4OOYA

Avibactam and class c beta-lactamases: mechanism of inhibition, conservation of binding pocket and implications for resistance
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
359
structure length
359
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Avibactam and Class C beta-Lactamases: Mechanism of Inhibition, Conservation of the Binding Pocket, and Implications for Resistance.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 121
structure length 359
sequence length 359
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ooyA00
3UN7A 4HESA 4K91A 3NDEA 2CC1A 4PM5A 2XD5A 2ZLYA 4ZTKA 5EVIC 5A93A 1IELA 1L0FA 2HP9A 1LI0A 2EX6A 5CEBA 4C3QA 3UPPA 1FSWA 4R4SA 3A3DA 4QD4A 3N8RA 5GHYA 4OQ0A 3BFDA 1K55A 4FH4A 1PW8A 1GHPA 2A49A 4KZBA 5KSHA 1XPBA 2H0YA 3Q7VA 4KENB 4KZ4A 3WRZA 3HUMA 4OPRA 1CEGA 1YLJA 1S0WA 4E3LA 4KZ7A 4R4RA 4OLGA 5BOHA 1YMSA 2PU2A 4OLDA 3HUNA 1XA1A 4RVAA 3M2KA 3PAGA 4GNUA 5CTMA 4C6YA 2WZZA 2WGVA 3FKWA 1NZUA 4S2IA 4KZ9A 4N1HA 1TDLA 3IHAA 3RXXA 5CHJA 2RCXA 5CHMA 5GL9A 2X71A 4DKIA 3O87A 5DF8A 5JYOA 3IXGA 4FD8A 4X6TA 2Y2MA 4QHCA 4MEZA 4DDYA 4P0MA 5HL1A 3MFDA 4OQIA 5DTTA 3WS1A 2XD1A 3SS5A 3NC8A 1NYYA 4A5RA 3GVBA 4MBKA 2XH9A 4KZAA 1DY6A 4ID4A 4WEJA 5HARA 1KVLA 4EV4A 1DJAA 3W4OA 4XUZA 1FQGA 2P74A 4OPQA 5DTSA 1PI5A 1LHYA 3PBOA 2ZQAA 1PIOA 1C3BA 1BLCA 4OOYA 1KE0A 2ZMAA 3W4PA 4OPYA 4ZJ2A 3HLWA 1SHVA 3C7UA 3VSKA 4RA7A 5A90A 4X56A 4NETA 1IEMA 4HEFA 5D3OA 3GV9A 4E3JA 3SS4A 1LL9A 2BLSA 3TSGA 3FYZA 4E3OA 5E2FA 1PWDA 3Q82A 3MZDA 4GB7A 5EOEA 3V5MA 1XP4A 1KDSA 1PW1A 3WRTA 4KZ5A 4N92A 3ZDJA 3OPHA 3GMWA 5FAOA 1NZOA 3MBZA 1BLPA 1JTDA 4S2NC 4JF6A 4WM9A 3LEZA 3N8SA 1FCOA 3OZHA 2HDQA 1E25A 5GHXA 5CGSA 3G30A 1WYCA 4UHUA 4N9KA 1KGGA 4PM6A 1SDEA 3SS3A 4R1GA 5HX9A 2FFFB 5EPHA 3PAEA 4BENA 3P98A 3O86A 3CJMA 1FR6A 1L0GA 1ERMA 2ZQ8A 5GLCA 1KE4A 2WAEA 3B3XA 1FSYA 3N8LA 1MXOA 4UA9A 5DVAA 3M6HA 3V50A 2QPNA 4KQQA 4JBFA 3V39A 3HVFA 1K6RA 4R0QA 2UWXA 3ZVWA 2H10A 1IYPA 5G18A 5FQ9A 3I7JA 1K56D 2PU4A 3A3EA 2J9OA 3OPRA 3IH8A 2G2WA 1E3UD 1FCMA 3QHYA 5E2EA 3PBQA 1VM1A 2XF3A 5E2HA 1WYBA 1ZKJA 1SKFA 4Z9QA 4DE3A 5EVIB 2HP6A 5FQQA 3S1YA 4DE1A 1LI9A 4LV0A 4O7DA 3IT9A 1L0EA 4XXRA 4UA6A 3W8KA 2ZC5B 3VSLA 2H0TA 5CTNA 4JXWA 1KGEA 4LCMA 4U0TA 4OONA 3ZG9B 2VGKA 2B5RA 1LL5A 1JWZA 1WE4A 2ZQDA 3SOIA 4S2LA 1DJBA 2ZM8A 3HUOA 4OQGA 4U0XA 5A91A 2WGWB 5EUAA 5FASA 2XEPA 4LV1A 1KDWA 2EXBA 1PI4A 3UE0A 2ZD8A 3G2ZA 3G2YA 5HFOA 1XGJA 4KG5A 3HBRA 2HDUA 4YINA 5FA7A 4E3MA 1E4DA 1ZG6A 3CMZA 2HDRA 3G4PA 3ITAA 3FKVA 4JPMA 3UO9A 2WKEA 4OH0A 1IYQA 1W7FA 4DF6A 2ZQ7A 3O3VA 4R3BA 4EBLA 3UE3A 5FQKA 5CERA 3M6BA 3OCNA 2J7VA 2ZC7A 3FWLA 2JE5A 4QB8A 1K25A 1W8YA 4QJGA 1Q2QA 3EQVA 1Q2PA 2X02A 4UAAA 1ES4A 1OMEA 4JF4A 2EFUA 3IQAA 3BM6A 2P9VB 1MWRA 3FZCA 3ZHHA 5FQMA 4DDSA 3SH9A 1PZOA 2EX9A 4GD6A 4DXCA 2RL3A 5CECA 5EVID 1FOFA 2A3UA 4ZDXA 1QMEA 4E3IA 2Z2LB 3UPOA 4JXVA 4Y0TA 3DTMA 4GD8A 1I2SA 4S2MA 3UNWA 1PWCA 3UDFA 3Q1FA 3NIAA 3PBRA 1DJCA 5GLBA 4F94A 1G68A 3IF6C 2IWDA 4YFMA 2ZM2A 1K56A 5FAQA 3C4PA 2H5SA 4JLFA 3TG9A 5F83A 3P09A 1E3UA 2PBYA 4WMCD 3HL9A 3PBTA 1SCWA 5L2FA 3JYIA 5FAPA 3NY4A 3DW0A 1IYOA 2Y2PA 4WZ5A 1NRFA 1TEMA 3G34A 5AQ9A 3W4QA 1YM1A 1K55C 4GKUA 1XXMA 2WAFA 4K0XA 1FR1A 3S4XA 3UE1A 4BD1A 5GLAA 5AQAA 3OC2A 2XDMA 3N6IA 4Y0OA 4H8RA 4RX2A 4IBXA 4RYEA 3BLMA 3VP3A 1JWVA 2ZC3B 1VQQA 2DNSA 5IHVA 2EFXA 2FFYA 2OV5A 1MWUA 5EVLA 4BLMA 1KVMA 4BL2A 5E43A 3AGFA 1O07A 1YMXA 5KSCA 4R23A 1XX2A 4KZ6A 4U3TA 3ZNYA 5CGWA 3SH7A 1CI8A 1I2WA 1EWZA 3IXHA 3MKFA 5TGFA 4P87A 3VP2A 4FSFA 2E8IA 3A3FA 2HP5A 4UA7A 2WKIA 3N4IA 1IKGA 1M6KA 4N9LA 4DXBA 1K57A 4OKPA 1Y54A 2ZQ9A 4DRTA 4QY5A 3GRJA 1ES3A 5EECA 3UPNA 3DWZA 4PPRA 5I94A 3UDIA 2Y2JA 3AGDA 1N9BA 5AQ7A 4DE2A 2WYXA 3HLCA 4MBHA 3HREA 1ONHA 2XQZA 4BD0A 1CI9A 3WWXA 3QNBA 4PM8A 5F82A 1K54C 3TOIA 2ZQCA 1J9MA 2Y2GA 4GN2A 1LLBA 3OPPA 4BQMA 1ESIA 4OOMA 1SDNA 1ZG4A 2Z2MB 3IHBA 4X69A 5EVIA 5FI6A 4EUZA 2Y2LA 5FATA 2OLVA 2XR0A 3D4FA 3MZEA 5M1AA 1GA9A 5EE8A 3QNCA 4LENA 4Q8IA 2V1ZA 5DTKA 3ZNTA 1Z6FA 5FDHA 4E6WA 3Q07A 2G2UA 4QU3A 2BG1A 4NK3A 1ESUA 2WGIA 2WGWA 4WMCA 4ZJ1A 2XFSA 4D2OA 5JYPA 1K4EA 4PM7A 3LY3A 2Q9MA 4PMAA 2I72A 3IWOA 1XA7A 3ZG7B 4KQRA 2EX2A 1XGIA 2J8YA 1RGYA 2IWCA 2Y55A 4QY6A 5U47A 3NCKA 5KMWA 3IXDA 3ITBA 2XK1A 4OQHA 1G6AA 2DRWA 4S2JA 3IWQA 3IH9A 1YLWA 1K38A 5F1GA 4EBPA 4B88A 3MZFA 3O88A 2Y91A 2DCFA 4EQIA 3M2JA 4GDBA 1RCJA 4E3KA 1NY0A 3BFEA 4ZAMA 4CJNA 4KZ8A 2J9PA 1YT4A 3NDGA 4WYYA 1HZOA 2IWBA 3ZG5A 3ZVTA 2WZXA 1PWGA 1QMFA 1K6SA 2P9VA 3IF6B 1YLTA 2QZ6A 2HDSA 2WK0A 2Y2IA 3LY4A 3BLSA 3UY6A 3CG5A 1ES2A 5HAQA 2JC7A 4OPZA 5FQJA 2ZC6B 4Y0UA 5A92A 4S2OA 4BL3A 3WS0A 4P6BA 1IYSA 2Q9NA 2WKHA 3HLDA 3MKEA 5CRFA 3VOZA 3ZG8B 1BZAA 1TVFA 1W8QA 2Y4AA 2XGNA 2Y2OA 2X01A 4ZBEA 1NXYA 3GTCA 5F1FA 1PZPA 3BFCA 1RP5A 3A3IA 3LCEA 5AQBA 4WZ4A 2XFTA 3VP0A 3Q7VB 3VOYA 2JBFA 1BLSA 1N4OA 2XLNA 4KQOA 4Y7PA 3G31A 4DE0A 5HW3A 3V3SA 3WS2A 4EWFA 3C4OA 4X68A 5M18A 3ZFZA 3IWIA 1BULA 1ONGA 4X55A 1GHMA 3RJUA 1YQSA 3PBSA 4JKTA 2OSUA 4OVDA 5HAIA 3SH8A 3HLBA 1W5DA 4S2NA 1YLZA 1O7EA 3C7VA 3CZDA 1H8YA 1U60A 3N7WA 3WS5A 4ZJ3A 2ZJ9A 3V3RA 3G32A 3IF5A 4GOGA 3VFHA 4X53A 5DF7A 3ZG0A 3GSGA 4IVKA 3Q7ZA 4K0WA 1H8ZA 1RGZA 2C6WB 3ISGA 3BFFA 4MBFA 1EI5A 1HTZA 1HD8A 1JWPA 4IEDA 4R3JA 3LO7A 4MLLA 4FH2A 1MWTA 3ZGAB 1GHIA 4XUXA 2R9WA 1W79A 2ZC4B 2JCHA 3AGEA 4HBUA 4CPKA 4PM9A 3BFGA 4WELA 1ZC2A 4LCLA 4GDNA 3S22A 1K54A 3RXWA 1MWSA 2V2FF 2EXAA 1I5QA 1H5XA 3MXSA 5TFQA 5HAPA 4JF5A 4JXGA 4B4ZA 2Y2KA 1CEFA 5CGXA 4E3NA 5J8XA 3OCLA 3G35A 3NBLA 5GHZA 4LV3A 1MKIA 3ZCZA 4M3KA 3IXBA 1ALQA 1MY8A 5CEDA 3OPLA 4IBRA 1BSGA 4LV2A 4OOLA 1ES5A 2V20A 4WBGA 1PYYA 2WUQA 1GA0A 1BLHA 3BRMA 3BYDA 5DF9A 2HPBA 2R9XA 4KG6A 4WZ5C 3NI9A 1BT5A 4N1XA 1KE3A 1CK3A 1XKZA 3UDXA 3Q81A 3BEBA 4L0LA 2Y2NA 3FV7A 4S2KA 3WS4A 1MBLA 2OLUA 1L0DA 1YLPA 5CHUA 1GCEA 4WEKA 2ZM0A 1K4FA 1EROA 3PTEA 1NYMA 3BECA 1HVBA 2Y59A 3MXRA 3C5AA 1FCNA 5KZHA 3HLEA 4IVIA 4JXSA 1YLYA 4MNRA 3E2LA 3VP1A 3VP4A 4OP8A 4RX3A 1AXBA 5E2GA 1M40A 2QMIA 1BTLA 4P85A 4S2PA 4GZBA 2VGJA 3EQUA 1IKIA 4KZ3A 1S6RA 3PBNA 4KG2A 4B4XA 3GR2A 3HLFA 1K57C 1BUEA 3A3JA 1KGFA 2WADA 5FQIA 3VMAA 5FI2A 1ERQA 2Y2HA 3DWKA 5CXWA 5TR7A 4BJPA 4HBTA 1NJ4A 2Y2QA 5EOOA 4OP5A 4C75A 2GDNA 1L2SA 4E6XA 5FSRA 2EX8A 2C5WB 3GQZA 3HLGA 5M19A 1MPLA 5FI7A 5GLDA 4EBNA 3E2KA 1JVJA 1TDGA 4FCFA 3VFFA 1JTGA 3IF6A
chains in the Genus database with same CATH superfamily
3UN7A 4K91A 5AVFA 4PM5A 2XD5A 3U4LP 2HP9A 4C3QA 4R4SA 4QD4A 1XJ4A 3R7WA 3BFDA 3L9KA 1PW8A 4ME4A 4KENB 2PBDP 3HUMA 4C6YA 4RVAA 5CTMA 3M2KA 4GNUA 4X1MA 3O5YA 3FKWA 1NZUA 2GX5A 2VK3A 5EM0A 4F3LA 3IHAA 3T12B 2W1TA 2RCXA 5GL9A 2X71A 1D1JA 2VZWA 4P0MA 5HL1A 3MFDA 2XD1A 2HV1A 3SS5A 1NYYA 3GVBA 2FH5A 5HARA 1DY6A 3LIDA 1GSXA 3BWLA 3W4OA 4XUZA 2P74A 5DTSA 1PI5A 3HJKA 1Y4OA 3CITA 1BLCA 4ZJ2A 3HLWA 4NXGA 3VSKA 4RA7A 4NETA 3GV9A 2JKTM 1LL9A 2BLSA 3TSGA 3FYZA 1K0KA 4GB7A 3MZDA 2PRFA 1XP4A 3LEQA 2EWVA 1JTDA 2V0UA 3OZHA 3QP8A 5FL3A 1ZTUA 3G30A 4UHUA 4N9KA 1SDEA 4R1GA 2FFFB 4NXEA 3CJMA 1L0GA 3W2ZA 5GLCA 2GZAA 1MXOA 1IOUA 1K6RA 2QHKA 3QP5A 2O0YA 5FQ9A 3I7JA 3KYZA 5HPFA 3IH8A 3PBQA 4L9EA 1WYBA 1SKFA 2Y79A 1XJ3A 3IT9A 4BBVA 4U0TA 4R70A 2B5RA 4LLOB 2JKRM 2YKFA 3IBRA 3QP2A 3HUOA 4U0XA 5C5KA 5F69A 4WL9A 4LV1A 2EXBA 1X0OA 2ZD8A 3G2ZA 1W63Q 3LIEA 3OLOA 2A2LA 4PAUA 5HFOA 5KIZA 3HBRA 2HDUA 4KUKA 3VE4A 3G4PA 2EA9A 1ODVA 2JKTI 2WKEA 4OH0A 3T50A 4DF6A 4EBLA 3T4LA 4HY8A 2ZC7A 4LGWA 4L9GA 4QB8A 1K25A 2PR6A 3H7WA 2J3TD 4NEED 4WUJA 1MWRA 5FQMA 4R38A 3CPTA 4GD6A 1N9OA 1FOFA 4HH3A 4GD8A 1I2SA 3UDFA 3CUEC 3IS2B 1DJCA 4F94A 3IF6C 2OWJA 2IWDA 3F1NB 1F9IA 1K56A 5FAQA 4WMCD 1FILA 3JYIA 5FAPA 3VOLA 3KSGA 3NY4A 3DW0A 3G34A 3W4QA 5GLAA 3G6OA 5FDSA 2ZC3B 1VQQA 5EVLA 4QPRA 1O07A 1YMXA 2QKPA 1XX2A 3IXHA 3B33A 1M6KA 4GHIB 4N9LA 4DRTA 2ZQ9A 3CLOA 5EECA 4IJGA 4PPRA 5DFYA 3JVVA 5AQ7A 4DE2A 3NJAA 1ONHA 2XQZA 4BD0A 1J3WA 3TOIA 2Y2GA 3LIBA 4PHTA 3BQAA 1SDNA 2L1MA 3IHBA 4II7A 5FI6A 2V8CA 2XR0A 1GA9A 5EE8A 3QNCA 4E6WA 3Q07A 3E98A 2WGWA 1TS8A 4ZJ1A 1NLYA 3UB9A 3LY3A 1LT0A 4PMAA 2W3FA 1SKOB 3LR5A 4KQRA 2Y55A 5U47A 1RGYA 2IWCA 3T4JA 3BY9A 1XJ2A 3IXDA 3ITBA 2XK1A 4S2JA 1YLWA 4EBPA 2Y91A 5A8BA 4EQIA 1RCJA 4E3KA 1YT4A 1YLTA 2QZ6A 2HDSA 3BLSA 3UY6A 4AFIA 1ES2A 2ZC6B 4Y0UA 2ZOIA 4BL3A 3VOZA 5CRFA 5DFXA 1TVFA 2XGNA 2Y2OA 4QWOA 1NXYA 3GTCA 5F1FA 1RP5A 5AQBA 3VP0A 2XFTA 3Q7VB 1BLSA 4KQOA 4Y7PA 3G31A 1BULA 4X55A 1GHMA 3RJUA 1NWZA 1OJ5A 3SH8A 1YLZA 2W3HA 1O7EA 5IT5A 1YSPA 1P9WA 2ZJ9A 2HGVA 3IF5A 4YWZA 4X53A 4IVKA 3S7QA 3Q7ZA 2W1RA 4HP9A 4KUOA 1JWPA 1MKMA 3C38A 2ZC4B 4HBUA 2JCHA 3BFGA 3T4TA 4EESA 4LCLA 4GDNA 5DJUA 1T1BA 2V2FF 5EV0A 2WKQA 4JF5A 1CEFA 3NULA 4IHQA 3ICYA 3G35A 3PHYA 1BSGA 5EVEA 1GA0A 5DF9A 4BMWA 2R9XA 1BT5A 1KE3A 1XKZA 3Q81A 2Y2NA 4S2KA 4MN5A 1GCEA 1NYMA 3BECA 3MXRA 1T18A 4OP8A 4GCZA 4KZ3A 2WADA 1PRQA 5FI2A 5CXWA 4BJPA 3F1PA 2GDNA 4E6XA 5M19A 5FI7A 2J3TC 4FCFA 1JTGA 2B18A 3NDEA 3KSIA 3IX4A 4ZTKA 1D06A 3F1OA 3UPPA 3A3DA 2IA2A 4OQ0A 4B9OA 2WKRA 1K55A 2JKFA 3EGDC 3WRZA 4OPRA 3NECA 4KZ7A 4OLGA 1ACFA 1YMSA 3OBFA 1S67L 3E4OA 4KZ9A 2M7UA 5CHJA 3NHQA 4MN7A 2QJ7A 4FD8A 4NXFA 1VB6A 4DDYA 5DTTA 3WS1A 2O9CA 3SW1A 5HWTA 1YAXA 4KZAA 4WEJA 1KVLA 1MC0A 4FTXA 1FQGA 4DJ2A 2KOIA 4OPQA 3H82A 2V8FA 2ZQAA 4P6ZS 4LPZA 2A24B 3FG8A 1KE0A 4OPYA 3MSHA 5I5LA 5IU1A 2ZMFA 3S7NA 1SHVA 1TS7A 3MQOA 1SZVA 3SS4A 3KSFA 3Q82A 5LBRA 2VEAA 1OJGA 2W3DA 4N92A 3OPHA 4Q0IA 1NZOA 3MBZA 1BLPA 4FOFA 3N8SA 5GHXA 3TE8A 5CGSA 4Y17A 4PM6A 5EPHA 4BENA 2L4RA 1TD5A 3P98A 1FR6A 1KE4A 2W0NA 3N8LA 5DVAA 2JN7A 5HWVA 3V39A 3HVFA 4Z1WA 3ULFA 2UWXA 2VKSA 2PU4A 1E3UD 2V1AA 5E2EA 4CLCA 2XF3A 3LYXA 4GS9A 5EVIB 2HP6A 2PYRA 5FQQA 3LI9A 2J80A 4X1LA 2QJ5A 4I5SA 4LCMA 4OONA 2VGKA 1D7EA 1JWZA 1WE4A 4OQGA 5A91A 2B02A 1PI4A 1XGJA 4E3MA 1E4DA 1WA9A 3FKVA 4XT2B 1IYQA 5F68A 5CERA 3M6BA 2J7VA 4D60A 3FWLA 4UAAA 1OMEA 2EFUA 2M1CA 2P9VB 3E0YA 2BTFP 2EX9A 2EWWA 2RL3A 4ZRRA 5HSQA 5EVID 4JGRA 2A3UA 4PKYG 1QMEA 1VEUB 2Z2LB 3UPOA 4S2MA 3UNWA 1PWCA 3NIAA 3PBRA 3MS6A 4HOIA 3C4PA 1OT9A 3TG9A 5F83A 4I3AA 5L2FA 1IYOA 1H3QA 2Y2PA 4WZ5A 5AQ9A 1P97A 4GKUA 1XXMA 3UE1A 1DP9A 1FR1A 4Y0OA 4RX2A 4H6JB 2VLGA 3T4QA 1MZUA 1JWVA 1GSVA 5IHVA 2EFXA 2OV5A 4JGOA 2NUTC 3KX0X 4U3TA 5CGWA 1CI8A 3LIAA 1Z09A 4FSFA 4UA7A 1IKGA 5AJGA 4OKPA 2P08A 3GRJA 3DWZA 5I94A 4MCWA 2VV7A 2Y2JA 1VETB 5DKLA 2WYXA 4MBHA 1G5UA 3HREA 3WWXA 1HLUP 5F82A 3OPPA 3ZYTA 1ESIA 1ZG4A 2Z2MB 2ZL1A 4HH2A 5IS1A 3HJIA 5FATA 2OLVA 5HD3A 1PFLA 2PR5A 2QYBA 2V1ZA 2Q0OA 1Z6FA 1NRJA 1N9LA 2OWHA 2BG1A 2WGIA 2XFSA 1LSVA 1UGUA 3E4QA 2AVXA 1XA7A 1LSWA 2EX2A 2J8YA 5KMWA 2Z6CA 4OQHA 1G6AA 4ARZA 2DRWA 3IWQA 3O88A 3D72A 4MMNA 4WYYA 1HZOA 4HJ3A 1PWGA 2MJ6A 2WK0A 3B42A 3MQQA 3WS0A 4P6BA 2Q9NA 3ZG8B 1W8QA 1UWNX 3A0RA 3VOYA 2JBFA 5HW3A 3V3SA 3WS2A 4ESPA 1ONGA 3A0SA 2KDKA 3PBSA 3HLBA 4F3LB 4CLCD 1S4RA 2W1TB 3G32A 3VFHA 3GSGA 4O8GA 4MBFA 1HTZA 3LO7A 4MLLA 4FH2A 5DKKA 2R9WA 1W79A 3JPUA 2R78A 1TF1A 4UEYA 3S22A 1MWSA 4FUWA 1H5XA 3L7HA 4B4ZA 1Y28A 3OCLA 3NBLA 4LV3A 3IX3A 2UV0E 3ZCZA 5J7EA 5HDSA 1MY8A 3OPLA 4LV2A 1PYYA 2B95A 3BYDA 4KG6A 3NI9A 3LI8A 3MJQA 3UDXA 3BEBA 4IUHA 1DP6A 4PKYA 1EROA 3PTEA 1HVBA 3HLEA 4IVIA 4JXSA 1YLYA 1M40A 3UB5P 4KG2A 4B4XA 1K57C 1BUEA 5FQIA 1DP8A 3DWKA 4NXBA 4HBTA 3OOVA 3IX8A 4OP5A 5FSRA 2EX8A 2C5WB 3GQZA 3HLGA 3D3OA 2XA7S 2VGLS 2Y8HA 5GLDA 3CUEA 1TDGA 3IF6A 4GJ4A 4HESA 2ZLYA 5L8MA 5EVIC 1IELA 2EX6A 5CEBA 1FSWA 5TBMA 3N8RA 2BASA 4HHDA 5GHYA 1GHPA 4KZBA 5KSHA 1XPBA 2H0YA 4KZ4A 2NUPC 2E8JA 4KQDA 1YLJA 1S0WA 4R4RA 5BOHA 1DRMA 2PU2A 3HUNA 2WZZA 3DTIA 1AWIA 3H7WB 4N1HA 1TDLA 4DKIA 3O87A 5L09A 2G7UA 5JYOA 3IXGA 2XSSA 4QHCA 4MEZA 4HI4A 4OQIA 3NC8A 2XH9A 1TS6A 4EV4A 1DJAA 3QP6A 4G3VA 4B93A 4JGQA 2QWSA 4OOYA 3W4PA 3C7UA 2ACGA 5A90A 4X56A 4UQIS 3T1SA 4EU0A 1KOUA 4E3JA 3NOUC 1V9YA 4E3OA 5EOEA 1KDSA 1PW1A 3WRTA 3ZDJA 3UMDA 4I38A 4HQAA 4S2NC 3P7NA 4WM9A 4HP4A 2HDQA 1YKDA 1WYCA 1KGGA 2HJEA 4O01A 1FSYA 4UA9A 2QPNA 4KQQA 3T1RA 4JBFA 4R0QA 4WLAA 1IYPA 4CQHA 1K56D 3A3EA 3OPRA 2G2WA 3GECA 2O99A 4DE3A 3S1YA 4R6LA 4DE1A 1LI9A 5FEFA 2LB5A 4XXRA 4UA6A 3W8KA 2ZC5B 2H0TA 3LGOA 4G3KA 4JXWA 1KGEA 3ZG9B 1LL5A 3SOIA 2ZQDA 4S2LA 2ZM8A 1S4SA 2WGWB 5EUAA 5FASA 1KDWA 3DTKA 3UE0A 4KG5A 4YINA 3IBJA 3ITAA 1N9NA 1W7FA 2ZQ7A 3O3VA 3TJZC 4LRXC 3UE3A 2W27A 3OCNA 1OPXA 2JE5A 3DBAA 1CF0A 4QJGA 1Q2QA 3EQVA 1Q2PA 5TJJA 2X02A 3MXQA 4JF4A 2P04A 3FZCA 3ZHHA 4RQ9A 1XFNA 4DXCA 3UMEA 4HNBA 3LR0A 3DTMA 4JXVA 4Y0TA 3Q1FA 2ZOHA 5J4EA 4YFMA 2ZM2A 2PBYA 3HL9A 3PBTA 3P01A 1TEMA 1YM1A 2WAFA 4K0XA 4BD1A 5AQAA 4EEUA 3K3DA 2K2NA 4RYEA 3VP3A 2DNSA 2FFYA 1MWUA 4BLMA 5KSCA 4R23A 4KZ6A 3ZNYA 3RH8B 5HPIA 3SH7A 1I2WA 1EWZA 5CX7A 3MKFA 5G4ZA 4YOFA 1STZA 3T4SA 3VP2A 3A3FA 3N4IA 3U2AA 4DXBA 3BY8A 1OTAA 1Y54A 1ES3A 3UPNA 3UDIA 1N9BA 3KYEA 3HLCA 1G6OA 3D9YA 2OAP1 3TW8A 2HJ9C 4EEPA 2VV8A 1K54C 2ZQCA 1J9MA 1LLBA 4I3JA 5F6AA 5HWWA 4X69A 3MR0A 2Y2LA 3D4FA 3MZEA 5M1AA 3NOTC 4LENA 4Q8IA 3FPVA 5DTKA 5FDHA 2KX6A 5HZHA 3LR4A 5HDDA 5HL6A 1T1AA 4NG2A 4NK3A 4WMCA 2PHYA 4D2OA 5JYPA 1K4EA 4PM7A 3IWOA 1XGIA 3ZQ5A 3NCKA 5HD5A 2D01A 3IH9A 5F1GA 5L10A 3F1PB 3MZFA 2DCFA 3M2JA 3NOPC 3BFEA 4KZ8A 3ZG5A 3ZVTA 2WZXA 1K6SA 2P7JA 2Y2IA 3KYQA 3CG5A 4OPZA 5FQJA 5L07A 2HZ5A 4S2OA 2M7VA 3F1OB 1IYSA 3LFVA 2WKHA 3MKEA 1BZAA 2X01A 4ZBEA 3IS2A 3BFCA 3LCEA 3E4PA 3UB8A 2W3GA 3F1NA 4DE0A 3B47A 4EWFA 5K5BA 5M18A 3ZFZA 4EERA 2OAQ1 4JKTA 5HAIA 4OVDA 3S7OA 3C7VA 3N7WA 1U60A 3WS5A 4ZJ3A 2VV6A 5DF7A 2YKHA 3BFFA 1EI5A 1HD8A 4Q0JA 2H28A 2GJ3A 1MWTA 3ZGAB 4IUKA 3AGEA 1ZC2A 1K54A 1I5QA 5TFQA 3H9WA 5HAPA 1XJ6A 3H82B 3HCYA 4GHIA 2VJWA 3PYPA 1G28A 1A0KA 4WF0A 5GHZA 3LIFA 2PDRA 1MKIA 4M3KA 5CEDA 2K31A 2OOLA 2V0WA 4OOLA 3LUQA 1OTBA 5F5YA 3BRMA 2HPBA 4N1XA 2ZBBA 3FV7A 4X25A 1CJFA 3MF0A 4BWIA 1YSQA 2PD8A 1L0DA 1YLPA 5CHUA 2ZM0A 1FCNA 3SZTA 4MNRA 3E2LA 4E04A 2D02A 4RX3A 1AXBA 1SKOA 1F98A 5E2GA 2QMIA 1BTLA 4P85A 4S2PA 5EM1A 4GZBA 2VGJA 3EQUA 4LRZE 1V9ZA 1S6RA 3GR2A 3HLFA 3A3JA 1P0ZA 3VMAA 4CLCB 1ERQA 4GS9B 2JKGA 5TR7A 2Y2QA 4DMZA 2V9AA 3JVUA 1GSWA 3EOIA 2CC1A 5A93A 1L0FA 2JHEA 1LI0A 4R3AA 4FH4A 2A49A 1TS0A 2XA7M 3Q7VA 2VGLM 3R7WB 3K2NA 4E3LA 1CEGA 3UB6A 4ETZA 4OLDA 1XA1A 3PAGA 3R4KA 2VA0A 2WGVA 4S2IA 1LSXA 5J3WA 3RXXA 5CHMA 3PR6A 5DF8A 1YPRA 4X6TA 1NLZA 2Y2MA 4A5RA 4MBKA 4ID4A 2DMWA 3V67A 3K3CA 1LHYA 3PBOA 1PIOA 1C3BA 3KO6A 1F2KA 3RTYA 2ZMAA 3UE6A 4YNRA 1IEMA 4HEFA 5D3OA 3PXPA 2JKRI 3TRCA 4Y3IA 5E2FA 1PWDA 3V5MA 4KZ5A 4HJ4A 3GMWA 5FAOA 4JF6A 3LEZA 1FCOA 1E25A 2VX8A 3SS3A 5HX9A 1T1CA 4UQIM 3PAEA 3O86A 1ERMA 2ZQ8A 4DN0A 3MQ0A 2WAEA 3B3XA 3M6HA 3V50A 3ZVWA 2H10A 2INWA 5G18A 3BJNA 2J9OA 4BBUA 1FCMA 3QHYA 4BBTA 1VM1A 4K08A 5E2HA 1ZKJA 3CWFA 3MMHA 4Z9QA 2ZL1B 4GLQA 3DTEA 4LV0A 4O7DA 1L0EA 4CLCE 1W63M 3VSLA 5CTNA 4EW7A 1DJBA 2XEPA 3G2YA 3T4KA 5FA7A 1ZG6A 4JPMA 3CMZA 2HDRA 3UO9A 1L3LA 3C2WA 3C30A 4ARZB 4R3BA 5FQKA 4JGPA 4EQ1A 3RFBA 1W8YA 2KLIA 1OT6A 4M4XA 1BYWA 1ES4A 3IQAA 3BM6A 1OTEA 2K7SA 1ZHHB 4DDSA 3SH9A 1PZOA 2L0WA 5CECA 3BQ8A 4ZDXA 4Y2FA 3CPTB 4E3IA 2FZ0A 5GLBA 1VHMA 1G68A 1OTIA 3C8CA 2H5SA 4JLFA 3P09A 1E3UA 1SCWA 4Y13A 1IFQA 2A24A 1NRFA 4MN6A 1K55C 3S4XA 2PYPA 1S1YA 5DJTA 5HDCA 3OC2A 2XDMA 3N6IA 2PT7A 4H8RA 1LL8A 4IBXA 4EETB 3BLMA 3EGXC 1JNUA 3A0VA 1KVMA 4I3IA 4Y15A 4BL2A 5E43A 1T19A 3AGFA 2ZMVA 5G4YA 3VV4A 5TGFA 4P6ZM 2V1BA 4P87A 2E8IA 2HP5A 2WKIA 1K57A 3CI6A 4QY5A 4MDZA 3AGDA 3UB7A 5MC7A 3EWKA 1CI9A 4GW9A 3QNBA 4PM8A 4Q0HA 1EW0A 4ETXA 4GN2A 4BQMA 4OOMA 1P9RA 5EVIA 4EUZA 3CAXA 4DJ3A 2Z6DA 3ZNTA 3S7PA 1CQAA 3VE3A 2G2UA 4QU3A 1ESUA 1PNEA 4WN5A 2Q9MA 4NKPA 2I72A 5FEGA 3ZG7B 4QY6A 3QP1A 1OTDA 4XT2A 4EXOA 2CMNA 1H8MA 1K38A 3KSHA 4B88A 4GDBA 1NY0A 4ZAMA 4CJNA 2J9PA 3NDGA 2IWBA 1QMFA 2P9VA 2WKPA 3IF6B 3LY4A 4CLCC 5HAQA 2JC7A 5A92A 4EUVA 3HLDA 2HF6A 1VEUA 5TBMB 2I9VA 4I39A 2Y4AA 2LB9A 1PZPA 3A3IA 4WZ4A 1H0MA 1N4OA 1XFQA 2XLNA 3T1XA 1UWPX 4Y5FA 3C4OA 4X68A 3IWIA 1YQSA 3QP4A 2OSUA 1W5DA 4S2NA 3T4OA 1S1ZA 3CZDA 1H8YA 3FC7A 3V3RA 4H6JA 3BW6A 4GOGA 3ZG0A 2J3WA 4K0WA 1H8ZA 1RGZA 2C6WB 3ISGA 4R3JA 4IEDA 1GHIA 4XUXA 4CPKA 2PD7A 4PM9A 4WELA 3FPWA 4G3WA 3RXWA 2EXAA 3MXSA 4JXGA 2O9AA 2Y2KA 5CGXA 4E3NA 5AVEA 1VETA 5J8XA 2W3EA 3LICA 3IXBA 1ALQA 4IBRA 1ES5A 2V20A 4WBGA 4HIAA 2WUQA 1BLHA 4HJ6A 4WZ5C 1CK3A 4L0LA 1FIKA 1F5MA 3LR3A 3WS4A 1MBLA 1S66L 3MFXA 2OLUA 4WEKA 2XROA 2XRNA 1K4FA 2GNXA 2Y59A 3C5AA 5KZHA 2O9BA 3GDIA 3CHWP 3VP1A 3VP4A 3EEHA 3DAVA 3T1QB 4LRYC 1IKIA 4LFUA 3PBNA 3EEAA 4O0PA 1KGFA 2Y2HA 1NJ4A 5EOOA 4C75A 1L2SA 2PAVP 4L9FA 1MPLA 5EFWA 4EBNA 3E2KA 1JVJA 3VFFA
chains in the Genus database with same CATH topology
3UN7A 4HESA 4K91A 3NDEA 2CC1A 4PM5A 2XD5A 2ZLYA 4ZTKA 5EVIC 5A93A 1IELA 1L0FA 2HP9A 1LI0A 2EX6A 5CEBA 4C3QA 3UPPA 1FSWA 4R4SA 3A3DA 4QD4A 3N8RA 5GHYA 4OQ0A 3BFDA 1K55A 4FH4A 1PW8A 1GHPA 2A49A 4KZBA 5KSHA 1XPBA 2H0YA 3Q7VA 4KENB 4KZ4A 3WRZA 3HUMA 4OPRA 1CEGA 1YLJA 1S0WA 4E3LA 4KZ7A 4R4RA 4OLGA 5BOHA 1YMSA 2PU2A 4OLDA 3HUNA 1XA1A 4RVAA 3M2KA 3PAGA 4GNUA 5CTMA 4C6YA 2WZZA 2WGVA 3FKWA 1NZUA 4S2IA 4KZ9A 4N1HA 1TDLA 3IHAA 3RXXA 5CHJA 2RCXA 5CHMA 5GL9A 2X71A 4DKIA 3O87A 5DF8A 5JYOA 3IXGA 4FD8A 4X6TA 2Y2MA 4QHCA 4MEZA 4DDYA 4P0MA 5HL1A 3MFDA 4OQIA 5DTTA 3WS1A 2XD1A 3SS5A 3NC8A 1NYYA 4A5RA 3GVBA 4MBKA 2XH9A 4KZAA 1DY6A 4ID4A 4WEJA 5HARA 1KVLA 4EV4A 1DJAA 3W4OA 4XUZA 1FQGA 2P74A 4OPQA 5DTSA 1PI5A 1LHYA 3PBOA 2ZQAA 1PIOA 1C3BA 1BLCA 4OOYA 1KE0A 2ZMAA 3W4PA 4OPYA 4ZJ2A 3HLWA 1SHVA 3C7UA 3VSKA 4RA7A 5A90A 4X56A 4NETA 1IEMA 4HEFA 5D3OA 3GV9A 4E3JA 3SS4A 1LL9A 2BLSA 3TSGA 3FYZA 4E3OA 5E2FA 1PWDA 3Q82A 3MZDA 4GB7A 5EOEA 3V5MA 1XP4A 1KDSA 1PW1A 3WRTA 4KZ5A 4N92A 3ZDJA 3OPHA 3GMWA 5FAOA 1NZOA 3MBZA 1BLPA 1JTDA 4S2NC 4JF6A 4WM9A 3LEZA 3N8SA 1FCOA 3OZHA 2HDQA 1E25A 5GHXA 5CGSA 3G30A 1WYCA 4UHUA 4N9KA 1KGGA 4PM6A 1SDEA 3SS3A 4R1GA 5HX9A 2FFFB 5EPHA 3PAEA 4BENA 3P98A 3O86A 3CJMA 1FR6A 1L0GA 1ERMA 2ZQ8A 5GLCA 1KE4A 2WAEA 3B3XA 1FSYA 3N8LA 1MXOA 4UA9A 5DVAA 3M6HA 3V50A 2QPNA 4KQQA 4JBFA 3V39A 3HVFA 1K6RA 4R0QA 2UWXA 3ZVWA 2H10A 1IYPA 5G18A 5FQ9A 3I7JA 1K56D 2PU4A 3A3EA 2J9OA 3OPRA 3IH8A 2G2WA 1E3UD 1FCMA 3QHYA 5E2EA 3PBQA 1VM1A 2XF3A 5E2HA 1WYBA 1ZKJA 1SKFA 4Z9QA 4DE3A 5EVIB 2HP6A 5FQQA 3S1YA 4DE1A 1LI9A 4LV0A 4O7DA 3IT9A 1L0EA 4XXRA 4UA6A 3W8KA 2ZC5B 3VSLA 2H0TA 5CTNA 4JXWA 1KGEA 4LCMA 4U0TA 4OONA 3ZG9B 2VGKA 2B5RA 1LL5A 1JWZA 1WE4A 2ZQDA 3SOIA 4S2LA 1DJBA 2ZM8A 3HUOA 4OQGA 4U0XA 5A91A 2WGWB 5EUAA 5FASA 2XEPA 4LV1A 1KDWA 2EXBA 1PI4A 3UE0A 2ZD8A 3G2ZA 3G2YA 5HFOA 1XGJA 4KG5A 3HBRA 2HDUA 4YINA 5FA7A 4E3MA 1E4DA 1ZG6A 3CMZA 2HDRA 3G4PA 3ITAA 3FKVA 4JPMA 3UO9A 2WKEA 4OH0A 1IYQA 1W7FA 4DF6A 2ZQ7A 3O3VA 4R3BA 4EBLA 3UE3A 5FQKA 5CERA 3M6BA 3OCNA 2J7VA 2ZC7A 3FWLA 2JE5A 4QB8A 1K25A 1W8YA 4QJGA 1Q2QA 3EQVA 1Q2PA 2X02A 4UAAA 1ES4A 1OMEA 4JF4A 2EFUA 3IQAA 3BM6A 2P9VB 1MWRA 3FZCA 3ZHHA 5FQMA 4DDSA 3SH9A 1PZOA 2EX9A 4GD6A 4DXCA 2RL3A 5CECA 5EVID 1FOFA 2A3UA 4ZDXA 1QMEA 4E3IA 2Z2LB 3UPOA 4JXVA 4Y0TA 3DTMA 4GD8A 1I2SA 4S2MA 3UNWA 1PWCA 3UDFA 3Q1FA 3NIAA 3PBRA 1DJCA 5GLBA 4F94A 1G68A 3IF6C 2IWDA 4YFMA 2ZM2A 1K56A 5FAQA 3C4PA 2H5SA 4JLFA 3TG9A 5F83A 3P09A 1E3UA 2PBYA 4WMCD 3HL9A 3PBTA 1SCWA 5L2FA 3JYIA 5FAPA 3NY4A 3DW0A 1IYOA 2Y2PA 4WZ5A 1NRFA 1TEMA 3G34A 5AQ9A 3W4QA 1YM1A 1K55C 4GKUA 1XXMA 2WAFA 4K0XA 1FR1A 3S4XA 3UE1A 4BD1A 5GLAA 5AQAA 3OC2A 2XDMA 3N6IA 4Y0OA 4H8RA 4RX2A 4IBXA 4RYEA 3BLMA 3VP3A 1JWVA 2ZC3B 1VQQA 2DNSA 5IHVA 2EFXA 2FFYA 2OV5A 1MWUA 5EVLA 4BLMA 1KVMA 4BL2A 5E43A 3AGFA 1O07A 1YMXA 5KSCA 4R23A 1XX2A 4KZ6A 4U3TA 3ZNYA 5CGWA 3SH7A 1CI8A 1I2WA 1EWZA 3IXHA 3MKFA 5TGFA 4P87A 3VP2A 4FSFA 2E8IA 3A3FA 2HP5A 4UA7A 2WKIA 3N4IA 1IKGA 1M6KA 4N9LA 4DXBA 1K57A 4OKPA 1Y54A 2ZQ9A 4DRTA 4QY5A 3GRJA 1ES3A 5EECA 3UPNA 3DWZA 4PPRA 5I94A 3UDIA 2Y2JA 3AGDA 1N9BA 5AQ7A 4DE2A 2WYXA 3HLCA 4MBHA 3HREA 1ONHA 2XQZA 4BD0A 1CI9A 3WWXA 3QNBA 4PM8A 5F82A 1K54C 3TOIA 2ZQCA 1J9MA 2Y2GA 4GN2A 1LLBA 3OPPA 4BQMA 1ESIA 4OOMA 1SDNA 1ZG4A 2Z2MB 3IHBA 4X69A 5EVIA 5FI6A 4EUZA 2Y2LA 5FATA 2OLVA 2XR0A 3D4FA 3MZEA 5M1AA 1GA9A 5EE8A 3QNCA 4LENA 4Q8IA 2V1ZA 5DTKA 3ZNTA 1Z6FA 5FDHA 4E6WA 3Q07A 2G2UA 4QU3A 2BG1A 4NK3A 1ESUA 2WGIA 2WGWA 4WMCA 4ZJ1A 2XFSA 4D2OA 5JYPA 1K4EA 4PM7A 3LY3A 2Q9MA 4PMAA 2I72A 3IWOA 1XA7A 3ZG7B 4KQRA 2EX2A 1XGIA 2J8YA 1RGYA 2IWCA 2Y55A 4QY6A 5U47A 3NCKA 5KMWA 3IXDA 3ITBA 2XK1A 4OQHA 1G6AA 2DRWA 4S2JA 3IWQA 3IH9A 1YLWA 1K38A 5F1GA 4EBPA 4B88A 3MZFA 3O88A 2Y91A 2DCFA 4EQIA 3M2JA 4GDBA 1RCJA 4E3KA 1NY0A 3BFEA 4ZAMA 4CJNA 4KZ8A 2J9PA 1YT4A 3NDGA 4WYYA 1HZOA 2IWBA 3ZG5A 3ZVTA 2WZXA 1PWGA 1QMFA 1K6SA 2P9VA 3IF6B 1YLTA 2QZ6A 2HDSA 2WK0A 2Y2IA 3LY4A 3BLSA 3UY6A 3CG5A 1ES2A 5HAQA 2JC7A 4OPZA 5FQJA 2ZC6B 4Y0UA 5A92A 4S2OA 4BL3A 3WS0A 4P6BA 1IYSA 2Q9NA 2WKHA 3HLDA 3MKEA 5CRFA 3VOZA 3ZG8B 1BZAA 1TVFA 1W8QA 2Y4AA 2XGNA 2Y2OA 2X01A 4ZBEA 1NXYA 3GTCA 5F1FA 1PZPA 3BFCA 1RP5A 3A3IA 3LCEA 5AQBA 4WZ4A 2XFTA 3VP0A 3Q7VB 3VOYA 2JBFA 1BLSA 1N4OA 2XLNA 4KQOA 4Y7PA 3G31A 4DE0A 5HW3A 3V3SA 3WS2A 4EWFA 3C4OA 4X68A 5M18A 3ZFZA 3IWIA 1BULA 1ONGA 4X55A 1GHMA 3RJUA 1YQSA 3PBSA 4JKTA 2OSUA 4OVDA 5HAIA 3SH8A 3HLBA 1W5DA 4S2NA 1YLZA 1O7EA 3C7VA 3CZDA 1H8YA 1U60A 3N7WA 3WS5A 4ZJ3A 2ZJ9A 3V3RA 3G32A 3IF5A 4GOGA 3VFHA 4X53A 5DF7A 3ZG0A 3GSGA 4IVKA 3Q7ZA 4K0WA 1H8ZA 1RGZA 2C6WB 3ISGA 3BFFA 4MBFA 1EI5A 1HTZA 1HD8A 1JWPA 4IEDA 4R3JA 3LO7A 4MLLA 4FH2A 1MWTA 3ZGAB 1GHIA 4XUXA 2R9WA 1W79A 2ZC4B 2JCHA 3AGEA 4HBUA 4CPKA 4PM9A 3BFGA 4WELA 1ZC2A 4LCLA 4GDNA 3S22A 1K54A 3RXWA 1MWSA 2V2FF 2EXAA 1I5QA 1H5XA 3MXSA 5TFQA 5HAPA 4JF5A 4JXGA 4B4ZA 2Y2KA 1CEFA 5CGXA 4E3NA 5J8XA 3OCLA 3G35A 3NBLA 5GHZA 4LV3A 1MKIA 3ZCZA 4M3KA 3IXBA 1ALQA 1MY8A 5CEDA 3OPLA 4IBRA 1BSGA 4LV2A 4OOLA 1ES5A 2V20A 4WBGA 1PYYA 2WUQA 1GA0A 1BLHA 3BRMA 3BYDA 5DF9A 2HPBA 2R9XA 4KG6A 4WZ5C 3NI9A 1BT5A 4N1XA 1KE3A 1CK3A 1XKZA 3UDXA 3Q81A 3BEBA 4L0LA 2Y2NA 3FV7A 4S2KA 3WS4A 1MBLA 2OLUA 1L0DA 1YLPA 5CHUA 1GCEA 4WEKA 2ZM0A 1K4FA 1EROA 3PTEA 1NYMA 3BECA 1HVBA 2Y59A 3MXRA 3C5AA 1FCNA 5KZHA 3HLEA 4IVIA 4JXSA 1YLYA 4MNRA 3E2LA 3VP1A 3VP4A 4OP8A 4RX3A 1AXBA 5E2GA 1M40A 2QMIA 1BTLA 4P85A 4S2PA 4GZBA 2VGJA 3EQUA 1IKIA 4KZ3A 1S6RA 3PBNA 4KG2A 4B4XA 3GR2A 3HLFA 1K57C 1BUEA 3A3JA 1KGFA 2WADA 5FQIA 3VMAA 5FI2A 1ERQA 2Y2HA 3DWKA 5CXWA 5TR7A 4BJPA 4HBTA 1NJ4A 2Y2QA 5EOOA 4OP5A 4C75A 2GDNA 1L2SA 4E6XA 5FSRA 2EX8A 2C5WB 3GQZA 3HLGA 5M19A 1MPLA 5FI7A 5GLDA 4EBNA 3E2KA 1JVJA 1TDGA 4FCFA 3VFFA 1JTGA 3IF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UN7 A;  4HES A;  4K91 A;  3NDE A;  2CC1 A;  4PM5 A;  2XD5 A;  2ZLY A;  4ZTK A;  5EVI C;  5A93 A;  1IEL A;  1L0F A;  2HP9 A;  1LI0 A;  2EX6 A;  5CEB A;  4C3Q A;  3UPP A;  1FSW A;  4R4S A;  3A3D A;  4QD4 A;  3N8R A;  5GHY A;  4OQ0 A;  3BFD A;  1K55 A;  4FH4 A;  1PW8 A;  1GHP A;  2A49 A;  4KZB A;  5KSH A;  1XPB A;  2H0Y A;  3Q7V A;  4KEN B;  4KZ4 A;  3WRZ A;  3HUM A;  4OPR A;  1CEG A;  1YLJ A;  1S0W A;  4E3L A;  4KZ7 A;  4R4R A;  4OLG A;  5BOH A;  1YMS A;  2PU2 A;  4OLD A;  3HUN A;  1XA1 A;  4RVA A;  3M2K A;  3PAG A;  4GNU A;  5CTM A;  4C6Y A;  2WZZ A;  2WGV A;  3FKW A;  1NZU A;  4S2I A;  4KZ9 A;  4N1H A;  1TDL A;  3IHA A;  3RXX A;  5CHJ A;  2RCX A;  5CHM A;  5GL9 A;  2X71 A;  4DKI A;  3O87 A;  5DF8 A;  5JYO A;  3IXG A;  4FD8 A;  4X6T A;  2Y2M A;  4QHC A;  4MEZ A;  4DDY A;  4P0M A;  5HL1 A;  3MFD A;  4OQI A;  5DTT A;  3WS1 A;  2XD1 A;  3SS5 A;  3NC8 A;  1NYY A;  4A5R A;  3GVB A;  4MBK A;  2XH9 A;  4KZA A;  1DY6 A;  4ID4 A;  4WEJ A;  5HAR A;  1KVL A;  4EV4 A;  1DJA A;  3W4O A;  4XUZ A;  1FQG A;  2P74 A;  4OPQ A;  5DTS A;  1PI5 A;  1LHY A;  3PBO A;  2ZQA A;  1PIO A;  1C3B A;  1BLC A;  4OOY A;  1KE0 A;  2ZMA A;  3W4P A;  4OPY A;  4ZJ2 A;  3HLW A;  1SHV A;  3C7U A;  3VSK A;  4RA7 A;  5A90 A;  4X56 A;  4NET A;  1IEM A;  4HEF A;  5D3O A;  3GV9 A;  4E3J A;  3SS4 A;  1LL9 A;  2BLS A;  3TSG A;  3FYZ A;  4E3O A;  5E2F A;  1PWD A;  3Q82 A;  3MZD A;  4GB7 A;  5EOE A;  3V5M A;  1XP4 A;  1KDS A;  1PW1 A;  3WRT A;  4KZ5 A;  4N92 A;  3ZDJ A;  3OPH A;  3GMW A;  5FAO A;  1NZO A;  3MBZ A;  1BLP A;  1JTD A;  4S2N C;  4JF6 A;  4WM9 A;  3LEZ A;  3N8S A;  1FCO A;  3OZH A;  2HDQ A;  1E25 A;  5GHX A;  5CGS A;  3G30 A;  1WYC A;  4UHU A;  4N9K A;  1KGG A;  4PM6 A;  1SDE A;  3SS3 A;  4R1G A;  5HX9 A;  2FFF B;  5EPH A;  3PAE A;  4BEN A;  3P98 A;  3O86 A;  3CJM A;  1FR6 A;  1L0G A;  1ERM A;  2ZQ8 A;  5GLC A;  1KE4 A;  2WAE A;  3B3X A;  1FSY A;  3N8L A;  1MXO A;  4UA9 A;  5DVA A;  3M6H A;  3V50 A;  2QPN A;  4KQQ A;  4JBF A;  3V39 A;  3HVF A;  1K6R A;  4R0Q A;  2UWX A;  3ZVW A;  2H10 A;  1IYP A;  5G18 A;  5FQ9 A;  3I7J A;  1K56 D;  2PU4 A;  3A3E A;  2J9O A;  3OPR A;  3IH8 A;  2G2W A;  1E3U D;  1FCM A;  3QHY A;  5E2E A;  3PBQ A;  1VM1 A;  2XF3 A;  5E2H A;  1WYB A;  1ZKJ A;  1SKF A;  4Z9Q A;  4DE3 A;  5EVI B;  2HP6 A;  5FQQ A;  3S1Y A;  4DE1 A;  1LI9 A;  4LV0 A;  4O7D A;  3IT9 A;  1L0E A;  4XXR A;  4UA6 A;  3W8K A;  2ZC5 B;  3VSL A;  2H0T A;  5CTN A;  4JXW A;  1KGE A;  4LCM A;  4U0T A;  4OON A;  3ZG9 B;  2VGK A;  2B5R A;  1LL5 A;  1JWZ A;  1WE4 A;  2ZQD A;  3SOI A;  4S2L A;  1DJB A;  2ZM8 A;  3HUO A;  4OQG A;  4U0X A;  5A91 A;  2WGW B;  5EUA A;  5FAS A;  2XEP A;  4LV1 A;  1KDW A;  2EXB A;  1PI4 A;  3UE0 A;  2ZD8 A;  3G2Z A;  3G2Y A;  5HFO A;  1XGJ A;  4KG5 A;  3HBR A;  2HDU A;  4YIN A;  5FA7 A;  4E3M A;  1E4D A;  1ZG6 A;  3CMZ A;  2HDR A;  3G4P A;  3ITA A;  3FKV A;  4JPM A;  3UO9 A;  2WKE A;  4OH0 A;  1IYQ A;  1W7F A;  4DF6 A;  2ZQ7 A;  3O3V A;  4R3B A;  4EBL A;  3UE3 A;  5FQK A;  5CER A;  3M6B A;  3OCN A;  2J7V A;  2ZC7 A;  3FWL A;  2JE5 A;  4QB8 A;  1K25 A;  1W8Y A;  4QJG A;  1Q2Q A;  3EQV A;  1Q2P A;  2X02 A;  4UAA A;  1ES4 A;  1OME A;  4JF4 A;  2EFU A;  3IQA A;  3BM6 A;  2P9V B;  1MWR A;  3FZC A;  3ZHH A;  5FQM A;  4DDS A;  3SH9 A;  1PZO A;  2EX9 A;  4GD6 A;  4DXC A;  2RL3 A;  5CEC A;  5EVI D;  1FOF A;  2A3U A;  4ZDX A;  1QME A;  4E3I A;  2Z2L B;  3UPO A;  4JXV A;  4Y0T A;  3DTM A;  4GD8 A;  1I2S A;  4S2M A;  3UNW A;  1PWC A;  3UDF A;  3Q1F A;  3NIA A;  3PBR A;  1DJC A;  5GLB A;  4F94 A;  1G68 A;  3IF6 C;  2IWD A;  4YFM A;  2ZM2 A;  1K56 A;  5FAQ A;  3C4P A;  2H5S A;  4JLF A;  3TG9 A;  5F83 A;  3P09 A;  1E3U A;  2PBY A;  4WMC D;  3HL9 A;  3PBT A;  1SCW A;  5L2F A;  3JYI A;  5FAP A;  3NY4 A;  3DW0 A;  1IYO A;  2Y2P A;  4WZ5 A;  1NRF A;  1TEM A;  3G34 A;  5AQ9 A;  3W4Q A;  1YM1 A;  1K55 C;  4GKU A;  1XXM A;  2WAF A;  4K0X A;  1FR1 A;  3S4X A;  3UE1 A;  4BD1 A;  5GLA A;  5AQA A;  3OC2 A;  2XDM A;  3N6I A;  4Y0O A;  4H8R A;  4RX2 A;  4IBX A;  4RYE A;  3BLM A;  3VP3 A;  1JWV A;  2ZC3 B;  1VQQ A;  2DNS A;  5IHV A;  2EFX A;  2FFY A;  2OV5 A;  1MWU A;  5EVL A;  4BLM A;  1KVM A;  4BL2 A;  5E43 A;  3AGF A;  1O07 A;  1YMX A;  5KSC A;  4R23 A;  1XX2 A;  4KZ6 A;  4U3T A;  3ZNY A;  5CGW A;  3SH7 A;  1CI8 A;  1I2W A;  1EWZ A;  3IXH A;  3MKF A;  5TGF A;  4P87 A;  3VP2 A;  4FSF A;  2E8I A;  3A3F A;  2HP5 A;  4UA7 A;  2WKI A;  3N4I A;  1IKG A;  1M6K A;  4N9L A;  4DXB A;  1K57 A;  4OKP A;  1Y54 A;  2ZQ9 A;  4DRT A;  4QY5 A;  3GRJ A;  1ES3 A;  5EEC A;  3UPN A;  3DWZ A;  4PPR A;  5I94 A;  3UDI A;  2Y2J A;  3AGD A;  1N9B A;  5AQ7 A;  4DE2 A;  2WYX A;  3HLC A;  4MBH A;  3HRE A;  1ONH A;  2XQZ A;  4BD0 A;  1CI9 A;  3WWX A;  3QNB A;  4PM8 A;  5F82 A;  1K54 C;  3TOI A;  2ZQC A;  1J9M A;  2Y2G A;  4GN2 A;  1LLB A;  3OPP A;  4BQM A;  1ESI A;  4OOM A;  1SDN A;  1ZG4 A;  2Z2M B;  3IHB A;  4X69 A;  5EVI A;  5FI6 A;  4EUZ A;  2Y2L A;  5FAT A;  2OLV A;  2XR0 A;  3D4F A;  3MZE A;  5M1A A;  1GA9 A;  5EE8 A;  3QNC A;  4LEN A;  4Q8I A;  2V1Z A;  5DTK A;  3ZNT A;  1Z6F A;  5FDH A;  4E6W A;  3Q07 A;  2G2U A;  4QU3 A;  2BG1 A;  4NK3 A;  1ESU A;  2WGI A;  2WGW A;  4WMC A;  4ZJ1 A;  2XFS A;  4D2O A;  5JYP A;  1K4E A;  4PM7 A;  3LY3 A;  2Q9M A;  4PMA A;  2I72 A;  3IWO A;  1XA7 A;  3ZG7 B;  4KQR A;  2EX2 A;  1XGI A;  2J8Y A;  1RGY A;  2IWC A;  2Y55 A;  4QY6 A;  5U47 A;  3NCK A;  5KMW A;  3IXD A;  3ITB A;  2XK1 A;  4OQH A;  1G6A A;  2DRW A;  4S2J A;  3IWQ A;  3IH9 A;  1YLW A;  1K38 A;  5F1G A;  4EBP A;  4B88 A;  3MZF A;  3O88 A;  2Y91 A;  2DCF A;  4EQI A;  3M2J A;  4GDB A;  1RCJ A;  4E3K A;  1NY0 A;  3BFE A;  4ZAM A;  4CJN A;  4KZ8 A;  2J9P A;  1YT4 A;  3NDG A;  4WYY A;  1HZO A;  2IWB A;  3ZG5 A;  3ZVT A;  2WZX A;  1PWG A;  1QMF A;  1K6S A;  2P9V A;  3IF6 B;  1YLT A;  2QZ6 A;  2HDS A;  2WK0 A;  2Y2I A;  3LY4 A;  3BLS A;  3UY6 A;  3CG5 A;  1ES2 A;  5HAQ A;  2JC7 A;  4OPZ A;  5FQJ A;  2ZC6 B;  4Y0U A;  5A92 A;  4S2O A;  4BL3 A;  3WS0 A;  4P6B A;  1IYS A;  2Q9N A;  2WKH A;  3HLD A;  3MKE A;  5CRF A;  3VOZ A;  3ZG8 B;  1BZA A;  1TVF A;  1W8Q A;  2Y4A A;  2XGN A;  2Y2O A;  2X01 A;  4ZBE A;  1NXY A;  3GTC A;  5F1F A;  1PZP A;  3BFC A;  1RP5 A;  3A3I A;  3LCE A;  5AQB A;  4WZ4 A;  2XFT A;  3VP0 A;  3Q7V B;  3VOY A;  2JBF A;  1BLS A;  1N4O A;  2XLN A;  4KQO A;  4Y7P A;  3G31 A;  4DE0 A;  5HW3 A;  3V3S A;  3WS2 A;  4EWF A;  3C4O A;  4X68 A;  5M18 A;  3ZFZ A;  3IWI A;  1BUL A;  1ONG A;  4X55 A;  1GHM A;  3RJU A;  1YQS A;  3PBS A;  4JKT A;  2OSU A;  4OVD A;  5HAI A;  3SH8 A;  3HLB A;  1W5D A;  4S2N A;  1YLZ A;  1O7E A;  3C7V A;  3CZD A;  1H8Y A;  1U60 A;  3N7W A;  3WS5 A;  4ZJ3 A;  2ZJ9 A;  3V3R A;  3G32 A;  3IF5 A;  4GOG A;  3VFH A;  4X53 A;  5DF7 A;  3ZG0 A;  3GSG A;  4IVK A;  3Q7Z A;  4K0W A;  1H8Z A;  1RGZ A;  2C6W B;  3ISG A;  3BFF A;  4MBF A;  1EI5 A;  1HTZ A;  1HD8 A;  1JWP A;  4IED A;  4R3J A;  3LO7 A;  4MLL A;  4FH2 A;  1MWT A;  3ZGA B;  1GHI A;  4XUX A;  2R9W A;  1W79 A;  2ZC4 B;  2JCH A;  3AGE A;  4HBU A;  4CPK A;  4PM9 A;  3BFG A;  4WEL A;  1ZC2 A;  4LCL A;  4GDN A;  3S22 A;  1K54 A;  3RXW A;  1MWS A;  2V2F F;  2EXA A;  1I5Q A;  1H5X A;  3MXS A;  5TFQ A;  5HAP A;  4JF5 A;  4JXG A;  4B4Z A;  2Y2K A;  1CEF A;  5CGX A;  4E3N A;  5J8X A;  3OCL A;  3G35 A;  3NBL A;  5GHZ A;  4LV3 A;  1MKI A;  3ZCZ A;  4M3K A;  3IXB A;  1ALQ A;  1MY8 A;  5CED A;  3OPL A;  4IBR A;  1BSG A;  4LV2 A;  4OOL A;  1ES5 A;  2V20 A;  4WBG A;  1PYY A;  2WUQ A;  1GA0 A;  1BLH A;  3BRM A;  3BYD A;  5DF9 A;  2HPB A;  2R9X A;  4KG6 A;  4WZ5 C;  3NI9 A;  1BT5 A;  4N1X A;  1KE3 A;  1CK3 A;  1XKZ A;  3UDX A;  3Q81 A;  3BEB A;  4L0L A;  2Y2N A;  3FV7 A;  4S2K A;  3WS4 A;  1MBL A;  2OLU A;  1L0D A;  1YLP A;  5CHU A;  1GCE A;  4WEK A;  2ZM0 A;  1K4F A;  1ERO A;  3PTE A;  1NYM A;  3BEC A;  1HVB A;  2Y59 A;  3MXR A;  3C5A A;  1FCN A;  5KZH A;  3HLE A;  4IVI A;  4JXS A;  1YLY A;  4MNR A;  3E2L A;  3VP1 A;  3VP4 A;  4OP8 A;  4RX3 A;  1AXB A;  5E2G A;  1M40 A;  2QMI A;  1BTL A;  4P85 A;  4S2P A;  4GZB A;  2VGJ A;  3EQU A;  1IKI A;  4KZ3 A;  1S6R A;  3PBN A;  4KG2 A;  4B4X A;  3GR2 A;  3HLF A;  1K57 C;  1BUE A;  3A3J A;  1KGF A;  2WAD A;  5FQI A;  3VMA A;  5FI2 A;  1ERQ A;  2Y2H A;  3DWK A;  5CXW A;  5TR7 A;  4BJP A;  4HBT A;  1NJ4 A;  2Y2Q A;  5EOO A;  4OP5 A;  4C75 A;  2GDN A;  1L2S A;  4E6X A;  5FSR A;  2EX8 A;  2C5W B;  3GQZ A;  3HLG A;  5M19 A;  1MPL A;  5FI7 A;  5GLD A;  4EBN A;  3E2K A;  1JVJ A;  1TDG A;  4FCF A;  3VFF A;  1JTG A;  3IF6 A; 
#chains in the Genus database with same CATH topology
 3UN7 A;  4K91 A;  5AVF A;  4PM5 A;  2XD5 A;  3U4L P;  2HP9 A;  4C3Q A;  4R4S A;  4QD4 A;  1XJ4 A;  3R7W A;  3BFD A;  3L9K A;  1PW8 A;  4ME4 A;  4KEN B;  2PBD P;  3HUM A;  4C6Y A;  4RVA A;  5CTM A;  3M2K A;  4GNU A;  4X1M A;  3O5Y A;  3FKW A;  1NZU A;  2GX5 A;  2VK3 A;  5EM0 A;  4F3L A;  3IHA A;  3T12 B;  2W1T A;  2RCX A;  5GL9 A;  2X71 A;  1D1J A;  2VZW A;  4P0M A;  5HL1 A;  3MFD A;  2XD1 A;  2HV1 A;  3SS5 A;  1NYY A;  3GVB A;  2FH5 A;  5HAR A;  1DY6 A;  3LID A;  1GSX A;  3BWL A;  3W4O A;  4XUZ A;  2P74 A;  5DTS A;  1PI5 A;  3HJK A;  1Y4O A;  3CIT A;  1BLC A;  4ZJ2 A;  3HLW A;  4NXG A;  3VSK A;  4RA7 A;  4NET A;  3GV9 A;  2JKT M;  1LL9 A;  2BLS A;  3TSG A;  3FYZ A;  1K0K A;  4GB7 A;  3MZD A;  2PRF A;  1XP4 A;  3LEQ A;  2EWV A;  1JTD A;  2V0U A;  3OZH A;  3QP8 A;  5FL3 A;  1ZTU A;  3G30 A;  4UHU A;  4N9K A;  1SDE A;  4R1G A;  2FFF B;  4NXE A;  3CJM A;  1L0G A;  3W2Z A;  5GLC A;  2GZA A;  1MXO A;  1IOU A;  1K6R A;  2QHK A;  3QP5 A;  2O0Y A;  5FQ9 A;  3I7J A;  3KYZ A;  5HPF A;  3IH8 A;  3PBQ A;  4L9E A;  1WYB A;  1SKF A;  2Y79 A;  1XJ3 A;  3IT9 A;  4BBV A;  4U0T A;  4R70 A;  2B5R A;  4LLO B;  2JKR M;  2YKF A;  3IBR A;  3QP2 A;  3HUO A;  4U0X A;  5C5K A;  5F69 A;  4WL9 A;  4LV1 A;  2EXB A;  1X0O A;  2ZD8 A;  3G2Z A;  1W63 Q;  3LIE A;  3OLO A;  2A2L A;  4PAU A;  5HFO A;  5KIZ A;  3HBR A;  2HDU A;  4KUK A;  3VE4 A;  3G4P A;  2EA9 A;  1ODV A;  2JKT I;  2WKE A;  4OH0 A;  3T50 A;  4DF6 A;  4EBL A;  3T4L A;  4HY8 A;  2ZC7 A;  4LGW A;  4L9G A;  4QB8 A;  1K25 A;  2PR6 A;  3H7W A;  2J3T D;  4NEE D;  4WUJ A;  1MWR A;  5FQM A;  4R38 A;  3CPT A;  4GD6 A;  1N9O A;  1FOF A;  4HH3 A;  4GD8 A;  1I2S A;  3UDF A;  3CUE C;  3IS2 B;  1DJC A;  4F94 A;  3IF6 C;  2OWJ A;  2IWD A;  3F1N B;  1F9I A;  1K56 A;  5FAQ A;  4WMC D;  1FIL A;  3JYI A;  5FAP A;  3VOL A;  3KSG A;  3NY4 A;  3DW0 A;  3G34 A;  3W4Q A;  5GLA A;  3G6O A;  5FDS A;  2ZC3 B;  1VQQ A;  5EVL A;  4QPR A;  1O07 A;  1YMX A;  2QKP A;  1XX2 A;  3IXH A;  3B33 A;  1M6K A;  4GHI B;  4N9L A;  4DRT A;  2ZQ9 A;  3CLO A;  5EEC A;  4IJG A;  4PPR A;  5DFY A;  3JVV A;  5AQ7 A;  4DE2 A;  3NJA A;  1ONH A;  2XQZ A;  4BD0 A;  1J3W A;  3TOI A;  2Y2G A;  3LIB A;  4PHT A;  3BQA A;  1SDN A;  2L1M A;  3IHB A;  4II7 A;  5FI6 A;  2V8C A;  2XR0 A;  1GA9 A;  5EE8 A;  3QNC A;  4E6W A;  3Q07 A;  3E98 A;  2WGW A;  1TS8 A;  4ZJ1 A;  1NLY A;  3UB9 A;  3LY3 A;  1LT0 A;  4PMA A;  2W3F A;  1SKO B;  3LR5 A;  4KQR A;  2Y55 A;  5U47 A;  1RGY A;  2IWC A;  3T4J A;  3BY9 A;  1XJ2 A;  3IXD A;  3ITB A;  2XK1 A;  4S2J A;  1YLW A;  4EBP A;  2Y91 A;  5A8B A;  4EQI A;  1RCJ A;  4E3K A;  1YT4 A;  1YLT A;  2QZ6 A;  2HDS A;  3BLS A;  3UY6 A;  4AFI A;  1ES2 A;  2ZC6 B;  4Y0U A;  2ZOI A;  4BL3 A;  3VOZ A;  5CRF A;  5DFX A;  1TVF A;  2XGN A;  2Y2O A;  4QWO A;  1NXY A;  3GTC A;  5F1F A;  1RP5 A;  5AQB A;  3VP0 A;  2XFT A;  3Q7V B;  1BLS A;  4KQO A;  4Y7P A;  3G31 A;  1BUL A;  4X55 A;  1GHM A;  3RJU A;  1NWZ A;  1OJ5 A;  3SH8 A;  1YLZ A;  2W3H A;  1O7E A;  5IT5 A;  1YSP A;  1P9W A;  2ZJ9 A;  2HGV A;  3IF5 A;  4YWZ A;  4X53 A;  4IVK A;  3S7Q A;  3Q7Z A;  2W1R A;  4HP9 A;  4KUO A;  1JWP A;  1MKM A;  3C38 A;  2ZC4 B;  4HBU A;  2JCH A;  3BFG A;  3T4T A;  4EES A;  4LCL A;  4GDN A;  5DJU A;  1T1B A;  2V2F F;  5EV0 A;  2WKQ A;  4JF5 A;  1CEF A;  3NUL A;  4IHQ A;  3ICY A;  3G35 A;  3PHY A;  1BSG A;  5EVE A;  1GA0 A;  5DF9 A;  4BMW A;  2R9X A;  1BT5 A;  1KE3 A;  1XKZ A;  3Q81 A;  2Y2N A;  4S2K A;  4MN5 A;  1GCE A;  1NYM A;  3BEC A;  3MXR A;  1T18 A;  4OP8 A;  4GCZ A;  4KZ3 A;  2WAD A;  1PRQ A;  5FI2 A;  5CXW A;  4BJP A;  3F1P A;  2GDN A;  4E6X A;  5M19 A;  5FI7 A;  2J3T C;  4FCF A;  1JTG A;  2B18 A;  3NDE A;  3KSI A;  3IX4 A;  4ZTK A;  1D06 A;  3F1O A;  3UPP A;  3A3D A;  2IA2 A;  4OQ0 A;  4B9O A;  2WKR A;  1K55 A;  2JKF A;  3EGD C;  3WRZ A;  4OPR A;  3NEC A;  4KZ7 A;  4OLG A;  1ACF A;  1YMS A;  3OBF A;  1S67 L;  3E4O A;  4KZ9 A;  2M7U A;  5CHJ A;  3NHQ A;  4MN7 A;  2QJ7 A;  4FD8 A;  4NXF A;  1VB6 A;  4DDY A;  5DTT A;  3WS1 A;  2O9C A;  3SW1 A;  5HWT A;  1YAX A;  4KZA A;  4WEJ A;  1KVL A;  1MC0 A;  4FTX A;  1FQG A;  4DJ2 A;  2KOI A;  4OPQ A;  3H82 A;  2V8F A;  2ZQA A;  4P6Z S;  4LPZ A;  2A24 B;  3FG8 A;  1KE0 A;  4OPY A;  3MSH A;  5I5L A;  5IU1 A;  2ZMF A;  3S7N A;  1SHV A;  1TS7 A;  3MQO A;  1SZV A;  3SS4 A;  3KSF A;  3Q82 A;  5LBR A;  2VEA A;  1OJG A;  2W3D A;  4N92 A;  3OPH A;  4Q0I A;  1NZO A;  3MBZ A;  1BLP A;  4FOF A;  3N8S A;  5GHX A;  3TE8 A;  5CGS A;  4Y17 A;  4PM6 A;  5EPH A;  4BEN A;  2L4R A;  1TD5 A;  3P98 A;  1FR6 A;  1KE4 A;  2W0N A;  3N8L A;  5DVA A;  2JN7 A;  5HWV A;  3V39 A;  3HVF A;  4Z1W A;  3ULF A;  2UWX A;  2VKS A;  2PU4 A;  1E3U D;  2V1A A;  5E2E A;  4CLC A;  2XF3 A;  3LYX A;  4GS9 A;  5EVI B;  2HP6 A;  2PYR A;  5FQQ A;  3LI9 A;  2J80 A;  4X1L A;  2QJ5 A;  4I5S A;  4LCM A;  4OON A;  2VGK A;  1D7E A;  1JWZ A;  1WE4 A;  4OQG A;  5A91 A;  2B02 A;  1PI4 A;  1XGJ A;  4E3M A;  1E4D A;  1WA9 A;  3FKV A;  4XT2 B;  1IYQ A;  5F68 A;  5CER A;  3M6B A;  2J7V A;  4D60 A;  3FWL A;  4UAA A;  1OME A;  2EFU A;  2M1C A;  2P9V B;  3E0Y A;  2BTF P;  2EX9 A;  2EWW A;  2RL3 A;  4ZRR A;  5HSQ A;  5EVI D;  4JGR A;  2A3U A;  4PKY G;  1QME A;  1VEU B;  2Z2L B;  3UPO A;  4S2M A;  3UNW A;  1PWC A;  3NIA A;  3PBR A;  3MS6 A;  4HOI A;  3C4P A;  1OT9 A;  3TG9 A;  5F83 A;  4I3A A;  5L2F A;  1IYO A;  1H3Q A;  2Y2P A;  4WZ5 A;  5AQ9 A;  1P97 A;  4GKU A;  1XXM A;  3UE1 A;  1DP9 A;  1FR1 A;  4Y0O A;  4RX2 A;  4H6J B;  2VLG A;  3T4Q A;  1MZU A;  1JWV A;  1GSV A;  5IHV A;  2EFX A;  2OV5 A;  4JGO A;  2NUT C;  3KX0 X;  4U3T A;  5CGW A;  1CI8 A;  3LIA A;  1Z09 A;  4FSF A;  4UA7 A;  1IKG A;  5AJG A;  4OKP A;  2P08 A;  3GRJ A;  3DWZ A;  5I94 A;  4MCW A;  2VV7 A;  2Y2J A;  1VET B;  5DKL A;  2WYX A;  4MBH A;  1G5U A;  3HRE A;  3WWX A;  1HLU P;  5F82 A;  3OPP A;  3ZYT A;  1ESI A;  1ZG4 A;  2Z2M B;  2ZL1 A;  4HH2 A;  5IS1 A;  3HJI A;  5FAT A;  2OLV A;  5HD3 A;  1PFL A;  2PR5 A;  2QYB A;  2V1Z A;  2Q0O A;  1Z6F A;  1NRJ A;  1N9L A;  2OWH A;  2BG1 A;  2WGI A;  2XFS A;  1LSV A;  1UGU A;  3E4Q A;  2AVX A;  1XA7 A;  1LSW A;  2EX2 A;  2J8Y A;  5KMW A;  2Z6C A;  4OQH A;  1G6A A;  4ARZ A;  2DRW A;  3IWQ A;  3O88 A;  3D72 A;  4MMN A;  4WYY A;  1HZO A;  4HJ3 A;  1PWG A;  2MJ6 A;  2WK0 A;  3B42 A;  3MQQ A;  3WS0 A;  4P6B A;  2Q9N A;  3ZG8 B;  1W8Q A;  1UWN X;  3A0R A;  3VOY A;  2JBF A;  5HW3 A;  3V3S A;  3WS2 A;  4ESP A;  1ONG A;  3A0S A;  2KDK A;  3PBS A;  3HLB A;  4F3L B;  4CLC D;  1S4R A;  2W1T B;  3G32 A;  3VFH A;  3GSG A;  4O8G A;  4MBF A;  1HTZ A;  3LO7 A;  4MLL A;  4FH2 A;  5DKK A;  2R9W A;  1W79 A;  3JPU A;  2R78 A;  1TF1 A;  4UEY A;  3S22 A;  1MWS A;  4FUW A;  1H5X A;  3L7H A;  4B4Z A;  1Y28 A;  3OCL A;  3NBL A;  4LV3 A;  3IX3 A;  2UV0 E;  3ZCZ A;  5J7E A;  5HDS A;  1MY8 A;  3OPL A;  4LV2 A;  1PYY A;  2B95 A;  3BYD A;  4KG6 A;  3NI9 A;  3LI8 A;  3MJQ A;  3UDX A;  3BEB A;  4IUH A;  1DP6 A;  4PKY A;  1ERO A;  3PTE A;  1HVB A;  3HLE A;  4IVI A;  4JXS A;  1YLY A;  1M40 A;  3UB5 P;  4KG2 A;  4B4X A;  1K57 C;  1BUE A;  5FQI A;  1DP8 A;  3DWK A;  4NXB A;  4HBT A;  3OOV A;  3IX8 A;  4OP5 A;  5FSR A;  2EX8 A;  2C5W B;  3GQZ A;  3HLG A;  3D3O A;  2XA7 S;  2VGL S;  2Y8H A;  5GLD A;  3CUE A;  1TDG A;  3IF6 A;  4GJ4 A;  4HES A;  2ZLY A;  5L8M A;  5EVI C;  1IEL A;  2EX6 A;  5CEB A;  1FSW A;  5TBM A;  3N8R A;  2BAS A;  4HHD A;  5GHY A;  1GHP A;  4KZB A;  5KSH A;  1XPB A;  2H0Y A;  4KZ4 A;  2NUP C;  2E8J A;  4KQD A;  1YLJ A;  1S0W A;  4R4R A;  5BOH A;  1DRM A;  2PU2 A;  3HUN A;  2WZZ A;  3DTI A;  1AWI A;  3H7W B;  4N1H A;  1TDL A;  4DKI A;  3O87 A;  5L09 A;  2G7U A;  5JYO A;  3IXG A;  2XSS A;  4QHC A;  4MEZ A;  4HI4 A;  4OQI A;  3NC8 A;  2XH9 A;  1TS6 A;  4EV4 A;  1DJA A;  3QP6 A;  4G3V A;  4B93 A;  4JGQ A;  2QWS A;  4OOY A;  3W4P A;  3C7U A;  2ACG A;  5A90 A;  4X56 A;  4UQI S;  3T1S A;  4EU0 A;  1KOU A;  4E3J A;  3NOU C;  1V9Y A;  4E3O A;  5EOE A;  1KDS A;  1PW1 A;  3WRT A;  3ZDJ A;  3UMD A;  4I38 A;  4HQA A;  4S2N C;  3P7N A;  4WM9 A;  4HP4 A;  2HDQ A;  1YKD A;  1WYC A;  1KGG A;  2HJE A;  4O01 A;  1FSY A;  4UA9 A;  2QPN A;  4KQQ A;  3T1R A;  4JBF A;  4R0Q A;  4WLA A;  1IYP A;  4CQH A;  1K56 D;  3A3E A;  3OPR A;  2G2W A;  3GEC A;  2O99 A;  4DE3 A;  3S1Y A;  4R6L A;  4DE1 A;  1LI9 A;  5FEF A;  2LB5 A;  4XXR A;  4UA6 A;  3W8K A;  2ZC5 B;  2H0T A;  3LGO A;  4G3K A;  4JXW A;  1KGE A;  3ZG9 B;  1LL5 A;  3SOI A;  2ZQD A;  4S2L A;  2ZM8 A;  1S4S A;  2WGW B;  5EUA A;  5FAS A;  1KDW A;  3DTK A;  3UE0 A;  4KG5 A;  4YIN A;  3IBJ A;  3ITA A;  1N9N A;  1W7F A;  2ZQ7 A;  3O3V A;  3TJZ C;  4LRX C;  3UE3 A;  2W27 A;  3OCN A;  1OPX A;  2JE5 A;  3DBA A;  1CF0 A;  4QJG A;  1Q2Q A;  3EQV A;  1Q2P A;  5TJJ A;  2X02 A;  3MXQ A;  4JF4 A;  2P04 A;  3FZC A;  3ZHH A;  4RQ9 A;  1XFN A;  4DXC A;  3UME A;  4HNB A;  3LR0 A;  3DTM A;  4JXV A;  4Y0T A;  3Q1F A;  2ZOH A;  5J4E A;  4YFM A;  2ZM2 A;  2PBY A;  3HL9 A;  3PBT A;  3P01 A;  1TEM A;  1YM1 A;  2WAF A;  4K0X A;  4BD1 A;  5AQA A;  4EEU A;  3K3D A;  2K2N A;  4RYE A;  3VP3 A;  2DNS A;  2FFY A;  1MWU A;  4BLM A;  5KSC A;  4R23 A;  4KZ6 A;  3ZNY A;  3RH8 B;  5HPI A;  3SH7 A;  1I2W A;  1EWZ A;  5CX7 A;  3MKF A;  5G4Z A;  4YOF A;  1STZ A;  3T4S A;  3VP2 A;  3A3F A;  3N4I A;  3U2A A;  4DXB A;  3BY8 A;  1OTA A;  1Y54 A;  1ES3 A;  3UPN A;  3UDI A;  1N9B A;  3KYE A;  3HLC A;  1G6O A;  3D9Y A;  2OAP 1;  3TW8 A;  2HJ9 C;  4EEP A;  2VV8 A;  1K54 C;  2ZQC A;  1J9M A;  1LLB A;  4I3J A;  5F6A A;  5HWW A;  4X69 A;  3MR0 A;  2Y2L A;  3D4F A;  3MZE A;  5M1A A;  3NOT C;  4LEN A;  4Q8I A;  3FPV A;  5DTK A;  5FDH A;  2KX6 A;  5HZH A;  3LR4 A;  5HDD A;  5HL6 A;  1T1A A;  4NG2 A;  4NK3 A;  4WMC A;  2PHY A;  4D2O A;  5JYP A;  1K4E A;  4PM7 A;  3IWO A;  1XGI A;  3ZQ5 A;  3NCK A;  5HD5 A;  2D01 A;  3IH9 A;  5F1G A;  5L10 A;  3F1P B;  3MZF A;  2DCF A;  3M2J A;  3NOP C;  3BFE A;  4KZ8 A;  3ZG5 A;  3ZVT A;  2WZX A;  1K6S A;  2P7J A;  2Y2I A;  3KYQ A;  3CG5 A;  4OPZ A;  5FQJ A;  5L07 A;  2HZ5 A;  4S2O A;  2M7V A;  3F1O B;  1IYS A;  3LFV A;  2WKH A;  3MKE A;  1BZA A;  2X01 A;  4ZBE A;  3IS2 A;  3BFC A;  3LCE A;  3E4P A;  3UB8 A;  2W3G A;  3F1N A;  4DE0 A;  3B47 A;  4EWF A;  5K5B A;  5M18 A;  3ZFZ A;  4EER A;  2OAQ 1;  4JKT A;  5HAI A;  4OVD A;  3S7O A;  3C7V A;  3N7W A;  1U60 A;  3WS5 A;  4ZJ3 A;  2VV6 A;  5DF7 A;  2YKH A;  3BFF A;  1EI5 A;  1HD8 A;  4Q0J A;  2H28 A;  2GJ3 A;  1MWT A;  3ZGA B;  4IUK A;  3AGE A;  1ZC2 A;  1K54 A;  1I5Q A;  5TFQ A;  3H9W A;  5HAP A;  1XJ6 A;  3H82 B;  3HCY A;  4GHI A;  2VJW A;  3PYP A;  1G28 A;  1A0K A;  4WF0 A;  5GHZ A;  3LIF A;  2PDR A;  1MKI A;  4M3K A;  5CED A;  2K31 A;  2OOL A;  2V0W A;  4OOL A;  3LUQ A;  1OTB A;  5F5Y A;  3BRM A;  2HPB A;  4N1X A;  2ZBB A;  3FV7 A;  4X25 A;  1CJF A;  3MF0 A;  4BWI A;  1YSQ A;  2PD8 A;  1L0D A;  1YLP A;  5CHU A;  2ZM0 A;  1FCN A;  3SZT A;  4MNR A;  3E2L A;  4E04 A;  2D02 A;  4RX3 A;  1AXB A;  1SKO A;  1F98 A;  5E2G A;  2QMI A;  1BTL A;  4P85 A;  4S2P A;  5EM1 A;  4GZB A;  2VGJ A;  3EQU A;  4LRZ E;  1V9Z A;  1S6R A;  3GR2 A;  3HLF A;  3A3J A;  1P0Z A;  3VMA A;  4CLC B;  1ERQ A;  4GS9 B;  2JKG A;  5TR7 A;  2Y2Q A;  4DMZ A;  2V9A A;  3JVU A;  1GSW A;  3EOI A;  2CC1 A;  5A93 A;  1L0F A;  2JHE A;  1LI0 A;  4R3A A;  4FH4 A;  2A49 A;  1TS0 A;  2XA7 M;  3Q7V A;  2VGL M;  3R7W B;  3K2N A;  4E3L A;  1CEG A;  3UB6 A;  4ETZ A;  4OLD A;  1XA1 A;  3PAG A;  3R4K A;  2VA0 A;  2WGV A;  4S2I A;  1LSX A;  5J3W A;  3RXX A;  5CHM A;  3PR6 A;  5DF8 A;  1YPR A;  4X6T A;  1NLZ A;  2Y2M A;  4A5R A;  4MBK A;  4ID4 A;  2DMW A;  3V67 A;  3K3C A;  1LHY A;  3PBO A;  1PIO A;  1C3B A;  3KO6 A;  1F2K A;  3RTY A;  2ZMA A;  3UE6 A;  4YNR A;  1IEM A;  4HEF A;  5D3O A;  3PXP A;  2JKR I;  3TRC A;  4Y3I A;  5E2F A;  1PWD A;  3V5M A;  4KZ5 A;  4HJ4 A;  3GMW A;  5FAO A;  4JF6 A;  3LEZ A;  1FCO A;  1E25 A;  2VX8 A;  3SS3 A;  5HX9 A;  1T1C A;  4UQI M;  3PAE A;  3O86 A;  1ERM A;  2ZQ8 A;  4DN0 A;  3MQ0 A;  2WAE A;  3B3X A;  3M6H A;  3V50 A;  3ZVW A;  2H10 A;  2INW A;  5G18 A;  3BJN A;  2J9O A;  4BBU A;  1FCM A;  3QHY A;  4BBT A;  1VM1 A;  4K08 A;  5E2H A;  1ZKJ A;  3CWF A;  3MMH A;  4Z9Q A;  2ZL1 B;  4GLQ A;  3DTE A;  4LV0 A;  4O7D A;  1L0E A;  4CLC E;  1W63 M;  3VSL A;  5CTN A;  4EW7 A;  1DJB A;  2XEP A;  3G2Y A;  3T4K A;  5FA7 A;  1ZG6 A;  4JPM A;  3CMZ A;  2HDR A;  3UO9 A;  1L3L A;  3C2W A;  3C30 A;  4ARZ B;  4R3B A;  5FQK A;  4JGP A;  4EQ1 A;  3RFB A;  1W8Y A;  2KLI A;  1OT6 A;  4M4X A;  1BYW A;  1ES4 A;  3IQA A;  3BM6 A;  1OTE A;  2K7S A;  1ZHH B;  4DDS A;  3SH9 A;  1PZO A;  2L0W A;  5CEC A;  3BQ8 A;  4ZDX A;  4Y2F A;  3CPT B;  4E3I A;  2FZ0 A;  5GLB A;  1VHM A;  1G68 A;  1OTI A;  3C8C A;  2H5S A;  4JLF A;  3P09 A;  1E3U A;  1SCW A;  4Y13 A;  1IFQ A;  2A24 A;  1NRF A;  4MN6 A;  1K55 C;  3S4X A;  2PYP A;  1S1Y A;  5DJT A;  5HDC A;  3OC2 A;  2XDM A;  3N6I A;  2PT7 A;  4H8R A;  1LL8 A;  4IBX A;  4EET B;  3BLM A;  3EGX C;  1JNU A;  3A0V A;  1KVM A;  4I3I A;  4Y15 A;  4BL2 A;  5E43 A;  1T19 A;  3AGF A;  2ZMV A;  5G4Y A;  3VV4 A;  5TGF A;  4P6Z M;  2V1B A;  4P87 A;  2E8I A;  2HP5 A;  2WKI A;  1K57 A;  3CI6 A;  4QY5 A;  4MDZ A;  3AGD A;  3UB7 A;  5MC7 A;  3EWK A;  1CI9 A;  4GW9 A;  3QNB A;  4PM8 A;  4Q0H A;  1EW0 A;  4ETX A;  4GN2 A;  4BQM A;  4OOM A;  1P9R A;  5EVI A;  4EUZ A;  3CAX A;  4DJ3 A;  2Z6D A;  3ZNT A;  3S7P A;  1CQA A;  3VE3 A;  2G2U A;  4QU3 A;  1ESU A;  1PNE A;  4WN5 A;  2Q9M A;  4NKP A;  2I72 A;  5FEG A;  3ZG7 B;  4QY6 A;  3QP1 A;  1OTD A;  4XT2 A;  4EXO A;  2CMN A;  1H8M A;  1K38 A;  3KSH A;  4B88 A;  4GDB A;  1NY0 A;  4ZAM A;  4CJN A;  2J9P A;  3NDG A;  2IWB A;  1QMF A;  2P9V A;  2WKP A;  3IF6 B;  3LY4 A;  4CLC C;  5HAQ A;  2JC7 A;  5A92 A;  4EUV A;  3HLD A;  2HF6 A;  1VEU A;  5TBM B;  2I9V A;  4I39 A;  2Y4A A;  2LB9 A;  1PZP A;  3A3I A;  4WZ4 A;  1H0M A;  1N4O A;  1XFQ A;  2XLN A;  3T1X A;  1UWP X;  4Y5F A;  3C4O A;  4X68 A;  3IWI A;  1YQS A;  3QP4 A;  2OSU A;  1W5D A;  4S2N A;  3T4O A;  1S1Z A;  3CZD A;  1H8Y A;  3FC7 A;  3V3R A;  4H6J A;  3BW6 A;  4GOG A;  3ZG0 A;  2J3W A;  4K0W A;  1H8Z A;  1RGZ A;  2C6W B;  3ISG A;  4R3J A;  4IED A;  1GHI A;  4XUX A;  4CPK A;  2PD7 A;  4PM9 A;  4WEL A;  3FPW A;  4G3W A;  3RXW A;  2EXA A;  3MXS A;  4JXG A;  2O9A A;  2Y2K A;  5CGX A;  4E3N A;  5AVE A;  1VET A;  5J8X A;  2W3E A;  3LIC A;  3IXB A;  1ALQ A;  4IBR A;  1ES5 A;  2V20 A;  4WBG A;  4HIA A;  2WUQ A;  1BLH A;  4HJ6 A;  4WZ5 C;  1CK3 A;  4L0L A;  1FIK A;  1F5M A;  3LR3 A;  3WS4 A;  1MBL A;  1S66 L;  3MFX A;  2OLU A;  4WEK A;  2XRO A;  2XRN A;  1K4F A;  2GNX A;  2Y59 A;  3C5A A;  5KZH A;  2O9B A;  3GDI A;  3CHW P;  3VP1 A;  3VP4 A;  3EEH A;  3DAV A;  3T1Q B;  4LRY C;  1IKI A;  4LFU A;  3PBN A;  3EEA A;  4O0P A;  1KGF A;  2Y2H A;  1NJ4 A;  5EOO A;  4C75 A;  1L2S A;  2PAV P;  4L9F A;  1MPL A;  5EFW A;  4EBN A;  3E2K A;  1JVJ A;  3VFF A; 
#chains in the Genus database with same CATH homology
 3UN7 A;  4HES A;  4K91 A;  3NDE A;  2CC1 A;  4PM5 A;  2XD5 A;  2ZLY A;  4ZTK A;  5EVI C;  5A93 A;  1IEL A;  1L0F A;  2HP9 A;  1LI0 A;  2EX6 A;  5CEB A;  4C3Q A;  3UPP A;  1FSW A;  4R4S A;  3A3D A;  4QD4 A;  3N8R A;  5GHY A;  4OQ0 A;  3BFD A;  1K55 A;  4FH4 A;  1PW8 A;  1GHP A;  2A49 A;  4KZB A;  5KSH A;  1XPB A;  2H0Y A;  3Q7V A;  4KEN B;  4KZ4 A;  3WRZ A;  3HUM A;  4OPR A;  1CEG A;  1YLJ A;  1S0W A;  4E3L A;  4KZ7 A;  4R4R A;  4OLG A;  5BOH A;  1YMS A;  2PU2 A;  4OLD A;  3HUN A;  1XA1 A;  4RVA A;  3M2K A;  3PAG A;  4GNU A;  5CTM A;  4C6Y A;  2WZZ A;  2WGV A;  3FKW A;  1NZU A;  4S2I A;  4KZ9 A;  4N1H A;  1TDL A;  3IHA A;  3RXX A;  5CHJ A;  2RCX A;  5CHM A;  5GL9 A;  2X71 A;  4DKI A;  3O87 A;  5DF8 A;  5JYO A;  3IXG A;  4FD8 A;  4X6T A;  2Y2M A;  4QHC A;  4MEZ A;  4DDY A;  4P0M A;  5HL1 A;  3MFD A;  4OQI A;  5DTT A;  3WS1 A;  2XD1 A;  3SS5 A;  3NC8 A;  1NYY A;  4A5R A;  3GVB A;  4MBK A;  2XH9 A;  4KZA A;  1DY6 A;  4ID4 A;  4WEJ A;  5HAR A;  1KVL A;  4EV4 A;  1DJA A;  3W4O A;  4XUZ A;  1FQG A;  2P74 A;  4OPQ A;  5DTS A;  1PI5 A;  1LHY A;  3PBO A;  2ZQA A;  1PIO A;  1C3B A;  1BLC A;  4OOY A;  1KE0 A;  2ZMA A;  3W4P A;  4OPY A;  4ZJ2 A;  3HLW A;  1SHV A;  3C7U A;  3VSK A;  4RA7 A;  5A90 A;  4X56 A;  4NET A;  1IEM A;  4HEF A;  5D3O A;  3GV9 A;  4E3J A;  3SS4 A;  1LL9 A;  2BLS A;  3TSG A;  3FYZ A;  4E3O A;  5E2F A;  1PWD A;  3Q82 A;  3MZD A;  4GB7 A;  5EOE A;  3V5M A;  1XP4 A;  1KDS A;  1PW1 A;  3WRT A;  4KZ5 A;  4N92 A;  3ZDJ A;  3OPH A;  3GMW A;  5FAO A;  1NZO A;  3MBZ A;  1BLP A;  1JTD A;  4S2N C;  4JF6 A;  4WM9 A;  3LEZ A;  3N8S A;  1FCO A;  3OZH A;  2HDQ A;  1E25 A;  5GHX A;  5CGS A;  3G30 A;  1WYC A;  4UHU A;  4N9K A;  1KGG A;  4PM6 A;  1SDE A;  3SS3 A;  4R1G A;  5HX9 A;  2FFF B;  5EPH A;  3PAE A;  4BEN A;  3P98 A;  3O86 A;  3CJM A;  1FR6 A;  1L0G A;  1ERM A;  2ZQ8 A;  5GLC A;  1KE4 A;  2WAE A;  3B3X A;  1FSY A;  3N8L A;  1MXO A;  4UA9 A;  5DVA A;  3M6H A;  3V50 A;  2QPN A;  4KQQ A;  4JBF A;  3V39 A;  3HVF A;  1K6R A;  4R0Q A;  2UWX A;  3ZVW A;  2H10 A;  1IYP A;  5G18 A;  5FQ9 A;  3I7J A;  1K56 D;  2PU4 A;  3A3E A;  2J9O A;  3OPR A;  3IH8 A;  2G2W A;  1E3U D;  1FCM A;  3QHY A;  5E2E A;  3PBQ A;  1VM1 A;  2XF3 A;  5E2H A;  1WYB A;  1ZKJ A;  1SKF A;  4Z9Q A;  4DE3 A;  5EVI B;  2HP6 A;  5FQQ A;  3S1Y A;  4DE1 A;  1LI9 A;  4LV0 A;  4O7D A;  3IT9 A;  1L0E A;  4XXR A;  4UA6 A;  3W8K A;  2ZC5 B;  3VSL A;  2H0T A;  5CTN A;  4JXW A;  1KGE A;  4LCM A;  4U0T A;  4OON A;  3ZG9 B;  2VGK A;  2B5R A;  1LL5 A;  1JWZ A;  1WE4 A;  2ZQD A;  3SOI A;  4S2L A;  1DJB A;  2ZM8 A;  3HUO A;  4OQG A;  4U0X A;  5A91 A;  2WGW B;  5EUA A;  5FAS A;  2XEP A;  4LV1 A;  1KDW A;  2EXB A;  1PI4 A;  3UE0 A;  2ZD8 A;  3G2Z A;  3G2Y A;  5HFO A;  1XGJ A;  4KG5 A;  3HBR A;  2HDU A;  4YIN A;  5FA7 A;  4E3M A;  1E4D A;  1ZG6 A;  3CMZ A;  2HDR A;  3G4P A;  3ITA A;  3FKV A;  4JPM A;  3UO9 A;  2WKE A;  4OH0 A;  1IYQ A;  1W7F A;  4DF6 A;  2ZQ7 A;  3O3V A;  4R3B A;  4EBL A;  3UE3 A;  5FQK A;  5CER A;  3M6B A;  3OCN A;  2J7V A;  2ZC7 A;  3FWL A;  2JE5 A;  4QB8 A;  1K25 A;  1W8Y A;  4QJG A;  1Q2Q A;  3EQV A;  1Q2P A;  2X02 A;  4UAA A;  1ES4 A;  1OME A;  4JF4 A;  2EFU A;  3IQA A;  3BM6 A;  2P9V B;  1MWR A;  3FZC A;  3ZHH A;  5FQM A;  4DDS A;  3SH9 A;  1PZO A;  2EX9 A;  4GD6 A;  4DXC A;  2RL3 A;  5CEC A;  5EVI D;  1FOF A;  2A3U A;  4ZDX A;  1QME A;  4E3I A;  2Z2L B;  3UPO A;  4JXV A;  4Y0T A;  3DTM A;  4GD8 A;  1I2S A;  4S2M A;  3UNW A;  1PWC A;  3UDF A;  3Q1F A;  3NIA A;  3PBR A;  1DJC A;  5GLB A;  4F94 A;  1G68 A;  3IF6 C;  2IWD A;  4YFM A;  2ZM2 A;  1K56 A;  5FAQ A;  3C4P A;  2H5S A;  4JLF A;  3TG9 A;  5F83 A;  3P09 A;  1E3U A;  2PBY A;  4WMC D;  3HL9 A;  3PBT A;  1SCW A;  5L2F A;  3JYI A;  5FAP A;  3NY4 A;  3DW0 A;  1IYO A;  2Y2P A;  4WZ5 A;  1NRF A;  1TEM A;  3G34 A;  5AQ9 A;  3W4Q A;  1YM1 A;  1K55 C;  4GKU A;  1XXM A;  2WAF A;  4K0X A;  1FR1 A;  3S4X A;  3UE1 A;  4BD1 A;  5GLA A;  5AQA A;  3OC2 A;  2XDM A;  3N6I A;  4Y0O A;  4H8R A;  4RX2 A;  4IBX A;  4RYE A;  3BLM A;  3VP3 A;  1JWV A;  2ZC3 B;  1VQQ A;  2DNS A;  5IHV A;  2EFX A;  2FFY A;  2OV5 A;  1MWU A;  5EVL A;  4BLM A;  1KVM A;  4BL2 A;  5E43 A;  3AGF A;  1O07 A;  1YMX A;  5KSC A;  4R23 A;  1XX2 A;  4KZ6 A;  4U3T A;  3ZNY A;  5CGW A;  3SH7 A;  1CI8 A;  1I2W A;  1EWZ A;  3IXH A;  3MKF A;  5TGF A;  4P87 A;  3VP2 A;  4FSF A;  2E8I A;  3A3F A;  2HP5 A;  4UA7 A;  2WKI A;  3N4I A;  1IKG A;  1M6K A;  4N9L A;  4DXB A;  1K57 A;  4OKP A;  1Y54 A;  2ZQ9 A;  4DRT A;  4QY5 A;  3GRJ A;  1ES3 A;  5EEC A;  3UPN A;  3DWZ A;  4PPR A;  5I94 A;  3UDI A;  2Y2J A;  3AGD A;  1N9B A;  5AQ7 A;  4DE2 A;  2WYX A;  3HLC A;  4MBH A;  3HRE A;  1ONH A;  2XQZ A;  4BD0 A;  1CI9 A;  3WWX A;  3QNB A;  4PM8 A;  5F82 A;  1K54 C;  3TOI A;  2ZQC A;  1J9M A;  2Y2G A;  4GN2 A;  1LLB A;  3OPP A;  4BQM A;  1ESI A;  4OOM A;  1SDN A;  1ZG4 A;  2Z2M B;  3IHB A;  4X69 A;  5EVI A;  5FI6 A;  4EUZ A;  2Y2L A;  5FAT A;  2OLV A;  2XR0 A;  3D4F A;  3MZE A;  5M1A A;  1GA9 A;  5EE8 A;  3QNC A;  4LEN A;  4Q8I A;  2V1Z A;  5DTK A;  3ZNT A;  1Z6F A;  5FDH A;  4E6W A;  3Q07 A;  2G2U A;  4QU3 A;  2BG1 A;  4NK3 A;  1ESU A;  2WGI A;  2WGW A;  4WMC A;  4ZJ1 A;  2XFS A;  4D2O A;  5JYP A;  1K4E A;  4PM7 A;  3LY3 A;  2Q9M A;  4PMA A;  2I72 A;  3IWO A;  1XA7 A;  3ZG7 B;  4KQR A;  2EX2 A;  1XGI A;  2J8Y A;  1RGY A;  2IWC A;  2Y55 A;  4QY6 A;  5U47 A;  3NCK A;  5KMW A;  3IXD A;  3ITB A;  2XK1 A;  4OQH A;  1G6A A;  2DRW A;  4S2J A;  3IWQ A;  3IH9 A;  1YLW A;  1K38 A;  5F1G A;  4EBP A;  4B88 A;  3MZF A;  3O88 A;  2Y91 A;  2DCF A;  4EQI A;  3M2J A;  4GDB A;  1RCJ A;  4E3K A;  1NY0 A;  3BFE A;  4ZAM A;  4CJN A;  4KZ8 A;  2J9P A;  1YT4 A;  3NDG A;  4WYY A;  1HZO A;  2IWB A;  3ZG5 A;  3ZVT A;  2WZX A;  1PWG A;  1QMF A;  1K6S A;  2P9V A;  3IF6 B;  1YLT A;  2QZ6 A;  2HDS A;  2WK0 A;  2Y2I A;  3LY4 A;  3BLS A;  3UY6 A;  3CG5 A;  1ES2 A;  5HAQ A;  2JC7 A;  4OPZ A;  5FQJ A;  2ZC6 B;  4Y0U A;  5A92 A;  4S2O A;  4BL3 A;  3WS0 A;  4P6B A;  1IYS A;  2Q9N A;  2WKH A;  3HLD A;  3MKE A;  5CRF A;  3VOZ A;  3ZG8 B;  1BZA A;  1TVF A;  1W8Q A;  2Y4A A;  2XGN A;  2Y2O A;  2X01 A;  4ZBE A;  1NXY A;  3GTC A;  5F1F A;  1PZP A;  3BFC A;  1RP5 A;  3A3I A;  3LCE A;  5AQB A;  4WZ4 A;  2XFT A;  3VP0 A;  3Q7V B;  3VOY A;  2JBF A;  1BLS A;  1N4O A;  2XLN A;  4KQO A;  4Y7P A;  3G31 A;  4DE0 A;  5HW3 A;  3V3S A;  3WS2 A;  4EWF A;  3C4O A;  4X68 A;  5M18 A;  3ZFZ A;  3IWI A;  1BUL A;  1ONG A;  4X55 A;  1GHM A;  3RJU A;  1YQS A;  3PBS A;  4JKT A;  2OSU A;  4OVD A;  5HAI A;  3SH8 A;  3HLB A;  1W5D A;  4S2N A;  1YLZ A;  1O7E A;  3C7V A;  3CZD A;  1H8Y A;  1U60 A;  3N7W A;  3WS5 A;  4ZJ3 A;  2ZJ9 A;  3V3R A;  3G32 A;  3IF5 A;  4GOG A;  3VFH A;  4X53 A;  5DF7 A;  3ZG0 A;  3GSG A;  4IVK A;  3Q7Z A;  4K0W A;  1H8Z A;  1RGZ A;  2C6W B;  3ISG A;  3BFF A;  4MBF A;  1EI5 A;  1HTZ A;  1HD8 A;  1JWP A;  4IED A;  4R3J A;  3LO7 A;  4MLL A;  4FH2 A;  1MWT A;  3ZGA B;  1GHI A;  4XUX A;  2R9W A;  1W79 A;  2ZC4 B;  2JCH A;  3AGE A;  4HBU A;  4CPK A;  4PM9 A;  3BFG A;  4WEL A;  1ZC2 A;  4LCL A;  4GDN A;  3S22 A;  1K54 A;  3RXW A;  1MWS A;  2V2F F;  2EXA A;  1I5Q A;  1H5X A;  3MXS A;  5TFQ A;  5HAP A;  4JF5 A;  4JXG A;  4B4Z A;  2Y2K A;  1CEF A;  5CGX A;  4E3N A;  5J8X A;  3OCL A;  3G35 A;  3NBL A;  5GHZ A;  4LV3 A;  1MKI A;  3ZCZ A;  4M3K A;  3IXB A;  1ALQ A;  1MY8 A;  5CED A;  3OPL A;  4IBR A;  1BSG A;  4LV2 A;  4OOL A;  1ES5 A;  2V20 A;  4WBG A;  1PYY A;  2WUQ A;  1GA0 A;  1BLH A;  3BRM A;  3BYD A;  5DF9 A;  2HPB A;  2R9X A;  4KG6 A;  4WZ5 C;  3NI9 A;  1BT5 A;  4N1X A;  1KE3 A;  1CK3 A;  1XKZ A;  3UDX A;  3Q81 A;  3BEB A;  4L0L A;  2Y2N A;  3FV7 A;  4S2K A;  3WS4 A;  1MBL A;  2OLU A;  1L0D A;  1YLP A;  5CHU A;  1GCE A;  4WEK A;  2ZM0 A;  1K4F A;  1ERO A;  3PTE A;  1NYM A;  3BEC A;  1HVB A;  2Y59 A;  3MXR A;  3C5A A;  1FCN A;  5KZH A;  3HLE A;  4IVI A;  4JXS A;  1YLY A;  4MNR A;  3E2L A;  3VP1 A;  3VP4 A;  4OP8 A;  4RX3 A;  1AXB A;  5E2G A;  1M40 A;  2QMI A;  1BTL A;  4P85 A;  4S2P A;  4GZB A;  2VGJ A;  3EQU A;  1IKI A;  4KZ3 A;  1S6R A;  3PBN A;  4KG2 A;  4B4X A;  3GR2 A;  3HLF A;  1K57 C;  1BUE A;  3A3J A;  1KGF A;  2WAD A;  5FQI A;  3VMA A;  5FI2 A;  1ERQ A;  2Y2H A;  3DWK A;  5CXW A;  5TR7 A;  4BJP A;  4HBT A;  1NJ4 A;  2Y2Q A;  5EOO A;  4OP5 A;  4C75 A;  2GDN A;  1L2S A;  4E6X A;  5FSR A;  2EX8 A;  2C5W B;  3GQZ A;  3HLG A;  5M19 A;  1MPL A;  5FI7 A;  5GLD A;  4EBN A;  3E2K A;  1JVJ A;  1TDG A;  4FCF A;  3VFF A;  1JTG A;  3IF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...