4HOIA

Crystal structure of pas domain from the mouse eag1 potassium channel
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
SHMTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium voltage-gated channel subfamily H member 1
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hoiA00
2ZOIA 1XJ3A 4EQ1A 3LIDA 3LI8A 4R6LA 2JHEA 2D01A 2P7JA 1OTEA 4DJ3A 2V1BA 2EA9A 2B02A 2PYRA 5HD5A 3A0SA 1V9YA 4B9OA 2M1CA 5IU1A 3NOTC 5HSQA 1GSWA 2PR6A 3F1PA 3F1OA 1S1YA 4L9GA 4I38A 4KUOA 5HWTA 3H82B 2QJ7A 4EETB 3H9WA 3LIBA 4HOIA 3D72A 4HP4A 1P0ZA 2K7SA 4JGQA 2WKRA 5F6AA 3MQQA 3UB8A 2VV6A 3A0VA 4H6JB 4XT2B 3PHYA 1UWPX 4WF0A 1KOUA 2VV7A 5HDDA 1T1AA 3C8CA 5F69A 4HY8A 3LIAA 2R78A 4BBUA 2V0UA 2W27A 2PDRA 1TS0A 2A24B 1G28A 4WL9A 3OLOA 3UMEA 1F9IA 2D02A 4EEPA 4LRZE 1JNUA 2QKPA 4KUKA 2GJ3A 2HV1A 4BBTA 1DP6A 3HJIA 3E4QA 4RQ9A 1S1ZA 1OT6A 3SW1A 5DKLA 5HD3A 2PYPA 2ZBBA 2VV8A 1OTIA 5J4EA 3LIFA 3MXQA 1GSXA 1ODVA 1EW0A 1T18A 1OTDA 2L4RA 3FG8A 4WN5A 2BASA 1LSWA 4HH3A 4HIAA 3MJQA 3ULFA 4JGPA 2L0WA 3GECA 2H28A 2Z6DA 3RH8B 3ZQ5A 3LYXA 4JGOA 5AVEA 4I3AA 1S4RA 5DJUA 1DRMA 3MQOA 4HHDA 3H82A 2OWHA 2PD8A 2WKPA 3CAXA 1N9OA 2CMNA 2V1AA 1LSVA 4L9EA 1GSVA 3VOLA 2WKQA 2QHKA 3LUQA 2QWSA 3K3DA 1T1CA 4HJ4A 4R38A 4GS9B 3BY8A 4H6JA 4XT2A 4GW9A 2JN7A 3BY9A 4PKYG 4EW7A 4NXEA 1XJ2A 4YWZA 4I39A 3IS2B 4WLAA 2A24A 3NJAA 2L1MA 1OT9A 2QJ5A 5EFWA 5TBMB 3UE6A 4F3LB 4I5SA 5A8BA 1OJGA 1S67L 3RTYA 5AVFA 3LICA 5J3WA 4L9FA 3EWKA 3B33A 2VEAA 1XFQA 1XJ4A 1WA9A 3A0RA 1NWZA 1XFNA 2I9VA 3LI9A 2OWJA 1BYWA 3F1PB 4GHIB 3F1OB 2KDKA 3LIEA 3T50A 4MN6A 4HNBA 1OTBA 2KX6A 3G6OA 3UMDA 5HDSA 3H7WB 1TS7A 3MFXA 4GS9A 4HJ3A 3E4OA 1UGUA 5F5YA 3F1NB 1T19A 4LPZA 4EERA 1Y28A 4DJ2A 4K08A 1XJ6A 4PKYA 4HP9A 1N9LA 3KX0X 1V9ZA 3CLOA 2PHYA 3FC7A 4GCZA 5TBMA 4EEUA 4KQDA 5I5LA 5HWWA 1DP8A 3NOUC 3BWLA 4F3LA 4WUJA 1TS8A 4NXFA 2W0NA 3CWFA 5IS1A 1F98A 3UB6A 2OOLA 4HQAA 1X0OA 1S4SA 5HDCA 4NXGA 4M4XA 1N9NA 3UB7A 2PR5A 4EESA 3NOPC 5J7EA 4GHIA 5HZHA 1MZUA 5F68A 2J80A 2V9AA 2VLGA 4JGRA 2Z6CA 3C2WA 3EEHA 2PD7A 1S66L 5HWVA 3H7WA 4I3JA 3IBRA 4MN5A 1P97A 3P7NA 3GDIA 3K3CA 3UB9A 3VE4A 1D7EA 1T1BA 2INWA 5DKKA 3F1NA 1D06A 1VB6A 4HJ6A 4LLOB 5DJTA 1OTAA 1LL8A 1DP9A 1LT0A 3VE3A 3E4PA 3PYPA 5KIZA 3ICYA 5G4ZA 3NHQA 4LRYC 1UWNX 4I3IA 2YKHA 4BBVA 2YKFA 4EXOA 4NXBA 4LRXC 3MR0A 5G4YA 2ZOHA 3HJKA 2V0WA 4R3AA 1TS6A 4E04A 4HI4A 1LSXA 1OJ5A 4R70A 3IS2A 4HH2A
chains in the Genus database with same CATH superfamily
3LFVA 4OPRA 4FSFA 1Z09A 5GLAA 1TDGA 4C6YA 1A0KA 3LI8A 4R6LA 4YOFA 3OPPA 3PXPA 3UE1A 1W8QA 3A3EA 3BQ8A 2BTFP 2IWBA 1ES4A 2PYRA 1YLJA 3GVBA 5HD5A 3BECA 4S2NC 3SH8A 5FQ9A 3A3JA 4B9OA 2M1CA 3T4SA 5IU1A 3NOTC 4JKTA 3V3RA 2BLSA 1K6RA 3F1PA 4HBTA 3BLMA 5HFOA 3V67A 1IYPA 3D9YA 2B5RA 3H82B 1DY6A 5FI2A 3JPUA 5FAPA 1L3LA 3FPVA 2XH9A 3D72A 2K7SA 5F6AA 5L07A 2J8YA 3RFBA 4H6JB 4XT2B 3PHYA 3BFCA 3LEZA 1KOUA 2VV7A 1T1AA 3KYEA 3O3VA 1H8ZA 2B95A 2V0UA 1NXYA 1YAXA 3UE0A 1TS0A 4WL9A 2HP6A 1H5XA 3UMEA 3ZG9B 5CGXA 4X6TA 5FA7A 2D02A 5DF8A 2IWCA 2M7VA 4EEPA 4LRZE 2QKPA 4DKIA 3IWQA 2Y2GA 4G3VA 4ZBEA 3CG5A 1IKIA 3SW1A 4BLMA 3BFDA 3D3OA 3E98A 5DF7A 1OTIA 5J4EA 3LIFA 4OONA 3MXQA 1H3QA 2EFXA 3Q1FA 4S2OA 2Q0OA 2W3EA 1OTDA 3ZNYA 3LEQA 1ES3A 3P09A 3MJQA 1K56D 4S2IA 2H28A 1C3BA 5KSHA 5GLBA 1J9MA 4EWFA 5EVIC 4GOGA 3K2NA 4JGOA 5AVEA 3HREA 5DJUA 3OBFA 4HHDA 3H82A 3GMWA 2V1AA 4K0WA 2A3UA 2XGNA 3ITBA 5DVAA 5FL3A 1XP4A 4YNRA 3LUQA 2QWSA 3IWOA 1T1CA 4JF5A 1IELA 2K31A 4H6JA 4XT2A 4GW9A 5FDSA 3C38A 1EI5A 3R7WB 2PT7A 4NXEA 4KZ9A 1IKGA 3VFHA 2Y2PA 3G4PA 4WLAA 5MC7A 3M6HA 4LV1A 1XPBA 1AXBA 2L1MA 4M3KA 1QMFA 5K5BA 5EFWA 5TBMB 3CZDA 4II7A 4X25A 2PU4A 2ZM2A 3UDFA 4F3LB 1F5MA 4UQIM 4JLFA 2Y59A 5FI6A 4LCMA 3RTYA 4BL3A 1PZPA 1NLZA 4L9FA 4QJGA 3DAVA 4Y0UA 1LI9A 1O7EA 1XJ4A 3MMHA 1NWZA 2J9OA 3LO7A 4PAUA 5A92A 3LI9A 2OWJA 4QHCA 3F1OB 2KDKA 4WZ5A 5AQBA 3T50A 4HNBA 2KX6A 2FFFB 4AFIA 1K57A 5M1AA 5U47A 3TRCA 2H0TA 3QNCA 3NDGA 4KQQA 2EX2A 2QMIA 4KZAA 1VQQA 2ZLYA 1ONGA 1QMEA 4MDZA 3R4KA 1KDSA 1BLPA 5GHZA 3F1NB 5AQ9A 3G2ZA 3R7WA 4FOFA 3OCNA 4CLCC 5E2FA 4GZBA 4PKYA 3PR6A 4H8RA 4IVKA 4X1LA 4X68A 1JVJA 1ESIA 3MBZA 5A91A 4UA9A 1KVLA 3U4LP 1CEFA 4MN7A 5TBMA 4ID4A 2JKGA 5I5LA 3CPTB 4Y3IA 5HWWA 3MQ0A 4F3LA 2OAQ1 1BLHA 3PTEA 4DE3A 4NXFA 5GHXA 3CUEA 3OC2A 3C7VA 3CWFA 4BJPA 1F98A 3PAEA 3W8KA 4QU3A 4HQAA 1AWIA 2EX6A 5EE8A 3ISGA 2O9BA 3P98A 1RCJA 1X0OA 2HP5A 1S4SA 4LENA 4Q0HA 1W5DA 4NXGA 5HAQA 3UB7A 3VV4A 3HLBA 2H0YA 2JBFA 3B47A 3IH9A 4UAAA 1FCNA 5F82A 5HZHA 1FQGA 3AGEA 5F68A 1CF0A 1EROA 2O99A 3T4JA 4JGRA 2Z6CA 3CITA 1IYOA 4UA6A 4IBRA 2OLVA 1W63M 3EEHA 2B18A 2X71A 1SKOB 4EUZA 5JYPA 1DJAA 4I3JA 2V8CA 3D4FA 4DF6A 3QP2A 3P7NA 3UB9A 1D7EA 4R3BA 3B3XA 3C7UA 4PM7A 3F1NA 1I5QA 4X69A 1N4OA 5BOHA 4DXBA 1LL8A 1DP9A 1RGYA 3QNBA 1N9BA 1L0DA 3PYPA 5KIZA 3S22A 2H10A 3G2YA 4LRYC 5E2EA 2W3GA 5FASA 2YKFA 3IHBA 4EXOA 3N6IA 3S7PA 2VGKA 5DFYA 3KYZA 3KSIA 3HLDA 1GA9A 4YFMA 3WS5A 3HJKA 2V0WA 1GHIA 4S2MA 1K54A 4E04A 5HARA 4G3WA 4HI4A 4U3TA 1LSXA 1J3WA 3QHYA 3KO6A 1NYMA 1XJ3A 3DTMA 5EVEA 3MKFA 4WELA 1K56A 3I7JA 4EU0A 3A3FA 5DTKA 2JKTI 5E2HA 5CHUA 3LIDA 3PBTA 2XEPA 4XUXA 3HUNA 2JHEA 3UY6A 2WGVA 2D01A 3IF6C 2P7JA 1OTEA 1SKOA 1OPXA 2B02A 2EA9A 1MBLA 3KYQA 4R4RA 3HL9A 4ARZB 4U0XA 1YLZA 3A0SA 1V9YA 5FI7A 5HSQA 1GSWA 4UQIS 2PR6A 4KQOA 4S2NA 1H8YA 1FR6A 4L9GA 4WEKA 4PM5A 4KUOA 5HWTA 5CRFA 2QYBA 5EVIB 3FPWA 1ONHA 2V8FA 5HPFA 1XGJA 1K4EA 4HOIA 4F94A 1MPLA 5EPHA 3MQQA 3UE3A 2J9PA 1XX2A 5DTSA 4ZJ1A 4S2PA 1FILA 4OH0A 1JWZA 1L0FA 5HDDA 3ZG8B 5F69A 1Y54A 4HY8A 4S2JA 2WGWB 3TW8A 4OPQA 4JXWA 2IA2A 2ZQCA 2W27A 2HF6A 2H5SA 1PW8A 2P9VA 1G28A 3BQAA 3RXXA 4QY5A 3VP2A 2HDUA 5AQAA 1W63Q 3HJIA 4O01A 4X1MA 4Y2FA 4Q8IA 2VV8A 3SS5A 3GTCA 3G32A 3QP5A 1EW0A 4ARZA 3NULA 1T18A 1MWUA 2XDMA 4YINA 3VP4A 5CGSA 4Q0IA 4HIAA 1YMSA 4X55A 3ULFA 4JGPA 3GECA 1PZOA 2Z6DA 3A3IA 4OKPA 3LYXA 5FQKA 2JCHA 3IBJA 1S4RA 1P9WA 2AVXA 1NZOA 1DRMA 4IHQA 3ZYTA 3KSFA 1K55A 5EVIA 3EGXC 1ALQA 2J7VA 1LSVA 3LGOA 2XSSA 3WS4A 2V1ZA 3T4TA 2VZWA 3K3DA 4HJ4A 1K38A 4GS9B 4KZ7A 1M6KA 4OOMA 2M7UA 2WYXA 2Y8HA 4PKYG 1K6SA 4R1GA 3EQUA 3MZFA 5L2FA 2JC7A 3UDIA 1XJ2A 2WGWA 5EV0A 1CQAA 5FAOA 1NRJA 5DTTA 3T1XA 4CLCB 1TVFA 5HAIA 2VJWA 3NJAA 1DJCA 2CC1A 1PNEA 1OT9A 2ZL1B 2QJ5A 2VGJA 5FEFA 2I72A 2XD5A 2P04A 1MWSA 2OSUA 3O87A 2ZQ9A 1L2SA 2HDRA 5A8BA 1OJGA 4IBXA 1YSPA 3SS4A 4RX3A 4JPMA 5J3WA 4HBUA 1GHPA 3HLWA 3IF5A 3S7NA 3IXHA 1WA9A 1XFNA 3BFEA 4LV3A 3JVVA 4R4SA 3EOIA 4GHIB 4Y7PA 1YQSA 5CXWA 3DBAA 3LIEA 1HLUP 2W1RA 1G6OA 2ZQ8A 5M18A 1W79A 1KGGA 2GX5A 2JKFA 5EECA 1LLBA 4DE1A 3NDEA 2WAEA 3VP3A 4S2KA 2MJ6A 1CI8A 3N8SA 4WYYA 3MFXA 4GS9A 3AGFA 3E4OA 5LBRA 5F5YA 4ZTKA 4EBLA 1T19A 3HLCA 1SZVA 4DDYA 1ZG4A 2XFTA 1JTGA 3T4LA 1VETB 5EM1A 4KG5A 3MXRA 3KX0X 1Q2QA 3G31A 3QP4A 4B93A 4CLCA 1P9RA 3FC7A 1KE4A 3ZGAB 1YLWA 2VGLM 3MZDA 3PBNA 2ZL1A 1VEUB 4EEUA 4KQDA 3FKWA 1DP8A 2R9WA 2RL3A 4IJGA 1TS8A 5F1FA 4O8GA 4ETXA 3NECA 5A93A 4JF6A 2W0NA 5GLDA 1IYQA 2HJEA 2C6WB 2G2UA 4GN2A 1XKZA 2XLNA 1CI9A 5HDCA 3L9KA 3PBOA 4M4XA 2FFYA 2PR5A 4EESA 4GHIA 3QP1A 4OLDA 4C75A 4LCLA 3V39A 5KMWA 3C2WA 3HLGA 3VOZA 3FKVA 2PD7A 3W4QA 2HJ9C 4MN5A 5L09A 3EGDC 3U2AA 3UO9A 3PAGA 3VE4A 1T1BA 2W3HA 3IF6B 2INWA 3VMAA 3JYIA 5DKKA 3PBSA 3LR3A 4OOYA 3ZCZA 3S1YA 3T1SA 1CJFA 1XA1A 1YKDA 2ZQAA 4OP5A 3UN7A 2DMWA 2ZMFA 3OPHA 1LT0A 4E3MA 2WUQA 2VK3A 1VETA 3E4PA 3EQVA 1K25A 1STZA 3MFDA 3CI6A 4I3IA 2YKHA 4BL2A 2XRNA 1IYSA 1HZOA 2Y2JA 4DE0A 3DW0A 2ZOHA 3HUOA 4X53A 4R3AA 4S2LA 1TS6A 5EVID 4QPRA 2DNSA 2R9XA 2EXAA 2XROA 2KLIA 3UNWA 4GDBA 1WYBA 4DDSA 1XA7A 5KSCA 1KDWA 4QD4A 1WYCA 1PFLA 3NY4A 2EFUA 1KE0A 2EWVA 1RP5A 5CERA 4Y0OA 1S0WA 4N9LA 3UB5P 1ZC2A 1YLPA 1ES2A 3HVFA 2Y2HA 4DJ3A 2V1BA 3S7OA 2WZZA 2OLUA 2ZD8A 4PM8A 3IF6A 3MZEA 1MWTA 1DJBA 2JKRM 2ZC6B 2X01A 4JXGA 3ZG0A 2HGVA 3F1OA 4Y15A 2XF3A 4I38A 2XA7M 4OPZA 2Y2QA 2G2WA 4EETB 3Q7VB 3DTKA 1VHMA 1PIOA 4O0PA 3IX3A 3LIBA 3V5MA 4HP4A 1BUEA 2WKRA 1XXMA 2WKIA 2VV6A 3A0VA 4BWIA 3ZVWA 3AGDA 1OMEA 1YT4A 4GJ4A 1UWPX 3KSHA 1IEMA 4ESPA 3C8CA 4HESA 3LIAA 4EV4A 4XUZA 4GD6A 4WMCD 3IT9A 2PDRA 3ZFZA 3UPPA 4JXVA 1SDNA 3OLOA 4Y13A 1F9IA 4E6XA 2A2LA 4KUKA 3O5YA 2GJ3A 2HV1A 1PRQA 4BBTA 1DP6A 1MY8A 1S1ZA 3CPTA 4OLGA 2NUPC 3N7WA 1OT6A 3WS2A 1HD8A 2ZBBA 1BULA 5FAQA 3CHWP 1RGZA 2VGLS 4L0LA 4CLCD 2L4RA 4WN5A 2E8JA 3T12B 2BASA 2GDNA 3LCEA 1W7FA 3Q81A 4FD8A 5HL6A 4XXRA 3RH8B 3ZQ5A 1YM1A 5DFXA 3BW6A 1FOFA 3G30A 2OWHA 2WKPA 5FATA 3CAXA 5L8MA 5CGWA 3Q7VA 1E3UD 1L0GA 3PBQA 4L9EA 1GSVA 3BRMA 5C5KA 4NETA 2WKQA 3CUEC 2QHKA 4B4ZA 1ZHHB 2J3TC 5HW3A 3BY8A 4FH2A 3C4PA 3C4OA 4B4XA 3BY9A 1G68A 3E2KA 1KVMA 4EW7A 1LL9A 2QPNA 2ZJ9A 1JTDA 4YWZA 4KZ4A 3IXGA 4I39A 5A90A 3IS2B 2Z2MB 3GQZA 4E3KA 4PMAA 4OQHA 4LFUA 4R0QA 4K0XA 3UE6A 3N4IA 3GR2A 3GRJA 1S67L 1KGEA 4FTXA 3WWXA 4MMNA 3IX8A 3KSGA 2Y79A 4CPKA 4OQ0A 4MNRA 4P85A 1BTLA 5IT5A 1LI0A 1W8YA 3IXDA 2PBYA 2I9VA 4MEZA 3UDXA 2O0YA 1YMXA 3F1PB 4DRTA 5EM0A 1G5UA 1O07A 3MF0A 1ZG6A 4KZ3A 2EXBA 3BEBA 4QB8A 4E3NA 4MN6A 4FUWA 4WZ4A 4OOLA 3S7QA 2DRWA 5AJGA 2ZQ7A 2WKHA 3G35A 3H7WB 3OZHA 1TS7A 3MSHA 3IXBA 5CECA 1KE3A 1F2KA 4Y5FA 5L10A 3B42A 1YLTA 2WADA 4EERA 1Y28A 4Z9QA 4K08A 1GHMA 1XJ6A 3VP0A 5TJJA 3NIAA 4HP9A 1N9LA 5E43A 2Q9NA 4N92A 4G3KA 1V9ZA 3CLOA 4D60A 5FSRA 1HVBA 4Y17A 4EBNA 1MKMA 4GCZA 2VKSA 1ERMA 2UV0E 2FZ0A 2XA7S 2Y2MA 3FWLA 4WUJA 3BYDA 2J3TD 4MLLA 3CJMA 3HCYA 5FQIA 1FCMA 1S6RA 3WS1A 3SH7A 1HTZA 3ZG7B 2ZQDA 5EUAA 2EX9A 1N9NA 3NI9A 4LGWA 2WKEA 5HX9A 4EQIA 5FQQA 4IVIA 2PBDP 3ZVTA 3IWIA 1TD5A 4GDNA 1NJ4A 1PYYA 2J80A 3QP6A 1NRFA 5EOEA 4NEED 2RCXA 2BG1A 1S66L 3VSKA 3H7WA 4ETZA 1P97A 5FQMA 3GDIA 3K3CA 4JF4A 2EWWA 3LY3A 2Y4AA 1IOUA 2HZ5A 5I94A 2A49A 1VB6A 4HJ6A 2XK1A 3TJZC 4P87A 4DN0A 4FCFA 2XD1A 3NBLA 4KG6A 4OP8A 2Y2KA 2VA0A 1GA0A 4Q0JA 3DTEA 3ICYA 3NHQA 4WMCA 4BD1A 4X56A 3ZNTA 1UWNX 2C5WB 2KOIA 1CK3A 2Y91A 3EEAA 3N8LA 1TDLA 3UPNA 4OQIA 3UPOA 4BBVA 2W1TB 3JVUA 3P01A 3MR0A 3QP8A 5G4YA 1H8MA 5CHJA 1PWGA 2V20A 4IEDA 4P0MA 1E4DA 4NG2A 3SZTA 1L0EA 4E3IA 1FSWA 3V50A 2EX8A 2ZOIA 1SHVA 3GSGA 1K55C 1YSQA 2FH5A 4QWOA 3TE8A 4EQ1A 1XGIA 4U0TA 4E6WA 4EBPA 1K4FA 4BMWA 4HEFA 3OCLA 3OOVA 1PI5A 2LB9A 5CEDA 3N8RA 3IH8A 4N9KA 1E3UA 3VSLA 2V2FF 4KZ8A 3W2ZA 5CEBA 4UEYA 4WBGA 1ZKJA 2PU2A 3ZG5A 2ACGA 1YLYA 2GZAA 4BENA 1S1YA 5M19A 3IQAA 4N1HA 1ERQA 1JWVA 2QJ7A 3ZHHA 4MBKA 5FEGA 3H9WA 5CTNA 4ME4A 1PWCA 3PBRA 1P0ZA 3TG9A 4JGQA 2W1TA 4BQMA 1LHYA 3UB8A 3VOYA 4WF0A 2WAFA 3ZDJA 4R23A 1TF1A 3T4OA 2R78A 4BBUA 2O9CA 3DTIA 4A5RA 4OQGA 2A24B 2WZXA 1JNUA 2HDSA 1VEUA 3E4QA 4ZJ2A 2XFSA 2XQZA 4RQ9A 5GLCA 1PW1A 2DCFA 3CMZA 4P6ZM 1BT5A 2E8IA 2VX8A 1ESUA 5CHMA 5DKLA 5HD3A 2PYPA 3OPLA 4OPYA 2ZMVA 1SDEA 3BLSA 1FCOA 3HBRA 1GSXA 1ODVA 4IUHA 1BLCA 4PHTA 3FG8A 4BD0A 1LSWA 4HH3A 1MWRA 2Y2OA 2Y2IA 1MC0A 2L0WA 2Q9MA 3VP1A 2JKTM 2ZC7A 3NC8A 1KGFA 4I3AA 4CJNA 3RJUA 3MQOA 4C3QA 2PD8A 4ZRRA 4B88A 1N9OA 5TFQA 2CMNA 1NZUA 3BFFA 1LL5A 1Y4OA 3VOLA 2P08A 2WGIA 2O9AA 2HPBA 3ITAA 4DXCA 5GL9A 5GHYA 4R38A 4Y0TA 1BSGA 3HLFA 5FDHA 4KZBA 4MBHA 2JN7A 1NY0A 5TGFA 1VM1A 4RA7A 1U60A 5HL1A 4KENB 2Y2NA 4KQRA 1ES5A 2A24A 3DWZA 4LV2A 5TR7A 4MCWA 2WK0A 4D2OA 2XR0A 2OAP1 1SKFA 2X02A 3W4PA 1H0MA 2PAVP 1SCWA 3LR0A 4I5SA 1PWDA 2OV5A 5AVFA 3O86A 3LICA 4E3OA 4E3JA 3MS6A 3NCKA 3EWKA 4RVAA 3T1QB 3B33A 2VEAA 1M40A 4PM9A 5DF9A 3RXWA 1XFQA 2ZC5B 3E2LA 3A0RA 3G34A 4WZ5C 2ZC3B 1BYWA 4GD8A 3MXSA 4EUVA 4ZAMA 1K57C 3WS0A 4E3LA 4K91A 3TOIA 1OTBA 4NKPA 4PPRA 5CTMA 3G6OA 3UMDA 3T4KA 3HLEA 5HDSA 2J3WA 3C5AA 2ZM8A 4DE2A 4MBFA 3WRZA 4HJ3A 3BM6A 3C30A 1BZAA 5J8XA 1UGUA 1TEMA 2HDQA 3BFGA 5FQJA 4LPZA 5HAPA 4DJ2A 1NYYA 3A3DA 3Q7ZA 1G6AA 2W3FA 3HUMA 1FIKA 5EOOA 2P9VB 5G18A 3DWKA 5KZHA 2P74A 2PHYA 3M2JA 4P6BA 3Q82A 4Z1WA 3VFFA 3Q07A 2QZ6A 1CEGA 4ZJ3A 3FV7A 1BLSA 3LR5A 2ZM0A 3NOUC 1IFQA 3BWLA 2JE5A 3TSGA 2UWXA 3BJNA 1I2WA 2Y2LA 3T1RA 1I2SA 4IUKA 4N1XA 4LV0A 1YPRA 5IS1A 3UB6A 4ZDXA 4JBFA 2OOLA 2Y55A 5EVLA 1FR1A 5E2GA 1ACFA 4KG2A 4RX2A 4GKUA 3L7HA 4QY6A 3FZCA 3T4QA 2K2NA 5D3OA 3NOPC 5CX7A 3IX4A 5J7EA 3IHAA 3SOIA 2G7UA 3MKEA 2ZMAA 1MZUA 4RYEA 2JKRI 3OPRA 2V9AA 2VLGA 4GNUA 4PM6A 3SS3A 1MKIA 4DMZA 2W3DA 5HWVA 2ZC4B 5HPIA 3IBRA 5F1GA 4WM9A 2IWDA 1D1JA 4GB7A 3SH9A 3M2KA 4OVDA 2LB5A 1PI4A 1Z6FA 3GV9A 1NLYA 4P6ZS 3O88A 4UHUA 5AQ7A 4R3JA 1D06A 4GLQA 3E0YA 4LLOB 4O7DA 5DJTA 4KZ5A 1OTAA 4CQHA 3S4XA 1MXOA 1WE4A 2Z2LB 3VE3A 2HP9A 3WRTA 1K0KA 1FSYA 5G4ZA 1ZTUA 4UA7A 4FH4A 1Q2PA 1EWZA 3M6BA 5JYOA 4WEJA 4CLCE 4NXBA 4LRXC 3FYZA 3LY4A 1K54C 5F83A 3V3SA 1E25A 1GCEA 2PRFA 4JXSA 4KZ6A 2NUTC 4NK3A 3W4OA 2GNXA 4R70A 1OJ5A 5IHVA 3IS2A 1JWPA 4HH2A 3LR4A
chains in the Genus database with same CATH topology
3LFVA 2ZOIA 4FSFA 1XJ3A 1YSQA 2EWVA 4WELA 4EU0A 2FH5A 3TE8A 4EQ1A 2JKTI 3LIDA 3LI8A 3PBTA 4R6LA 4YOFA 4BMWA 3OCLA 3OOVA 3PXPA 2JHEA 2D01A 2LB9A 2P7JA 1OTEA 4DJ3A 2V1BA 3BQ8A 1OPXA 2B02A 2EA9A 3KYQA 2PYRA 3S7OA 3W2ZA 5HD5A 4ARZB 3A0SA 1V9YA 4B9OA 2M1CA 4UEYA 3T4SA 5IU1A 3NOTC 5HSQA 1GSWA 4UQIS 2JKRM 2PR6A 4KQOA 3F1PA 2GZAA 2HGVA 3F1OA 1S1YA 4L9GA 4WEKA 3V67A 4I38A 2XA7M 4KUOA 5HWTA 3H82B 2QJ7A 4EETB 2QYBA 3FPWA 3H9WA 5HPFA 3FPVA 1VHMA 4O0PA 3LIBA 4ME4A 4HOIA 3D72A 4HP4A 3PBRA 1P0ZA 2K7SA 4JGQA 2WKRA 5F6AA 3MQQA 3UE3A 2W1TA 3UB8A 4BWIA 2VV6A 3A0VA 3RFBA 4H6JB 4XT2B 3PHYA 4GJ4A 1UWPX 4WF0A 1KOUA 3KSHA 2VV7A 5HDDA 1T1AA 3C8CA 5F69A 1TF1A 4HY8A 3T4OA 3LIAA 2R78A 3TW8A 4BBUA 2V0UA 2IA2A 2W27A 2O9CA 1YAXA 2HF6A 2PDRA 1TS0A 2A24B 1G28A 3BQAA 4WL9A 3OLOA 3UMEA 1F9IA 2D02A 2M7VA 4EEPA 4LRZE 1JNUA 2A2LA 2QKPA 3O5YA 4KUKA 2GJ3A 1W63Q 2HV1A 4BBTA 1DP6A 4G3VA 3HJIA 3E4QA 4O01A 4Y2FA 4RQ9A 1S1ZA 4P6ZM 2NUPC 1OT6A 2VX8A 3SW1A 3D3OA 3E98A 5DKLA 5HD3A 2PYPA 2ZBBA 2VV8A 1OTIA 2ZMVA 5J4EA 3LIFA 3MXQA 1GSXA 1H3QA 1ODVA 4IUHA 1EW0A 2VGLS 4L0LA 4ARZA 4CLCD 1T18A 2W3EA 1OTDA 4PHTA 2L4RA 3FG8A 4WN5A 2BASA 1LSWA 4HH3A 4Q0IA 4HIAA 3MJQA 3ULFA 4JGPA 1MC0A 2L0WA 3GECA 2H28A 5HL6A 2Z6DA 2JKTM 5KSHA 3RH8B 3ZQ5A 3LYXA 5DFXA 3BW6A 3K2NA 4JGOA 3IBJA 4I3AA 1S4RA 5AVEA 1P9WA 5DJUA 3OBFA 1DRMA 4IHQA 3MQOA 4HHDA 3H82A 3ZYTA 2OWHA 2PD8A 2WKPA 3KSFA 4ZRRA 3CAXA 1N9OA 5L8MA 2CMNA 2V1AA 3EGXC 3PBQA 1LSVA 4L9EA 1GSVA 3VOLA 2P08A 2O9AA 5C5KA 2XSSA 5FL3A 2WKQA 3CUEC 4YNRA 2QHKA 3LUQA 2QWSA 3T4TA 2VZWA 3K3DA 1T1CA 4HJ4A 4R38A 4GS9B 1ZHHB 2K31A 2J3TC 4OOMA 2M7UA 3BY8A 4H6JA 4XT2A 4GW9A 2JN7A 3BY9A 3C38A 3R7WB 2PT7A 2Y8HA 4PKYG 4EW7A 3EQUA 4NXEA 1XJ2A 1NRJA 4YWZA 4I39A 3IS2B 4WLAA 4CLCB 2A24A 5MC7A 2VJWA 4MCWA 3NJAA 2L1MA 2OAP1 1OT9A 5K5BA 2QJ5A 5EFWA 5TBMB 3UE6A 2P04A 4II7A 4F3LB 1F5MA 3LR0A 4I5SA 4UQIM 5A8BA 1OJGA 1S67L 1YSPA 3RTYA 5AVFA 3LICA 1NLZA 4L9FA 3EWKA 4MMNA 5J3WA 3B33A 2VEAA 3KSGA 2Y79A 5DF9A 1XFQA 1XJ4A 3S7NA 3MMHA 1WA9A 3A0RA 5IT5A 1NWZA 1XFNA 3JVVA 2I9VA 4PAUA 2O0YA 3LI9A 2OWJA 1BYWA 3F1PB 3EOIA 4EUVA 4GHIB 3MF0A 3F1OB 3DBAA 2KDKA 3LIEA 2W1RA 1G6OA 3T50A 4MN6A 4HNBA 1OTBA 4NKPA 2GX5A 2KX6A 4OOLA 3G6OA 3UMDA 4AFIA 3T4KA 3S7QA 5HDSA 2J3WA 5AJGA 3TRCA 3H7WB 1TS7A 2MJ6A 4Y5FA 3MFXA 4GS9A 4HJ3A 4MDZA 3C30A 3R4KA 3E4OA 5LBRA 1UGUA 3B42A 5F5YA 3F1NB 1T19A 3R7WA 4FOFA 4LPZA 4EERA 3OCNA 1Y28A 4CLCC 4DJ2A 4K08A 1XJ6A 3T4LA 5TJJA 4PKYA 3PR6A 2W3FA 4HP9A 1N9LA 4G3KA 3KX0X 1V9ZA 3CLOA 4B93A 4CLCA 2PHYA 1P9RA 3FC7A 4Z1WA 1MKMA 4GCZA 2VGLM 3PBNA 2VKSA 4MN7A 5TBMA 4EEUA 3LR5A 4KQDA 5I5LA 4Y3IA 5HWWA 1DP8A 3NOUC 1IFQA 3BWLA 2FZ0A 3MQ0A 2XA7S 2OAQ1 4F3LA 3BJNA 4WUJA 4IJGA 1TS8A 2J3TD 4NXFA 3CUEA 4O8GA 3OC2A 4ETXA 3HCYA 2W0NA 4IUKA 3CWFA 5IS1A 4BJPA 1F98A 3UB6A 2HJEA 2OOLA 4HQAA 2O9BA 1X0OA 1S4SA 5HDCA 4Q0HA 3PBOA 4NXGA 4M4XA 1N9NA 3T4QA 3UB7A 3VV4A 2PR5A 4EESA 2K2NA 3NOPC 5CX7A 5J7EA 3B47A 2G7UA 4GHIA 5HZHA 1MZUA 2JKRI 1TD5A 5F68A 2J80A 2O99A 2V9AA 2VLGA 3T4JA 4JGRA 2Z6CA 3CITA 4DMZA 3C2WA 2W3DA 4NEED 1W63M 3EEHA 2B18A 2PD7A 1S66L 5HWVA 2HJ9C 3H7WA 4I3JA 3IBRA 4MN5A 4ETZA 5HPIA 1P97A 3EGDC 3P7NA 3GDIA 3K3CA 3U2AA 3UB9A 3VE4A 1D7EA 2EWWA 1T1BA 2LB5A 2W3HA 1NLYA 2INWA 4P6ZS 1IOUA 5DKKA 3PBSA 3F1NA 1D06A 1VB6A 3LR3A 4HJ6A 4GLQA 3TJZC 3E0YA 4LLOB 4DN0A 5DJTA 1YKDA 1OTAA 2DMWA 2ZMFA 4CQHA 1LL8A 1DP9A 2VA0A 1LT0A 3VE3A 4Q0JA 3E4PA 3PYPA 5KIZA 3ICYA 3EQVA 1STZA 5G4ZA 1ZTUA 3NHQA 4LRYC 1UWNX 3CI6A 4I3IA 2KOIA 2YKHA 3EEAA 2W3GA 4BBVA 2W1TB 3JVUA 2XRNA 4WEJA 2YKFA 4CLCE 4EXOA 4NXBA 4LRXC 3P01A 3MR0A 3S7PA 5G4YA 5DFYA 3KYZA 1H8MA 3KSIA 2ZOHA 3HJKA 2V0WA 2NUTC 4R3AA 1TS6A 4E04A 4G3WA 4HI4A 4QPRA 2GNXA 1LSXA 1OJ5A 4R70A 3IS2A 2XROA 2KLIA 4HH2A 3LR4A 3KO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOI A;  1XJ3 A;  4EQ1 A;  3LID A;  3LI8 A;  4R6L A;  2JHE A;  2D01 A;  2P7J A;  1OTE A;  4DJ3 A;  2V1B A;  2EA9 A;  2B02 A;  2PYR A;  5HD5 A;  3A0S A;  1V9Y A;  4B9O A;  2M1C A;  5IU1 A;  3NOT C;  5HSQ A;  1GSW A;  2PR6 A;  3F1P A;  3F1O A;  1S1Y A;  4L9G A;  4I38 A;  4KUO A;  5HWT A;  3H82 B;  2QJ7 A;  4EET B;  3H9W A;  3LIB A;  4HOI A;  3D72 A;  4HP4 A;  1P0Z A;  2K7S A;  4JGQ A;  2WKR A;  5F6A A;  3MQQ A;  3UB8 A;  2VV6 A;  3A0V A;  4H6J B;  4XT2 B;  3PHY A;  1UWP X;  4WF0 A;  1KOU A;  2VV7 A;  5HDD A;  1T1A A;  3C8C A;  5F69 A;  4HY8 A;  3LIA A;  2R78 A;  4BBU A;  2V0U A;  2W27 A;  2PDR A;  1TS0 A;  2A24 B;  1G28 A;  4WL9 A;  3OLO A;  3UME A;  1F9I A;  2D02 A;  4EEP A;  4LRZ E;  1JNU A;  2QKP A;  4KUK A;  2GJ3 A;  2HV1 A;  4BBT A;  1DP6 A;  3HJI A;  3E4Q A;  4RQ9 A;  1S1Z A;  1OT6 A;  3SW1 A;  5DKL A;  5HD3 A;  2PYP A;  2ZBB A;  2VV8 A;  1OTI A;  5J4E A;  3LIF A;  3MXQ A;  1GSX A;  1ODV A;  1EW0 A;  1T18 A;  1OTD A;  2L4R A;  3FG8 A;  4WN5 A;  2BAS A;  1LSW A;  4HH3 A;  4HIA A;  3MJQ A;  3ULF A;  4JGP A;  2L0W A;  3GEC A;  2H28 A;  2Z6D A;  3RH8 B;  3ZQ5 A;  3LYX A;  4JGO A;  5AVE A;  4I3A A;  1S4R A;  5DJU A;  1DRM A;  3MQO A;  4HHD A;  3H82 A;  2OWH A;  2PD8 A;  2WKP A;  3CAX A;  1N9O A;  2CMN A;  2V1A A;  1LSV A;  4L9E A;  1GSV A;  3VOL A;  2WKQ A;  2QHK A;  3LUQ A;  2QWS A;  3K3D A;  1T1C A;  4HJ4 A;  4R38 A;  4GS9 B;  3BY8 A;  4H6J A;  4XT2 A;  4GW9 A;  2JN7 A;  3BY9 A;  4PKY G;  4EW7 A;  4NXE A;  1XJ2 A;  4YWZ A;  4I39 A;  3IS2 B;  4WLA A;  2A24 A;  3NJA A;  2L1M A;  1OT9 A;  2QJ5 A;  5EFW A;  5TBM B;  3UE6 A;  4F3L B;  4I5S A;  5A8B A;  1OJG A;  1S67 L;  3RTY A;  5AVF A;  3LIC A;  5J3W A;  4L9F A;  3EWK A;  3B33 A;  2VEA A;  1XFQ A;  1XJ4 A;  1WA9 A;  3A0R A;  1NWZ A;  1XFN A;  2I9V A;  3LI9 A;  2OWJ A;  1BYW A;  3F1P B;  4GHI B;  3F1O B;  2KDK A;  3LIE A;  3T50 A;  4MN6 A;  4HNB A;  1OTB A;  2KX6 A;  3G6O A;  3UMD A;  5HDS A;  3H7W B;  1TS7 A;  3MFX A;  4GS9 A;  4HJ3 A;  3E4O A;  1UGU A;  5F5Y A;  3F1N B;  1T19 A;  4LPZ A;  4EER A;  1Y28 A;  4DJ2 A;  4K08 A;  1XJ6 A;  4PKY A;  4HP9 A;  1N9L A;  3KX0 X;  1V9Z A;  3CLO A;  2PHY A;  3FC7 A;  4GCZ A;  5TBM A;  4EEU A;  4KQD A;  5I5L A;  5HWW A;  1DP8 A;  3NOU C;  3BWL A;  4F3L A;  4WUJ A;  1TS8 A;  4NXF A;  2W0N A;  3CWF A;  5IS1 A;  1F98 A;  3UB6 A;  2OOL A;  4HQA A;  1X0O A;  1S4S A;  5HDC A;  4NXG A;  4M4X A;  1N9N A;  3UB7 A;  2PR5 A;  4EES A;  3NOP C;  5J7E A;  4GHI A;  5HZH A;  1MZU A;  5F68 A;  2J80 A;  2V9A A;  2VLG A;  4JGR A;  2Z6C A;  3C2W A;  3EEH A;  2PD7 A;  1S66 L;  5HWV A;  3H7W A;  4I3J A;  3IBR A;  4MN5 A;  1P97 A;  3P7N A;  3GDI A;  3K3C A;  3UB9 A;  3VE4 A;  1D7E A;  1T1B A;  2INW A;  5DKK A;  3F1N A;  1D06 A;  1VB6 A;  4HJ6 A;  4LLO B;  5DJT A;  1OTA A;  1LL8 A;  1DP9 A;  1LT0 A;  3VE3 A;  3E4P A;  3PYP A;  5KIZ A;  3ICY A;  5G4Z A;  3NHQ A;  4LRY C;  1UWN X;  4I3I A;  2YKH A;  4BBV A;  2YKF A;  4EXO A;  4NXB A;  4LRX C;  3MR0 A;  5G4Y A;  2ZOH A;  3HJK A;  2V0W A;  4R3A A;  1TS6 A;  4E04 A;  4HI4 A;  1LSX A;  1OJ5 A;  4R70 A;  3IS2 A;  4HH2 A; 
#chains in the Genus database with same CATH topology
 3LFV A;  4OPR A;  4FSF A;  1Z09 A;  5GLA A;  1TDG A;  4C6Y A;  1A0K A;  3LI8 A;  4R6L A;  4YOF A;  3OPP A;  3PXP A;  3UE1 A;  1W8Q A;  3A3E A;  3BQ8 A;  2BTF P;  2IWB A;  1ES4 A;  2PYR A;  1YLJ A;  3GVB A;  5HD5 A;  3BEC A;  4S2N C;  3SH8 A;  5FQ9 A;  3A3J A;  4B9O A;  2M1C A;  3T4S A;  5IU1 A;  3NOT C;  4JKT A;  3V3R A;  2BLS A;  1K6R A;  3F1P A;  4HBT A;  3BLM A;  5HFO A;  3V67 A;  1IYP A;  3D9Y A;  2B5R A;  3H82 B;  1DY6 A;  5FI2 A;  3JPU A;  5FAP A;  1L3L A;  3FPV A;  2XH9 A;  3D72 A;  2K7S A;  5F6A A;  5L07 A;  2J8Y A;  3RFB A;  4H6J B;  4XT2 B;  3PHY A;  3BFC A;  3LEZ A;  1KOU A;  2VV7 A;  1T1A A;  3KYE A;  3O3V A;  1H8Z A;  2B95 A;  2V0U A;  1NXY A;  1YAX A;  3UE0 A;  1TS0 A;  4WL9 A;  2HP6 A;  1H5X A;  3UME A;  3ZG9 B;  5CGX A;  4X6T A;  5FA7 A;  2D02 A;  5DF8 A;  2IWC A;  2M7V A;  4EEP A;  4LRZ E;  2QKP A;  4DKI A;  3IWQ A;  2Y2G A;  4G3V A;  4ZBE A;  3CG5 A;  1IKI A;  3SW1 A;  4BLM A;  3BFD A;  3D3O A;  3E98 A;  5DF7 A;  1OTI A;  5J4E A;  3LIF A;  4OON A;  3MXQ A;  1H3Q A;  2EFX A;  3Q1F A;  4S2O A;  2Q0O A;  2W3E A;  1OTD A;  3ZNY A;  3LEQ A;  1ES3 A;  3P09 A;  3MJQ A;  1K56 D;  4S2I A;  2H28 A;  1C3B A;  5KSH A;  5GLB A;  1J9M A;  4EWF A;  5EVI C;  4GOG A;  3K2N A;  4JGO A;  5AVE A;  3HRE A;  5DJU A;  3OBF A;  4HHD A;  3H82 A;  3GMW A;  2V1A A;  4K0W A;  2A3U A;  2XGN A;  3ITB A;  5DVA A;  5FL3 A;  1XP4 A;  4YNR A;  3LUQ A;  2QWS A;  3IWO A;  1T1C A;  4JF5 A;  1IEL A;  2K31 A;  4H6J A;  4XT2 A;  4GW9 A;  5FDS A;  3C38 A;  1EI5 A;  3R7W B;  2PT7 A;  4NXE A;  4KZ9 A;  1IKG A;  3VFH A;  2Y2P A;  3G4P A;  4WLA A;  5MC7 A;  3M6H A;  4LV1 A;  1XPB A;  1AXB A;  2L1M A;  4M3K A;  1QMF A;  5K5B A;  5EFW A;  5TBM B;  3CZD A;  4II7 A;  4X25 A;  2PU4 A;  2ZM2 A;  3UDF A;  4F3L B;  1F5M A;  4UQI M;  4JLF A;  2Y59 A;  5FI6 A;  4LCM A;  3RTY A;  4BL3 A;  1PZP A;  1NLZ A;  4L9F A;  4QJG A;  3DAV A;  4Y0U A;  1LI9 A;  1O7E A;  1XJ4 A;  3MMH A;  1NWZ A;  2J9O A;  3LO7 A;  4PAU A;  5A92 A;  3LI9 A;  2OWJ A;  4QHC A;  3F1O B;  2KDK A;  4WZ5 A;  5AQB A;  3T50 A;  4HNB A;  2KX6 A;  2FFF B;  4AFI A;  1K57 A;  5M1A A;  5U47 A;  3TRC A;  2H0T A;  3QNC A;  3NDG A;  4KQQ A;  2EX2 A;  2QMI A;  4KZA A;  1VQQ A;  2ZLY A;  1ONG A;  1QME A;  4MDZ A;  3R4K A;  1KDS A;  1BLP A;  5GHZ A;  3F1N B;  5AQ9 A;  3G2Z A;  3R7W A;  4FOF A;  3OCN A;  4CLC C;  5E2F A;  4GZB A;  4PKY A;  3PR6 A;  4H8R A;  4IVK A;  4X1L A;  4X68 A;  1JVJ A;  1ESI A;  3MBZ A;  5A91 A;  4UA9 A;  1KVL A;  3U4L P;  1CEF A;  4MN7 A;  5TBM A;  4ID4 A;  2JKG A;  5I5L A;  3CPT B;  4Y3I A;  5HWW A;  3MQ0 A;  4F3L A;  2OAQ 1;  1BLH A;  3PTE A;  4DE3 A;  4NXF A;  5GHX A;  3CUE A;  3OC2 A;  3C7V A;  3CWF A;  4BJP A;  1F98 A;  3PAE A;  3W8K A;  4QU3 A;  4HQA A;  1AWI A;  2EX6 A;  5EE8 A;  3ISG A;  2O9B A;  3P98 A;  1RCJ A;  1X0O A;  2HP5 A;  1S4S A;  4LEN A;  4Q0H A;  1W5D A;  4NXG A;  5HAQ A;  3UB7 A;  3VV4 A;  3HLB A;  2H0Y A;  2JBF A;  3B47 A;  3IH9 A;  4UAA A;  1FCN A;  5F82 A;  5HZH A;  1FQG A;  3AGE A;  5F68 A;  1CF0 A;  1ERO A;  2O99 A;  3T4J A;  4JGR A;  2Z6C A;  3CIT A;  1IYO A;  4UA6 A;  4IBR A;  2OLV A;  1W63 M;  3EEH A;  2B18 A;  2X71 A;  1SKO B;  4EUZ A;  5JYP A;  1DJA A;  4I3J A;  2V8C A;  3D4F A;  4DF6 A;  3QP2 A;  3P7N A;  3UB9 A;  1D7E A;  4R3B A;  3B3X A;  3C7U A;  4PM7 A;  3F1N A;  1I5Q A;  4X69 A;  1N4O A;  5BOH A;  4DXB A;  1LL8 A;  1DP9 A;  1RGY A;  3QNB A;  1N9B A;  1L0D A;  3PYP A;  5KIZ A;  3S22 A;  2H10 A;  3G2Y A;  4LRY C;  5E2E A;  2W3G A;  5FAS A;  2YKF A;  3IHB A;  4EXO A;  3N6I A;  3S7P A;  2VGK A;  5DFY A;  3KYZ A;  3KSI A;  3HLD A;  1GA9 A;  4YFM A;  3WS5 A;  3HJK A;  2V0W A;  1GHI A;  4S2M A;  1K54 A;  4E04 A;  5HAR A;  4G3W A;  4HI4 A;  4U3T A;  1LSX A;  1J3W A;  3QHY A;  3KO6 A;  1NYM A;  1XJ3 A;  3DTM A;  5EVE A;  3MKF A;  4WEL A;  1K56 A;  3I7J A;  4EU0 A;  3A3F A;  5DTK A;  2JKT I;  5E2H A;  5CHU A;  3LID A;  3PBT A;  2XEP A;  4XUX A;  3HUN A;  2JHE A;  3UY6 A;  2WGV A;  2D01 A;  3IF6 C;  2P7J A;  1OTE A;  1SKO A;  1OPX A;  2B02 A;  2EA9 A;  1MBL A;  3KYQ A;  4R4R A;  3HL9 A;  4ARZ B;  4U0X A;  1YLZ A;  3A0S A;  1V9Y A;  5FI7 A;  5HSQ A;  1GSW A;  4UQI S;  2PR6 A;  4KQO A;  4S2N A;  1H8Y A;  1FR6 A;  4L9G A;  4WEK A;  4PM5 A;  4KUO A;  5HWT A;  5CRF A;  2QYB A;  5EVI B;  3FPW A;  1ONH A;  2V8F A;  5HPF A;  1XGJ A;  1K4E A;  4HOI A;  4F94 A;  1MPL A;  5EPH A;  3MQQ A;  3UE3 A;  2J9P A;  1XX2 A;  5DTS A;  4ZJ1 A;  4S2P A;  1FIL A;  4OH0 A;  1JWZ A;  1L0F A;  5HDD A;  3ZG8 B;  5F69 A;  1Y54 A;  4HY8 A;  4S2J A;  2WGW B;  3TW8 A;  4OPQ A;  4JXW A;  2IA2 A;  2ZQC A;  2W27 A;  2HF6 A;  2H5S A;  1PW8 A;  2P9V A;  1G28 A;  3BQA A;  3RXX A;  4QY5 A;  3VP2 A;  2HDU A;  5AQA A;  1W63 Q;  3HJI A;  4O01 A;  4X1M A;  4Y2F A;  4Q8I A;  2VV8 A;  3SS5 A;  3GTC A;  3G32 A;  3QP5 A;  1EW0 A;  4ARZ A;  3NUL A;  1T18 A;  1MWU A;  2XDM A;  4YIN A;  3VP4 A;  5CGS A;  4Q0I A;  4HIA A;  1YMS A;  4X55 A;  3ULF A;  4JGP A;  3GEC A;  1PZO A;  2Z6D A;  3A3I A;  4OKP A;  3LYX A;  5FQK A;  2JCH A;  3IBJ A;  1S4R A;  1P9W A;  2AVX A;  1NZO A;  1DRM A;  4IHQ A;  3ZYT A;  3KSF A;  1K55 A;  5EVI A;  3EGX C;  1ALQ A;  2J7V A;  1LSV A;  3LGO A;  2XSS A;  3WS4 A;  2V1Z A;  3T4T A;  2VZW A;  3K3D A;  4HJ4 A;  1K38 A;  4GS9 B;  4KZ7 A;  1M6K A;  4OOM A;  2M7U A;  2WYX A;  2Y8H A;  4PKY G;  1K6S A;  4R1G A;  3EQU A;  3MZF A;  5L2F A;  2JC7 A;  3UDI A;  1XJ2 A;  2WGW A;  5EV0 A;  1CQA A;  5FAO A;  1NRJ A;  5DTT A;  3T1X A;  4CLC B;  1TVF A;  5HAI A;  2VJW A;  3NJA A;  1DJC A;  2CC1 A;  1PNE A;  1OT9 A;  2ZL1 B;  2QJ5 A;  2VGJ A;  5FEF A;  2I72 A;  2XD5 A;  2P04 A;  1MWS A;  2OSU A;  3O87 A;  2ZQ9 A;  1L2S A;  2HDR A;  5A8B A;  1OJG A;  4IBX A;  1YSP A;  3SS4 A;  4RX3 A;  4JPM A;  5J3W A;  4HBU A;  1GHP A;  3HLW A;  3IF5 A;  3S7N A;  3IXH A;  1WA9 A;  1XFN A;  3BFE A;  4LV3 A;  3JVV A;  4R4S A;  3EOI A;  4GHI B;  4Y7P A;  1YQS A;  5CXW A;  3DBA A;  3LIE A;  1HLU P;  2W1R A;  1G6O A;  2ZQ8 A;  5M18 A;  1W79 A;  1KGG A;  2GX5 A;  2JKF A;  5EEC A;  1LLB A;  4DE1 A;  3NDE A;  2WAE A;  3VP3 A;  4S2K A;  2MJ6 A;  1CI8 A;  3N8S A;  4WYY A;  3MFX A;  4GS9 A;  3AGF A;  3E4O A;  5LBR A;  5F5Y A;  4ZTK A;  4EBL A;  1T19 A;  3HLC A;  1SZV A;  4DDY A;  1ZG4 A;  2XFT A;  1JTG A;  3T4L A;  1VET B;  5EM1 A;  4KG5 A;  3MXR A;  3KX0 X;  1Q2Q A;  3G31 A;  3QP4 A;  4B93 A;  4CLC A;  1P9R A;  3FC7 A;  1KE4 A;  3ZGA B;  1YLW A;  2VGL M;  3MZD A;  3PBN A;  2ZL1 A;  1VEU B;  4EEU A;  4KQD A;  3FKW A;  1DP8 A;  2R9W A;  2RL3 A;  4IJG A;  1TS8 A;  5F1F A;  4O8G A;  4ETX A;  3NEC A;  5A93 A;  4JF6 A;  2W0N A;  5GLD A;  1IYQ A;  2HJE A;  2C6W B;  2G2U A;  4GN2 A;  1XKZ A;  2XLN A;  1CI9 A;  5HDC A;  3L9K A;  3PBO A;  4M4X A;  2FFY A;  2PR5 A;  4EES A;  4GHI A;  3QP1 A;  4OLD A;  4C75 A;  4LCL A;  3V39 A;  5KMW A;  3C2W A;  3HLG A;  3VOZ A;  3FKV A;  2PD7 A;  3W4Q A;  2HJ9 C;  4MN5 A;  5L09 A;  3EGD C;  3U2A A;  3UO9 A;  3PAG A;  3VE4 A;  1T1B A;  2W3H A;  3IF6 B;  2INW A;  3VMA A;  3JYI A;  5DKK A;  3PBS A;  3LR3 A;  4OOY A;  3ZCZ A;  3S1Y A;  3T1S A;  1CJF A;  1XA1 A;  1YKD A;  2ZQA A;  4OP5 A;  3UN7 A;  2DMW A;  2ZMF A;  3OPH A;  1LT0 A;  4E3M A;  2WUQ A;  2VK3 A;  1VET A;  3E4P A;  3EQV A;  1K25 A;  1STZ A;  3MFD A;  3CI6 A;  4I3I A;  2YKH A;  4BL2 A;  2XRN A;  1IYS A;  1HZO A;  2Y2J A;  4DE0 A;  3DW0 A;  2ZOH A;  3HUO A;  4X53 A;  4R3A A;  4S2L A;  1TS6 A;  5EVI D;  4QPR A;  2DNS A;  2R9X A;  2EXA A;  2XRO A;  2KLI A;  3UNW A;  4GDB A;  1WYB A;  4DDS A;  1XA7 A;  5KSC A;  1KDW A;  4QD4 A;  1WYC A;  1PFL A;  3NY4 A;  2EFU A;  1KE0 A;  2EWV A;  1RP5 A;  5CER A;  4Y0O A;  1S0W A;  4N9L A;  3UB5 P;  1ZC2 A;  1YLP A;  1ES2 A;  3HVF A;  2Y2H A;  4DJ3 A;  2V1B A;  3S7O A;  2WZZ A;  2OLU A;  2ZD8 A;  4PM8 A;  3IF6 A;  3MZE A;  1MWT A;  1DJB A;  2JKR M;  2ZC6 B;  2X01 A;  4JXG A;  3ZG0 A;  2HGV A;  3F1O A;  4Y15 A;  2XF3 A;  4I38 A;  2XA7 M;  4OPZ A;  2Y2Q A;  2G2W A;  4EET B;  3Q7V B;  3DTK A;  1VHM A;  1PIO A;  4O0P A;  3IX3 A;  3LIB A;  3V5M A;  4HP4 A;  1BUE A;  2WKR A;  1XXM A;  2WKI A;  2VV6 A;  3A0V A;  4BWI A;  3ZVW A;  3AGD A;  1OME A;  1YT4 A;  4GJ4 A;  1UWP X;  3KSH A;  1IEM A;  4ESP A;  3C8C A;  4HES A;  3LIA A;  4EV4 A;  4XUZ A;  4GD6 A;  4WMC D;  3IT9 A;  2PDR A;  3ZFZ A;  3UPP A;  4JXV A;  1SDN A;  3OLO A;  4Y13 A;  1F9I A;  4E6X A;  2A2L A;  4KUK A;  3O5Y A;  2GJ3 A;  2HV1 A;  1PRQ A;  4BBT A;  1DP6 A;  1MY8 A;  1S1Z A;  3CPT A;  4OLG A;  2NUP C;  3N7W A;  1OT6 A;  3WS2 A;  1HD8 A;  2ZBB A;  1BUL A;  5FAQ A;  3CHW P;  1RGZ A;  2VGL S;  4L0L A;  4CLC D;  2L4R A;  4WN5 A;  2E8J A;  3T12 B;  2BAS A;  2GDN A;  3LCE A;  1W7F A;  3Q81 A;  4FD8 A;  5HL6 A;  4XXR A;  3RH8 B;  3ZQ5 A;  1YM1 A;  5DFX A;  3BW6 A;  1FOF A;  3G30 A;  2OWH A;  2WKP A;  5FAT A;  3CAX A;  5L8M A;  5CGW A;  3Q7V A;  1E3U D;  1L0G A;  3PBQ A;  4L9E A;  1GSV A;  3BRM A;  5C5K A;  4NET A;  2WKQ A;  3CUE C;  2QHK A;  4B4Z A;  1ZHH B;  2J3T C;  5HW3 A;  3BY8 A;  4FH2 A;  3C4P A;  3C4O A;  4B4X A;  3BY9 A;  1G68 A;  3E2K A;  1KVM A;  4EW7 A;  1LL9 A;  2QPN A;  2ZJ9 A;  1JTD A;  4YWZ A;  4KZ4 A;  3IXG A;  4I39 A;  5A90 A;  3IS2 B;  2Z2M B;  3GQZ A;  4E3K A;  4PMA A;  4OQH A;  4LFU A;  4R0Q A;  4K0X A;  3UE6 A;  3N4I A;  3GR2 A;  3GRJ A;  1S67 L;  1KGE A;  4FTX A;  3WWX A;  4MMN A;  3IX8 A;  3KSG A;  2Y79 A;  4CPK A;  4OQ0 A;  4MNR A;  4P85 A;  1BTL A;  5IT5 A;  1LI0 A;  1W8Y A;  3IXD A;  2PBY A;  2I9V A;  4MEZ A;  3UDX A;  2O0Y A;  1YMX A;  3F1P B;  4DRT A;  5EM0 A;  1G5U A;  1O07 A;  3MF0 A;  1ZG6 A;  4KZ3 A;  2EXB A;  3BEB A;  4QB8 A;  4E3N A;  4MN6 A;  4FUW A;  4WZ4 A;  4OOL A;  3S7Q A;  2DRW A;  5AJG A;  2ZQ7 A;  2WKH A;  3G35 A;  3H7W B;  3OZH A;  1TS7 A;  3MSH A;  3IXB A;  5CEC A;  1KE3 A;  1F2K A;  4Y5F A;  5L10 A;  3B42 A;  1YLT A;  2WAD A;  4EER A;  1Y28 A;  4Z9Q A;  4K08 A;  1GHM A;  1XJ6 A;  3VP0 A;  5TJJ A;  3NIA A;  4HP9 A;  1N9L A;  5E43 A;  2Q9N A;  4N92 A;  4G3K A;  1V9Z A;  3CLO A;  4D60 A;  5FSR A;  1HVB A;  4Y17 A;  4EBN A;  1MKM A;  4GCZ A;  2VKS A;  1ERM A;  2UV0 E;  2FZ0 A;  2XA7 S;  2Y2M A;  3FWL A;  4WUJ A;  3BYD A;  2J3T D;  4MLL A;  3CJM A;  3HCY A;  5FQI A;  1FCM A;  1S6R A;  3WS1 A;  3SH7 A;  1HTZ A;  3ZG7 B;  2ZQD A;  5EUA A;  2EX9 A;  1N9N A;  3NI9 A;  4LGW A;  2WKE A;  5HX9 A;  4EQI A;  5FQQ A;  4IVI A;  2PBD P;  3ZVT A;  3IWI A;  1TD5 A;  4GDN A;  1NJ4 A;  1PYY A;  2J80 A;  3QP6 A;  1NRF A;  5EOE A;  4NEE D;  2RCX A;  2BG1 A;  1S66 L;  3VSK A;  3H7W A;  4ETZ A;  1P97 A;  5FQM A;  3GDI A;  3K3C A;  4JF4 A;  2EWW A;  3LY3 A;  2Y4A A;  1IOU A;  2HZ5 A;  5I94 A;  2A49 A;  1VB6 A;  4HJ6 A;  2XK1 A;  3TJZ C;  4P87 A;  4DN0 A;  4FCF A;  2XD1 A;  3NBL A;  4KG6 A;  4OP8 A;  2Y2K A;  2VA0 A;  1GA0 A;  4Q0J A;  3DTE A;  3ICY A;  3NHQ A;  4WMC A;  4BD1 A;  4X56 A;  3ZNT A;  1UWN X;  2C5W B;  2KOI A;  1CK3 A;  2Y91 A;  3EEA A;  3N8L A;  1TDL A;  3UPN A;  4OQI A;  3UPO A;  4BBV A;  2W1T B;  3JVU A;  3P01 A;  3MR0 A;  3QP8 A;  5G4Y A;  1H8M A;  5CHJ A;  1PWG A;  2V20 A;  4IED A;  4P0M A;  1E4D A;  4NG2 A;  3SZT A;  1L0E A;  4E3I A;  1FSW A;  3V50 A;  2EX8 A;  2ZOI A;  1SHV A;  3GSG A;  1K55 C;  1YSQ A;  2FH5 A;  4QWO A;  3TE8 A;  4EQ1 A;  1XGI A;  4U0T A;  4E6W A;  4EBP A;  1K4F A;  4BMW A;  4HEF A;  3OCL A;  3OOV A;  1PI5 A;  2LB9 A;  5CED A;  3N8R A;  3IH8 A;  4N9K A;  1E3U A;  3VSL A;  2V2F F;  4KZ8 A;  3W2Z A;  5CEB A;  4UEY A;  4WBG A;  1ZKJ A;  2PU2 A;  3ZG5 A;  2ACG A;  1YLY A;  2GZA A;  4BEN A;  1S1Y A;  5M19 A;  3IQA A;  4N1H A;  1ERQ A;  1JWV A;  2QJ7 A;  3ZHH A;  4MBK A;  5FEG A;  3H9W A;  5CTN A;  4ME4 A;  1PWC A;  3PBR A;  1P0Z A;  3TG9 A;  4JGQ A;  2W1T A;  4BQM A;  1LHY A;  3UB8 A;  3VOY A;  4WF0 A;  2WAF A;  3ZDJ A;  4R23 A;  1TF1 A;  3T4O A;  2R78 A;  4BBU A;  2O9C A;  3DTI A;  4A5R A;  4OQG A;  2A24 B;  2WZX A;  1JNU A;  2HDS A;  1VEU A;  3E4Q A;  4ZJ2 A;  2XFS A;  2XQZ A;  4RQ9 A;  5GLC A;  1PW1 A;  2DCF A;  3CMZ A;  4P6Z M;  1BT5 A;  2E8I A;  2VX8 A;  1ESU A;  5CHM A;  5DKL A;  5HD3 A;  2PYP A;  3OPL A;  4OPY A;  2ZMV A;  1SDE A;  3BLS A;  1FCO A;  3HBR A;  1GSX A;  1ODV A;  4IUH A;  1BLC A;  4PHT A;  3FG8 A;  4BD0 A;  1LSW A;  4HH3 A;  1MWR A;  2Y2O A;  2Y2I A;  1MC0 A;  2L0W A;  2Q9M A;  3VP1 A;  2JKT M;  2ZC7 A;  3NC8 A;  1KGF A;  4I3A A;  4CJN A;  3RJU A;  3MQO A;  4C3Q A;  2PD8 A;  4ZRR A;  4B88 A;  1N9O A;  5TFQ A;  2CMN A;  1NZU A;  3BFF A;  1LL5 A;  1Y4O A;  3VOL A;  2P08 A;  2WGI A;  2O9A A;  2HPB A;  3ITA A;  4DXC A;  5GL9 A;  5GHY A;  4R38 A;  4Y0T A;  1BSG A;  3HLF A;  5FDH A;  4KZB A;  4MBH A;  2JN7 A;  1NY0 A;  5TGF A;  1VM1 A;  4RA7 A;  1U60 A;  5HL1 A;  4KEN B;  2Y2N A;  4KQR A;  1ES5 A;  2A24 A;  3DWZ A;  4LV2 A;  5TR7 A;  4MCW A;  2WK0 A;  4D2O A;  2XR0 A;  2OAP 1;  1SKF A;  2X02 A;  3W4P A;  1H0M A;  2PAV P;  1SCW A;  3LR0 A;  4I5S A;  1PWD A;  2OV5 A;  5AVF A;  3O86 A;  3LIC A;  4E3O A;  4E3J A;  3MS6 A;  3NCK A;  3EWK A;  4RVA A;  3T1Q B;  3B33 A;  2VEA A;  1M40 A;  4PM9 A;  5DF9 A;  3RXW A;  1XFQ A;  2ZC5 B;  3E2L A;  3A0R A;  3G34 A;  4WZ5 C;  2ZC3 B;  1BYW A;  4GD8 A;  3MXS A;  4EUV A;  4ZAM A;  1K57 C;  3WS0 A;  4E3L A;  4K91 A;  3TOI A;  1OTB A;  4NKP A;  4PPR A;  5CTM A;  3G6O A;  3UMD A;  3T4K A;  3HLE A;  5HDS A;  2J3W A;  3C5A A;  2ZM8 A;  4DE2 A;  4MBF A;  3WRZ A;  4HJ3 A;  3BM6 A;  3C30 A;  1BZA A;  5J8X A;  1UGU A;  1TEM A;  2HDQ A;  3BFG A;  5FQJ A;  4LPZ A;  5HAP A;  4DJ2 A;  1NYY A;  3A3D A;  3Q7Z A;  1G6A A;  2W3F A;  3HUM A;  1FIK A;  5EOO A;  2P9V B;  5G18 A;  3DWK A;  5KZH A;  2P74 A;  2PHY A;  3M2J A;  4P6B A;  3Q82 A;  4Z1W A;  3VFF A;  3Q07 A;  2QZ6 A;  1CEG A;  4ZJ3 A;  3FV7 A;  1BLS A;  3LR5 A;  2ZM0 A;  3NOU C;  1IFQ A;  3BWL A;  2JE5 A;  3TSG A;  2UWX A;  3BJN A;  1I2W A;  2Y2L A;  3T1R A;  1I2S A;  4IUK A;  4N1X A;  4LV0 A;  1YPR A;  5IS1 A;  3UB6 A;  4ZDX A;  4JBF A;  2OOL A;  2Y55 A;  5EVL A;  1FR1 A;  5E2G A;  1ACF A;  4KG2 A;  4RX2 A;  4GKU A;  3L7H A;  4QY6 A;  3FZC A;  3T4Q A;  2K2N A;  5D3O A;  3NOP C;  5CX7 A;  3IX4 A;  5J7E A;  3IHA A;  3SOI A;  2G7U A;  3MKE A;  2ZMA A;  1MZU A;  4RYE A;  2JKR I;  3OPR A;  2V9A A;  2VLG A;  4GNU A;  4PM6 A;  3SS3 A;  1MKI A;  4DMZ A;  2W3D A;  5HWV A;  2ZC4 B;  5HPI A;  3IBR A;  5F1G A;  4WM9 A;  2IWD A;  1D1J A;  4GB7 A;  3SH9 A;  3M2K A;  4OVD A;  2LB5 A;  1PI4 A;  1Z6F A;  3GV9 A;  1NLY A;  4P6Z S;  3O88 A;  4UHU A;  5AQ7 A;  4R3J A;  1D06 A;  4GLQ A;  3E0Y A;  4LLO B;  4O7D A;  5DJT A;  4KZ5 A;  1OTA A;  4CQH A;  3S4X A;  1MXO A;  1WE4 A;  2Z2L B;  3VE3 A;  2HP9 A;  3WRT A;  1K0K A;  1FSY A;  5G4Z A;  1ZTU A;  4UA7 A;  4FH4 A;  1Q2P A;  1EWZ A;  3M6B A;  5JYO A;  4WEJ A;  4CLC E;  4NXB A;  4LRX C;  3FYZ A;  3LY4 A;  1K54 C;  5F83 A;  3V3S A;  1E25 A;  1GCE A;  2PRF A;  4JXS A;  4KZ6 A;  2NUT C;  4NK3 A;  3W4O A;  2GNX A;  4R70 A;  1OJ5 A;  5IHV A;  3IS2 A;  1JWP A;  4HH2 A;  3LR4 A; 
#chains in the Genus database with same CATH homology
 3LFV A;  2ZOI A;  4FSF A;  1XJ3 A;  1YSQ A;  2EWV A;  4WEL A;  4EU0 A;  2FH5 A;  3TE8 A;  4EQ1 A;  2JKT I;  3LID A;  3LI8 A;  3PBT A;  4R6L A;  4YOF A;  4BMW A;  3OCL A;  3OOV A;  3PXP A;  2JHE A;  2D01 A;  2LB9 A;  2P7J A;  1OTE A;  4DJ3 A;  2V1B A;  3BQ8 A;  1OPX A;  2B02 A;  2EA9 A;  3KYQ A;  2PYR A;  3S7O A;  3W2Z A;  5HD5 A;  4ARZ B;  3A0S A;  1V9Y A;  4B9O A;  2M1C A;  4UEY A;  3T4S A;  5IU1 A;  3NOT C;  5HSQ A;  1GSW A;  4UQI S;  2JKR M;  2PR6 A;  4KQO A;  3F1P A;  2GZA A;  2HGV A;  3F1O A;  1S1Y A;  4L9G A;  4WEK A;  3V67 A;  4I38 A;  2XA7 M;  4KUO A;  5HWT A;  3H82 B;  2QJ7 A;  4EET B;  2QYB A;  3FPW A;  3H9W A;  5HPF A;  3FPV A;  1VHM A;  4O0P A;  3LIB A;  4ME4 A;  4HOI A;  3D72 A;  4HP4 A;  3PBR A;  1P0Z A;  2K7S A;  4JGQ A;  2WKR A;  5F6A A;  3MQQ A;  3UE3 A;  2W1T A;  3UB8 A;  4BWI A;  2VV6 A;  3A0V A;  3RFB A;  4H6J B;  4XT2 B;  3PHY A;  4GJ4 A;  1UWP X;  4WF0 A;  1KOU A;  3KSH A;  2VV7 A;  5HDD A;  1T1A A;  3C8C A;  5F69 A;  1TF1 A;  4HY8 A;  3T4O A;  3LIA A;  2R78 A;  3TW8 A;  4BBU A;  2V0U A;  2IA2 A;  2W27 A;  2O9C A;  1YAX A;  2HF6 A;  2PDR A;  1TS0 A;  2A24 B;  1G28 A;  3BQA A;  4WL9 A;  3OLO A;  3UME A;  1F9I A;  2D02 A;  2M7V A;  4EEP A;  4LRZ E;  1JNU A;  2A2L A;  2QKP A;  3O5Y A;  4KUK A;  2GJ3 A;  1W63 Q;  2HV1 A;  4BBT A;  1DP6 A;  4G3V A;  3HJI A;  3E4Q A;  4O01 A;  4Y2F A;  4RQ9 A;  1S1Z A;  4P6Z M;  2NUP C;  1OT6 A;  2VX8 A;  3SW1 A;  3D3O A;  3E98 A;  5DKL A;  5HD3 A;  2PYP A;  2ZBB A;  2VV8 A;  1OTI A;  2ZMV A;  5J4E A;  3LIF A;  3MXQ A;  1GSX A;  1H3Q A;  1ODV A;  4IUH A;  1EW0 A;  2VGL S;  4L0L A;  4ARZ A;  4CLC D;  1T18 A;  2W3E A;  1OTD A;  4PHT A;  2L4R A;  3FG8 A;  4WN5 A;  2BAS A;  1LSW A;  4HH3 A;  4Q0I A;  4HIA A;  3MJQ A;  3ULF A;  4JGP A;  1MC0 A;  2L0W A;  3GEC A;  2H28 A;  5HL6 A;  2Z6D A;  2JKT M;  5KSH A;  3RH8 B;  3ZQ5 A;  3LYX A;  5DFX A;  3BW6 A;  3K2N A;  4JGO A;  3IBJ A;  4I3A A;  1S4R A;  5AVE A;  1P9W A;  5DJU A;  3OBF A;  1DRM A;  4IHQ A;  3MQO A;  4HHD A;  3H82 A;  3ZYT A;  2OWH A;  2PD8 A;  2WKP A;  3KSF A;  4ZRR A;  3CAX A;  1N9O A;  5L8M A;  2CMN A;  2V1A A;  3EGX C;  3PBQ A;  1LSV A;  4L9E A;  1GSV A;  3VOL A;  2P08 A;  2O9A A;  5C5K A;  2XSS A;  5FL3 A;  2WKQ A;  3CUE C;  4YNR A;  2QHK A;  3LUQ A;  2QWS A;  3T4T A;  2VZW A;  3K3D A;  1T1C A;  4HJ4 A;  4R38 A;  4GS9 B;  1ZHH B;  2K31 A;  2J3T C;  4OOM A;  2M7U A;  3BY8 A;  4H6J A;  4XT2 A;  4GW9 A;  2JN7 A;  3BY9 A;  3C38 A;  3R7W B;  2PT7 A;  2Y8H A;  4PKY G;  4EW7 A;  3EQU A;  4NXE A;  1XJ2 A;  1NRJ A;  4YWZ A;  4I39 A;  3IS2 B;  4WLA A;  4CLC B;  2A24 A;  5MC7 A;  2VJW A;  4MCW A;  3NJA A;  2L1M A;  2OAP 1;  1OT9 A;  5K5B A;  2QJ5 A;  5EFW A;  5TBM B;  3UE6 A;  2P04 A;  4II7 A;  4F3L B;  1F5M A;  3LR0 A;  4I5S A;  4UQI M;  5A8B A;  1OJG A;  1S67 L;  1YSP A;  3RTY A;  5AVF A;  3LIC A;  1NLZ A;  4L9F A;  3EWK A;  4MMN A;  5J3W A;  3B33 A;  2VEA A;  3KSG A;  2Y79 A;  5DF9 A;  1XFQ A;  1XJ4 A;  3S7N A;  3MMH A;  1WA9 A;  3A0R A;  5IT5 A;  1NWZ A;  1XFN A;  3JVV A;  2I9V A;  4PAU A;  2O0Y A;  3LI9 A;  2OWJ A;  1BYW A;  3F1P B;  3EOI A;  4EUV A;  4GHI B;  3MF0 A;  3F1O B;  3DBA A;  2KDK A;  3LIE A;  2W1R A;  1G6O A;  3T50 A;  4MN6 A;  4HNB A;  1OTB A;  4NKP A;  2GX5 A;  2KX6 A;  4OOL A;  3G6O A;  3UMD A;  4AFI A;  3T4K A;  3S7Q A;  5HDS A;  2J3W A;  5AJG A;  3TRC A;  3H7W B;  1TS7 A;  2MJ6 A;  4Y5F A;  3MFX A;  4GS9 A;  4HJ3 A;  4MDZ A;  3C30 A;  3R4K A;  3E4O A;  5LBR A;  1UGU A;  3B42 A;  5F5Y A;  3F1N B;  1T19 A;  3R7W A;  4FOF A;  4LPZ A;  4EER A;  3OCN A;  1Y28 A;  4CLC C;  4DJ2 A;  4K08 A;  1XJ6 A;  3T4L A;  5TJJ A;  4PKY A;  3PR6 A;  2W3F A;  4HP9 A;  1N9L A;  4G3K A;  3KX0 X;  1V9Z A;  3CLO A;  4B93 A;  4CLC A;  2PHY A;  1P9R A;  3FC7 A;  4Z1W A;  1MKM A;  4GCZ A;  2VGL M;  3PBN A;  2VKS A;  4MN7 A;  5TBM A;  4EEU A;  3LR5 A;  4KQD A;  5I5L A;  4Y3I A;  5HWW A;  1DP8 A;  3NOU C;  1IFQ A;  3BWL A;  2FZ0 A;  3MQ0 A;  2XA7 S;  2OAQ 1;  4F3L A;  3BJN A;  4WUJ A;  4IJG A;  1TS8 A;  2J3T D;  4NXF A;  3CUE A;  4O8G A;  3OC2 A;  4ETX A;  3HCY A;  2W0N A;  4IUK A;  3CWF A;  5IS1 A;  4BJP A;  1F98 A;  3UB6 A;  2HJE A;  2OOL A;  4HQA A;  2O9B A;  1X0O A;  1S4S A;  5HDC A;  4Q0H A;  3PBO A;  4NXG A;  4M4X A;  1N9N A;  3T4Q A;  3UB7 A;  3VV4 A;  2PR5 A;  4EES A;  2K2N A;  3NOP C;  5CX7 A;  5J7E A;  3B47 A;  2G7U A;  4GHI A;  5HZH A;  1MZU A;  2JKR I;  1TD5 A;  5F68 A;  2J80 A;  2O99 A;  2V9A A;  2VLG A;  3T4J A;  4JGR A;  2Z6C A;  3CIT A;  4DMZ A;  3C2W A;  2W3D A;  4NEE D;  1W63 M;  3EEH A;  2B18 A;  2PD7 A;  1S66 L;  5HWV A;  2HJ9 C;  3H7W A;  4I3J A;  3IBR A;  4MN5 A;  4ETZ A;  5HPI A;  1P97 A;  3EGD C;  3P7N A;  3GDI A;  3K3C A;  3U2A A;  3UB9 A;  3VE4 A;  1D7E A;  2EWW A;  1T1B A;  2LB5 A;  2W3H A;  1NLY A;  2INW A;  4P6Z S;  1IOU A;  5DKK A;  3PBS A;  3F1N A;  1D06 A;  1VB6 A;  3LR3 A;  4HJ6 A;  4GLQ A;  3TJZ C;  3E0Y A;  4LLO B;  4DN0 A;  5DJT A;  1YKD A;  1OTA A;  2DMW A;  2ZMF A;  4CQH A;  1LL8 A;  1DP9 A;  2VA0 A;  1LT0 A;  3VE3 A;  4Q0J A;  3E4P A;  3PYP A;  5KIZ A;  3ICY A;  3EQV A;  1STZ A;  5G4Z A;  1ZTU A;  3NHQ A;  4LRY C;  1UWN X;  3CI6 A;  4I3I A;  2KOI A;  2YKH A;  3EEA A;  2W3G A;  4BBV A;  2W1T B;  3JVU A;  2XRN A;  4WEJ A;  2YKF A;  4CLC E;  4EXO A;  4NXB A;  4LRX C;  3P01 A;  3MR0 A;  3S7P A;  5G4Y A;  5DFY A;  3KYZ A;  1H8M A;  3KSI A;  2ZOH A;  3HJK A;  2V0W A;  2NUT C;  4R3A A;  1TS6 A;  4E04 A;  4G3W A;  4HI4 A;  4QPR A;  2GNX A;  1LSX A;  1OJ5 A;  4R70 A;  3IS2 A;  2XRO A;  2KLI A;  4HH2 A;  3LR4 A;  3KO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...