4OOYA

Avibactam and class c beta-lactamases: mechanism of inhibition, conservation of binding pocket and implications for resistance
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
359
structure length
359
Chain Sequence
b'APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Avibactam and Class C beta-Lactamases: Mechanism of Inhibition, Conservation of the Binding Pocket, and Implications for Resistance.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 121
structure length 359
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ooyA00
1BZAA 4UA7A 2WUQA 4LCMA 3VFFA 2EX2A 1ERMA 3N8RA 3FZCA 4S2NC 1K55A 4MBHA 5FQJA 5CERA 4OVDA 1SCWA 4PM9A 5GLBA 1IKGA 5EE8A 2ZJ9A 3UE3A 4OQIA 2Y2PA 3BLSA 4R4RA 3IF5A 1XA7A 4E3MA 1XPBA 1YMXA 1LL5A 4OPRA 5DF9A 2Y2IA 3SS4A 4E3OA 5F1FA 3ZG5A 4DKIA 1FR6A 3NCKA 3MKFA 3IF6C 1Y54A 4LV0A 5E2FA 5EUAA 5EVLA 5GL9A 1SHVA 1MWRA 1YLYA 2HPBA 4MNRA 1S6RA 1XX2A 4IVKA 1Q2QA 1L0GA 4DE0A 2GDNA 2H0TA 3MKEA 4K91A 3IT9A 2ZM2A 2XFSA 3UE1A 3WS1A 1MWUA 4JLFA 2XDMA 3IF6A 3HLCA 1L2SA 1YLTA 3LO7A 4OPYA 5E2GA 5HAQA 3IF6B 1GHPA 1HD8A 1K6RA 3Q1FA 4ZJ2A 1K54A 4KZ4A 4OOLA 4KZ6A 3CZDA 1MXOA 4OONA 5HFOA 4D2OA 2P9VA 3WRZA 4PPRA 1KE3A 4X6TA 3W4PA 4RX2A 3ZDJA 4S2JA 3WS0A 1YM1A 2B5RA 4FD8A 2ZLYA 3HUMA 1SKFA 4R0QA 3NC8A 4KZ5A 4N9KA 3SH8A 1ES5A 3UDFA 2OLVA 2Z2LB 4DE1A 3UDIA 5CHMA 3M2KA 3MFDA 3JYIA 5AQAA 4KZBA 3IWQA 5DTTA 4E6XA 3SS5A 2JCHA 4P6BA 1E3UD 4X56A 3HLBA 3FKVA 2RCXA 4RVAA 1BT5A 1L0DA 1CI9A 1M6KA 2V1ZA 3PBQA 4HBTA 3HBRA 3UPOA 3GSGA 2WADA 3BFFA 3VSKA 4UA6A 3HVFA 2IWCA 5F1GA 1QMEA 3ZG8B 3E2KA 2Y59A 3HLFA 2ZQAA 4QB8A 3PBNA 3WS4A 3OPPA 1LI9A 3GQZA 5FAQA 3N4IA 4WELA 2ZQCA 3AGEA 3EQVA 3NBLA 5CGWA 4UHUA 3NIAA 4ZAMA 3VP3A 2PU2A 3GVBA 3S22A 4OQGA 3ZCZA 1Q2PA 1PZOA 3OPHA 1N9BA 4ID4A 1RCJA 4OP5A 3HUNA 4YINA 4JXSA 4X53A 3C5AA 1MBLA 4XXRA 1ZC2A 3NDEA 5CEBA 3G35A 4KG2A 1W7FA 4Q8IA 4DDYA 2DRWA 2WGWA 4QHCA 4KZ3A 1YMSA 1E25A 3ITBA 1Z6FA 3EQUA 2JC7A 1RP5A 1C3BA 1NZUA 2J9OA 1HTZA 3RXXA 3A3JA 1MPLA 1ZKJA 5CXWA 1E3UA 3IXGA 4WMCD 5TGFA 3TG9A 1KDSA 2X02A 4B4XA 4FCFA 1W79A 1ZG6A 4DDSA 5GHYA 2H5SA 4JF5A 1GCEA 2EXBA 5GHXA 3TSGA 2V20A 4E6WA 4Y0TA 2WGIA 3V50A 3A3IA 1EROA 3W4QA 1BLPA 1IYQA 1KGFA 1YQSA 2QPNA 1K4EA 4P85A 3ZVTA 2IWDA 2Y2JA 1W5DA 5FQ9A 2ZQ7A 4CJNA 2ZMAA 4EQIA 1I2WA 4P0MA 5I94A 3G30A 3RJUA 5KZHA 2EFXA 1I5QA 4BQMA 5DVAA 2JBFA 3HLWA 2G2UA 4X68A 5CGSA 3VSLA 5JYPA 5U47A 5D3OA 3C7UA 1ALQA 1BSGA 1K6SA 1M40A 5F82A 4R23A 2G2WA 5CGXA 1FQGA 4R3BA 4ZTKA 5JYOA 3TOIA 3VP4A 1O7EA 4H8RA 5FQKA 5IHVA 2UWXA 2EX9A 3G32A 4IVIA 4OPZA 5M18A 2OSUA 5A93A 5A92A 4R1GA 1ES2A 5FASA 3DWZA 1VQQA 2CC1A 3GV9A 5F83A 4BD1A 2X01A 1I2SA 4WMCA 1TVFA 3WS2A 3IWOA 3PBTA 4UA9A 5KSCA 4C3QA 3PBOA 1K54C 5J8XA 3N6IA 3IXDA 1YT4A 5FQQA 1KDWA 2A49A 4M3KA 3DWKA 2Y55A 4MLLA 5AQ7A 2J9PA 2XR0A 5TFQA 2Q9NA 3PAEA 1FR1A 1ES3A 4RX3A 5EOOA 1FCMA 2J7VA 1JVJA 2QZ6A 4OLGA 3VP1A 4XUXA 2ZQDA 3FKWA 3QNBA 2Y4AA 3BLMA 2WKIA 4BL3A 4U0TA 2XQZA 3SH9A 1FCNA 4LENA 3G4PA 2HP9A 5A90A 2FFYA 2P9VB 3GRJA 4GD6A 4QY6A 5L2FA 1K57A 2OLUA 2Y2LA 5FQIA 3HLDA 3VMAA 3G31A 2I72A 3V39A 2E8IA 1KGGA 3V5MA 1GA9A 1ERQA 5HAPA 2Y91A 3E2LA 2Y2HA 1CI8A 1FSYA 4C75A 4S2MA 1RGYA 3VP0A 3OPRA 5GLDA 3A3EA 3O88A 4S2IA 4BD0A 5M19A 4DF6A 1K56D 4EWFA 4ZJ3A 2V2FF 3M2JA 3ZHHA 1XA1A 3ZG9B 1RGZA 1KVLA 1NYYA 2ZC6B 4OKPA 1K4FA 1XXMA 4FH2A 4XUZA 3OZHA 3ZVWA 4WEJA 5HW3A 3M6BA 3HL9A 2WKEA 1H8ZA 4N9LA 4MBKA 4GDBA 2HDQA 1BULA 3NY4A 3A3FA 2XH9A 2Y2KA 4KQRA 1W8YA 3G2ZA 2R9XA 3BEBA 1BTLA 1FSWA 2Q9MA 4WM9A 4QU3A 3WS5A 4N1HA 2H10A 3MZFA 1FCOA 5EVID 4ZBEA 1DJCA 5HARA 4S2OA 3D4FA 3S1YA 3G34A 4IBXA 5AQBA 4X69A 2XEPA 1VM1A 5AQ9A 3BFDA 5FI7A 3ZNYA 1ONHA 3B3XA 4GN2A 1QMFA 1HZOA 2ZD8A 3BRMA 1G6AA 3Q81A 4GB7A 4KZ9A 2WKHA 5FSRA 4LV1A 4ZJ1A 3MXSA 3O87A 5G18A 3FYZA 4PM5A 4HBUA 4KG5A 1CK3A 4KG6A 1KGEA 1K38A 2JE5A 5CTMA 5DTKA 4BL2A 2WGVA 2EX8A 2VGKA 3BFEA 1K25A 2WGWB 4GZBA 1YLJA 2OV5A 4OOMA 2BLSA 5EOEA 1YLWA 1PWGA 3ZFZA 3LCEA 1YLPA 3Q7VA 1K56A 3P09A 1W8QA 3O3VA 4GD8A 2QMIA 3Q7VB 1IYOA 4O7DA 1L0FA 3PBRA 2EFUA 4ZDXA 5EVIC 3UNWA 1NXYA 1S0WA 2A3UA 5GHZA 3VP2A 3WWXA 2HDRA 3GTCA 5KMWA 4LCLA 1CEFA 3ITAA 1MWSA 3BFGA 3M6HA 1ESIA 2Y2OA 5A91A 1WYBA 3SS3A 4A5RA 4JF6A 1LL9A 3AGFA 1IYPA 1XKZA 3IWIA 4FH4A 2Y2NA 3UPPA 1O07A 1L0EA 4S2KA 4DE2A 3Q7ZA 2EX6A 3UPNA 1TDLA 5EVIA 3BECA 3WRTA 4LV3A 1XP4A 1MKIA 2R9WA 4OLDA 3QNCA 4NK3A 2Y2GA 1IKIA 1IELA 4K0WA 2DCFA 5CRFA 4EUZA 1GHMA 3FWLA 4PM7A 5GLAA 1DJAA 4UAAA 5FI6A 1H8YA 4GKUA 3UE0A 2HDUA 3SOIA 5BOHA 4MBFA 3I7JA 2X71A 3IXHA 4R3JA 1ES4A 2WYXA 3CJMA 3N8LA 2BG1A 4OQHA 4JKTA 1PW8A 3G2YA 2ZC3B 5DTSA 2XF3A 3FV7A 3N7WA 4LV2A 3C4OA 3HREA 1PWDA 1WYCA 5CHUA 4WBGA 5HAIA 2C6WB 5FI2A 1DY6A 3ISGA 1MWTA 4E3IA 1GA0A 1JTGA 4BENA 3VOZA 3MZDA 1ONGA 1BLHA 4N1XA 4S2LA 4S2NA 5CECA 1CEGA 1WE4A 2DNSA 3HLGA 4WEKA 3W8KA 1PW1A 1G68A 3LY3A 3S4XA 1K57C 1J9MA 4EBPA 2XFTA 3GR2A 3OCLA 1U60A 4YFMA 4IBRA 4JXWA 3IHBA 3UDXA 1IEMA 3P98A 3PBSA 1TDGA 4KZAA 5CTNA 2ZC7A 4E3KA 3BFCA 1LI0A 4Y0UA 2ZQ9A 4OPQA 1YLZA 1LHYA 3IXBA 2WAEA 1JWZA 4OOYA 3V3SA 2FFFB 1PWCA 1NY0A 1N4OA 4PMAA 1BLCA 2WAFA 4FSFA 4PM8A 4WYYA 3OC2A 4S2PA 4B88A 4E3JA 2VGJA 3LEZA 5EPHA 1GHIA 4QD4A 5DF8A 2Y2QA 3IHAA 3QHYA 1PIOA 4BLMA 3Q82A 3IH9A 5E43A 1E4DA 4E3NA 2ZM8A 4GDNA 4GOGA 1EWZA 2ZM0A 1BUEA 4Y0OA 3VOYA 1EI5A 1JWVA 2XD5A 2J8YA 4EBNA 4GNUA 4WZ4A 4P87A 2ZQ8A 2C5WB 5KSHA 4U3TA 3BYDA 1AXBA 1BLSA 4KQQA 2XLNA 3Q07A 4C6YA 5FQMA 4JXVA 4IEDA 2HDSA 4EBLA 2Y2MA 4OP8A 3DW0A 3ZNTA 4Z9QA 2XK1A 4QY5A 5FA7A 1ESUA 5HL1A 2WZXA 3IQAA 1KE0A 3MXRA 1FOFA 3ZG7B 4KQOA 3HLEA 3C4PA 4JXGA 5M1AA 3A3DA 2XGNA 3O86A 4MEZA 1KVMA 1JWPA 2XD1A 3HUOA 2IWBA 4HEFA 1MY8A 5FATA 1XGJA 5FAOA 3V3RA 1KE4A 1PZPA 1IYSA 3IH8A 2HP5A 3CG5A 1PI5A 2Z2MB 2ZC5B 4L0LA 2PBYA 2ZC4B 3OCNA 4CPKA 1NZOA 3AGDA 5FAPA 3LY4A 4U0XA 4R4SA 4WZ5C 4KZ8A 3VFHA 4E3LA 3UN7A 4QJGA 1NJ4A 3OPLA 2H0YA 5EECA 5GLCA 5HX9A 1LLBA 1TEMA 2P74A 1NRFA 5E2HA 4NETA 3ZG0A 3NDGA 4K0XA 4B4ZA 3ZGAB 4Y7PA 5CEDA 3MZEA 3DTMA 4HESA 4WZ5A 3N8SA 1SDEA 1HVBA 4OQ0A 4DE3A 1H5XA 3PTEA 4PM6A 4JBFA 5CHJA 5E2EA 4KZ7A 3MBZA 2RL3A 3NI9A 4JPMA 4OH0A 4BJPA 4DXBA 4EV4A 2WK0A 4DRTA 3GMWA 4JF4A 1DJBA 4KENB 1ZG4A 3UO9A 5FDHA 3RXWA 1PI4A 2WZZA 2EXAA 1SDNA 3W4OA 3CMZA 5EVIB 3C7VA 1NYMA 2HP6A 1JTDA 4RA7A 1K55C 2PU4A 4X55A 4RYEA 3SH7A 3UY6A 5TR7A 5DF7A 4F94A 1PYYA 1XGIA 4N92A 1OMEA 3PAGA 4DXCA 3BM6A
chains in the Genus database with same CATH superfamily
4UA7A 2WUQA 4X1LA 2EX2A 4S2NC 1P9RA 1SCWA 4ESPA 5EE8A 3S7QA 3BLSA 3IF5A 1YMXA 4KUOA 5J4EA 1J3WA 1OJ5A 5DF9A 3SS4A 1ZHHB 3T1SA 2O9CA 1FR6A 3IF6C 1UGUA 1Y54A 4UQIM 1MWRA 2H0TA 4K91A 3IT9A 2XFSA 3UE1A 3WS1A 2OAP1 3IF6A 4KUKA 3LO7A 4OPYA 3IF6B 1GHPA 1HD8A 3PR6A 4KZ6A 3S7OA 3WRZA 3W4PA 3ZDJA 3WS0A 1YM1A 2B5RA 4FTXA 4R0QA 4D60A 3UDFA 4Q0IA 2Z2LB 4DE1A 4Y17A 5CHMA 3M2KA 3JYIA 4LRYC 5DTTA 4X56A 3IBJA 4MN6A 4O8GA 3A0SA 4YNRA 4UEYA 2PAVP 3O5YA 3PBQA 2W3GA 4HBTA 4Y3IA 3GSGA 4GW9A 2IWCA 1QMEA 3E2KA 3HLFA 2PR5A 3WS4A 3QP8A 2Z6DA 2ZQCA 3BY9A 3NBLA 3VP3A 3A0RA 1T1BA 4OQGA 3UMEA 1MBLA 3NDEA 4R3AA 3QP2A 3G35A 4Q8IA 3CHWP 1NZUA 2KLIA 1MPLA 1N9NA 2X02A 1ZG6A 5GHYA 2H5SA 4I39A 5GHXA 2V20A 4E6WA 2P04A 2WGIA 3NOPC 2GNXA 1KGFA 1YQSA 2W1RA 5IS1A 2V0UA 5FQ9A 4I5SA 5I94A 1LL8A 5HL6A 5CGSA 5U47A 1ALQA 5F82A 1O7EA 4H8RA 2KDKA 1T19A 5A93A 5FASA 3DWZA 1VQQA 2CC1A 4BD1A 4WMCA 3IWOA 3C30A 1K54C 3N6IA 3IXDA 1YT4A 5FQQA 1KDWA 2Q9NA 3PAEA 1ES3A 5HWTA 4OLGA 3FKWA 2W1TA 4Y13A 1XJ3A 1XJ4A 2YKHA 2HP9A 2FFYA 4GD6A 5FQIA 3UMDA 2A24A 1GA9A 1VETA 5HAPA 3E2LA 3BWLA 4S2MA 1RGYA 3OPRA 3A3EA 4S2IA 4DF6A 1K56D 5DKLA 4LPZA 3ZG9B 2BASA 4FH2A 4XUZA 5DFYA 1H8ZA 2PYPA 1BULA 3NY4A 4KQRA 1YKDA 1DP8A 1P97A 1FCOA 4ZBEA 5HARA 1S4SA 3BFDA 1GSXA 2GJ3A 2VA0A 5FSRA 4ZJ1A 4LV1A 3O87A 3FYZA 4KG5A 2HGVA 2VKSA 2W27A 2JE5A 5CTMA 2WGVA 3JPUA 1K25A 4ETZA 4GZBA 5DJTA 2QYBA 5EOEA 3ZFZA 2K31A 1SKOA 2ZBBA 4ZDXA 5GHZA 5LBRA 1LSXA 4JGOA 3ITAA 4A5RA 2VV8A 3LIBA 3IWIA 5EV0A 4S2KA 3ZQ5A 2EX6A 4PAUA 3QNCA 1IKIA 4K0WA 4EUZA 5FI6A 1H8YA 3I7JA 1OTDA 3QP5A 1XJ6A 2WYXA 3PHYA 1GSWA 1OTEA 3P01A 2GX5A 1V9YA 1PWDA 4NXBA 2HJ9C 4WUJA 5FI2A 5CX7A 4BBTA 4HH2A 4S2LA 5CECA 4N1XA 4BBUA 1WE4A 3EEAA 2B18A 4LGWA 4IBRA 3IHBA 5J7EA 1LT0A 2ZC7A 3BFCA 1LI0A 3LUQA 2WKRA 4OPQA 3IXBA 1LHYA 1H3QA 2FFFB 4EEUA 1N4OA 1BLCA 4B88A 2JKRI 2XA7M 4L9GA 5EPHA 2Y2QA 1S66L 1PIOA 4BLMA 4GDNA 1EWZA 3VOYA 4EBNA 4WZ4A 4Z1WA 3VV4A 2PDRA 4U3TA 4Y15A 4JXVA 3LIFA 1PNEA 2J3TD 3DW0A 1D7EA 5HD3A 3F1NA 3FPWA 5FA7A 1OJGA 2OWJA 4JXGA 2XGNA 5AJGA 1KVMA 2IWBA 3HUOA 4F3LB 3OOVA 1PZPA 2CMNA 4L0LA 2PBYA 3OCNA 1NZOA 3VFHA 4E3LA 2XRNA 4EUVA 1LLBA 1TEMA 1NRFA 5E2HA 3UB7A 3ZG0A 4Y7PA 4EEPA 3DTMA 3LIAA 3N8SA 4OQ0A 2QJ7A 4DE3A 4PM6A 4OH0A 3MBZA 4JPMA 4BJPA 5AVFA 2WK0A 5K5BA 3L9KA 1DJBA 1ZG4A 2M1CA 3RXWA 1SDNA 1FILA 5EVIB 4IUHA 2HP6A 1JTDA 1K55C 3MFXA 5TR7A 5DF7A 1PYYA 4GHIA 1OMEA 3PAGA 1BZAA 4EU0A 3VFFA 1ERMA 3H82B 1K55A 4MBHA 2D02A 4OVDA 3NOUC 4PM9A 5GLBA 2O99A 2ZJ9A 3ULFA 2D01A 4OQIA 2Y2PA 2PHYA 1XA7A 4OPRA 4E3OA 1OPXA 4DKIA 2VGLS 5E2FA 2VJWA 3B33A 4NXEA 1SHVA 4MNRA 3MJQA 1L0GA 4DE0A 3MKEA 3T1QB 1F98A 1Z09A 3MQ0A 5L09A 1L2SA 5E2GA 5HAQA 5EFWA 3Q1FA 4KZ4A 1MXOA 1BYWA 2P9VA 2JHEA 4X6TA 3CAXA 3K2NA 3D3OA 4S2JA 4E04A 3HUMA 3L7HA 3SH8A 1ES5A 5J3WA 5L8MA 3UDIA 1N9OA 4E6XA 4NXFA 3T1RA 4DJ2A 3HLBA 3FKVA 3IBRA 2RCXA 2VGLM 4RVAA 1BT5A 1L0DA 2YKFA 1AWIA 3UPOA 3MSHA 3BFFA 5F6AA 3VSKA 3HVFA 2ZQAA 3PBNA 3KYZA 4X1MA 4BMWA 3E98A 1S4RA 3AGEA 3NIAA 3ZCZA 1N9BA 2VEAA 1RCJA 3HUNA 2QHKA 1ZTUA 2EWVA 5CEBA 4FUWA 2WGWA 1YMSA 3F1PB 3RXXA 3A3JA 3T4TA 1E3UA 5TGFA 4UQIS 3MF0A 1KDSA 3LI8A 4FCFA 1W79A 4DDSA 2V9AA 4YOFA 4RQ9A 3D9YA 4JF5A 1GCEA 2EXBA 1BLPA 4P85A 1K4EA 3GECA 2Y2JA 1L3LA 4CJNA 2ZL1A 3KSFA 4EQIA 1I2WA 3G30A 1S1YA 2EFXA 2JBFA 1MKMA 2G2UA 3MXQA 3VSLA 4IJGA 1K6SA 1BSGA 1M40A 4FOFA 5CGXA 1F5MA 3TOIA 3KO6A 4AFIA 2PBDP 2FZ0A 3G32A 5M18A 3B47A 1TD5A 3T4KA 1ES2A 4JGPA 1NLZA 2X01A 1I2SA 3MS6A 4B93A 5KSCA 4HJ4A 4EETB 3UB9A 4M3KA 3T4QA 3DWKA 4DN0A 5TFQA 4EXOA 1FR1A 5EOOA 1FCMA 1JVJA 2QZ6A 5TJJA 2ZQDA 2LB9A 4BL3A 4H6JA 2XSSA 4U0TA 2XQZA 4LENA 3G4PA 5L2FA 3HLDA 3V39A 3FC7A 2LB5A 4XT2A 1FSYA 3FPVA 3VP0A 3O88A 3EOIA 5F5YA 1OTAA 5MC7A 4LRXC 3LIDA 3NHQA 1W63M 5HPFA 4Q0JA 1NYYA 3NJAA 3CI6A 2BTFP 4ARZA 3UB5P 5HWVA 4WEJA 3HL9A 3H9WA 2WKEA 4MBKA 2V1BA 2W3FA 2R9XA 3BEBA 5EVID 3MZFA 1DJCA 1NWZA 4S2OA 3S1YA 3G34A 1Y4OA 1ONHA 2L4RA 4GN2A 5TBMA 4GB7A 1G6AA 1CK3A 4KG6A 2WKPA 1KGEA 1K38A 2VGKA 2OV5A 3LR3A 4PKYG 3Q7VA 3P09A 3O3VA 2HJEA 3Q7VB 1L0FA 1TS6A 2EFUA 4II7A 5KMWA 1ODVA 1A0KA 2Q0OA 3BFGA 1ESIA 2Y2OA 5A91A 3TJZC 1WYBA 4HHDA 3AGFA 3VE4A 3UB6A 3UPPA 1O07A 2W0NA 3Q7ZA 3BECA 3T4SA 2V1AA 2EA9A 4HIAA 2Y2GA 1IELA 2DCFA 5GLAA 3RFBA 3T12B 1XFQA 4LFUA 5BOHA 3BQAA 3MQOA 3N8LA 2ZC3B 1G28A 5CHUA 4G3KA 4WBGA 3ISGA 1BLHA 3HLGA 3W8KA 1PW1A 1G68A 3GR2A 1U60A 4CLCA 4E3KA 3PBSA 2W1TB 2JKRM 1JWZA 4OOYA 2WAFA 3E4OA 4WYYA 3LR4A 2J3WA 2A24B 5DF8A 1VETB 2V0WA 5E43A 1JWVA 4GNUA 5HSQA 5KSHA 5IT5A 3QP6A 3Q07A 3MR0A 4EBLA 3ZNTA 4L9FA 2XK1A 4QY5A 3TW8A 3HLEA 4MEZA 2QWSA 1JWPA 5L07A 3DTIA 1CQAA 3CUEC 3KYQA 1KE4A 3IH8A 2VLGA 2ZC5B 4CPKA 3AGDA 3KYEA 1OT6A 5FAPA 1LSVA 4R4SA 3UN7A 5HWWA 1SZVA 3OPLA 5GLCA 3CUEA 5HX9A 2P74A 4K0XA 4GJ4A 5HDSA 1HVBA 1SKOB 3LEQA 3OLOA 3PTEA 3CITA 5E2EA 3NI9A 3GMWA 4JF4A 5HZHA 1S1ZA 1PI4A 3H7WA 3W4OA 1NYMA 4WLAA 2ACGA 2E8JA 4RYEA 2XA7S 4F94A 1XGIA 4N92A 4R38A 3KX0X 4DXCA 1IOUA 4LCMA 1H0MA 5FQJA 5CERA 4WF0A 2ZMFA 2JKFA 5FEFA 4R4RA 2UV0E 5C5KA 1V9ZA 4MN5A 5EM0A 1LL5A 4ZRRA 3T50A 5F1FA 2PT7A 3IX8A 3LI9A 3NCKA 3MKFA 4LV0A 3HJIA 3T1XA 1YLYA 4HP9A 5DJUA 1S6RA 4IVKA 2JKGA 4L9EA 1Q2QA 2GDNA 2ZM2A 1MWUA 3HLCA 1YLTA 1K6RA 4MN7A 4OOLA 2JKTM 3CZDA 3EGXC 4RX2A 3LR5A 4N9KA 1OTBA 2H28A 4JGQA 3MFDA 4KZBA 3IWQA 1PRQA 4P6ZM 4P6BA 3V67A 2AVXA 2B95A 1IFQA 1CI9A 4M4XA 3F1NB 5F1GA 1G6OA 2L1MA 1UWPX 4QB8A 2QKPA 3KSIA 1LI9A 3N4IA 1KOUA 5CGWA 4UHUA 1Q2PA 3OPHA 4ID4A 2A2LA 2VK3A 2VX8A 3C5AA 4XXRA 1ZC2A 2V8FA 4KG2A 1W7FA 2M7UA 1F9IA 4QHCA 4KZ3A 3ITBA 3KSHA 1Z6FA 3EQUA 1C3BA 1HTZA 1TS0A 1ZKJA 3ZYTA 3IXGA 4WMCD 3TG9A 1W63Q 4CLCE 4EERA 2ZMVA 1TF1A 1EROA 3W4QA 4ETXA 1IYQA 4WL9A 1W5DA 1TS7A 2ZQ7A 4GHIB 3RJUA 5KZHA 2Y8HA 5DVAA 3HLWA 4X68A 3C7UA 4R23A 1FQGA 4ZTKA 5JYOA 1YPRA 3VP4A 3MQQA 1G5UA 4OPZA 2OSUA 5A92A 5F83A 1TVFA 3WS2A 4UA9A 1MC0A 3PBTA 3PBOA 1HLUP 1EW0A 2A49A 1MZUA 4MLLA 3P7NA 2XR0A 4RX3A 3F1OA 1H8MA 3F1OB 4LLOB 2Y4AA 3BLMA 2M7VA 3SH9A 1FCNA 3BY8A 2P9VB 4QY6A 1K57A 4G3VA 1KGGA 3V5MA 1ERQA 2Y91A 2Y2HA 1CI8A 5KIZA 1T1AA 4IUKA 4BD0A 4PHTA 3EGDC 4ZJ3A 1T1CA 3M2JA 5EVEA 1XA1A 1RGZA 5EM1A 2ZOHA 4Y2FA 4OKPA 1K4FA 1XXMA 4YWZA 3OZHA 3M6BA 4ME4A 4N9LA 2L0WA 2HDQA 4QWOA 3A3FA 2Y2KA 3G2ZA 1FSWA 2Q9MA 4WM9A 1DP6A 4QU3A 4N1HA 4GS9A 3D4FA 4IBXA 3ICYA 2XEPA 1VM1A 5FI7A 3B3XA 1QMFA 2ZD8A 3BRMA 4KZ9A 2WKHA 4GCZA 5DTKA 4BL2A 2EX8A 2WGWB 1YLJA 2BLSA 1PWGA 1YLPA 1K56A 4GD8A 3IS2A 2VZWA 2OWHA 4K08A 3IS2B 2A3UA 4HY8A 3GTCA 1CEFA 1MWSA 3M6HA 4G3WA 3SS3A 4JF6A 1LL9A 1XKZA 4FH4A 2Y2NA 2ZL1B 1TDLA 1XP4A 3K3DA 3R7WA 4NK3A 1YSQA 1GHMA 3FWLA 4UAAA 2HDUA 2I9VA 2X71A 4R3JA 1ES4A 1YSPA 2O9BA 4JKTA 5DTSA 5HD5A 3LFVA 3FV7A 4HP4A 4LV2A 3C4OA 3S7NA 3HREA 4R6LA 3JVVA 2C6WB 1MWTA 4E3IA 1JTGA 3R4KA 4BENA 3MZDA 1ONGA 4S2NA 3HCYA 2DNSA 2EWWA 4HNBA 3S4XA 4EBPA 2W3HA 3UDXA 1IEMA 5CTNA 1TDGA 4KZAA 3RTYA 3C38A 2ZQ9A 4H6JB 3NULA 1YLZA 3PXPA 5G4ZA 1NY0A 4PMAA 4O0PA 4FSFA 2NUTC 3OC2A 2VGJA 4DMZA 3LEZA 2O9AA 1GHIA 4XT2B 1CJFA 3IHAA 3QHYA 3Q82A 1E4DA 4E3NA 2ZM8A 1BUEA 1PFLA 1EI5A 4R70A 3C2WA 2XD5A 2J8YA 4P87A 2QJ5A 2C5WB 4ARZB 3BYDA 1AXBA 2PD7A 4KQQA 2XLNA 3IX3A 4C6YA 4IEDA 2HDSA 2Y2MA 2HZ5A 4Z9QA 1ESUA 3CWFA 2WZXA 1KE0A 5M1AA 3A3DA 3O86A 4HJ3A 3KSGA 1MY8A 5TBMB 5FAOA 3CG5A 1PI5A 2ZOIA 2Z2MB 2OOLA 3LY4A 4WZ5C 4KZ8A 1OT9A 2J80A 4HQAA 4QJGA 3FG8A 4NETA 4DJ3A 2J3TC 2VV6A 3NDGA 5CEDA 3MZEA 3CLOA 4HESA 4WZ5A 1SDEA 5F69A 1H5XA 3DTEA 5CHJA 4JBFA 3BW6A 4EV4A 2RL3A 3T4JA 2WZZA 4MDZA 3CMZA 3GDIA 4BWIA 3C7VA 2V8CA 3MMHA 3SZTA 2PU4A 3LGOA 5FL3A 4GLQA 3E0YA 5FDSA 3TRCA 3EWKA 5DFXA 3N8RA 3FZCA 3D72A 1IKGA 2PRFA 3UE3A 1YAXA 4CLCC 3E4QA 4E3MA 1XPBA 3E4PA 2G7UA 2Y2IA 2R78A 3ZG5A 5EVLA 5EUAA 5GL9A 4CLCB 2KOIA 4CQHA 2HPBA 1XFNA 1D06A 1XX2A 1STZA 3U2AA 4EQ1A 1K0KA 4JLFA 1OTIA 2XDMA 1WA9A 3DBAA 4ZJ2A 1K54A 5HFOA 4OONA 5FEGA 4D2OA 5L10A 3DTKA 4PPRA 1KE3A 4IHQA 4FD8A 2ZLYA 4MCWA 1SKFA 5I5LA 3SW1A 3NC8A 4KZ5A 2WKQA 2FH5A 2OLVA 2B02A 5AQAA 3SS5A 2JCHA 5AVEA 2MJ6A 4NXGA 1E3UD 2JN7A 3LIEA 1TS8A 4MMNA 4LRZE 1M6KA 2V1ZA 3HBRA 2WADA 4EW7A 4UA6A 3ZG8B 2Y59A 1NLYA 3OPPA 2INWA 3GQZA 5FAQA 3OBFA 4WELA 1VHMA 3EQVA 4ZAMA 1D1JA 2PU2A 3GVBA 3S22A 1PZOA 4OP5A 3JVUA 4YINA 4JXSA 4X53A 3S7PA 4DDYA 4HH3A 2DRWA 1E25A 2JC7A 1RP5A 2J9OA 5DKKA 3NOTC 3G6OA 5CXWA 3BJNA 4B4XA 1CF0A 5HPIA 3H7WB 3TSGA 4Y0TA 3V50A 3A3IA 3B42A 1S67L 2QPNA 3ZVTA 2IWDA 1Y28A 1GSVA 2ZMAA 4P0MA 4BQMA 1I5QA 1VB6A 5JYPA 4I3IA 5D3OA 2G2WA 4R3BA 1XJ2A 3LR0A 5FQKA 5IHVA 2UWXA 2EX9A 1DP9A 4IVIA 1NRJA 5IU1A 4R1GA 4P6ZS 2NUPC 3GV9A 5A8BA 4X25A 4C3QA 5J8XA 5AQ7A 2Y55A 2J9PA 5F68A 3UB8A 2O0YA 2J7VA 4KQDA 3VP1A 4XUXA 3QNBA 2WKIA 5A90A 3GRJA 4HOIA 2OLUA 2P08A 2Y2LA 1FIKA 3VMAA 3RH8B 2W3DA 3QP1A 3G31A 4BBVA 2I72A 2E8IA 2KX6A 4C75A 3NECA 1F2KA 5GLDA 1P9WA 4NG2A 5M19A 4EWFA 2V2FF 3ZHHA 1KVLA 2ZC6B 3HJKA 3ZVWA 5HW3A 2Y79A 1X0OA 4GDBA 3BQ8A 2XH9A 1W8YA 1ACFA 3CPTA 1BTLA 4JGRA 2H10A 3CPTB 4HJ6A 3C8CA 1DRMA 5AQBA 4X69A 2P7JA 5AQ9A 3EEHA 3ZNYA 1HZOA 3Q81A 3WS5A 4F3LA 3MXSA 5G18A 4PM5A 4HBUA 4WN5A 3BFEA 4OOMA 1YLWA 3LCEA 1W8QA 2QMIA 1IYOA 4O7DA 3PBRA 5EVIC 3UNWA 1NXYA 3DAVA 1S0WA 3WWXA 3VP2A 2HDRA 4LCLA 3TE8A 1IYPA 4CLCD 1L0EA 4DE2A 3UPNA 5EVIA 3WRTA 4LV3A 1MKIA 2R9WA 4OLDA 2VV7A 5CRFA 4PM7A 1DJAA 1T18A 4GKUA 3UE0A 3SOIA 4MBFA 3IXHA 5HDDA 3H82A 1UWNX 3CJMA 2HF6A 2BG1A 4OQHA 1PW8A 3G2YA 3T4LA 2XF3A 3N7WA 1JNUA 3IX4A 1WYCA 2HV1A 5HAIA 2Z6CA 1DY6A 1LSWA 2W3EA 3W2ZA 1GA0A 3VOZA 1P0ZA 1CEGA 4WEKA 3LY3A 1K57C 1J9MA 2PD8A 2XFTA 2PYRA 3OCLA 4YFMA 2PR6A 3UE6A 4JXWA 1VEUA 1N9LA 3P98A 4Y0UA 1VEUB 4Y5FA 2WAEA 3V3SA 1PWCA 4HI4A 4PM8A 3LICA 4S2PA 2GZAA 4E3JA 4QD4A 4EESA 3IH9A 4GOGA 2ZM0A 4Y0OA 4I38A 2JKTI 4QPRA 2ZQ8A 2K7SA 4Q0HA 1BLSA 5FQMA 3QP4A 4NKPA 4NEED 3U4LP 4OP8A 5HDCA 3K3CA 4O01A 5HL1A 3IQAA 4GS9B 3MXRA 1FOFA 3ZG7B 4KQOA 2XROA 3C4PA 2XD1A 4HEFA 4PKYA 5FATA 1XGJA 3V3RA 1IYSA 2HP5A 2ZC4B 4U0XA 4B9OA 3LYXA 1NJ4A 2H0YA 5EECA 4I3AA 2DMWA 3VE3A 2IA2A 4B4ZA 3ZGAB 2OAQ1 3T4OA 2K2NA 3PYPA 3F1PA 4KZ7A 4DXBA 3A0VA 4DRTA 4KENB 3UO9A 5FDHA 4I3JA 2EXAA 4RA7A 4X55A 3R7WB 3SH7A 3UY6A 3VOLA 5G4YA 3BM6A
chains in the Genus database with same CATH topology
1BZAA 4UA7A 2WUQA 4LCMA 3VFFA 2EX2A 1ERMA 3N8RA 3FZCA 4S2NC 1K55A 4MBHA 5FQJA 5CERA 4OVDA 1SCWA 4PM9A 5GLBA 1IKGA 5EE8A 2ZJ9A 3UE3A 4OQIA 2Y2PA 3BLSA 4R4RA 3IF5A 1XA7A 4E3MA 1XPBA 1YMXA 1LL5A 4OPRA 5DF9A 2Y2IA 3SS4A 4E3OA 5F1FA 3ZG5A 4DKIA 1FR6A 3NCKA 3MKFA 3IF6C 1Y54A 4LV0A 5E2FA 5EUAA 5EVLA 5GL9A 1SHVA 1MWRA 1YLYA 2HPBA 4MNRA 1S6RA 1XX2A 4IVKA 1Q2QA 1L0GA 4DE0A 2GDNA 2H0TA 3MKEA 4K91A 3IT9A 2ZM2A 2XFSA 3UE1A 3WS1A 1MWUA 4JLFA 2XDMA 3IF6A 3HLCA 1L2SA 1YLTA 3LO7A 4OPYA 5E2GA 5HAQA 3IF6B 1GHPA 1HD8A 1K6RA 3Q1FA 4ZJ2A 1K54A 4KZ4A 4OOLA 4KZ6A 3CZDA 1MXOA 4OONA 5HFOA 4D2OA 2P9VA 3WRZA 4PPRA 1KE3A 4X6TA 3W4PA 4RX2A 3ZDJA 4S2JA 3WS0A 1YM1A 2B5RA 4FD8A 2ZLYA 3HUMA 1SKFA 4R0QA 3NC8A 4KZ5A 4N9KA 3SH8A 1ES5A 3UDFA 2OLVA 2Z2LB 4DE1A 3UDIA 5CHMA 3M2KA 3MFDA 3JYIA 5AQAA 4KZBA 3IWQA 5DTTA 4E6XA 3SS5A 2JCHA 4P6BA 1E3UD 4X56A 3HLBA 3FKVA 2RCXA 4RVAA 1BT5A 1L0DA 1CI9A 1M6KA 2V1ZA 3PBQA 4HBTA 3HBRA 3UPOA 3GSGA 2WADA 3BFFA 3VSKA 4UA6A 3HVFA 2IWCA 5F1GA 1QMEA 3ZG8B 3E2KA 2Y59A 3HLFA 2ZQAA 4QB8A 3PBNA 3WS4A 3OPPA 1LI9A 3GQZA 5FAQA 3N4IA 4WELA 2ZQCA 3AGEA 3EQVA 3NBLA 5CGWA 4UHUA 3NIAA 4ZAMA 3VP3A 2PU2A 3GVBA 3S22A 4OQGA 3ZCZA 1Q2PA 1PZOA 3OPHA 1N9BA 4ID4A 1RCJA 4OP5A 3HUNA 4YINA 4JXSA 4X53A 3C5AA 1MBLA 4XXRA 1ZC2A 3NDEA 5CEBA 3G35A 4KG2A 1W7FA 4Q8IA 4DDYA 2DRWA 2WGWA 4QHCA 4KZ3A 1YMSA 1E25A 3ITBA 1Z6FA 3EQUA 2JC7A 1RP5A 1C3BA 1NZUA 2J9OA 1HTZA 3RXXA 3A3JA 1MPLA 1ZKJA 5CXWA 1E3UA 3IXGA 4WMCD 5TGFA 3TG9A 1KDSA 2X02A 4B4XA 4FCFA 1W79A 1ZG6A 4DDSA 5GHYA 2H5SA 4JF5A 1GCEA 2EXBA 5GHXA 3TSGA 2V20A 4E6WA 4Y0TA 2WGIA 3V50A 3A3IA 1EROA 3W4QA 1BLPA 1IYQA 1KGFA 1YQSA 2QPNA 1K4EA 4P85A 3ZVTA 2IWDA 2Y2JA 1W5DA 5FQ9A 2ZQ7A 4CJNA 2ZMAA 4EQIA 1I2WA 4P0MA 5I94A 3G30A 3RJUA 5KZHA 2EFXA 1I5QA 4BQMA 5DVAA 2JBFA 3HLWA 2G2UA 4X68A 5CGSA 3VSLA 5JYPA 5U47A 5D3OA 3C7UA 1ALQA 1BSGA 1K6SA 1M40A 5F82A 4R23A 2G2WA 5CGXA 1FQGA 4R3BA 4ZTKA 5JYOA 3TOIA 3VP4A 1O7EA 4H8RA 5FQKA 5IHVA 2UWXA 2EX9A 3G32A 4IVIA 4OPZA 5M18A 2OSUA 5A93A 5A92A 4R1GA 1ES2A 5FASA 3DWZA 1VQQA 2CC1A 3GV9A 5F83A 4BD1A 2X01A 1I2SA 4WMCA 1TVFA 3WS2A 3IWOA 3PBTA 4UA9A 5KSCA 4C3QA 3PBOA 1K54C 5J8XA 3N6IA 3IXDA 1YT4A 5FQQA 1KDWA 2A49A 4M3KA 3DWKA 2Y55A 4MLLA 5AQ7A 2J9PA 2XR0A 5TFQA 2Q9NA 3PAEA 1FR1A 1ES3A 4RX3A 5EOOA 1FCMA 2J7VA 1JVJA 2QZ6A 4OLGA 3VP1A 4XUXA 2ZQDA 3FKWA 3QNBA 2Y4AA 3BLMA 2WKIA 4BL3A 4U0TA 2XQZA 3SH9A 1FCNA 4LENA 3G4PA 2HP9A 5A90A 2FFYA 2P9VB 3GRJA 4GD6A 4QY6A 5L2FA 1K57A 2OLUA 2Y2LA 5FQIA 3HLDA 3VMAA 3G31A 2I72A 3V39A 2E8IA 1KGGA 3V5MA 1GA9A 1ERQA 5HAPA 2Y91A 3E2LA 2Y2HA 1CI8A 1FSYA 4C75A 4S2MA 1RGYA 3VP0A 3OPRA 5GLDA 3A3EA 3O88A 4S2IA 4BD0A 5M19A 4DF6A 1K56D 4EWFA 4ZJ3A 2V2FF 3M2JA 3ZHHA 1XA1A 3ZG9B 1RGZA 1KVLA 1NYYA 2ZC6B 4OKPA 1K4FA 1XXMA 4FH2A 4XUZA 3OZHA 3ZVWA 4WEJA 5HW3A 3M6BA 3HL9A 2WKEA 1H8ZA 4N9LA 4MBKA 4GDBA 2HDQA 1BULA 3NY4A 3A3FA 2XH9A 2Y2KA 4KQRA 1W8YA 3G2ZA 2R9XA 3BEBA 1BTLA 1FSWA 2Q9MA 4WM9A 4QU3A 3WS5A 4N1HA 2H10A 3MZFA 1FCOA 5EVID 4ZBEA 1DJCA 5HARA 4S2OA 3D4FA 3S1YA 3G34A 4IBXA 5AQBA 4X69A 2XEPA 1VM1A 5AQ9A 3BFDA 5FI7A 3ZNYA 1ONHA 3B3XA 4GN2A 1QMFA 1HZOA 2ZD8A 3BRMA 1G6AA 3Q81A 4GB7A 4KZ9A 2WKHA 5FSRA 4LV1A 4ZJ1A 3MXSA 3O87A 5G18A 3FYZA 4PM5A 4HBUA 4KG5A 1CK3A 4KG6A 1KGEA 1K38A 2JE5A 5CTMA 5DTKA 4BL2A 2WGVA 2EX8A 2VGKA 3BFEA 1K25A 2WGWB 4GZBA 1YLJA 2OV5A 4OOMA 2BLSA 5EOEA 1YLWA 1PWGA 3ZFZA 3LCEA 1YLPA 3Q7VA 1K56A 3P09A 1W8QA 3O3VA 4GD8A 2QMIA 3Q7VB 1IYOA 4O7DA 1L0FA 3PBRA 2EFUA 4ZDXA 5EVIC 3UNWA 1NXYA 1S0WA 2A3UA 5GHZA 3VP2A 3WWXA 2HDRA 3GTCA 5KMWA 4LCLA 1CEFA 3ITAA 1MWSA 3BFGA 3M6HA 1ESIA 2Y2OA 5A91A 1WYBA 3SS3A 4A5RA 4JF6A 1LL9A 3AGFA 1IYPA 1XKZA 3IWIA 4FH4A 2Y2NA 3UPPA 1O07A 1L0EA 4S2KA 4DE2A 3Q7ZA 2EX6A 3UPNA 1TDLA 5EVIA 3BECA 3WRTA 4LV3A 1XP4A 1MKIA 2R9WA 4OLDA 3QNCA 4NK3A 2Y2GA 1IKIA 1IELA 4K0WA 2DCFA 5CRFA 4EUZA 1GHMA 3FWLA 4PM7A 5GLAA 1DJAA 4UAAA 5FI6A 1H8YA 4GKUA 3UE0A 2HDUA 3SOIA 5BOHA 4MBFA 3I7JA 2X71A 3IXHA 4R3JA 1ES4A 2WYXA 3CJMA 3N8LA 2BG1A 4OQHA 4JKTA 1PW8A 3G2YA 2ZC3B 5DTSA 2XF3A 3FV7A 3N7WA 4LV2A 3C4OA 3HREA 1PWDA 1WYCA 5CHUA 4WBGA 5HAIA 2C6WB 5FI2A 1DY6A 3ISGA 1MWTA 4E3IA 1GA0A 1JTGA 4BENA 3VOZA 3MZDA 1ONGA 1BLHA 4N1XA 4S2LA 4S2NA 5CECA 1CEGA 1WE4A 2DNSA 3HLGA 4WEKA 3W8KA 1PW1A 1G68A 3LY3A 3S4XA 1K57C 1J9MA 4EBPA 2XFTA 3GR2A 3OCLA 1U60A 4YFMA 4IBRA 4JXWA 3IHBA 3UDXA 1IEMA 3P98A 3PBSA 1TDGA 4KZAA 5CTNA 2ZC7A 4E3KA 3BFCA 1LI0A 4Y0UA 2ZQ9A 4OPQA 1YLZA 1LHYA 3IXBA 2WAEA 1JWZA 4OOYA 3V3SA 2FFFB 1PWCA 1NY0A 1N4OA 4PMAA 1BLCA 2WAFA 4FSFA 4PM8A 4WYYA 3OC2A 4S2PA 4B88A 4E3JA 2VGJA 3LEZA 5EPHA 1GHIA 4QD4A 5DF8A 2Y2QA 3IHAA 3QHYA 1PIOA 4BLMA 3Q82A 3IH9A 5E43A 1E4DA 4E3NA 2ZM8A 4GDNA 4GOGA 1EWZA 2ZM0A 1BUEA 4Y0OA 3VOYA 1EI5A 1JWVA 2XD5A 2J8YA 4EBNA 4GNUA 4WZ4A 4P87A 2ZQ8A 2C5WB 5KSHA 4U3TA 3BYDA 1AXBA 1BLSA 4KQQA 2XLNA 3Q07A 4C6YA 5FQMA 4JXVA 4IEDA 2HDSA 4EBLA 2Y2MA 4OP8A 3DW0A 3ZNTA 4Z9QA 2XK1A 4QY5A 5FA7A 1ESUA 5HL1A 2WZXA 3IQAA 1KE0A 3MXRA 1FOFA 3ZG7B 4KQOA 3HLEA 3C4PA 4JXGA 5M1AA 3A3DA 2XGNA 3O86A 4MEZA 1KVMA 1JWPA 2XD1A 3HUOA 2IWBA 4HEFA 1MY8A 5FATA 1XGJA 5FAOA 3V3RA 1KE4A 1PZPA 1IYSA 3IH8A 2HP5A 3CG5A 1PI5A 2Z2MB 2ZC5B 4L0LA 2PBYA 2ZC4B 3OCNA 4CPKA 1NZOA 3AGDA 5FAPA 3LY4A 4U0XA 4R4SA 4WZ5C 4KZ8A 3VFHA 4E3LA 3UN7A 4QJGA 1NJ4A 3OPLA 2H0YA 5EECA 5GLCA 5HX9A 1LLBA 1TEMA 2P74A 1NRFA 5E2HA 4NETA 3ZG0A 3NDGA 4K0XA 4B4ZA 3ZGAB 4Y7PA 5CEDA 3MZEA 3DTMA 4HESA 4WZ5A 3N8SA 1SDEA 1HVBA 4OQ0A 4DE3A 1H5XA 3PTEA 4PM6A 4JBFA 5CHJA 5E2EA 4KZ7A 3MBZA 2RL3A 3NI9A 4JPMA 4OH0A 4BJPA 4DXBA 4EV4A 2WK0A 4DRTA 3GMWA 4JF4A 1DJBA 4KENB 1ZG4A 3UO9A 5FDHA 3RXWA 1PI4A 2WZZA 2EXAA 1SDNA 3W4OA 3CMZA 5EVIB 3C7VA 1NYMA 2HP6A 1JTDA 4RA7A 1K55C 2PU4A 4X55A 4RYEA 3SH7A 3UY6A 5TR7A 5DF7A 4F94A 1PYYA 1XGIA 4N92A 1OMEA 3PAGA 4DXCA 3BM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZA A;  4UA7 A;  2WUQ A;  4LCM A;  3VFF A;  2EX2 A;  1ERM A;  3N8R A;  3FZC A;  4S2N C;  1K55 A;  4MBH A;  5FQJ A;  5CER A;  4OVD A;  1SCW A;  4PM9 A;  5GLB A;  1IKG A;  5EE8 A;  2ZJ9 A;  3UE3 A;  4OQI A;  2Y2P A;  3BLS A;  4R4R A;  3IF5 A;  1XA7 A;  4E3M A;  1XPB A;  1YMX A;  1LL5 A;  4OPR A;  5DF9 A;  2Y2I A;  3SS4 A;  4E3O A;  5F1F A;  3ZG5 A;  4DKI A;  1FR6 A;  3NCK A;  3MKF A;  3IF6 C;  1Y54 A;  4LV0 A;  5E2F A;  5EUA A;  5EVL A;  5GL9 A;  1SHV A;  1MWR A;  1YLY A;  2HPB A;  4MNR A;  1S6R A;  1XX2 A;  4IVK A;  1Q2Q A;  1L0G A;  4DE0 A;  2GDN A;  2H0T A;  3MKE A;  4K91 A;  3IT9 A;  2ZM2 A;  2XFS A;  3UE1 A;  3WS1 A;  1MWU A;  4JLF A;  2XDM A;  3IF6 A;  3HLC A;  1L2S A;  1YLT A;  3LO7 A;  4OPY A;  5E2G A;  5HAQ A;  3IF6 B;  1GHP A;  1HD8 A;  1K6R A;  3Q1F A;  4ZJ2 A;  1K54 A;  4KZ4 A;  4OOL A;  4KZ6 A;  3CZD A;  1MXO A;  4OON A;  5HFO A;  4D2O A;  2P9V A;  3WRZ A;  4PPR A;  1KE3 A;  4X6T A;  3W4P A;  4RX2 A;  3ZDJ A;  4S2J A;  3WS0 A;  1YM1 A;  2B5R A;  4FD8 A;  2ZLY A;  3HUM A;  1SKF A;  4R0Q A;  3NC8 A;  4KZ5 A;  4N9K A;  3SH8 A;  1ES5 A;  3UDF A;  2OLV A;  2Z2L B;  4DE1 A;  3UDI A;  5CHM A;  3M2K A;  3MFD A;  3JYI A;  5AQA A;  4KZB A;  3IWQ A;  5DTT A;  4E6X A;  3SS5 A;  2JCH A;  4P6B A;  1E3U D;  4X56 A;  3HLB A;  3FKV A;  2RCX A;  4RVA A;  1BT5 A;  1L0D A;  1CI9 A;  1M6K A;  2V1Z A;  3PBQ A;  4HBT A;  3HBR A;  3UPO A;  3GSG A;  2WAD A;  3BFF A;  3VSK A;  4UA6 A;  3HVF A;  2IWC A;  5F1G A;  1QME A;  3ZG8 B;  3E2K A;  2Y59 A;  3HLF A;  2ZQA A;  4QB8 A;  3PBN A;  3WS4 A;  3OPP A;  1LI9 A;  3GQZ A;  5FAQ A;  3N4I A;  4WEL A;  2ZQC A;  3AGE A;  3EQV A;  3NBL A;  5CGW A;  4UHU A;  3NIA A;  4ZAM A;  3VP3 A;  2PU2 A;  3GVB A;  3S22 A;  4OQG A;  3ZCZ A;  1Q2P A;  1PZO A;  3OPH A;  1N9B A;  4ID4 A;  1RCJ A;  4OP5 A;  3HUN A;  4YIN A;  4JXS A;  4X53 A;  3C5A A;  1MBL A;  4XXR A;  1ZC2 A;  3NDE A;  5CEB A;  3G35 A;  4KG2 A;  1W7F A;  4Q8I A;  4DDY A;  2DRW A;  2WGW A;  4QHC A;  4KZ3 A;  1YMS A;  1E25 A;  3ITB A;  1Z6F A;  3EQU A;  2JC7 A;  1RP5 A;  1C3B A;  1NZU A;  2J9O A;  1HTZ A;  3RXX A;  3A3J A;  1MPL A;  1ZKJ A;  5CXW A;  1E3U A;  3IXG A;  4WMC D;  5TGF A;  3TG9 A;  1KDS A;  2X02 A;  4B4X A;  4FCF A;  1W79 A;  1ZG6 A;  4DDS A;  5GHY A;  2H5S A;  4JF5 A;  1GCE A;  2EXB A;  5GHX A;  3TSG A;  2V20 A;  4E6W A;  4Y0T A;  2WGI A;  3V50 A;  3A3I A;  1ERO A;  3W4Q A;  1BLP A;  1IYQ A;  1KGF A;  1YQS A;  2QPN A;  1K4E A;  4P85 A;  3ZVT A;  2IWD A;  2Y2J A;  1W5D A;  5FQ9 A;  2ZQ7 A;  4CJN A;  2ZMA A;  4EQI A;  1I2W A;  4P0M A;  5I94 A;  3G30 A;  3RJU A;  5KZH A;  2EFX A;  1I5Q A;  4BQM A;  5DVA A;  2JBF A;  3HLW A;  2G2U A;  4X68 A;  5CGS A;  3VSL A;  5JYP A;  5U47 A;  5D3O A;  3C7U A;  1ALQ A;  1BSG A;  1K6S A;  1M40 A;  5F82 A;  4R23 A;  2G2W A;  5CGX A;  1FQG A;  4R3B A;  4ZTK A;  5JYO A;  3TOI A;  3VP4 A;  1O7E A;  4H8R A;  5FQK A;  5IHV A;  2UWX A;  2EX9 A;  3G32 A;  4IVI A;  4OPZ A;  5M18 A;  2OSU A;  5A93 A;  5A92 A;  4R1G A;  1ES2 A;  5FAS A;  3DWZ A;  1VQQ A;  2CC1 A;  3GV9 A;  5F83 A;  4BD1 A;  2X01 A;  1I2S A;  4WMC A;  1TVF A;  3WS2 A;  3IWO A;  3PBT A;  4UA9 A;  5KSC A;  4C3Q A;  3PBO A;  1K54 C;  5J8X A;  3N6I A;  3IXD A;  1YT4 A;  5FQQ A;  1KDW A;  2A49 A;  4M3K A;  3DWK A;  2Y55 A;  4MLL A;  5AQ7 A;  2J9P A;  2XR0 A;  5TFQ A;  2Q9N A;  3PAE A;  1FR1 A;  1ES3 A;  4RX3 A;  5EOO A;  1FCM A;  2J7V A;  1JVJ A;  2QZ6 A;  4OLG A;  3VP1 A;  4XUX A;  2ZQD A;  3FKW A;  3QNB A;  2Y4A A;  3BLM A;  2WKI A;  4BL3 A;  4U0T A;  2XQZ A;  3SH9 A;  1FCN A;  4LEN A;  3G4P A;  2HP9 A;  5A90 A;  2FFY A;  2P9V B;  3GRJ A;  4GD6 A;  4QY6 A;  5L2F A;  1K57 A;  2OLU A;  2Y2L A;  5FQI A;  3HLD A;  3VMA A;  3G31 A;  2I72 A;  3V39 A;  2E8I A;  1KGG A;  3V5M A;  1GA9 A;  1ERQ A;  5HAP A;  2Y91 A;  3E2L A;  2Y2H A;  1CI8 A;  1FSY A;  4C75 A;  4S2M A;  1RGY A;  3VP0 A;  3OPR A;  5GLD A;  3A3E A;  3O88 A;  4S2I A;  4BD0 A;  5M19 A;  4DF6 A;  1K56 D;  4EWF A;  4ZJ3 A;  2V2F F;  3M2J A;  3ZHH A;  1XA1 A;  3ZG9 B;  1RGZ A;  1KVL A;  1NYY A;  2ZC6 B;  4OKP A;  1K4F A;  1XXM A;  4FH2 A;  4XUZ A;  3OZH A;  3ZVW A;  4WEJ A;  5HW3 A;  3M6B A;  3HL9 A;  2WKE A;  1H8Z A;  4N9L A;  4MBK A;  4GDB A;  2HDQ A;  1BUL A;  3NY4 A;  3A3F A;  2XH9 A;  2Y2K A;  4KQR A;  1W8Y A;  3G2Z A;  2R9X A;  3BEB A;  1BTL A;  1FSW A;  2Q9M A;  4WM9 A;  4QU3 A;  3WS5 A;  4N1H A;  2H10 A;  3MZF A;  1FCO A;  5EVI D;  4ZBE A;  1DJC A;  5HAR A;  4S2O A;  3D4F A;  3S1Y A;  3G34 A;  4IBX A;  5AQB A;  4X69 A;  2XEP A;  1VM1 A;  5AQ9 A;  3BFD A;  5FI7 A;  3ZNY A;  1ONH A;  3B3X A;  4GN2 A;  1QMF A;  1HZO A;  2ZD8 A;  3BRM A;  1G6A A;  3Q81 A;  4GB7 A;  4KZ9 A;  2WKH A;  5FSR A;  4LV1 A;  4ZJ1 A;  3MXS A;  3O87 A;  5G18 A;  3FYZ A;  4PM5 A;  4HBU A;  4KG5 A;  1CK3 A;  4KG6 A;  1KGE A;  1K38 A;  2JE5 A;  5CTM A;  5DTK A;  4BL2 A;  2WGV A;  2EX8 A;  2VGK A;  3BFE A;  1K25 A;  2WGW B;  4GZB A;  1YLJ A;  2OV5 A;  4OOM A;  2BLS A;  5EOE A;  1YLW A;  1PWG A;  3ZFZ A;  3LCE A;  1YLP A;  3Q7V A;  1K56 A;  3P09 A;  1W8Q A;  3O3V A;  4GD8 A;  2QMI A;  3Q7V B;  1IYO A;  4O7D A;  1L0F A;  3PBR A;  2EFU A;  4ZDX A;  5EVI C;  3UNW A;  1NXY A;  1S0W A;  2A3U A;  5GHZ A;  3VP2 A;  3WWX A;  2HDR A;  3GTC A;  5KMW A;  4LCL A;  1CEF A;  3ITA A;  1MWS A;  3BFG A;  3M6H A;  1ESI A;  2Y2O A;  5A91 A;  1WYB A;  3SS3 A;  4A5R A;  4JF6 A;  1LL9 A;  3AGF A;  1IYP A;  1XKZ A;  3IWI A;  4FH4 A;  2Y2N A;  3UPP A;  1O07 A;  1L0E A;  4S2K A;  4DE2 A;  3Q7Z A;  2EX6 A;  3UPN A;  1TDL A;  5EVI A;  3BEC A;  3WRT A;  4LV3 A;  1XP4 A;  1MKI A;  2R9W A;  4OLD A;  3QNC A;  4NK3 A;  2Y2G A;  1IKI A;  1IEL A;  4K0W A;  2DCF A;  5CRF A;  4EUZ A;  1GHM A;  3FWL A;  4PM7 A;  5GLA A;  1DJA A;  4UAA A;  5FI6 A;  1H8Y A;  4GKU A;  3UE0 A;  2HDU A;  3SOI A;  5BOH A;  4MBF A;  3I7J A;  2X71 A;  3IXH A;  4R3J A;  1ES4 A;  2WYX A;  3CJM A;  3N8L A;  2BG1 A;  4OQH A;  4JKT A;  1PW8 A;  3G2Y A;  2ZC3 B;  5DTS A;  2XF3 A;  3FV7 A;  3N7W A;  4LV2 A;  3C4O A;  3HRE A;  1PWD A;  1WYC A;  5CHU A;  4WBG A;  5HAI A;  2C6W B;  5FI2 A;  1DY6 A;  3ISG A;  1MWT A;  4E3I A;  1GA0 A;  1JTG A;  4BEN A;  3VOZ A;  3MZD A;  1ONG A;  1BLH A;  4N1X A;  4S2L A;  4S2N A;  5CEC A;  1CEG A;  1WE4 A;  2DNS A;  3HLG A;  4WEK A;  3W8K A;  1PW1 A;  1G68 A;  3LY3 A;  3S4X A;  1K57 C;  1J9M A;  4EBP A;  2XFT A;  3GR2 A;  3OCL A;  1U60 A;  4YFM A;  4IBR A;  4JXW A;  3IHB A;  3UDX A;  1IEM A;  3P98 A;  3PBS A;  1TDG A;  4KZA A;  5CTN A;  2ZC7 A;  4E3K A;  3BFC A;  1LI0 A;  4Y0U A;  2ZQ9 A;  4OPQ A;  1YLZ A;  1LHY A;  3IXB A;  2WAE A;  1JWZ A;  4OOY A;  3V3S A;  2FFF B;  1PWC A;  1NY0 A;  1N4O A;  4PMA A;  1BLC A;  2WAF A;  4FSF A;  4PM8 A;  4WYY A;  3OC2 A;  4S2P A;  4B88 A;  4E3J A;  2VGJ A;  3LEZ A;  5EPH A;  1GHI A;  4QD4 A;  5DF8 A;  2Y2Q A;  3IHA A;  3QHY A;  1PIO A;  4BLM A;  3Q82 A;  3IH9 A;  5E43 A;  1E4D A;  4E3N A;  2ZM8 A;  4GDN A;  4GOG A;  1EWZ A;  2ZM0 A;  1BUE A;  4Y0O A;  3VOY A;  1EI5 A;  1JWV A;  2XD5 A;  2J8Y A;  4EBN A;  4GNU A;  4WZ4 A;  4P87 A;  2ZQ8 A;  2C5W B;  5KSH A;  4U3T A;  3BYD A;  1AXB A;  1BLS A;  4KQQ A;  2XLN A;  3Q07 A;  4C6Y A;  5FQM A;  4JXV A;  4IED A;  2HDS A;  4EBL A;  2Y2M A;  4OP8 A;  3DW0 A;  3ZNT A;  4Z9Q A;  2XK1 A;  4QY5 A;  5FA7 A;  1ESU A;  5HL1 A;  2WZX A;  3IQA A;  1KE0 A;  3MXR A;  1FOF A;  3ZG7 B;  4KQO A;  3HLE A;  3C4P A;  4JXG A;  5M1A A;  3A3D A;  2XGN A;  3O86 A;  4MEZ A;  1KVM A;  1JWP A;  2XD1 A;  3HUO A;  2IWB A;  4HEF A;  1MY8 A;  5FAT A;  1XGJ A;  5FAO A;  3V3R A;  1KE4 A;  1PZP A;  1IYS A;  3IH8 A;  2HP5 A;  3CG5 A;  1PI5 A;  2Z2M B;  2ZC5 B;  4L0L A;  2PBY A;  2ZC4 B;  3OCN A;  4CPK A;  1NZO A;  3AGD A;  5FAP A;  3LY4 A;  4U0X A;  4R4S A;  4WZ5 C;  4KZ8 A;  3VFH A;  4E3L A;  3UN7 A;  4QJG A;  1NJ4 A;  3OPL A;  2H0Y A;  5EEC A;  5GLC A;  5HX9 A;  1LLB A;  1TEM A;  2P74 A;  1NRF A;  5E2H A;  4NET A;  3ZG0 A;  3NDG A;  4K0X A;  4B4Z A;  3ZGA B;  4Y7P A;  5CED A;  3MZE A;  3DTM A;  4HES A;  4WZ5 A;  3N8S A;  1SDE A;  1HVB A;  4OQ0 A;  4DE3 A;  1H5X A;  3PTE A;  4PM6 A;  4JBF A;  5CHJ A;  5E2E A;  4KZ7 A;  3MBZ A;  2RL3 A;  3NI9 A;  4JPM A;  4OH0 A;  4BJP A;  4DXB A;  4EV4 A;  2WK0 A;  4DRT A;  3GMW A;  4JF4 A;  1DJB A;  4KEN B;  1ZG4 A;  3UO9 A;  5FDH A;  3RXW A;  1PI4 A;  2WZZ A;  2EXA A;  1SDN A;  3W4O A;  3CMZ A;  5EVI B;  3C7V A;  1NYM A;  2HP6 A;  1JTD A;  4RA7 A;  1K55 C;  2PU4 A;  4X55 A;  4RYE A;  3SH7 A;  3UY6 A;  5TR7 A;  5DF7 A;  4F94 A;  1PYY A;  1XGI A;  4N92 A;  1OME A;  3PAG A;  4DXC A;  3BM6 A; 
#chains in the Genus database with same CATH topology
 4UA7 A;  2WUQ A;  4X1L A;  2EX2 A;  4S2N C;  1P9R A;  1SCW A;  4ESP A;  5EE8 A;  3S7Q A;  3BLS A;  3IF5 A;  1YMX A;  4KUO A;  5J4E A;  1J3W A;  1OJ5 A;  5DF9 A;  3SS4 A;  1ZHH B;  3T1S A;  2O9C A;  1FR6 A;  3IF6 C;  1UGU A;  1Y54 A;  4UQI M;  1MWR A;  2H0T A;  4K91 A;  3IT9 A;  2XFS A;  3UE1 A;  3WS1 A;  2OAP 1;  3IF6 A;  4KUK A;  3LO7 A;  4OPY A;  3IF6 B;  1GHP A;  1HD8 A;  3PR6 A;  4KZ6 A;  3S7O A;  3WRZ A;  3W4P A;  3ZDJ A;  3WS0 A;  1YM1 A;  2B5R A;  4FTX A;  4R0Q A;  4D60 A;  3UDF A;  4Q0I A;  2Z2L B;  4DE1 A;  4Y17 A;  5CHM A;  3M2K A;  3JYI A;  4LRY C;  5DTT A;  4X56 A;  3IBJ A;  4MN6 A;  4O8G A;  3A0S A;  4YNR A;  4UEY A;  2PAV P;  3O5Y A;  3PBQ A;  2W3G A;  4HBT A;  4Y3I A;  3GSG A;  4GW9 A;  2IWC A;  1QME A;  3E2K A;  3HLF A;  2PR5 A;  3WS4 A;  3QP8 A;  2Z6D A;  2ZQC A;  3BY9 A;  3NBL A;  3VP3 A;  3A0R A;  1T1B A;  4OQG A;  3UME A;  1MBL A;  3NDE A;  4R3A A;  3QP2 A;  3G35 A;  4Q8I A;  3CHW P;  1NZU A;  2KLI A;  1MPL A;  1N9N A;  2X02 A;  1ZG6 A;  5GHY A;  2H5S A;  4I39 A;  5GHX A;  2V20 A;  4E6W A;  2P04 A;  2WGI A;  3NOP C;  2GNX A;  1KGF A;  1YQS A;  2W1R A;  5IS1 A;  2V0U A;  5FQ9 A;  4I5S A;  5I94 A;  1LL8 A;  5HL6 A;  5CGS A;  5U47 A;  1ALQ A;  5F82 A;  1O7E A;  4H8R A;  2KDK A;  1T19 A;  5A93 A;  5FAS A;  3DWZ A;  1VQQ A;  2CC1 A;  4BD1 A;  4WMC A;  3IWO A;  3C30 A;  1K54 C;  3N6I A;  3IXD A;  1YT4 A;  5FQQ A;  1KDW A;  2Q9N A;  3PAE A;  1ES3 A;  5HWT A;  4OLG A;  3FKW A;  2W1T A;  4Y13 A;  1XJ3 A;  1XJ4 A;  2YKH A;  2HP9 A;  2FFY A;  4GD6 A;  5FQI A;  3UMD A;  2A24 A;  1GA9 A;  1VET A;  5HAP A;  3E2L A;  3BWL A;  4S2M A;  1RGY A;  3OPR A;  3A3E A;  4S2I A;  4DF6 A;  1K56 D;  5DKL A;  4LPZ A;  3ZG9 B;  2BAS A;  4FH2 A;  4XUZ A;  5DFY A;  1H8Z A;  2PYP A;  1BUL A;  3NY4 A;  4KQR A;  1YKD A;  1DP8 A;  1P97 A;  1FCO A;  4ZBE A;  5HAR A;  1S4S A;  3BFD A;  1GSX A;  2GJ3 A;  2VA0 A;  5FSR A;  4ZJ1 A;  4LV1 A;  3O87 A;  3FYZ A;  4KG5 A;  2HGV A;  2VKS A;  2W27 A;  2JE5 A;  5CTM A;  2WGV A;  3JPU A;  1K25 A;  4ETZ A;  4GZB A;  5DJT A;  2QYB A;  5EOE A;  3ZFZ A;  2K31 A;  1SKO A;  2ZBB A;  4ZDX A;  5GHZ A;  5LBR A;  1LSX A;  4JGO A;  3ITA A;  4A5R A;  2VV8 A;  3LIB A;  3IWI A;  5EV0 A;  4S2K A;  3ZQ5 A;  2EX6 A;  4PAU A;  3QNC A;  1IKI A;  4K0W A;  4EUZ A;  5FI6 A;  1H8Y A;  3I7J A;  1OTD A;  3QP5 A;  1XJ6 A;  2WYX A;  3PHY A;  1GSW A;  1OTE A;  3P01 A;  2GX5 A;  1V9Y A;  1PWD A;  4NXB A;  2HJ9 C;  4WUJ A;  5FI2 A;  5CX7 A;  4BBT A;  4HH2 A;  4S2L A;  5CEC A;  4N1X A;  4BBU A;  1WE4 A;  3EEA A;  2B18 A;  4LGW A;  4IBR A;  3IHB A;  5J7E A;  1LT0 A;  2ZC7 A;  3BFC A;  1LI0 A;  3LUQ A;  2WKR A;  4OPQ A;  3IXB A;  1LHY A;  1H3Q A;  2FFF B;  4EEU A;  1N4O A;  1BLC A;  4B88 A;  2JKR I;  2XA7 M;  4L9G A;  5EPH A;  2Y2Q A;  1S66 L;  1PIO A;  4BLM A;  4GDN A;  1EWZ A;  3VOY A;  4EBN A;  4WZ4 A;  4Z1W A;  3VV4 A;  2PDR A;  4U3T A;  4Y15 A;  4JXV A;  3LIF A;  1PNE A;  2J3T D;  3DW0 A;  1D7E A;  5HD3 A;  3F1N A;  3FPW A;  5FA7 A;  1OJG A;  2OWJ A;  4JXG A;  2XGN A;  5AJG A;  1KVM A;  2IWB A;  3HUO A;  4F3L B;  3OOV A;  1PZP A;  2CMN A;  4L0L A;  2PBY A;  3OCN A;  1NZO A;  3VFH A;  4E3L A;  2XRN A;  4EUV A;  1LLB A;  1TEM A;  1NRF A;  5E2H A;  3UB7 A;  3ZG0 A;  4Y7P A;  4EEP A;  3DTM A;  3LIA A;  3N8S A;  4OQ0 A;  2QJ7 A;  4DE3 A;  4PM6 A;  4OH0 A;  3MBZ A;  4JPM A;  4BJP A;  5AVF A;  2WK0 A;  5K5B A;  3L9K A;  1DJB A;  1ZG4 A;  2M1C A;  3RXW A;  1SDN A;  1FIL A;  5EVI B;  4IUH A;  2HP6 A;  1JTD A;  1K55 C;  3MFX A;  5TR7 A;  5DF7 A;  1PYY A;  4GHI A;  1OME A;  3PAG A;  1BZA A;  4EU0 A;  3VFF A;  1ERM A;  3H82 B;  1K55 A;  4MBH A;  2D02 A;  4OVD A;  3NOU C;  4PM9 A;  5GLB A;  2O99 A;  2ZJ9 A;  3ULF A;  2D01 A;  4OQI A;  2Y2P A;  2PHY A;  1XA7 A;  4OPR A;  4E3O A;  1OPX A;  4DKI A;  2VGL S;  5E2F A;  2VJW A;  3B33 A;  4NXE A;  1SHV A;  4MNR A;  3MJQ A;  1L0G A;  4DE0 A;  3MKE A;  3T1Q B;  1F98 A;  1Z09 A;  3MQ0 A;  5L09 A;  1L2S A;  5E2G A;  5HAQ A;  5EFW A;  3Q1F A;  4KZ4 A;  1MXO A;  1BYW A;  2P9V A;  2JHE A;  4X6T A;  3CAX A;  3K2N A;  3D3O A;  4S2J A;  4E04 A;  3HUM A;  3L7H A;  3SH8 A;  1ES5 A;  5J3W A;  5L8M A;  3UDI A;  1N9O A;  4E6X A;  4NXF A;  3T1R A;  4DJ2 A;  3HLB A;  3FKV A;  3IBR A;  2RCX A;  2VGL M;  4RVA A;  1BT5 A;  1L0D A;  2YKF A;  1AWI A;  3UPO A;  3MSH A;  3BFF A;  5F6A A;  3VSK A;  3HVF A;  2ZQA A;  3PBN A;  3KYZ A;  4X1M A;  4BMW A;  3E98 A;  1S4R A;  3AGE A;  3NIA A;  3ZCZ A;  1N9B A;  2VEA A;  1RCJ A;  3HUN A;  2QHK A;  1ZTU A;  2EWV A;  5CEB A;  4FUW A;  2WGW A;  1YMS A;  3F1P B;  3RXX A;  3A3J A;  3T4T A;  1E3U A;  5TGF A;  4UQI S;  3MF0 A;  1KDS A;  3LI8 A;  4FCF A;  1W79 A;  4DDS A;  2V9A A;  4YOF A;  4RQ9 A;  3D9Y A;  4JF5 A;  1GCE A;  2EXB A;  1BLP A;  4P85 A;  1K4E A;  3GEC A;  2Y2J A;  1L3L A;  4CJN A;  2ZL1 A;  3KSF A;  4EQI A;  1I2W A;  3G30 A;  1S1Y A;  2EFX A;  2JBF A;  1MKM A;  2G2U A;  3MXQ A;  3VSL A;  4IJG A;  1K6S A;  1BSG A;  1M40 A;  4FOF A;  5CGX A;  1F5M A;  3TOI A;  3KO6 A;  4AFI A;  2PBD P;  2FZ0 A;  3G32 A;  5M18 A;  3B47 A;  1TD5 A;  3T4K A;  1ES2 A;  4JGP A;  1NLZ A;  2X01 A;  1I2S A;  3MS6 A;  4B93 A;  5KSC A;  4HJ4 A;  4EET B;  3UB9 A;  4M3K A;  3T4Q A;  3DWK A;  4DN0 A;  5TFQ A;  4EXO A;  1FR1 A;  5EOO A;  1FCM A;  1JVJ A;  2QZ6 A;  5TJJ A;  2ZQD A;  2LB9 A;  4BL3 A;  4H6J A;  2XSS A;  4U0T A;  2XQZ A;  4LEN A;  3G4P A;  5L2F A;  3HLD A;  3V39 A;  3FC7 A;  2LB5 A;  4XT2 A;  1FSY A;  3FPV A;  3VP0 A;  3O88 A;  3EOI A;  5F5Y A;  1OTA A;  5MC7 A;  4LRX C;  3LID A;  3NHQ A;  1W63 M;  5HPF A;  4Q0J A;  1NYY A;  3NJA A;  3CI6 A;  2BTF P;  4ARZ A;  3UB5 P;  5HWV A;  4WEJ A;  3HL9 A;  3H9W A;  2WKE A;  4MBK A;  2V1B A;  2W3F A;  2R9X A;  3BEB A;  5EVI D;  3MZF A;  1DJC A;  1NWZ A;  4S2O A;  3S1Y A;  3G34 A;  1Y4O A;  1ONH A;  2L4R A;  4GN2 A;  5TBM A;  4GB7 A;  1G6A A;  1CK3 A;  4KG6 A;  2WKP A;  1KGE A;  1K38 A;  2VGK A;  2OV5 A;  3LR3 A;  4PKY G;  3Q7V A;  3P09 A;  3O3V A;  2HJE A;  3Q7V B;  1L0F A;  1TS6 A;  2EFU A;  4II7 A;  5KMW A;  1ODV A;  1A0K A;  2Q0O A;  3BFG A;  1ESI A;  2Y2O A;  5A91 A;  3TJZ C;  1WYB A;  4HHD A;  3AGF A;  3VE4 A;  3UB6 A;  3UPP A;  1O07 A;  2W0N A;  3Q7Z A;  3BEC A;  3T4S A;  2V1A A;  2EA9 A;  4HIA A;  2Y2G A;  1IEL A;  2DCF A;  5GLA A;  3RFB A;  3T12 B;  1XFQ A;  4LFU A;  5BOH A;  3BQA A;  3MQO A;  3N8L A;  2ZC3 B;  1G28 A;  5CHU A;  4G3K A;  4WBG A;  3ISG A;  1BLH A;  3HLG A;  3W8K A;  1PW1 A;  1G68 A;  3GR2 A;  1U60 A;  4CLC A;  4E3K A;  3PBS A;  2W1T B;  2JKR M;  1JWZ A;  4OOY A;  2WAF A;  3E4O A;  4WYY A;  3LR4 A;  2J3W A;  2A24 B;  5DF8 A;  1VET B;  2V0W A;  5E43 A;  1JWV A;  4GNU A;  5HSQ A;  5KSH A;  5IT5 A;  3QP6 A;  3Q07 A;  3MR0 A;  4EBL A;  3ZNT A;  4L9F A;  2XK1 A;  4QY5 A;  3TW8 A;  3HLE A;  4MEZ A;  2QWS A;  1JWP A;  5L07 A;  3DTI A;  1CQA A;  3CUE C;  3KYQ A;  1KE4 A;  3IH8 A;  2VLG A;  2ZC5 B;  4CPK A;  3AGD A;  3KYE A;  1OT6 A;  5FAP A;  1LSV A;  4R4S A;  3UN7 A;  5HWW A;  1SZV A;  3OPL A;  5GLC A;  3CUE A;  5HX9 A;  2P74 A;  4K0X A;  4GJ4 A;  5HDS A;  1HVB A;  1SKO B;  3LEQ A;  3OLO A;  3PTE A;  3CIT A;  5E2E A;  3NI9 A;  3GMW A;  4JF4 A;  5HZH A;  1S1Z A;  1PI4 A;  3H7W A;  3W4O A;  1NYM A;  4WLA A;  2ACG A;  2E8J A;  4RYE A;  2XA7 S;  4F94 A;  1XGI A;  4N92 A;  4R38 A;  3KX0 X;  4DXC A;  1IOU A;  4LCM A;  1H0M A;  5FQJ A;  5CER A;  4WF0 A;  2ZMF A;  2JKF A;  5FEF A;  4R4R A;  2UV0 E;  5C5K A;  1V9Z A;  4MN5 A;  5EM0 A;  1LL5 A;  4ZRR A;  3T50 A;  5F1F A;  2PT7 A;  3IX8 A;  3LI9 A;  3NCK A;  3MKF A;  4LV0 A;  3HJI A;  3T1X A;  1YLY A;  4HP9 A;  5DJU A;  1S6R A;  4IVK A;  2JKG A;  4L9E A;  1Q2Q A;  2GDN A;  2ZM2 A;  1MWU A;  3HLC A;  1YLT A;  1K6R A;  4MN7 A;  4OOL A;  2JKT M;  3CZD A;  3EGX C;  4RX2 A;  3LR5 A;  4N9K A;  1OTB A;  2H28 A;  4JGQ A;  3MFD A;  4KZB A;  3IWQ A;  1PRQ A;  4P6Z M;  4P6B A;  3V67 A;  2AVX A;  2B95 A;  1IFQ A;  1CI9 A;  4M4X A;  3F1N B;  5F1G A;  1G6O A;  2L1M A;  1UWP X;  4QB8 A;  2QKP A;  3KSI A;  1LI9 A;  3N4I A;  1KOU A;  5CGW A;  4UHU A;  1Q2P A;  3OPH A;  4ID4 A;  2A2L A;  2VK3 A;  2VX8 A;  3C5A A;  4XXR A;  1ZC2 A;  2V8F A;  4KG2 A;  1W7F A;  2M7U A;  1F9I A;  4QHC A;  4KZ3 A;  3ITB A;  3KSH A;  1Z6F A;  3EQU A;  1C3B A;  1HTZ A;  1TS0 A;  1ZKJ A;  3ZYT A;  3IXG A;  4WMC D;  3TG9 A;  1W63 Q;  4CLC E;  4EER A;  2ZMV A;  1TF1 A;  1ERO A;  3W4Q A;  4ETX A;  1IYQ A;  4WL9 A;  1W5D A;  1TS7 A;  2ZQ7 A;  4GHI B;  3RJU A;  5KZH A;  2Y8H A;  5DVA A;  3HLW A;  4X68 A;  3C7U A;  4R23 A;  1FQG A;  4ZTK A;  5JYO A;  1YPR A;  3VP4 A;  3MQQ A;  1G5U A;  4OPZ A;  2OSU A;  5A92 A;  5F83 A;  1TVF A;  3WS2 A;  4UA9 A;  1MC0 A;  3PBT A;  3PBO A;  1HLU P;  1EW0 A;  2A49 A;  1MZU A;  4MLL A;  3P7N A;  2XR0 A;  4RX3 A;  3F1O A;  1H8M A;  3F1O B;  4LLO B;  2Y4A A;  3BLM A;  2M7V A;  3SH9 A;  1FCN A;  3BY8 A;  2P9V B;  4QY6 A;  1K57 A;  4G3V A;  1KGG A;  3V5M A;  1ERQ A;  2Y91 A;  2Y2H A;  1CI8 A;  5KIZ A;  1T1A A;  4IUK A;  4BD0 A;  4PHT A;  3EGD C;  4ZJ3 A;  1T1C A;  3M2J A;  5EVE A;  1XA1 A;  1RGZ A;  5EM1 A;  2ZOH A;  4Y2F A;  4OKP A;  1K4F A;  1XXM A;  4YWZ A;  3OZH A;  3M6B A;  4ME4 A;  4N9L A;  2L0W A;  2HDQ A;  4QWO A;  3A3F A;  2Y2K A;  3G2Z A;  1FSW A;  2Q9M A;  4WM9 A;  1DP6 A;  4QU3 A;  4N1H A;  4GS9 A;  3D4F A;  4IBX A;  3ICY A;  2XEP A;  1VM1 A;  5FI7 A;  3B3X A;  1QMF A;  2ZD8 A;  3BRM A;  4KZ9 A;  2WKH A;  4GCZ A;  5DTK A;  4BL2 A;  2EX8 A;  2WGW B;  1YLJ A;  2BLS A;  1PWG A;  1YLP A;  1K56 A;  4GD8 A;  3IS2 A;  2VZW A;  2OWH A;  4K08 A;  3IS2 B;  2A3U A;  4HY8 A;  3GTC A;  1CEF A;  1MWS A;  3M6H A;  4G3W A;  3SS3 A;  4JF6 A;  1LL9 A;  1XKZ A;  4FH4 A;  2Y2N A;  2ZL1 B;  1TDL A;  1XP4 A;  3K3D A;  3R7W A;  4NK3 A;  1YSQ A;  1GHM A;  3FWL A;  4UAA A;  2HDU A;  2I9V A;  2X71 A;  4R3J A;  1ES4 A;  1YSP A;  2O9B A;  4JKT A;  5DTS A;  5HD5 A;  3LFV A;  3FV7 A;  4HP4 A;  4LV2 A;  3C4O A;  3S7N A;  3HRE A;  4R6L A;  3JVV A;  2C6W B;  1MWT A;  4E3I A;  1JTG A;  3R4K A;  4BEN A;  3MZD A;  1ONG A;  4S2N A;  3HCY A;  2DNS A;  2EWW A;  4HNB A;  3S4X A;  4EBP A;  2W3H A;  3UDX A;  1IEM A;  5CTN A;  1TDG A;  4KZA A;  3RTY A;  3C38 A;  2ZQ9 A;  4H6J B;  3NUL A;  1YLZ A;  3PXP A;  5G4Z A;  1NY0 A;  4PMA A;  4O0P A;  4FSF A;  2NUT C;  3OC2 A;  2VGJ A;  4DMZ A;  3LEZ A;  2O9A A;  1GHI A;  4XT2 B;  1CJF A;  3IHA A;  3QHY A;  3Q82 A;  1E4D A;  4E3N A;  2ZM8 A;  1BUE A;  1PFL A;  1EI5 A;  4R70 A;  3C2W A;  2XD5 A;  2J8Y A;  4P87 A;  2QJ5 A;  2C5W B;  4ARZ B;  3BYD A;  1AXB A;  2PD7 A;  4KQQ A;  2XLN A;  3IX3 A;  4C6Y A;  4IED A;  2HDS A;  2Y2M A;  2HZ5 A;  4Z9Q A;  1ESU A;  3CWF A;  2WZX A;  1KE0 A;  5M1A A;  3A3D A;  3O86 A;  4HJ3 A;  3KSG A;  1MY8 A;  5TBM B;  5FAO A;  3CG5 A;  1PI5 A;  2ZOI A;  2Z2M B;  2OOL A;  3LY4 A;  4WZ5 C;  4KZ8 A;  1OT9 A;  2J80 A;  4HQA A;  4QJG A;  3FG8 A;  4NET A;  4DJ3 A;  2J3T C;  2VV6 A;  3NDG A;  5CED A;  3MZE A;  3CLO A;  4HES A;  4WZ5 A;  1SDE A;  5F69 A;  1H5X A;  3DTE A;  5CHJ A;  4JBF A;  3BW6 A;  4EV4 A;  2RL3 A;  3T4J A;  2WZZ A;  4MDZ A;  3CMZ A;  3GDI A;  4BWI A;  3C7V A;  2V8C A;  3MMH A;  3SZT A;  2PU4 A;  3LGO A;  5FL3 A;  4GLQ A;  3E0Y A;  5FDS A;  3TRC A;  3EWK A;  5DFX A;  3N8R A;  3FZC A;  3D72 A;  1IKG A;  2PRF A;  3UE3 A;  1YAX A;  4CLC C;  3E4Q A;  4E3M A;  1XPB A;  3E4P A;  2G7U A;  2Y2I A;  2R78 A;  3ZG5 A;  5EVL A;  5EUA A;  5GL9 A;  4CLC B;  2KOI A;  4CQH A;  2HPB A;  1XFN A;  1D06 A;  1XX2 A;  1STZ A;  3U2A A;  4EQ1 A;  1K0K A;  4JLF A;  1OTI A;  2XDM A;  1WA9 A;  3DBA A;  4ZJ2 A;  1K54 A;  5HFO A;  4OON A;  5FEG A;  4D2O A;  5L10 A;  3DTK A;  4PPR A;  1KE3 A;  4IHQ A;  4FD8 A;  2ZLY A;  4MCW A;  1SKF A;  5I5L A;  3SW1 A;  3NC8 A;  4KZ5 A;  2WKQ A;  2FH5 A;  2OLV A;  2B02 A;  5AQA A;  3SS5 A;  2JCH A;  5AVE A;  2MJ6 A;  4NXG A;  1E3U D;  2JN7 A;  3LIE A;  1TS8 A;  4MMN A;  4LRZ E;  1M6K A;  2V1Z A;  3HBR A;  2WAD A;  4EW7 A;  4UA6 A;  3ZG8 B;  2Y59 A;  1NLY A;  3OPP A;  2INW A;  3GQZ A;  5FAQ A;  3OBF A;  4WEL A;  1VHM A;  3EQV A;  4ZAM A;  1D1J A;  2PU2 A;  3GVB A;  3S22 A;  1PZO A;  4OP5 A;  3JVU A;  4YIN A;  4JXS A;  4X53 A;  3S7P A;  4DDY A;  4HH3 A;  2DRW A;  1E25 A;  2JC7 A;  1RP5 A;  2J9O A;  5DKK A;  3NOT C;  3G6O A;  5CXW A;  3BJN A;  4B4X A;  1CF0 A;  5HPI A;  3H7W B;  3TSG A;  4Y0T A;  3V50 A;  3A3I A;  3B42 A;  1S67 L;  2QPN A;  3ZVT A;  2IWD A;  1Y28 A;  1GSV A;  2ZMA A;  4P0M A;  4BQM A;  1I5Q A;  1VB6 A;  5JYP A;  4I3I A;  5D3O A;  2G2W A;  4R3B A;  1XJ2 A;  3LR0 A;  5FQK A;  5IHV A;  2UWX A;  2EX9 A;  1DP9 A;  4IVI A;  1NRJ A;  5IU1 A;  4R1G A;  4P6Z S;  2NUP C;  3GV9 A;  5A8B A;  4X25 A;  4C3Q A;  5J8X A;  5AQ7 A;  2Y55 A;  2J9P A;  5F68 A;  3UB8 A;  2O0Y A;  2J7V A;  4KQD A;  3VP1 A;  4XUX A;  3QNB A;  2WKI A;  5A90 A;  3GRJ A;  4HOI A;  2OLU A;  2P08 A;  2Y2L A;  1FIK A;  3VMA A;  3RH8 B;  2W3D A;  3QP1 A;  3G31 A;  4BBV A;  2I72 A;  2E8I A;  2KX6 A;  4C75 A;  3NEC A;  1F2K A;  5GLD A;  1P9W A;  4NG2 A;  5M19 A;  4EWF A;  2V2F F;  3ZHH A;  1KVL A;  2ZC6 B;  3HJK A;  3ZVW A;  5HW3 A;  2Y79 A;  1X0O A;  4GDB A;  3BQ8 A;  2XH9 A;  1W8Y A;  1ACF A;  3CPT A;  1BTL A;  4JGR A;  2H10 A;  3CPT B;  4HJ6 A;  3C8C A;  1DRM A;  5AQB A;  4X69 A;  2P7J A;  5AQ9 A;  3EEH A;  3ZNY A;  1HZO A;  3Q81 A;  3WS5 A;  4F3L A;  3MXS A;  5G18 A;  4PM5 A;  4HBU A;  4WN5 A;  3BFE A;  4OOM A;  1YLW A;  3LCE A;  1W8Q A;  2QMI A;  1IYO A;  4O7D A;  3PBR A;  5EVI C;  3UNW A;  1NXY A;  3DAV A;  1S0W A;  3WWX A;  3VP2 A;  2HDR A;  4LCL A;  3TE8 A;  1IYP A;  4CLC D;  1L0E A;  4DE2 A;  3UPN A;  5EVI A;  3WRT A;  4LV3 A;  1MKI A;  2R9W A;  4OLD A;  2VV7 A;  5CRF A;  4PM7 A;  1DJA A;  1T18 A;  4GKU A;  3UE0 A;  3SOI A;  4MBF A;  3IXH A;  5HDD A;  3H82 A;  1UWN X;  3CJM A;  2HF6 A;  2BG1 A;  4OQH A;  1PW8 A;  3G2Y A;  3T4L A;  2XF3 A;  3N7W A;  1JNU A;  3IX4 A;  1WYC A;  2HV1 A;  5HAI A;  2Z6C A;  1DY6 A;  1LSW A;  2W3E A;  3W2Z A;  1GA0 A;  3VOZ A;  1P0Z A;  1CEG A;  4WEK A;  3LY3 A;  1K57 C;  1J9M A;  2PD8 A;  2XFT A;  2PYR A;  3OCL A;  4YFM A;  2PR6 A;  3UE6 A;  4JXW A;  1VEU A;  1N9L A;  3P98 A;  4Y0U A;  1VEU B;  4Y5F A;  2WAE A;  3V3S A;  1PWC A;  4HI4 A;  4PM8 A;  3LIC A;  4S2P A;  2GZA A;  4E3J A;  4QD4 A;  4EES A;  3IH9 A;  4GOG A;  2ZM0 A;  4Y0O A;  4I38 A;  2JKT I;  4QPR A;  2ZQ8 A;  2K7S A;  4Q0H A;  1BLS A;  5FQM A;  3QP4 A;  4NKP A;  4NEE D;  3U4L P;  4OP8 A;  5HDC A;  3K3C A;  4O01 A;  5HL1 A;  3IQA A;  4GS9 B;  3MXR A;  1FOF A;  3ZG7 B;  4KQO A;  2XRO A;  3C4P A;  2XD1 A;  4HEF A;  4PKY A;  5FAT A;  1XGJ A;  3V3R A;  1IYS A;  2HP5 A;  2ZC4 B;  4U0X A;  4B9O A;  3LYX A;  1NJ4 A;  2H0Y A;  5EEC A;  4I3A A;  2DMW A;  3VE3 A;  2IA2 A;  4B4Z A;  3ZGA B;  2OAQ 1;  3T4O A;  2K2N A;  3PYP A;  3F1P A;  4KZ7 A;  4DXB A;  3A0V A;  4DRT A;  4KEN B;  3UO9 A;  5FDH A;  4I3J A;  2EXA A;  4RA7 A;  4X55 A;  3R7W B;  3SH7 A;  3UY6 A;  3VOL A;  5G4Y A;  3BM6 A; 
#chains in the Genus database with same CATH homology
 1BZA A;  4UA7 A;  2WUQ A;  4LCM A;  3VFF A;  2EX2 A;  1ERM A;  3N8R A;  3FZC A;  4S2N C;  1K55 A;  4MBH A;  5FQJ A;  5CER A;  4OVD A;  1SCW A;  4PM9 A;  5GLB A;  1IKG A;  5EE8 A;  2ZJ9 A;  3UE3 A;  4OQI A;  2Y2P A;  3BLS A;  4R4R A;  3IF5 A;  1XA7 A;  4E3M A;  1XPB A;  1YMX A;  1LL5 A;  4OPR A;  5DF9 A;  2Y2I A;  3SS4 A;  4E3O A;  5F1F A;  3ZG5 A;  4DKI A;  1FR6 A;  3NCK A;  3MKF A;  3IF6 C;  1Y54 A;  4LV0 A;  5E2F A;  5EUA A;  5EVL A;  5GL9 A;  1SHV A;  1MWR A;  1YLY A;  2HPB A;  4MNR A;  1S6R A;  1XX2 A;  4IVK A;  1Q2Q A;  1L0G A;  4DE0 A;  2GDN A;  2H0T A;  3MKE A;  4K91 A;  3IT9 A;  2ZM2 A;  2XFS A;  3UE1 A;  3WS1 A;  1MWU A;  4JLF A;  2XDM A;  3IF6 A;  3HLC A;  1L2S A;  1YLT A;  3LO7 A;  4OPY A;  5E2G A;  5HAQ A;  3IF6 B;  1GHP A;  1HD8 A;  1K6R A;  3Q1F A;  4ZJ2 A;  1K54 A;  4KZ4 A;  4OOL A;  4KZ6 A;  3CZD A;  1MXO A;  4OON A;  5HFO A;  4D2O A;  2P9V A;  3WRZ A;  4PPR A;  1KE3 A;  4X6T A;  3W4P A;  4RX2 A;  3ZDJ A;  4S2J A;  3WS0 A;  1YM1 A;  2B5R A;  4FD8 A;  2ZLY A;  3HUM A;  1SKF A;  4R0Q A;  3NC8 A;  4KZ5 A;  4N9K A;  3SH8 A;  1ES5 A;  3UDF A;  2OLV A;  2Z2L B;  4DE1 A;  3UDI A;  5CHM A;  3M2K A;  3MFD A;  3JYI A;  5AQA A;  4KZB A;  3IWQ A;  5DTT A;  4E6X A;  3SS5 A;  2JCH A;  4P6B A;  1E3U D;  4X56 A;  3HLB A;  3FKV A;  2RCX A;  4RVA A;  1BT5 A;  1L0D A;  1CI9 A;  1M6K A;  2V1Z A;  3PBQ A;  4HBT A;  3HBR A;  3UPO A;  3GSG A;  2WAD A;  3BFF A;  3VSK A;  4UA6 A;  3HVF A;  2IWC A;  5F1G A;  1QME A;  3ZG8 B;  3E2K A;  2Y59 A;  3HLF A;  2ZQA A;  4QB8 A;  3PBN A;  3WS4 A;  3OPP A;  1LI9 A;  3GQZ A;  5FAQ A;  3N4I A;  4WEL A;  2ZQC A;  3AGE A;  3EQV A;  3NBL A;  5CGW A;  4UHU A;  3NIA A;  4ZAM A;  3VP3 A;  2PU2 A;  3GVB A;  3S22 A;  4OQG A;  3ZCZ A;  1Q2P A;  1PZO A;  3OPH A;  1N9B A;  4ID4 A;  1RCJ A;  4OP5 A;  3HUN A;  4YIN A;  4JXS A;  4X53 A;  3C5A A;  1MBL A;  4XXR A;  1ZC2 A;  3NDE A;  5CEB A;  3G35 A;  4KG2 A;  1W7F A;  4Q8I A;  4DDY A;  2DRW A;  2WGW A;  4QHC A;  4KZ3 A;  1YMS A;  1E25 A;  3ITB A;  1Z6F A;  3EQU A;  2JC7 A;  1RP5 A;  1C3B A;  1NZU A;  2J9O A;  1HTZ A;  3RXX A;  3A3J A;  1MPL A;  1ZKJ A;  5CXW A;  1E3U A;  3IXG A;  4WMC D;  5TGF A;  3TG9 A;  1KDS A;  2X02 A;  4B4X A;  4FCF A;  1W79 A;  1ZG6 A;  4DDS A;  5GHY A;  2H5S A;  4JF5 A;  1GCE A;  2EXB A;  5GHX A;  3TSG A;  2V20 A;  4E6W A;  4Y0T A;  2WGI A;  3V50 A;  3A3I A;  1ERO A;  3W4Q A;  1BLP A;  1IYQ A;  1KGF A;  1YQS A;  2QPN A;  1K4E A;  4P85 A;  3ZVT A;  2IWD A;  2Y2J A;  1W5D A;  5FQ9 A;  2ZQ7 A;  4CJN A;  2ZMA A;  4EQI A;  1I2W A;  4P0M A;  5I94 A;  3G30 A;  3RJU A;  5KZH A;  2EFX A;  1I5Q A;  4BQM A;  5DVA A;  2JBF A;  3HLW A;  2G2U A;  4X68 A;  5CGS A;  3VSL A;  5JYP A;  5U47 A;  5D3O A;  3C7U A;  1ALQ A;  1BSG A;  1K6S A;  1M40 A;  5F82 A;  4R23 A;  2G2W A;  5CGX A;  1FQG A;  4R3B A;  4ZTK A;  5JYO A;  3TOI A;  3VP4 A;  1O7E A;  4H8R A;  5FQK A;  5IHV A;  2UWX A;  2EX9 A;  3G32 A;  4IVI A;  4OPZ A;  5M18 A;  2OSU A;  5A93 A;  5A92 A;  4R1G A;  1ES2 A;  5FAS A;  3DWZ A;  1VQQ A;  2CC1 A;  3GV9 A;  5F83 A;  4BD1 A;  2X01 A;  1I2S A;  4WMC A;  1TVF A;  3WS2 A;  3IWO A;  3PBT A;  4UA9 A;  5KSC A;  4C3Q A;  3PBO A;  1K54 C;  5J8X A;  3N6I A;  3IXD A;  1YT4 A;  5FQQ A;  1KDW A;  2A49 A;  4M3K A;  3DWK A;  2Y55 A;  4MLL A;  5AQ7 A;  2J9P A;  2XR0 A;  5TFQ A;  2Q9N A;  3PAE A;  1FR1 A;  1ES3 A;  4RX3 A;  5EOO A;  1FCM A;  2J7V A;  1JVJ A;  2QZ6 A;  4OLG A;  3VP1 A;  4XUX A;  2ZQD A;  3FKW A;  3QNB A;  2Y4A A;  3BLM A;  2WKI A;  4BL3 A;  4U0T A;  2XQZ A;  3SH9 A;  1FCN A;  4LEN A;  3G4P A;  2HP9 A;  5A90 A;  2FFY A;  2P9V B;  3GRJ A;  4GD6 A;  4QY6 A;  5L2F A;  1K57 A;  2OLU A;  2Y2L A;  5FQI A;  3HLD A;  3VMA A;  3G31 A;  2I72 A;  3V39 A;  2E8I A;  1KGG A;  3V5M A;  1GA9 A;  1ERQ A;  5HAP A;  2Y91 A;  3E2L A;  2Y2H A;  1CI8 A;  1FSY A;  4C75 A;  4S2M A;  1RGY A;  3VP0 A;  3OPR A;  5GLD A;  3A3E A;  3O88 A;  4S2I A;  4BD0 A;  5M19 A;  4DF6 A;  1K56 D;  4EWF A;  4ZJ3 A;  2V2F F;  3M2J A;  3ZHH A;  1XA1 A;  3ZG9 B;  1RGZ A;  1KVL A;  1NYY A;  2ZC6 B;  4OKP A;  1K4F A;  1XXM A;  4FH2 A;  4XUZ A;  3OZH A;  3ZVW A;  4WEJ A;  5HW3 A;  3M6B A;  3HL9 A;  2WKE A;  1H8Z A;  4N9L A;  4MBK A;  4GDB A;  2HDQ A;  1BUL A;  3NY4 A;  3A3F A;  2XH9 A;  2Y2K A;  4KQR A;  1W8Y A;  3G2Z A;  2R9X A;  3BEB A;  1BTL A;  1FSW A;  2Q9M A;  4WM9 A;  4QU3 A;  3WS5 A;  4N1H A;  2H10 A;  3MZF A;  1FCO A;  5EVI D;  4ZBE A;  1DJC A;  5HAR A;  4S2O A;  3D4F A;  3S1Y A;  3G34 A;  4IBX A;  5AQB A;  4X69 A;  2XEP A;  1VM1 A;  5AQ9 A;  3BFD A;  5FI7 A;  3ZNY A;  1ONH A;  3B3X A;  4GN2 A;  1QMF A;  1HZO A;  2ZD8 A;  3BRM A;  1G6A A;  3Q81 A;  4GB7 A;  4KZ9 A;  2WKH A;  5FSR A;  4LV1 A;  4ZJ1 A;  3MXS A;  3O87 A;  5G18 A;  3FYZ A;  4PM5 A;  4HBU A;  4KG5 A;  1CK3 A;  4KG6 A;  1KGE A;  1K38 A;  2JE5 A;  5CTM A;  5DTK A;  4BL2 A;  2WGV A;  2EX8 A;  2VGK A;  3BFE A;  1K25 A;  2WGW B;  4GZB A;  1YLJ A;  2OV5 A;  4OOM A;  2BLS A;  5EOE A;  1YLW A;  1PWG A;  3ZFZ A;  3LCE A;  1YLP A;  3Q7V A;  1K56 A;  3P09 A;  1W8Q A;  3O3V A;  4GD8 A;  2QMI A;  3Q7V B;  1IYO A;  4O7D A;  1L0F A;  3PBR A;  2EFU A;  4ZDX A;  5EVI C;  3UNW A;  1NXY A;  1S0W A;  2A3U A;  5GHZ A;  3VP2 A;  3WWX A;  2HDR A;  3GTC A;  5KMW A;  4LCL A;  1CEF A;  3ITA A;  1MWS A;  3BFG A;  3M6H A;  1ESI A;  2Y2O A;  5A91 A;  1WYB A;  3SS3 A;  4A5R A;  4JF6 A;  1LL9 A;  3AGF A;  1IYP A;  1XKZ A;  3IWI A;  4FH4 A;  2Y2N A;  3UPP A;  1O07 A;  1L0E A;  4S2K A;  4DE2 A;  3Q7Z A;  2EX6 A;  3UPN A;  1TDL A;  5EVI A;  3BEC A;  3WRT A;  4LV3 A;  1XP4 A;  1MKI A;  2R9W A;  4OLD A;  3QNC A;  4NK3 A;  2Y2G A;  1IKI A;  1IEL A;  4K0W A;  2DCF A;  5CRF A;  4EUZ A;  1GHM A;  3FWL A;  4PM7 A;  5GLA A;  1DJA A;  4UAA A;  5FI6 A;  1H8Y A;  4GKU A;  3UE0 A;  2HDU A;  3SOI A;  5BOH A;  4MBF A;  3I7J A;  2X71 A;  3IXH A;  4R3J A;  1ES4 A;  2WYX A;  3CJM A;  3N8L A;  2BG1 A;  4OQH A;  4JKT A;  1PW8 A;  3G2Y A;  2ZC3 B;  5DTS A;  2XF3 A;  3FV7 A;  3N7W A;  4LV2 A;  3C4O A;  3HRE A;  1PWD A;  1WYC A;  5CHU A;  4WBG A;  5HAI A;  2C6W B;  5FI2 A;  1DY6 A;  3ISG A;  1MWT A;  4E3I A;  1GA0 A;  1JTG A;  4BEN A;  3VOZ A;  3MZD A;  1ONG A;  1BLH A;  4N1X A;  4S2L A;  4S2N A;  5CEC A;  1CEG A;  1WE4 A;  2DNS A;  3HLG A;  4WEK A;  3W8K A;  1PW1 A;  1G68 A;  3LY3 A;  3S4X A;  1K57 C;  1J9M A;  4EBP A;  2XFT A;  3GR2 A;  3OCL A;  1U60 A;  4YFM A;  4IBR A;  4JXW A;  3IHB A;  3UDX A;  1IEM A;  3P98 A;  3PBS A;  1TDG A;  4KZA A;  5CTN A;  2ZC7 A;  4E3K A;  3BFC A;  1LI0 A;  4Y0U A;  2ZQ9 A;  4OPQ A;  1YLZ A;  1LHY A;  3IXB A;  2WAE A;  1JWZ A;  4OOY A;  3V3S A;  2FFF B;  1PWC A;  1NY0 A;  1N4O A;  4PMA A;  1BLC A;  2WAF A;  4FSF A;  4PM8 A;  4WYY A;  3OC2 A;  4S2P A;  4B88 A;  4E3J A;  2VGJ A;  3LEZ A;  5EPH A;  1GHI A;  4QD4 A;  5DF8 A;  2Y2Q A;  3IHA A;  3QHY A;  1PIO A;  4BLM A;  3Q82 A;  3IH9 A;  5E43 A;  1E4D A;  4E3N A;  2ZM8 A;  4GDN A;  4GOG A;  1EWZ A;  2ZM0 A;  1BUE A;  4Y0O A;  3VOY A;  1EI5 A;  1JWV A;  2XD5 A;  2J8Y A;  4EBN A;  4GNU A;  4WZ4 A;  4P87 A;  2ZQ8 A;  2C5W B;  5KSH A;  4U3T A;  3BYD A;  1AXB A;  1BLS A;  4KQQ A;  2XLN A;  3Q07 A;  4C6Y A;  5FQM A;  4JXV A;  4IED A;  2HDS A;  4EBL A;  2Y2M A;  4OP8 A;  3DW0 A;  3ZNT A;  4Z9Q A;  2XK1 A;  4QY5 A;  5FA7 A;  1ESU A;  5HL1 A;  2WZX A;  3IQA A;  1KE0 A;  3MXR A;  1FOF A;  3ZG7 B;  4KQO A;  3HLE A;  3C4P A;  4JXG A;  5M1A A;  3A3D A;  2XGN A;  3O86 A;  4MEZ A;  1KVM A;  1JWP A;  2XD1 A;  3HUO A;  2IWB A;  4HEF A;  1MY8 A;  5FAT A;  1XGJ A;  5FAO A;  3V3R A;  1KE4 A;  1PZP A;  1IYS A;  3IH8 A;  2HP5 A;  3CG5 A;  1PI5 A;  2Z2M B;  2ZC5 B;  4L0L A;  2PBY A;  2ZC4 B;  3OCN A;  4CPK A;  1NZO A;  3AGD A;  5FAP A;  3LY4 A;  4U0X A;  4R4S A;  4WZ5 C;  4KZ8 A;  3VFH A;  4E3L A;  3UN7 A;  4QJG A;  1NJ4 A;  3OPL A;  2H0Y A;  5EEC A;  5GLC A;  5HX9 A;  1LLB A;  1TEM A;  2P74 A;  1NRF A;  5E2H A;  4NET A;  3ZG0 A;  3NDG A;  4K0X A;  4B4Z A;  3ZGA B;  4Y7P A;  5CED A;  3MZE A;  3DTM A;  4HES A;  4WZ5 A;  3N8S A;  1SDE A;  1HVB A;  4OQ0 A;  4DE3 A;  1H5X A;  3PTE A;  4PM6 A;  4JBF A;  5CHJ A;  5E2E A;  4KZ7 A;  3MBZ A;  2RL3 A;  3NI9 A;  4JPM A;  4OH0 A;  4BJP A;  4DXB A;  4EV4 A;  2WK0 A;  4DRT A;  3GMW A;  4JF4 A;  1DJB A;  4KEN B;  1ZG4 A;  3UO9 A;  5FDH A;  3RXW A;  1PI4 A;  2WZZ A;  2EXA A;  1SDN A;  3W4O A;  3CMZ A;  5EVI B;  3C7V A;  1NYM A;  2HP6 A;  1JTD A;  4RA7 A;  1K55 C;  2PU4 A;  4X55 A;  4RYE A;  3SH7 A;  3UY6 A;  5TR7 A;  5DF7 A;  4F94 A;  1PYY A;  1XGI A;  4N92 A;  1OME A;  3PAG A;  4DXC A;  3BM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...