4OOYA

Avibactam and class c beta-lactamases: mechanism of inhibition, conservation of binding pocket and implications for resistance
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
359
structure length
359
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Avibactam and Class C beta-Lactamases: Mechanism of Inhibition, Conservation of the Binding Pocket, and Implications for Resistance.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 121
structure length 359
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ooyA00
3TG9A 1N4OA 1FCNA 1FCOA 4P0MA 5F1FA 3VMAA 5DTKA 5BOHA 4KZ4A 4MNRA 3UDXA 4S2NA 4BQMA 2IWDA 4MLLA 2FFFB 3AGFA 2DNSA 1K57A 3CZDA 1K4FA 5AQ9A 3A3JA 3MZDA 4MBKA 4C3QA 1KDSA 4R4RA 3HLWA 4X68A 4B4XA 4GOGA 1LLBA 2R9XA 4RX3A 4ZBEA 5HFOA 1E3UD 3UDIA 3O3VA 1VQQA 1JVJA 2UWXA 5U47A 3CG5A 2Z2MB 2A49A 3BLMA 2WADA 3O88A 2WGWA 5AQBA 1S6RA 1SHVA 3BRMA 4OP8A 4QU3A 1EROA 3FKWA 2JC7A 3LEZA 4DE3A 5HL1A 2V2FF 3VP2A 4OPZA 1JWZA 1K55C 1ZG6A 4P87A 2G2UA 5FSRA 3V3RA 5GLAA 3GVBA 3UPPA 2ZQCA 4R3JA 3SOIA 1LL9A 4DE1A 3IHAA 3Q07A 3OCLA 4P85A 2WZZA 4WYYA 4OH0A 1FR1A 5EOEA 4LENA 5L2FA 3VSKA 4OPRA 3D4FA 4DKIA 3BLSA 4BENA 3LO7A 2QZ6A 4DE0A 2PU4A 2ZC5B 2J9PA 4EBNA 4E3LA 3M2KA 3ZGAB 4FCFA 3OC2A 3WWXA 5GHZA 2HP5A 1DJAA 4GD8A 3Q81A 4BD0A 4DXBA 1K4EA 3VFHA 5GHYA 4KZBA 1BULA 1TVFA 4ZAMA 4X53A 5CHJA 1H8ZA 3VOZA 1I2SA 2XQZA 3BM6A 1LL5A 4X69A 3VP1A 4N1HA 2HDUA 2XFSA 1YLZA 5CGWA 1KGFA 4GD6A 1S0WA 3V50A 4IBXA 1XXMA 3IXDA 4GNUA 3IXBA 4JXGA 5FI2A 3ZG0A 5CRFA 2Z2LB 4BLMA 3IWIA 4DDYA 3C7VA 1NZOA 2ZQ7A 1IYQA 4D2OA 4KENB 4X55A 2WKHA 3GR2A 2Y4AA 2Y2KA 1MWRA 3OPPA 5FI6A 2E8IA 3VFFA 1TEMA 4KQOA 3ZCZA 3M2JA 5KSHA 4OLGA 2WUQA 5FAOA 2ZQ9A 4GKUA 2WZXA 5FAQA 5JYPA 4FH4A 4H8RA 1ES4A 2OSUA 2WGVA 4O7DA 1PWCA 3BECA 3UY6A 4YFMA 4X56A 3I7JA 2IWCA 1ES5A 1PWDA 3WRTA 4Q8IA 5EPHA 2EFUA 4QY6A 1GCEA 3UE3A 1E25A 3P98A 3ZG8B 5EVLA 3OCNA 3LY4A 4JF4A 1PZOA 4UA7A 1K56A 1ZKJA 1YQSA 4PPRA 4WZ5A 1C3BA 2VGKA 4KG6A 1YLPA 4R23A 5DF7A 1DY6A 4R0QA 1CI9A 4FD8A 3UPNA 3MXRA 1L0EA 4ID4A 1H5XA 3ZNYA 3UNWA 3SS3A 3O87A 3PBQA 3AGEA 3G35A 4JXWA 4KG2A 5CERA 1LI0A 4C6YA 1BSGA 4P6BA 4ZDXA 4WMCA 1FQGA 5KSCA 5GL9A 1QMEA 2B5RA 1YMXA 3GMWA 4N9LA 1OMEA 5TR7A 3EQVA 3P09A 2WK0A 2WKIA 1SDEA 3ISGA 4JLFA 5FDHA 1NYMA 4OLDA 5F83A 2HP6A 4Y0OA 1W79A 5E43A 2BG1A 5FASA 3Q7VB 4PM5A 4HEFA 5EUAA 4Y0TA 3UN7A 3HLDA 4LCLA 3G34A 4E6XA 1CEGA 3S4XA 4HBUA 1NXYA 4CPKA 4WZ4A 3SH7A 1GA0A 1XPBA 4OQIA 3OPRA 4LV1A 1BLPA 2OV5A 2ZM8A 4S2JA 1CI8A 3N8RA 4E3KA 1DJBA 3UE1A 1JTDA 3NBLA 2WGWB 2XFTA 1WYCA 3DW0A 4XXRA 4BD1A 2HDSA 1XA7A 1Y54A 1WYBA 1MKIA 3N7WA 1HVBA 3B3XA 2Y2IA 1ESIA 1N9BA 2ZJ9A 1XA1A 1YLTA 2ZQDA 1IYOA 2HDRA 3G31A 2WGIA 3WS0A 1XGIA 5GHXA 2H10A 4U3TA 5FQIA 2Y2PA 4U0XA 1VM1A 2BLSA 5EVIA 1Q2QA 3IF6C 5AQ7A 4ZJ3A 3MXSA 5EE8A 2H0TA 1XX2A 4QB8A 3QNCA 2XGNA 2P9VA 1HD8A 3C5AA 3C4OA 1K54C 4GB7A 4OVDA 2X01A 4N9KA 3OZHA 1ES3A 1G6AA 2EX8A 3AGDA 3BYDA 5HAPA 1EWZA 1ALQA 1ZC2A 2XD1A 4S2IA 3PBNA 3UPOA 1FR6A 4WBGA 5CHMA 1L0FA 3PTEA 1ONHA 5F82A 2Y2MA 1KGGA 3HLEA 2Y59A 3VP4A 3VOYA 4DDSA 1FOFA 4E3IA 3JYIA 4OONA 4KZAA 4GZBA 1W5DA 5FA7A 4HBTA 4KQRA 3O86A 5FQ9A 1PWGA 4E6WA 3VP3A 4S2NC 5A92A 1YMSA 2XD5A 3HL9A 4KZ5A 1K56D 4RVAA 4F94A 4ZJ2A 3V3SA 2Y2LA 3ZG5A 3IH8A 4N1XA 4OQHA 5IHVA 5EOOA 1MWSA 1AXBA 3SH9A 3PBOA 4HESA 5DF8A 5F1GA 2G2WA 3C7UA 4K91A 3GV9A 3IH9A 1KE0A 3Q1FA 5CGSA 5CHUA 4IBRA 4QD4A 3MZFA 1GA9A 1XKZA 2ZMAA 3ZDJA 4Y0UA 1WE4A 5HAIA 4S2MA 1BLHA 3G2YA 4WMCD 4KZ9A 5HW3A 1NRFA 3A3EA 5GLBA 4LV3A 3Q7ZA 4E3JA 1PW8A 2ZLYA 1NZUA 2J9OA 2ZD8A 3FZCA 1IELA 2ZM2A 1Q2PA 3N6IA 3PBRA 5DVAA 4ZTKA 5FAPA 3GRJA 3ZVWA 2ZC6B 1PI4A 4JBFA 4X6TA 3PBTA 1MWUA 3NC8A 2WKEA 5E2EA 3LY3A 3ITAA 4EBPA 4GDBA 4E3OA 4MBFA 4WEJA 4JF5A 3UE0A 3GTCA 5M1AA 4WELA 1XGJA 3BFDA 2X02A 4GN2A 5GLDA 3DWKA 4EQIA 1W7FA 3G32A 1HZOA 1ZG4A 3IF6B 4KQQA 3A3DA 4Z9QA 3HLCA 5HX9A 4BL3A 3HUMA 1J9MA 3BFFA 1L2SA 1ES2A 2H5SA 2EFXA 4JXSA 3TSGA 3HLGA 3RXXA 1IKGA 3HLBA 1MWTA 5HARA 3NI9A 4UAAA 1I5QA 3ZVTA 3ZNTA 2EXBA 1E4DA 1EI5A 3BFEA 3QNBA 4S2KA 4S2OA 4WEKA 1MBLA 5CGXA 3ITBA 4PM6A 5HAQA 1FSWA 2Y2JA 3NIAA 3ZG7B 4EV4A 2ZQAA 4KZ7A 3S1YA 1YLJA 5G18A 1O07A 3UDFA 1U60A 5EVID 3WRZA 1K6SA 3V39A 4RX2A 2OLVA 3NDGA 1K55A 3G30A 3NY4A 4R3BA 1BLCA 1FCMA 3BEBA 3N4IA 4NETA 5FQJA 3RXWA 4GDNA 1K6RA 2XK1A 4CJNA 2EX6A 2P74A 5JYOA 5J8XA 3HUOA 3S22A 4EBLA 3W4PA 4B88A 1YM1A 3MKFA 2XDMA 2PU2A 1MXOA 5CTMA 3W4QA 3WS4A 1BTLA 5FQQA 2HDQA 1ESUA 2XR0A 2HPBA 3V5MA 1DJCA 3ZFZA 1SCWA 3FKVA 2ZM0A 3HREA 4EWFA 1SKFA 4XUXA 3IT9A 5CTNA 4B4ZA 1PZPA 2RCXA 3CJMA 5TGFA 4WZ5C 4E3MA 2C6WB 5EVIB 3W8KA 2ZC4B 2JBFA 4M3KA 2WYXA 3FV7A 5TFQA 3Q7VA 2ZC7A 3IWQA 5M18A 4LV0A 2J7VA 2P9VB 3HBRA 4JF6A 4MBHA 4OOMA 3ZG9B 3M6HA 4OQ0A 4OOYA 1KDWA 2WAEA 3IXGA 3SH8A 3GQZA 5CECA 4KZ6A 2Q9NA 3BFGA 3QHYA 3PAEA 3MFDA 2DRWA 1TDGA 1O7EA 4LV2A 3A3FA 4IVIA 5FQKA 3VP0A 3OPHA 1IYSA 4RA7A 4Y7PA 3EQUA 4IVKA 1KGEA 1M6KA 1IYPA 2EX2A 2EX9A 1BT5A 2FFYA 1ERMA 5CEBA 2Y2HA 4FH2A 2XH9A 1KVMA 3UO9A 2HP9A 2R9WA 4LCMA 1RGZA 1IKIA 1PYYA 3M6BA 2OLUA 4RYEA 4KZ3A 3PBSA 1CEFA 2Y2NA 3DWZA 4R1GA 4MEZA 1W8YA 4K0WA 3NCKA 5AQAA 3IHBA 5A91A 1K57C 1QMFA 2Y2QA 3MBZA 2ZC3B 4OQGA 4ZJ1A 3RJUA 5FATA 4UA9A 1TDLA 4U0TA 2GDNA 1PW1A 1XP4A 5A93A 2XEPA 1ERQA 3IXHA 3DTMA 4JPMA 2ZQ8A 1SDNA 4UHUA 3SS5A 2XLNA 3SS4A 2QMIA 5E2FA 3WS1A 4E3NA 1BZAA 3E2LA 3FYZA 4QJGA 3MZEA 1E3UA 4R4SA 4A5RA 4QHCA 5FI7A 5GLCA 3WS2A 3C4PA 4K0XA 1K25A 3A3IA 3HVFA 5EVIC 1PI5A 4OP5A 2Y2GA 1IEMA 4PM7A 5CEDA 1L0GA 1JWPA 4JKTA 2DCFA 2C5WB 2PBYA 1ONGA 4S2PA 1NYYA 2CC1A 4BL2A 5KZHA 4L0LA 2J8YA 3MKEA 2H0YA 2Y55A 5E2GA 1YLWA 5DF9A 4KZ8A 4WM9A 1JWVA 3N8LA 5EECA 1KE3A 2WAFA 3LCEA 1GHMA 3HLFA 3OPLA 3NDEA 4JXVA 3ZHHA 1LHYA 3FWLA 5DTTA 1GHIA 1NY0A 1RCJA 5D3OA 4PM9A 1NJ4A 2JE5A 4NK3A 2QPNA 1FSYA 2IWBA 1RGYA 1W8QA 1MY8A 1G68A 1KVLA 4EUZA 3IQAA 3PAGA 2V20A 3N8SA 5DTSA 1RP5A 3GSGA 4OOLA 5E2HA 5FQMA 4BJPA 1MPLA 3W4OA 2VGJA 1Z6FA 1JTGA 3IF5A 1CK3A 2V1ZA 2Y91A 5CXWA 1LI9A 5A90A 2Q9MA 2Y2OA 1HTZA 1K38A 4C75A 4N92A 1GHPA 1YLYA 4PMAA 5KMWA 1KE4A 1BLSA 4OKPA 4S2LA 4FSFA 4IEDA 1L0DA 4OPYA 1YT4A 1BUEA 4OPQA 3TOIA 4DF6A 3IF6A 1I2WA 4KG5A 1M40A 2I72A 3G4PA 3IWOA 4DXCA 4YINA 4UA6A 3BFCA 1K54A 2A3UA 2RL3A 3CMZA 5M19A 1H8YA 3E2KA 2XF3A 1PIOA 3VSLA 4DE2A 4PM8A 4DRTA 3G2ZA 4QY5A 3HUNA 2EXAA 2X71A 4XUZA 3Q82A 2JCHA 3WS5A 5I94A
chains in the Genus database with same CATH superfamily
3TG9A 1N4OA 1FCNA 1FCOA 3UDXA 1OTAA 1L3LA 2VA0A 3AGFA 1XJ6A 1K4FA 3A3JA 4MBKA 4C3QA 4CLCC 5MC7A 1KDSA 2NUPC 3IBJA 4GOGA 1E3UD 1OTDA 1VQQA 2VV7A 2WADA 1SHVA 3BRMA 3E4OA 4I3AA 4HOIA 3FKWA 2G2UA 3T4QA 5HZHA 3GVBA 4NXGA 2ZQCA 4HY8A 3D9YA 1P9RA 3R4KA 2M1CA 3OCLA 2WZZA 1FR1A 5EOEA 5L2FA 4DKIA 3FPVA 4GHIB 4BENA 5HWTA 3OC2A 3D3OA 1DJAA 4BD0A 2A2LA 3VFHA 4FUWA 5GHYA 1BULA 5EFWA 4X53A 3KYEA 4MMNA 3VOZA 2XQZA 1LL5A 3LFVA 3IS2B 4N1HA 3U4LP 5DFXA 3CAXA 4PKYG 2PD8A 1ACFA 3IXDA 5J7EA 5FI2A 3K2NA 4IJGA 2ZQ7A 4KENB 2WKHA 3GR2A 3VFFA 1TEMA 5KSHA 2WUQA 5JYPA 4FH4A 4CLCB 2OSUA 1PWCA 2PR6A 3BECA 3MFXA 3UMDA 3UE3A 2XA7S 1K56A 3FC7A 4WZ5A 1C3BA 4MN5A 2VGKA 2ZMVA 4KG6A 1DY6A 3LIBA 4GS9B 1G28A 1PFLA 3ZNYA 3UNWA 3O87A 3F1OB 5CERA 4Y15A 4P6BA 1FQGA 5GL9A 3KSGA 5TR7A 2WKIA 4IUHA 3C38A 3L9KA 4OLDA 5E43A 2BG1A 4WL9A 3LIAA 3UN7A 5HD3A 2Y79A 4E6XA 3S4XA 3RTYA 5L07A 4CPKA 1GA0A 1XPBA 3OPRA 2OV5A 3IX8A 3UE1A 3NBLA 3DW0A 4XXRA 2PYRA 3EWKA 1XJ4A 1WYBA 4EW7A 5FDSA 1HVBA 2ZOIA 4EEUA 2H10A 1VM1A 2BLSA 3IF6C 3MXSA 4WN5A 3QNCA 1HD8A 1K54C 1F9IA 3OZHA 3P7NA 1ALQA 2XD1A 4EETB 1FR6A 5F82A 2Y2MA 1CQAA 1YKDA 3HLEA 3VP4A 1DP9A 2V1BA 1S1ZA 5FQ9A 3TRCA 4E6WA 5A92A 4KZ5A 3KX0X 4F94A 1K56D 3IH8A 2W3HA 2R78A 3SH9A 5F1GA 4K91A 2BTFP 3GV9A 4NXFA 3MZFA 2ZMAA 2Y8HA 1LSVA 2I9VA 1BLHA 3UB8A 3LR5A 3A3EA 4LV3A 2NUTC 3FZCA 1NZUA 1OJGA 3N6IA 5FAPA 3LI8A 1PI4A 4JBFA 4Q0HA 3FPWA 5M1AA 1YAXA 3BFDA 4GN2A 2HV1A 4BBUA 3BQAA 1AWIA 1ZG4A 3IF6B 3O5YA 3A3DA 2BASA 2E8JA 5FEGA 2O9AA 3T50A 4G3WA 3HLBA 3NI9A 5FL3A 2O9BA 5CGXA 5HAQA 2ZQAA 4Z1WA 3ZYTA 4GCZA 2HJEA 2OLVA 3NDGA 3G30A 5HSQA 1FCMA 4NETA 1T19A 2XK1A 4B88A 3MSHA 2B18A 5HD5A 2PU2A 1MXOA 3W4QA 3WS4A 5FQQA 1ESUA 1TS8A 1XJ2A 2A24B 2ZM0A 2VV6A 4BBTA 2VV8A 3H7WB 4XUXA 1PZPA 2RCXA 4E3MA 5TGFA 4WZ5C 2ZC4B 2PRFA 3ZG9B 1XFQA 1W63M 2WAEA 3GQZA 5DKLA 3BFGA 3QHYA 2QHKA 4LV2A 1WA9A 3ICYA 3VP0A 1IYSA 4RA7A 4IVKA 1KGEA 1ZTUA 2EX9A 2FFYA 3DTIA 2Y2HA 1KVMA 4WUJA 4ZRRA 2D01A 4LCMA 1IKIA 2OLUA 4LFUA 3B33A 1S67L 4RYEA 2Y2NA 3DWZA 4R1GA 2Y2QA 3MBZA 4ZJ1A 2ZC3B 4UA9A 4WLAA 3CI6A 1PW1A 2JKTM 2XEPA 2L4RA 5EVEA 3DBAA 3JVUA 3SS5A 4GHIA 2QMIA 1UGUA 4E3NA 3E2LA 1XJ3A 3QP8A 3MZEA 4DN0A 4R4SA 4A5RA 4QHCA 5HDSA 3LR3A 5CEDA 2DCFA 1P97A 4X1MA 1NWZA 4B9OA 2GZAA 4B93A 4R70A 1YLWA 1D7EA 1JWVA 3ZHHA 4JXVA 5DTTA 1RCJA 2IWBA 2QPNA 1G68A 3LYXA 3IQAA 3PAGA 2V20A 3N8SA 5FQMA 1MPLA 2VGJA 1JTGA 3IF5A 4ARZB 2Y91A 1LI9A 4N92A 4S2LA 4FSFA 1L0DA 1BUEA 3E98A 2I72A 3DAVA 2A3UA 1YSPA 4PM8A 3G2ZA 2X71A 3WS5A 2PDRA 3T1RA 5DTKA 5BOHA 4S2NA 4BQMA 2IWDA 2FFFB 4EEPA 3R7WB 1F98A 1K57A 5LBRA 1LLBA 2R9XA 4RX3A 3UDIA 5U47A 3BLMA 2VLGA 5HL1A 4ME4A 2Z6DA 3VP2A 1MC0A 4OPZA 4P87A 5FSRA 3V3RA 5GLAA 3KO6A 3CHWP 2QJ7A 1P9WA 3SOIA 3IX4A 2W0NA 5L10A 3LEQA 1VHMA 3BLSA 4HJ4A 4DE0A 3ZGAB 4YWZA 3LIEA 1TVFA 2IA2A 1VETA 1H8ZA 4X69A 1YLZA 5CGWA 3MQQA 3ULFA 4IBXA 3IWIA 1NZOA 1PNEA 4X55A 5A8BA 1MWRA 5FI6A 2E8IA 2ZBBA 2H28A 5FAOA 2ZQ9A 4UEYA 3TW8A 4O7DA 4YFMA 5IS1A 3I7JA 3T4LA 1ES5A 4Q8IA 5EPHA 3OBFA 4ETZA 1GCEA 3BJNA 3P98A 5F5YA 3VE3A 3OCNA 3LY4A 4HP4A 3GDIA 4ESPA 4R23A 4R0QA 3EEAA 2VJWA 1CI9A 4FD8A 3MXRA 1L0EA 2B02A 4ID4A 2UV0E 5IT5A 2Q0OA 2L0WA 3PBQA 3PYPA 4EU0A 4JXWA 4KG2A 4L9EA 1BSGA 1T1CA 2P08A 4WMCA 1QMEA 1N9NA 4M4XA 1YMXA 3B47A 3GMWA 4N9LA 2XROA 1GSXA 5FDHA 1NYMA 1X0OA 3E4QA 4LCLA 2XRNA 4HJ3A 4WZ4A 5HPIA 3SH7A 4HIAA 2ZL1B 2ZM8A 4E3KA 1DJBA 2WGWB 3K3DA 3BW6A 1WYCA 4BD1A 2HDSA 1MKIA 1N9OA 1K0KA 3SZTA 2Y2IA 2ZJ9A 1N9BA 3D72A 3CITA 2ZQDA 2A24A 3G31A 3OLOA 3S7OA 3H7WA 5FQIA 1Q2QA 4LRZE 5AQ7A 4BWIA 1NRJA 3C4OA 4OVDA 1MZUA 3AGDA 3LIDA 5HAPA 1EWZA 2KX6A 1ZC2A 3JPUA 1ONHA 5HDCA 1KGGA 3VOYA 3JYIA 1DP8A 5FA7A 4KQRA 3JVVA 2JKTI 3VP3A 2JHEA 4S2NC 4RVAA 3HL9A 3E4PA 2Y2LA 2P04A 4OQHA 5IHVA 3PBOA 3C7UA 3OOVA 1GA9A 4Y0UA 4S2MA 4WMCD 4KZ9A 1NRFA 5GLBA 2Z6CA 3SW1A 1PW8A 3UB5P 4PHTA 1IELA 4ZTKA 3GRJA 2YKHA 1MWUA 3KSFA 3LY3A 5E2EA 4EBPA 3W2ZA 4E3OA 4MBFA 5F6AA 4WELA 5AVEA 2X02A 1HZOA 4EUVA 4KQQA 1J9MA 1OJ5A 1ES2A 4G3VA 1Z09A 2PYPA 3TSGA 3MQOA 4FOFA 3RXXA 1MWTA 4UAAA 1I5QA 3ZNTA 4S2OA 1MBLA 3P01A 4EV4A 5L09A 3S1YA 1YLJA 1DRMA 1U60A 4RX2A 4ARZA 1K55A 1OTBA 4R3BA 4Q0JA 3BEBA 3RXWA 4IHQA 4YNRA 5JYOA 5J8XA 3HUOA 1P0ZA 3W4PA 3MKFA 2XR0A 3V5MA 3ZFZA 1SCWA 3FKVA 1SKFA 3IT9A 4B4ZA 5EVIB 4KUKA 4M3KA 3Q7VA 2ZC7A 3HJKA 2P9VB 4Q0IA 5DFYA 4OOYA 1KDWA 3BWLA 3LR0A 3IXGA 3SH8A 5CECA 2OAQ1 3EGXC 3MFDA 3R7WA 1TDGA 1O7EA 3A3FA 4IVIA 3A0VA 2INWA 1M6KA 1BT5A 1VETB 2XH9A 1VEUA 3M6BA 3VV4A 2M7UA 3PBSA 4MEZA 1W8YA 5AQAA 3IHBA 1QMFA 3BY8A 3RJUA 1TDLA 4U0TA 2GDNA 3ZQ5A 1IFQA 2V0UA 3RFBA 2W3GA 2XLNA 5J4EA 3CWFA 4QJGA 3FYZA 1S1YA 3QP2A 2JKRM 2WKRA 4LGWA 5GLCA 4JGQA 3C4PA 4PAUA 3HVFA 1PI5A 1IEMA 4RQ9A 2J8YA 1SZVA 2D02A 4KZ8A 2QKPA 3QP5A 4L9FA 3FWLA 2J3WA 1GHIA 1NY0A 4PM9A 1NJ4A 2JE5A 1FSYA 4LRYC 1RGYA 5HWWA 1KVLA 2K2NA 5E2HA 4QWOA 2W3FA 1Z6FA 3BY9A 5HWVA 1CK3A 2V1ZA 4C75A 1GHPA 5KMWA 4X1LA 3UE6A 3NOPC 1TS7A 1YT4A 5AVFA 4DF6A 3G4PA 3IWOA 4YINA 3BFCA 5M19A 2LB9A 4QY5A 3HUNA 4XUZA 5I5LA 2W1RA 3F1PB 3KSIA 4P0MA 5F1FA 4HJ6A 3VMAA 4MNRA 4O01A 3K3CA 2GX5A 3UB6A 2DNSA 5AQ9A 3MZDA 3HLWA 4X68A 4ZBEA 5HFOA 2ZL1A 2UWXA 2A49A 3O88A 2WGWA 3LI9A 2JC7A 2V2FF 3LICA 4I39A 1JWZA 1K55C 1ZG6A 4QPRA 3UPPA 4JGPA 4R3JA 3IHAA 2O0YA 4WYYA 4LENA 4UQIS 3VSKA 3D4FA 3LO7A 2QZ6A 2ZC5B 4UQIM 4E3LA 1H3QA 5GHZA 2HP5A 4GD8A 3Q81A 4DXBA 1K4EA 5G4YA 3T4TA 4LRXC 5CHJA 3BM6A 2OOLA 2W3EA 2XFSA 4GD6A 4GNUA 2KOIA 4JXGA 3ZG0A 5CRFA 2Z2LB 4BLMA 1IYQA 3OPPA 4KQOA 3ZCZA 3M2JA 4OLGA 2IWCA 1PWDA 2EFUA 4ETXA 4QY6A 5FEFA 1E25A 1Y28A 3ZG8B 1Y4OA 5HDDA 4JF4A 1W63Q 1YQSA 2VZWA 3GECA 2EA9A 1H5XA 3SS3A 3T1SA 1MKMA 2W1TA 1LI0A 4C6YA 3T1QB 4ZDXA 4HH3A 3ISGA 4LPZA 2HP6A 4Y0OA 1W79A 3Q7VB 4HEFA 3HLDA 1DP6A 3G34A 1T1BA 1CEGA 4HBUA 1NXYA 4OQIA 4LV1A 1BLPA 3N8RA 3UMEA 3PXPA 1XA7A 1Y54A 1VEUB 3N7WA 2XSSA 2WKQA 3B3XA 1LSWA 1ESIA 1F2KA 1SKOB 1YLTA 1IYOA 2HDRA 2O99A 2FZ0A 1FILA 3H9WA 1XGIA 5GHXA 5EVIA 1XX2A 2XGNA 2P9VA 5G4ZA 4GB7A 2HJ9C 1ES3A 2EX8A 3BYDA 3PBNA 3UPOA 4WBGA 3PTEA 4FTXA 2MJ6A 2Y59A 1FOFA 1H8MA 4HBTA 2XD5A 4GLQA 4ZJ2A 1NLYA 4E04A 4N1XA 5EOOA 5DF8A 2G2WA 3Q1FA 5K5BA 5CHUA 4IBRA 4QD4A 1XKZA 3BQ8A 2QWSA 4R38A 3G2YA 3E0YA 1IOUA 2ZLYA 2J9OA 2ZD8A 4E3IA 2ZM2A 3CPTA 3PBRA 5DVAA 2ZC6B 1V9YA 4X6TA 4DJ3A 3H82A 3UE0A 3MF0A 1XGJA 3A0RA 1W7FA 3DTKA 3MR0A 4Z9QA 4BL3A 3HLCA 5HX9A 3HUMA 3BFFA 1L2SA 2VKSA 5EV0A 1YSQA 2H5SA 4JXSA 3NHQA 1IKGA 2ZOHA 5HARA 3ZVTA 2J80A 2EXBA 1EI5A 4S2KA 4WEKA 3ITBA 3LUQA 1FSWA 3IX3A 3NIAA 3ZG7B 2G7UA 1G6OA 4KZ7A 5G18A 5EVID 1CF0A 1PRQA 1K6SA 3T4KA 3VE4A 3V39A 3EOIA 3NY4A 1BLCA 1LSXA 3TJZC 1K6RA 2EX6A 1N9LA 4AFIA 3S22A 2V9AA 1YM1A 4Y2FA 1BTLA 2HDQA 2PAVP 1A0KA 3NULA 3HREA 4CQHA 3VOLA 3CJMA 2C6WB 3IBRA 4NXEA 3W8KA 2JBFA 3FV7A 5TFQA 4LV0A 2J7VA 3HBRA 4MBHA 3TE8A 4OOMA 3F1PA 3M6HA 4OQ0A 5TBMB 4KZ6A 3PAEA 2DRWA 3CLOA 2VK3A 3T4SA 5FQKA 2EX2A 1ERMA 5CEBA 4FH2A 3UO9A 1OT9A 3S7PA 1PYYA 2HGVA 3C8CA 4NKPA 3NCKA 5A91A 1HLUP 1K57C 5FATA 4XT2B 2FH5A 1XP4A 2PBDP 4O8GA 3IXHA 4HHDA 4L9GA 4IUKA 1SDNA 3SS4A 5E2FA 3WS1A 1BZAA 5HL6A 1ZHHB 4NXBA 1K25A 3A3IA 5EVIC 2Y2GA 4PM7A 1JWPA 2PBYA 1ONGA 1NYYA 5HPFA 5AJGA 3RH8B 4BL2A 4II7A 5E2GA 5DJUA 3S7QA 3N8LA 1KE3A 3LCEA 3NDEA 2W1TB 3T4OA 1UWNX 5D3OA 1W8QA 1LL8A 1MY8A 4EUZA 4MCWA 1FIKA 4BJPA 3W4OA 3UB7A 2W27A 5CXWA 2XA7M 2Y2OA 1HTZA 1K38A 1YLYA 4PMAA 1KE4A 1BLSA 2YKFA 3B42A 5EM0A 4I3JA 1I2WA 1M40A 1G5UA 2GNXA 4KUOA 4F3LB 4EESA 2RL3A 1H0MA 3E2KA 4CLCE 4DE2A 1PIOA 5F68A 3VSLA 2EXAA 3Q82A 4HH2A 3A0SA 3MMHA 4GJ4A 4GW9A 1JNUA 4KZ4A 3U2AA 3LIFA 4MLLA 4EXOA 2J3TD 3CZDA 3LGOA 1KOUA 2KLIA 4R4RA 4MN7A 4B4XA 3O3VA 1JVJA 4HP9A 3CG5A 2Z2MB 1NLZA 3MQ0A 5AQBA 5DJTA 1S6RA 4OP8A 4QU3A 4DE3A 1EROA 3LEZA 3LR4A 3L7HA 2V8FA 1CJFA 4H6JA 1SKOA 3QP1A 1LL9A 1ODVA 4HNBA 3Q07A 4DE1A 3PHYA 4P85A 2JKFA 4OH0A 4EQ1A 4EERA 4OPRA 2PU4A 4EBNA 2J9PA 3M2KA 4FCFA 3WWXA 4YOFA 2K7SA 4Y5FA 1T1AA 4KZBA 3CPTB 4ZAMA 4R6LA 1I2SA 3H82B 2EWWA 2GJ3A 3VP1A 5F69A 2HDUA 4PKYA 1KGFA 1S0WA 5KIZA 3V50A 1XXMA 3IXBA 4DDYA 3C7VA 4D2OA 2Y4AA 2Y2KA 2L1MA 3KSHA 4GKUA 1OTEA 2WZXA 5FAQA 4H8RA 1ES4A 2WGVA 3UY6A 3NJAA 4X56A 3HJIA 3WRTA 3NOTC 3CUEA 5EVLA 3S7NA 4BBVA 1PZOA 4UA7A 1STZA 1ZKJA 2J3TC 3F1NA 4NEED 4PPRA 3C30A 1TF1A 5DF7A 1YLPA 3UPNA 4I5SA 4X25A 3AGEA 3G35A 5KSCA 2VEAA 2B5RA 1OMEA 3EQVA 3P09A 2WK0A 3QP6A 1SDEA 3MXQA 4JLFA 3FG8A 5F83A 5FASA 4MDZA 4PM5A 2VX8A 5EUAA 2K31A 4Y0TA 4HQAA 2PD7A 3NOUC 5EM1A 1BYWA 1GSVA 4S2JA 4K08A 1CI8A 1JTDA 2XFTA 5DKKA 1EW0A 1XA1A 2WGIA 3WS0A 4U3TA 2Y2PA 4U0XA 3DTEA 2P7JA 4ZJ3A 5EE8A 2H0TA 4QB8A 4I38A 3C5AA 2X01A 4N9KA 1G6AA 5TBMA 4S2IA 5CHMA 1L0FA 4I3IA 4D60A 4DDSA 4OONA 4KZAA 4GZBA 1W5DA 1YPRA 1S4SA 3O86A 1PWGA 3PR6A 1YMSA 5CX7A 3V3SA 3ZG5A 2PT7A 3EGDC 1OPXA 1MWSA 1AXBA 4HESA 4Y3IA 2HZ5A 3IH9A 1KE0A 5CGSA 1OT6A 3ZDJA 1T18A 4XT2A 1WE4A 5HAIA 2QJ5A 5HW3A 1V9ZA 3MJQA 3Q7ZA 4E3JA 3T12B 1Q2PA 2EWVA 4NG2A 3ZVWA 3PBTA 3NC8A 1GSWA 2WKEA 1D1JA 3ITAA 4GDBA 3MS6A 3IS2A 2AVXA 4JF5A 4WEJA 3GTCA 2HF6A 4G3KA 3QP4A 2OWHA 5GLDA 3DWKA 4EQIA 3G32A 3UB9A 2QYBA 4LLOB 2EFXA 3T1XA 3HLGA 4CLCA 1TD5A 4Y17A 1E4DA 3BFEA 3C2WA 3QNBA 4PM6A 2Y2JA 1O07A 3UDFA 3WRZA 2B95A 2PHYA 3N4IA 5FQJA 4GS9A 4GDNA 4CJNA 4Y13A 2P74A 4EBLA 3KYQA 2XDMA 3F1OA 5CTMA 3CUEC 2HPBA 4JGRA 1DJCA 5J3WA 3T4JA 4EWFA 4F3LA 5CTNA 2DMWA 2JN7A 4H6JB 2W3DA 2WYXA 1VB6A 5M18A 3IWQA 2ZMFA 4JF6A 4BMWA 1J3WA 2M7VA 2Q9NA 3NECA 1XFNA 1D06A 3OPHA 4Y7PA 3EQUA 3V67A 1IYPA 1F5MA 2HP9A 2R9WA 1RGZA 5C5KA 2V8CA 1S66L 4KZ3A 4R3AA 1CEFA 3G6OA 4K0WA 3KYZA 4OQGA 2LB5A 2JKRI 2O9CA 4MN6A 2OWJA 5A93A 1ERQA 3DTMA 4JPMA 2KDKA 2OAP1 2ZQ8A 4UHUA 4CLCD 2CMNA 2ACGA 1E3UA 4WF0A 4KQDA 5FI7A 3WS2A 4K0XA 4OP5A 5L8MA 4DJ2A 1L0GA 4JKTA 2C5WB 4S2PA 2PR5A 3F1NB 2CC1A 1TS0A 5KZHA 4L0LA 3MKEA 3HCYA 2H0YA 1LT0A 2Y55A 5DF9A 4WM9A 5EECA 4O0PA 2WAFA 1GHMA 3HLFA 3OPLA 1LHYA 1S4RA 4NK3A 4DMZA 5DTSA 1RP5A 3GSGA 4OOLA 2VGLS 2JKGA 2WKPA 1TS6A 2VGLM 1UWPX 2V0WA 5A90A 2Q9MA 4P6ZS 4HI4A 4P6ZM 4OKPA 4IEDA 4OPYA 4OPQA 3TOIA 3IF6A 4KG5A 1OTIA 5TJJA 4DXCA 4UA6A 1K54A 2V1AA 4JGOA 3CMZA 1H8YA 2XF3A 5IU1A 4DRTA 3EEHA 2JCHA 5I94A
chains in the Genus database with same CATH topology
3TG9A 1N4OA 1FCNA 1FCOA 4P0MA 5F1FA 3VMAA 5DTKA 5BOHA 4KZ4A 4MNRA 3UDXA 4S2NA 4BQMA 2IWDA 4MLLA 2FFFB 3AGFA 2DNSA 1K57A 3CZDA 1K4FA 5AQ9A 3A3JA 3MZDA 4MBKA 4C3QA 1KDSA 4R4RA 3HLWA 4X68A 4B4XA 4GOGA 1LLBA 2R9XA 4RX3A 4ZBEA 5HFOA 1E3UD 3UDIA 3O3VA 1VQQA 1JVJA 2UWXA 5U47A 3CG5A 2Z2MB 2A49A 3BLMA 2WADA 3O88A 2WGWA 5AQBA 1S6RA 1SHVA 3BRMA 4OP8A 4QU3A 1EROA 3FKWA 2JC7A 3LEZA 4DE3A 5HL1A 2V2FF 3VP2A 4OPZA 1JWZA 1K55C 1ZG6A 4P87A 2G2UA 5FSRA 3V3RA 5GLAA 3GVBA 3UPPA 2ZQCA 4R3JA 3SOIA 1LL9A 4DE1A 3IHAA 3Q07A 3OCLA 4P85A 2WZZA 4WYYA 4OH0A 1FR1A 5EOEA 4LENA 5L2FA 3VSKA 4OPRA 3D4FA 4DKIA 3BLSA 4BENA 3LO7A 2QZ6A 4DE0A 2PU4A 2ZC5B 2J9PA 4EBNA 4E3LA 3M2KA 3ZGAB 4FCFA 3OC2A 3WWXA 5GHZA 2HP5A 1DJAA 4GD8A 3Q81A 4BD0A 4DXBA 1K4EA 3VFHA 5GHYA 4KZBA 1BULA 1TVFA 4ZAMA 4X53A 5CHJA 1H8ZA 3VOZA 1I2SA 2XQZA 3BM6A 1LL5A 4X69A 3VP1A 4N1HA 2HDUA 2XFSA 1YLZA 5CGWA 1KGFA 4GD6A 1S0WA 3V50A 4IBXA 1XXMA 3IXDA 4GNUA 3IXBA 4JXGA 5FI2A 3ZG0A 5CRFA 2Z2LB 4BLMA 3IWIA 4DDYA 3C7VA 1NZOA 2ZQ7A 1IYQA 4D2OA 4KENB 4X55A 2WKHA 3GR2A 2Y4AA 2Y2KA 1MWRA 3OPPA 5FI6A 2E8IA 3VFFA 1TEMA 4KQOA 3ZCZA 3M2JA 5KSHA 4OLGA 2WUQA 5FAOA 2ZQ9A 4GKUA 2WZXA 5FAQA 5JYPA 4FH4A 4H8RA 1ES4A 2OSUA 2WGVA 4O7DA 1PWCA 3BECA 3UY6A 4YFMA 4X56A 3I7JA 2IWCA 1ES5A 1PWDA 3WRTA 4Q8IA 5EPHA 2EFUA 4QY6A 1GCEA 3UE3A 1E25A 3P98A 3ZG8B 5EVLA 3OCNA 3LY4A 4JF4A 1PZOA 4UA7A 1K56A 1ZKJA 1YQSA 4PPRA 4WZ5A 1C3BA 2VGKA 4KG6A 1YLPA 4R23A 5DF7A 1DY6A 4R0QA 1CI9A 4FD8A 3UPNA 3MXRA 1L0EA 4ID4A 1H5XA 3ZNYA 3UNWA 3SS3A 3O87A 3PBQA 3AGEA 3G35A 4JXWA 4KG2A 5CERA 1LI0A 4C6YA 1BSGA 4P6BA 4ZDXA 4WMCA 1FQGA 5KSCA 5GL9A 1QMEA 2B5RA 1YMXA 3GMWA 4N9LA 1OMEA 5TR7A 3EQVA 3P09A 2WK0A 2WKIA 1SDEA 3ISGA 4JLFA 5FDHA 1NYMA 4OLDA 5F83A 2HP6A 4Y0OA 1W79A 5E43A 2BG1A 5FASA 3Q7VB 4PM5A 4HEFA 5EUAA 4Y0TA 3UN7A 3HLDA 4LCLA 3G34A 4E6XA 1CEGA 3S4XA 4HBUA 1NXYA 4CPKA 4WZ4A 3SH7A 1GA0A 1XPBA 4OQIA 3OPRA 4LV1A 1BLPA 2OV5A 2ZM8A 4S2JA 1CI8A 3N8RA 4E3KA 1DJBA 3UE1A 1JTDA 3NBLA 2WGWB 2XFTA 1WYCA 3DW0A 4XXRA 4BD1A 2HDSA 1XA7A 1Y54A 1WYBA 1MKIA 3N7WA 1HVBA 3B3XA 2Y2IA 1ESIA 1N9BA 2ZJ9A 1XA1A 1YLTA 2ZQDA 1IYOA 2HDRA 3G31A 2WGIA 3WS0A 1XGIA 5GHXA 2H10A 4U3TA 5FQIA 2Y2PA 4U0XA 1VM1A 2BLSA 5EVIA 1Q2QA 3IF6C 5AQ7A 4ZJ3A 3MXSA 5EE8A 2H0TA 1XX2A 4QB8A 3QNCA 2XGNA 2P9VA 1HD8A 3C5AA 3C4OA 1K54C 4GB7A 4OVDA 2X01A 4N9KA 3OZHA 1ES3A 1G6AA 2EX8A 3AGDA 3BYDA 5HAPA 1EWZA 1ALQA 1ZC2A 2XD1A 4S2IA 3PBNA 3UPOA 1FR6A 4WBGA 5CHMA 1L0FA 3PTEA 1ONHA 5F82A 2Y2MA 1KGGA 3HLEA 2Y59A 3VP4A 3VOYA 4DDSA 1FOFA 4E3IA 3JYIA 4OONA 4KZAA 4GZBA 1W5DA 5FA7A 4HBTA 4KQRA 3O86A 5FQ9A 1PWGA 4E6WA 3VP3A 4S2NC 5A92A 1YMSA 2XD5A 3HL9A 4KZ5A 1K56D 4RVAA 4F94A 4ZJ2A 3V3SA 2Y2LA 3ZG5A 3IH8A 4N1XA 4OQHA 5IHVA 5EOOA 1MWSA 1AXBA 3SH9A 3PBOA 4HESA 5DF8A 5F1GA 2G2WA 3C7UA 4K91A 3GV9A 3IH9A 1KE0A 3Q1FA 5CGSA 5CHUA 4IBRA 4QD4A 3MZFA 1GA9A 1XKZA 2ZMAA 3ZDJA 4Y0UA 1WE4A 5HAIA 4S2MA 1BLHA 3G2YA 4WMCD 4KZ9A 5HW3A 1NRFA 3A3EA 5GLBA 4LV3A 3Q7ZA 4E3JA 1PW8A 2ZLYA 1NZUA 2J9OA 2ZD8A 3FZCA 1IELA 2ZM2A 1Q2PA 3N6IA 3PBRA 5DVAA 4ZTKA 5FAPA 3GRJA 3ZVWA 2ZC6B 1PI4A 4JBFA 4X6TA 3PBTA 1MWUA 3NC8A 2WKEA 5E2EA 3LY3A 3ITAA 4EBPA 4GDBA 4E3OA 4MBFA 4WEJA 4JF5A 3UE0A 3GTCA 5M1AA 4WELA 1XGJA 3BFDA 2X02A 4GN2A 5GLDA 3DWKA 4EQIA 1W7FA 3G32A 1HZOA 1ZG4A 3IF6B 4KQQA 3A3DA 4Z9QA 3HLCA 5HX9A 4BL3A 3HUMA 1J9MA 3BFFA 1L2SA 1ES2A 2H5SA 2EFXA 4JXSA 3TSGA 3HLGA 3RXXA 1IKGA 3HLBA 1MWTA 5HARA 3NI9A 4UAAA 1I5QA 3ZVTA 3ZNTA 2EXBA 1E4DA 1EI5A 3BFEA 3QNBA 4S2KA 4S2OA 4WEKA 1MBLA 5CGXA 3ITBA 4PM6A 5HAQA 1FSWA 2Y2JA 3NIAA 3ZG7B 4EV4A 2ZQAA 4KZ7A 3S1YA 1YLJA 5G18A 1O07A 3UDFA 1U60A 5EVID 3WRZA 1K6SA 3V39A 4RX2A 2OLVA 3NDGA 1K55A 3G30A 3NY4A 4R3BA 1BLCA 1FCMA 3BEBA 3N4IA 4NETA 5FQJA 3RXWA 4GDNA 1K6RA 2XK1A 4CJNA 2EX6A 2P74A 5JYOA 5J8XA 3HUOA 3S22A 4EBLA 3W4PA 4B88A 1YM1A 3MKFA 2XDMA 2PU2A 1MXOA 5CTMA 3W4QA 3WS4A 1BTLA 5FQQA 2HDQA 1ESUA 2XR0A 2HPBA 3V5MA 1DJCA 3ZFZA 1SCWA 3FKVA 2ZM0A 3HREA 4EWFA 1SKFA 4XUXA 3IT9A 5CTNA 4B4ZA 1PZPA 2RCXA 3CJMA 5TGFA 4WZ5C 4E3MA 2C6WB 5EVIB 3W8KA 2ZC4B 2JBFA 4M3KA 2WYXA 3FV7A 5TFQA 3Q7VA 2ZC7A 3IWQA 5M18A 4LV0A 2J7VA 2P9VB 3HBRA 4JF6A 4MBHA 4OOMA 3ZG9B 3M6HA 4OQ0A 4OOYA 1KDWA 2WAEA 3IXGA 3SH8A 3GQZA 5CECA 4KZ6A 2Q9NA 3BFGA 3QHYA 3PAEA 3MFDA 2DRWA 1TDGA 1O7EA 4LV2A 3A3FA 4IVIA 5FQKA 3VP0A 3OPHA 1IYSA 4RA7A 4Y7PA 3EQUA 4IVKA 1KGEA 1M6KA 1IYPA 2EX2A 2EX9A 1BT5A 2FFYA 1ERMA 5CEBA 2Y2HA 4FH2A 2XH9A 1KVMA 3UO9A 2HP9A 2R9WA 4LCMA 1RGZA 1IKIA 1PYYA 3M6BA 2OLUA 4RYEA 4KZ3A 3PBSA 1CEFA 2Y2NA 3DWZA 4R1GA 4MEZA 1W8YA 4K0WA 3NCKA 5AQAA 3IHBA 5A91A 1K57C 1QMFA 2Y2QA 3MBZA 2ZC3B 4OQGA 4ZJ1A 3RJUA 5FATA 4UA9A 1TDLA 4U0TA 2GDNA 1PW1A 1XP4A 5A93A 2XEPA 1ERQA 3IXHA 3DTMA 4JPMA 2ZQ8A 1SDNA 4UHUA 3SS5A 2XLNA 3SS4A 2QMIA 5E2FA 3WS1A 4E3NA 1BZAA 3E2LA 3FYZA 4QJGA 3MZEA 1E3UA 4R4SA 4A5RA 4QHCA 5FI7A 5GLCA 3WS2A 3C4PA 4K0XA 1K25A 3A3IA 3HVFA 5EVIC 1PI5A 4OP5A 2Y2GA 1IEMA 4PM7A 5CEDA 1L0GA 1JWPA 4JKTA 2DCFA 2C5WB 2PBYA 1ONGA 4S2PA 1NYYA 2CC1A 4BL2A 5KZHA 4L0LA 2J8YA 3MKEA 2H0YA 2Y55A 5E2GA 1YLWA 5DF9A 4KZ8A 4WM9A 1JWVA 3N8LA 5EECA 1KE3A 2WAFA 3LCEA 1GHMA 3HLFA 3OPLA 3NDEA 4JXVA 3ZHHA 1LHYA 3FWLA 5DTTA 1GHIA 1NY0A 1RCJA 5D3OA 4PM9A 1NJ4A 2JE5A 4NK3A 2QPNA 1FSYA 2IWBA 1RGYA 1W8QA 1MY8A 1G68A 1KVLA 4EUZA 3IQAA 3PAGA 2V20A 3N8SA 5DTSA 1RP5A 3GSGA 4OOLA 5E2HA 5FQMA 4BJPA 1MPLA 3W4OA 2VGJA 1Z6FA 1JTGA 3IF5A 1CK3A 2V1ZA 2Y91A 5CXWA 1LI9A 5A90A 2Q9MA 2Y2OA 1HTZA 1K38A 4C75A 4N92A 1GHPA 1YLYA 4PMAA 5KMWA 1KE4A 1BLSA 4OKPA 4S2LA 4FSFA 4IEDA 1L0DA 4OPYA 1YT4A 1BUEA 4OPQA 3TOIA 4DF6A 3IF6A 1I2WA 4KG5A 1M40A 2I72A 3G4PA 3IWOA 4DXCA 4YINA 4UA6A 3BFCA 1K54A 2A3UA 2RL3A 3CMZA 5M19A 1H8YA 3E2KA 2XF3A 1PIOA 3VSLA 4DE2A 4PM8A 4DRTA 3G2ZA 4QY5A 3HUNA 2EXAA 2X71A 4XUZA 3Q82A 2JCHA 3WS5A 5I94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG9 A;  1N4O A;  1FCN A;  1FCO A;  4P0M A;  5F1F A;  3VMA A;  5DTK A;  5BOH A;  4KZ4 A;  4MNR A;  3UDX A;  4S2N A;  4BQM A;  2IWD A;  4MLL A;  2FFF B;  3AGF A;  2DNS A;  1K57 A;  3CZD A;  1K4F A;  5AQ9 A;  3A3J A;  3MZD A;  4MBK A;  4C3Q A;  1KDS A;  4R4R A;  3HLW A;  4X68 A;  4B4X A;  4GOG A;  1LLB A;  2R9X A;  4RX3 A;  4ZBE A;  5HFO A;  1E3U D;  3UDI A;  3O3V A;  1VQQ A;  1JVJ A;  2UWX A;  5U47 A;  3CG5 A;  2Z2M B;  2A49 A;  3BLM A;  2WAD A;  3O88 A;  2WGW A;  5AQB A;  1S6R A;  1SHV A;  3BRM A;  4OP8 A;  4QU3 A;  1ERO A;  3FKW A;  2JC7 A;  3LEZ A;  4DE3 A;  5HL1 A;  2V2F F;  3VP2 A;  4OPZ A;  1JWZ A;  1K55 C;  1ZG6 A;  4P87 A;  2G2U A;  5FSR A;  3V3R A;  5GLA A;  3GVB A;  3UPP A;  2ZQC A;  4R3J A;  3SOI A;  1LL9 A;  4DE1 A;  3IHA A;  3Q07 A;  3OCL A;  4P85 A;  2WZZ A;  4WYY A;  4OH0 A;  1FR1 A;  5EOE A;  4LEN A;  5L2F A;  3VSK A;  4OPR A;  3D4F A;  4DKI A;  3BLS A;  4BEN A;  3LO7 A;  2QZ6 A;  4DE0 A;  2PU4 A;  2ZC5 B;  2J9P A;  4EBN A;  4E3L A;  3M2K A;  3ZGA B;  4FCF A;  3OC2 A;  3WWX A;  5GHZ A;  2HP5 A;  1DJA A;  4GD8 A;  3Q81 A;  4BD0 A;  4DXB A;  1K4E A;  3VFH A;  5GHY A;  4KZB A;  1BUL A;  1TVF A;  4ZAM A;  4X53 A;  5CHJ A;  1H8Z A;  3VOZ A;  1I2S A;  2XQZ A;  3BM6 A;  1LL5 A;  4X69 A;  3VP1 A;  4N1H A;  2HDU A;  2XFS A;  1YLZ A;  5CGW A;  1KGF A;  4GD6 A;  1S0W A;  3V50 A;  4IBX A;  1XXM A;  3IXD A;  4GNU A;  3IXB A;  4JXG A;  5FI2 A;  3ZG0 A;  5CRF A;  2Z2L B;  4BLM A;  3IWI A;  4DDY A;  3C7V A;  1NZO A;  2ZQ7 A;  1IYQ A;  4D2O A;  4KEN B;  4X55 A;  2WKH A;  3GR2 A;  2Y4A A;  2Y2K A;  1MWR A;  3OPP A;  5FI6 A;  2E8I A;  3VFF A;  1TEM A;  4KQO A;  3ZCZ A;  3M2J A;  5KSH A;  4OLG A;  2WUQ A;  5FAO A;  2ZQ9 A;  4GKU A;  2WZX A;  5FAQ A;  5JYP A;  4FH4 A;  4H8R A;  1ES4 A;  2OSU A;  2WGV A;  4O7D A;  1PWC A;  3BEC A;  3UY6 A;  4YFM A;  4X56 A;  3I7J A;  2IWC A;  1ES5 A;  1PWD A;  3WRT A;  4Q8I A;  5EPH A;  2EFU A;  4QY6 A;  1GCE A;  3UE3 A;  1E25 A;  3P98 A;  3ZG8 B;  5EVL A;  3OCN A;  3LY4 A;  4JF4 A;  1PZO A;  4UA7 A;  1K56 A;  1ZKJ A;  1YQS A;  4PPR A;  4WZ5 A;  1C3B A;  2VGK A;  4KG6 A;  1YLP A;  4R23 A;  5DF7 A;  1DY6 A;  4R0Q A;  1CI9 A;  4FD8 A;  3UPN A;  3MXR A;  1L0E A;  4ID4 A;  1H5X A;  3ZNY A;  3UNW A;  3SS3 A;  3O87 A;  3PBQ A;  3AGE A;  3G35 A;  4JXW A;  4KG2 A;  5CER A;  1LI0 A;  4C6Y A;  1BSG A;  4P6B A;  4ZDX A;  4WMC A;  1FQG A;  5KSC A;  5GL9 A;  1QME A;  2B5R A;  1YMX A;  3GMW A;  4N9L A;  1OME A;  5TR7 A;  3EQV A;  3P09 A;  2WK0 A;  2WKI A;  1SDE A;  3ISG A;  4JLF A;  5FDH A;  1NYM A;  4OLD A;  5F83 A;  2HP6 A;  4Y0O A;  1W79 A;  5E43 A;  2BG1 A;  5FAS A;  3Q7V B;  4PM5 A;  4HEF A;  5EUA A;  4Y0T A;  3UN7 A;  3HLD A;  4LCL A;  3G34 A;  4E6X A;  1CEG A;  3S4X A;  4HBU A;  1NXY A;  4CPK A;  4WZ4 A;  3SH7 A;  1GA0 A;  1XPB A;  4OQI A;  3OPR A;  4LV1 A;  1BLP A;  2OV5 A;  2ZM8 A;  4S2J A;  1CI8 A;  3N8R A;  4E3K A;  1DJB A;  3UE1 A;  1JTD A;  3NBL A;  2WGW B;  2XFT A;  1WYC A;  3DW0 A;  4XXR A;  4BD1 A;  2HDS A;  1XA7 A;  1Y54 A;  1WYB A;  1MKI A;  3N7W A;  1HVB A;  3B3X A;  2Y2I A;  1ESI A;  1N9B A;  2ZJ9 A;  1XA1 A;  1YLT A;  2ZQD A;  1IYO A;  2HDR A;  3G31 A;  2WGI A;  3WS0 A;  1XGI A;  5GHX A;  2H10 A;  4U3T A;  5FQI A;  2Y2P A;  4U0X A;  1VM1 A;  2BLS A;  5EVI A;  1Q2Q A;  3IF6 C;  5AQ7 A;  4ZJ3 A;  3MXS A;  5EE8 A;  2H0T A;  1XX2 A;  4QB8 A;  3QNC A;  2XGN A;  2P9V A;  1HD8 A;  3C5A A;  3C4O A;  1K54 C;  4GB7 A;  4OVD A;  2X01 A;  4N9K A;  3OZH A;  1ES3 A;  1G6A A;  2EX8 A;  3AGD A;  3BYD A;  5HAP A;  1EWZ A;  1ALQ A;  1ZC2 A;  2XD1 A;  4S2I A;  3PBN A;  3UPO A;  1FR6 A;  4WBG A;  5CHM A;  1L0F A;  3PTE A;  1ONH A;  5F82 A;  2Y2M A;  1KGG A;  3HLE A;  2Y59 A;  3VP4 A;  3VOY A;  4DDS A;  1FOF A;  4E3I A;  3JYI A;  4OON A;  4KZA A;  4GZB A;  1W5D A;  5FA7 A;  4HBT A;  4KQR A;  3O86 A;  5FQ9 A;  1PWG A;  4E6W A;  3VP3 A;  4S2N C;  5A92 A;  1YMS A;  2XD5 A;  3HL9 A;  4KZ5 A;  1K56 D;  4RVA A;  4F94 A;  4ZJ2 A;  3V3S A;  2Y2L A;  3ZG5 A;  3IH8 A;  4N1X A;  4OQH A;  5IHV A;  5EOO A;  1MWS A;  1AXB A;  3SH9 A;  3PBO A;  4HES A;  5DF8 A;  5F1G A;  2G2W A;  3C7U A;  4K91 A;  3GV9 A;  3IH9 A;  1KE0 A;  3Q1F A;  5CGS A;  5CHU A;  4IBR A;  4QD4 A;  3MZF A;  1GA9 A;  1XKZ A;  2ZMA A;  3ZDJ A;  4Y0U A;  1WE4 A;  5HAI A;  4S2M A;  1BLH A;  3G2Y A;  4WMC D;  4KZ9 A;  5HW3 A;  1NRF A;  3A3E A;  5GLB A;  4LV3 A;  3Q7Z A;  4E3J A;  1PW8 A;  2ZLY A;  1NZU A;  2J9O A;  2ZD8 A;  3FZC A;  1IEL A;  2ZM2 A;  1Q2P A;  3N6I A;  3PBR A;  5DVA A;  4ZTK A;  5FAP A;  3GRJ A;  3ZVW A;  2ZC6 B;  1PI4 A;  4JBF A;  4X6T A;  3PBT A;  1MWU A;  3NC8 A;  2WKE A;  5E2E A;  3LY3 A;  3ITA A;  4EBP A;  4GDB A;  4E3O A;  4MBF A;  4WEJ A;  4JF5 A;  3UE0 A;  3GTC A;  5M1A A;  4WEL A;  1XGJ A;  3BFD A;  2X02 A;  4GN2 A;  5GLD A;  3DWK A;  4EQI A;  1W7F A;  3G32 A;  1HZO A;  1ZG4 A;  3IF6 B;  4KQQ A;  3A3D A;  4Z9Q A;  3HLC A;  5HX9 A;  4BL3 A;  3HUM A;  1J9M A;  3BFF A;  1L2S A;  1ES2 A;  2H5S A;  2EFX A;  4JXS A;  3TSG A;  3HLG A;  3RXX A;  1IKG A;  3HLB A;  1MWT A;  5HAR A;  3NI9 A;  4UAA A;  1I5Q A;  3ZVT A;  3ZNT A;  2EXB A;  1E4D A;  1EI5 A;  3BFE A;  3QNB A;  4S2K A;  4S2O A;  4WEK A;  1MBL A;  5CGX A;  3ITB A;  4PM6 A;  5HAQ A;  1FSW A;  2Y2J A;  3NIA A;  3ZG7 B;  4EV4 A;  2ZQA A;  4KZ7 A;  3S1Y A;  1YLJ A;  5G18 A;  1O07 A;  3UDF A;  1U60 A;  5EVI D;  3WRZ A;  1K6S A;  3V39 A;  4RX2 A;  2OLV A;  3NDG A;  1K55 A;  3G30 A;  3NY4 A;  4R3B A;  1BLC A;  1FCM A;  3BEB A;  3N4I A;  4NET A;  5FQJ A;  3RXW A;  4GDN A;  1K6R A;  2XK1 A;  4CJN A;  2EX6 A;  2P74 A;  5JYO A;  5J8X A;  3HUO A;  3S22 A;  4EBL A;  3W4P A;  4B88 A;  1YM1 A;  3MKF A;  2XDM A;  2PU2 A;  1MXO A;  5CTM A;  3W4Q A;  3WS4 A;  1BTL A;  5FQQ A;  2HDQ A;  1ESU A;  2XR0 A;  2HPB A;  3V5M A;  1DJC A;  3ZFZ A;  1SCW A;  3FKV A;  2ZM0 A;  3HRE A;  4EWF A;  1SKF A;  4XUX A;  3IT9 A;  5CTN A;  4B4Z A;  1PZP A;  2RCX A;  3CJM A;  5TGF A;  4WZ5 C;  4E3M A;  2C6W B;  5EVI B;  3W8K A;  2ZC4 B;  2JBF A;  4M3K A;  2WYX A;  3FV7 A;  5TFQ A;  3Q7V A;  2ZC7 A;  3IWQ A;  5M18 A;  4LV0 A;  2J7V A;  2P9V B;  3HBR A;  4JF6 A;  4MBH A;  4OOM A;  3ZG9 B;  3M6H A;  4OQ0 A;  4OOY A;  1KDW A;  2WAE A;  3IXG A;  3SH8 A;  3GQZ A;  5CEC A;  4KZ6 A;  2Q9N A;  3BFG A;  3QHY A;  3PAE A;  3MFD A;  2DRW A;  1TDG A;  1O7E A;  4LV2 A;  3A3F A;  4IVI A;  5FQK A;  3VP0 A;  3OPH A;  1IYS A;  4RA7 A;  4Y7P A;  3EQU A;  4IVK A;  1KGE A;  1M6K A;  1IYP A;  2EX2 A;  2EX9 A;  1BT5 A;  2FFY A;  1ERM A;  5CEB A;  2Y2H A;  4FH2 A;  2XH9 A;  1KVM A;  3UO9 A;  2HP9 A;  2R9W A;  4LCM A;  1RGZ A;  1IKI A;  1PYY A;  3M6B A;  2OLU A;  4RYE A;  4KZ3 A;  3PBS A;  1CEF A;  2Y2N A;  3DWZ A;  4R1G A;  4MEZ A;  1W8Y A;  4K0W A;  3NCK A;  5AQA A;  3IHB A;  5A91 A;  1K57 C;  1QMF A;  2Y2Q A;  3MBZ A;  2ZC3 B;  4OQG A;  4ZJ1 A;  3RJU A;  5FAT A;  4UA9 A;  1TDL A;  4U0T A;  2GDN A;  1PW1 A;  1XP4 A;  5A93 A;  2XEP A;  1ERQ A;  3IXH A;  3DTM A;  4JPM A;  2ZQ8 A;  1SDN A;  4UHU A;  3SS5 A;  2XLN A;  3SS4 A;  2QMI A;  5E2F A;  3WS1 A;  4E3N A;  1BZA A;  3E2L A;  3FYZ A;  4QJG A;  3MZE A;  1E3U A;  4R4S A;  4A5R A;  4QHC A;  5FI7 A;  5GLC A;  3WS2 A;  3C4P A;  4K0X A;  1K25 A;  3A3I A;  3HVF A;  5EVI C;  1PI5 A;  4OP5 A;  2Y2G A;  1IEM A;  4PM7 A;  5CED A;  1L0G A;  1JWP A;  4JKT A;  2DCF A;  2C5W B;  2PBY A;  1ONG A;  4S2P A;  1NYY A;  2CC1 A;  4BL2 A;  5KZH A;  4L0L A;  2J8Y A;  3MKE A;  2H0Y A;  2Y55 A;  5E2G A;  1YLW A;  5DF9 A;  4KZ8 A;  4WM9 A;  1JWV A;  3N8L A;  5EEC A;  1KE3 A;  2WAF A;  3LCE A;  1GHM A;  3HLF A;  3OPL A;  3NDE A;  4JXV A;  3ZHH A;  1LHY A;  3FWL A;  5DTT A;  1GHI A;  1NY0 A;  1RCJ A;  5D3O A;  4PM9 A;  1NJ4 A;  2JE5 A;  4NK3 A;  2QPN A;  1FSY A;  2IWB A;  1RGY A;  1W8Q A;  1MY8 A;  1G68 A;  1KVL A;  4EUZ A;  3IQA A;  3PAG A;  2V20 A;  3N8S A;  5DTS A;  1RP5 A;  3GSG A;  4OOL A;  5E2H A;  5FQM A;  4BJP A;  1MPL A;  3W4O A;  2VGJ A;  1Z6F A;  1JTG A;  3IF5 A;  1CK3 A;  2V1Z A;  2Y91 A;  5CXW A;  1LI9 A;  5A90 A;  2Q9M A;  2Y2O A;  1HTZ A;  1K38 A;  4C75 A;  4N92 A;  1GHP A;  1YLY A;  4PMA A;  5KMW A;  1KE4 A;  1BLS A;  4OKP A;  4S2L A;  4FSF A;  4IED A;  1L0D A;  4OPY A;  1YT4 A;  1BUE A;  4OPQ A;  3TOI A;  4DF6 A;  3IF6 A;  1I2W A;  4KG5 A;  1M40 A;  2I72 A;  3G4P A;  3IWO A;  4DXC A;  4YIN A;  4UA6 A;  3BFC A;  1K54 A;  2A3U A;  2RL3 A;  3CMZ A;  5M19 A;  1H8Y A;  3E2K A;  2XF3 A;  1PIO A;  3VSL A;  4DE2 A;  4PM8 A;  4DRT A;  3G2Z A;  4QY5 A;  3HUN A;  2EXA A;  2X71 A;  4XUZ A;  3Q82 A;  2JCH A;  3WS5 A;  5I94 A; 
#chains in the Genus database with same CATH topology
 3TG9 A;  1N4O A;  1FCN A;  1FCO A;  3UDX A;  1OTA A;  1L3L A;  2VA0 A;  3AGF A;  1XJ6 A;  1K4F A;  3A3J A;  4MBK A;  4C3Q A;  4CLC C;  5MC7 A;  1KDS A;  2NUP C;  3IBJ A;  4GOG A;  1E3U D;  1OTD A;  1VQQ A;  2VV7 A;  2WAD A;  1SHV A;  3BRM A;  3E4O A;  4I3A A;  4HOI A;  3FKW A;  2G2U A;  3T4Q A;  5HZH A;  3GVB A;  4NXG A;  2ZQC A;  4HY8 A;  3D9Y A;  1P9R A;  3R4K A;  2M1C A;  3OCL A;  2WZZ A;  1FR1 A;  5EOE A;  5L2F A;  4DKI A;  3FPV A;  4GHI B;  4BEN A;  5HWT A;  3OC2 A;  3D3O A;  1DJA A;  4BD0 A;  2A2L A;  3VFH A;  4FUW A;  5GHY A;  1BUL A;  5EFW A;  4X53 A;  3KYE A;  4MMN A;  3VOZ A;  2XQZ A;  1LL5 A;  3LFV A;  3IS2 B;  4N1H A;  3U4L P;  5DFX A;  3CAX A;  4PKY G;  2PD8 A;  1ACF A;  3IXD A;  5J7E A;  5FI2 A;  3K2N A;  4IJG A;  2ZQ7 A;  4KEN B;  2WKH A;  3GR2 A;  3VFF A;  1TEM A;  5KSH A;  2WUQ A;  5JYP A;  4FH4 A;  4CLC B;  2OSU A;  1PWC A;  2PR6 A;  3BEC A;  3MFX A;  3UMD A;  3UE3 A;  2XA7 S;  1K56 A;  3FC7 A;  4WZ5 A;  1C3B A;  4MN5 A;  2VGK A;  2ZMV A;  4KG6 A;  1DY6 A;  3LIB A;  4GS9 B;  1G28 A;  1PFL A;  3ZNY A;  3UNW A;  3O87 A;  3F1O B;  5CER A;  4Y15 A;  4P6B A;  1FQG A;  5GL9 A;  3KSG A;  5TR7 A;  2WKI A;  4IUH A;  3C38 A;  3L9K A;  4OLD A;  5E43 A;  2BG1 A;  4WL9 A;  3LIA A;  3UN7 A;  5HD3 A;  2Y79 A;  4E6X A;  3S4X A;  3RTY A;  5L07 A;  4CPK A;  1GA0 A;  1XPB A;  3OPR A;  2OV5 A;  3IX8 A;  3UE1 A;  3NBL A;  3DW0 A;  4XXR A;  2PYR A;  3EWK A;  1XJ4 A;  1WYB A;  4EW7 A;  5FDS A;  1HVB A;  2ZOI A;  4EEU A;  2H10 A;  1VM1 A;  2BLS A;  3IF6 C;  3MXS A;  4WN5 A;  3QNC A;  1HD8 A;  1K54 C;  1F9I A;  3OZH A;  3P7N A;  1ALQ A;  2XD1 A;  4EET B;  1FR6 A;  5F82 A;  2Y2M A;  1CQA A;  1YKD A;  3HLE A;  3VP4 A;  1DP9 A;  2V1B A;  1S1Z A;  5FQ9 A;  3TRC A;  4E6W A;  5A92 A;  4KZ5 A;  3KX0 X;  4F94 A;  1K56 D;  3IH8 A;  2W3H A;  2R78 A;  3SH9 A;  5F1G A;  4K91 A;  2BTF P;  3GV9 A;  4NXF A;  3MZF A;  2ZMA A;  2Y8H A;  1LSV A;  2I9V A;  1BLH A;  3UB8 A;  3LR5 A;  3A3E A;  4LV3 A;  2NUT C;  3FZC A;  1NZU A;  1OJG A;  3N6I A;  5FAP A;  3LI8 A;  1PI4 A;  4JBF A;  4Q0H A;  3FPW A;  5M1A A;  1YAX A;  3BFD A;  4GN2 A;  2HV1 A;  4BBU A;  3BQA A;  1AWI A;  1ZG4 A;  3IF6 B;  3O5Y A;  3A3D A;  2BAS A;  2E8J A;  5FEG A;  2O9A A;  3T50 A;  4G3W A;  3HLB A;  3NI9 A;  5FL3 A;  2O9B A;  5CGX A;  5HAQ A;  2ZQA A;  4Z1W A;  3ZYT A;  4GCZ A;  2HJE A;  2OLV A;  3NDG A;  3G30 A;  5HSQ A;  1FCM A;  4NET A;  1T19 A;  2XK1 A;  4B88 A;  3MSH A;  2B18 A;  5HD5 A;  2PU2 A;  1MXO A;  3W4Q A;  3WS4 A;  5FQQ A;  1ESU A;  1TS8 A;  1XJ2 A;  2A24 B;  2ZM0 A;  2VV6 A;  4BBT A;  2VV8 A;  3H7W B;  4XUX A;  1PZP A;  2RCX A;  4E3M A;  5TGF A;  4WZ5 C;  2ZC4 B;  2PRF A;  3ZG9 B;  1XFQ A;  1W63 M;  2WAE A;  3GQZ A;  5DKL A;  3BFG A;  3QHY A;  2QHK A;  4LV2 A;  1WA9 A;  3ICY A;  3VP0 A;  1IYS A;  4RA7 A;  4IVK A;  1KGE A;  1ZTU A;  2EX9 A;  2FFY A;  3DTI A;  2Y2H A;  1KVM A;  4WUJ A;  4ZRR A;  2D01 A;  4LCM A;  1IKI A;  2OLU A;  4LFU A;  3B33 A;  1S67 L;  4RYE A;  2Y2N A;  3DWZ A;  4R1G A;  2Y2Q A;  3MBZ A;  4ZJ1 A;  2ZC3 B;  4UA9 A;  4WLA A;  3CI6 A;  1PW1 A;  2JKT M;  2XEP A;  2L4R A;  5EVE A;  3DBA A;  3JVU A;  3SS5 A;  4GHI A;  2QMI A;  1UGU A;  4E3N A;  3E2L A;  1XJ3 A;  3QP8 A;  3MZE A;  4DN0 A;  4R4S A;  4A5R A;  4QHC A;  5HDS A;  3LR3 A;  5CED A;  2DCF A;  1P97 A;  4X1M A;  1NWZ A;  4B9O A;  2GZA A;  4B93 A;  4R70 A;  1YLW A;  1D7E A;  1JWV A;  3ZHH A;  4JXV A;  5DTT A;  1RCJ A;  2IWB A;  2QPN A;  1G68 A;  3LYX A;  3IQA A;  3PAG A;  2V20 A;  3N8S A;  5FQM A;  1MPL A;  2VGJ A;  1JTG A;  3IF5 A;  4ARZ B;  2Y91 A;  1LI9 A;  4N92 A;  4S2L A;  4FSF A;  1L0D A;  1BUE A;  3E98 A;  2I72 A;  3DAV A;  2A3U A;  1YSP A;  4PM8 A;  3G2Z A;  2X71 A;  3WS5 A;  2PDR A;  3T1R A;  5DTK A;  5BOH A;  4S2N A;  4BQM A;  2IWD A;  2FFF B;  4EEP A;  3R7W B;  1F98 A;  1K57 A;  5LBR A;  1LLB A;  2R9X A;  4RX3 A;  3UDI A;  5U47 A;  3BLM A;  2VLG A;  5HL1 A;  4ME4 A;  2Z6D A;  3VP2 A;  1MC0 A;  4OPZ A;  4P87 A;  5FSR A;  3V3R A;  5GLA A;  3KO6 A;  3CHW P;  2QJ7 A;  1P9W A;  3SOI A;  3IX4 A;  2W0N A;  5L10 A;  3LEQ A;  1VHM A;  3BLS A;  4HJ4 A;  4DE0 A;  3ZGA B;  4YWZ A;  3LIE A;  1TVF A;  2IA2 A;  1VET A;  1H8Z A;  4X69 A;  1YLZ A;  5CGW A;  3MQQ A;  3ULF A;  4IBX A;  3IWI A;  1NZO A;  1PNE A;  4X55 A;  5A8B A;  1MWR A;  5FI6 A;  2E8I A;  2ZBB A;  2H28 A;  5FAO A;  2ZQ9 A;  4UEY A;  3TW8 A;  4O7D A;  4YFM A;  5IS1 A;  3I7J A;  3T4L A;  1ES5 A;  4Q8I A;  5EPH A;  3OBF A;  4ETZ A;  1GCE A;  3BJN A;  3P98 A;  5F5Y A;  3VE3 A;  3OCN A;  3LY4 A;  4HP4 A;  3GDI A;  4ESP A;  4R23 A;  4R0Q A;  3EEA A;  2VJW A;  1CI9 A;  4FD8 A;  3MXR A;  1L0E A;  2B02 A;  4ID4 A;  2UV0 E;  5IT5 A;  2Q0O A;  2L0W A;  3PBQ A;  3PYP A;  4EU0 A;  4JXW A;  4KG2 A;  4L9E A;  1BSG A;  1T1C A;  2P08 A;  4WMC A;  1QME A;  1N9N A;  4M4X A;  1YMX A;  3B47 A;  3GMW A;  4N9L A;  2XRO A;  1GSX A;  5FDH A;  1NYM A;  1X0O A;  3E4Q A;  4LCL A;  2XRN A;  4HJ3 A;  4WZ4 A;  5HPI A;  3SH7 A;  4HIA A;  2ZL1 B;  2ZM8 A;  4E3K A;  1DJB A;  2WGW B;  3K3D A;  3BW6 A;  1WYC A;  4BD1 A;  2HDS A;  1MKI A;  1N9O A;  1K0K A;  3SZT A;  2Y2I A;  2ZJ9 A;  1N9B A;  3D72 A;  3CIT A;  2ZQD A;  2A24 A;  3G31 A;  3OLO A;  3S7O A;  3H7W A;  5FQI A;  1Q2Q A;  4LRZ E;  5AQ7 A;  4BWI A;  1NRJ A;  3C4O A;  4OVD A;  1MZU A;  3AGD A;  3LID A;  5HAP A;  1EWZ A;  2KX6 A;  1ZC2 A;  3JPU A;  1ONH A;  5HDC A;  1KGG A;  3VOY A;  3JYI A;  1DP8 A;  5FA7 A;  4KQR A;  3JVV A;  2JKT I;  3VP3 A;  2JHE A;  4S2N C;  4RVA A;  3HL9 A;  3E4P A;  2Y2L A;  2P04 A;  4OQH A;  5IHV A;  3PBO A;  3C7U A;  3OOV A;  1GA9 A;  4Y0U A;  4S2M A;  4WMC D;  4KZ9 A;  1NRF A;  5GLB A;  2Z6C A;  3SW1 A;  1PW8 A;  3UB5 P;  4PHT A;  1IEL A;  4ZTK A;  3GRJ A;  2YKH A;  1MWU A;  3KSF A;  3LY3 A;  5E2E A;  4EBP A;  3W2Z A;  4E3O A;  4MBF A;  5F6A A;  4WEL A;  5AVE A;  2X02 A;  1HZO A;  4EUV A;  4KQQ A;  1J9M A;  1OJ5 A;  1ES2 A;  4G3V A;  1Z09 A;  2PYP A;  3TSG A;  3MQO A;  4FOF A;  3RXX A;  1MWT A;  4UAA A;  1I5Q A;  3ZNT A;  4S2O A;  1MBL A;  3P01 A;  4EV4 A;  5L09 A;  3S1Y A;  1YLJ A;  1DRM A;  1U60 A;  4RX2 A;  4ARZ A;  1K55 A;  1OTB A;  4R3B A;  4Q0J A;  3BEB A;  3RXW A;  4IHQ A;  4YNR A;  5JYO A;  5J8X A;  3HUO A;  1P0Z A;  3W4P A;  3MKF A;  2XR0 A;  3V5M A;  3ZFZ A;  1SCW A;  3FKV A;  1SKF A;  3IT9 A;  4B4Z A;  5EVI B;  4KUK A;  4M3K A;  3Q7V A;  2ZC7 A;  3HJK A;  2P9V B;  4Q0I A;  5DFY A;  4OOY A;  1KDW A;  3BWL A;  3LR0 A;  3IXG A;  3SH8 A;  5CEC A;  2OAQ 1;  3EGX C;  3MFD A;  3R7W A;  1TDG A;  1O7E A;  3A3F A;  4IVI A;  3A0V A;  2INW A;  1M6K A;  1BT5 A;  1VET B;  2XH9 A;  1VEU A;  3M6B A;  3VV4 A;  2M7U A;  3PBS A;  4MEZ A;  1W8Y A;  5AQA A;  3IHB A;  1QMF A;  3BY8 A;  3RJU A;  1TDL A;  4U0T A;  2GDN A;  3ZQ5 A;  1IFQ A;  2V0U A;  3RFB A;  2W3G A;  2XLN A;  5J4E A;  3CWF A;  4QJG A;  3FYZ A;  1S1Y A;  3QP2 A;  2JKR M;  2WKR A;  4LGW A;  5GLC A;  4JGQ A;  3C4P A;  4PAU A;  3HVF A;  1PI5 A;  1IEM A;  4RQ9 A;  2J8Y A;  1SZV A;  2D02 A;  4KZ8 A;  2QKP A;  3QP5 A;  4L9F A;  3FWL A;  2J3W A;  1GHI A;  1NY0 A;  4PM9 A;  1NJ4 A;  2JE5 A;  1FSY A;  4LRY C;  1RGY A;  5HWW A;  1KVL A;  2K2N A;  5E2H A;  4QWO A;  2W3F A;  1Z6F A;  3BY9 A;  5HWV A;  1CK3 A;  2V1Z A;  4C75 A;  1GHP A;  5KMW A;  4X1L A;  3UE6 A;  3NOP C;  1TS7 A;  1YT4 A;  5AVF A;  4DF6 A;  3G4P A;  3IWO A;  4YIN A;  3BFC A;  5M19 A;  2LB9 A;  4QY5 A;  3HUN A;  4XUZ A;  5I5L A;  2W1R A;  3F1P B;  3KSI A;  4P0M A;  5F1F A;  4HJ6 A;  3VMA A;  4MNR A;  4O01 A;  3K3C A;  2GX5 A;  3UB6 A;  2DNS A;  5AQ9 A;  3MZD A;  3HLW A;  4X68 A;  4ZBE A;  5HFO A;  2ZL1 A;  2UWX A;  2A49 A;  3O88 A;  2WGW A;  3LI9 A;  2JC7 A;  2V2F F;  3LIC A;  4I39 A;  1JWZ A;  1K55 C;  1ZG6 A;  4QPR A;  3UPP A;  4JGP A;  4R3J A;  3IHA A;  2O0Y A;  4WYY A;  4LEN A;  4UQI S;  3VSK A;  3D4F A;  3LO7 A;  2QZ6 A;  2ZC5 B;  4UQI M;  4E3L A;  1H3Q A;  5GHZ A;  2HP5 A;  4GD8 A;  3Q81 A;  4DXB A;  1K4E A;  5G4Y A;  3T4T A;  4LRX C;  5CHJ A;  3BM6 A;  2OOL A;  2W3E A;  2XFS A;  4GD6 A;  4GNU A;  2KOI A;  4JXG A;  3ZG0 A;  5CRF A;  2Z2L B;  4BLM A;  1IYQ A;  3OPP A;  4KQO A;  3ZCZ A;  3M2J A;  4OLG A;  2IWC A;  1PWD A;  2EFU A;  4ETX A;  4QY6 A;  5FEF A;  1E25 A;  1Y28 A;  3ZG8 B;  1Y4O A;  5HDD A;  4JF4 A;  1W63 Q;  1YQS A;  2VZW A;  3GEC A;  2EA9 A;  1H5X A;  3SS3 A;  3T1S A;  1MKM A;  2W1T A;  1LI0 A;  4C6Y A;  3T1Q B;  4ZDX A;  4HH3 A;  3ISG A;  4LPZ A;  2HP6 A;  4Y0O A;  1W79 A;  3Q7V B;  4HEF A;  3HLD A;  1DP6 A;  3G34 A;  1T1B A;  1CEG A;  4HBU A;  1NXY A;  4OQI A;  4LV1 A;  1BLP A;  3N8R A;  3UME A;  3PXP A;  1XA7 A;  1Y54 A;  1VEU B;  3N7W A;  2XSS A;  2WKQ A;  3B3X A;  1LSW A;  1ESI A;  1F2K A;  1SKO B;  1YLT A;  1IYO A;  2HDR A;  2O99 A;  2FZ0 A;  1FIL A;  3H9W A;  1XGI A;  5GHX A;  5EVI A;  1XX2 A;  2XGN A;  2P9V A;  5G4Z A;  4GB7 A;  2HJ9 C;  1ES3 A;  2EX8 A;  3BYD A;  3PBN A;  3UPO A;  4WBG A;  3PTE A;  4FTX A;  2MJ6 A;  2Y59 A;  1FOF A;  1H8M A;  4HBT A;  2XD5 A;  4GLQ A;  4ZJ2 A;  1NLY A;  4E04 A;  4N1X A;  5EOO A;  5DF8 A;  2G2W A;  3Q1F A;  5K5B A;  5CHU A;  4IBR A;  4QD4 A;  1XKZ A;  3BQ8 A;  2QWS A;  4R38 A;  3G2Y A;  3E0Y A;  1IOU A;  2ZLY A;  2J9O A;  2ZD8 A;  4E3I A;  2ZM2 A;  3CPT A;  3PBR A;  5DVA A;  2ZC6 B;  1V9Y A;  4X6T A;  4DJ3 A;  3H82 A;  3UE0 A;  3MF0 A;  1XGJ A;  3A0R A;  1W7F A;  3DTK A;  3MR0 A;  4Z9Q A;  4BL3 A;  3HLC A;  5HX9 A;  3HUM A;  3BFF A;  1L2S A;  2VKS A;  5EV0 A;  1YSQ A;  2H5S A;  4JXS A;  3NHQ A;  1IKG A;  2ZOH A;  5HAR A;  3ZVT A;  2J80 A;  2EXB A;  1EI5 A;  4S2K A;  4WEK A;  3ITB A;  3LUQ A;  1FSW A;  3IX3 A;  3NIA A;  3ZG7 B;  2G7U A;  1G6O A;  4KZ7 A;  5G18 A;  5EVI D;  1CF0 A;  1PRQ A;  1K6S A;  3T4K A;  3VE4 A;  3V39 A;  3EOI A;  3NY4 A;  1BLC A;  1LSX A;  3TJZ C;  1K6R A;  2EX6 A;  1N9L A;  4AFI A;  3S22 A;  2V9A A;  1YM1 A;  4Y2F A;  1BTL A;  2HDQ A;  2PAV P;  1A0K A;  3NUL A;  3HRE A;  4CQH A;  3VOL A;  3CJM A;  2C6W B;  3IBR A;  4NXE A;  3W8K A;  2JBF A;  3FV7 A;  5TFQ A;  4LV0 A;  2J7V A;  3HBR A;  4MBH A;  3TE8 A;  4OOM A;  3F1P A;  3M6H A;  4OQ0 A;  5TBM B;  4KZ6 A;  3PAE A;  2DRW A;  3CLO A;  2VK3 A;  3T4S A;  5FQK A;  2EX2 A;  1ERM A;  5CEB A;  4FH2 A;  3UO9 A;  1OT9 A;  3S7P A;  1PYY A;  2HGV A;  3C8C A;  4NKP A;  3NCK A;  5A91 A;  1HLU P;  1K57 C;  5FAT A;  4XT2 B;  2FH5 A;  1XP4 A;  2PBD P;  4O8G A;  3IXH A;  4HHD A;  4L9G A;  4IUK A;  1SDN A;  3SS4 A;  5E2F A;  3WS1 A;  1BZA A;  5HL6 A;  1ZHH B;  4NXB A;  1K25 A;  3A3I A;  5EVI C;  2Y2G A;  4PM7 A;  1JWP A;  2PBY A;  1ONG A;  1NYY A;  5HPF A;  5AJG A;  3RH8 B;  4BL2 A;  4II7 A;  5E2G A;  5DJU A;  3S7Q A;  3N8L A;  1KE3 A;  3LCE A;  3NDE A;  2W1T B;  3T4O A;  1UWN X;  5D3O A;  1W8Q A;  1LL8 A;  1MY8 A;  4EUZ A;  4MCW A;  1FIK A;  4BJP A;  3W4O A;  3UB7 A;  2W27 A;  5CXW A;  2XA7 M;  2Y2O A;  1HTZ A;  1K38 A;  1YLY A;  4PMA A;  1KE4 A;  1BLS A;  2YKF A;  3B42 A;  5EM0 A;  4I3J A;  1I2W A;  1M40 A;  1G5U A;  2GNX A;  4KUO A;  4F3L B;  4EES A;  2RL3 A;  1H0M A;  3E2K A;  4CLC E;  4DE2 A;  1PIO A;  5F68 A;  3VSL A;  2EXA A;  3Q82 A;  4HH2 A;  3A0S A;  3MMH A;  4GJ4 A;  4GW9 A;  1JNU A;  4KZ4 A;  3U2A A;  3LIF A;  4MLL A;  4EXO A;  2J3T D;  3CZD A;  3LGO A;  1KOU A;  2KLI A;  4R4R A;  4MN7 A;  4B4X A;  3O3V A;  1JVJ A;  4HP9 A;  3CG5 A;  2Z2M B;  1NLZ A;  3MQ0 A;  5AQB A;  5DJT A;  1S6R A;  4OP8 A;  4QU3 A;  4DE3 A;  1ERO A;  3LEZ A;  3LR4 A;  3L7H A;  2V8F A;  1CJF A;  4H6J A;  1SKO A;  3QP1 A;  1LL9 A;  1ODV A;  4HNB A;  3Q07 A;  4DE1 A;  3PHY A;  4P85 A;  2JKF A;  4OH0 A;  4EQ1 A;  4EER A;  4OPR A;  2PU4 A;  4EBN A;  2J9P A;  3M2K A;  4FCF A;  3WWX A;  4YOF A;  2K7S A;  4Y5F A;  1T1A A;  4KZB A;  3CPT B;  4ZAM A;  4R6L A;  1I2S A;  3H82 B;  2EWW A;  2GJ3 A;  3VP1 A;  5F69 A;  2HDU A;  4PKY A;  1KGF A;  1S0W A;  5KIZ A;  3V50 A;  1XXM A;  3IXB A;  4DDY A;  3C7V A;  4D2O A;  2Y4A A;  2Y2K A;  2L1M A;  3KSH A;  4GKU A;  1OTE A;  2WZX A;  5FAQ A;  4H8R A;  1ES4 A;  2WGV A;  3UY6 A;  3NJA A;  4X56 A;  3HJI A;  3WRT A;  3NOT C;  3CUE A;  5EVL A;  3S7N A;  4BBV A;  1PZO A;  4UA7 A;  1STZ A;  1ZKJ A;  2J3T C;  3F1N A;  4NEE D;  4PPR A;  3C30 A;  1TF1 A;  5DF7 A;  1YLP A;  3UPN A;  4I5S A;  4X25 A;  3AGE A;  3G35 A;  5KSC A;  2VEA A;  2B5R A;  1OME A;  3EQV A;  3P09 A;  2WK0 A;  3QP6 A;  1SDE A;  3MXQ A;  4JLF A;  3FG8 A;  5F83 A;  5FAS A;  4MDZ A;  4PM5 A;  2VX8 A;  5EUA A;  2K31 A;  4Y0T A;  4HQA A;  2PD7 A;  3NOU C;  5EM1 A;  1BYW A;  1GSV A;  4S2J A;  4K08 A;  1CI8 A;  1JTD A;  2XFT A;  5DKK A;  1EW0 A;  1XA1 A;  2WGI A;  3WS0 A;  4U3T A;  2Y2P A;  4U0X A;  3DTE A;  2P7J A;  4ZJ3 A;  5EE8 A;  2H0T A;  4QB8 A;  4I38 A;  3C5A A;  2X01 A;  4N9K A;  1G6A A;  5TBM A;  4S2I A;  5CHM A;  1L0F A;  4I3I A;  4D60 A;  4DDS A;  4OON A;  4KZA A;  4GZB A;  1W5D A;  1YPR A;  1S4S A;  3O86 A;  1PWG A;  3PR6 A;  1YMS A;  5CX7 A;  3V3S A;  3ZG5 A;  2PT7 A;  3EGD C;  1OPX A;  1MWS A;  1AXB A;  4HES A;  4Y3I A;  2HZ5 A;  3IH9 A;  1KE0 A;  5CGS A;  1OT6 A;  3ZDJ A;  1T18 A;  4XT2 A;  1WE4 A;  5HAI A;  2QJ5 A;  5HW3 A;  1V9Z A;  3MJQ A;  3Q7Z A;  4E3J A;  3T12 B;  1Q2P A;  2EWV A;  4NG2 A;  3ZVW A;  3PBT A;  3NC8 A;  1GSW A;  2WKE A;  1D1J A;  3ITA A;  4GDB A;  3MS6 A;  3IS2 A;  2AVX A;  4JF5 A;  4WEJ A;  3GTC A;  2HF6 A;  4G3K A;  3QP4 A;  2OWH A;  5GLD A;  3DWK A;  4EQI A;  3G32 A;  3UB9 A;  2QYB A;  4LLO B;  2EFX A;  3T1X A;  3HLG A;  4CLC A;  1TD5 A;  4Y17 A;  1E4D A;  3BFE A;  3C2W A;  3QNB A;  4PM6 A;  2Y2J A;  1O07 A;  3UDF A;  3WRZ A;  2B95 A;  2PHY A;  3N4I A;  5FQJ A;  4GS9 A;  4GDN A;  4CJN A;  4Y13 A;  2P74 A;  4EBL A;  3KYQ A;  2XDM A;  3F1O A;  5CTM A;  3CUE C;  2HPB A;  4JGR A;  1DJC A;  5J3W A;  3T4J A;  4EWF A;  4F3L A;  5CTN A;  2DMW A;  2JN7 A;  4H6J B;  2W3D A;  2WYX A;  1VB6 A;  5M18 A;  3IWQ A;  2ZMF A;  4JF6 A;  4BMW A;  1J3W A;  2M7V A;  2Q9N A;  3NEC A;  1XFN A;  1D06 A;  3OPH A;  4Y7P A;  3EQU A;  3V67 A;  1IYP A;  1F5M A;  2HP9 A;  2R9W A;  1RGZ A;  5C5K A;  2V8C A;  1S66 L;  4KZ3 A;  4R3A A;  1CEF A;  3G6O A;  4K0W A;  3KYZ A;  4OQG A;  2LB5 A;  2JKR I;  2O9C A;  4MN6 A;  2OWJ A;  5A93 A;  1ERQ A;  3DTM A;  4JPM A;  2KDK A;  2OAP 1;  2ZQ8 A;  4UHU A;  4CLC D;  2CMN A;  2ACG A;  1E3U A;  4WF0 A;  4KQD A;  5FI7 A;  3WS2 A;  4K0X A;  4OP5 A;  5L8M A;  4DJ2 A;  1L0G A;  4JKT A;  2C5W B;  4S2P A;  2PR5 A;  3F1N B;  2CC1 A;  1TS0 A;  5KZH A;  4L0L A;  3MKE A;  3HCY A;  2H0Y A;  1LT0 A;  2Y55 A;  5DF9 A;  4WM9 A;  5EEC A;  4O0P A;  2WAF A;  1GHM A;  3HLF A;  3OPL A;  1LHY A;  1S4R A;  4NK3 A;  4DMZ A;  5DTS A;  1RP5 A;  3GSG A;  4OOL A;  2VGL S;  2JKG A;  2WKP A;  1TS6 A;  2VGL M;  1UWP X;  2V0W A;  5A90 A;  2Q9M A;  4P6Z S;  4HI4 A;  4P6Z M;  4OKP A;  4IED A;  4OPY A;  4OPQ A;  3TOI A;  3IF6 A;  4KG5 A;  1OTI A;  5TJJ A;  4DXC A;  4UA6 A;  1K54 A;  2V1A A;  4JGO A;  3CMZ A;  1H8Y A;  2XF3 A;  5IU1 A;  4DRT A;  3EEH A;  2JCH A;  5I94 A; 
#chains in the Genus database with same CATH homology
 3TG9 A;  1N4O A;  1FCN A;  1FCO A;  4P0M A;  5F1F A;  3VMA A;  5DTK A;  5BOH A;  4KZ4 A;  4MNR A;  3UDX A;  4S2N A;  4BQM A;  2IWD A;  4MLL A;  2FFF B;  3AGF A;  2DNS A;  1K57 A;  3CZD A;  1K4F A;  5AQ9 A;  3A3J A;  3MZD A;  4MBK A;  4C3Q A;  1KDS A;  4R4R A;  3HLW A;  4X68 A;  4B4X A;  4GOG A;  1LLB A;  2R9X A;  4RX3 A;  4ZBE A;  5HFO A;  1E3U D;  3UDI A;  3O3V A;  1VQQ A;  1JVJ A;  2UWX A;  5U47 A;  3CG5 A;  2Z2M B;  2A49 A;  3BLM A;  2WAD A;  3O88 A;  2WGW A;  5AQB A;  1S6R A;  1SHV A;  3BRM A;  4OP8 A;  4QU3 A;  1ERO A;  3FKW A;  2JC7 A;  3LEZ A;  4DE3 A;  5HL1 A;  2V2F F;  3VP2 A;  4OPZ A;  1JWZ A;  1K55 C;  1ZG6 A;  4P87 A;  2G2U A;  5FSR A;  3V3R A;  5GLA A;  3GVB A;  3UPP A;  2ZQC A;  4R3J A;  3SOI A;  1LL9 A;  4DE1 A;  3IHA A;  3Q07 A;  3OCL A;  4P85 A;  2WZZ A;  4WYY A;  4OH0 A;  1FR1 A;  5EOE A;  4LEN A;  5L2F A;  3VSK A;  4OPR A;  3D4F A;  4DKI A;  3BLS A;  4BEN A;  3LO7 A;  2QZ6 A;  4DE0 A;  2PU4 A;  2ZC5 B;  2J9P A;  4EBN A;  4E3L A;  3M2K A;  3ZGA B;  4FCF A;  3OC2 A;  3WWX A;  5GHZ A;  2HP5 A;  1DJA A;  4GD8 A;  3Q81 A;  4BD0 A;  4DXB A;  1K4E A;  3VFH A;  5GHY A;  4KZB A;  1BUL A;  1TVF A;  4ZAM A;  4X53 A;  5CHJ A;  1H8Z A;  3VOZ A;  1I2S A;  2XQZ A;  3BM6 A;  1LL5 A;  4X69 A;  3VP1 A;  4N1H A;  2HDU A;  2XFS A;  1YLZ A;  5CGW A;  1KGF A;  4GD6 A;  1S0W A;  3V50 A;  4IBX A;  1XXM A;  3IXD A;  4GNU A;  3IXB A;  4JXG A;  5FI2 A;  3ZG0 A;  5CRF A;  2Z2L B;  4BLM A;  3IWI A;  4DDY A;  3C7V A;  1NZO A;  2ZQ7 A;  1IYQ A;  4D2O A;  4KEN B;  4X55 A;  2WKH A;  3GR2 A;  2Y4A A;  2Y2K A;  1MWR A;  3OPP A;  5FI6 A;  2E8I A;  3VFF A;  1TEM A;  4KQO A;  3ZCZ A;  3M2J A;  5KSH A;  4OLG A;  2WUQ A;  5FAO A;  2ZQ9 A;  4GKU A;  2WZX A;  5FAQ A;  5JYP A;  4FH4 A;  4H8R A;  1ES4 A;  2OSU A;  2WGV A;  4O7D A;  1PWC A;  3BEC A;  3UY6 A;  4YFM A;  4X56 A;  3I7J A;  2IWC A;  1ES5 A;  1PWD A;  3WRT A;  4Q8I A;  5EPH A;  2EFU A;  4QY6 A;  1GCE A;  3UE3 A;  1E25 A;  3P98 A;  3ZG8 B;  5EVL A;  3OCN A;  3LY4 A;  4JF4 A;  1PZO A;  4UA7 A;  1K56 A;  1ZKJ A;  1YQS A;  4PPR A;  4WZ5 A;  1C3B A;  2VGK A;  4KG6 A;  1YLP A;  4R23 A;  5DF7 A;  1DY6 A;  4R0Q A;  1CI9 A;  4FD8 A;  3UPN A;  3MXR A;  1L0E A;  4ID4 A;  1H5X A;  3ZNY A;  3UNW A;  3SS3 A;  3O87 A;  3PBQ A;  3AGE A;  3G35 A;  4JXW A;  4KG2 A;  5CER A;  1LI0 A;  4C6Y A;  1BSG A;  4P6B A;  4ZDX A;  4WMC A;  1FQG A;  5KSC A;  5GL9 A;  1QME A;  2B5R A;  1YMX A;  3GMW A;  4N9L A;  1OME A;  5TR7 A;  3EQV A;  3P09 A;  2WK0 A;  2WKI A;  1SDE A;  3ISG A;  4JLF A;  5FDH A;  1NYM A;  4OLD A;  5F83 A;  2HP6 A;  4Y0O A;  1W79 A;  5E43 A;  2BG1 A;  5FAS A;  3Q7V B;  4PM5 A;  4HEF A;  5EUA A;  4Y0T A;  3UN7 A;  3HLD A;  4LCL A;  3G34 A;  4E6X A;  1CEG A;  3S4X A;  4HBU A;  1NXY A;  4CPK A;  4WZ4 A;  3SH7 A;  1GA0 A;  1XPB A;  4OQI A;  3OPR A;  4LV1 A;  1BLP A;  2OV5 A;  2ZM8 A;  4S2J A;  1CI8 A;  3N8R A;  4E3K A;  1DJB A;  3UE1 A;  1JTD A;  3NBL A;  2WGW B;  2XFT A;  1WYC A;  3DW0 A;  4XXR A;  4BD1 A;  2HDS A;  1XA7 A;  1Y54 A;  1WYB A;  1MKI A;  3N7W A;  1HVB A;  3B3X A;  2Y2I A;  1ESI A;  1N9B A;  2ZJ9 A;  1XA1 A;  1YLT A;  2ZQD A;  1IYO A;  2HDR A;  3G31 A;  2WGI A;  3WS0 A;  1XGI A;  5GHX A;  2H10 A;  4U3T A;  5FQI A;  2Y2P A;  4U0X A;  1VM1 A;  2BLS A;  5EVI A;  1Q2Q A;  3IF6 C;  5AQ7 A;  4ZJ3 A;  3MXS A;  5EE8 A;  2H0T A;  1XX2 A;  4QB8 A;  3QNC A;  2XGN A;  2P9V A;  1HD8 A;  3C5A A;  3C4O A;  1K54 C;  4GB7 A;  4OVD A;  2X01 A;  4N9K A;  3OZH A;  1ES3 A;  1G6A A;  2EX8 A;  3AGD A;  3BYD A;  5HAP A;  1EWZ A;  1ALQ A;  1ZC2 A;  2XD1 A;  4S2I A;  3PBN A;  3UPO A;  1FR6 A;  4WBG A;  5CHM A;  1L0F A;  3PTE A;  1ONH A;  5F82 A;  2Y2M A;  1KGG A;  3HLE A;  2Y59 A;  3VP4 A;  3VOY A;  4DDS A;  1FOF A;  4E3I A;  3JYI A;  4OON A;  4KZA A;  4GZB A;  1W5D A;  5FA7 A;  4HBT A;  4KQR A;  3O86 A;  5FQ9 A;  1PWG A;  4E6W A;  3VP3 A;  4S2N C;  5A92 A;  1YMS A;  2XD5 A;  3HL9 A;  4KZ5 A;  1K56 D;  4RVA A;  4F94 A;  4ZJ2 A;  3V3S A;  2Y2L A;  3ZG5 A;  3IH8 A;  4N1X A;  4OQH A;  5IHV A;  5EOO A;  1MWS A;  1AXB A;  3SH9 A;  3PBO A;  4HES A;  5DF8 A;  5F1G A;  2G2W A;  3C7U A;  4K91 A;  3GV9 A;  3IH9 A;  1KE0 A;  3Q1F A;  5CGS A;  5CHU A;  4IBR A;  4QD4 A;  3MZF A;  1GA9 A;  1XKZ A;  2ZMA A;  3ZDJ A;  4Y0U A;  1WE4 A;  5HAI A;  4S2M A;  1BLH A;  3G2Y A;  4WMC D;  4KZ9 A;  5HW3 A;  1NRF A;  3A3E A;  5GLB A;  4LV3 A;  3Q7Z A;  4E3J A;  1PW8 A;  2ZLY A;  1NZU A;  2J9O A;  2ZD8 A;  3FZC A;  1IEL A;  2ZM2 A;  1Q2P A;  3N6I A;  3PBR A;  5DVA A;  4ZTK A;  5FAP A;  3GRJ A;  3ZVW A;  2ZC6 B;  1PI4 A;  4JBF A;  4X6T A;  3PBT A;  1MWU A;  3NC8 A;  2WKE A;  5E2E A;  3LY3 A;  3ITA A;  4EBP A;  4GDB A;  4E3O A;  4MBF A;  4WEJ A;  4JF5 A;  3UE0 A;  3GTC A;  5M1A A;  4WEL A;  1XGJ A;  3BFD A;  2X02 A;  4GN2 A;  5GLD A;  3DWK A;  4EQI A;  1W7F A;  3G32 A;  1HZO A;  1ZG4 A;  3IF6 B;  4KQQ A;  3A3D A;  4Z9Q A;  3HLC A;  5HX9 A;  4BL3 A;  3HUM A;  1J9M A;  3BFF A;  1L2S A;  1ES2 A;  2H5S A;  2EFX A;  4JXS A;  3TSG A;  3HLG A;  3RXX A;  1IKG A;  3HLB A;  1MWT A;  5HAR A;  3NI9 A;  4UAA A;  1I5Q A;  3ZVT A;  3ZNT A;  2EXB A;  1E4D A;  1EI5 A;  3BFE A;  3QNB A;  4S2K A;  4S2O A;  4WEK A;  1MBL A;  5CGX A;  3ITB A;  4PM6 A;  5HAQ A;  1FSW A;  2Y2J A;  3NIA A;  3ZG7 B;  4EV4 A;  2ZQA A;  4KZ7 A;  3S1Y A;  1YLJ A;  5G18 A;  1O07 A;  3UDF A;  1U60 A;  5EVI D;  3WRZ A;  1K6S A;  3V39 A;  4RX2 A;  2OLV A;  3NDG A;  1K55 A;  3G30 A;  3NY4 A;  4R3B A;  1BLC A;  1FCM A;  3BEB A;  3N4I A;  4NET A;  5FQJ A;  3RXW A;  4GDN A;  1K6R A;  2XK1 A;  4CJN A;  2EX6 A;  2P74 A;  5JYO A;  5J8X A;  3HUO A;  3S22 A;  4EBL A;  3W4P A;  4B88 A;  1YM1 A;  3MKF A;  2XDM A;  2PU2 A;  1MXO A;  5CTM A;  3W4Q A;  3WS4 A;  1BTL A;  5FQQ A;  2HDQ A;  1ESU A;  2XR0 A;  2HPB A;  3V5M A;  1DJC A;  3ZFZ A;  1SCW A;  3FKV A;  2ZM0 A;  3HRE A;  4EWF A;  1SKF A;  4XUX A;  3IT9 A;  5CTN A;  4B4Z A;  1PZP A;  2RCX A;  3CJM A;  5TGF A;  4WZ5 C;  4E3M A;  2C6W B;  5EVI B;  3W8K A;  2ZC4 B;  2JBF A;  4M3K A;  2WYX A;  3FV7 A;  5TFQ A;  3Q7V A;  2ZC7 A;  3IWQ A;  5M18 A;  4LV0 A;  2J7V A;  2P9V B;  3HBR A;  4JF6 A;  4MBH A;  4OOM A;  3ZG9 B;  3M6H A;  4OQ0 A;  4OOY A;  1KDW A;  2WAE A;  3IXG A;  3SH8 A;  3GQZ A;  5CEC A;  4KZ6 A;  2Q9N A;  3BFG A;  3QHY A;  3PAE A;  3MFD A;  2DRW A;  1TDG A;  1O7E A;  4LV2 A;  3A3F A;  4IVI A;  5FQK A;  3VP0 A;  3OPH A;  1IYS A;  4RA7 A;  4Y7P A;  3EQU A;  4IVK A;  1KGE A;  1M6K A;  1IYP A;  2EX2 A;  2EX9 A;  1BT5 A;  2FFY A;  1ERM A;  5CEB A;  2Y2H A;  4FH2 A;  2XH9 A;  1KVM A;  3UO9 A;  2HP9 A;  2R9W A;  4LCM A;  1RGZ A;  1IKI A;  1PYY A;  3M6B A;  2OLU A;  4RYE A;  4KZ3 A;  3PBS A;  1CEF A;  2Y2N A;  3DWZ A;  4R1G A;  4MEZ A;  1W8Y A;  4K0W A;  3NCK A;  5AQA A;  3IHB A;  5A91 A;  1K57 C;  1QMF A;  2Y2Q A;  3MBZ A;  2ZC3 B;  4OQG A;  4ZJ1 A;  3RJU A;  5FAT A;  4UA9 A;  1TDL A;  4U0T A;  2GDN A;  1PW1 A;  1XP4 A;  5A93 A;  2XEP A;  1ERQ A;  3IXH A;  3DTM A;  4JPM A;  2ZQ8 A;  1SDN A;  4UHU A;  3SS5 A;  2XLN A;  3SS4 A;  2QMI A;  5E2F A;  3WS1 A;  4E3N A;  1BZA A;  3E2L A;  3FYZ A;  4QJG A;  3MZE A;  1E3U A;  4R4S A;  4A5R A;  4QHC A;  5FI7 A;  5GLC A;  3WS2 A;  3C4P A;  4K0X A;  1K25 A;  3A3I A;  3HVF A;  5EVI C;  1PI5 A;  4OP5 A;  2Y2G A;  1IEM A;  4PM7 A;  5CED A;  1L0G A;  1JWP A;  4JKT A;  2DCF A;  2C5W B;  2PBY A;  1ONG A;  4S2P A;  1NYY A;  2CC1 A;  4BL2 A;  5KZH A;  4L0L A;  2J8Y A;  3MKE A;  2H0Y A;  2Y55 A;  5E2G A;  1YLW A;  5DF9 A;  4KZ8 A;  4WM9 A;  1JWV A;  3N8L A;  5EEC A;  1KE3 A;  2WAF A;  3LCE A;  1GHM A;  3HLF A;  3OPL A;  3NDE A;  4JXV A;  3ZHH A;  1LHY A;  3FWL A;  5DTT A;  1GHI A;  1NY0 A;  1RCJ A;  5D3O A;  4PM9 A;  1NJ4 A;  2JE5 A;  4NK3 A;  2QPN A;  1FSY A;  2IWB A;  1RGY A;  1W8Q A;  1MY8 A;  1G68 A;  1KVL A;  4EUZ A;  3IQA A;  3PAG A;  2V20 A;  3N8S A;  5DTS A;  1RP5 A;  3GSG A;  4OOL A;  5E2H A;  5FQM A;  4BJP A;  1MPL A;  3W4O A;  2VGJ A;  1Z6F A;  1JTG A;  3IF5 A;  1CK3 A;  2V1Z A;  2Y91 A;  5CXW A;  1LI9 A;  5A90 A;  2Q9M A;  2Y2O A;  1HTZ A;  1K38 A;  4C75 A;  4N92 A;  1GHP A;  1YLY A;  4PMA A;  5KMW A;  1KE4 A;  1BLS A;  4OKP A;  4S2L A;  4FSF A;  4IED A;  1L0D A;  4OPY A;  1YT4 A;  1BUE A;  4OPQ A;  3TOI A;  4DF6 A;  3IF6 A;  1I2W A;  4KG5 A;  1M40 A;  2I72 A;  3G4P A;  3IWO A;  4DXC A;  4YIN A;  4UA6 A;  3BFC A;  1K54 A;  2A3U A;  2RL3 A;  3CMZ A;  5M19 A;  1H8Y A;  3E2K A;  2XF3 A;  1PIO A;  3VSL A;  4DE2 A;  4PM8 A;  4DRT A;  3G2Z A;  4QY5 A;  3HUN A;  2EXA A;  2X71 A;  4XUZ A;  3Q82 A;  2JCH A;  3WS5 A;  5I94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...