4OOYA

Avibactam and class c beta-lactamases: mechanism of inhibition, conservation of binding pocket and implications for resistance
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
359
structure length
359
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Avibactam and Class C beta-Lactamases: Mechanism of Inhibition, Conservation of the Binding Pocket, and Implications for Resistance.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 121
structure length 359
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ooyA00
4Z9QA 1K38A 1NJ4A 4JKTA 5GL9A 4DDYA 2Y2PA 3WWXA 5A90A 3MXRA 4X56A 3ZG0A 5EVIA 3UDIA 4OLDA 1CI9A 1JVJA 4OONA 3OZHA 3HUNA 2UWXA 3A3DA 3IF6C 3WRZA 3QHYA 2WKIA 4JXWA 1HTZA 1I5QA 1O7EA 1S0WA 1MXOA 4EBLA 1YLPA 4E6XA 1EI5A 1DJAA 4WELA 5FAPA 2IWDA 3W4OA 5CGXA 5HARA 1MPLA 5F83A 3VOZA 4WZ4A 4BL2A 1XGJA 1E25A 1QMFA 2ZQ7A 1GCEA 2Y2HA 2XD5A 4OPRA 5FASA 4PM8A 5DTTA 4C75A 4MEZA 5HAPA 2EFXA 3OPRA 1PI4A 1WYBA 3PBQA 2E8IA 1S6RA 5CEDA 1YT4A 5L2FA 1CK3A 3Q7ZA 3A3IA 1EWZA 1N4OA 3G2YA 3TSGA 1KVMA 4JBFA 3VP3A 4E3JA 1MY8A 1BZAA 1IYOA 4LENA 2QMIA 2EX2A 3A3EA 5EECA 1MWSA 1KDWA 4EBNA 4HEFA 3FKVA 5DTKA 4PM7A 2X01A 3IWIA 1O07A 1E3UD 1K6RA 3OPLA 3V39A 2G2WA 2Z2LB 4S2OA 2WKHA 4CPKA 4ZJ1A 3M2KA 3N4IA 1VQQA 1WE4A 2Q9MA 5CEBA 2ZC5B 3BFCA 3W4PA 1N9BA 2P9VA 3BRMA 4ZAMA 5KZHA 2V20A 1L2SA 4OPYA 3G35A 1FCMA 3UPPA 3NBLA 2RL3A 5F82A 3VP2A 1YLJA 3LY4A 4OP8A 5A91A 4MBKA 1W79A 1JTGA 3IF6A 4D2OA 1IEMA 1ERQA 1DY6A 1BULA 1XXMA 1YQSA 5GLBA 3VP1A 1BLPA 4UA6A 4FH4A 1ALQA 4PMAA 3VMAA 2JCHA 3HUMA 4DKIA 3V3RA 2XD1A 1MBLA 2ZQ9A 2CC1A 3G34A 5FA7A 4B4XA 2ZQDA 4IVIA 4P85A 4BD1A 1BTLA 3OPPA 1W8QA 3WS0A 5CGWA 3VSLA 3IWOA 4S2IA 3SOIA 3GVBA 4QB8A 3QNCA 4IBRA 2XK1A 3ZG5A 5AQ7A 5GLCA 2PU4A 1TDLA 3GV9A 2XEPA 3HLFA 3IXBA 4GNUA 4RA7A 1L0GA 4PM6A 3WS4A 1FSWA 2QZ6A 4LV3A 4LV0A 3G32A 4N9LA 1YLZA 2HP6A 4M3KA 3UNWA 5CECA 1JWPA 1MWRA 2WUQA 4N92A 5FDHA 4GZBA 3NIAA 3WS1A 1KGGA 3G31A 3WRTA 2HDUA 1GA0A 3O3VA 3Q81A 2V2FF 3EQUA 4KZ6A 3IWQA 1MWTA 3WS2A 2HDQA 1LL5A 3MKEA 3I7JA 2Y2IA 1K55C 4JLFA 2WGWB 3CG5A 2Y2JA 2XQZA 5CTMA 3MZDA 1H5XA 5I94A 5GHYA 5E2GA 2Y4AA 3OC2A 4KG6A 2ZC6B 3CJMA 1K54C 4N1XA 1IKIA 5M19A 3ZCZA 4X55A 1XX2A 3FKWA 3RJUA 3AGEA 3NCKA 4L0LA 2ZMAA 1RGZA 1W8YA 4KZBA 3NY4A 5FQMA 4KZ8A 4OQIA 4DXCA 1EROA 1WYCA 4DE3A 5TFQA 3LCEA 3IQAA 2C5WB 3GQZA 1ES3A 2XF3A 3HLGA 2Y91A 3MZFA 5AQ9A 3W8KA 2RCXA 5E43A 5CTNA 5E2EA 3BECA 3BYDA 3VFHA 2EX6A 3TG9A 3VP4A 3ZVTA 3HLBA 3NDGA 3MFDA 4EBPA 1H8YA 1YM1A 4GOGA 4KG2A 5FQKA 2Y59A 3MBZA 5HFOA 1RGYA 2H5SA 4WM9A 4RYEA 5EOOA 5EVIB 5A92A 1ONGA 3JYIA 1LL9A 3UE3A 3PBNA 3N8RA 2Y2MA 3M6BA 3SH7A 1M40A 4B4ZA 3ZNYA 1GHPA 3N7WA 3AGDA 4EWFA 2HP9A 2A49A 4E3MA 3ZVWA 2DNSA 1TVFA 4BD0A 1L0FA 2VGKA 5EVLA 5A93A 1K56D 3BLMA 4X68A 2IWBA 3RXXA 4OVDA 3UPNA 4OKPA 3OCLA 4KQRA 4PPRA 5FATA 4BJPA 2H0TA 5BOHA 2X71A 4S2KA 4JXVA 2XDMA 1AXBA 2G2UA 5D3OA 4QJGA 4FCFA 5DVAA 2Z2MB 5CRFA 1BLHA 1PZOA 4KZ9A 1SDNA 1FCOA 1K55A 2VGJA 1L0EA 2ZM8A 1YLYA 1ES5A 1Z6FA 1ES4A 2Y2NA 3BFGA 4QY5A 4RVAA 2Y2GA 1K54A 5HL1A 1LLBA 4R3BA 1M6KA 2WAEA 1TDGA 2OLVA 4R23A 4UA7A 4P0MA 3BFFA 1PW1A 5FAOA 4KENB 2H10A 2QPNA 3C4OA 3TOIA 1IYQA 1KVLA 1I2SA 1IYPA 3UPOA 2ZD8A 3HLEA 5EVID 5CERA 3C4PA 4X69A 2HP5A 4S2PA 1K4FA 1XKZA 4CJNA 1YLTA 3O86A 4N1HA 3B3XA 1YMXA 1CEGA 1RP5A 4BLMA 4R3JA 3DW0A 4KZ5A 3EQVA 5FI2A 4XXRA 2ZC7A 2P9VB 2Y2LA 4C3QA 3CMZA 1ES2A 5GLDA 3P98A 4WYYA 4GB7A 5HX9A 3HLDA 4ZTKA 3HBRA 2R9XA 1NZOA 3LEZA 1K4EA 2XLNA 3IF6B 3OCNA 2PBYA 3ZFZA 1NY0A 1G6AA 2EXAA 4XUZA 3BM6A 3O88A 1XGIA 1KE0A 1HZOA 2EXBA 3N8LA 3UN7A 3S1YA 5EPHA 3ISGA 1SKFA 5DTSA 4UA9A 3MXSA 3ZNTA 2EFUA 2WAFA 4LV1A 1ZG4A 2I72A 4U0XA 1NZUA 4RX3A 3ZG9B 4WZ5C 2Y2KA 3GMWA 3E2LA 1C3BA 1H8ZA 5HAQA 1PWGA 1NXYA 4E3OA 3IF5A 4ZDXA 1GHIA 5JYOA 2GDNA 2BG1A 3PAEA 4K0WA 3M6HA 1ESUA 1HD8A 4QHCA 2A3UA 1CI8A 2WYXA 3AGFA 5FSRA 4LV2A 3Q1FA 1GHMA 1LI0A 2Q9NA 3LY3A 4IVKA 4E3IA 1NRFA 1RCJA 4DE2A 3IXHA 1KGEA 3Q7VA 3PBSA 4XUXA 1Y54A 2V1ZA 3UE1A 5E2FA 2ZM0A 4S2NC 1ESIA 2J7VA 3WS5A 1ZC2A 4WEKA 1L0DA 1G68A 1J9MA 1XP4A 4OP5A 1KE4A 2X02A 3BLSA 3FWLA 3SS5A 4E3LA 2EX9A 1YMSA 4X6TA 1Q2QA 4BL3A 2WGIA 4OOLA 4QU3A 1QMEA 4FSFA 4MBFA 5CHJA 5FAQA 2C6WB 1NYYA 1LHYA 5FI6A 4ZJ3A 1PZPA 4DRTA 1E4DA 3V3SA 4WMCD 4E6WA 1W5DA 4YINA 5M1AA 5CHMA 1SHVA 2XH9A 4GN2A 1FSYA 4KZ4A 4OQGA 3V50A 4OOMA 2PU2A 4R0QA 1JWVA 4QD4A 4C6YA 2ZLYA 1K57C 4JXGA 1JTDA 3O87A 2XFSA 4UHUA 2Y55A 1VM1A 2HPBA 4YFMA 4JPMA 3S4XA 2ZJ9A 1FR1A 4DDSA 3ZG8B 3NI9A 3PBTA 1FQGA 2JC7A 1XPBA 3PBOA 4R4RA 1SCWA 5U47A 3BFEA 3LO7A 4WZ5A 3IT9A 1DJCA 1KE3A 1E3UA 5KSCA 5DF7A 4OH0A 4GKUA 4MLLA 1IKGA 3SS4A 3N8SA 4PM5A 2JE5A 3M2JA 4B88A 3PBRA 1IYSA 3G30A 5EE8A 4F94A 4K91A 1MWUA 1PW8A 4WEJA 2ZC4B 2JBFA 4R1GA 1FR6A 5KMWA 1HVBA 4P87A 4O7DA 2J8YA 4H8RA 3IHAA 3FV7A 3CZDA 3QNBA 1PWDA 3GTCA 1BUEA 3UDXA 3FZCA 4S2NA 4GD6A 3RXWA 1PI5A 4U3TA 3UDFA 3IXGA 3W4QA 2IWCA 3C7UA 2WADA 1CEFA 1ONHA 3A3FA 4IEDA 5GLAA 4Y0TA 3E2KA 3GR2A 5F1GA 2OSUA 1KGFA 3GRJA 4NETA 4ID4A 3Q82A 2WGVA 5TGFA 1MKIA 2ZQCA 1YLWA 2H0YA 4JF4A 4K0XA 4GDNA 1GA9A 4KQOA 2B5RA 3ZG7B 4BQMA 3NC8A 1XA1A 2WZXA 4KQQA 5CHUA 2ZC3B 4FD8A 4Y0UA 4JF5A 4LCMA 4IBXA 4E3KA 4DF6A 2HDRA 4DXBA 3PTEA 4GD8A 3FYZA 3DTMA 4WBGA 2BLSA 5EOEA 5FI7A 4HBTA 3UY6A 4ZBEA 3P09A 4HESA 4R4SA 3ZHHA 5J8XA 1K57A 3V5MA 2ZQ8A 1ZKJA 2FFYA 3G2ZA 4MNRA 3UO9A 3ITBA 3VFFA 5F1FA 1BLSA 3ZGAB 1PIOA 3BEBA 3DWZA 4S2MA 5CXWA 4BENA 4GDBA 4RX2A 4X53A 2XR0A 3MZEA 3Q07A 4S2JA 4QY6A 4E3NA 2EX8A 3PAGA 1NYMA 2WKEA 2XFTA 4KZ7A 2Y2OA 4FH2A 5DF8A 4EV4A 5KSHA 1I2WA 2Y2QA 2J9PA 2ZM2A 4OPQA 4U0TA 1FOFA 1K25A 4MBHA 5CGSA 3HUOA 3SS3A 5EVIC 4PM9A 4DE1A 1XA7A 1FCNA 5GHXA 3HL9A 3ITAA 4NK3A 5AQBA 4EUZA 4JF6A 4WMCA 3OPHA 3UE0A 5IHVA 5HW3A 3IXDA 3D4FA 3BFDA 4KZAA 2ZQAA 5AQAA 3A3JA 4KG5A 3VP0A 1OMEA 3HVFA 4Q8IA 3NDEA 2FFFB 1Q2PA 1JWZA 3N6IA 3VSKA 1DJBA 1TEMA 4N9KA 4OQ0A 3C7VA 2DRWA 1KDSA 4ZJ2A 4S2LA 3Q7VB 3HREA 1SDEA 2WK0A 4HBUA 2OV5A 4A5RA 5GHZA 5M18A 3SH8A 1IELA 3IHBA 2OLUA 4OOYA 5FQ9A 4Y0OA 2P74A 3VOYA 2XGNA 2DCFA 2WZZA 2WGWA 1PWCA 3HLCA 4OQHA 1K56A 1U60A 4Y7PA 5FQIA 2J9OA 4DE0A 3IH8A 5E2HA 5TR7A 3DWKA 4EQIA 1W7FA 5DF9A 1BSGA 4P6BA 4KZ3A 5G18A 4JXSA 3C5AA 5HAIA 3GSGA 3MKFA 3SH9A 3ZDJA 5FQQA 1K6SA 2HDSA 2R9WA 5JYPA 5FQJA 1LI9A 4OPZA 1BT5A 4LCLA 3S22A 1PYYA 4OLGA 1BLCA 1ZG6A 3IH9A 1ERMA 3G4PA 4UAAA 5EUAA 3HLWA
chains in the Genus database with same CATH superfamily
2M7UA 4JKTA 1NJ4A 5GL9A 4DDYA 2Y2PA 4HOIA 3WWXA 1OTIA 4OONA 3WRZA 3QHYA 4JXWA 1O7EA 1S0WA 3RTYA 3T4LA 1V9ZA 2VZWA 2W3FA 1EI5A 5FAPA 2IWDA 5CGXA 5HARA 1YSPA 1MPLA 4BBUA 1XGJA 1CJFA 1PRQA 1PI4A 3PBQA 1S6RA 3A3IA 2ZMFA 1EWZA 1N4OA 4WF0A 1F5MA 2V0WA 1IYOA 2VGLM 4Q0JA 3A3EA 1S1YA 1PFLA 2B18A 5G4ZA 1OT9A 2JKTM 3HCYA 3D72A 1E3UD 1K6RA 5DFXA 3V39A 4CPKA 3N4IA 1WE4A 4HNBA 3W4PA 1OJ5A 2P9VA 3BRMA 1L2SA 4OPYA 3G35A 2RL3A 3VP2A 1YLJA 5A91A 1F9IA 1BLPA 4UA6A 1ALQA 3VMAA 2I9VA 2XD1A 4KQDA 2CC1A 3MMHA 4IVIA 1BTLA 4ETXA 4YNRA 3T4OA 2XSSA 3E4OA 5CGWA 4S2IA 4QB8A 3H82B 3ZG5A 5GLCA 3GV9A 2XEPA 5TBMA 4RA7A 1L0GA 5IU1A 3LICA 3G32A 3H7WA 3KSIA 1T19A 4M3KA 3UNWA 5CECA 1JWPA 2WUQA 4N92A 4F3LB 2M1CA 2HDUA 3Q81A 1D7EA 2HDQA 3NECA 3LGOA 4JLFA 4KG6A 4N1XA 4X55A 4H6JB 3AGEA 4L0LA 2ZMAA 4KZBA 4EXOA 2C5WB 2ZOIA 2PD7A 4NEED 3BECA 3BYDA 2EX6A 3TG9A 4GOGA 3T4QA 1RGYA 2H5SA 5EVIB 1ONGA 1LL9A 4GCZA 4NXFA 3N8RA 3SH7A 4O01A 1X0OA 3N7WA 4NG2A 3CPTA 2DNSA 3ZVWA 4BD0A 4OVDA 3UPNA 5FATA 1G5UA 2PRFA 4BJPA 5IS1A 2INWA 2X71A 4JXVA 1AXBA 2G2UA 5D3OA 4QJGA 3BY8A 4KUKA 2LB9A 4MMNA 1SDNA 2VGJA 1L0EA 3PR6A 2ZM8A 1DP9A 3IX4A 1YLYA 1ES5A 1Z6FA 4QY5A 2Y2NA 2NUPC 4L9GA 1M6KA 1TDGA 5FAOA 4WLAA 1T1AA 4S2PA 1XKZA 4LFUA 4CJNA 1YLTA 4N1HA 4BLMA 5FI2A 4XXRA 2ZC7A 2V0UA 3DAVA 3P98A 3HLDA 1MC0A 1NZOA 2J3TD 3T4KA 3IF6B 3OCNA 3S7NA 2EXAA 4XUZA 4Y17A 3EEAA 3UN7A 4CLCD 3ISGA 1VEUB 4XT2B 1P0ZA 4RX3A 1C3BA 1H8ZA 4GS9A 2IA2A 3OLOA 1NXYA 3JVUA 3DBAA 3KSGA 2MJ6A 4IVKA 4R3AA 1NRFA 4DE2A 1KGEA 3HJKA 3Q7VA 2V1ZA 2KLIA 4S2NC 1G68A 1XP4A 4OP5A 2X02A 3BLSA 3FWLA 3SS5A 1LSVA 1YMSA 1Q2QA 4BL3A 4OOLA 2VX8A 4FSFA 4MBFA 3EGXC 2VV8A 1E4DA 3LFVA 4E6WA 2OWJA 3A0SA 2B02A 4GN2A 1FSYA 5MC7A 4I38A 4OQGA 4OOMA 4R0QA 2ZLYA 2DMWA 1K57C 2W3EA 4HIAA 1T1CA 2HJEA 1VM1A 3S4XA 4DDSA 5HWWA 1XPBA 2UV0E 5U47A 3LEQA 1KE3A 4IUKA 4X25A 5KSCA 5K5BA 1IKGA 4PM5A 3MQQA 4B88A 5L07A 5EE8A 1IYSA 1PW8A 2BTFP 4O7DA 4DN0A 3IHAA 1PWDA 3MR0A 3FZCA 4S2NA 4GD6A 4U3TA 3UDFA 3VE4A 2PR5A 1K0KA 2IWCA 2WADA 1ONHA 4X1MA 3E2KA 1KGFA 2PT7A 3Q82A 2WGVA 1MKIA 2ZQCA 3FPVA 1XA1A 4KQQA 5FL3A 4FD8A 1XJ4A 1YPRA 2Z6DA 4JF5A 3T1SA 2VGLS 2HDRA 4IHQA 3FYZA 4HBTA 4ZBEA 2ACGA 5HDDA 4YWZA 1K57A 3V5MA 4DMZA 2ZQ8A 2FFYA 3G2ZA 1Y4OA 5F1FA 1BLSA 1OPXA 3BEBA 2XR0A 2EX8A 2WKEA 5DF8A 3L7HA 4JGOA 1K25A 3HUOA 5EVIC 3QP2A 4DE1A 1FCNA 3HL9A 5IHVA 4GHIB 5HW3A 3IXDA 3UB5P 4KG5A 3H82A 2FFFB 3KSHA 1JWZA 3N6IA 3VSKA 1TF1A 4HJ4A 2O9CA 4OQ0A 3C7VA 2R78A 3ZQ5A 3A0VA 2L4RA 1YAXA 4F3LA 5DKLA 1SDEA 5GHZA 1IELA 2O9BA 2K7SA 2WZZA 3HLCA 3VOYA 5KIZA 4OQHA 1K56A 4Y7PA 3KX0X 2V8CA 1DRMA 4P6ZS 4H6JA 5DF9A 5G18A 3TW8A 2PDRA 3SH9A 1P9RA 4QWOA 3QP6A 2R9WA 5JYPA 5FQJA 4OPZA 1BT5A 4AFIA 3UE6A 2VKSA 3V3SA 1ZHHB 1Z09A 3T1XA 5FDSA 4QPRA 3MXRA 4X56A 5A90A 4Y5FA 5EVIA 4O8GA 3HUNA 3IF6C 2WKIA 4PKYA 1I5QA 3T4TA 3OBFA 5HD3A 1TS7A 4NKPA 4WZ4A 4BL2A 4G3VA 3TRCA 3G6OA 2QWSA 2XD5A 4OPRA 4Y15A 4R38A 1TS6A 5DTTA 3OPRA 1WYBA 3C30A 3A0RA 5CEDA 5L2FA 2VA0A 3TSGA 1KVMA 3VP3A 3VOLA 5HD5A 3S7PA 2JKGA 1XFQA 2QMIA 2KX6A 1VHMA 3ICYA 2M7VA 3IWIA 3OPLA 4HY8A 2WKHA 1FILA 5CEBA 2PYPA 3BFCA 1STZA 2W3DA 4EQ1A 1FCMA 2A24B 5F82A 3LY4A 4OP8A 1W79A 3IF6A 1IEMA 1ERQA 1DY6A 1BULA 2JCHA 3HUMA 3LI9A 2FH5A 2ZQ9A 1VEUA 4XT2A 4JGRA 2ZQDA 4P85A 4BD1A 1GSWA 2OAQ1 2FZ0A 3QP8A 3B42A 5J3WA 3QNCA 3F1NB 2PU4A 4GNUA 3HLFA 4PM6A 3WS4A 2QZ6A 2PAVP 2HP6A 4FTXA 3NIAA 3WRTA 2V2FF 3IWQA 3MKEA 2NUTC 5CTMA 1H5XA 5E2GA 3OC2A 2GZAA 3FKWA 3CITA 3BJNA 3NY4A 4OQIA 2HV1A 3HJIA 4ARZB 2VEAA 3S7OA 3PYPA 1ES3A 2EWVA 2V9AA 3MZFA 5AQ9A 3W8KA 4II7A 3VP4A 3ZVTA 4I3AA 3NDGA 4EBPA 1H8YA 5FQKA 4ESPA 5A92A 1LSXA 1L3LA 3M6BA 1M40A 1IOUA 2KDKA 3ZNYA 1GHPA 3AGDA 2HP9A 1W63M 1ODVA 1K56D 4X68A 1SKOB 5DVAA 1XJ2A 2Z2MB 5CRFA 3CUEC 1PZOA 3MXQA 3T4SA 3BFGA 4RVAA 3QP1A 4R3BA 2W3HA 1JNUA 1S4RA 4BWIA 2QPNA 3TOIA 3DTEA 3HLEA 5EVID 4JGQA 4X69A 1OTDA 2HP5A 1A0KA 3K3DA 4C3QA 3KYEA 2XROA 3HBRA 3ZFZA 1NY0A 3O88A 3S1YA 1SKFA 5J7EA 3ZNTA 1XJ6A 2I72A 3D3OA 2Y2KA 4RQ9A 4GHIA 3FC7A 5CX7A 1IFQA 2GDNA 2BG1A 4MN6A 3PAEA 3M6HA 4QHCA 2WYXA 5FSRA 3CUEA 1GHMA 1LI0A 4PHTA 2O0YA 2O99A 1S66L 4XUXA 3UE1A 1ESIA 3WS5A 1L0DA 1J9MA 2W1TB 1GSVA 5F68A 4EETB 4X6TA 2WGIA 5FAQA 5FI6A 1VETA 4ZJ3A 1NYYA 1LHYA 1Y28A 3FPWA 4DRTA 3NHQA 1W5DA 4YINA 3V67A 2XH9A 3UMDA 3H9WA 2E8JA 5FEFA 1JWVA 3P01A 4G3WA 1JTDA 4YFMA 2KOIA 2Y55A 2HPBA 4JPMA 2ZJ9A 3NI9A 3PBTA 3EOIA 1FQGA 3PBOA 4R4RA 1SCWA 3IT9A 4OH0A 4MLLA 1PNEA 3PBRA 3G30A 3IX8A 1MWUA 3LUQA 1HVBA 5HZHA 4H8RA 3CWFA 1G28A 1BUEA 3LIFA 1PI5A 3KYZA 3RXWA 3DTKA 4ETZA 1CEFA 2P04A 5GLAA 3IX3A 1WA9A 3GR2A 5TGFA 1YLWA 3UB7A 4GDNA 1GA9A 4BQMA 3NC8A 1MZUA 5CHUA 5HPFA 4JGPA 3CHWP 4WL9A 5AVEA 1NRJA 4DF6A 4GD8A 3DTMA 1P9WA 5FI7A 3P09A 4R4SA 5J8XA 2L1MA 1ZKJA 4MNRA 5IT5A 3T4JA 3GECA 3VFFA 1PIOA 5CXWA 2A24A 4RX2A 3MZEA 3Q07A 4QY6A 3TE8A 2GJ3A 4OPQA 1FOFA 4MBHA 3SS3A 4G3KA 3ITAA 4EUZA 4WMCA 3OPHA 3UE0A 2QHKA 2W0NA 3F1NA 2ZL1B 3MJQA 5EFWA 1KDSA 3C8CA 4A5RA 2OV5A 3SH8A 4MCWA 2AVXA 5FQ9A 2VK3A 2VLGA 4EESA 2DCFA 1U60A 1YSQA 4B93A 5FQIA 5TJJA 5TR7A 5C5KA 3K2NA 2HGVA 4P6BA 1OTEA 3MQOA 3UMEA 3C5AA 3GSGA 2EWWA 3F1OB 4ARZA 3W2ZA 2D01A 1PYYA 1ZG6A 3IH9A 1ERMA 4Z9QA 3UDIA 1JVJA 5AJGA 3OZHA 4I3JA 1MXOA 1VB6A 4HQAA 1YLPA 4EBLA 4E6XA 1DJAA 4WELA 4CQHA 3W4OA 5F83A 3VOZA 2K2NA 1QMFA 1T1BA 2ZQ7A 1GCEA 5FASA 1SKOA 4EUVA 4C75A 4MEZA 5HAPA 3PXPA 2E8IA 3NULA 1CK3A 4L9EA 4CLCB 3KYQA 4E3JA 1P97A 1BZAA 4LENA 3MF0A 5EECA 1MWSA 3T50A 4HEFA 4WN5A 2X01A 3UB6A 3VV4A 4BBVA 1MKMA 3ZYTA 4S2OA 4ZJ1A 1VQQA 4PKYG 2ZC5B 1TS0A 5F69A 3C38A 3LR0A 5KZHA 2V20A 3NBLA 1JTGA 4D2OA 1XXMA 5AVFA 3VP1A 3E0YA 3K3CA 3V3RA 1ACFA 4DKIA 3G34A 5FA7A 1YKDA 2P7JA 4HI4A 3LI8A 4L9FA 2JHEA 3VSLA 3IWOA 1G6OA 2Y79A 4IBRA 2PHYA 1TDLA 3IXBA 4LV3A 4LGWA 4N9LA 1YLZA 1MWRA 4IJGA 5FDHA 4NXBA 1CQAA 5TBMB 1KGGA 3G31A 5A8BA 1OJGA 2W1TA 1GA0A 4KZ6A 2P08A 3EQUA 1LL5A 3I7JA 1K55C 2WGWB 3MZDA 4BMWA 2ZC6B 3CJMA 1K54C 5M19A 5HWVA 1XX2A 3RJUA 3NCKA 1RGZA 1W8YA 3E98A 4KZ8A 3R4KA 1EROA 1WYCA 4ZRRA 5TFQA 3IQAA 3GQZA 3HLGA 5E43A 5CTNA 5E2EA 4CLCE 3VFHA 3HLBA 4LRXC 2Y59A 4O0PA 3MBZA 4LRZE 4MN7A 4Q0IA 5HFOA 2QKPA 2VV6A 2XA7M 5EOOA 3UE3A 3P7NA 1N9NA 4EWFA 2A49A 4E3MA 1TVFA 4EU0A 1L0FA 5A93A 2IWBA 1N9OA 4I3IA 3OCLA 4PPRA 5BOHA 3L9KA 2XDMA 1V9YA 1FCOA 1K55A 4FOFA 5EV0A 2HF6A 1W63Q 1ES4A 2Y2GA 1K54A 2PD8A 3GDIA 2JN7A 2WAEA 5J4EA 4P0MA 1PW1A 4R70A 2H10A 2VJWA 1IYQA 1KVLA 1IYPA 3UPOA 2ZD8A 3NOPC 1HLUP 5CERA 3C4PA 1CF0A 1CEGA 1RP5A 4R3JA 4KZ5A 2Y2LA 1ES2A 4WYYA 4GB7A 5HX9A 4ZTKA 1K4EA 2XLNA 2PBYA 1G6AA 2B95A 1XGIA 1KE0A 1HZOA 3N8LA 4UA9A 2EFUA 2WAFA 4LV1A 1LSWA 4WZ5C 4I39A 1PWGA 3IF5A 3B33A 4GJ4A 4ZDXA 4K0WA 1ESUA 1HD8A 2ZL1A 3QP5A 4LV2A 1OTAA 2Q9NA 3LY3A 1NWZA 1RCJA 3IXHA 1Y54A 2J7VA 3RFBA 1UWNX 3VE3A 3S7QA 4CLCC 4QU3A 1QMEA 5CHJA 5HL6A 2H28A 3T1QB 3F1OA 3V50A 2PU2A 1LL8A 4ME4A 4QD4A 4C6YA 4JXGA 3O87A 2XFSA 4UHUA 3MQ0A 3MFXA 1H8MA 2JC7A 3QP4A 3LO7A 4WZ5A 3U2AA 1DJCA 2V1AA 3SS4A 3N8SA 2JE5A 3M2JA 4F94A 4K91A 4WEJA 1FR6A 5KMWA 4P87A 1AWIA 2J8YA 5DJUA 3FV7A 5L10A 3CZDA 3B47A 3GTCA 3UDXA 4EEUA 2YKFA 3C7UA 4CLCA 3U4LP 4Y0TA 2OSUA 4NETA 2HJ9C 3F1PB 2HZ5A 4KQOA 3ZG7B 2B5RA 1OTBA 2ZC3B 4LCMA 4IBXA 4E3KA 2BASA 3PTEA 3FG8A 5EOEA 5HSQA 3ITBA 4S2MA 1H3QA 4GDBA 3EWKA 3PAGA 2XFTA 4KZ7A 1EW0A 3LYXA 4FH2A 5KSHA 5L09A 1I2WA 5CGSA 2ZM2A 1N9LA 5G4YA 4I5SA 4LRYC 4PM9A 5GHXA 4NK3A 5AQBA 4JF6A 2V1BA 2ZQAA 3A3JA 3VP0A 3HVFA 4Y3IA 3PHYA 1DJBA 1TEMA 4N9KA 2DRWA 4S2LA 4LLOB 2WK0A 2Q0OA 5M18A 2OAP1 4Y0OA 2P74A 1PWCA 2WGWA 1NLYA 4HJ3A 4P6ZM 3OOVA 3DWKA 4EQIA 1W7FA 1BSGA 4KZ3A 4JXSA 5HAIA 5FQQA 1K6SA 2HDSA 1S4SA 1D06A 1H0MA 3S22A 2J80A 4OLGA 5EUAA 3NOTC 3HLWA 1K38A 3LIAA 3ZG0A 4OLDA 1CI9A 1ZTUA 4D60A 2UWXA 3A3DA 1HTZA 4PAUA 5L8MA 2XA7S 3E4QA 3DTIA 1E25A 5LBRA 2Y2HA 4PM8A 4BBTA 4UEYA 2EFXA 5HDSA 3BQ8A 1YT4A 3IS2B 4HH3A 3Q7ZA 2PBDP 3G2YA 1GSXA 4JBFA 1MY8A 1FIKA 4MDZA 1UGUA 2EX2A 2EA9A 4HP4A 1KDWA 4EBNA 3FKVA 5DTKA 4PM7A 1O07A 2G2WA 2Z2LB 4Y13A 1S67L 3M2KA 2Q9MA 1N9BA 3D9YA 2JKFA 3RH8B 2ZOHA 4ZAMA 2QYBA 3UPPA 2W27A 4MBKA 1YQSA 5GLBA 4FH4A 4PMAA 2O9AA 1MBLA 4DJ3A 4B4XA 4HH2A 3OPPA 5EM1A 2PR6A 1W8QA 3WS0A 3SOIA 3GVBA 3SW1A 2XK1A 4GW9A 5AQ7A 4B9OA 1F2KA 2QJ5A 1FSWA 4LV0A 1TD5A 4UQIM 4GZBA 3WS1A 5I5LA 5EM0A 3O3VA 3WS2A 4M4XA 1MWTA 2G7UA 3BY9A 4LPZA 2Y2IA 3CG5A 2Y2JA 2XQZA 1LT0A 5I94A 5GHYA 2Y4AA 3KO6A 1IKIA 3ZCZA 3LR4A 5FQMA 3R7WB 4DXCA 4DE3A 3LCEA 2XF3A 3IBRA 2Y91A 3C2WA 4X1LA 4FUWA 2RCXA 5F6AA 2XRNA 3LR5A 3MFDA 4EERA 1YM1A 4KG2A 5F5YA 2W1RA 3CAXA 4WM9A 4RYEA 3JYIA 3NOUC 3KSFA 3PBNA 4K08A 2Y2MA 1J3WA 4B4ZA 4GLQA 5EVEA 3E4PA 2VGKA 2JKRI 3LR3A 5EVLA 3BLMA 3RXXA 4OKPA 4KUOA 2Y8HA 4KQRA 2H0TA 4S2KA 3BWLA 4FCFA 1BLHA 4KZ9A 5DJTA 1KOUA 3F1PA 5HL1A 1SZVA 1LLBA 4R23A 2OLVA 4UA7A 2YKHA 3BFFA 4KENB 3C4OA 1NLZA 1I2SA 3NJAA 1K4FA 3O86A 3B3XA 1YMXA 3BQAA 3UB9A 2PYRA 3DW0A 3EQVA 2GNXA 1T18A 5HPIA 2P9VB 3CMZA 4NXEA 5GLDA 2R9XA 3LEZA 1UWPX 3BM6A 4R6LA 2EXBA 5EPHA 2W3GA 5HWTA 5DTSA 3MXSA 4HJ6A 2LB5A 1ZG4A 3MS6A 4U0XA 1NZUA 3ZG9B 3GMWA 3E2LA 5HAQA 2WKPA 4E3OA 1GHIA 1S1ZA 5JYOA 2A3UA 1CI8A 3AGFA 5DFYA 2J3WA 2Z6CA 3Q1FA 4E3IA 3H7WB 3PBSA 5E2FA 2ZM0A 1ZC2A 4WEKA 4HHDA 1KE4A 4E3LA 2EX9A 1OT6A 2C6WB 4EEPA 1PZPA 4WMCD 3LIBA 1VETB 5M1AA 2D02A 2L0WA 5CHMA 1SHVA 4Z1WA 4KZ4A 4EW7A 3EEHA 3LIEA 2VV7A 5HDCA 3SZTA 2OOLA 2ZBBA 3CLOA 1FR1A 4YOFA 3ZG8B 2JKTI 3BFEA 1E3UA 3LIDA 3TJZC 5DF7A 4GKUA 2OWHA 3CPTB 4WUJA 1F98A 2ZC4B 2JBFA 4R1GA 4DJ2A 3QNBA 5DKKA 3IXGA 3W4QA 2ZMVA 2WKRA 4E04A 3A3FA 3IS2A 2GX5A 3JPUA 4IEDA 1TS8A 5F1GA 4Q0HA 3GRJA 2CMNA 4ID4A 4K0XA 4JF4A 2H0YA 1BYWA 2WZXA 3T12B 4Y0UA 2V8FA 1DP6A 4DXBA 4WBGA 2BLSA 3UY6A 4HESA 3ZHHA 3UO9A 3ZGAB 2JKRM 3JVVA 4HP9A 3DWZA 4NXGA 5FEGA 4BENA 2WKQA 4X53A 1D1JA 4S2JA 4E3NA 1NYMA 2A2LA 2Y2OA 4EV4A 2Y2QA 4U0TA 2J9PA 3EGDC 4MN5A 1XFNA 2K31A 1XA7A 4IUHA 3UB8A 3T1RA 1XJ3A 4GS9B 3ULFA 3D4FA 3BFDA 4KZAA 5AQAA 1OMEA 4Q8IA 3NDEA 1Q2PA 4ZJ2A 2J3TC 3Q7VB 3HREA 4HBUA 3IBJA 3IHBA 2OLUA 4UQIS 2QJ7A 4OOYA 2XGNA 4DE0A 2J9OA 3IH8A 4Y2FA 5E2HA 1DP8A 3CI6A 3MKFA 3R7WA 3ZDJA 1LI9A 4LCLA 1BLCA 3G4PA 3O5YA 4UAAA 3MSHA 3BW6A
chains in the Genus database with same CATH topology
4Z9QA 1K38A 1NJ4A 4JKTA 5GL9A 4DDYA 2Y2PA 3WWXA 5A90A 3MXRA 4X56A 3ZG0A 5EVIA 3UDIA 4OLDA 1CI9A 1JVJA 4OONA 3OZHA 3HUNA 2UWXA 3A3DA 3IF6C 3WRZA 3QHYA 2WKIA 4JXWA 1HTZA 1I5QA 1O7EA 1S0WA 1MXOA 4EBLA 1YLPA 4E6XA 1EI5A 1DJAA 4WELA 5FAPA 2IWDA 3W4OA 5CGXA 5HARA 1MPLA 5F83A 3VOZA 4WZ4A 4BL2A 1XGJA 1E25A 1QMFA 2ZQ7A 1GCEA 2Y2HA 2XD5A 4OPRA 5FASA 4PM8A 5DTTA 4C75A 4MEZA 5HAPA 2EFXA 3OPRA 1PI4A 1WYBA 3PBQA 2E8IA 1S6RA 5CEDA 1YT4A 5L2FA 1CK3A 3Q7ZA 3A3IA 1EWZA 1N4OA 3G2YA 3TSGA 1KVMA 4JBFA 3VP3A 4E3JA 1MY8A 1BZAA 1IYOA 4LENA 2QMIA 2EX2A 3A3EA 5EECA 1MWSA 1KDWA 4EBNA 4HEFA 3FKVA 5DTKA 4PM7A 2X01A 3IWIA 1O07A 1E3UD 1K6RA 3OPLA 3V39A 2G2WA 2Z2LB 4S2OA 2WKHA 4CPKA 4ZJ1A 3M2KA 3N4IA 1VQQA 1WE4A 2Q9MA 5CEBA 2ZC5B 3BFCA 3W4PA 1N9BA 2P9VA 3BRMA 4ZAMA 5KZHA 2V20A 1L2SA 4OPYA 3G35A 1FCMA 3UPPA 3NBLA 2RL3A 5F82A 3VP2A 1YLJA 3LY4A 4OP8A 5A91A 4MBKA 1W79A 1JTGA 3IF6A 4D2OA 1IEMA 1ERQA 1DY6A 1BULA 1XXMA 1YQSA 5GLBA 3VP1A 1BLPA 4UA6A 4FH4A 1ALQA 4PMAA 3VMAA 2JCHA 3HUMA 4DKIA 3V3RA 2XD1A 1MBLA 2ZQ9A 2CC1A 3G34A 5FA7A 4B4XA 2ZQDA 4IVIA 4P85A 4BD1A 1BTLA 3OPPA 1W8QA 3WS0A 5CGWA 3VSLA 3IWOA 4S2IA 3SOIA 3GVBA 4QB8A 3QNCA 4IBRA 2XK1A 3ZG5A 5AQ7A 5GLCA 2PU4A 1TDLA 3GV9A 2XEPA 3HLFA 3IXBA 4GNUA 4RA7A 1L0GA 4PM6A 3WS4A 1FSWA 2QZ6A 4LV3A 4LV0A 3G32A 4N9LA 1YLZA 2HP6A 4M3KA 3UNWA 5CECA 1JWPA 1MWRA 2WUQA 4N92A 5FDHA 4GZBA 3NIAA 3WS1A 1KGGA 3G31A 3WRTA 2HDUA 1GA0A 3O3VA 3Q81A 2V2FF 3EQUA 4KZ6A 3IWQA 1MWTA 3WS2A 2HDQA 1LL5A 3MKEA 3I7JA 2Y2IA 1K55C 4JLFA 2WGWB 3CG5A 2Y2JA 2XQZA 5CTMA 3MZDA 1H5XA 5I94A 5GHYA 5E2GA 2Y4AA 3OC2A 4KG6A 2ZC6B 3CJMA 1K54C 4N1XA 1IKIA 5M19A 3ZCZA 4X55A 1XX2A 3FKWA 3RJUA 3AGEA 3NCKA 4L0LA 2ZMAA 1RGZA 1W8YA 4KZBA 3NY4A 5FQMA 4KZ8A 4OQIA 4DXCA 1EROA 1WYCA 4DE3A 5TFQA 3LCEA 3IQAA 2C5WB 3GQZA 1ES3A 2XF3A 3HLGA 2Y91A 3MZFA 5AQ9A 3W8KA 2RCXA 5E43A 5CTNA 5E2EA 3BECA 3BYDA 3VFHA 2EX6A 3TG9A 3VP4A 3ZVTA 3HLBA 3NDGA 3MFDA 4EBPA 1H8YA 1YM1A 4GOGA 4KG2A 5FQKA 2Y59A 3MBZA 5HFOA 1RGYA 2H5SA 4WM9A 4RYEA 5EOOA 5EVIB 5A92A 1ONGA 3JYIA 1LL9A 3UE3A 3PBNA 3N8RA 2Y2MA 3M6BA 3SH7A 1M40A 4B4ZA 3ZNYA 1GHPA 3N7WA 3AGDA 4EWFA 2HP9A 2A49A 4E3MA 3ZVWA 2DNSA 1TVFA 4BD0A 1L0FA 2VGKA 5EVLA 5A93A 1K56D 3BLMA 4X68A 2IWBA 3RXXA 4OVDA 3UPNA 4OKPA 3OCLA 4KQRA 4PPRA 5FATA 4BJPA 2H0TA 5BOHA 2X71A 4S2KA 4JXVA 2XDMA 1AXBA 2G2UA 5D3OA 4QJGA 4FCFA 5DVAA 2Z2MB 5CRFA 1BLHA 1PZOA 4KZ9A 1SDNA 1FCOA 1K55A 2VGJA 1L0EA 2ZM8A 1YLYA 1ES5A 1Z6FA 1ES4A 2Y2NA 3BFGA 4QY5A 4RVAA 2Y2GA 1K54A 5HL1A 1LLBA 4R3BA 1M6KA 2WAEA 1TDGA 2OLVA 4R23A 4UA7A 4P0MA 3BFFA 1PW1A 5FAOA 4KENB 2H10A 2QPNA 3C4OA 3TOIA 1IYQA 1KVLA 1I2SA 1IYPA 3UPOA 2ZD8A 3HLEA 5EVID 5CERA 3C4PA 4X69A 2HP5A 4S2PA 1K4FA 1XKZA 4CJNA 1YLTA 3O86A 4N1HA 3B3XA 1YMXA 1CEGA 1RP5A 4BLMA 4R3JA 3DW0A 4KZ5A 3EQVA 5FI2A 4XXRA 2ZC7A 2P9VB 2Y2LA 4C3QA 3CMZA 1ES2A 5GLDA 3P98A 4WYYA 4GB7A 5HX9A 3HLDA 4ZTKA 3HBRA 2R9XA 1NZOA 3LEZA 1K4EA 2XLNA 3IF6B 3OCNA 2PBYA 3ZFZA 1NY0A 1G6AA 2EXAA 4XUZA 3BM6A 3O88A 1XGIA 1KE0A 1HZOA 2EXBA 3N8LA 3UN7A 3S1YA 5EPHA 3ISGA 1SKFA 5DTSA 4UA9A 3MXSA 3ZNTA 2EFUA 2WAFA 4LV1A 1ZG4A 2I72A 4U0XA 1NZUA 4RX3A 3ZG9B 4WZ5C 2Y2KA 3GMWA 3E2LA 1C3BA 1H8ZA 5HAQA 1PWGA 1NXYA 4E3OA 3IF5A 4ZDXA 1GHIA 5JYOA 2GDNA 2BG1A 3PAEA 4K0WA 3M6HA 1ESUA 1HD8A 4QHCA 2A3UA 1CI8A 2WYXA 3AGFA 5FSRA 4LV2A 3Q1FA 1GHMA 1LI0A 2Q9NA 3LY3A 4IVKA 4E3IA 1NRFA 1RCJA 4DE2A 3IXHA 1KGEA 3Q7VA 3PBSA 4XUXA 1Y54A 2V1ZA 3UE1A 5E2FA 2ZM0A 4S2NC 1ESIA 2J7VA 3WS5A 1ZC2A 4WEKA 1L0DA 1G68A 1J9MA 1XP4A 4OP5A 1KE4A 2X02A 3BLSA 3FWLA 3SS5A 4E3LA 2EX9A 1YMSA 4X6TA 1Q2QA 4BL3A 2WGIA 4OOLA 4QU3A 1QMEA 4FSFA 4MBFA 5CHJA 5FAQA 2C6WB 1NYYA 1LHYA 5FI6A 4ZJ3A 1PZPA 4DRTA 1E4DA 3V3SA 4WMCD 4E6WA 1W5DA 4YINA 5M1AA 5CHMA 1SHVA 2XH9A 4GN2A 1FSYA 4KZ4A 4OQGA 3V50A 4OOMA 2PU2A 4R0QA 1JWVA 4QD4A 4C6YA 2ZLYA 1K57C 4JXGA 1JTDA 3O87A 2XFSA 4UHUA 2Y55A 1VM1A 2HPBA 4YFMA 4JPMA 3S4XA 2ZJ9A 1FR1A 4DDSA 3ZG8B 3NI9A 3PBTA 1FQGA 2JC7A 1XPBA 3PBOA 4R4RA 1SCWA 5U47A 3BFEA 3LO7A 4WZ5A 3IT9A 1DJCA 1KE3A 1E3UA 5KSCA 5DF7A 4OH0A 4GKUA 4MLLA 1IKGA 3SS4A 3N8SA 4PM5A 2JE5A 3M2JA 4B88A 3PBRA 1IYSA 3G30A 5EE8A 4F94A 4K91A 1MWUA 1PW8A 4WEJA 2ZC4B 2JBFA 4R1GA 1FR6A 5KMWA 1HVBA 4P87A 4O7DA 2J8YA 4H8RA 3IHAA 3FV7A 3CZDA 3QNBA 1PWDA 3GTCA 1BUEA 3UDXA 3FZCA 4S2NA 4GD6A 3RXWA 1PI5A 4U3TA 3UDFA 3IXGA 3W4QA 2IWCA 3C7UA 2WADA 1CEFA 1ONHA 3A3FA 4IEDA 5GLAA 4Y0TA 3E2KA 3GR2A 5F1GA 2OSUA 1KGFA 3GRJA 4NETA 4ID4A 3Q82A 2WGVA 5TGFA 1MKIA 2ZQCA 1YLWA 2H0YA 4JF4A 4K0XA 4GDNA 1GA9A 4KQOA 2B5RA 3ZG7B 4BQMA 3NC8A 1XA1A 2WZXA 4KQQA 5CHUA 2ZC3B 4FD8A 4Y0UA 4JF5A 4LCMA 4IBXA 4E3KA 4DF6A 2HDRA 4DXBA 3PTEA 4GD8A 3FYZA 3DTMA 4WBGA 2BLSA 5EOEA 5FI7A 4HBTA 3UY6A 4ZBEA 3P09A 4HESA 4R4SA 3ZHHA 5J8XA 1K57A 3V5MA 2ZQ8A 1ZKJA 2FFYA 3G2ZA 4MNRA 3UO9A 3ITBA 3VFFA 5F1FA 1BLSA 3ZGAB 1PIOA 3BEBA 3DWZA 4S2MA 5CXWA 4BENA 4GDBA 4RX2A 4X53A 2XR0A 3MZEA 3Q07A 4S2JA 4QY6A 4E3NA 2EX8A 3PAGA 1NYMA 2WKEA 2XFTA 4KZ7A 2Y2OA 4FH2A 5DF8A 4EV4A 5KSHA 1I2WA 2Y2QA 2J9PA 2ZM2A 4OPQA 4U0TA 1FOFA 1K25A 4MBHA 5CGSA 3HUOA 3SS3A 5EVIC 4PM9A 4DE1A 1XA7A 1FCNA 5GHXA 3HL9A 3ITAA 4NK3A 5AQBA 4EUZA 4JF6A 4WMCA 3OPHA 3UE0A 5IHVA 5HW3A 3IXDA 3D4FA 3BFDA 4KZAA 2ZQAA 5AQAA 3A3JA 4KG5A 3VP0A 1OMEA 3HVFA 4Q8IA 3NDEA 2FFFB 1Q2PA 1JWZA 3N6IA 3VSKA 1DJBA 1TEMA 4N9KA 4OQ0A 3C7VA 2DRWA 1KDSA 4ZJ2A 4S2LA 3Q7VB 3HREA 1SDEA 2WK0A 4HBUA 2OV5A 4A5RA 5GHZA 5M18A 3SH8A 1IELA 3IHBA 2OLUA 4OOYA 5FQ9A 4Y0OA 2P74A 3VOYA 2XGNA 2DCFA 2WZZA 2WGWA 1PWCA 3HLCA 4OQHA 1K56A 1U60A 4Y7PA 5FQIA 2J9OA 4DE0A 3IH8A 5E2HA 5TR7A 3DWKA 4EQIA 1W7FA 5DF9A 1BSGA 4P6BA 4KZ3A 5G18A 4JXSA 3C5AA 5HAIA 3GSGA 3MKFA 3SH9A 3ZDJA 5FQQA 1K6SA 2HDSA 2R9WA 5JYPA 5FQJA 1LI9A 4OPZA 1BT5A 4LCLA 3S22A 1PYYA 4OLGA 1BLCA 1ZG6A 3IH9A 1ERMA 3G4PA 4UAAA 5EUAA 3HLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9Q A;  1K38 A;  1NJ4 A;  4JKT A;  5GL9 A;  4DDY A;  2Y2P A;  3WWX A;  5A90 A;  3MXR A;  4X56 A;  3ZG0 A;  5EVI A;  3UDI A;  4OLD A;  1CI9 A;  1JVJ A;  4OON A;  3OZH A;  3HUN A;  2UWX A;  3A3D A;  3IF6 C;  3WRZ A;  3QHY A;  2WKI A;  4JXW A;  1HTZ A;  1I5Q A;  1O7E A;  1S0W A;  1MXO A;  4EBL A;  1YLP A;  4E6X A;  1EI5 A;  1DJA A;  4WEL A;  5FAP A;  2IWD A;  3W4O A;  5CGX A;  5HAR A;  1MPL A;  5F83 A;  3VOZ A;  4WZ4 A;  4BL2 A;  1XGJ A;  1E25 A;  1QMF A;  2ZQ7 A;  1GCE A;  2Y2H A;  2XD5 A;  4OPR A;  5FAS A;  4PM8 A;  5DTT A;  4C75 A;  4MEZ A;  5HAP A;  2EFX A;  3OPR A;  1PI4 A;  1WYB A;  3PBQ A;  2E8I A;  1S6R A;  5CED A;  1YT4 A;  5L2F A;  1CK3 A;  3Q7Z A;  3A3I A;  1EWZ A;  1N4O A;  3G2Y A;  3TSG A;  1KVM A;  4JBF A;  3VP3 A;  4E3J A;  1MY8 A;  1BZA A;  1IYO A;  4LEN A;  2QMI A;  2EX2 A;  3A3E A;  5EEC A;  1MWS A;  1KDW A;  4EBN A;  4HEF A;  3FKV A;  5DTK A;  4PM7 A;  2X01 A;  3IWI A;  1O07 A;  1E3U D;  1K6R A;  3OPL A;  3V39 A;  2G2W A;  2Z2L B;  4S2O A;  2WKH A;  4CPK A;  4ZJ1 A;  3M2K A;  3N4I A;  1VQQ A;  1WE4 A;  2Q9M A;  5CEB A;  2ZC5 B;  3BFC A;  3W4P A;  1N9B A;  2P9V A;  3BRM A;  4ZAM A;  5KZH A;  2V20 A;  1L2S A;  4OPY A;  3G35 A;  1FCM A;  3UPP A;  3NBL A;  2RL3 A;  5F82 A;  3VP2 A;  1YLJ A;  3LY4 A;  4OP8 A;  5A91 A;  4MBK A;  1W79 A;  1JTG A;  3IF6 A;  4D2O A;  1IEM A;  1ERQ A;  1DY6 A;  1BUL A;  1XXM A;  1YQS A;  5GLB A;  3VP1 A;  1BLP A;  4UA6 A;  4FH4 A;  1ALQ A;  4PMA A;  3VMA A;  2JCH A;  3HUM A;  4DKI A;  3V3R A;  2XD1 A;  1MBL A;  2ZQ9 A;  2CC1 A;  3G34 A;  5FA7 A;  4B4X A;  2ZQD A;  4IVI A;  4P85 A;  4BD1 A;  1BTL A;  3OPP A;  1W8Q A;  3WS0 A;  5CGW A;  3VSL A;  3IWO A;  4S2I A;  3SOI A;  3GVB A;  4QB8 A;  3QNC A;  4IBR A;  2XK1 A;  3ZG5 A;  5AQ7 A;  5GLC A;  2PU4 A;  1TDL A;  3GV9 A;  2XEP A;  3HLF A;  3IXB A;  4GNU A;  4RA7 A;  1L0G A;  4PM6 A;  3WS4 A;  1FSW A;  2QZ6 A;  4LV3 A;  4LV0 A;  3G32 A;  4N9L A;  1YLZ A;  2HP6 A;  4M3K A;  3UNW A;  5CEC A;  1JWP A;  1MWR A;  2WUQ A;  4N92 A;  5FDH A;  4GZB A;  3NIA A;  3WS1 A;  1KGG A;  3G31 A;  3WRT A;  2HDU A;  1GA0 A;  3O3V A;  3Q81 A;  2V2F F;  3EQU A;  4KZ6 A;  3IWQ A;  1MWT A;  3WS2 A;  2HDQ A;  1LL5 A;  3MKE A;  3I7J A;  2Y2I A;  1K55 C;  4JLF A;  2WGW B;  3CG5 A;  2Y2J A;  2XQZ A;  5CTM A;  3MZD A;  1H5X A;  5I94 A;  5GHY A;  5E2G A;  2Y4A A;  3OC2 A;  4KG6 A;  2ZC6 B;  3CJM A;  1K54 C;  4N1X A;  1IKI A;  5M19 A;  3ZCZ A;  4X55 A;  1XX2 A;  3FKW A;  3RJU A;  3AGE A;  3NCK A;  4L0L A;  2ZMA A;  1RGZ A;  1W8Y A;  4KZB A;  3NY4 A;  5FQM A;  4KZ8 A;  4OQI A;  4DXC A;  1ERO A;  1WYC A;  4DE3 A;  5TFQ A;  3LCE A;  3IQA A;  2C5W B;  3GQZ A;  1ES3 A;  2XF3 A;  3HLG A;  2Y91 A;  3MZF A;  5AQ9 A;  3W8K A;  2RCX A;  5E43 A;  5CTN A;  5E2E A;  3BEC A;  3BYD A;  3VFH A;  2EX6 A;  3TG9 A;  3VP4 A;  3ZVT A;  3HLB A;  3NDG A;  3MFD A;  4EBP A;  1H8Y A;  1YM1 A;  4GOG A;  4KG2 A;  5FQK A;  2Y59 A;  3MBZ A;  5HFO A;  1RGY A;  2H5S A;  4WM9 A;  4RYE A;  5EOO A;  5EVI B;  5A92 A;  1ONG A;  3JYI A;  1LL9 A;  3UE3 A;  3PBN A;  3N8R A;  2Y2M A;  3M6B A;  3SH7 A;  1M40 A;  4B4Z A;  3ZNY A;  1GHP A;  3N7W A;  3AGD A;  4EWF A;  2HP9 A;  2A49 A;  4E3M A;  3ZVW A;  2DNS A;  1TVF A;  4BD0 A;  1L0F A;  2VGK A;  5EVL A;  5A93 A;  1K56 D;  3BLM A;  4X68 A;  2IWB A;  3RXX A;  4OVD A;  3UPN A;  4OKP A;  3OCL A;  4KQR A;  4PPR A;  5FAT A;  4BJP A;  2H0T A;  5BOH A;  2X71 A;  4S2K A;  4JXV A;  2XDM A;  1AXB A;  2G2U A;  5D3O A;  4QJG A;  4FCF A;  5DVA A;  2Z2M B;  5CRF A;  1BLH A;  1PZO A;  4KZ9 A;  1SDN A;  1FCO A;  1K55 A;  2VGJ A;  1L0E A;  2ZM8 A;  1YLY A;  1ES5 A;  1Z6F A;  1ES4 A;  2Y2N A;  3BFG A;  4QY5 A;  4RVA A;  2Y2G A;  1K54 A;  5HL1 A;  1LLB A;  4R3B A;  1M6K A;  2WAE A;  1TDG A;  2OLV A;  4R23 A;  4UA7 A;  4P0M A;  3BFF A;  1PW1 A;  5FAO A;  4KEN B;  2H10 A;  2QPN A;  3C4O A;  3TOI A;  1IYQ A;  1KVL A;  1I2S A;  1IYP A;  3UPO A;  2ZD8 A;  3HLE A;  5EVI D;  5CER A;  3C4P A;  4X69 A;  2HP5 A;  4S2P A;  1K4F A;  1XKZ A;  4CJN A;  1YLT A;  3O86 A;  4N1H A;  3B3X A;  1YMX A;  1CEG A;  1RP5 A;  4BLM A;  4R3J A;  3DW0 A;  4KZ5 A;  3EQV A;  5FI2 A;  4XXR A;  2ZC7 A;  2P9V B;  2Y2L A;  4C3Q A;  3CMZ A;  1ES2 A;  5GLD A;  3P98 A;  4WYY A;  4GB7 A;  5HX9 A;  3HLD A;  4ZTK A;  3HBR A;  2R9X A;  1NZO A;  3LEZ A;  1K4E A;  2XLN A;  3IF6 B;  3OCN A;  2PBY A;  3ZFZ A;  1NY0 A;  1G6A A;  2EXA A;  4XUZ A;  3BM6 A;  3O88 A;  1XGI A;  1KE0 A;  1HZO A;  2EXB A;  3N8L A;  3UN7 A;  3S1Y A;  5EPH A;  3ISG A;  1SKF A;  5DTS A;  4UA9 A;  3MXS A;  3ZNT A;  2EFU A;  2WAF A;  4LV1 A;  1ZG4 A;  2I72 A;  4U0X A;  1NZU A;  4RX3 A;  3ZG9 B;  4WZ5 C;  2Y2K A;  3GMW A;  3E2L A;  1C3B A;  1H8Z A;  5HAQ A;  1PWG A;  1NXY A;  4E3O A;  3IF5 A;  4ZDX A;  1GHI A;  5JYO A;  2GDN A;  2BG1 A;  3PAE A;  4K0W A;  3M6H A;  1ESU A;  1HD8 A;  4QHC A;  2A3U A;  1CI8 A;  2WYX A;  3AGF A;  5FSR A;  4LV2 A;  3Q1F A;  1GHM A;  1LI0 A;  2Q9N A;  3LY3 A;  4IVK A;  4E3I A;  1NRF A;  1RCJ A;  4DE2 A;  3IXH A;  1KGE A;  3Q7V A;  3PBS A;  4XUX A;  1Y54 A;  2V1Z A;  3UE1 A;  5E2F A;  2ZM0 A;  4S2N C;  1ESI A;  2J7V A;  3WS5 A;  1ZC2 A;  4WEK A;  1L0D A;  1G68 A;  1J9M A;  1XP4 A;  4OP5 A;  1KE4 A;  2X02 A;  3BLS A;  3FWL A;  3SS5 A;  4E3L A;  2EX9 A;  1YMS A;  4X6T A;  1Q2Q A;  4BL3 A;  2WGI A;  4OOL A;  4QU3 A;  1QME A;  4FSF A;  4MBF A;  5CHJ A;  5FAQ A;  2C6W B;  1NYY A;  1LHY A;  5FI6 A;  4ZJ3 A;  1PZP A;  4DRT A;  1E4D A;  3V3S A;  4WMC D;  4E6W A;  1W5D A;  4YIN A;  5M1A A;  5CHM A;  1SHV A;  2XH9 A;  4GN2 A;  1FSY A;  4KZ4 A;  4OQG A;  3V50 A;  4OOM A;  2PU2 A;  4R0Q A;  1JWV A;  4QD4 A;  4C6Y A;  2ZLY A;  1K57 C;  4JXG A;  1JTD A;  3O87 A;  2XFS A;  4UHU A;  2Y55 A;  1VM1 A;  2HPB A;  4YFM A;  4JPM A;  3S4X A;  2ZJ9 A;  1FR1 A;  4DDS A;  3ZG8 B;  3NI9 A;  3PBT A;  1FQG A;  2JC7 A;  1XPB A;  3PBO A;  4R4R A;  1SCW A;  5U47 A;  3BFE A;  3LO7 A;  4WZ5 A;  3IT9 A;  1DJC A;  1KE3 A;  1E3U A;  5KSC A;  5DF7 A;  4OH0 A;  4GKU A;  4MLL A;  1IKG A;  3SS4 A;  3N8S A;  4PM5 A;  2JE5 A;  3M2J A;  4B88 A;  3PBR A;  1IYS A;  3G30 A;  5EE8 A;  4F94 A;  4K91 A;  1MWU A;  1PW8 A;  4WEJ A;  2ZC4 B;  2JBF A;  4R1G A;  1FR6 A;  5KMW A;  1HVB A;  4P87 A;  4O7D A;  2J8Y A;  4H8R A;  3IHA A;  3FV7 A;  3CZD A;  3QNB A;  1PWD A;  3GTC A;  1BUE A;  3UDX A;  3FZC A;  4S2N A;  4GD6 A;  3RXW A;  1PI5 A;  4U3T A;  3UDF A;  3IXG A;  3W4Q A;  2IWC A;  3C7U A;  2WAD A;  1CEF A;  1ONH A;  3A3F A;  4IED A;  5GLA A;  4Y0T A;  3E2K A;  3GR2 A;  5F1G A;  2OSU A;  1KGF A;  3GRJ A;  4NET A;  4ID4 A;  3Q82 A;  2WGV A;  5TGF A;  1MKI A;  2ZQC A;  1YLW A;  2H0Y A;  4JF4 A;  4K0X A;  4GDN A;  1GA9 A;  4KQO A;  2B5R A;  3ZG7 B;  4BQM A;  3NC8 A;  1XA1 A;  2WZX A;  4KQQ A;  5CHU A;  2ZC3 B;  4FD8 A;  4Y0U A;  4JF5 A;  4LCM A;  4IBX A;  4E3K A;  4DF6 A;  2HDR A;  4DXB A;  3PTE A;  4GD8 A;  3FYZ A;  3DTM A;  4WBG A;  2BLS A;  5EOE A;  5FI7 A;  4HBT A;  3UY6 A;  4ZBE A;  3P09 A;  4HES A;  4R4S A;  3ZHH A;  5J8X A;  1K57 A;  3V5M A;  2ZQ8 A;  1ZKJ A;  2FFY A;  3G2Z A;  4MNR A;  3UO9 A;  3ITB A;  3VFF A;  5F1F A;  1BLS A;  3ZGA B;  1PIO A;  3BEB A;  3DWZ A;  4S2M A;  5CXW A;  4BEN A;  4GDB A;  4RX2 A;  4X53 A;  2XR0 A;  3MZE A;  3Q07 A;  4S2J A;  4QY6 A;  4E3N A;  2EX8 A;  3PAG A;  1NYM A;  2WKE A;  2XFT A;  4KZ7 A;  2Y2O A;  4FH2 A;  5DF8 A;  4EV4 A;  5KSH A;  1I2W A;  2Y2Q A;  2J9P A;  2ZM2 A;  4OPQ A;  4U0T A;  1FOF A;  1K25 A;  4MBH A;  5CGS A;  3HUO A;  3SS3 A;  5EVI C;  4PM9 A;  4DE1 A;  1XA7 A;  1FCN A;  5GHX A;  3HL9 A;  3ITA A;  4NK3 A;  5AQB A;  4EUZ A;  4JF6 A;  4WMC A;  3OPH A;  3UE0 A;  5IHV A;  5HW3 A;  3IXD A;  3D4F A;  3BFD A;  4KZA A;  2ZQA A;  5AQA A;  3A3J A;  4KG5 A;  3VP0 A;  1OME A;  3HVF A;  4Q8I A;  3NDE A;  2FFF B;  1Q2P A;  1JWZ A;  3N6I A;  3VSK A;  1DJB A;  1TEM A;  4N9K A;  4OQ0 A;  3C7V A;  2DRW A;  1KDS A;  4ZJ2 A;  4S2L A;  3Q7V B;  3HRE A;  1SDE A;  2WK0 A;  4HBU A;  2OV5 A;  4A5R A;  5GHZ A;  5M18 A;  3SH8 A;  1IEL A;  3IHB A;  2OLU A;  4OOY A;  5FQ9 A;  4Y0O A;  2P74 A;  3VOY A;  2XGN A;  2DCF A;  2WZZ A;  2WGW A;  1PWC A;  3HLC A;  4OQH A;  1K56 A;  1U60 A;  4Y7P A;  5FQI A;  2J9O A;  4DE0 A;  3IH8 A;  5E2H A;  5TR7 A;  3DWK A;  4EQI A;  1W7F A;  5DF9 A;  1BSG A;  4P6B A;  4KZ3 A;  5G18 A;  4JXS A;  3C5A A;  5HAI A;  3GSG A;  3MKF A;  3SH9 A;  3ZDJ A;  5FQQ A;  1K6S A;  2HDS A;  2R9W A;  5JYP A;  5FQJ A;  1LI9 A;  4OPZ A;  1BT5 A;  4LCL A;  3S22 A;  1PYY A;  4OLG A;  1BLC A;  1ZG6 A;  3IH9 A;  1ERM A;  3G4P A;  4UAA A;  5EUA A;  3HLW A; 
#chains in the Genus database with same CATH topology
 2M7U A;  4JKT A;  1NJ4 A;  5GL9 A;  4DDY A;  2Y2P A;  4HOI A;  3WWX A;  1OTI A;  4OON A;  3WRZ A;  3QHY A;  4JXW A;  1O7E A;  1S0W A;  3RTY A;  3T4L A;  1V9Z A;  2VZW A;  2W3F A;  1EI5 A;  5FAP A;  2IWD A;  5CGX A;  5HAR A;  1YSP A;  1MPL A;  4BBU A;  1XGJ A;  1CJF A;  1PRQ A;  1PI4 A;  3PBQ A;  1S6R A;  3A3I A;  2ZMF A;  1EWZ A;  1N4O A;  4WF0 A;  1F5M A;  2V0W A;  1IYO A;  2VGL M;  4Q0J A;  3A3E A;  1S1Y A;  1PFL A;  2B18 A;  5G4Z A;  1OT9 A;  2JKT M;  3HCY A;  3D72 A;  1E3U D;  1K6R A;  5DFX A;  3V39 A;  4CPK A;  3N4I A;  1WE4 A;  4HNB A;  3W4P A;  1OJ5 A;  2P9V A;  3BRM A;  1L2S A;  4OPY A;  3G35 A;  2RL3 A;  3VP2 A;  1YLJ A;  5A91 A;  1F9I A;  1BLP A;  4UA6 A;  1ALQ A;  3VMA A;  2I9V A;  2XD1 A;  4KQD A;  2CC1 A;  3MMH A;  4IVI A;  1BTL A;  4ETX A;  4YNR A;  3T4O A;  2XSS A;  3E4O A;  5CGW A;  4S2I A;  4QB8 A;  3H82 B;  3ZG5 A;  5GLC A;  3GV9 A;  2XEP A;  5TBM A;  4RA7 A;  1L0G A;  5IU1 A;  3LIC A;  3G32 A;  3H7W A;  3KSI A;  1T19 A;  4M3K A;  3UNW A;  5CEC A;  1JWP A;  2WUQ A;  4N92 A;  4F3L B;  2M1C A;  2HDU A;  3Q81 A;  1D7E A;  2HDQ A;  3NEC A;  3LGO A;  4JLF A;  4KG6 A;  4N1X A;  4X55 A;  4H6J B;  3AGE A;  4L0L A;  2ZMA A;  4KZB A;  4EXO A;  2C5W B;  2ZOI A;  2PD7 A;  4NEE D;  3BEC A;  3BYD A;  2EX6 A;  3TG9 A;  4GOG A;  3T4Q A;  1RGY A;  2H5S A;  5EVI B;  1ONG A;  1LL9 A;  4GCZ A;  4NXF A;  3N8R A;  3SH7 A;  4O01 A;  1X0O A;  3N7W A;  4NG2 A;  3CPT A;  2DNS A;  3ZVW A;  4BD0 A;  4OVD A;  3UPN A;  5FAT A;  1G5U A;  2PRF A;  4BJP A;  5IS1 A;  2INW A;  2X71 A;  4JXV A;  1AXB A;  2G2U A;  5D3O A;  4QJG A;  3BY8 A;  4KUK A;  2LB9 A;  4MMN A;  1SDN A;  2VGJ A;  1L0E A;  3PR6 A;  2ZM8 A;  1DP9 A;  3IX4 A;  1YLY A;  1ES5 A;  1Z6F A;  4QY5 A;  2Y2N A;  2NUP C;  4L9G A;  1M6K A;  1TDG A;  5FAO A;  4WLA A;  1T1A A;  4S2P A;  1XKZ A;  4LFU A;  4CJN A;  1YLT A;  4N1H A;  4BLM A;  5FI2 A;  4XXR A;  2ZC7 A;  2V0U A;  3DAV A;  3P98 A;  3HLD A;  1MC0 A;  1NZO A;  2J3T D;  3T4K A;  3IF6 B;  3OCN A;  3S7N A;  2EXA A;  4XUZ A;  4Y17 A;  3EEA A;  3UN7 A;  4CLC D;  3ISG A;  1VEU B;  4XT2 B;  1P0Z A;  4RX3 A;  1C3B A;  1H8Z A;  4GS9 A;  2IA2 A;  3OLO A;  1NXY A;  3JVU A;  3DBA A;  3KSG A;  2MJ6 A;  4IVK A;  4R3A A;  1NRF A;  4DE2 A;  1KGE A;  3HJK A;  3Q7V A;  2V1Z A;  2KLI A;  4S2N C;  1G68 A;  1XP4 A;  4OP5 A;  2X02 A;  3BLS A;  3FWL A;  3SS5 A;  1LSV A;  1YMS A;  1Q2Q A;  4BL3 A;  4OOL A;  2VX8 A;  4FSF A;  4MBF A;  3EGX C;  2VV8 A;  1E4D A;  3LFV A;  4E6W A;  2OWJ A;  3A0S A;  2B02 A;  4GN2 A;  1FSY A;  5MC7 A;  4I38 A;  4OQG A;  4OOM A;  4R0Q A;  2ZLY A;  2DMW A;  1K57 C;  2W3E A;  4HIA A;  1T1C A;  2HJE A;  1VM1 A;  3S4X A;  4DDS A;  5HWW A;  1XPB A;  2UV0 E;  5U47 A;  3LEQ A;  1KE3 A;  4IUK A;  4X25 A;  5KSC A;  5K5B A;  1IKG A;  4PM5 A;  3MQQ A;  4B88 A;  5L07 A;  5EE8 A;  1IYS A;  1PW8 A;  2BTF P;  4O7D A;  4DN0 A;  3IHA A;  1PWD A;  3MR0 A;  3FZC A;  4S2N A;  4GD6 A;  4U3T A;  3UDF A;  3VE4 A;  2PR5 A;  1K0K A;  2IWC A;  2WAD A;  1ONH A;  4X1M A;  3E2K A;  1KGF A;  2PT7 A;  3Q82 A;  2WGV A;  1MKI A;  2ZQC A;  3FPV A;  1XA1 A;  4KQQ A;  5FL3 A;  4FD8 A;  1XJ4 A;  1YPR A;  2Z6D A;  4JF5 A;  3T1S A;  2VGL S;  2HDR A;  4IHQ A;  3FYZ A;  4HBT A;  4ZBE A;  2ACG A;  5HDD A;  4YWZ A;  1K57 A;  3V5M A;  4DMZ A;  2ZQ8 A;  2FFY A;  3G2Z A;  1Y4O A;  5F1F A;  1BLS A;  1OPX A;  3BEB A;  2XR0 A;  2EX8 A;  2WKE A;  5DF8 A;  3L7H A;  4JGO A;  1K25 A;  3HUO A;  5EVI C;  3QP2 A;  4DE1 A;  1FCN A;  3HL9 A;  5IHV A;  4GHI B;  5HW3 A;  3IXD A;  3UB5 P;  4KG5 A;  3H82 A;  2FFF B;  3KSH A;  1JWZ A;  3N6I A;  3VSK A;  1TF1 A;  4HJ4 A;  2O9C A;  4OQ0 A;  3C7V A;  2R78 A;  3ZQ5 A;  3A0V A;  2L4R A;  1YAX A;  4F3L A;  5DKL A;  1SDE A;  5GHZ A;  1IEL A;  2O9B A;  2K7S A;  2WZZ A;  3HLC A;  3VOY A;  5KIZ A;  4OQH A;  1K56 A;  4Y7P A;  3KX0 X;  2V8C A;  1DRM A;  4P6Z S;  4H6J A;  5DF9 A;  5G18 A;  3TW8 A;  2PDR A;  3SH9 A;  1P9R A;  4QWO A;  3QP6 A;  2R9W A;  5JYP A;  5FQJ A;  4OPZ A;  1BT5 A;  4AFI A;  3UE6 A;  2VKS A;  3V3S A;  1ZHH B;  1Z09 A;  3T1X A;  5FDS A;  4QPR A;  3MXR A;  4X56 A;  5A90 A;  4Y5F A;  5EVI A;  4O8G A;  3HUN A;  3IF6 C;  2WKI A;  4PKY A;  1I5Q A;  3T4T A;  3OBF A;  5HD3 A;  1TS7 A;  4NKP A;  4WZ4 A;  4BL2 A;  4G3V A;  3TRC A;  3G6O A;  2QWS A;  2XD5 A;  4OPR A;  4Y15 A;  4R38 A;  1TS6 A;  5DTT A;  3OPR A;  1WYB A;  3C30 A;  3A0R A;  5CED A;  5L2F A;  2VA0 A;  3TSG A;  1KVM A;  3VP3 A;  3VOL A;  5HD5 A;  3S7P A;  2JKG A;  1XFQ A;  2QMI A;  2KX6 A;  1VHM A;  3ICY A;  2M7V A;  3IWI A;  3OPL A;  4HY8 A;  2WKH A;  1FIL A;  5CEB A;  2PYP A;  3BFC A;  1STZ A;  2W3D A;  4EQ1 A;  1FCM A;  2A24 B;  5F82 A;  3LY4 A;  4OP8 A;  1W79 A;  3IF6 A;  1IEM A;  1ERQ A;  1DY6 A;  1BUL A;  2JCH A;  3HUM A;  3LI9 A;  2FH5 A;  2ZQ9 A;  1VEU A;  4XT2 A;  4JGR A;  2ZQD A;  4P85 A;  4BD1 A;  1GSW A;  2OAQ 1;  2FZ0 A;  3QP8 A;  3B42 A;  5J3W A;  3QNC A;  3F1N B;  2PU4 A;  4GNU A;  3HLF A;  4PM6 A;  3WS4 A;  2QZ6 A;  2PAV P;  2HP6 A;  4FTX A;  3NIA A;  3WRT A;  2V2F F;  3IWQ A;  3MKE A;  2NUT C;  5CTM A;  1H5X A;  5E2G A;  3OC2 A;  2GZA A;  3FKW A;  3CIT A;  3BJN A;  3NY4 A;  4OQI A;  2HV1 A;  3HJI A;  4ARZ B;  2VEA A;  3S7O A;  3PYP A;  1ES3 A;  2EWV A;  2V9A A;  3MZF A;  5AQ9 A;  3W8K A;  4II7 A;  3VP4 A;  3ZVT A;  4I3A A;  3NDG A;  4EBP A;  1H8Y A;  5FQK A;  4ESP A;  5A92 A;  1LSX A;  1L3L A;  3M6B A;  1M40 A;  1IOU A;  2KDK A;  3ZNY A;  1GHP A;  3AGD A;  2HP9 A;  1W63 M;  1ODV A;  1K56 D;  4X68 A;  1SKO B;  5DVA A;  1XJ2 A;  2Z2M B;  5CRF A;  3CUE C;  1PZO A;  3MXQ A;  3T4S A;  3BFG A;  4RVA A;  3QP1 A;  4R3B A;  2W3H A;  1JNU A;  1S4R A;  4BWI A;  2QPN A;  3TOI A;  3DTE A;  3HLE A;  5EVI D;  4JGQ A;  4X69 A;  1OTD A;  2HP5 A;  1A0K A;  3K3D A;  4C3Q A;  3KYE A;  2XRO A;  3HBR A;  3ZFZ A;  1NY0 A;  3O88 A;  3S1Y A;  1SKF A;  5J7E A;  3ZNT A;  1XJ6 A;  2I72 A;  3D3O A;  2Y2K A;  4RQ9 A;  4GHI A;  3FC7 A;  5CX7 A;  1IFQ A;  2GDN A;  2BG1 A;  4MN6 A;  3PAE A;  3M6H A;  4QHC A;  2WYX A;  5FSR A;  3CUE A;  1GHM A;  1LI0 A;  4PHT A;  2O0Y A;  2O99 A;  1S66 L;  4XUX A;  3UE1 A;  1ESI A;  3WS5 A;  1L0D A;  1J9M A;  2W1T B;  1GSV A;  5F68 A;  4EET B;  4X6T A;  2WGI A;  5FAQ A;  5FI6 A;  1VET A;  4ZJ3 A;  1NYY A;  1LHY A;  1Y28 A;  3FPW A;  4DRT A;  3NHQ A;  1W5D A;  4YIN A;  3V67 A;  2XH9 A;  3UMD A;  3H9W A;  2E8J A;  5FEF A;  1JWV A;  3P01 A;  4G3W A;  1JTD A;  4YFM A;  2KOI A;  2Y55 A;  2HPB A;  4JPM A;  2ZJ9 A;  3NI9 A;  3PBT A;  3EOI A;  1FQG A;  3PBO A;  4R4R A;  1SCW A;  3IT9 A;  4OH0 A;  4MLL A;  1PNE A;  3PBR A;  3G30 A;  3IX8 A;  1MWU A;  3LUQ A;  1HVB A;  5HZH A;  4H8R A;  3CWF A;  1G28 A;  1BUE A;  3LIF A;  1PI5 A;  3KYZ A;  3RXW A;  3DTK A;  4ETZ A;  1CEF A;  2P04 A;  5GLA A;  3IX3 A;  1WA9 A;  3GR2 A;  5TGF A;  1YLW A;  3UB7 A;  4GDN A;  1GA9 A;  4BQM A;  3NC8 A;  1MZU A;  5CHU A;  5HPF A;  4JGP A;  3CHW P;  4WL9 A;  5AVE A;  1NRJ A;  4DF6 A;  4GD8 A;  3DTM A;  1P9W A;  5FI7 A;  3P09 A;  4R4S A;  5J8X A;  2L1M A;  1ZKJ A;  4MNR A;  5IT5 A;  3T4J A;  3GEC A;  3VFF A;  1PIO A;  5CXW A;  2A24 A;  4RX2 A;  3MZE A;  3Q07 A;  4QY6 A;  3TE8 A;  2GJ3 A;  4OPQ A;  1FOF A;  4MBH A;  3SS3 A;  4G3K A;  3ITA A;  4EUZ A;  4WMC A;  3OPH A;  3UE0 A;  2QHK A;  2W0N A;  3F1N A;  2ZL1 B;  3MJQ A;  5EFW A;  1KDS A;  3C8C A;  4A5R A;  2OV5 A;  3SH8 A;  4MCW A;  2AVX A;  5FQ9 A;  2VK3 A;  2VLG A;  4EES A;  2DCF A;  1U60 A;  1YSQ A;  4B93 A;  5FQI A;  5TJJ A;  5TR7 A;  5C5K A;  3K2N A;  2HGV A;  4P6B A;  1OTE A;  3MQO A;  3UME A;  3C5A A;  3GSG A;  2EWW A;  3F1O B;  4ARZ A;  3W2Z A;  2D01 A;  1PYY A;  1ZG6 A;  3IH9 A;  1ERM A;  4Z9Q A;  3UDI A;  1JVJ A;  5AJG A;  3OZH A;  4I3J A;  1MXO A;  1VB6 A;  4HQA A;  1YLP A;  4EBL A;  4E6X A;  1DJA A;  4WEL A;  4CQH A;  3W4O A;  5F83 A;  3VOZ A;  2K2N A;  1QMF A;  1T1B A;  2ZQ7 A;  1GCE A;  5FAS A;  1SKO A;  4EUV A;  4C75 A;  4MEZ A;  5HAP A;  3PXP A;  2E8I A;  3NUL A;  1CK3 A;  4L9E A;  4CLC B;  3KYQ A;  4E3J A;  1P97 A;  1BZA A;  4LEN A;  3MF0 A;  5EEC A;  1MWS A;  3T50 A;  4HEF A;  4WN5 A;  2X01 A;  3UB6 A;  3VV4 A;  4BBV A;  1MKM A;  3ZYT A;  4S2O A;  4ZJ1 A;  1VQQ A;  4PKY G;  2ZC5 B;  1TS0 A;  5F69 A;  3C38 A;  3LR0 A;  5KZH A;  2V20 A;  3NBL A;  1JTG A;  4D2O A;  1XXM A;  5AVF A;  3VP1 A;  3E0Y A;  3K3C A;  3V3R A;  1ACF A;  4DKI A;  3G34 A;  5FA7 A;  1YKD A;  2P7J A;  4HI4 A;  3LI8 A;  4L9F A;  2JHE A;  3VSL A;  3IWO A;  1G6O A;  2Y79 A;  4IBR A;  2PHY A;  1TDL A;  3IXB A;  4LV3 A;  4LGW A;  4N9L A;  1YLZ A;  1MWR A;  4IJG A;  5FDH A;  4NXB A;  1CQA A;  5TBM B;  1KGG A;  3G31 A;  5A8B A;  1OJG A;  2W1T A;  1GA0 A;  4KZ6 A;  2P08 A;  3EQU A;  1LL5 A;  3I7J A;  1K55 C;  2WGW B;  3MZD A;  4BMW A;  2ZC6 B;  3CJM A;  1K54 C;  5M19 A;  5HWV A;  1XX2 A;  3RJU A;  3NCK A;  1RGZ A;  1W8Y A;  3E98 A;  4KZ8 A;  3R4K A;  1ERO A;  1WYC A;  4ZRR A;  5TFQ A;  3IQA A;  3GQZ A;  3HLG A;  5E43 A;  5CTN A;  5E2E A;  4CLC E;  3VFH A;  3HLB A;  4LRX C;  2Y59 A;  4O0P A;  3MBZ A;  4LRZ E;  4MN7 A;  4Q0I A;  5HFO A;  2QKP A;  2VV6 A;  2XA7 M;  5EOO A;  3UE3 A;  3P7N A;  1N9N A;  4EWF A;  2A49 A;  4E3M A;  1TVF A;  4EU0 A;  1L0F A;  5A93 A;  2IWB A;  1N9O A;  4I3I A;  3OCL A;  4PPR A;  5BOH A;  3L9K A;  2XDM A;  1V9Y A;  1FCO A;  1K55 A;  4FOF A;  5EV0 A;  2HF6 A;  1W63 Q;  1ES4 A;  2Y2G A;  1K54 A;  2PD8 A;  3GDI A;  2JN7 A;  2WAE A;  5J4E A;  4P0M A;  1PW1 A;  4R70 A;  2H10 A;  2VJW A;  1IYQ A;  1KVL A;  1IYP A;  3UPO A;  2ZD8 A;  3NOP C;  1HLU P;  5CER A;  3C4P A;  1CF0 A;  1CEG A;  1RP5 A;  4R3J A;  4KZ5 A;  2Y2L A;  1ES2 A;  4WYY A;  4GB7 A;  5HX9 A;  4ZTK A;  1K4E A;  2XLN A;  2PBY A;  1G6A A;  2B95 A;  1XGI A;  1KE0 A;  1HZO A;  3N8L A;  4UA9 A;  2EFU A;  2WAF A;  4LV1 A;  1LSW A;  4WZ5 C;  4I39 A;  1PWG A;  3IF5 A;  3B33 A;  4GJ4 A;  4ZDX A;  4K0W A;  1ESU A;  1HD8 A;  2ZL1 A;  3QP5 A;  4LV2 A;  1OTA A;  2Q9N A;  3LY3 A;  1NWZ A;  1RCJ A;  3IXH A;  1Y54 A;  2J7V A;  3RFB A;  1UWN X;  3VE3 A;  3S7Q A;  4CLC C;  4QU3 A;  1QME A;  5CHJ A;  5HL6 A;  2H28 A;  3T1Q B;  3F1O A;  3V50 A;  2PU2 A;  1LL8 A;  4ME4 A;  4QD4 A;  4C6Y A;  4JXG A;  3O87 A;  2XFS A;  4UHU A;  3MQ0 A;  3MFX A;  1H8M A;  2JC7 A;  3QP4 A;  3LO7 A;  4WZ5 A;  3U2A A;  1DJC A;  2V1A A;  3SS4 A;  3N8S A;  2JE5 A;  3M2J A;  4F94 A;  4K91 A;  4WEJ A;  1FR6 A;  5KMW A;  4P87 A;  1AWI A;  2J8Y A;  5DJU A;  3FV7 A;  5L10 A;  3CZD A;  3B47 A;  3GTC A;  3UDX A;  4EEU A;  2YKF A;  3C7U A;  4CLC A;  3U4L P;  4Y0T A;  2OSU A;  4NET A;  2HJ9 C;  3F1P B;  2HZ5 A;  4KQO A;  3ZG7 B;  2B5R A;  1OTB A;  2ZC3 B;  4LCM A;  4IBX A;  4E3K A;  2BAS A;  3PTE A;  3FG8 A;  5EOE A;  5HSQ A;  3ITB A;  4S2M A;  1H3Q A;  4GDB A;  3EWK A;  3PAG A;  2XFT A;  4KZ7 A;  1EW0 A;  3LYX A;  4FH2 A;  5KSH A;  5L09 A;  1I2W A;  5CGS A;  2ZM2 A;  1N9L A;  5G4Y A;  4I5S A;  4LRY C;  4PM9 A;  5GHX A;  4NK3 A;  5AQB A;  4JF6 A;  2V1B A;  2ZQA A;  3A3J A;  3VP0 A;  3HVF A;  4Y3I A;  3PHY A;  1DJB A;  1TEM A;  4N9K A;  2DRW A;  4S2L A;  4LLO B;  2WK0 A;  2Q0O A;  5M18 A;  2OAP 1;  4Y0O A;  2P74 A;  1PWC A;  2WGW A;  1NLY A;  4HJ3 A;  4P6Z M;  3OOV A;  3DWK A;  4EQI A;  1W7F A;  1BSG A;  4KZ3 A;  4JXS A;  5HAI A;  5FQQ A;  1K6S A;  2HDS A;  1S4S A;  1D06 A;  1H0M A;  3S22 A;  2J80 A;  4OLG A;  5EUA A;  3NOT C;  3HLW A;  1K38 A;  3LIA A;  3ZG0 A;  4OLD A;  1CI9 A;  1ZTU A;  4D60 A;  2UWX A;  3A3D A;  1HTZ A;  4PAU A;  5L8M A;  2XA7 S;  3E4Q A;  3DTI A;  1E25 A;  5LBR A;  2Y2H A;  4PM8 A;  4BBT A;  4UEY A;  2EFX A;  5HDS A;  3BQ8 A;  1YT4 A;  3IS2 B;  4HH3 A;  3Q7Z A;  2PBD P;  3G2Y A;  1GSX A;  4JBF A;  1MY8 A;  1FIK A;  4MDZ A;  1UGU A;  2EX2 A;  2EA9 A;  4HP4 A;  1KDW A;  4EBN A;  3FKV A;  5DTK A;  4PM7 A;  1O07 A;  2G2W A;  2Z2L B;  4Y13 A;  1S67 L;  3M2K A;  2Q9M A;  1N9B A;  3D9Y A;  2JKF A;  3RH8 B;  2ZOH A;  4ZAM A;  2QYB A;  3UPP A;  2W27 A;  4MBK A;  1YQS A;  5GLB A;  4FH4 A;  4PMA A;  2O9A A;  1MBL A;  4DJ3 A;  4B4X A;  4HH2 A;  3OPP A;  5EM1 A;  2PR6 A;  1W8Q A;  3WS0 A;  3SOI A;  3GVB A;  3SW1 A;  2XK1 A;  4GW9 A;  5AQ7 A;  4B9O A;  1F2K A;  2QJ5 A;  1FSW A;  4LV0 A;  1TD5 A;  4UQI M;  4GZB A;  3WS1 A;  5I5L A;  5EM0 A;  3O3V A;  3WS2 A;  4M4X A;  1MWT A;  2G7U A;  3BY9 A;  4LPZ A;  2Y2I A;  3CG5 A;  2Y2J A;  2XQZ A;  1LT0 A;  5I94 A;  5GHY A;  2Y4A A;  3KO6 A;  1IKI A;  3ZCZ A;  3LR4 A;  5FQM A;  3R7W B;  4DXC A;  4DE3 A;  3LCE A;  2XF3 A;  3IBR A;  2Y91 A;  3C2W A;  4X1L A;  4FUW A;  2RCX A;  5F6A A;  2XRN A;  3LR5 A;  3MFD A;  4EER A;  1YM1 A;  4KG2 A;  5F5Y A;  2W1R A;  3CAX A;  4WM9 A;  4RYE A;  3JYI A;  3NOU C;  3KSF A;  3PBN A;  4K08 A;  2Y2M A;  1J3W A;  4B4Z A;  4GLQ A;  5EVE A;  3E4P A;  2VGK A;  2JKR I;  3LR3 A;  5EVL A;  3BLM A;  3RXX A;  4OKP A;  4KUO A;  2Y8H A;  4KQR A;  2H0T A;  4S2K A;  3BWL A;  4FCF A;  1BLH A;  4KZ9 A;  5DJT A;  1KOU A;  3F1P A;  5HL1 A;  1SZV A;  1LLB A;  4R23 A;  2OLV A;  4UA7 A;  2YKH A;  3BFF A;  4KEN B;  3C4O A;  1NLZ A;  1I2S A;  3NJA A;  1K4F A;  3O86 A;  3B3X A;  1YMX A;  3BQA A;  3UB9 A;  2PYR A;  3DW0 A;  3EQV A;  2GNX A;  1T18 A;  5HPI A;  2P9V B;  3CMZ A;  4NXE A;  5GLD A;  2R9X A;  3LEZ A;  1UWP X;  3BM6 A;  4R6L A;  2EXB A;  5EPH A;  2W3G A;  5HWT A;  5DTS A;  3MXS A;  4HJ6 A;  2LB5 A;  1ZG4 A;  3MS6 A;  4U0X A;  1NZU A;  3ZG9 B;  3GMW A;  3E2L A;  5HAQ A;  2WKP A;  4E3O A;  1GHI A;  1S1Z A;  5JYO A;  2A3U A;  1CI8 A;  3AGF A;  5DFY A;  2J3W A;  2Z6C A;  3Q1F A;  4E3I A;  3H7W B;  3PBS A;  5E2F A;  2ZM0 A;  1ZC2 A;  4WEK A;  4HHD A;  1KE4 A;  4E3L A;  2EX9 A;  1OT6 A;  2C6W B;  4EEP A;  1PZP A;  4WMC D;  3LIB A;  1VET B;  5M1A A;  2D02 A;  2L0W A;  5CHM A;  1SHV A;  4Z1W A;  4KZ4 A;  4EW7 A;  3EEH A;  3LIE A;  2VV7 A;  5HDC A;  3SZT A;  2OOL A;  2ZBB A;  3CLO A;  1FR1 A;  4YOF A;  3ZG8 B;  2JKT I;  3BFE A;  1E3U A;  3LID A;  3TJZ C;  5DF7 A;  4GKU A;  2OWH A;  3CPT B;  4WUJ A;  1F98 A;  2ZC4 B;  2JBF A;  4R1G A;  4DJ2 A;  3QNB A;  5DKK A;  3IXG A;  3W4Q A;  2ZMV A;  2WKR A;  4E04 A;  3A3F A;  3IS2 A;  2GX5 A;  3JPU A;  4IED A;  1TS8 A;  5F1G A;  4Q0H A;  3GRJ A;  2CMN A;  4ID4 A;  4K0X A;  4JF4 A;  2H0Y A;  1BYW A;  2WZX A;  3T12 B;  4Y0U A;  2V8F A;  1DP6 A;  4DXB A;  4WBG A;  2BLS A;  3UY6 A;  4HES A;  3ZHH A;  3UO9 A;  3ZGA B;  2JKR M;  3JVV A;  4HP9 A;  3DWZ A;  4NXG A;  5FEG A;  4BEN A;  2WKQ A;  4X53 A;  1D1J A;  4S2J A;  4E3N A;  1NYM A;  2A2L A;  2Y2O A;  4EV4 A;  2Y2Q A;  4U0T A;  2J9P A;  3EGD C;  4MN5 A;  1XFN A;  2K31 A;  1XA7 A;  4IUH A;  3UB8 A;  3T1R A;  1XJ3 A;  4GS9 B;  3ULF A;  3D4F A;  3BFD A;  4KZA A;  5AQA A;  1OME A;  4Q8I A;  3NDE A;  1Q2P A;  4ZJ2 A;  2J3T C;  3Q7V B;  3HRE A;  4HBU A;  3IBJ A;  3IHB A;  2OLU A;  4UQI S;  2QJ7 A;  4OOY A;  2XGN A;  4DE0 A;  2J9O A;  3IH8 A;  4Y2F A;  5E2H A;  1DP8 A;  3CI6 A;  3MKF A;  3R7W A;  3ZDJ A;  1LI9 A;  4LCL A;  1BLC A;  3G4P A;  3O5Y A;  4UAA A;  3MSH A;  3BW6 A; 
#chains in the Genus database with same CATH homology
 4Z9Q A;  1K38 A;  1NJ4 A;  4JKT A;  5GL9 A;  4DDY A;  2Y2P A;  3WWX A;  5A90 A;  3MXR A;  4X56 A;  3ZG0 A;  5EVI A;  3UDI A;  4OLD A;  1CI9 A;  1JVJ A;  4OON A;  3OZH A;  3HUN A;  2UWX A;  3A3D A;  3IF6 C;  3WRZ A;  3QHY A;  2WKI A;  4JXW A;  1HTZ A;  1I5Q A;  1O7E A;  1S0W A;  1MXO A;  4EBL A;  1YLP A;  4E6X A;  1EI5 A;  1DJA A;  4WEL A;  5FAP A;  2IWD A;  3W4O A;  5CGX A;  5HAR A;  1MPL A;  5F83 A;  3VOZ A;  4WZ4 A;  4BL2 A;  1XGJ A;  1E25 A;  1QMF A;  2ZQ7 A;  1GCE A;  2Y2H A;  2XD5 A;  4OPR A;  5FAS A;  4PM8 A;  5DTT A;  4C75 A;  4MEZ A;  5HAP A;  2EFX A;  3OPR A;  1PI4 A;  1WYB A;  3PBQ A;  2E8I A;  1S6R A;  5CED A;  1YT4 A;  5L2F A;  1CK3 A;  3Q7Z A;  3A3I A;  1EWZ A;  1N4O A;  3G2Y A;  3TSG A;  1KVM A;  4JBF A;  3VP3 A;  4E3J A;  1MY8 A;  1BZA A;  1IYO A;  4LEN A;  2QMI A;  2EX2 A;  3A3E A;  5EEC A;  1MWS A;  1KDW A;  4EBN A;  4HEF A;  3FKV A;  5DTK A;  4PM7 A;  2X01 A;  3IWI A;  1O07 A;  1E3U D;  1K6R A;  3OPL A;  3V39 A;  2G2W A;  2Z2L B;  4S2O A;  2WKH A;  4CPK A;  4ZJ1 A;  3M2K A;  3N4I A;  1VQQ A;  1WE4 A;  2Q9M A;  5CEB A;  2ZC5 B;  3BFC A;  3W4P A;  1N9B A;  2P9V A;  3BRM A;  4ZAM A;  5KZH A;  2V20 A;  1L2S A;  4OPY A;  3G35 A;  1FCM A;  3UPP A;  3NBL A;  2RL3 A;  5F82 A;  3VP2 A;  1YLJ A;  3LY4 A;  4OP8 A;  5A91 A;  4MBK A;  1W79 A;  1JTG A;  3IF6 A;  4D2O A;  1IEM A;  1ERQ A;  1DY6 A;  1BUL A;  1XXM A;  1YQS A;  5GLB A;  3VP1 A;  1BLP A;  4UA6 A;  4FH4 A;  1ALQ A;  4PMA A;  3VMA A;  2JCH A;  3HUM A;  4DKI A;  3V3R A;  2XD1 A;  1MBL A;  2ZQ9 A;  2CC1 A;  3G34 A;  5FA7 A;  4B4X A;  2ZQD A;  4IVI A;  4P85 A;  4BD1 A;  1BTL A;  3OPP A;  1W8Q A;  3WS0 A;  5CGW A;  3VSL A;  3IWO A;  4S2I A;  3SOI A;  3GVB A;  4QB8 A;  3QNC A;  4IBR A;  2XK1 A;  3ZG5 A;  5AQ7 A;  5GLC A;  2PU4 A;  1TDL A;  3GV9 A;  2XEP A;  3HLF A;  3IXB A;  4GNU A;  4RA7 A;  1L0G A;  4PM6 A;  3WS4 A;  1FSW A;  2QZ6 A;  4LV3 A;  4LV0 A;  3G32 A;  4N9L A;  1YLZ A;  2HP6 A;  4M3K A;  3UNW A;  5CEC A;  1JWP A;  1MWR A;  2WUQ A;  4N92 A;  5FDH A;  4GZB A;  3NIA A;  3WS1 A;  1KGG A;  3G31 A;  3WRT A;  2HDU A;  1GA0 A;  3O3V A;  3Q81 A;  2V2F F;  3EQU A;  4KZ6 A;  3IWQ A;  1MWT A;  3WS2 A;  2HDQ A;  1LL5 A;  3MKE A;  3I7J A;  2Y2I A;  1K55 C;  4JLF A;  2WGW B;  3CG5 A;  2Y2J A;  2XQZ A;  5CTM A;  3MZD A;  1H5X A;  5I94 A;  5GHY A;  5E2G A;  2Y4A A;  3OC2 A;  4KG6 A;  2ZC6 B;  3CJM A;  1K54 C;  4N1X A;  1IKI A;  5M19 A;  3ZCZ A;  4X55 A;  1XX2 A;  3FKW A;  3RJU A;  3AGE A;  3NCK A;  4L0L A;  2ZMA A;  1RGZ A;  1W8Y A;  4KZB A;  3NY4 A;  5FQM A;  4KZ8 A;  4OQI A;  4DXC A;  1ERO A;  1WYC A;  4DE3 A;  5TFQ A;  3LCE A;  3IQA A;  2C5W B;  3GQZ A;  1ES3 A;  2XF3 A;  3HLG A;  2Y91 A;  3MZF A;  5AQ9 A;  3W8K A;  2RCX A;  5E43 A;  5CTN A;  5E2E A;  3BEC A;  3BYD A;  3VFH A;  2EX6 A;  3TG9 A;  3VP4 A;  3ZVT A;  3HLB A;  3NDG A;  3MFD A;  4EBP A;  1H8Y A;  1YM1 A;  4GOG A;  4KG2 A;  5FQK A;  2Y59 A;  3MBZ A;  5HFO A;  1RGY A;  2H5S A;  4WM9 A;  4RYE A;  5EOO A;  5EVI B;  5A92 A;  1ONG A;  3JYI A;  1LL9 A;  3UE3 A;  3PBN A;  3N8R A;  2Y2M A;  3M6B A;  3SH7 A;  1M40 A;  4B4Z A;  3ZNY A;  1GHP A;  3N7W A;  3AGD A;  4EWF A;  2HP9 A;  2A49 A;  4E3M A;  3ZVW A;  2DNS A;  1TVF A;  4BD0 A;  1L0F A;  2VGK A;  5EVL A;  5A93 A;  1K56 D;  3BLM A;  4X68 A;  2IWB A;  3RXX A;  4OVD A;  3UPN A;  4OKP A;  3OCL A;  4KQR A;  4PPR A;  5FAT A;  4BJP A;  2H0T A;  5BOH A;  2X71 A;  4S2K A;  4JXV A;  2XDM A;  1AXB A;  2G2U A;  5D3O A;  4QJG A;  4FCF A;  5DVA A;  2Z2M B;  5CRF A;  1BLH A;  1PZO A;  4KZ9 A;  1SDN A;  1FCO A;  1K55 A;  2VGJ A;  1L0E A;  2ZM8 A;  1YLY A;  1ES5 A;  1Z6F A;  1ES4 A;  2Y2N A;  3BFG A;  4QY5 A;  4RVA A;  2Y2G A;  1K54 A;  5HL1 A;  1LLB A;  4R3B A;  1M6K A;  2WAE A;  1TDG A;  2OLV A;  4R23 A;  4UA7 A;  4P0M A;  3BFF A;  1PW1 A;  5FAO A;  4KEN B;  2H10 A;  2QPN A;  3C4O A;  3TOI A;  1IYQ A;  1KVL A;  1I2S A;  1IYP A;  3UPO A;  2ZD8 A;  3HLE A;  5EVI D;  5CER A;  3C4P A;  4X69 A;  2HP5 A;  4S2P A;  1K4F A;  1XKZ A;  4CJN A;  1YLT A;  3O86 A;  4N1H A;  3B3X A;  1YMX A;  1CEG A;  1RP5 A;  4BLM A;  4R3J A;  3DW0 A;  4KZ5 A;  3EQV A;  5FI2 A;  4XXR A;  2ZC7 A;  2P9V B;  2Y2L A;  4C3Q A;  3CMZ A;  1ES2 A;  5GLD A;  3P98 A;  4WYY A;  4GB7 A;  5HX9 A;  3HLD A;  4ZTK A;  3HBR A;  2R9X A;  1NZO A;  3LEZ A;  1K4E A;  2XLN A;  3IF6 B;  3OCN A;  2PBY A;  3ZFZ A;  1NY0 A;  1G6A A;  2EXA A;  4XUZ A;  3BM6 A;  3O88 A;  1XGI A;  1KE0 A;  1HZO A;  2EXB A;  3N8L A;  3UN7 A;  3S1Y A;  5EPH A;  3ISG A;  1SKF A;  5DTS A;  4UA9 A;  3MXS A;  3ZNT A;  2EFU A;  2WAF A;  4LV1 A;  1ZG4 A;  2I72 A;  4U0X A;  1NZU A;  4RX3 A;  3ZG9 B;  4WZ5 C;  2Y2K A;  3GMW A;  3E2L A;  1C3B A;  1H8Z A;  5HAQ A;  1PWG A;  1NXY A;  4E3O A;  3IF5 A;  4ZDX A;  1GHI A;  5JYO A;  2GDN A;  2BG1 A;  3PAE A;  4K0W A;  3M6H A;  1ESU A;  1HD8 A;  4QHC A;  2A3U A;  1CI8 A;  2WYX A;  3AGF A;  5FSR A;  4LV2 A;  3Q1F A;  1GHM A;  1LI0 A;  2Q9N A;  3LY3 A;  4IVK A;  4E3I A;  1NRF A;  1RCJ A;  4DE2 A;  3IXH A;  1KGE A;  3Q7V A;  3PBS A;  4XUX A;  1Y54 A;  2V1Z A;  3UE1 A;  5E2F A;  2ZM0 A;  4S2N C;  1ESI A;  2J7V A;  3WS5 A;  1ZC2 A;  4WEK A;  1L0D A;  1G68 A;  1J9M A;  1XP4 A;  4OP5 A;  1KE4 A;  2X02 A;  3BLS A;  3FWL A;  3SS5 A;  4E3L A;  2EX9 A;  1YMS A;  4X6T A;  1Q2Q A;  4BL3 A;  2WGI A;  4OOL A;  4QU3 A;  1QME A;  4FSF A;  4MBF A;  5CHJ A;  5FAQ A;  2C6W B;  1NYY A;  1LHY A;  5FI6 A;  4ZJ3 A;  1PZP A;  4DRT A;  1E4D A;  3V3S A;  4WMC D;  4E6W A;  1W5D A;  4YIN A;  5M1A A;  5CHM A;  1SHV A;  2XH9 A;  4GN2 A;  1FSY A;  4KZ4 A;  4OQG A;  3V50 A;  4OOM A;  2PU2 A;  4R0Q A;  1JWV A;  4QD4 A;  4C6Y A;  2ZLY A;  1K57 C;  4JXG A;  1JTD A;  3O87 A;  2XFS A;  4UHU A;  2Y55 A;  1VM1 A;  2HPB A;  4YFM A;  4JPM A;  3S4X A;  2ZJ9 A;  1FR1 A;  4DDS A;  3ZG8 B;  3NI9 A;  3PBT A;  1FQG A;  2JC7 A;  1XPB A;  3PBO A;  4R4R A;  1SCW A;  5U47 A;  3BFE A;  3LO7 A;  4WZ5 A;  3IT9 A;  1DJC A;  1KE3 A;  1E3U A;  5KSC A;  5DF7 A;  4OH0 A;  4GKU A;  4MLL A;  1IKG A;  3SS4 A;  3N8S A;  4PM5 A;  2JE5 A;  3M2J A;  4B88 A;  3PBR A;  1IYS A;  3G30 A;  5EE8 A;  4F94 A;  4K91 A;  1MWU A;  1PW8 A;  4WEJ A;  2ZC4 B;  2JBF A;  4R1G A;  1FR6 A;  5KMW A;  1HVB A;  4P87 A;  4O7D A;  2J8Y A;  4H8R A;  3IHA A;  3FV7 A;  3CZD A;  3QNB A;  1PWD A;  3GTC A;  1BUE A;  3UDX A;  3FZC A;  4S2N A;  4GD6 A;  3RXW A;  1PI5 A;  4U3T A;  3UDF A;  3IXG A;  3W4Q A;  2IWC A;  3C7U A;  2WAD A;  1CEF A;  1ONH A;  3A3F A;  4IED A;  5GLA A;  4Y0T A;  3E2K A;  3GR2 A;  5F1G A;  2OSU A;  1KGF A;  3GRJ A;  4NET A;  4ID4 A;  3Q82 A;  2WGV A;  5TGF A;  1MKI A;  2ZQC A;  1YLW A;  2H0Y A;  4JF4 A;  4K0X A;  4GDN A;  1GA9 A;  4KQO A;  2B5R A;  3ZG7 B;  4BQM A;  3NC8 A;  1XA1 A;  2WZX A;  4KQQ A;  5CHU A;  2ZC3 B;  4FD8 A;  4Y0U A;  4JF5 A;  4LCM A;  4IBX A;  4E3K A;  4DF6 A;  2HDR A;  4DXB A;  3PTE A;  4GD8 A;  3FYZ A;  3DTM A;  4WBG A;  2BLS A;  5EOE A;  5FI7 A;  4HBT A;  3UY6 A;  4ZBE A;  3P09 A;  4HES A;  4R4S A;  3ZHH A;  5J8X A;  1K57 A;  3V5M A;  2ZQ8 A;  1ZKJ A;  2FFY A;  3G2Z A;  4MNR A;  3UO9 A;  3ITB A;  3VFF A;  5F1F A;  1BLS A;  3ZGA B;  1PIO A;  3BEB A;  3DWZ A;  4S2M A;  5CXW A;  4BEN A;  4GDB A;  4RX2 A;  4X53 A;  2XR0 A;  3MZE A;  3Q07 A;  4S2J A;  4QY6 A;  4E3N A;  2EX8 A;  3PAG A;  1NYM A;  2WKE A;  2XFT A;  4KZ7 A;  2Y2O A;  4FH2 A;  5DF8 A;  4EV4 A;  5KSH A;  1I2W A;  2Y2Q A;  2J9P A;  2ZM2 A;  4OPQ A;  4U0T A;  1FOF A;  1K25 A;  4MBH A;  5CGS A;  3HUO A;  3SS3 A;  5EVI C;  4PM9 A;  4DE1 A;  1XA7 A;  1FCN A;  5GHX A;  3HL9 A;  3ITA A;  4NK3 A;  5AQB A;  4EUZ A;  4JF6 A;  4WMC A;  3OPH A;  3UE0 A;  5IHV A;  5HW3 A;  3IXD A;  3D4F A;  3BFD A;  4KZA A;  2ZQA A;  5AQA A;  3A3J A;  4KG5 A;  3VP0 A;  1OME A;  3HVF A;  4Q8I A;  3NDE A;  2FFF B;  1Q2P A;  1JWZ A;  3N6I A;  3VSK A;  1DJB A;  1TEM A;  4N9K A;  4OQ0 A;  3C7V A;  2DRW A;  1KDS A;  4ZJ2 A;  4S2L A;  3Q7V B;  3HRE A;  1SDE A;  2WK0 A;  4HBU A;  2OV5 A;  4A5R A;  5GHZ A;  5M18 A;  3SH8 A;  1IEL A;  3IHB A;  2OLU A;  4OOY A;  5FQ9 A;  4Y0O A;  2P74 A;  3VOY A;  2XGN A;  2DCF A;  2WZZ A;  2WGW A;  1PWC A;  3HLC A;  4OQH A;  1K56 A;  1U60 A;  4Y7P A;  5FQI A;  2J9O A;  4DE0 A;  3IH8 A;  5E2H A;  5TR7 A;  3DWK A;  4EQI A;  1W7F A;  5DF9 A;  1BSG A;  4P6B A;  4KZ3 A;  5G18 A;  4JXS A;  3C5A A;  5HAI A;  3GSG A;  3MKF A;  3SH9 A;  3ZDJ A;  5FQQ A;  1K6S A;  2HDS A;  2R9W A;  5JYP A;  5FQJ A;  1LI9 A;  4OPZ A;  1BT5 A;  4LCL A;  3S22 A;  1PYY A;  4OLG A;  1BLC A;  1ZG6 A;  3IH9 A;  1ERM A;  3G4P A;  4UAA A;  5EUA A;  3HLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...