4EERA

Crystal structure of lov2 domain of arabidopsis thaliana phototropin 2 c426a mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
106
structure length
106
Chain Sequence
EKNFVISDPRLPDNPIIFASDSFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLFHLQPMRDQKGELQYFIGVQLDGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, flavoprotein
molecule keywords Phototropin-2
publication title Structural Tuning of the Fluorescent Protein iLOV for Improved Photostability.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 34
structure length 106
sequence length 106
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eerA00
2JHEA 3F1NB 5J4EA 3UMDA 4HIAA 1G28A 3C8CA 4JGRA 1UGUA 2GJ3A 4HJ3A 3G6OA 3E4QA 3ZQ5A 4HOIA 3MJQA 4PKYG 5AVEA 1F9IA 1VB6A 3VE3A 4H6JA 5F6AA 3UB9A 4DJ2A 5TBMA 5DJUA 4F3LA 2M1CA 4BBVA 1P97A 4GHIB 2V0UA 1P0ZA 1LSXA 2VV7A 2WKQA 4NXGA 3IBRA 2EA9A 4WLAA 3H7WB 3LI9A 3IS2B 4EEPA 4HP4A 4HP9A 2L4RA 3PHYA 1TS6A 1V9YA 1X0OA 5DJTA 5IU1A 4R3AA 3F1PB 2OOLA 1TS0A 4HI4A 4HHDA 3BY8A 2PD7A 3LUQA 1S67L 4GCZA 3T50A 4I39A 2Z6DA 3H9WA 2BASA 3RH8B 3UMEA 2OWHA 3GDIA 4R38A 1DP8A 2V0WA 4HH3A 5DKKA 1OTDA 3LIFA 1TS7A 5G4YA 1LSWA 5IS1A 5J7EA 2JN7A 3E4PA 3GECA 3CAXA 4WF0A 4XT2B 3EWKA 1Y28A 5DKLA 1XFQA 1D06A 2VV6A 2H28A 3NOUC 1T1AA 2W27A 1OTEA 4HJ6A 4HNBA 4WUJA 4K08A 1KOUA 2V9AA 3A0SA 1XJ6A 3A0VA 2K7SA 5HWWA 2A24A 4LRXC 3H82B 3BWLA 3ULFA 2HV1A 4I3IA 3VOLA 2PD8A 4I3JA 2L1MA 4GS9B 2YKFA 1XJ2A 2I9VA 4HQAA 1GSVA 3ICYA 1ODVA 4EXOA 3D72A 4L9GA 3B33A 3FC7A 1EW0A 4JGPA 3CWFA 4EEUA 1D7EA 4HY8A 3UB8A 3NOTC 4R6LA 5I5LA 1XJ4A 3MR0A 5F69A 4KUOA 2OWJA 3NOPC 1MZUA 1S1YA 3MFXA 2WKPA 1LT0A 3LIAA 2B02A 1N9OA 2KDKA 2VLGA 5AVFA 2PYRA 5HDCA 4F3LB 2YKHA 4JGQA 2KX6A 2PHYA 1V9ZA 3H7WA 5HDSA 1T1CA 3IS2A 3LICA 1UWPX 4I3AA 3UE6A 3K3CA 3F1PA 5HDDA 3LI8A 3F1OB 1GSWA 4LLOB 2QHKA 2P7JA 4KQDA 4LRYC 3HJKA 3EEHA 2QJ7A 1N9NA 1UWNX 4RQ9A 1T18A 4EQ1A 5F5YA 5KIZA 3LIDA 2Z6CA 4WL9A 5A8BA 2PDRA 5J3WA 3UB6A 1OTAA 3LIEA 4XT2A 4R70A 4M4XA 1S4RA 3LYXA 4I38A 1OJ5A 1BYWA 4JGOA 4HJ4A 1OTBA 2QKPA 5F68A 1T1BA 2R78A 2L0WA 1T19A 2V1AA 4B9OA 3F1NA 4L9FA 2A24B 5HZHA 4BBUA 4BBTA 3CLOA 4MN6A 2QJ5A 3FG8A 2VV8A 3PYPA 3OLOA 1LSVA 2V1BA 2PR6A 4YWZA 4PKYA 4H6JB 1XFNA 3E4OA 2WKRA 4GHIA 5TBMB 1XJ3A 2ZBBA 2CMNA 5HWVA 3SW1A 1LL8A 4GW9A 3K3DA 2D02A 4L9EA 5HD5A 5EFWA 4LRZE 1WA9A 4NXEA 2VEAA 4MN5A 1GSXA 5HWTA 2J80A 3C2WA 4HH2A 4DJ3A 1JNUA 3F1OA 2D01A 3KX0X 2ZOHA 4KUKA 1DP6A 3BY9A 1S1ZA 4EW7A 3P7NA 3RTYA 4EESA 2PR5A 4EETB 1TS8A 3NHQA 3HJIA 1N9LA 5HD3A 3UB7A 2PYPA 3MQQA 1S4SA 4NXBA 1OT9A 2INWA 2QWSA 1OJGA 1S66L 3MXQA 4I5SA 2W0NA 4E04A 5G4ZA 4LPZA 3MQOA 2ZOIA 4WN5A 1DRMA 3LIBA 3H82A 1OTIA 1DP9A 5HSQA 1NWZA 3A0RA 3NJAA 4GS9A 4NXFA 4EERA 1F98A 3VE4A 1OT6A
chains in the Genus database with same CATH superfamily
2ZQDA 4RA7A 4KZ8A 3UMDA 2WZXA 4HIAA 2GJ3A 4HJ3A 2R9WA 2DMWA 3E0YA 4QY5A 4S2LA 4KENB 4PKYG 5AVEA 4UQIS 2VGJA 4BENA 3NY4A 1VB6A 2PAVP 2HDSA 3C38A 3UB9A 4PM7A 3SOIA 3A3DA 2Y2GA 1Y54A 4LCMA 1PYYA 2Y4AA 5DJUA 2O9AA 2WAEA 3LCEA 5TR7A 3SH9A 3N8RA 3VP1A 4S2JA 3T4JA 3A3EA 4B4ZA 1P9WA 4IUHA 1K55A 1P0ZA 4JLFA 3CUEA 1LSXA 2XA7S 3CJMA 4OLDA 1KE3A 4WELA 3KSGA 4HESA 4NEED 2EX8A 3H7WB 1PW1A 3ITBA 4RX2A 5L07A 2P04A 4OPQA 3S1YA 2Y2OA 1XA1A 4Y0UA 2L4RA 3CITA 1NXYA 2H10A 1HZOA 1TS0A 3BW6A 4HHDA 1JWZA 1S67L 2ZC6B 5CGWA 3VP0A 5I94A 4K0XA 4DMZA 5CGXA 3G4PA 4DDYA 4S2OA 3PAEA 1MKMA 3TW8A 3HCYA 1C3BA 3HLEA 3LIFA 5L09A 3GR2A 4C6YA 4Y2FA 4DN0A 1L0DA 1RCJA 4O8GA 1FSYA 2JN7A 3GECA 3CAXA 4WF0A 2JKGA 4XT2B 3EWKA 1Y28A 4MCWA 5KMWA 1D06A 2HP5A 4R4SA 1JTGA 5F82A 4R23A 2JC7A 3LR4A 1KOUA 3ZG9B 1TVFA 5IHVA 2Y2MA 3BFEA 3EOIA 2K7SA 5DVAA 3C5AA 5HWWA 3I7JA 2VJWA 5FAOA 2P9VB 1ZG6A 5HAQA 1I2SA 4ZBEA 4OKPA 4R3BA 4UQIM 2Y2PA 4I3JA 1MBLA 1XJ2A 2PBYA 5L8MA 1W8QA 2J3TD 3ICYA 3ZNYA 3R4KA 2Y2LA 4EXOA 3S7QA 3ZDJA 4UA7A 4DKIA 1ESIA 3QP8A 3HL9A 3FC7A 2ZC7A 3LO7A 4P6BA 1YQSA 4JGPA 4GJ4A 1PNEA 2XA7M 4LENA 1XJ4A 3D9YA 2XLNA 2V2FF 2PU4A 3EGXC 5D3OA 3U4LP 4WYYA 1MZUA 2XD1A 3HLFA 2W3HA 2G2WA 5HARA 2KDKA 2PYRA 5HDCA 4ARZB 3VFHA 5C5KA 2YKHA 4JGQA 3WRTA 2ZQAA 5G18A 4DE1A 2KX6A 2ZC3B 2H0YA 1V9ZA 2HPBA 3CHWP 4MMNA 3PBOA 4S2MA 2Y2KA 1T1CA 5HDSA 4NKPA 1CQAA 4Q0HA 2H0TA 4Y13A 2JCHA 5CRFA 4P0MA 2C6WB 3VSKA 5DF8A 3LI8A 1O7EA 4CLCE 1CK3A 1H5XA 2ZQ8A 3LR0A 2JKRI 3HJKA 3LY3A 3C30A 3DW0A 4S2IA 4X1MA 2QMIA 4GD6A 4RYEA 5EVIA 3BLSA 2PRFA 4RVAA 5KIZA 2G2UA 2Z6CA 4PM6A 4II7A 3V50A 1ES3A 5J3WA 3UB6A 1OTAA 2V8FA 5FL3A 2W1TB 4HBTA 5EM1A 3O3VA 3BRMA 3ISGA 1N9BA 2XSSA 3CI6A 2A3UA 3WS5A 2ZM2A 3B47A 1K6RA 3LYXA 1W63Q 1H8MA 1OJ5A 3M6BA 1D1JA 3W8KA 4PMAA 3SS4A 2B5RA 5FQJA 5F68A 1T1BA 2L0WA 1T19A 3HLDA 5CTNA 2XQZA 3F1NA 1KGGA 5FQIA 1FCOA 4DE2A 3T1SA 4BBTA 1ERMA 4PHTA 2VKSA 2KLIA 3FG8A 5CGSA 3KSHA 1HLUP 3FPVA 1DJCA 4RX3A 2EXBA 3VP3A 4NETA 2PR6A 3T4SA 4FCFA 1SDNA 3GTCA 4H6JB 3CMZA 4MBKA 2K31A 5HAIA 5F1GA 5GHZA 3A3FA 4GHIA 1XGIA 2BTFP 1XJ3A 1SKOA 1N4OA 3OC2A 1LL8A 1ZKJA 5M18A 3NCKA 1MPLA 4L9EA 3B42A 4H8RA 4FOFA 1PIOA 4OVDA 1WA9A 1EI5A 4QB8A 2OV5A 2VEAA 4MN5A 1KDWA 3MXSA 2ACGA 4X56A 3W4QA 4HH2A 4Y5FA 2XF3A 3F1OA 3WWXA 1HD8A 4U3TA 2J3TC 3BY9A 1S1ZA 3B3XA 5HL6A 1MWTA 4S2PA 1BLPA 4DE3A 4CPKA 1IYPA 4EETB 3NHQA 1FILA 1N9LA 1NZOA 4QD4A 5HD3A 3UE3A 4X25A 4BLMA 4ESPA 3ZFZA 2PYPA 3MQQA 2QPNA 5E43A 1KGEA 1JTDA 4KZ4A 3IXHA 1L0FA 1S4SA 2HF6A 1HVBA 4D2OA 3PR6A 1PFLA 4B4XA 3HLBA 3MXQA 3T12B 5CX7A 2W0NA 4E04A 5G4ZA 1G6AA 1M6KA 3WS2A 4C3QA 3MQOA 3N4IA 3BQAA 3LIBA 1OTIA 1ZG4A 4QHCA 4XUXA 3PAGA 5HSQA 4MBFA 2JBFA 2WGIA 5EPHA 5FI2A 4UA6A 3PBQA 4OLGA 4Q0JA 2M7UA 1OT6A 1MWSA 1RP5A 2IWCA 2JHEA 2XFSA 1ONHA 3F1NB 3MKFA 4IHQA 1G28A 1M40A 3O87A 1UGUA 1MC0A 3G6OA 3E4QA 2IWDA 5A91A 3NI9A 3CZDA 3QNCA 5K5BA 1LI0A 3VE3A 5F6AA 5KZHA 1K38A 4DJ2A 4OP8A 3OPPA 3DWKA 5TBMA 1EWZA 2J9PA 5EOEA 4GHIB 2V0UA 4OH0A 2ZJ9A 3MS6A 3NDGA 2WKQA 2RCXA 3ZVTA 3IBRA 2Z2MB 4WLAA 3FKVA 3LI9A 3IS2B 5FQQA 4HP4A 5HAPA 4CLCA 1J3WA 4N9KA 2GNXA 3Q7ZA 1S6RA 5E2FA 2X71A 1TS6A 1U60A 1X0OA 3C4PA 5IU1A 3F1PB 2OOLA 4X6TA 3BY8A 4ME4A 3R7WB 2PD7A 2ZQ7A 2PT7A 3LUQA 4GCZA 3U2AA 3UNWA 4I39A 3Q7VB 2Z6DA 3H9WA 2MJ6A 2BASA 2HZ5A 5E2HA 4JXGA 5A93A 4R38A 1W7FA 1DP8A 2V0WA 4GD8A 5DKKA 2VZWA 2JKRM 4FD8A 5G4YA 1LSWA 1YLPA 3Q07A 5IS1A 5DTTA 2Y55A 4R0QA 4ZJ3A 3IWOA 2H28A 2W27A 2ZQCA 4HNBA 1LL5A 3DTMA 3QNBA 4C75A 3A0SA 3S7OA 3G34A 2V1ZA 3IF6C 3FPWA 2Y2QA 4CJNA 1VETA 3DBAA 2XGNA 4R4RA 2EWVA 4KZ5A 3BWLA 5GL9A 2HV1A 3ULFA 1BLSA 4I3IA 4U0TA 5TGFA 4ZDXA 4UAAA 3IXGA 2WK0A 4S2NA 4FSFA 3MZFA 1GSVA 3KYQA 3PBRA 1NRJA 3IF6B 3B33A 3V39A 3LY4A 1CEGA 4MN7A 4EEUA 3UPOA 4A5RA 3EQVA 3PBNA 4ZRRA 3VP2A 2G7UA 4KUOA 4X68A 5HFOA 1S1YA 3MFXA 5GLBA 3FKWA 2ZLYA 4Y3IA 1LT0A 2B02A 3S22A 1IYOA 1N9OA 3QHYA 1JWPA 4B88A 3VSLA 1LL9A 2WADA 2PHYA 5CEDA 3IH9A 3QP2A 5DTSA 3DTIA 4HEFA 3UE6A 1K54A 1CI8A 2I72A 3KYEA 5HDDA 2EX2A 2OAQ1 4OP5A 1W63M 4N9LA 5CHUA 3L7HA 1GSWA 4LLOB 2QHKA 4E6XA 4LV2A 5AQ7A 3ZYTA 5FASA 2NUTC 2RL3A 3EEHA 2WAFA 1PI4A 1NZUA 3ZVWA 1N9NA 4KZBA 3ZCZA 1H8YA 4EU0A 2EX6A 1XA7A 1PZPA 2J3WA 4MLLA 1LLBA 1YLYA 3W2ZA 3HVFA 3DTEA 4QJGA 3IX4A 4M4XA 5HW3A 3GRJA 4QWOA 5TFQA 4Y17A 5IT5A 2GX5A 2OLVA 1BYWA 4S2NC 5AQ9A 1FR1A 1OTBA 2R78A 5EVEA 1H3QA 1PW8A 2V1AA 3M2JA 4B9OA 4OOLA 4UHUA 3QP1A 5EVID 2Y2JA 4L9FA 1PI5A 5HZHA 4LV1A 1G5UA 1OPXA 2O99A 3FYZA 4MN6A 5GLDA 3VMAA 2W1RA 5JYOA 3O88A 1ACFA 2VV8A 2Q9NA 1K55C 3PYPA 5FEGA 3CUEC 5EUAA 4XXRA 1PWCA 3FZCA 2V1BA 4PM8A 2H5SA 4DE0A 5EVLA 1IELA 2VGLS 3NECA 1PRQA 3M2KA 3N7WA 3N8SA 4G3VA 2VGKA 1KDSA 5EV0A 1YMSA 3M6HA 5JYPA 1BT5A 4OPYA 3NIAA 1VHMA 3TSGA 5HWVA 3SW1A 4MDZA 4GW9A 3C4OA 4EBNA 4N92A 4MEZA 5HD5A 5TJJA 4OQHA 1BLCA 1NJ4A 2XEPA 3UB5P 2FFYA 2J80A 1YSQA 2WGWA 4HBUA 3P98A 3G30A 1ERQA 5AQAA 2W3GA 1TDGA 1JNUA 2BG1A 2D01A 3GVBA 2ZOHA 4KUKA 4WEKA 1DP6A 4YOFA 4EW7A 1F5MA 1AWIA 3GMWA 3HLWA 2EX9A 4GDBA 1TS8A 5BOHA 4IBRA 1NRFA 5DF9A 3WS0A 5KSHA 2Q0OA 3QP5A 3T4LA 2Y8HA 1LI9A 4LGWA 2JE5A 2LB5A 4NXBA 2QWSA 3N8LA 5LBRA 1E3UA 1S66L 5FAQA 3AGEA 2PU2A 4ETXA 3UDXA 4WZ4A 1TEMA 4IJGA 4EUVA 1PWGA 5HPFA 3DWZA 2ZOIA 3OCLA 1KE4A 1NLZA 2FFFB 3PBTA 3OPHA 4WN5A 3VOYA 3MZDA 3UPPA 1FOFA 4JKTA 4PPRA 4IUKA 3V67A 3TOIA 1NWZA 5CHMA 4OOYA 1YM1A 4NXFA 2ZM8A 1AXBA 1S0WA 1VEUA 3WS1A 2ZL1A 1BLHA 3NBLA 4R1GA 3HUNA 2LB9A 4HOIA 4OQIA 3IBJA 4PM5A 3S7PA 1MY8A 1F9IA 2WGVA 4JBFA 4KZ9A 3UDIA 1ALQA 2V8CA 4G3KA 1W79A 4ZJ1A 3WRZA 2EWWA 1XKZA 1H8ZA 4F3LA 4K91A 4BBVA 2NUPC 3G2YA 1J9MA 1P97A 4Z1WA 3CPTA 2HDUA 2HJ9C 4NXGA 4O0PA 1EROA 4XUZA 3EGDC 4QY6A 5DTKA 4EEPA 2W3EA 1DY6A 5EECA 2HP6A 5CEBA 5EVIC 1JVJA 1V9YA 5DJTA 3BFDA 1K56A 3DAVA 4R3AA 3A3JA 2ZC5B 3IF5A 1QMEA 4IVIA 3BFGA 4Y15A 3T50A 1YLZA 4BWIA 2XDMA 2XFTA 3GSGA 4NK3A 2CC1A 5EVIB 4HH3A 3BLMA 1TS7A 3BJNA 4FH4A 2WYXA 4CLCD 2JKTI 4O01A 2ZC4B 3E4PA 1W8YA 3NULA 1E25A 3Q1FA 4BMWA 5DKLA 1XFQA 1T1AA 3T4QA 4HJ6A 4WUJA 3O5YA 4X55A 2GZAA 4X69A 2V9AA 3HUOA 1XJ6A 2VX8A 3W4PA 4FTXA 4LRXC 3KSIA 1ONGA 2PD8A 2L1MA 1XPBA 2YKFA 4DRTA 2I9VA 4WEJA 3Q81A 3BYDA 4NG2A 4N1XA 1IYQA 3D72A 4L9GA 2Q9MA 3PTEA 2DNSA 2Z2LB 1EW0A 1MKIA 3CWFA 3HREA 3UB8A 4HY8A 2AVXA 3NOTC 3SS3A 5I5LA 3MR0A 3T4OA 3ZG0A 5F69A 4P6ZS 2OWJA 3HBRA 1XX2A 4E6WA 2EFXA 3T1QB 3OPRA 1SKOB 3TG9A 3BFFA 1FR6A 3G31A 4KZAA 4F3LB 4WZ5A 3MKEA 3CPTB 3H7WA 1NYYA 2EFUA 3C7UA 2HGVA 3SZTA 5GLCA 4LV0A 2ZMAA 4I3AA 4EBLA 1E4DA 1HTZA 3T4TA 4MNRA 4OONA 1GHMA 3IXDA 4GZBA 4WMCA 1PZOA 2KOIA 3F1OB 3L9KA 2UWXA 2P08A 4KZ7A 3NDEA 4IVKA 4LRYC 3RXXA 4JF4A 4RQ9A 1IEMA 4DXBA 1BTLA 4E3NA 2EXAA 1WYBA 3IT9A 3K2NA 4WL9A 5A8BA 2PDRA 3IHBA 3MMHA 1K6SA 3LIEA 4XT2A 4R70A 4GNUA 5FAPA 5GLAA 3ZHHA 1KVMA 1VM1A 1FCNA 4GN2A 4GKUA 3E2KA 3JVUA 1DJAA 1CI9A 1W5DA 2QKPA 1SCWA 2HDRA 3QP6A 2P9VA 3QP4A 1SHVA 3IQAA 3KYZA 1YKDA 3BEBA 1FIKA 3MFDA 4P6ZM 2XROA 2J7VA 2OAP1 3OLOA 4KG2A 5F83A 3T1RA 1MWUA 4S2KA 4PKYA 3JPUA 1L0EA 1XFNA 3A3IA 4WZ5C 4JPMA 4ETZA 3D3OA 3EQUA 2K2NA 4CQHA 3MSHA 4GDNA 4CLCC 3E4OA 3G32A 2VK3A 5TBMB 3IX8A 2FH5A 2ZBBA 2CMNA 3LEQA 1KGFA 3W4OA 1L2SA 1ES2A 4ARZA 3S7NA 4L0LA 3K3DA 2D02A 2HDQA 3NC8A 2ZD8A 3E98A 1YLTA 4B93A 5EFWA 5FI7A 4LRZE 3GV9A 4NXEA 3UO9A 3CG5A 1IKIA 2OSUA 5EM0A 4CLCB 1GSXA 5HWTA 3C2WA 4DJ3A 4X1LA 4KG6A 4Z9QA 2C5WB 5CXWA 1Q2QA 3KX0X 5A90A 5HL1A 4AFIA 1RGZA 5L10A 3RTYA 3SS5A 1NLYA 2PR5A 5EOOA 3V3RA 1BZAA 3HJIA 2J9OA 3BQ8A 2Y59A 1GA0A 3AGFA 3OZHA 2FZ0A 4BJPA 5FATA 1ZHHB 2INWA 3ZG8B 3T4KA 1DJBA 1K4FA 1OJGA 3VP4A 3P09A 2W1TA 4O7DA 2O9CA 4I5SA 3G35A 5GHXA 3KSFA 3MBZA 1GCEA 1ZTUA 5L2FA 1GHPA 4KZ6A 4OPRA 2JKFA 4YFMA 2JKTM 5MC7A 3H82A 5F1FA 1VETB 1WE4A 4EQIA 4E3LA 1KE0A 3NJAA 1Z09A 3E2LA 4GS9A 3MF0A 2WUQA 4FUWA 5FQMA 3PBSA 2WKIA 1YT4A 1P9RA 3VE4A 5E2EA 3UN7A 3VV4A 4BD1A 5J4EA 2PBDP 3C8CA 1RGYA 4JGRA 1E3UD 2XR0A 3ZQ5A 1YSPA 4EUZA 2O0YA 3MJQA 2Y91A 3ZG5A 3HUMA 1K4EA 4PM9A 4M3KA 1NY0A 4H6JA 2ZM0A 1XGJA 3ZNTA 3IWIA 1MXOA 5FI6A 5KSCA 2OLUA 1I2WA 1K54C 5DFXA 2Y2IA 2M1CA 3OOVA 1SZVA 3TE8A 1STZA 2VV7A 1Z6FA 3DTKA 2EA9A 3P01A 5FDHA 4Y7PA 4HP9A 3PHYA 5CTMA 3TRCA 4EWFA 1BSGA 4X53A 1ESUA 5GHYA 1IYSA 4ID4A 1FSWA 4HI4A 3V3SA 1ES5A 1JWVA 4KZ3A 4P85A 4OQGA 4KG5A 3PXPA 4ZTKA 3RH8B 3UMEA 2IWBA 2OWHA 3GDIA 1Q2PA 1L0GA 3ZGAB 4ZJ2A 1OTDA 4PAUA 4FH2A 2E8JA 1YPRA 1BUEA 4OQ0A 5J7EA 4Y0OA 2QZ6A 5CECA 1MWRA 1VQQA 1K56D 2VV6A 1FCMA 2ZQ9A 3RXWA 3NOUC 3ITAA 5FA7A 2IA2A 1OTEA 4K08A 3LEZA 3FWLA 1PWDA 2ZMFA 2XK1A 1K57A 3A0VA 2A24A 4UEYA 3H82B 1TDLA 4E3OA 3VOLA 2VGLM 4GS9B 3VFFA 3WS4A 2A49A 3MZEA 4HQAA 3V5MA 1ODVA 3UY6A 2W3FA 4U0XA 4WM9A 3OBFA 1CEFA 4OOMA 2J8YA 1F2KA 3BECA 1GA9A 4G3WA 1D7EA 5DFYA 1SDEA 3BFCA 5AQBA 4R6LA 2QYBA 1SKFA 1H0MA 2Y2HA 2X02A 3NOPC 5AJGA 2WKPA 3LR5A 3LIAA 3LR3A 4JXWA 2Y79A 3FV7A 2VLGA 5AVFA 2XRNA 1ZC2A 2B18A 1A0KA 1YMXA 5J8XA 5HPIA 3D4FA 3IS2A 3AGDA 2P74A 3Q82A 3T1XA 3LICA 4EBPA 5A92A 5M19A 1UWPX 3MXRA 5FDSA 4DXCA 2WGWB 1K25A 3IHAA 3K3CA 1QMFA 3F1PA 2XD5A 3R7WA 1GHIA 4EV4A 3ZG7B 1ES4A 1XP4A 2XH9A 1NYMA 3S4XA 4ZAMA 3OCNA 3Q7VA 2P7JA 4KQDA 3IXBA 3IWQA 4IEDA 4KQRA 1G68A 3RJUA 5CERA 2QJ7A 1UWNX 1T18A 3JYIA 3GQZA 3HLCA 4EQ1A 4Q8IA 5F5YA 4JF6A 5FSRA 3MQ0A 3LIDA 1L3LA 5E2GA 1K57C 4UA9A 2E8IA 4JXVA 2DCFA 2W3DA 4WMCD 1O07A 2X01A 1S4RA 3UPNA 4I38A 4K0WA 1Y4OA 2B95A 3EEAA 4E3KA 4JGOA 4QU3A 4HJ4A 5U47A 3LFVA 3VOZA 4WBGA 2A24B 2R9XA 1VEUB 4E3MA 4BBUA 2ZL1B 3IH8A 5FQKA 4Q0IA 1K0KA 2ZMVA 3CLOA 4BL2A 1I5QA 2BLSA 3SH7A 2QJ5A 3IX3A 4LV3A 3IF6A 1CJFA 1TD5A 3OPLA 4LCLA 2UV0E 1LSVA 2Y2NA 3UE0A 4Y0TA 5FQ9A 4YWZA 4N1HA 3SH8A 4F94A 5EE8A 5FEFA 2WZZA 2WKRA 3G2ZA 4BQMA 1YLJA 4YNRA 1XXMA 4E3JA 4LFUA 3O86A 3LGOA 1YAXA 1TF1A 4BD0A 2DRWA 2O9BA 5HX9A 3N6IA 1LHYA 3JVVA 4DF6A 1IFQA 3TJZC 4MBHA 2M7VA 1BULA 4DDSA 4OPZA 4YINA 3UE1A 4IBXA 1YLWA 3C7VA 1KVLA 3P7NA 4E3IA 4EESA 2VA0A 3KO6A 4KQOA 2HJEA 4R3JA 1IKGA 4GB7A 2HP9A 3UB7A 2WKHA 1CF0A 4QPRA 2V20A 4JF5A 4JXSA 4BL3A 1OT9A 5CHJA 4KQQA 2WKEA 1FQGA 3UDFA 4LPZA 1IOUA 1WYCA 1DRMA 1OMEA 5DF7A 3RFBA 4P87A 3BM6A 1DP9A 2A2LA 3HLGA 5M1AA 3A0RA 4D60A 4GOGA 4EERA 2GDNA 1G6OA 1F98A 4GLQA
chains in the Genus database with same CATH topology
2JHEA 3VV4A 3F1NB 5J4EA 3UMDA 4HIAA 4IHQA 1G28A 3C8CA 4JGRA 1UGUA 2GJ3A 1MC0A 4HJ3A 3G6OA 3E4QA 3ZQ5A 1YSPA 2LB9A 4HOIA 2DMWA 3E0YA 3IBJA 2O0YA 3MJQA 4PKYG 5AVEA 3S7PA 4UQIS 1F9IA 5K5BA 1VB6A 3VE3A 4H6JA 4G3KA 5F6AA 3C38A 3UB9A 4DJ2A 2EWWA 5DFXA 5TBMA 5DJUA 2O9AA 4F3LA 2M1CA 3OOVA 2NUPC 4BBVA 3T4JA 1P9WA 1P97A 4IUHA 3TE8A 4Z1WA 4GHIB 1STZA 2V0UA 1P0ZA 3CUEA 1LSXA 2VV7A 2HJ9C 2WKQA 2XA7S 4NXGA 4O0PA 3IBRA 2EA9A 4WELA 3EGDC 3KSGA 4NEED 4WLAA 3H7WB 3P01A 3LI9A 2P04A 3IS2B 4EEPA 2W3EA 4HP4A 4HP9A 2L4RA 4CLCA 3PHYA 3CITA 2GNXA 1TS6A 3TRCA 1V9YA 1X0OA 5DJTA 5IU1A 4R3AA 3F1PB 2OOLA 1TS0A 4HI4A 3BW6A 4HHDA 3BY8A 4ME4A 3R7WB 2PD7A 2PT7A 3LUQA 1S67L 4GCZA 3T50A 3U2AA 4I39A 2Z6DA 3H9WA 4BWIA 2MJ6A 3PXPA 4DMZA 2BASA 3RH8B 3UMEA 2OWHA 3GDIA 4R38A 1MKMA 1DP8A 2V0WA 4HH3A 3TW8A 5DKKA 1OTDA 3HCYA 2VZWA 4PAUA 2JKRM 3LIFA 1TS7A 5G4YA 4Y2FA 3BJNA 4DN0A 1LSWA 5IS1A 4O8GA 4CLCD 2JKTI 4O01A 5J7EA 2JN7A 3E4PA 3GECA 3CAXA 4WF0A 4XT2B 4BMWA 3EWKA 1Y28A 5DKLA 1XFQA 4MCWA 1D06A 2VV6A 2H28A 3NOUC 1T1AA 2IA2A 2W27A 1OTEA 3T4QA 4HJ6A 4HNBA 3O5YA 4K08A 4WUJA 3LR4A 2GZAA 1KOUA 2V9AA 3A0SA 2ZMFA 3S7OA 1XJ6A 2VX8A 3A0VA 3FPWA 3EOIA 2K7SA 3DBAA 5HWWA 2A24A 2EWVA 4UEYA 4LRXC 2VJWA 3H82B 3BWLA 3KSIA 3ULFA 2HV1A 4I3IA 3VOLA 2PD8A 4UQIM 2VGLM 4I3JA 2L1MA 4GS9B 4FSFA 2YKFA 1XJ2A 2I9VA 4HQAA 5L8MA 4WEJA 1GSVA 2J3TD 3ICYA 1ODVA 3R4KA 2W3FA 3KYQA 4EXOA 3D72A 3S7QA 3PBRA 4L9GA 1NRJA 3OBFA 3B33A 4OOMA 3FC7A 1EW0A 4G3WA 4MN7A 4JGPA 3CWFA 4EEUA 1D7EA 4GJ4A 4HY8A 3UB8A 5DFYA 3NOTC 2XA7M 4R6LA 3EQVA 1XJ4A 3MR0A 3PBNA 4ZRRA 2QYBA 5I5LA 3T4OA 2G7UA 5F69A 3EGXC 4KUOA 4P6ZS 2OWJA 3NOPC 1MZUA 1S1YA 3MFXA 5AJGA 2WKPA 3LR5A 2W3HA 4Y3IA 1LT0A 3LIAA 2B02A 3LR3A 1N9OA 2KDKA 2Y79A 2VLGA 5AVFA 2PYRA 2XRNA 2B18A 5HDCA 4ARZB 4F3LB 5C5KA 2YKHA 4JGQA 2KX6A 2PHYA 1V9ZA 3H7WA 4MMNA 3PBOA 5HDSA 1T1CA 2HGVA 5HPIA 3IS2A 4NKPA 3LICA 4Q0HA 1UWPX 4I3AA 3UE6A 3T4TA 3K3CA 3F1PA 5HDDA 3LI8A 2KOIA 3F1OB 4CLCE 3R7WA 2OAQ1 1W63M 1GSWA 3OCNA 2P08A 4LLOB 2QHKA 3LR0A 2P7JA 4KQDA 2JKRI 4LRYC 3HJKA 3ZYTA 2NUTC 3EEHA 3C30A 2QJ7A 1N9NA 4EU0A 1UWNX 4RQ9A 1T18A 2J3WA 4EQ1A 5F5YA 5KIZA 3MQ0A 3K2NA 3LIDA 2Z6CA 4WL9A 5A8BA 4II7A 3W2ZA 2PDRA 3MMHA 5J3WA 3UB6A 1OTAA 5FL3A 2W1TB 3LIEA 2XSSA 2W3DA 4XT2A 4R70A 4M4XA 3CI6A 3B47A 5IT5A 1S4RA 3LYXA 1W63Q 1H8MA 2GX5A 1OJ5A 4I38A 3EEAA 1BYWA 3JVUA 4JGOA 4HJ4A 1OTBA 2QKPA 5F68A 1T1BA 2R78A 3LFVA 2L0WA 1T19A 1H3QA 2V1AA 4B9OA 4OOLA 3F1NA 4L9FA 2A24B 3KYZA 5HZHA 4BBUA 1OPXA 2O99A 1YKDA 4Q0IA 2ZMVA 4BBTA 3CLOA 4PHTA 4MN6A 2VKSA 2KLIA 2W1RA 2QJ5A 3FG8A 3KSHA 4P6ZM 2VV8A 2XROA 1TD5A 2OAP1 3PYPA 3OLOA 3CUEC 3FPVA 1LSVA 2V1BA 2PR6A 4YWZA 3T4SA 4PKYA 4H6JB 2VGLS 1XFNA 2K31A 4ETZA 3D3OA 4G3VA 3EQUA 2K2NA 4CQHA 4CLCC 3E4OA 2WKRA 4GHIA 5TBMB 4YNRA 2FH5A 1XJ3A 2ZBBA 2CMNA 1VHMA 5HWVA 3SW1A 3OC2A 1LL8A 1YAXA 4GW9A 4MDZA 1TF1A 4ARZA 3S7NA 4L0LA 3K3DA 2O9BA 2D02A 4L9EA 5HD5A 3JVVA 3B42A 5TJJA 1IFQA 4FOFA 3E98A 3TJZC 4B93A 5EFWA 2M7VA 4LRZE 1WA9A 4NXEA 2VEAA 4CLCB 4MN5A 1GSXA 5HWTA 2J80A 1YSQA 3C2WA 4HH2A 4DJ3A 2W3GA 4Y5FA 1JNUA 3F1OA 2D01A 3KX0X 2ZOHA 4KUKA 4WEKA 1DP6A 2J3TC 3BY9A 4YOFA 1S1ZA 4EW7A 5HL6A 3P7NA 1F5MA 4AFIA 3RTYA 4EESA 1NLYA 2VA0A 3KO6A 2PR5A 4EETB 1TS8A 4KQOA 3NHQA 2HJEA 3HJIA 5DF9A 1N9LA 3BQ8A 5KSHA 5HD3A 3UB7A 3UE3A 3T4LA 2PYPA 4QPRA 2Y8HA 2FZ0A 3MQQA 4BJPA 2LB5A 1S4SA 4NXBA 1OT9A 2HF6A 1ZHHB 2INWA 2QWSA 3T4KA 3PR6A 5LBRA 1OJGA 2W1TA 1S66L 3MXQA 2O9CA 4I5SA 5CX7A 4ETXA 2W0NA 4E04A 3KSFA 5G4ZA 4IJGA 4LPZA 1ZTUA 1IOUA 4EUVA 5HPFA 3MQOA 2ZOIA 3OCLA 1NLZA 3PBTA 4WN5A 1DRMA 2JKTM 5MC7A 3BQAA 3LIBA 3H82A 1OTIA 3RFBA 1DP9A 2A2LA 4IUKA 5HSQA 3V67A 1NWZA 3A0RA 3NJAA 3PBQA 4GS9A 4NXFA 4EERA 3MF0A 1G6OA 3PBSA 4Q0JA 2M7UA 1F98A 4GLQA 1P9RA 3VE4A 1OT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHE A;  3F1N B;  5J4E A;  3UMD A;  4HIA A;  1G28 A;  3C8C A;  4JGR A;  1UGU A;  2GJ3 A;  4HJ3 A;  3G6O A;  3E4Q A;  3ZQ5 A;  4HOI A;  3MJQ A;  4PKY G;  5AVE A;  1F9I A;  1VB6 A;  3VE3 A;  4H6J A;  5F6A A;  3UB9 A;  4DJ2 A;  5TBM A;  5DJU A;  4F3L A;  2M1C A;  4BBV A;  1P97 A;  4GHI B;  2V0U A;  1P0Z A;  1LSX A;  2VV7 A;  2WKQ A;  4NXG A;  3IBR A;  2EA9 A;  4WLA A;  3H7W B;  3LI9 A;  3IS2 B;  4EEP A;  4HP4 A;  4HP9 A;  2L4R A;  3PHY A;  1TS6 A;  1V9Y A;  1X0O A;  5DJT A;  5IU1 A;  4R3A A;  3F1P B;  2OOL A;  1TS0 A;  4HI4 A;  4HHD A;  3BY8 A;  2PD7 A;  3LUQ A;  1S67 L;  4GCZ A;  3T50 A;  4I39 A;  2Z6D A;  3H9W A;  2BAS A;  3RH8 B;  3UME A;  2OWH A;  3GDI A;  4R38 A;  1DP8 A;  2V0W A;  4HH3 A;  5DKK A;  1OTD A;  3LIF A;  1TS7 A;  5G4Y A;  1LSW A;  5IS1 A;  5J7E A;  2JN7 A;  3E4P A;  3GEC A;  3CAX A;  4WF0 A;  4XT2 B;  3EWK A;  1Y28 A;  5DKL A;  1XFQ A;  1D06 A;  2VV6 A;  2H28 A;  3NOU C;  1T1A A;  2W27 A;  1OTE A;  4HJ6 A;  4HNB A;  4WUJ A;  4K08 A;  1KOU A;  2V9A A;  3A0S A;  1XJ6 A;  3A0V A;  2K7S A;  5HWW A;  2A24 A;  4LRX C;  3H82 B;  3BWL A;  3ULF A;  2HV1 A;  4I3I A;  3VOL A;  2PD8 A;  4I3J A;  2L1M A;  4GS9 B;  2YKF A;  1XJ2 A;  2I9V A;  4HQA A;  1GSV A;  3ICY A;  1ODV A;  4EXO A;  3D72 A;  4L9G A;  3B33 A;  3FC7 A;  1EW0 A;  4JGP A;  3CWF A;  4EEU A;  1D7E A;  4HY8 A;  3UB8 A;  3NOT C;  4R6L A;  5I5L A;  1XJ4 A;  3MR0 A;  5F69 A;  4KUO A;  2OWJ A;  3NOP C;  1MZU A;  1S1Y A;  3MFX A;  2WKP A;  1LT0 A;  3LIA A;  2B02 A;  1N9O A;  2KDK A;  2VLG A;  5AVF A;  2PYR A;  5HDC A;  4F3L B;  2YKH A;  4JGQ A;  2KX6 A;  2PHY A;  1V9Z A;  3H7W A;  5HDS A;  1T1C A;  3IS2 A;  3LIC A;  1UWP X;  4I3A A;  3UE6 A;  3K3C A;  3F1P A;  5HDD A;  3LI8 A;  3F1O B;  1GSW A;  4LLO B;  2QHK A;  2P7J A;  4KQD A;  4LRY C;  3HJK A;  3EEH A;  2QJ7 A;  1N9N A;  1UWN X;  4RQ9 A;  1T18 A;  4EQ1 A;  5F5Y A;  5KIZ A;  3LID A;  2Z6C A;  4WL9 A;  5A8B A;  2PDR A;  5J3W A;  3UB6 A;  1OTA A;  3LIE A;  4XT2 A;  4R70 A;  4M4X A;  1S4R A;  3LYX A;  4I38 A;  1OJ5 A;  1BYW A;  4JGO A;  4HJ4 A;  1OTB A;  2QKP A;  5F68 A;  1T1B A;  2R78 A;  2L0W A;  1T19 A;  2V1A A;  4B9O A;  3F1N A;  4L9F A;  2A24 B;  5HZH A;  4BBU A;  4BBT A;  3CLO A;  4MN6 A;  2QJ5 A;  3FG8 A;  2VV8 A;  3PYP A;  3OLO A;  1LSV A;  2V1B A;  2PR6 A;  4YWZ A;  4PKY A;  4H6J B;  1XFN A;  3E4O A;  2WKR A;  4GHI A;  5TBM B;  1XJ3 A;  2ZBB A;  2CMN A;  5HWV A;  3SW1 A;  1LL8 A;  4GW9 A;  3K3D A;  2D02 A;  4L9E A;  5HD5 A;  5EFW A;  4LRZ E;  1WA9 A;  4NXE A;  2VEA A;  4MN5 A;  1GSX A;  5HWT A;  2J80 A;  3C2W A;  4HH2 A;  4DJ3 A;  1JNU A;  3F1O A;  2D01 A;  3KX0 X;  2ZOH A;  4KUK A;  1DP6 A;  3BY9 A;  1S1Z A;  4EW7 A;  3P7N A;  3RTY A;  4EES A;  2PR5 A;  4EET B;  1TS8 A;  3NHQ A;  3HJI A;  1N9L A;  5HD3 A;  3UB7 A;  2PYP A;  3MQQ A;  1S4S A;  4NXB A;  1OT9 A;  2INW A;  2QWS A;  1OJG A;  1S66 L;  3MXQ A;  4I5S A;  2W0N A;  4E04 A;  5G4Z A;  4LPZ A;  3MQO A;  2ZOI A;  4WN5 A;  1DRM A;  3LIB A;  3H82 A;  1OTI A;  1DP9 A;  5HSQ A;  1NWZ A;  3A0R A;  3NJA A;  4GS9 A;  4NXF A;  4EER A;  1F98 A;  3VE4 A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 2ZQD A;  4RA7 A;  4KZ8 A;  3UMD A;  2WZX A;  4HIA A;  2GJ3 A;  4HJ3 A;  2R9W A;  2DMW A;  3E0Y A;  4QY5 A;  4S2L A;  4KEN B;  4PKY G;  5AVE A;  4UQI S;  2VGJ A;  4BEN A;  3NY4 A;  1VB6 A;  2PAV P;  2HDS A;  3C38 A;  3UB9 A;  4PM7 A;  3SOI A;  3A3D A;  2Y2G A;  1Y54 A;  4LCM A;  1PYY A;  2Y4A A;  5DJU A;  2O9A A;  2WAE A;  3LCE A;  5TR7 A;  3SH9 A;  3N8R A;  3VP1 A;  4S2J A;  3T4J A;  3A3E A;  4B4Z A;  1P9W A;  4IUH A;  1K55 A;  1P0Z A;  4JLF A;  3CUE A;  1LSX A;  2XA7 S;  3CJM A;  4OLD A;  1KE3 A;  4WEL A;  3KSG A;  4HES A;  4NEE D;  2EX8 A;  3H7W B;  1PW1 A;  3ITB A;  4RX2 A;  5L07 A;  2P04 A;  4OPQ A;  3S1Y A;  2Y2O A;  1XA1 A;  4Y0U A;  2L4R A;  3CIT A;  1NXY A;  2H10 A;  1HZO A;  1TS0 A;  3BW6 A;  4HHD A;  1JWZ A;  1S67 L;  2ZC6 B;  5CGW A;  3VP0 A;  5I94 A;  4K0X A;  4DMZ A;  5CGX A;  3G4P A;  4DDY A;  4S2O A;  3PAE A;  1MKM A;  3TW8 A;  3HCY A;  1C3B A;  3HLE A;  3LIF A;  5L09 A;  3GR2 A;  4C6Y A;  4Y2F A;  4DN0 A;  1L0D A;  1RCJ A;  4O8G A;  1FSY A;  2JN7 A;  3GEC A;  3CAX A;  4WF0 A;  2JKG A;  4XT2 B;  3EWK A;  1Y28 A;  4MCW A;  5KMW A;  1D06 A;  2HP5 A;  4R4S A;  1JTG A;  5F82 A;  4R23 A;  2JC7 A;  3LR4 A;  1KOU A;  3ZG9 B;  1TVF A;  5IHV A;  2Y2M A;  3BFE A;  3EOI A;  2K7S A;  5DVA A;  3C5A A;  5HWW A;  3I7J A;  2VJW A;  5FAO A;  2P9V B;  1ZG6 A;  5HAQ A;  1I2S A;  4ZBE A;  4OKP A;  4R3B A;  4UQI M;  2Y2P A;  4I3J A;  1MBL A;  1XJ2 A;  2PBY A;  5L8M A;  1W8Q A;  2J3T D;  3ICY A;  3ZNY A;  3R4K A;  2Y2L A;  4EXO A;  3S7Q A;  3ZDJ A;  4UA7 A;  4DKI A;  1ESI A;  3QP8 A;  3HL9 A;  3FC7 A;  2ZC7 A;  3LO7 A;  4P6B A;  1YQS A;  4JGP A;  4GJ4 A;  1PNE A;  2XA7 M;  4LEN A;  1XJ4 A;  3D9Y A;  2XLN A;  2V2F F;  2PU4 A;  3EGX C;  5D3O A;  3U4L P;  4WYY A;  1MZU A;  2XD1 A;  3HLF A;  2W3H A;  2G2W A;  5HAR A;  2KDK A;  2PYR A;  5HDC A;  4ARZ B;  3VFH A;  5C5K A;  2YKH A;  4JGQ A;  3WRT A;  2ZQA A;  5G18 A;  4DE1 A;  2KX6 A;  2ZC3 B;  2H0Y A;  1V9Z A;  2HPB A;  3CHW P;  4MMN A;  3PBO A;  4S2M A;  2Y2K A;  1T1C A;  5HDS A;  4NKP A;  1CQA A;  4Q0H A;  2H0T A;  4Y13 A;  2JCH A;  5CRF A;  4P0M A;  2C6W B;  3VSK A;  5DF8 A;  3LI8 A;  1O7E A;  4CLC E;  1CK3 A;  1H5X A;  2ZQ8 A;  3LR0 A;  2JKR I;  3HJK A;  3LY3 A;  3C30 A;  3DW0 A;  4S2I A;  4X1M A;  2QMI A;  4GD6 A;  4RYE A;  5EVI A;  3BLS A;  2PRF A;  4RVA A;  5KIZ A;  2G2U A;  2Z6C A;  4PM6 A;  4II7 A;  3V50 A;  1ES3 A;  5J3W A;  3UB6 A;  1OTA A;  2V8F A;  5FL3 A;  2W1T B;  4HBT A;  5EM1 A;  3O3V A;  3BRM A;  3ISG A;  1N9B A;  2XSS A;  3CI6 A;  2A3U A;  3WS5 A;  2ZM2 A;  3B47 A;  1K6R A;  3LYX A;  1W63 Q;  1H8M A;  1OJ5 A;  3M6B A;  1D1J A;  3W8K A;  4PMA A;  3SS4 A;  2B5R A;  5FQJ A;  5F68 A;  1T1B A;  2L0W A;  1T19 A;  3HLD A;  5CTN A;  2XQZ A;  3F1N A;  1KGG A;  5FQI A;  1FCO A;  4DE2 A;  3T1S A;  4BBT A;  1ERM A;  4PHT A;  2VKS A;  2KLI A;  3FG8 A;  5CGS A;  3KSH A;  1HLU P;  3FPV A;  1DJC A;  4RX3 A;  2EXB A;  3VP3 A;  4NET A;  2PR6 A;  3T4S A;  4FCF A;  1SDN A;  3GTC A;  4H6J B;  3CMZ A;  4MBK A;  2K31 A;  5HAI A;  5F1G A;  5GHZ A;  3A3F A;  4GHI A;  1XGI A;  2BTF P;  1XJ3 A;  1SKO A;  1N4O A;  3OC2 A;  1LL8 A;  1ZKJ A;  5M18 A;  3NCK A;  1MPL A;  4L9E A;  3B42 A;  4H8R A;  4FOF A;  1PIO A;  4OVD A;  1WA9 A;  1EI5 A;  4QB8 A;  2OV5 A;  2VEA A;  4MN5 A;  1KDW A;  3MXS A;  2ACG A;  4X56 A;  3W4Q A;  4HH2 A;  4Y5F A;  2XF3 A;  3F1O A;  3WWX A;  1HD8 A;  4U3T A;  2J3T C;  3BY9 A;  1S1Z A;  3B3X A;  5HL6 A;  1MWT A;  4S2P A;  1BLP A;  4DE3 A;  4CPK A;  1IYP A;  4EET B;  3NHQ A;  1FIL A;  1N9L A;  1NZO A;  4QD4 A;  5HD3 A;  3UE3 A;  4X25 A;  4BLM A;  4ESP A;  3ZFZ A;  2PYP A;  3MQQ A;  2QPN A;  5E43 A;  1KGE A;  1JTD A;  4KZ4 A;  3IXH A;  1L0F A;  1S4S A;  2HF6 A;  1HVB A;  4D2O A;  3PR6 A;  1PFL A;  4B4X A;  3HLB A;  3MXQ A;  3T12 B;  5CX7 A;  2W0N A;  4E04 A;  5G4Z A;  1G6A A;  1M6K A;  3WS2 A;  4C3Q A;  3MQO A;  3N4I A;  3BQA A;  3LIB A;  1OTI A;  1ZG4 A;  4QHC A;  4XUX A;  3PAG A;  5HSQ A;  4MBF A;  2JBF A;  2WGI A;  5EPH A;  5FI2 A;  4UA6 A;  3PBQ A;  4OLG A;  4Q0J A;  2M7U A;  1OT6 A;  1MWS A;  1RP5 A;  2IWC A;  2JHE A;  2XFS A;  1ONH A;  3F1N B;  3MKF A;  4IHQ A;  1G28 A;  1M40 A;  3O87 A;  1UGU A;  1MC0 A;  3G6O A;  3E4Q A;  2IWD A;  5A91 A;  3NI9 A;  3CZD A;  3QNC A;  5K5B A;  1LI0 A;  3VE3 A;  5F6A A;  5KZH A;  1K38 A;  4DJ2 A;  4OP8 A;  3OPP A;  3DWK A;  5TBM A;  1EWZ A;  2J9P A;  5EOE A;  4GHI B;  2V0U A;  4OH0 A;  2ZJ9 A;  3MS6 A;  3NDG A;  2WKQ A;  2RCX A;  3ZVT A;  3IBR A;  2Z2M B;  4WLA A;  3FKV A;  3LI9 A;  3IS2 B;  5FQQ A;  4HP4 A;  5HAP A;  4CLC A;  1J3W A;  4N9K A;  2GNX A;  3Q7Z A;  1S6R A;  5E2F A;  2X71 A;  1TS6 A;  1U60 A;  1X0O A;  3C4P A;  5IU1 A;  3F1P B;  2OOL A;  4X6T A;  3BY8 A;  4ME4 A;  3R7W B;  2PD7 A;  2ZQ7 A;  2PT7 A;  3LUQ A;  4GCZ A;  3U2A A;  3UNW A;  4I39 A;  3Q7V B;  2Z6D A;  3H9W A;  2MJ6 A;  2BAS A;  2HZ5 A;  5E2H A;  4JXG A;  5A93 A;  4R38 A;  1W7F A;  1DP8 A;  2V0W A;  4GD8 A;  5DKK A;  2VZW A;  2JKR M;  4FD8 A;  5G4Y A;  1LSW A;  1YLP A;  3Q07 A;  5IS1 A;  5DTT A;  2Y55 A;  4R0Q A;  4ZJ3 A;  3IWO A;  2H28 A;  2W27 A;  2ZQC A;  4HNB A;  1LL5 A;  3DTM A;  3QNB A;  4C75 A;  3A0S A;  3S7O A;  3G34 A;  2V1Z A;  3IF6 C;  3FPW A;  2Y2Q A;  4CJN A;  1VET A;  3DBA A;  2XGN A;  4R4R A;  2EWV A;  4KZ5 A;  3BWL A;  5GL9 A;  2HV1 A;  3ULF A;  1BLS A;  4I3I A;  4U0T A;  5TGF A;  4ZDX A;  4UAA A;  3IXG A;  2WK0 A;  4S2N A;  4FSF A;  3MZF A;  1GSV A;  3KYQ A;  3PBR A;  1NRJ A;  3IF6 B;  3B33 A;  3V39 A;  3LY4 A;  1CEG A;  4MN7 A;  4EEU A;  3UPO A;  4A5R A;  3EQV A;  3PBN A;  4ZRR A;  3VP2 A;  2G7U A;  4KUO A;  4X68 A;  5HFO A;  1S1Y A;  3MFX A;  5GLB A;  3FKW A;  2ZLY A;  4Y3I A;  1LT0 A;  2B02 A;  3S22 A;  1IYO A;  1N9O A;  3QHY A;  1JWP A;  4B88 A;  3VSL A;  1LL9 A;  2WAD A;  2PHY A;  5CED A;  3IH9 A;  3QP2 A;  5DTS A;  3DTI A;  4HEF A;  3UE6 A;  1K54 A;  1CI8 A;  2I72 A;  3KYE A;  5HDD A;  2EX2 A;  2OAQ 1;  4OP5 A;  1W63 M;  4N9L A;  5CHU A;  3L7H A;  1GSW A;  4LLO B;  2QHK A;  4E6X A;  4LV2 A;  5AQ7 A;  3ZYT A;  5FAS A;  2NUT C;  2RL3 A;  3EEH A;  2WAF A;  1PI4 A;  1NZU A;  3ZVW A;  1N9N A;  4KZB A;  3ZCZ A;  1H8Y A;  4EU0 A;  2EX6 A;  1XA7 A;  1PZP A;  2J3W A;  4MLL A;  1LLB A;  1YLY A;  3W2Z A;  3HVF A;  3DTE A;  4QJG A;  3IX4 A;  4M4X A;  5HW3 A;  3GRJ A;  4QWO A;  5TFQ A;  4Y17 A;  5IT5 A;  2GX5 A;  2OLV A;  1BYW A;  4S2N C;  5AQ9 A;  1FR1 A;  1OTB A;  2R78 A;  5EVE A;  1H3Q A;  1PW8 A;  2V1A A;  3M2J A;  4B9O A;  4OOL A;  4UHU A;  3QP1 A;  5EVI D;  2Y2J A;  4L9F A;  1PI5 A;  5HZH A;  4LV1 A;  1G5U A;  1OPX A;  2O99 A;  3FYZ A;  4MN6 A;  5GLD A;  3VMA A;  2W1R A;  5JYO A;  3O88 A;  1ACF A;  2VV8 A;  2Q9N A;  1K55 C;  3PYP A;  5FEG A;  3CUE C;  5EUA A;  4XXR A;  1PWC A;  3FZC A;  2V1B A;  4PM8 A;  2H5S A;  4DE0 A;  5EVL A;  1IEL A;  2VGL S;  3NEC A;  1PRQ A;  3M2K A;  3N7W A;  3N8S A;  4G3V A;  2VGK A;  1KDS A;  5EV0 A;  1YMS A;  3M6H A;  5JYP A;  1BT5 A;  4OPY A;  3NIA A;  1VHM A;  3TSG A;  5HWV A;  3SW1 A;  4MDZ A;  4GW9 A;  3C4O A;  4EBN A;  4N92 A;  4MEZ A;  5HD5 A;  5TJJ A;  4OQH A;  1BLC A;  1NJ4 A;  2XEP A;  3UB5 P;  2FFY A;  2J80 A;  1YSQ A;  2WGW A;  4HBU A;  3P98 A;  3G30 A;  1ERQ A;  5AQA A;  2W3G A;  1TDG A;  1JNU A;  2BG1 A;  2D01 A;  3GVB A;  2ZOH A;  4KUK A;  4WEK A;  1DP6 A;  4YOF A;  4EW7 A;  1F5M A;  1AWI A;  3GMW A;  3HLW A;  2EX9 A;  4GDB A;  1TS8 A;  5BOH A;  4IBR A;  1NRF A;  5DF9 A;  3WS0 A;  5KSH A;  2Q0O A;  3QP5 A;  3T4L A;  2Y8H A;  1LI9 A;  4LGW A;  2JE5 A;  2LB5 A;  4NXB A;  2QWS A;  3N8L A;  5LBR A;  1E3U A;  1S66 L;  5FAQ A;  3AGE A;  2PU2 A;  4ETX A;  3UDX A;  4WZ4 A;  1TEM A;  4IJG A;  4EUV A;  1PWG A;  5HPF A;  3DWZ A;  2ZOI A;  3OCL A;  1KE4 A;  1NLZ A;  2FFF B;  3PBT A;  3OPH A;  4WN5 A;  3VOY A;  3MZD A;  3UPP A;  1FOF A;  4JKT A;  4PPR A;  4IUK A;  3V67 A;  3TOI A;  1NWZ A;  5CHM A;  4OOY A;  1YM1 A;  4NXF A;  2ZM8 A;  1AXB A;  1S0W A;  1VEU A;  3WS1 A;  2ZL1 A;  1BLH A;  3NBL A;  4R1G A;  3HUN A;  2LB9 A;  4HOI A;  4OQI A;  3IBJ A;  4PM5 A;  3S7P A;  1MY8 A;  1F9I A;  2WGV A;  4JBF A;  4KZ9 A;  3UDI A;  1ALQ A;  2V8C A;  4G3K A;  1W79 A;  4ZJ1 A;  3WRZ A;  2EWW A;  1XKZ A;  1H8Z A;  4F3L A;  4K91 A;  4BBV A;  2NUP C;  3G2Y A;  1J9M A;  1P97 A;  4Z1W A;  3CPT A;  2HDU A;  2HJ9 C;  4NXG A;  4O0P A;  1ERO A;  4XUZ A;  3EGD C;  4QY6 A;  5DTK A;  4EEP A;  2W3E A;  1DY6 A;  5EEC A;  2HP6 A;  5CEB A;  5EVI C;  1JVJ A;  1V9Y A;  5DJT A;  3BFD A;  1K56 A;  3DAV A;  4R3A A;  3A3J A;  2ZC5 B;  3IF5 A;  1QME A;  4IVI A;  3BFG A;  4Y15 A;  3T50 A;  1YLZ A;  4BWI A;  2XDM A;  2XFT A;  3GSG A;  4NK3 A;  2CC1 A;  5EVI B;  4HH3 A;  3BLM A;  1TS7 A;  3BJN A;  4FH4 A;  2WYX A;  4CLC D;  2JKT I;  4O01 A;  2ZC4 B;  3E4P A;  1W8Y A;  3NUL A;  1E25 A;  3Q1F A;  4BMW A;  5DKL A;  1XFQ A;  1T1A A;  3T4Q A;  4HJ6 A;  4WUJ A;  3O5Y A;  4X55 A;  2GZA A;  4X69 A;  2V9A A;  3HUO A;  1XJ6 A;  2VX8 A;  3W4P A;  4FTX A;  4LRX C;  3KSI A;  1ONG A;  2PD8 A;  2L1M A;  1XPB A;  2YKF A;  4DRT A;  2I9V A;  4WEJ A;  3Q81 A;  3BYD A;  4NG2 A;  4N1X A;  1IYQ A;  3D72 A;  4L9G A;  2Q9M A;  3PTE A;  2DNS A;  2Z2L B;  1EW0 A;  1MKI A;  3CWF A;  3HRE A;  3UB8 A;  4HY8 A;  2AVX A;  3NOT C;  3SS3 A;  5I5L A;  3MR0 A;  3T4O A;  3ZG0 A;  5F69 A;  4P6Z S;  2OWJ A;  3HBR A;  1XX2 A;  4E6W A;  2EFX A;  3T1Q B;  3OPR A;  1SKO B;  3TG9 A;  3BFF A;  1FR6 A;  3G31 A;  4KZA A;  4F3L B;  4WZ5 A;  3MKE A;  3CPT B;  3H7W A;  1NYY A;  2EFU A;  3C7U A;  2HGV A;  3SZT A;  5GLC A;  4LV0 A;  2ZMA A;  4I3A A;  4EBL A;  1E4D A;  1HTZ A;  3T4T A;  4MNR A;  4OON A;  1GHM A;  3IXD A;  4GZB A;  4WMC A;  1PZO A;  2KOI A;  3F1O B;  3L9K A;  2UWX A;  2P08 A;  4KZ7 A;  3NDE A;  4IVK A;  4LRY C;  3RXX A;  4JF4 A;  4RQ9 A;  1IEM A;  4DXB A;  1BTL A;  4E3N A;  2EXA A;  1WYB A;  3IT9 A;  3K2N A;  4WL9 A;  5A8B A;  2PDR A;  3IHB A;  3MMH A;  1K6S A;  3LIE A;  4XT2 A;  4R70 A;  4GNU A;  5FAP A;  5GLA A;  3ZHH A;  1KVM A;  1VM1 A;  1FCN A;  4GN2 A;  4GKU A;  3E2K A;  3JVU A;  1DJA A;  1CI9 A;  1W5D A;  2QKP A;  1SCW A;  2HDR A;  3QP6 A;  2P9V A;  3QP4 A;  1SHV A;  3IQA A;  3KYZ A;  1YKD A;  3BEB A;  1FIK A;  3MFD A;  4P6Z M;  2XRO A;  2J7V A;  2OAP 1;  3OLO A;  4KG2 A;  5F83 A;  3T1R A;  1MWU A;  4S2K A;  4PKY A;  3JPU A;  1L0E A;  1XFN A;  3A3I A;  4WZ5 C;  4JPM A;  4ETZ A;  3D3O A;  3EQU A;  2K2N A;  4CQH A;  3MSH A;  4GDN A;  4CLC C;  3E4O A;  3G32 A;  2VK3 A;  5TBM B;  3IX8 A;  2FH5 A;  2ZBB A;  2CMN A;  3LEQ A;  1KGF A;  3W4O A;  1L2S A;  1ES2 A;  4ARZ A;  3S7N A;  4L0L A;  3K3D A;  2D02 A;  2HDQ A;  3NC8 A;  2ZD8 A;  3E98 A;  1YLT A;  4B93 A;  5EFW A;  5FI7 A;  4LRZ E;  3GV9 A;  4NXE A;  3UO9 A;  3CG5 A;  1IKI A;  2OSU A;  5EM0 A;  4CLC B;  1GSX A;  5HWT A;  3C2W A;  4DJ3 A;  4X1L A;  4KG6 A;  4Z9Q A;  2C5W B;  5CXW A;  1Q2Q A;  3KX0 X;  5A90 A;  5HL1 A;  4AFI A;  1RGZ A;  5L10 A;  3RTY A;  3SS5 A;  1NLY A;  2PR5 A;  5EOO A;  3V3R A;  1BZA A;  3HJI A;  2J9O A;  3BQ8 A;  2Y59 A;  1GA0 A;  3AGF A;  3OZH A;  2FZ0 A;  4BJP A;  5FAT A;  1ZHH B;  2INW A;  3ZG8 B;  3T4K A;  1DJB A;  1K4F A;  1OJG A;  3VP4 A;  3P09 A;  2W1T A;  4O7D A;  2O9C A;  4I5S A;  3G35 A;  5GHX A;  3KSF A;  3MBZ A;  1GCE A;  1ZTU A;  5L2F A;  1GHP A;  4KZ6 A;  4OPR A;  2JKF A;  4YFM A;  2JKT M;  5MC7 A;  3H82 A;  5F1F A;  1VET B;  1WE4 A;  4EQI A;  4E3L A;  1KE0 A;  3NJA A;  1Z09 A;  3E2L A;  4GS9 A;  3MF0 A;  2WUQ A;  4FUW A;  5FQM A;  3PBS A;  2WKI A;  1YT4 A;  1P9R A;  3VE4 A;  5E2E A;  3UN7 A;  3VV4 A;  4BD1 A;  5J4E A;  2PBD P;  3C8C A;  1RGY A;  4JGR A;  1E3U D;  2XR0 A;  3ZQ5 A;  1YSP A;  4EUZ A;  2O0Y A;  3MJQ A;  2Y91 A;  3ZG5 A;  3HUM A;  1K4E A;  4PM9 A;  4M3K A;  1NY0 A;  4H6J A;  2ZM0 A;  1XGJ A;  3ZNT A;  3IWI A;  1MXO A;  5FI6 A;  5KSC A;  2OLU A;  1I2W A;  1K54 C;  5DFX A;  2Y2I A;  2M1C A;  3OOV A;  1SZV A;  3TE8 A;  1STZ A;  2VV7 A;  1Z6F A;  3DTK A;  2EA9 A;  3P01 A;  5FDH A;  4Y7P A;  4HP9 A;  3PHY A;  5CTM A;  3TRC A;  4EWF A;  1BSG A;  4X53 A;  1ESU A;  5GHY A;  1IYS A;  4ID4 A;  1FSW A;  4HI4 A;  3V3S A;  1ES5 A;  1JWV A;  4KZ3 A;  4P85 A;  4OQG A;  4KG5 A;  3PXP A;  4ZTK A;  3RH8 B;  3UME A;  2IWB A;  2OWH A;  3GDI A;  1Q2P A;  1L0G A;  3ZGA B;  4ZJ2 A;  1OTD A;  4PAU A;  4FH2 A;  2E8J A;  1YPR A;  1BUE A;  4OQ0 A;  5J7E A;  4Y0O A;  2QZ6 A;  5CEC A;  1MWR A;  1VQQ A;  1K56 D;  2VV6 A;  1FCM A;  2ZQ9 A;  3RXW A;  3NOU C;  3ITA A;  5FA7 A;  2IA2 A;  1OTE A;  4K08 A;  3LEZ A;  3FWL A;  1PWD A;  2ZMF A;  2XK1 A;  1K57 A;  3A0V A;  2A24 A;  4UEY A;  3H82 B;  1TDL A;  4E3O A;  3VOL A;  2VGL M;  4GS9 B;  3VFF A;  3WS4 A;  2A49 A;  3MZE A;  4HQA A;  3V5M A;  1ODV A;  3UY6 A;  2W3F A;  4U0X A;  4WM9 A;  3OBF A;  1CEF A;  4OOM A;  2J8Y A;  1F2K A;  3BEC A;  1GA9 A;  4G3W A;  1D7E A;  5DFY A;  1SDE A;  3BFC A;  5AQB A;  4R6L A;  2QYB A;  1SKF A;  1H0M A;  2Y2H A;  2X02 A;  3NOP C;  5AJG A;  2WKP A;  3LR5 A;  3LIA A;  3LR3 A;  4JXW A;  2Y79 A;  3FV7 A;  2VLG A;  5AVF A;  2XRN A;  1ZC2 A;  2B18 A;  1A0K A;  1YMX A;  5J8X A;  5HPI A;  3D4F A;  3IS2 A;  3AGD A;  2P74 A;  3Q82 A;  3T1X A;  3LIC A;  4EBP A;  5A92 A;  5M19 A;  1UWP X;  3MXR A;  5FDS A;  4DXC A;  2WGW B;  1K25 A;  3IHA A;  3K3C A;  1QMF A;  3F1P A;  2XD5 A;  3R7W A;  1GHI A;  4EV4 A;  3ZG7 B;  1ES4 A;  1XP4 A;  2XH9 A;  1NYM A;  3S4X A;  4ZAM A;  3OCN A;  3Q7V A;  2P7J A;  4KQD A;  3IXB A;  3IWQ A;  4IED A;  4KQR A;  1G68 A;  3RJU A;  5CER A;  2QJ7 A;  1UWN X;  1T18 A;  3JYI A;  3GQZ A;  3HLC A;  4EQ1 A;  4Q8I A;  5F5Y A;  4JF6 A;  5FSR A;  3MQ0 A;  3LID A;  1L3L A;  5E2G A;  1K57 C;  4UA9 A;  2E8I A;  4JXV A;  2DCF A;  2W3D A;  4WMC D;  1O07 A;  2X01 A;  1S4R A;  3UPN A;  4I38 A;  4K0W A;  1Y4O A;  2B95 A;  3EEA A;  4E3K A;  4JGO A;  4QU3 A;  4HJ4 A;  5U47 A;  3LFV A;  3VOZ A;  4WBG A;  2A24 B;  2R9X A;  1VEU B;  4E3M A;  4BBU A;  2ZL1 B;  3IH8 A;  5FQK A;  4Q0I A;  1K0K A;  2ZMV A;  3CLO A;  4BL2 A;  1I5Q A;  2BLS A;  3SH7 A;  2QJ5 A;  3IX3 A;  4LV3 A;  3IF6 A;  1CJF A;  1TD5 A;  3OPL A;  4LCL A;  2UV0 E;  1LSV A;  2Y2N A;  3UE0 A;  4Y0T A;  5FQ9 A;  4YWZ A;  4N1H A;  3SH8 A;  4F94 A;  5EE8 A;  5FEF A;  2WZZ A;  2WKR A;  3G2Z A;  4BQM A;  1YLJ A;  4YNR A;  1XXM A;  4E3J A;  4LFU A;  3O86 A;  3LGO A;  1YAX A;  1TF1 A;  4BD0 A;  2DRW A;  2O9B A;  5HX9 A;  3N6I A;  1LHY A;  3JVV A;  4DF6 A;  1IFQ A;  3TJZ C;  4MBH A;  2M7V A;  1BUL A;  4DDS A;  4OPZ A;  4YIN A;  3UE1 A;  4IBX A;  1YLW A;  3C7V A;  1KVL A;  3P7N A;  4E3I A;  4EES A;  2VA0 A;  3KO6 A;  4KQO A;  2HJE A;  4R3J A;  1IKG A;  4GB7 A;  2HP9 A;  3UB7 A;  2WKH A;  1CF0 A;  4QPR A;  2V20 A;  4JF5 A;  4JXS A;  4BL3 A;  1OT9 A;  5CHJ A;  4KQQ A;  2WKE A;  1FQG A;  3UDF A;  4LPZ A;  1IOU A;  1WYC A;  1DRM A;  1OME A;  5DF7 A;  3RFB A;  4P87 A;  3BM6 A;  1DP9 A;  2A2L A;  3HLG A;  5M1A A;  3A0R A;  4D60 A;  4GOG A;  4EER A;  2GDN A;  1G6O A;  1F98 A;  4GLQ A; 
#chains in the Genus database with same CATH homology
 2JHE A;  3VV4 A;  3F1N B;  5J4E A;  3UMD A;  4HIA A;  4IHQ A;  1G28 A;  3C8C A;  4JGR A;  1UGU A;  2GJ3 A;  1MC0 A;  4HJ3 A;  3G6O A;  3E4Q A;  3ZQ5 A;  1YSP A;  2LB9 A;  4HOI A;  2DMW A;  3E0Y A;  3IBJ A;  2O0Y A;  3MJQ A;  4PKY G;  5AVE A;  3S7P A;  4UQI S;  1F9I A;  5K5B A;  1VB6 A;  3VE3 A;  4H6J A;  4G3K A;  5F6A A;  3C38 A;  3UB9 A;  4DJ2 A;  2EWW A;  5DFX A;  5TBM A;  5DJU A;  2O9A A;  4F3L A;  2M1C A;  3OOV A;  2NUP C;  4BBV A;  3T4J A;  1P9W A;  1P97 A;  4IUH A;  3TE8 A;  4Z1W A;  4GHI B;  1STZ A;  2V0U A;  1P0Z A;  3CUE A;  1LSX A;  2VV7 A;  2HJ9 C;  2WKQ A;  2XA7 S;  4NXG A;  4O0P A;  3IBR A;  2EA9 A;  4WEL A;  3EGD C;  3KSG A;  4NEE D;  4WLA A;  3H7W B;  3P01 A;  3LI9 A;  2P04 A;  3IS2 B;  4EEP A;  2W3E A;  4HP4 A;  4HP9 A;  2L4R A;  4CLC A;  3PHY A;  3CIT A;  2GNX A;  1TS6 A;  3TRC A;  1V9Y A;  1X0O A;  5DJT A;  5IU1 A;  4R3A A;  3F1P B;  2OOL A;  1TS0 A;  4HI4 A;  3BW6 A;  4HHD A;  3BY8 A;  4ME4 A;  3R7W B;  2PD7 A;  2PT7 A;  3LUQ A;  1S67 L;  4GCZ A;  3T50 A;  3U2A A;  4I39 A;  2Z6D A;  3H9W A;  4BWI A;  2MJ6 A;  3PXP A;  4DMZ A;  2BAS A;  3RH8 B;  3UME A;  2OWH A;  3GDI A;  4R38 A;  1MKM A;  1DP8 A;  2V0W A;  4HH3 A;  3TW8 A;  5DKK A;  1OTD A;  3HCY A;  2VZW A;  4PAU A;  2JKR M;  3LIF A;  1TS7 A;  5G4Y A;  4Y2F A;  3BJN A;  4DN0 A;  1LSW A;  5IS1 A;  4O8G A;  4CLC D;  2JKT I;  4O01 A;  5J7E A;  2JN7 A;  3E4P A;  3GEC A;  3CAX A;  4WF0 A;  4XT2 B;  4BMW A;  3EWK A;  1Y28 A;  5DKL A;  1XFQ A;  4MCW A;  1D06 A;  2VV6 A;  2H28 A;  3NOU C;  1T1A A;  2IA2 A;  2W27 A;  1OTE A;  3T4Q A;  4HJ6 A;  4HNB A;  3O5Y A;  4K08 A;  4WUJ A;  3LR4 A;  2GZA A;  1KOU A;  2V9A A;  3A0S A;  2ZMF A;  3S7O A;  1XJ6 A;  2VX8 A;  3A0V A;  3FPW A;  3EOI A;  2K7S A;  3DBA A;  5HWW A;  2A24 A;  2EWV A;  4UEY A;  4LRX C;  2VJW A;  3H82 B;  3BWL A;  3KSI A;  3ULF A;  2HV1 A;  4I3I A;  3VOL A;  2PD8 A;  4UQI M;  2VGL M;  4I3J A;  2L1M A;  4GS9 B;  4FSF A;  2YKF A;  1XJ2 A;  2I9V A;  4HQA A;  5L8M A;  4WEJ A;  1GSV A;  2J3T D;  3ICY A;  1ODV A;  3R4K A;  2W3F A;  3KYQ A;  4EXO A;  3D72 A;  3S7Q A;  3PBR A;  4L9G A;  1NRJ A;  3OBF A;  3B33 A;  4OOM A;  3FC7 A;  1EW0 A;  4G3W A;  4MN7 A;  4JGP A;  3CWF A;  4EEU A;  1D7E A;  4GJ4 A;  4HY8 A;  3UB8 A;  5DFY A;  3NOT C;  2XA7 M;  4R6L A;  3EQV A;  1XJ4 A;  3MR0 A;  3PBN A;  4ZRR A;  2QYB A;  5I5L A;  3T4O A;  2G7U A;  5F69 A;  3EGX C;  4KUO A;  4P6Z S;  2OWJ A;  3NOP C;  1MZU A;  1S1Y A;  3MFX A;  5AJG A;  2WKP A;  3LR5 A;  2W3H A;  4Y3I A;  1LT0 A;  3LIA A;  2B02 A;  3LR3 A;  1N9O A;  2KDK A;  2Y79 A;  2VLG A;  5AVF A;  2PYR A;  2XRN A;  2B18 A;  5HDC A;  4ARZ B;  4F3L B;  5C5K A;  2YKH A;  4JGQ A;  2KX6 A;  2PHY A;  1V9Z A;  3H7W A;  4MMN A;  3PBO A;  5HDS A;  1T1C A;  2HGV A;  5HPI A;  3IS2 A;  4NKP A;  3LIC A;  4Q0H A;  1UWP X;  4I3A A;  3UE6 A;  3T4T A;  3K3C A;  3F1P A;  5HDD A;  3LI8 A;  2KOI A;  3F1O B;  4CLC E;  3R7W A;  2OAQ 1;  1W63 M;  1GSW A;  3OCN A;  2P08 A;  4LLO B;  2QHK A;  3LR0 A;  2P7J A;  4KQD A;  2JKR I;  4LRY C;  3HJK A;  3ZYT A;  2NUT C;  3EEH A;  3C30 A;  2QJ7 A;  1N9N A;  4EU0 A;  1UWN X;  4RQ9 A;  1T18 A;  2J3W A;  4EQ1 A;  5F5Y A;  5KIZ A;  3MQ0 A;  3K2N A;  3LID A;  2Z6C A;  4WL9 A;  5A8B A;  4II7 A;  3W2Z A;  2PDR A;  3MMH A;  5J3W A;  3UB6 A;  1OTA A;  5FL3 A;  2W1T B;  3LIE A;  2XSS A;  2W3D A;  4XT2 A;  4R70 A;  4M4X A;  3CI6 A;  3B47 A;  5IT5 A;  1S4R A;  3LYX A;  1W63 Q;  1H8M A;  2GX5 A;  1OJ5 A;  4I38 A;  3EEA A;  1BYW A;  3JVU A;  4JGO A;  4HJ4 A;  1OTB A;  2QKP A;  5F68 A;  1T1B A;  2R78 A;  3LFV A;  2L0W A;  1T19 A;  1H3Q A;  2V1A A;  4B9O A;  4OOL A;  3F1N A;  4L9F A;  2A24 B;  3KYZ A;  5HZH A;  4BBU A;  1OPX A;  2O99 A;  1YKD A;  4Q0I A;  2ZMV A;  4BBT A;  3CLO A;  4PHT A;  4MN6 A;  2VKS A;  2KLI A;  2W1R A;  2QJ5 A;  3FG8 A;  3KSH A;  4P6Z M;  2VV8 A;  2XRO A;  1TD5 A;  2OAP 1;  3PYP A;  3OLO A;  3CUE C;  3FPV A;  1LSV A;  2V1B A;  2PR6 A;  4YWZ A;  3T4S A;  4PKY A;  4H6J B;  2VGL S;  1XFN A;  2K31 A;  4ETZ A;  3D3O A;  4G3V A;  3EQU A;  2K2N A;  4CQH A;  4CLC C;  3E4O A;  2WKR A;  4GHI A;  5TBM B;  4YNR A;  2FH5 A;  1XJ3 A;  2ZBB A;  2CMN A;  1VHM A;  5HWV A;  3SW1 A;  3OC2 A;  1LL8 A;  1YAX A;  4GW9 A;  4MDZ A;  1TF1 A;  4ARZ A;  3S7N A;  4L0L A;  3K3D A;  2O9B A;  2D02 A;  4L9E A;  5HD5 A;  3JVV A;  3B42 A;  5TJJ A;  1IFQ A;  4FOF A;  3E98 A;  3TJZ C;  4B93 A;  5EFW A;  2M7V A;  4LRZ E;  1WA9 A;  4NXE A;  2VEA A;  4CLC B;  4MN5 A;  1GSX A;  5HWT A;  2J80 A;  1YSQ A;  3C2W A;  4HH2 A;  4DJ3 A;  2W3G A;  4Y5F A;  1JNU A;  3F1O A;  2D01 A;  3KX0 X;  2ZOH A;  4KUK A;  4WEK A;  1DP6 A;  2J3T C;  3BY9 A;  4YOF A;  1S1Z A;  4EW7 A;  5HL6 A;  3P7N A;  1F5M A;  4AFI A;  3RTY A;  4EES A;  1NLY A;  2VA0 A;  3KO6 A;  2PR5 A;  4EET B;  1TS8 A;  4KQO A;  3NHQ A;  2HJE A;  3HJI A;  5DF9 A;  1N9L A;  3BQ8 A;  5KSH A;  5HD3 A;  3UB7 A;  3UE3 A;  3T4L A;  2PYP A;  4QPR A;  2Y8H A;  2FZ0 A;  3MQQ A;  4BJP A;  2LB5 A;  1S4S A;  4NXB A;  1OT9 A;  2HF6 A;  1ZHH B;  2INW A;  2QWS A;  3T4K A;  3PR6 A;  5LBR A;  1OJG A;  2W1T A;  1S66 L;  3MXQ A;  2O9C A;  4I5S A;  5CX7 A;  4ETX A;  2W0N A;  4E04 A;  3KSF A;  5G4Z A;  4IJG A;  4LPZ A;  1ZTU A;  1IOU A;  4EUV A;  5HPF A;  3MQO A;  2ZOI A;  3OCL A;  1NLZ A;  3PBT A;  4WN5 A;  1DRM A;  2JKT M;  5MC7 A;  3BQA A;  3LIB A;  3H82 A;  1OTI A;  3RFB A;  1DP9 A;  2A2L A;  4IUK A;  5HSQ A;  3V67 A;  1NWZ A;  3A0R A;  3NJA A;  3PBQ A;  4GS9 A;  4NXF A;  4EER A;  3MF0 A;  1G6O A;  3PBS A;  4Q0J A;  2M7U A;  1F98 A;  4GLQ A;  1P9R A;  3VE4 A;  1OT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...