 3VV4A 4ETZA 3EWKA 3UMDA 4ARZA 4BBVA 1F5MA 2VX8A 2P7JA 4WN5A 4PKYG 2L4RA 2A24B 5G4ZA 4YNRA 3S7NA 2D02A 1UGUA 3BY8A 1XJ6A 1V9ZA 2KLIA 2W1TA 5J4EA 1VHMA 3P01A 2VJWA 4MDZA 4I5SA 1OT9A 2HF6A 3T4JA 4WEJA 5HSQA 3EGDC 2QJ7A 4HH2A 5HWVA 2A24A 3CITA 4L0LA 1TS7A 5C5KA 4WF0A 3PHYA 3PBNA 1OTDA 1UWNX 3KYZA 2EWWA 3GDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ4 A;  1F98 A;  1XFN A;  2QHK A;  3RTY A;  5HD3 A;  5HDC A;  2ZOI A;  2KDK A;  4NXF A;  2PR5 A;  5AVF A;  1JNU A;  1OTB A;  5DJT A;  2KX6 A;  3LI8 A;  3ULF A;  1NWZ A;  2OWJ A;  4HIA A;  2R78 A;  4HP4 A;  2V1A A;  3A0V A;  1Y28 A;  3LIC A;  2Z6C A;  4EQ1 A;  3UB7 A;  3C8C A;  4HHD A;  2GJ3 A;  5HD5 A;  3HJK A;  4GCZ A;  1S4S A;  4WUJ A;  5J7E A;  1DP8 A;  4NXB A;  4M4X A;  4EES A;  3CAX A;  4JGP A;  5F69 A;  3CLO A;  5F6A A;  4WL9 A;  3F1N B;  1LSW A;  4F3L B;  3FG8 A;  3LI9 A;  2JHE A;  4R70 A;  3VE3 A;  1XJ2 A;  3H7W B;  2K7S A;  3H9W A;  3T50 A;  5DJU A;  1OTI A;  2W0N A;  4RQ9 A;  5HDD A;  1ODV A;  3K3D A;  3B33 A;  2VV8 A;  1DP6 A;  3F1N A;  3FC7 A;  4F3L A;  1TS0 A;  4HY8 A;  4R6L A;  4EER A;  1LL8 A;  1T18 A;  3H7W A;  1XFQ A;  5EFW A;  1OJ5 A;  3E4Q A;  4EXO A;  2M1C A;  4HOI A;  4LRX C;  4XT2 B;  3KX0 X;  5J3W A;  5KIZ A;  4EEU A;  5AVE A;  3F1P B;  1N9L A;  5HWW A;  3CWF A;  1S1Y A;  2ZBB A;  4HNB A;  2B02 A;  2EA9 A;  3BWL A;  4HQA A;  3IS2 B;  5F5Y A;  2V0W A;  2L1M A;  2I9V A;  3MFX A;  4KQD A;  4LPZ A;  4XT2 A;  3LIE A;  3HJI A;  3OLO A;  4WLA A;  1LSV A;  3F1P A;  5TBM B;  1D06 A;  3VE4 A;  2PYP A;  1N9N A;  3IS2 A;  1MZU A;  2L0W A;  1BYW A;  1TS8 A;  2WKP A;  4LRY C;  2WKQ A;  1TS6 A;  2VEA A;  3UME A;  5TBM A;  3K3C A;  3UB9 A;  4GS9 B;  3PYP A;  4E04 A;  2YKF A;  4I3J A;  3SW1 A;  2CMN A;  4EET B;  1WA9 A;  1GSX A;  1V9Y A;  2Z6D A;  3LIA A;  1S4R A;  3MQO A;  3MJQ A;  2ZOH A;  4GS9 A;  3NJA A;  3LUQ A;  2OWH A;  1UWP X;  2PYR A;  3C2W A;  2D01 A;  3A0S A;  4NXE A;  2QWS A;  2QKP A;  2V0U A;  3F1O B;  2JN7 A;  3NOP C;  4HJ3 A;  3MQQ A;  2YKH A;  4I39 A;  5G4Y A;  3MR0 A;  1OTA A;  2PD8 A;  3P7N A;  1P97 A;  4BBU A;  4GHI B;  5F68 A;  2INW A;  4HP9 A;  5DKK A;  3BY9 A;  2PR6 A;  3F1O A;  2W27 A;  1T1B A;  2BAS A;  4R38 A;  3GEC A;  4HI4 A;  4JGO A;  2PD7 A;  4JGQ A;  4JGR A;  4KUK A;  1F9I A;  4GHI A;  1LT0 A;  4PKY A;  1D7E A;  4I3I A;  3UB6 A;  4NXG A;  4HJ6 A;  5IS1 A;  2VV7 A;  2H28 A;  4BBT A;  5HDS A;  2V9A A;  4DJ3 A;  1XJ4 A;  3IBR A;  1GSW A;  3LID A;  1X0O A;  1T1C A;  1OJG A;  1DP9 A;  1T1A A;  4B9O A;  2VLG A;  3NOU C;  4LLO B;  4MN6 A;  5DKL A;  4L9F A;  2PHY A;  2QJ5 A;  4H6J B;  4I3A A;  2J80 A;  3ZQ5 A;  3H82 B;  3LYX A;  4HH3 A;  1S66 L;  3E4P A;  3NHQ A;  3G6O A;  1VB6 A;  4L9G A;  1XJ3 A;  5HZH A;  1GSV A;  4H6J A;  3H82 A;  5HWT A;  1DRM A;  3UB8 A;  4EW7 A;  3D72 A;  4R3A A;  4YWZ A;  1OT6 A;  3RH8 B;  5A8B A;  4DJ2 A;  2PDR A;  3E4O A;  3NOT C;  2V1B A;  3UE6 A;  4MN5 A;  1N9O A;  3LIF A;  2VV6 A;  3MXQ A;  1OTE A;  5I5L A;  4L9E A;  5IU1 A;  1LSX A;  3A0R A;  1P0Z A;  1EW0 A;  3EEH A;  4LRZ E;  1KOU A;  3LIB A;  1G28 A;  4GW9 A;  4KUO A;  3ICY A;  1T19 A;  1S67 L;  2HV1 A;  2OOL A;  1S1Z A;  4K08 A;  4EEP A;  2WKR A;  4I38 A;  3VOL A;  3EWK A;  3UMD A;  4BBV A;  2P7J A;  4WN5 A;  4PKY G;  2L4R A;  2A24 B;  5G4Z A;  2D02 A;  1UGU A;  3BY8 A;  1XJ6 A;  1V9Z A;  5J4E A;  4I5S A;  1OT9 A;  5HSQ A;  2QJ7 A;  4HH2 A;  5HWV A;  2A24 A;  1TS7 A;  4WF0 A;  3PHY A;  1OTD A;  1UWN X;  3GDI A; 
#chains in the Genus database with same CATH topology
 2HDR A;  4R3B A;  3N8S A;  4GZB A;  2V8F A;  1PWG A;  5HD3 A;  1XKZ A;  2KDK A;  4QPR A;  5EUA A;  1ZG4 A;  1YSQ A;  2B95 A;  2ZC7 A;  3ITA A;  3VSL A;  1ZG6 A;  2XRN A;  3SS4 A;  5FQ9 A;  1K55 C;  1NXY A;  4IBR A;  1P9W A;  4EBP A;  5E43 A;  1TEM A;  1FOF A;  4HP4 A;  2V1A A;  1GCE A;  4S2K A;  3WS4 A;  5TR7 A;  1BLP A;  4U0X A;  1MPL A;  2ZC3 B;  4WEL A;  3UB7 A;  3VFF A;  1Y54 A;  3C8C A;  3EEA A;  4K0W A;  1PWC A;  4IJG A;  4OOL A;  4S2J A;  3HLD A;  1KE0 A;  2J7V A;  5J7E A;  2H10 A;  3V5M A;  4P85 A;  5CTN A;  5L8M A;  3HUN A;  3VP2 A;  2JC7 A;  3W4P A;  3IBJ A;  1YMX A;  1LSW A;  4JPM A;  3VMA A;  3PBT A;  3HBR A;  5MC7 A;  2J3T D;  3VP0 A;  1DJA A;  3E0Y A;  5FA7 A;  1MWU A;  1NYY A;  2W0N A;  3M2K A;  3JVV A;  2MJ6 A;  2Q9N A;  4XXR A;  3TE8 A;  3DBA A;  1ODV A;  3HLE A;  3K3D A;  2HDS A;  1JWZ A;  4N92 A;  5KSH A;  4F3L A;  3IXH A;  4RA7 A;  4HY8 A;  2JBF A;  4FTX A;  1LL8 A;  4R0Q A;  1IEM A;  5HPI A;  1KGE A;  3R4K A;  1AWI A;  1I2S A;  4UQI S;  4HBT A;  4KZA A;  3IF5 A;  2XF3 A;  3LGO A;  4LRX C;  2Q9M A;  5KIZ A;  5M1A A;  2ZQA A;  5AVE A;  1ES2 A;  3FPW A;  1YSP A;  4GKU A;  3I7J A;  3CWF A;  5FAO A;  3MS6 A;  2B02 A;  3BFG A;  2EA9 A;  2O9A A;  4EV4 A;  3S7P A;  3IS2 B;  1PI5 A;  3NDE A;  4E3I A;  5TGF A;  1NZU A;  5KZH A;  3SZT A;  1H8Y A;  1ZC2 A;  4XT2 A;  3LIE A;  1RGZ A;  3OLO A;  2VGK A;  2VGL M;  5LBR A;  1TDL A;  1F2K A;  4FD8 A;  4FCF A;  5TBM B;  4PAU A;  4OOM A;  4FOF A;  4GN2 A;  1MZU A;  1OME A;  3VP3 A;  2ZMA A;  4LRY C;  2UWX A;  2WKQ A;  3EQV A;  3N8L A;  3G2Z A;  1NRF A;  4B88 A;  4JXS A;  3UME A;  3EGX C;  3UN7 A;  3DWZ A;  1M6K A;  2ZD8 A;  4QY5 A;  1WYB A;  4Z9Q A;  5CED A;  2ZQD A;  3U2A A;  2YKF A;  2CMN A;  4DE1 A;  3MXR A;  4PMA A;  1FCM A;  2WGW A;  4BD0 A;  3A3J A;  5EOO A;  3QP5 A;  3MJQ A;  2ZOH A;  3NJA A;  2XA7 S;  2OWH A;  2PYR A;  2D01 A;  2QWS A;  5M18 A;  1VQQ A;  2JN7 A;  3NOP C;  4KZ9 A;  4HJ3 A;  3MQQ A;  2IWB A;  1K38 A;  3GMW A;  5DF8 A;  4CLC D;  1JTD A;  4BBU A;  3DTK A;  2P9V B;  3OPP A;  5GLB A;  2O0Y A;  4LFU A;  4MMN A;  2KOI A;  4OPQ A;  4GD8 A;  1J3W A;  1T1B A;  1XP4 A;  2BAS A;  2WUQ A;  2V1Z A;  5KMW A;  2CC1 A;  3GEC A;  4JGO A;  4Y5F A;  2ZM0 A;  1F9I A;  3SH7 A;  3IX4 A;  4QU3 A;  3ZHH A;  4PKY A;  1NY0 A;  4PM6 A;  2HP5 A;  3TJZ C;  1MY8 A;  1SKF A;  4IED A;  4BLM A;  4BJP A;  1CEF A;  3HLW A;  1K54 A;  1IYP A;  4BBT A;  2PAV P;  3TW8 A;  1GSW A;  3JVU A;  5DF7 A;  5HPF A;  1KE4 A;  1DP9 A;  3G2Y A;  1ES3 A;  2HJ9 C;  1T1A A;  3VP1 A;  2JKT I;  4LLO B;  4UA6 A;  3W2Z A;  5DKL A;  4JXG A;  2J80 A;  5EE8 A;  4GLQ A;  4QJG A;  3H82 B;  4Y0T A;  5E2F A;  5HL1 A;  4HH3 A;  1K57 A;  1S66 L;  4F94 A;  1XJ3 A;  1BSG A;  1BLH A;  1YKD A;  3DWK A;  5BOH A;  1CJF A;  5DTS A;  5FQI A;  4YOF A;  4Y17 A;  1DRM A;  1MWR A;  1PWD A;  3C7V A;  4R3A A;  4ME4 A;  1VET A;  1OT6 A;  3RH8 B;  3NDG A;  4Y0U A;  2EFX A;  3A3D A;  1ES4 A;  3FWL A;  4O0P A;  3UE6 A;  4UEY A;  4EU0 A;  3LIF A;  5HL6 A;  1ONH A;  3T4S A;  4OKP A;  4JBF A;  5EVI C;  5AJG A;  1MC0 A;  1G6O A;  3O87 A;  3KYE A;  1MWS A;  3R7W A;  1MBL A;  1KOU A;  3LIB A;  4IVK A;  4GW9 A;  4GJ4 A;  5E2G A;  2HV1 A;  1G68 A;  2OOL A;  2W1T B;  4B4Z A;  5CEB A;  3D3O A;  2GDN A;  2HP9 A;  1XA1 A;  2K31 A;  3HVF A;  2WKR A;  3ZG9 B;  1ERO A;  3HLC A;  1HVB A;  4I38 A;  4IBX A;  1YMS A;  4K91 A;  4ARZ A;  4OQI A;  5EVI A;  4WN5 A;  2PU4 A;  2Y2Q A;  1YT4 A;  4H8R A;  4YIN A;  1XJ6 A;  1PYY A;  1PRQ A;  5J4E A;  1PZP A;  2VJW A;  4MDZ A;  4OLG A;  5EOE A;  3T4J A;  4QHC A;  4WEJ A;  5HSQ A;  1K56 A;  3EGD C;  5HAI A;  5HWV A;  4WMC A;  4MEZ A;  3CIT A;  3PHY A;  4RX2 A;  2WKH A;  2EWW A;  2XQZ A;  3Q7Z A;  1F98 A;  4BL3 A;  4HES A;  3MMH A;  2RL3 A;  5A91 A;  3RTY A;  3ITB A;  2G2U A;  4NET A;  3S7Q A;  2Y55 A;  4ESP A;  3PBO A;  4OPR A;  1SDN A;  5AVF A;  4LV3 A;  4DXC A;  1OTB A;  3HLB A;  1JWV A;  1LL5 A;  3LI8 A;  3ULF A;  4BQM A;  1NWZ A;  3UPP A;  2Y91 A;  5GHY A;  3AGF A;  2Z2M B;  4KEN B;  3AGD A;  1E4D A;  5TJJ A;  3IX8 A;  2JE5 A;  1Y28 A;  3CUE C;  3LIC A;  1HD8 A;  4OP8 A;  1K0K A;  3L9K A;  3G31 A;  4HHD A;  3TOI A;  5HD5 A;  3QP8 A;  4GCZ A;  4S2L A;  1IEL A;  1YLW A;  2B18 A;  3FZC A;  1DP8 A;  2R9X A;  2ZL1 A;  1VEU A;  4KZ5 A;  4UA9 A;  4M4X A;  3BLM A;  4X25 A;  3T4Q A;  2HP6 A;  4EES A;  4GDN A;  1AXB A;  4KG6 A;  4KQQ A;  2ZQ9 A;  3GTC A;  1P9R A;  3FYZ A;  4GDB A;  1WE4 A;  3KSF A;  4F3L B;  3FG8 A;  2JHE A;  5CGS A;  3OC2 A;  1H8M A;  1FQG A;  5JYP A;  3UDX A;  1XJ2 A;  3MF0 A;  3IQA A;  3P09 A;  2WAD A;  3TG9 A;  3NIA A;  5AQ9 A;  3T50 A;  3MKF A;  3SS3 A;  4M3K A;  1K4F A;  3HUM A;  1FR6 A;  4RQ9 A;  1L3L A;  2WGV A;  3S1Y A;  3ZNY A;  3KSG A;  2VV8 A;  1DP6 A;  3F1N A;  2J3T C;  4KQO A;  3T4L A;  4IUH A;  5U47 A;  3H7W A;  1NJ4 A;  4OON A;  4X68 A;  2E8I A;  2IWD A;  4AFI A;  1NYM A;  4XT2 B;  1SZV A;  3B42 A;  2PBD P;  2EX8 A;  2RCX A;  5D3O A;  1N9L A;  5EVL A;  3BWL A;  4UQI M;  5F5Y A;  3MSH A;  3IHB A;  2WKE A;  3P98 A;  3MFX A;  3HJI A;  2VZW A;  3HCY A;  4WLA A;  1TD5 A;  3ZG8 B;  1H8Z A;  3IXD A;  3M2J A;  3M6B A;  3VE4 A;  5FI2 A;  4MN7 A;  5HX9 A;  3LY3 A;  1W63 M;  2P08 A;  4O7D A;  1IFQ A;  3WRT A;  3A3I A;  2WKP A;  5DF9 A;  3O3V A;  4X1M A;  4EUZ A;  3LEQ A;  2O99 A;  3N6I A;  2HGV A;  2WGW B;  1BLC A;  1TS6 A;  1IKI A;  5GHX A;  5FAP A;  3GV9 A;  3O88 A;  4E3L A;  3PBR A;  3UB9 A;  1MWT A;  5AQB A;  1CEG A;  4KZ3 A;  4C6Y A;  2XD5 A;  1K55 A;  5J8X A;  2E8J A;  2LB9 A;  3MQ0 A;  3MXS A;  1FR1 A;  4C3Q A;  1Z09 A;  3GQZ A;  4KZ7 A;  1V9Y A;  4S2P A;  3E98 A;  3N4I A;  4OLD A;  3MQO A;  3BYD A;  4DXB A;  3A0S A;  3WS2 A;  2V0U A;  1FCN A;  3ZNT A;  3QP4 A;  3KSI A;  5CHU A;  2YKH A;  2QPN A;  4Y7P A;  1GHM A;  1YM1 A;  4ZJ3 A;  2PD8 A;  5FQQ A;  3PTE A;  3P7N A;  3LCE A;  5CTM A;  3OOV A;  2XA7 M;  4WYY A;  2W3E A;  3T12 B;  2INW A;  2C5W B;  3E2L A;  2PR6 A;  4LCL A;  2VA0 A;  4OPY A;  3UNW A;  1L2S A;  4CLC C;  4P6Z S;  2PBY A;  2X02 A;  3OBF A;  2XEP A;  3S7O A;  3Q7V A;  2WZZ A;  2PD7 A;  4GNU A;  4JGR A;  3BW6 A;  4B93 A;  1Q2Q A;  1LT0 A;  5AQA A;  5FAT A;  3IHA A;  4JXV A;  3EQU A;  1L0D A;  4I3I A;  1W7F A;  4NXG A;  3UB5 P;  4WBG A;  4KZ8 A;  1FCO A;  5HDS A;  2V9A A;  2ZQ8 A;  4DJ3 A;  3GR2 A;  1XJ4 A;  4CLC A;  1BLS A;  1OJG A;  1KGG A;  2ZQ7 A;  4B9O A;  3NOU C;  3BFF A;  3BEC A;  3VOZ A;  4Q8I A;  1KGF A;  4MN6 A;  2HZ5 A;  4ZRR A;  3PR6 A;  4L9F A;  2PHY A;  3BFC A;  3T4K A;  3ZQ5 A;  5FDS A;  3DAV A;  3E4P A;  3NHQ A;  3ZGA B;  1VET B;  4GD6 A;  4JKT A;  4FSF A;  5HZH A;  5CXW A;  1GA0 A;  3UY6 A;  1VM1 A;  3IT9 A;  2EFU A;  5M19 A;  3ZVW A;  3C4P A;  2ACG A;  5F83 A;  1WYC A;  3R7W B;  3UE3 A;  5FAS A;  3IWI A;  2PDR A;  3NOT C;  2NUP C;  4MBH A;  2OAP 1;  1O7E A;  4E3K A;  4DE0 A;  1BT5 A;  4PM8 A;  1XGI A;  4PM9 A;  4ARZ B;  5IU1 A;  1LSX A;  3A0R A;  3L7H A;  1P0Z A;  1H5X A;  5EVI B;  3D4F A;  3EEH A;  3QNB A;  1G28 A;  2O9C A;  3V3S A;  3FKV A;  2H0Y A;  4KUO A;  1LL9 A;  2K2N A;  2V20 A;  1W63 Q;  1JWP A;  4EEP A;  3TSG A;  5L07 A;  3V39 A;  4Q0I A;  4XUX A;  2P74 A;  3WWX A;  3BEB A;  3VOL A;  4K0X A;  3VV4 A;  1E3U A;  1PZO A;  3MZD A;  4KG5 A;  5CHM A;  4BBV A;  3OPR A;  2FFF B;  2P7J A;  4PKY G;  2L4R A;  3BFE A;  3LO7 A;  1YLZ A;  4LGW A;  4ZJ1 A;  4A5R A;  1V9Z A;  4E3M A;  5JYO A;  3Q07 A;  1ZKJ A;  2ZM8 A;  3ZVT A;  1OT9 A;  3WS0 A;  1MKI A;  2QJ7 A;  4MNR A;  1TS7 A;  5EM1 A;  4WF0 A;  3PBN A;  1UWN X;  3KYZ A;  2ZJ9 A;  5DVA A;  3PBQ A;  2LB5 A;  4KQR A;  4OPZ A;  2QHK A;  3ZYT A;  2Y59 A;  5HDC A;  3Q81 A;  1SKO A;  2FH5 A;  4NXF A;  3NY4 A;  4G3W A;  2Q0O A;  4DE2 A;  1K25 A;  3JYI A;  4MCW A;  1NLY A;  4R23 A;  5DJT A;  2KX6 A;  1GHP A;  3IF6 C;  4WEK A;  2OLU A;  3CPT A;  4WM9 A;  2AVX A;  3BFD A;  3OPL A;  1W8Q A;  2OSU A;  4S2M A;  3IWQ A;  4HIA A;  4BWI A;  4RX3 A;  2ZL1 B;  3WS5 A;  1VEU B;  3BLS A;  2VK3 A;  3G32 A;  4PHT A;  1IYQ A;  3MBZ A;  2W3H A;  3KO6 A;  2GJ3 A;  5A93 A;  2DNS A;  4EBL A;  5HW3 A;  3HL9 A;  1N4O A;  3IF6 A;  1CK3 A;  3LR3 A;  5E2H A;  4Q0J A;  4OQ0 A;  2W3F A;  4GB7 A;  1YLT A;  4NXB A;  3HRE A;  3C5A A;  3CAX A;  3SOI A;  5F69 A;  3C38 A;  5EV0 A;  3F1N B;  4P0M A;  3IH8 A;  3VE3 A;  3C7U A;  3NC8 A;  4CPK A;  3RJU A;  2EXA A;  3H7W B;  5CGX A;  4E6X A;  4Y2F A;  3G35 A;  1OTI A;  4WZ5 C;  4PM7 A;  3CMZ A;  3MKE A;  5HDD A;  3QNC A;  4ZBE A;  4NG2 A;  3FC7 A;  1I2W A;  5I94 A;  4OP5 A;  2QZ6 A;  4R6L A;  4C75 A;  1YLP A;  4JF4 A;  3E4Q A;  2XRO A;  2R9W A;  2Y2L A;  5J3W A;  3V50 A;  2JKT M;  2UV0 E;  5F1F A;  4WZ4 A;  4Z1W A;  3NUL A;  4S2I A;  5A92 A;  1JTG A;  5HWW A;  1S1Y A;  3IH9 A;  4LV0 A;  1GA9 A;  5EPH A;  3LR5 A;  4HQA A;  2L1M A;  4KQD A;  4RVA A;  4D60 A;  2HDU A;  4LPZ A;  2ZC5 B;  1H0M A;  3T1X A;  5GLC A;  4N1X A;  2A3U A;  3C30 A;  4S2O A;  3WS1 A;  3NEC A;  4PPR A;  3F1P A;  1D06 A;  4RYE A;  2HDQ A;  1NRJ A;  3OCL A;  3KYQ A;  1LHY A;  4X56 A;  5IHV A;  1G6A A;  1BYW A;  1G5U A;  2NUT C;  1TS8 A;  2Y2M A;  3SS5 A;  1PNE A;  4X69 A;  3QP2 A;  2ZC6 B;  4DE3 A;  5EVE A;  3K3C A;  3HUO A;  1NZO A;  4XUZ A;  1IKG A;  1EWZ A;  4YFM A;  5FI6 A;  4IUK A;  5EM0 A;  1C3B A;  4EET B;  4OQH A;  1K4E A;  3O86 A;  1GSX A;  3UE0 A;  5L10 A;  3CUE A;  3FPV A;  3LIA A;  4DRT A;  1S4R A;  3CHW P;  2Y79 A;  2JKR M;  3NI9 A;  4GS9 A;  1BUE A;  3T1Q B;  1CF0 A;  1UWP X;  4R4R A;  4DMZ A;  3W4Q A;  4S2N C;  5DFX A;  2DRW A;  2QKP A;  3BJN A;  2WK0 A;  3AGE A;  3ZDJ A;  1YLY A;  4O8G A;  3BQA A;  3Q7V B;  4KZ4 A;  1TF1 A;  4E3J A;  2Y2N A;  5F68 A;  2W3D A;  4HP9 A;  5DKK A;  3F1O A;  2Y4A A;  4S2N A;  4HI4 A;  3DW0 A;  3BQ8 A;  2JKG A;  3PAG A;  4CLC B;  2VKS A;  4GHI A;  4NK3 A;  4DF6 A;  5FQM A;  2HPB A;  4KZ6 A;  2VV7 A;  2ZMF A;  1RGY A;  2H28 A;  4FH4 A;  3RXW A;  3IWO A;  3G30 A;  4P6Z M;  1DY6 A;  2OAQ 1;  3LID A;  1T1C A;  2Y2O A;  4CLC E;  4G3V A;  4EUV A;  5DTK A;  2J8Y A;  2WZX A;  4GOG A;  3A3E A;  2XH9 A;  2Y2I A;  5FQK A;  3EOI A;  3S22 A;  1W79 A;  4L9G A;  3RFB A;  2GX5 A;  5AQ7 A;  3OPH A;  1OPX A;  4DN0 A;  1GSV A;  4BMW A;  4H6J A;  4P6B A;  2EX2 A;  1LI9 A;  3T4O A;  1MKM A;  5HWT A;  2J9P A;  5L2F A;  2ZMV A;  1ESI A;  3UB8 A;  3DTE A;  5A8B A;  1HLU P;  4CJN A;  2XSS A;  4DJ2 A;  2V1B A;  3V67 A;  2QMI A;  2VV6 A;  5FQJ A;  3MXQ A;  1OTE A;  2XR0 A;  3ISG A;  4ETX A;  1IOU A;  4L9E A;  1RCJ A;  4Y13 A;  1S0W A;  2BG1 A;  3K2N A;  2QYB A;  1EW0 A;  4LRZ E;  2FZ0 A;  1FIL A;  4KZB A;  1T19 A;  1S67 L;  4JLF A;  3ZG7 B;  4IVI A;  1S1Z A;  4K08 A;  2H5S A;  1DJC A;  2GNX A;  2Z2L B;  4EQI A;  3VFH A;  3W4O A;  5HAP A;  2H0T A;  4E3O A;  3UMD A;  3V3R A;  2VX8 A;  3S7N A;  2D02 A;  1UGU A;  2KLI A;  3HLG A;  4R1G A;  1VHM A;  4I5S A;  1IYS A;  1D1J A;  1TDG A;  4BEN A;  1SKO B;  2XGN A;  5CHJ A;  2Y2P A;  2A24 A;  5C5K A;  1HZO A;  1E25 A;  3VOY A;  1PI4 A;  1W8Y A;  3NBL A;  3DTM A;  2PRF A;  1ACF A;  3GDI A;  4HJ4 A;  1XFN A;  3CPT B;  3VP4 A;  2ZOI A;  4BL2 A;  2DMW A;  1K6S A;  1PW1 A;  2PR5 A;  1XGJ A;  3NCK A;  1JNU A;  5IT5 A;  1DJB A;  3LY4 A;  1ERM A;  3UDI A;  3UO9 A;  2C6W B;  2XK1 A;  5HAQ A;  1QME A;  1NLZ A;  2JCH A;  1O07 A;  1U60 A;  2WKI A;  2OWJ A;  4KG2 A;  3Q82 A;  3IF6 B;  4EWF A;  2R78 A;  3C4O A;  1KDW A;  3A0V A;  3A3F A;  2Z6C A;  3ZG5 A;  4EQ1 A;  2EWV A;  3FKW A;  3HJK A;  4Y15 A;  1S4S A;  3QP6 A;  3E2K A;  4DDS A;  3SH8 A;  4WUJ A;  3UPO A;  1XA7 A;  3CI6 A;  5CRF A;  1YQS A;  1J9M A;  1GHI A;  4JGP A;  4JXW A;  5GHZ A;  1SDE A;  3FV7 A;  1KVL A;  3CLO A;  4JF5 A;  5F6A A;  2ZLY A;  4WL9 A;  1ALQ A;  2ZC4 B;  5A90 A;  5FEG A;  3LI9 A;  4N9L A;  4R70 A;  3PBS A;  5CER A;  1L0E A;  5CEC A;  3RXX A;  3JPU A;  3IXB A;  4U0T A;  3WRZ A;  2K7S A;  3B47 A;  2M7U A;  3H9W A;  1ES5 A;  4FH2 A;  3UPN A;  3BM6 A;  1L0F A;  5DJU A;  5K5B A;  1SHV A;  2A49 A;  3B33 A;  2W3G A;  3QHY A;  1TS0 A;  4QB8 A;  5GL9 A;  3W8K A;  4LV1 A;  3Q1F A;  3G4P A;  1K6R A;  4FUW A;  4EER A;  1Y4O A;  2Y2G A;  5HFO A;  1T18 A;  3LR0 A;  1K54 C;  1FSY A;  1LLB A;  1XFQ A;  5EFW A;  4ID4 A;  1OJ5 A;  3SH9 A;  4EXO A;  5E2E A;  5FI7 A;  2M1C A;  2VGJ A;  4HOI A;  1FIK A;  3KX0 X;  2W1R A;  2VGL S;  1YLJ A;  1ERQ A;  4EEU A;  3BRM A;  1L0G A;  4OQG A;  3N8R A;  3S4X A;  1CQA A;  1QMF A;  3F1P B;  4X6T A;  4B4X A;  4X55 A;  4E3N A;  2ZBB A;  4HNB A;  1A0K A;  2GZA A;  4IHQ A;  5L09 A;  1EI5 A;  4PM5 A;  2V0W A;  1K57 C;  2I9V A;  3KSH A;  3MZF A;  2M7V A;  3UE1 A;  2WAF A;  1KDS A;  4OOY A;  4U3T A;  4P87 A;  1LSV A;  4R3J A;  2BTF P;  4HBU A;  3ZFZ A;  3G34 A;  4UAA A;  2PYP A;  4NEE D;  2DCF A;  1YPR A;  1N9N A;  3IS2 A;  4UHU A;  4MBK A;  2WGI A;  2L0W A;  4NKP A;  1ZTU A;  2Y2K A;  1H3Q A;  2IA2 A;  2IWC A;  4CQH A;  3MFD A;  5FEF A;  2X71 A;  4UA7 A;  3M6H A;  2VEA A;  5TBM A;  2OV5 A;  1XPB A;  4LCM A;  4EBN A;  4GS9 B;  2HJE A;  3PYP A;  4E04 A;  4I3J A;  3SW1 A;  4OH0 A;  1PW8 A;  2G7U A;  1E3U D;  4DKI A;  1WA9 A;  1W5D A;  1BUL A;  2A2L A;  2BLS A;  2Z6D A;  4II7 A;  1IYO A;  4ZJ2 A;  5FAQ A;  5KSC A;  1LI0 A;  4N1H A;  3LUQ A;  4G3K A;  2XFT A;  3C2W A;  4NXE A;  3TRC A;  3QP1 A;  1RP5 A;  4R4S A;  3F1O B;  2I72 A;  3PAE A;  2JKF A;  4I39 A;  5G4Y A;  2O9B A;  5DTT A;  3MR0 A;  1OTA A;  4Y0O A;  1KVM A;  1P97 A;  5TFQ A;  3T1R A;  4GHI B;  1BZA A;  1FSW A;  5DFY A;  2JKR I;  3BY9 A;  4LV2 A;  2W27 A;  4MLL A;  3GRJ A;  4R38 A;  4O01 A;  4WZ5 A;  4JGQ A;  4KUK A;  4MBF A;  1ONG A;  1CI9 A;  2P9V A;  4HEF A;  1STZ A;  1D7E A;  3LR4 A;  1CI8 A;  3CG5 A;  3UB6 A;  5CX7 A;  4HJ6 A;  5IS1 A;  3GSG A;  1M40 A;  2ZM2 A;  2X01 A;  4QD4 A;  3IBR A;  4X53 A;  1X0O A;  5CGW A;  2V2F F;  3VSK A;  1YAX A;  2P04 A;  1TVF A;  2VLG A;  4QWO A;  3CZD A;  3HLF A;  5GLA A;  2QJ5 A;  4H6J B;  2PT7 A;  4I3A A;  5HAR A;  3LYX A;  3U4L P;  5F1G A;  3O5Y A;  5G18 A;  3G6O A;  1VB6 A;  1XXM A;  4BD1 A;  2ZQC A;  2Y2H A;  2V8C A;  1PFL A;  4E6W A;  3N7W A;  1Q2P A;  4QY6 A;  1XX2 A;  2B5R A;  4N9K A;  3H82 A;  2J3W A;  2FFY A;  1ZHH B;  3UDF A;  1HTZ A;  1KE3 A;  2EX6 A;  1BTL A;  4EW7 A;  3D72 A;  4YWZ A;  4Q0H A;  5EVI D;  2G2W A;  1ESU A;  2Y8H A;  3E4O A;  3DTI A;  1Z6F A;  3OCN A;  1S6R A;  4MN5 A;  1N9O A;  5EEC A;  1JVJ A;  5FSR A;  4LEN A;  4Y3I A;  4DDY A;  5I5L A;  3ZCZ A;  4ZAM A;  2PU2 A;  3CJM A;  3ZG0 A;  3PXP A;  3B3X A;  1MXO A;  3IX3 A;  1K56 D;  3LFV A;  2EX9 A;  4WMC D;  3ICY A;  3GVB A;  3T4T A;  5FL3 A;  2WYX A;  3D9Y A;  5GLD A;  3T1S A;  2WAE A;  4ETZ A;  3EWK A;  2J9O A;  1F5M A;  5FDH A;  1N9B A;  2A24 B;  5G4Z A;  4YNR A;  2XD1 A;  4ZTK A;  3BY8 A;  4JF6 A;  1I5Q A;  2XLN A;  2W1T A;  3IXG A;  3MZE A;  3P01 A;  2EXB A;  2XDM A;  2HF6 A;  4ZDX A;  1PIO A;  3LEZ A;  4OVD A;  2OLV A;  1SCW A;  4HH2 A;  4D2O A;  5F82 A;  3OZH A;  4L0L A;  2Y2J A;  4X1L A;  1OTD A;  2XFS A; 
#chains in the Genus database with same CATH homology
 4HJ4 A;  1F98 A;  1XFN A;  3PBQ A;  2LB5 A;  3MMH A;  2QHK A;  3RTY A;  3ZYT A;  5HD3 A;  5HDC A;  2ZOI A;  2KDK A;  2FH5 A;  4QPR A;  2DMW A;  4NXF A;  3S7Q A;  4G3W A;  2PR5 A;  3PBO A;  1YSQ A;  5AVF A;  1JNU A;  4MCW A;  2XRN A;  5IT5 A;  1NLY A;  1OTB A;  5DJT A;  2KX6 A;  1NLZ A;  4WEK A;  3LI8 A;  3ULF A;  1P9W A;  1NWZ A;  2OWJ A;  4HIA A;  4BWI A;  2R78 A;  4HP4 A;  2V1A A;  5TJJ A;  3A0V A;  1Y28 A;  3CUE C;  3LIC A;  2Z6C A;  4EQ1 A;  4PHT A;  4WEL A;  3UB7 A;  3C8C A;  2W3H A;  4HHD A;  3KO6 A;  2EWV A;  2GJ3 A;  3EEA A;  5HD5 A;  4IJG A;  3HJK A;  4OOL A;  4GCZ A;  1S4S A;  3LR3 A;  4WUJ A;  2B18 A;  5J7E A;  5L8M A;  1DP8 A;  3CI6 A;  4Q0J A;  2W3F A;  4NXB A;  4M4X A;  3T4Q A;  4EES A;  3CAX A;  4JGP A;  5F69 A;  3CLO A;  3C38 A;  1P9R A;  3IBJ A;  5F6A A;  4WL9 A;  3F1N B;  3KSF A;  1LSW A;  4F3L B;  3FG8 A;  3LI9 A;  3PBT A;  2JHE A;  4R70 A;  3OC2 A;  3VE3 A;  3PBS A;  1H8M A;  5MC7 A;  1XJ2 A;  3MF0 A;  3H7W B;  2J3T D;  2K7S A;  3B47 A;  2M7U A;  3H9W A;  3E0Y A;  3T50 A;  4Y2F A;  5DJU A;  1OTI A;  2W0N A;  4RQ9 A;  5K5B A;  3JVV A;  2MJ6 A;  5HDD A;  3TE8 A;  3DBA A;  1ODV A;  3K3D A;  3B33 A;  2VV8 A;  3KSG A;  1DP6 A;  3F1N A;  3FC7 A;  5KSH A;  2W3G A;  2J3T C;  4F3L A;  4KQO A;  1TS0 A;  3T4L A;  4IUH A;  4HY8 A;  4R6L A;  4EER A;  1LL8 A;  5HPI A;  1T18 A;  3H7W A;  3R4K A;  3LR0 A;  4UQI S;  1XFQ A;  5EFW A;  4AFI A;  1OJ5 A;  3E4Q A;  4EXO A;  2M1C A;  4HOI A;  2XRO A;  4LRX C;  4XT2 B;  3KX0 X;  5J3W A;  2W1R A;  2VGL S;  2JKT M;  5KIZ A;  4EEU A;  3B42 A;  5AVE A;  4Z1W A;  3FPW A;  1YSP A;  3F1P B;  1N9L A;  5HWW A;  3CWF A;  1S1Y A;  2ZBB A;  4HNB A;  2B02 A;  2GZA A;  2EA9 A;  2O9A A;  3BWL A;  3LR5 A;  4IHQ A;  4UQI M;  3S7P A;  4HQA A;  3IS2 B;  5F5Y A;  2V0W A;  2L1M A;  2I9V A;  3MFX A;  4KQD A;  3KSH A;  4LPZ A;  4XT2 A;  3LIE A;  3HJI A;  2M7V A;  3OLO A;  2VZW A;  2VGL M;  3C30 A;  3HCY A;  4WLA A;  1LSV A;  1TD5 A;  5LBR A;  3F1P A;  5TBM B;  1D06 A;  3VE4 A;  4MN7 A;  4PAU A;  2PYP A;  4OOM A;  1NRJ A;  4FOF A;  4NEE D;  1N9N A;  3IS2 A;  1MZU A;  3OCL A;  1W63 M;  2L0W A;  3KYQ A;  4NKP A;  1BYW A;  2NUT C;  1IFQ A;  1ZTU A;  2P08 A;  1TS8 A;  2WKP A;  4LRY C;  1H3Q A;  5DF9 A;  2IA2 A;  2WKQ A;  3EQV A;  2O99 A;  4CQH A;  2HGV A;  1TS6 A;  2VEA A;  3UME A;  5TBM A;  3EGX C;  3PBR A;  3K3C A;  3UB9 A;  4GS9 B;  2HJE A;  3PYP A;  4E04 A;  2LB9 A;  3U2A A;  2YKF A;  4IUK A;  3MQ0 A;  4I3J A;  3SW1 A;  2CMN A;  2G7U A;  4EET B;  1WA9 A;  1GSX A;  1V9Y A;  2A2L A;  3CUE A;  2Z6D A;  3FPV A;  3LIA A;  1S4R A;  3E98 A;  4II7 A;  3MQO A;  3MJQ A;  2Y79 A;  2JKR M;  2ZOH A;  4GS9 A;  3NJA A;  2XA7 S;  3LUQ A;  2OWH A;  1UWP X;  4G3K A;  4DMZ A;  2PYR A;  3C2W A;  2D01 A;  3A0S A;  4NXE A;  3TRC A;  5DFX A;  2QWS A;  2QKP A;  2V0U A;  3BJN A;  3F1O B;  3KSI A;  2JN7 A;  3NOP C;  4HJ3 A;  3MQQ A;  4O8G A;  2YKH A;  4I39 A;  5G4Y A;  2O9B A;  3BQA A;  3MR0 A;  1OTA A;  2PD8 A;  1TF1 A;  3P7N A;  1P97 A;  4BBU A;  4CLC D;  4GHI B;  2O0Y A;  3OOV A;  2XA7 M;  2W3D A;  5F68 A;  2W3E A;  4MMN A;  2INW A;  4HP9 A;  5DKK A;  5DFY A;  2KOI A;  2JKR I;  3BY9 A;  2PR6 A;  3F1O A;  2VA0 A;  2W27 A;  1T1B A;  4CLC C;  2BAS A;  4P6Z S;  3OBF A;  4R38 A;  3GEC A;  4HI4 A;  3BQ8 A;  4O01 A;  3S7O A;  4JGO A;  4Y5F A;  2PD7 A;  4JGQ A;  4JGR A;  3BW6 A;  4B93 A;  4KUK A;  4CLC B;  1F9I A;  2VKS A;  4GHI A;  1LT0 A;  4PKY A;  1STZ A;  1D7E A;  3LR4 A;  3EQU A;  3TJZ C;  4I3I A;  3UB6 A;  4BJP A;  5CX7 A;  4NXG A;  4HJ6 A;  5IS1 A;  2VV7 A;  2ZMF A;  2H28 A;  4BBT A;  4P6Z M;  5HDS A;  2V9A A;  2OAQ 1;  4DJ3 A;  1XJ4 A;  3TW8 A;  4CLC A;  3IBR A;  1GSW A;  3LID A;  1X0O A;  3JVU A;  1T1C A;  1OJG A;  5HPF A;  4CLC E;  1DP9 A;  4G3V A;  2HJ9 C;  1YAX A;  1T1A A;  4B9O A;  4EUV A;  2P04 A;  2JKT I;  2VLG A;  3NOU C;  4LLO B;  4MN6 A;  3W2Z A;  5DKL A;  4ZRR A;  3PR6 A;  4L9F A;  2PHY A;  2QJ5 A;  4H6J B;  2PT7 A;  4I3A A;  2J80 A;  3T4K A;  4GLQ A;  3ZQ5 A;  3H82 B;  3LYX A;  3EOI A;  4HH3 A;  3O5Y A;  1S66 L;  3E4P A;  3NHQ A;  3G6O A;  1VB6 A;  4L9G A;  3RFB A;  2GX5 A;  4FSF A;  1XJ3 A;  1OPX A;  1YKD A;  4DN0 A;  5HZH A;  1GSV A;  4BMW A;  4H6J A;  3H82 A;  3T4O A;  1MKM A;  2J3W A;  4YOF A;  5HWT A;  1ZHH B;  2ZMV A;  1DRM A;  3UB8 A;  4EW7 A;  3D72 A;  4R3A A;  4ME4 A;  4YWZ A;  1OT6 A;  3R7W B;  4Q0H A;  3RH8 B;  5A8B A;  2XSS A;  3UE3 A;  4DJ2 A;  2Y8H A;  2PDR A;  3E4O A;  3NOT C;  2NUP C;  2V1B A;  4O0P A;  3OCN A;  3UE6 A;  4UEY A;  4EU0 A;  3V67 A;  4MN5 A;  1N9O A;  2OAP 1;  3LIF A;  2VV6 A;  5HL6 A;  3MXQ A;  3T4S A;  1OTE A;  4Y3I A;  4ETX A;  1IOU A;  5I5L A;  4L9E A;  3PXP A;  5AJG A;  3K2N A;  2QYB A;  1MC0 A;  4ARZ B;  5IU1 A;  1G6O A;  1LSX A;  3A0R A;  1P0Z A;  3LFV A;  1EW0 A;  3R7W A;  3EEH A;  4LRZ E;  1KOU A;  3LIB A;  1G28 A;  2O9C A;  2FZ0 A;  4GW9 A;  4KUO A;  3ICY A;  4GJ4 A;  1T19 A;  2K2N A;  1S67 L;  2HV1 A;  2OOL A;  2W1T B;  1W63 Q;  3D3O A;  1S1Z A;  4K08 A;  3T4T A;  4EEP A;  2K31 A;  2WKR A;  4Q0I A;  2GNX A;  5FL3 A;  4I38 A;  3VOL A;  3VV4 A;  4ETZ A;  3EWK A;  3UMD A;  4ARZ A;  4BBV A;  1F5M A;  2VX8 A;  2P7J A;  4WN5 A;  4PKY G;  2L4R A;  2A24 B;  5G4Z A;  4YNR A;  3S7N A;  2D02 A;  1UGU A;  3BY8 A;  1XJ6 A;  1V9Z A;  2KLI A;  2W1T A;  5J4E A;  1VHM A;  3P01 A;  2VJW A;  4MDZ A;  4I5S A;  1OT9 A;  2HF6 A;  3T4J A;  4WEJ A;  5HSQ A;  3EGD C;  2QJ7 A;  4HH2 A;  5HWV A;  2A24 A;  3CIT A;  4L0L A;  1TS7 A;  5C5K A;  4WF0 A;  3PHY A;  3PBN A;  1OTD A;  1UWN X;  3KYZ A;  2EWW A;  3GDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...