4HOIA

Crystal structure of pas domain from the mouse eag1 potassium channel
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
SHMTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEVMQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQDKVVLFLCTFSDITAFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural properties of PAS domains from the KCNH potassium channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium voltage-gated channel subfamily H member 1
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hoiA00
4EETB 5J3WA 2OWJA 2V0UA 3SW1A 2J80A 1XJ4A 4GS9A 1GSXA 3D72A 4HH2A 4KQDA 1XFQA 1NWZA 1X0OA 3F1PA 3ULFA 2KX6A 5HZHA 1D06A 4BBVA 1ODVA 4RQ9A 4EESA 2PYRA 2PYPA 1TS7A 3HJIA 2VV6A 5HD5A 3VE4A 3LI8A 1LL8A 3LIEA 4GS9B 4LPZA 5HWWA 3UB9A 1DP8A 4WL9A 3CAXA 1S67L 5HDSA 3UMDA 3G6OA 4EEPA 3P7NA 2I9VA 2V9AA 3C8CA 3K3DA 3H82B 3IS2A 4GCZA 4GW9A 4HI4A 4L9FA 2M1CA 1UWNX 2YKFA 4MN6A 4HIAA 3CLOA 2PDRA 4EEUA 5I5LA 1GSVA 1OJ5A 1T1BA 2V0WA 3E4PA 4JGPA 3UMEA 4F3LA 4I39A 1DP9A 2ZOHA 2VEAA 4JGRA 2INWA 4R38A 4YWZA 2Z6DA 3PYPA 1V9ZA 3FG8A 3LUQA 3MXQA 3UB8A 4NXBA 5DKLA 3RTYA 3B33A 4DJ3A 2QHKA 1T19A 3F1OA 2VLGA 3LI9A 1LSWA 2PHYA 2CMNA 5F5YA 5HWTA 4I5SA 3CWFA 3NJAA 5J4EA 2H28A 3LIBA 1N9LA 1OTDA 1OJGA 3F1NA 1OTIA 4MN5A 4WF0A 2QWSA 5HWVA 4HQAA 5AVFA 1P97A 4XT2B 1DP6A 1UWPX 5EFWA 2L0WA 5TBMB 3T50A 4LRXC 3A0RA 3KX0X 3LIFA 3LYXA 5DJTA 4I3AA 5HSQA 2R78A 2V1BA 4HP9A 1D7EA 1LSXA 1S1ZA 1S4RA 1UGUA 5AVEA 2W0NA 1OT6A 4EW7A 2VV7A 2QKPA 4BBTA 4HOIA 3OLOA 1EW0A 2D01A 1XFNA 2JN7A 2Z6CA 2YKHA 1LT0A 2PD7A 2ZBBA 1OTAA 3MQOA 2L4RA 4M4XA 2WKQA 2BASA 3VE3A 1MZUA 2ZOIA 1T18A 3BY8A 1XJ6A 3EWKA 3GECA 3H7WA 2VV8A 3MJQA 3NOPC 5F6AA 4WUJA 2L1MA 3NOTC 4PKYG 1JNUA 1BYWA 1G28A 2OOLA 3E4OA 2EA9A 4GHIB 3K3CA 4H6JA 4HY8A 2A24B 3MFXA 1T1AA 3LIAA 4LRZE 2B02A 1OTBA 2QJ5A 4R3AA 3UB7A 2PR6A 4HH3A 4PKYA 3BY9A 4E04A 1F9IA 1LSVA 1XJ3A 2PD8A 2WKRA 1T1CA 5KIZA 1TS8A 3RH8B 4F3LB 1TS0A 4K08A 1S4SA 2HV1A 4GHIA 1OTEA 4H6JB 4NXEA 5TBMA 4EERA 5F69A 4JGOA 5G4ZA 2V1AA 3IS2B 3NHQA 1F98A 1TS6A 3NOUC 3H82A 4HP4A 4KUOA 5HDCA 5J7EA 4I38A 3ICYA 4HNBA 2OWHA 4NXGA 3F1OB 3C2WA 4I3JA 4JGQA 5HD3A 3VOLA 4BBUA 3F1NB 4LLOB 2P7JA 3PHYA 4LRYC 4WLAA 5G4YA 3UB6A 4I3IA 3GDIA 3UE6A 1VB6A 4WN5A 3A0SA 2W27A 1WA9A 3MQQA 3LICA 5F68A 1V9YA 1S1YA 3E4QA 2D02A 3A0VA 4R70A 3ZQ5A 3H9WA 5IU1A 1XJ2A 3IBRA 4DJ2A 3HJKA 3MR0A 4EQ1A 1N9NA 2KDKA 2PR5A 4NXFA 4HJ3A 2WKPA 4HJ4A 1S66L 4R6LA 1DRMA 4HJ6A 5HDDA 1N9OA 2A24A 4L9GA 1KOUA 4L9EA 3BWLA 4XT2A 2K7SA 4B9OA 3LIDA 5IS1A 2JHEA 3FC7A 5A8BA 3H7WB 1Y28A 3EEHA 1GSWA 5DKKA 1P0ZA 5DJUA 2GJ3A 4HHDA 4KUKA 4EXOA 1OT9A 3F1PB 2QJ7A
chains in the Genus database with same CATH superfamily
3S7QA 2XLNA 2KX6A 1ODVA 3ZG9B 4Q0HA 3V3RA 2GX5A 4HBUA 1PNEA 3OC2A 4NEED 1YMSA 2VK3A 2ZJ9A 3OCNA 3QP2A 3UE0A 4UEYA 2C6WB 2ZOHA 3UO9A 1YLTA 4OOYA 1K38A 3MS6A 4FD8A 5FASA 2PBDP 2P74A 2Y2JA 5A93A 3ZVTA 4GD6A 2G2WA 3TJZC 2G7UA 2J3WA 5FDHA 1JWPA 2EXBA 3N6IA 3MF0A 4M4XA 5CRFA 4Y7PA 1K6RA 5G18A 4IUHA 2PD8A 1T1CA 4F3LB 2ZD8A 3VP3A 3VFFA 3T4OA 3FKWA 5FQQA 3KSFA 4EERA 5DTSA 1N9BA 3IS2B 1KDWA 3LCEA 3VV4A 4Y17A 3IH8A 3UDFA 1FCOA 4QJGA 2IWDA 4HEFA 3SS5A 3L7HA 4MMNA 1H8YA 1DRMA 4HJ6A 5AJGA 2V20A 3IHBA 2Y59A 3D4FA 3H7WB 1HLUP 3NDEA 1K25A 4ID4A 1JTDA 2OV5A 2QJ7A 3NULA 5J3WA 5E2EA 2J80A 1FOFA 1BSGA 3ULFA 4FTXA 2XFTA 3O3VA 5AQBA 4OPZA 3MZFA 2W3EA 3LI8A 3UB9A 3ITAA 2FFYA 2I9VA 2V9AA 1BTLA 4HI4A 3OZHA 4GCZA 2XRNA 2ZQ9A 2Y2GA 1VHMA 3JYIA 3LEZA 4R4SA 1H8MA 3LO7A 2WZZA 4OP5A 4S2KA 4DXCA 4YNRA 3GR2A 4DE1A 3KO6A 4R38A 4DF6A 3PBOA 3PYPA 5FQ9A 3T4SA 5DFXA 5EVEA 5JYOA 3T4KA 1LSWA 3IXDA 1KGFA 3BEBA 1OTIA 3F1NA 4WF0A 3W4OA 4OH0A 4DN0A 3N8RA 4R23A 1NYMA 1MPLA 3MBZA 4WMCA 2Y8HA 5KMWA 4B88A 1J3WA 1W63M 2GNXA 1SZVA 1LT0A 2OLUA 5K5BA 3HUOA 4QY6A 1K56D 4BENA 1DJBA 1XXMA 3ZG0A 3E4OA 2HGVA 4S2LA 4G3VA 3OCLA 3O86A 1IFQA 4ZAMA 3G2ZA 1EWZA 1CQAA 3BLSA 2PRFA 2V1AA 3NHQA 4N92A 4KQOA 3MMHA 3L9KA 1DJAA 2RL3A 1Q2PA 2WGWA 2Y2LA 1OMEA 5GLCA 1BUEA 4OQ0A 1K4EA 2XDMA 1PRQA 2IWCA 3KYEA 1GHIA 5CTMA 3ZDJA 4DDYA 4X56A 2OWJA 1L0GA 4GS9A 4NXEA 4X6TA 1HZOA 5EVIC 4RA7A 3F1PA 5HW3A 3VE4A 3OPLA 4UQIM 3QP4A 3LIEA 3B47A 1K55A 3CAXA 1PZOA 4WEKA 2EFXA 5EVID 3ZNTA 5GHZA 1IYQA 2XROA 5HAQA 4WM9A 2XK1A 4X68A 4WYYA 4IUKA 4JGRA 3UB8A 3LI9A 2PHYA 4KG6A 1Y4OA 3OPHA 1YPRA 3VP2A 4JF6A 3MZEA 4MN5A 2J3TC 1L2SA 3C30A 4Y0UA 1QMEA 3T50A 2MJ6A 5A90A 3ZYTA 4WMCD 1ZHHB 2XD1A 1OTAA 5EM0A 1MXOA 4LFUA 1YLYA 3PR6A 3KSIA 3VFHA 1K56A 1IELA 2VV8A 4Y13A 4WUJA 4BQMA 1K57A 5L8MA 4KZAA 1STZA 4GHIA 4H6JB 5F69A 4B4ZA 2HJEA 3H82A 4S2NA 4ETZA 1H3QA 3BM6A 5HD3A 5CEDA 3S1YA 3VP1A 4I3IA 2W1TB 3IX4A 1S1YA 3IBRA 3MR0A 2WZXA 2HJ9C 1G6OA 4P87A 2Y55A 4L9GA 1O7EA 3R4KA 3DW0A 2P08A 2WGVA 3CJMA 4XT2A 4EQIA 3N7WA 4XXRA 1K54A 4U3TA 1ES4A 4EBPA 1XJ4A 4GLQA 1W7FA 4JXSA 1I2WA 4S2MA 5IT5A 4BBVA 4RQ9A 5HD5A 3Q7VB 1LL8A 5CGSA 3LFVA 1I2SA 2H0YA 3HBRA 2YKFA 4F94A 1GSVA 4KZBA 1NYYA 3MQ0A 1E3UA 3DAVA 3MXQA 3ZVWA 3IQAA 3B33A 4KQQA 4BMWA 4QY5A 4E3MA 4JBFA 2HPBA 1NRJA 1YLZA 4B4XA 4EU0A 3IF6B 2XQZA 1VETB 4I3AA 3E0YA 4HP9A 2OLVA 2GDNA 3V50A 4QD4A 2QKPA 5CERA 5HL6A 2WAFA 4AFIA 1PIOA 2WYXA 1AXBA 3FWLA 3N8LA 2I72A 2ZLYA 2J9PA 3NOPC 3HREA 4Y0TA 2ZC4B 4PM7A 4HH3A 2ZQDA 1F9IA 4IJGA 5KIZA 2ZC3B 5G4ZA 1PZPA 3S22A 2J8YA 1WE4A 3SS3A 3WS1A 2O9CA 4HNBA 3LEQA 4DE3A 3K2NA 2QYBA 3MQQA 4JF5A 1SKOB 4OPQA 2DRWA 1YAXA 2PU4A 4R6LA 4C3QA 3NCKA 5E2FA 3V39A 3A3DA 2JHEA 5DTKA 5DJUA 4EXOA 5TFQA 3WWXA 4BL2A 1LL5A 3D3OA 1NWZA 3E2KA 4MDZA 3HJIA 4Z9QA 3GSGA 4FSFA 4LPZA 4EEPA 2PAVP 2J9OA 3UPPA 2Q9NA 3C8CA 1F2KA 3IS2A 4Q0JA 4WBGA 2HDQA 3T4QA 2O9BA 4OQHA 3MKEA 4PHTA 5FDSA 1NRFA 4QWOA 2VLGA 3SH7A 3OBFA 3NJAA 3PBSA 1SDNA 1ERQA 2FH5A 4FH4A 1LLBA 3IXGA 4LRXC 3KX0X 4X53A 4HBTA 2W0NA 4PM6A 3IX3A 1EW0A 1P9WA 3GV9A 3T1XA 3CHWP 4BL3A 1O07A 2UV0E 3MJQA 1RGZA 1BYWA 1KE0A 5EM1A 1HD8A 5FQJA 2B02A 2BTFP 4GNUA 4IBRA 1HTZA 3LR3A 4OONA 2Y79A 4N9KA 1F98A 1TEMA 2AVXA 5DVAA 3UY6A 4WLAA 4ESPA 5CEBA 1F5MA 1YSQA 3LICA 4LV0A 4FUWA 4DE2A 2KDKA 2PR5A 1VETA 1XA1A 4GJ4A 1VEUB 4MBFA 3SH8A 3EEHA 4HHDA 4RX2A 2M7UA 3VSLA 3W2ZA 4OQIA 1H0MA 3IWQA 2H5SA 1HVBA 4DKIA 1XFQA 3CMZA 2Z2MB 1BLCA 2PYPA 2VV6A 5FQMA 3LR5A 1CI8A 3B42A 1ERMA 3P7NA 2X01A 1XP4A 4EEUA 5GLBA 4UAAA 2H0TA 5M18A 3Q7VA 4EBNA 2QPNA 3PBRA 1G5UA 2XA7M 4K0WA 1ONHA 1L3LA 5JYPA 4P6BA 1ZG6A 3P01A 3Q81A 1S1ZA 3CUEA 4NKPA 3SOIA 5CTNA 5CGWA 1FR1A 2Z6CA 1ZC2A 1PFLA 2PD7A 5GHYA 2HP6A 2BASA 3C7VA 3FYZA 1IOUA 4KQRA 3H7WA 1GA9A 2GZAA 3NY4A 1QMFA 3LIAA 1P9RA 2QJ5A 4KZ5A 2PR6A 2Y2MA 1XJ3A 3W8KA 1K6SA 4Q0IA 3RJUA 3GVBA 5AQ9A 4OPRA 3UN7A 5HDCA 5DF8A 3NOUC 4MBHA 1JWVA 2ACGA 3BQAA 4CLCC 3ICYA 2WKIA 3P09A 3QP1A 4NXGA 3ZG7B 2XD5A 4LLOB 4P85A 3IH9A 4OKPA 5G4YA 1IKGA 5FI2A 3TOIA 4FH2A 3B3XA 4CLCB 3NC8A 4OQGA 4ME4A 3OPPA 3BWLA 1U60A 3JVUA 4DMZA 2WADA 4KQDA 2HZ5A 2PYRA 1VQQA 1WYCA 1PWDA 2WGIA 2ZM8A 4N9LA 5FATA 3K3DA 3T1QB 2EX2A 4GW9A 3MFDA 4E6WA 1OJ5A 1GHMA 2LB5A 1E3UD 2VEAA 4UA7A 3CZDA 3T4LA 4GN2A 3AGFA 2O0YA 4XT2B 1DP6A 3BJNA 3G34A 2JN7A 2YKHA 2E8JA 4R3BA 3ZCZA 4KZ3A 3R7WA 1G28A 2EA9A 4P0MA 2A24B 1I5QA 5EE8A 3DTIA 2WKRA 2ZC5B 5F1GA 2HV1A 1GA0A 2B18A 4MBKA 4JF4A 3IXBA 4O01A 4BBUA 5L2FA 3GDIA 1VB6A 4K0XA 1ES5A 1FILA 1XJ2A 2M7VA 4ZTKA 5C5KA 2HP5A 4DXBA 4OLDA 1PI5A 4NXFA 3PBTA 2WUQA 2EWVA 2OAQ1 2A24A 2Y2KA 4L9EA 4IBXA 4Z1WA 4BJPA 5IS1A 1MC0A 5EOEA 2PU2A 4R4RA 3CI6A 2VX8A 3IWIA 3UE3A 1YKDA 2JE5A 3O5YA 5A91A 3WS4A 3GTCA 3I7JA 1OPXA 1J9MA 4MN6A 2XA7S 4UA6A 4ZJ3A 4S2OA 3ZNYA 1AWIA 2Z2LB 3LR4A 3KYQA 3G31A 1KGGA 4Y2FA 1SKOA 4FOFA 2Z6DA 2XGNA 4WEJA 3IT9A 2ZL1B 3VP0A 4Q8IA 5J4EA 3CWFA 1TF1A 1VM1A 1YLJA 2V1ZA 3W4QA 4EUZA 4IVKA 4KENB 4WZ5A 3UPOA 1VEUA 2VZWA 1GCEA 1YQSA 4KZ9A 3MXRA 5L10A 3LR0A 5FAPA 5AVEA 3BFGA 1OT6A 2VV7A 4BBTA 3NECA 2Y2HA 1A0KA 1XGIA 1YM1A 2HP9A 2L4RA 5AQAA 4M3KA 5AQ7A 1K4FA 3UE1A 3IF5A 5DF9A 4JPMA 4GHIB 4H6JA 4QPRA 4PM8A 4P6ZS 1OTBA 4LCMA 4JLFA 1EI5A 1PI4A 3RH8B 4CQHA 3EQUA 3VOYA 4E3KA 2W1TA 1G68A 4JXGA 2IWBA 5HPIA 1ESIA 1SCWA 4GDBA 1H5XA 4Y3IA 3OOVA 2EX8A 3DBAA 3HLEA 4JKTA 5FSRA 4HJ3A 2O9AA 3DTEA 3CPTA 2R9WA 3FC7A 4LV3A 5EVIB 2WKEA 2XH9A 2OSUA 4KUKA 1EROA 1NY0A 1X0OA 1JVJA 3KYZA 4E3NA 3PAEA 1XA7A 4D2OA 2ZMVA 3WS5A 3CITA 2ZL1A 1ES3A 2PT7A 3HL9A 5GL9A 3QP8A 3WRTA 4JXVA 4R1GA 2Y2PA 4RVAA 1K0KA 3RXXA 4YFMA 2L0WA 5M19A 2XR0A 3LIFA 3LYXA 5TR7A 4N1XA 5TJJA 2JKRI 3FV7A 1YT4A 4HOIA 1XFNA 2K31A 5CGXA 4C6YA 2C5WB 3BECA 1MZUA 1JWZA 2ZOIA 3Q1FA 4D60A 2Y2NA 3ZG5A 1PW1A 2X71A 4IHQA 1MKMA 3C4OA 3RFBA 3BY9A 1LSVA 1TS0A 4MCWA 1PWCA 4S2NC 5F83A 2JKTM 1S0WA 3GRJA 5L07A 4G3WA 4I38A 3FPVA 4OOMA 1FSYA 3F1NB 2JBFA 2XEPA 3E4QA 5E43A 5HFOA 3EQVA 1BLPA 2DMWA 4HJ4A 4ZBEA 2NUTC 3TE8A 3IF6C 2Y2IA 1SKFA 3HLWA 4EESA 4S2PA 3NI9A 4GS9B 2CC1A 4PAUA 4L9FA 2M1CA 3SZTA 3GQZA 3OPRA 4YWZA 2V8CA 2KLIA 5FEGA 2ZM2A 2WGWB 5CHUA 1NLZA 3PAGA 1C3BA 2JKGA 2H28A 3LIBA 1OJGA 2ZQCA 4E3IA 1KDSA 1IEMA 2VGLM 4JXWA 5L09A 1P97A 3NDGA 3DTKA 5FEFA 4UA9A 5HSQA 2R78A 1KVLA 2UWXA 3BFEA 3OLOA 3ITBA 2ZBBA 3E2LA 2J7VA 3VE3A 2WAEA 2Y4AA 4O8GA 2BG1A 3U4LP 5EOOA 3BY8A 5F6AA 4KZ7A 1JNUA 1TDGA 4RYEA 4GB7A 3Q7ZA 2JCHA 5CXWA 3PBNA 3KSGA 3A3IA 1TS8A 4O7DA 4JGOA 4HP4A 3NBLA 2OWHA 3C2WA 2EWWA 3AGDA 4KG2A 5A92A 3MXSA 4EQ1A 5IU1A 3V67A 4WZ5C 4LENA 5HX9A 1Z6FA 5E2HA 3S7OA 5GHXA 1KOUA 3QP5A 4DRTA 2VJWA 2K7SA 3LIDA 3MSHA 4NK3A 1Y28A 2WKHA 5DKKA 1TVFA 2Y91A 1MWSA 3D72A 5U47A 4WL9A 5HDSA 3V3SA 4QHCA 3MKFA 4IVIA 3DTMA 3HLDA 3UDIA 2QZ6A 3Q07A 4NETA 1BLSA 1PW8A 1FR6A 3C4PA 3RTYA 4DJ3A 3HLGA 2XSSA 3A3EA 4E3JA 1K55C 4MLLA 4EWFA 2A3UA 1M6KA 3E98A 1UWPX 3A0RA 5DJTA 2EXAA 4GZBA 1W8QA 1LSXA 2VGLS 3TG9A 3N4IA 4E6XA 4GD8A 3PXPA 4YINA 4GDNA 3FKVA 4ZDXA 2Y2OA 3BYDA 3JVVA 3ZHHA 4XUZA 1XX2A 1W63Q 5HAPA 1MKIA 4PMAA 4JGQA 3G4PA 4LRYC 2P7JA 1RP5A 5F68A 4RX3A 2K2NA 1LHYA 3H9WA 3EGXC 4MN7A 1IYPA 2XF3A 2JC7A 4OLGA 3QHYA 4YOFA 5CHJA 4R0QA 3F1PB 5FAOA 5HWVA 4HH2A 4E3OA 1Q2QA 3V5MA 1IYOA 3UMDA 1ACFA 1NZOA 3G6OA 1NLYA 1H8ZA 2B5RA 4HIAA 3CLOA 4GOGA 4IEDA 1L0EA 3UMEA 4I39A 4BD0A 2EX9A 5CX7A 1FIKA 1V9ZA 4BD1A 5HWTA 2ZQAA 5F5YA 1FCMA 2ZQ8A 2QWSA 3WRZA 3BW6A 5IHVA 1BULA 5TBMB 2V1BA 3UB5P 4EUVA 4S2JA 5FA7A 4WZ4A 1RGYA 2D01A 4CPKA 2ZM0A 3BFFA 3LY4A 4X1MA 1T18A 3UNWA 3FZCA 2L1MA 3ZG8B 5FL3A 1NZUA 2IA2A 4E04A 1BZAA 1E4DA 2JKTI 5DF7A 1GHPA 5E2GA 5TBMA 5EPHA 4ARZB 4C75A 1JTGA 3PTEA 1SHVA 2HF6A 3UB6A 4PPRA 2W27A 1V9YA 4R70A 3SS4A 4LV2A 2W1RA 3QP6A 1N9NA 3IX8A 5HPFA 1KVMA 3M2KA 2WKPA 5EVIA 4A5RA 2DCFA 1N9OA 3D9YA 4X69A 2W3GA 1W5DA 1CJFA 4K91A 3EEAA 5HZHA 3G32A 1MWUA 2O99A 3O88A 4EBLA 4II7A 1YSPA 3FPWA 5DTTA 1PYYA 3W4PA 1T1BA 4JGPA 5FI6A 2W3FA 1XKZA 5HARA 2BLSA 3LUQA 2W3HA 1XPBA 4QB8A 4OVDA 3QNCA 1OTDA 3LY3A 3HUNA 1LI0A 1YLPA 4KG5A 5EFWA 5HL1A 2P9VB 5CHMA 2EFUA 4EW7A 3BQ8A 5LBRA 3HCYA 3MQOA 4H8RA 1M40A 3T4JA 3EWKA 3TW8A 1CEGA 3NOTC 3C38A 3K3CA 2OAP1 5F1FA 2QMIA 5EVLA 1ALQA 3UDXA 4K08A 5BOHA 1S4SA 3NIAA 1G6AA 2XFSA 3A3JA 3GMWA 1DJCA 1TS6A 4KZ6A 5J7EA 1K54C 3CUEC 4I3JA 3VOLA 1N4OA 2D02A 1D1JA 4GKUA 5KSHA 3SH9A 5FQIA 2V2FF 4OOLA 3VOZA 4OPYA 5HDDA 5A8BA 1GSWA 1P0ZA 1OT9A 3QNBA 4KZ8A 5KSCA 1S6RA 2HDUA 4BLMA 1ZTUA 4S2IA 5M1AA 1S67L 3VP4A 4O0PA 2Q0OA 1BT5A 1UWNX 2PDRA 5F82A 1KE3A 4DDSA 2V0WA 3E4PA 3LGOA 1DP9A 5DKLA 5TGFA 3DWZA 3F1OA 3WS2A 4OP8A 1N9LA 5FAQA 2VKSA 4MNRA 3EOIA 1CF0A 1FSWA 3ZFZA 1CI9A 1UGUA 2JKRM 4KZ4A 3HLFA 4XUXA 4WELA 3M6BA 1W79A 3GECA 4PKYG 2OOLA 3TSGA 5HAIA 2ZC6B 2JKFA 4PM9A 4R3AA 4ZRRA 3IHAA 1TDLA 4Y5FA 3CG5A 1MBLA 4X1LA 1OTEA 1ONGA 3S7NA 3BRMA 2E8IA 4N1HA 2RCXA 4KUOA 2G2UA 3VSKA 3PHYA 3ZQ5A 3T1SA 3P98A 4WN5A 1WA9A 1ESUA 4U0TA 4ARZA 4QU3A 4L0LA 2P9VA 1SDEA 3S7PA 3G30A 4ZJ2A 3C7UA 3G35A 4P6ZM 3BLMA 3MZDA 1KGEA 4R3JA 2V0UA 3TRCA 2Y2QA 1GSXA 5GLAA 1RCJA 1D06A 4MEZA 1TS7A 5HWWA 5J8XA 5GLDA 4HESA 3HUMA 1NXYA 3H82B 3DWKA 5I5LA 3HLBA 4F3LA 1YMXA 4Y0OA 3KSHA 2A2LA 5KZHA 3FG8A 4NXBA 4PM5A 3IXHA 2VGJA 3ISGA 2W3DA 1KE4A 1TD5A 4CLCA 1MWRA 1CEFA 2NUPC 4UHUA 3BFDA 1PWGA 2WKQA 1NJ4A 4U0XA 2A49A 1DY6A 3BFCA 2WK0A 4G3KA 5EV0A 1K57C 4UQIS 1L0DA 1T1AA 4LRZE 3UB7A 3HVFA 3VMAA 2ZC7A 1Y54A 3G2YA 2FZ0A 1LL9A 5MC7A 3O87A 1L0FA 1XGJA 3F1OB 5FQKA 4X25A 2KOIA 3A0SA 3T4TA 4ZJ1A 3SW1A 3HLCA 4EV4A 2PBYA 3M6HA 2J3TD 4X55A 1S66L 3ZGAB 1LI9A 3S4XA 2EX6A 4B9OA 3CPTB 4E3LA 1W8YA 2GJ3A 1ZKJA 5EECA 4CJNA 4EETB 3AGEA 4ETXA 3PBQA 5I94A 5CECA 1DP8A 1MY8A 2VA0A 2LB9A 2P04A 3U2AA 1MWTA 1IYSA 5EUAA 2INWA 2H10A 3A3FA 4LV1A 3JPUA 1Z09A 2ZMAA 2HDRA 2QHKA 1T19A 4DJ2A 2CMNA 4I5SA 4HQAA 5AVFA 3EGDC 3RXWA 1ZG4A 2FFFB 4CLCE 1D7EA 2VGKA 4CLCD 1S4RA 4LGWA 3T1RA 2ZQ7A 3IWOA 2Q9MA 2DNSA 4FCFA 1E25A 1ES2A 2X02A 1IKIA 3R7WB 1XJ6A 3N8SA 4HY8A 3MFXA 3UPNA 4PKYA 4DE0A 2ZMFA 5D3OA 4LCLA 2HDSA 1CK3A 5FI7A 3T12B 3IBJA 2B95A 1BLHA 4NG2A 1FQGA 3UE6A 1WYBA 4BWIA 3A0VA 5DFYA 3Q82A 2V8FA 3HJKA 3M2JA 3C5AA 4B93A 2R9XA 3IF6A 1YLWA 3WS0A 1FCNA 4Y15A
chains in the Genus database with same CATH topology
3S7QA 3EEAA 3D3OA 1NWZA 1X0OA 5HZHA 2KX6A 1ODVA 4MDZA 3HJIA 2O99A 4FSFA 4LPZA 3KYZA 4EEPA 4II7A 4Q0HA 2GX5A 3C8CA 3IS2A 1YSPA 3OC2A 4Q0JA 3FPWA 4NEED 3T4QA 1T1BA 3OCNA 2O9BA 4JGPA 2ZMVA 4UEYA 2ZOHA 2W3FA 3CITA 3LUQA 4PHTA 2W3HA 2PT7A 2VLGA 3OBFA 3NJAA 1OTDA 3PBSA 2FH5A 5EFWA 2L0WA 4LRXC 3KX0X 3LIFA 3LYXA 5TJJA 2JKRI 2W0NA 4EW7A 3TJZC 2G7UA 4HOIA 2J3WA 1EW0A 3BQ8A 1XFNA 3MF0A 5LBRA 3HCYA 2K31A 3MQOA 1P9WA 4M4XA 1MZUA 2ZOIA 3T4JA 3EWKA 3TW8A 3MJQA 3NOTC 4IHQA 1BYWA 1MKMA 3C38A 3K3CA 2OAP1 2B02A 4IUHA 3RFBA 3BY9A 1LSVA 2PD8A 1T1CA 4F3LB 1TS0A 4K08A 1S4SA 4MCWA 2JKTM 3LR3A 3T4OA 2Y79A 3KSFA 4EERA 3IS2B 1F98A 1TS6A 4G3WA 3VV4A 5J7EA 4I38A 3CUEC 3FPVA 4OOMA 4I3JA 3VOLA 3F1NB 4WLAA 1F5MA 1YSQA 3LICA 3E4QA 2D02A 5KSHA 3EQVA 4MMNA 2KDKA 2PR5A 2DMWA 4HJ4A 4OOLA 1DRMA 4HJ6A 4GJ4A 5HDDA 5AJGA 2NUTC 3TE8A 5A8BA 3H7WB 3EEHA 1GSWA 1P0ZA 4HHDA 1OT9A 2M7UA 2QJ7A 3W2ZA 5J3WA 2J80A 1XFQA 1ZTUA 3ULFA 4EESA 2PYPA 2VV6A 2W3EA 3LI8A 4GS9B 3LR5A 3UB9A 3B42A 1S67L 3P7NA 2I9VA 4O0PA 2V9AA 4GCZA 4HI4A 4PAUA 2XRNA 4L9FA 2M1CA 1UWNX 1VHMA 4EEUA 2PDRA 1H8MA 2V0WA 3E4PA 4YNRA 1DP9A 3KO6A 4R38A 4YWZA 2KLIA 3PBOA 3PBRA 3PYPA 3T4SA 5DKLA 5DFXA 1NLZA 3F1OA 2XA7M 1LSWA 3T4KA 2H28A 3LIBA 1N9LA 1OJGA 2VKSA 3F1NA 1OTIA 4WF0A 3EOIA 2VGLM 4DN0A 1P97A 3P01A 5HSQA 2R78A 1S1ZA 3CUEA 4NKPA 1UGUA 2Y8HA 2JKRM 3OLOA 1W63M 2GNXA 2Z6CA 1LT0A 2PD7A 2ZBBA 5K5BA 3VE3A 2BASA 4WELA 4O8GA 1IOUA 3BY8A 3GECA 3H7WA 5F6AA 2GZAA 1JNUA 2OOLA 4PKYG 3E4OA 2HGVA 3LIAA 3PBNA 1P9RA 2QJ5A 4R3AA 2PR6A 3KSGA 1XJ3A 4G3VA 4ZRRA 1TS8A 4Y5FA 4Q0IA 3OCLA 1OTEA 1IFQA 3S7NA 4JGOA 2V1AA 3NHQA 4HP4A 5HDCA 3NOUC 4KUOA 4KQOA 3BQAA 4CLCC 3ICYA 2OWHA 3MMHA 4NXGA 3C2WA 2EWWA 4LLOB 3PHYA 5G4YA 3ZQ5A 4WN5A 1WA9A 4EQ1A 5IU1A 4ARZA 3V67A 4L0LA 4CLCB 3S7PA 3S7OA 4ME4A 1KOUA 3BWLA 2VJWA 2K7SA 4P6ZM 3LIDA 1Y28A 3JVUA 5DKKA 4DMZA 2OWJA 2V0UA 3TRCA 4KQDA 4GS9A 4NXEA 1GSXA 3D72A 3F1PA 1D06A 2PYRA 3VE4A 1TS7A 5HWWA 4UQIM 3LIEA 3B47A 4WL9A 5HDSA 3CAXA 4WEKA 3K3DA 3H82B 4GW9A 5I5LA 2XROA 1OJ5A 4F3LA 2LB5A 3KSHA 4IUKA 2A2LA 2VEAA 4JGRA 3FG8A 3UB8A 4NXBA 3RTYA 4DJ3A 3LI9A 2PHYA 3T4LA 2XSSA 4MN5A 2O0YA 2J3TC 3E98A 3C30A 4XT2B 1DP6A 1UWPX 3T50A 3BJNA 2MJ6A 3A0RA 5DJTA 2W3DA 3ZYTA 4CLCA 1TD5A 1LSXA 1ZHHB 2NUPC 2JN7A 2YKHA 2VGLS 1OTAA 2WKQA 3PXPA 3PR6A 4G3KA 3KSIA 2VV8A 4WUJA 3R7WA 1G28A 4UQIS 2EA9A 2A24B 1T1AA 4LRZE 3UB7A 3JVVA 2WKRA 5L8MA 1STZA 1W63Q 2HV1A 4GHIA 4H6JB 2FZ0A 2B18A 5F69A 5MC7A 2HJEA 3H82A 4ETZA 1H3QA 4O01A 3F1OB 5HD3A 4JGQA 4BBUA 4LRYC 2P7JA 4I3IA 3GDIA 2KOIA 1VB6A 2W1TB 3A0SA 3T4TA 5F68A 3SW1A 1S1YA 2K2NA 3H9WA 1XJ2A 3EGXC 3IBRA 2M7VA 3MR0A 5C5KA 4MN7A 2J3TD 4NXFA 2HJ9C 1G6OA 1S66L 3PBTA 2EWVA 2OAQ1 2A24A 4YOFA 4L9GA 4L9EA 3R4KA 2P08A 4XT2A 4Z1WA 4BJPA 4B9OA 5IS1A 1MC0A 2GJ3A 3CI6A 3F1PB 2VX8A 5HWVA 4EETB 3UE3A 1XJ4A 4GLQA 4HH2A 1YKDA 5IT5A 4BBVA 4RQ9A 4ETXA 5HD5A 3PBQA 1LL8A 1DP8A 3UMDA 3O5YA 3G6OA 3LFVA 2VA0A 1NLYA 2LB9A 1OPXA 2YKFA 4MN6A 2XA7S 2P04A 4HIAA 3CLOA 1GSVA 3UMEA 3LR4A 4I39A 3U2AA 3KYQA 3MQ0A 2INWA 4Y2FA 5CX7A 4FOFA 2Z6DA 1V9ZA 3MXQA 3B33A 4WEJA 2QHKA 1T19A 5HWTA 4BMWA 4DJ2A 2CMNA 5F5YA 4I5SA 3CWFA 5J4EA 1TF1A 1NRJA 2QWSA 3BW6A 4HQAA 5AVFA 4EU0A 5TBMB 3EGDC 2VZWA 4I3AA 3E0YA 4CLCE 2V1BA 4HP9A 1D7EA 4EUVA 3LR0A 4CLCD 1S4RA 5AVEA 1OT6A 2VV7A 2QKPA 4BBTA 5HL6A 2D01A 4AFIA 2L4RA 3R7WB 1T18A 1XJ6A 3NOPC 2L1MA 5DF9A 4GHIB 4H6JA 4HY8A 5FL3A 4QPRA 3MFXA 4P6ZS 1OTBA 2IA2A 4PKYA 4HH3A 4E04A 1F9IA 2ZMFA 4IJGA 2JKTI 5KIZA 3RH8B 4CQHA 3EQUA 5TBMA 4ARZB 5G4ZA 2W1TA 3IBJA 5HPIA 2O9CA 4HNBA 2HF6A 3UB6A 3K2NA 2QYBA 3UE6A 4BWIA 3MQQA 2W27A 1V9YA 4Y3IA 3A0VA 4R70A 5DFYA 3OOVA 3HJKA 2W1RA 3DBAA 1N9NA 5HPFA 1YAXA 4HJ3A 2O9AA 2WKPA 4R6LA 4B93A 1N9OA 2W3GA 2JHEA 3FC7A 5DJUA 4KUKA 4EXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EET B;  5J3W A;  2OWJ A;  2V0U A;  3SW1 A;  2J80 A;  1XJ4 A;  4GS9 A;  1GSX A;  3D72 A;  4HH2 A;  4KQD A;  1XFQ A;  1NWZ A;  1X0O A;  3F1P A;  3ULF A;  2KX6 A;  5HZH A;  1D06 A;  4BBV A;  1ODV A;  4RQ9 A;  4EES A;  2PYR A;  2PYP A;  1TS7 A;  3HJI A;  2VV6 A;  5HD5 A;  3VE4 A;  3LI8 A;  1LL8 A;  3LIE A;  4GS9 B;  4LPZ A;  5HWW A;  3UB9 A;  1DP8 A;  4WL9 A;  3CAX A;  1S67 L;  5HDS A;  3UMD A;  3G6O A;  4EEP A;  3P7N A;  2I9V A;  2V9A A;  3C8C A;  3K3D A;  3H82 B;  3IS2 A;  4GCZ A;  4GW9 A;  4HI4 A;  4L9F A;  2M1C A;  1UWN X;  2YKF A;  4MN6 A;  4HIA A;  3CLO A;  2PDR A;  4EEU A;  5I5L A;  1GSV A;  1OJ5 A;  1T1B A;  2V0W A;  3E4P A;  4JGP A;  3UME A;  4F3L A;  4I39 A;  1DP9 A;  2ZOH A;  2VEA A;  4JGR A;  2INW A;  4R38 A;  4YWZ A;  2Z6D A;  3PYP A;  1V9Z A;  3FG8 A;  3LUQ A;  3MXQ A;  3UB8 A;  4NXB A;  5DKL A;  3RTY A;  3B33 A;  4DJ3 A;  2QHK A;  1T19 A;  3F1O A;  2VLG A;  3LI9 A;  1LSW A;  2PHY A;  2CMN A;  5F5Y A;  5HWT A;  4I5S A;  3CWF A;  3NJA A;  5J4E A;  2H28 A;  3LIB A;  1N9L A;  1OTD A;  1OJG A;  3F1N A;  1OTI A;  4MN5 A;  4WF0 A;  2QWS A;  5HWV A;  4HQA A;  5AVF A;  1P97 A;  4XT2 B;  1DP6 A;  1UWP X;  5EFW A;  2L0W A;  5TBM B;  3T50 A;  4LRX C;  3A0R A;  3KX0 X;  3LIF A;  3LYX A;  5DJT A;  4I3A A;  5HSQ A;  2R78 A;  2V1B A;  4HP9 A;  1D7E A;  1LSX A;  1S1Z A;  1S4R A;  1UGU A;  5AVE A;  2W0N A;  1OT6 A;  4EW7 A;  2VV7 A;  2QKP A;  4BBT A;  4HOI A;  3OLO A;  1EW0 A;  2D01 A;  1XFN A;  2JN7 A;  2Z6C A;  2YKH A;  1LT0 A;  2PD7 A;  2ZBB A;  1OTA A;  3MQO A;  2L4R A;  4M4X A;  2WKQ A;  2BAS A;  3VE3 A;  1MZU A;  2ZOI A;  1T18 A;  3BY8 A;  1XJ6 A;  3EWK A;  3GEC A;  3H7W A;  2VV8 A;  3MJQ A;  3NOP C;  5F6A A;  4WUJ A;  2L1M A;  3NOT C;  4PKY G;  1JNU A;  1BYW A;  1G28 A;  2OOL A;  3E4O A;  2EA9 A;  4GHI B;  3K3C A;  4H6J A;  4HY8 A;  2A24 B;  3MFX A;  1T1A A;  3LIA A;  4LRZ E;  2B02 A;  1OTB A;  2QJ5 A;  4R3A A;  3UB7 A;  2PR6 A;  4HH3 A;  4PKY A;  3BY9 A;  4E04 A;  1F9I A;  1LSV A;  1XJ3 A;  2PD8 A;  2WKR A;  1T1C A;  5KIZ A;  1TS8 A;  3RH8 B;  4F3L B;  1TS0 A;  4K08 A;  1S4S A;  2HV1 A;  4GHI A;  1OTE A;  4H6J B;  4NXE A;  5TBM A;  4EER A;  5F69 A;  4JGO A;  5G4Z A;  2V1A A;  3IS2 B;  3NHQ A;  1F98 A;  1TS6 A;  3NOU C;  3H82 A;  4HP4 A;  4KUO A;  5HDC A;  5J7E A;  4I38 A;  3ICY A;  4HNB A;  2OWH A;  4NXG A;  3F1O B;  3C2W A;  4I3J A;  4JGQ A;  5HD3 A;  3VOL A;  4BBU A;  3F1N B;  4LLO B;  2P7J A;  3PHY A;  4LRY C;  4WLA A;  5G4Y A;  3UB6 A;  4I3I A;  3GDI A;  3UE6 A;  1VB6 A;  4WN5 A;  3A0S A;  2W27 A;  1WA9 A;  3MQQ A;  3LIC A;  5F68 A;  1V9Y A;  1S1Y A;  3E4Q A;  2D02 A;  3A0V A;  4R70 A;  3ZQ5 A;  3H9W A;  5IU1 A;  1XJ2 A;  3IBR A;  4DJ2 A;  3HJK A;  3MR0 A;  4EQ1 A;  1N9N A;  2KDK A;  2PR5 A;  4NXF A;  4HJ3 A;  2WKP A;  4HJ4 A;  1S66 L;  4R6L A;  1DRM A;  4HJ6 A;  5HDD A;  1N9O A;  2A24 A;  4L9G A;  1KOU A;  4L9E A;  3BWL A;  4XT2 A;  2K7S A;  4B9O A;  3LID A;  5IS1 A;  2JHE A;  3FC7 A;  5A8B A;  3H7W B;  1Y28 A;  3EEH A;  1GSW A;  5DKK A;  1P0Z A;  5DJU A;  2GJ3 A;  4HHD A;  4KUK A;  4EXO A;  1OT9 A;  3F1P B;  2QJ7 A; 
#chains in the Genus database with same CATH topology
 3S7Q A;  2XLN A;  2KX6 A;  1ODV A;  3ZG9 B;  4Q0H A;  3V3R A;  2GX5 A;  4HBU A;  1PNE A;  3OC2 A;  4NEE D;  1YMS A;  2VK3 A;  2ZJ9 A;  3OCN A;  3QP2 A;  3UE0 A;  4UEY A;  2C6W B;  2ZOH A;  3UO9 A;  1YLT A;  4OOY A;  1K38 A;  3MS6 A;  4FD8 A;  5FAS A;  2PBD P;  2P74 A;  2Y2J A;  5A93 A;  3ZVT A;  4GD6 A;  2G2W A;  3TJZ C;  2G7U A;  2J3W A;  5FDH A;  1JWP A;  2EXB A;  3N6I A;  3MF0 A;  4M4X A;  5CRF A;  4Y7P A;  1K6R A;  5G18 A;  4IUH A;  2PD8 A;  1T1C A;  4F3L B;  2ZD8 A;  3VP3 A;  3VFF A;  3T4O A;  3FKW A;  5FQQ A;  3KSF A;  4EER A;  5DTS A;  1N9B A;  3IS2 B;  1KDW A;  3LCE A;  3VV4 A;  4Y17 A;  3IH8 A;  3UDF A;  1FCO A;  4QJG A;  2IWD A;  4HEF A;  3SS5 A;  3L7H A;  4MMN A;  1H8Y A;  1DRM A;  4HJ6 A;  5AJG A;  2V20 A;  3IHB A;  2Y59 A;  3D4F A;  3H7W B;  1HLU P;  3NDE A;  1K25 A;  4ID4 A;  1JTD A;  2OV5 A;  2QJ7 A;  3NUL A;  5J3W A;  5E2E A;  2J80 A;  1FOF A;  1BSG A;  3ULF A;  4FTX A;  2XFT A;  3O3V A;  5AQB A;  4OPZ A;  3MZF A;  2W3E A;  3LI8 A;  3UB9 A;  3ITA A;  2FFY A;  2I9V A;  2V9A A;  1BTL A;  4HI4 A;  3OZH A;  4GCZ A;  2XRN A;  2ZQ9 A;  2Y2G A;  1VHM A;  3JYI A;  3LEZ A;  4R4S A;  1H8M A;  3LO7 A;  2WZZ A;  4OP5 A;  4S2K A;  4DXC A;  4YNR A;  3GR2 A;  4DE1 A;  3KO6 A;  4R38 A;  4DF6 A;  3PBO A;  3PYP A;  5FQ9 A;  3T4S A;  5DFX A;  5EVE A;  5JYO A;  3T4K A;  1LSW A;  3IXD A;  1KGF A;  3BEB A;  1OTI A;  3F1N A;  4WF0 A;  3W4O A;  4OH0 A;  4DN0 A;  3N8R A;  4R23 A;  1NYM A;  1MPL A;  3MBZ A;  4WMC A;  2Y8H A;  5KMW A;  4B88 A;  1J3W A;  1W63 M;  2GNX A;  1SZV A;  1LT0 A;  2OLU A;  5K5B A;  3HUO A;  4QY6 A;  1K56 D;  4BEN A;  1DJB A;  1XXM A;  3ZG0 A;  3E4O A;  2HGV A;  4S2L A;  4G3V A;  3OCL A;  3O86 A;  1IFQ A;  4ZAM A;  3G2Z A;  1EWZ A;  1CQA A;  3BLS A;  2PRF A;  2V1A A;  3NHQ A;  4N92 A;  4KQO A;  3MMH A;  3L9K A;  1DJA A;  2RL3 A;  1Q2P A;  2WGW A;  2Y2L A;  1OME A;  5GLC A;  1BUE A;  4OQ0 A;  1K4E A;  2XDM A;  1PRQ A;  2IWC A;  3KYE A;  1GHI A;  5CTM A;  3ZDJ A;  4DDY A;  4X56 A;  2OWJ A;  1L0G A;  4GS9 A;  4NXE A;  4X6T A;  1HZO A;  5EVI C;  4RA7 A;  3F1P A;  5HW3 A;  3VE4 A;  3OPL A;  4UQI M;  3QP4 A;  3LIE A;  3B47 A;  1K55 A;  3CAX A;  1PZO A;  4WEK A;  2EFX A;  5EVI D;  3ZNT A;  5GHZ A;  1IYQ A;  2XRO A;  5HAQ A;  4WM9 A;  2XK1 A;  4X68 A;  4WYY A;  4IUK A;  4JGR A;  3UB8 A;  3LI9 A;  2PHY A;  4KG6 A;  1Y4O A;  3OPH A;  1YPR A;  3VP2 A;  4JF6 A;  3MZE A;  4MN5 A;  2J3T C;  1L2S A;  3C30 A;  4Y0U A;  1QME A;  3T50 A;  2MJ6 A;  5A90 A;  3ZYT A;  4WMC D;  1ZHH B;  2XD1 A;  1OTA A;  5EM0 A;  1MXO A;  4LFU A;  1YLY A;  3PR6 A;  3KSI A;  3VFH A;  1K56 A;  1IEL A;  2VV8 A;  4Y13 A;  4WUJ A;  4BQM A;  1K57 A;  5L8M A;  4KZA A;  1STZ A;  4GHI A;  4H6J B;  5F69 A;  4B4Z A;  2HJE A;  3H82 A;  4S2N A;  4ETZ A;  1H3Q A;  3BM6 A;  5HD3 A;  5CED A;  3S1Y A;  3VP1 A;  4I3I A;  2W1T B;  3IX4 A;  1S1Y A;  3IBR A;  3MR0 A;  2WZX A;  2HJ9 C;  1G6O A;  4P87 A;  2Y55 A;  4L9G A;  1O7E A;  3R4K A;  3DW0 A;  2P08 A;  2WGV A;  3CJM A;  4XT2 A;  4EQI A;  3N7W A;  4XXR A;  1K54 A;  4U3T A;  1ES4 A;  4EBP A;  1XJ4 A;  4GLQ A;  1W7F A;  4JXS A;  1I2W A;  4S2M A;  5IT5 A;  4BBV A;  4RQ9 A;  5HD5 A;  3Q7V B;  1LL8 A;  5CGS A;  3LFV A;  1I2S A;  2H0Y A;  3HBR A;  2YKF A;  4F94 A;  1GSV A;  4KZB A;  1NYY A;  3MQ0 A;  1E3U A;  3DAV A;  3MXQ A;  3ZVW A;  3IQA A;  3B33 A;  4KQQ A;  4BMW A;  4QY5 A;  4E3M A;  4JBF A;  2HPB A;  1NRJ A;  1YLZ A;  4B4X A;  4EU0 A;  3IF6 B;  2XQZ A;  1VET B;  4I3A A;  3E0Y A;  4HP9 A;  2OLV A;  2GDN A;  3V50 A;  4QD4 A;  2QKP A;  5CER A;  5HL6 A;  2WAF A;  4AFI A;  1PIO A;  2WYX A;  1AXB A;  3FWL A;  3N8L A;  2I72 A;  2ZLY A;  2J9P A;  3NOP C;  3HRE A;  4Y0T A;  2ZC4 B;  4PM7 A;  4HH3 A;  2ZQD A;  1F9I A;  4IJG A;  5KIZ A;  2ZC3 B;  5G4Z A;  1PZP A;  3S22 A;  2J8Y A;  1WE4 A;  3SS3 A;  3WS1 A;  2O9C A;  4HNB A;  3LEQ A;  4DE3 A;  3K2N A;  2QYB A;  3MQQ A;  4JF5 A;  1SKO B;  4OPQ A;  2DRW A;  1YAX A;  2PU4 A;  4R6L A;  4C3Q A;  3NCK A;  5E2F A;  3V39 A;  3A3D A;  2JHE A;  5DTK A;  5DJU A;  4EXO A;  5TFQ A;  3WWX A;  4BL2 A;  1LL5 A;  3D3O A;  1NWZ A;  3E2K A;  4MDZ A;  3HJI A;  4Z9Q A;  3GSG A;  4FSF A;  4LPZ A;  4EEP A;  2PAV P;  2J9O A;  3UPP A;  2Q9N A;  3C8C A;  1F2K A;  3IS2 A;  4Q0J A;  4WBG A;  2HDQ A;  3T4Q A;  2O9B A;  4OQH A;  3MKE A;  4PHT A;  5FDS A;  1NRF A;  4QWO A;  2VLG A;  3SH7 A;  3OBF A;  3NJA A;  3PBS A;  1SDN A;  1ERQ A;  2FH5 A;  4FH4 A;  1LLB A;  3IXG A;  4LRX C;  3KX0 X;  4X53 A;  4HBT A;  2W0N A;  4PM6 A;  3IX3 A;  1EW0 A;  1P9W A;  3GV9 A;  3T1X A;  3CHW P;  4BL3 A;  1O07 A;  2UV0 E;  3MJQ A;  1RGZ A;  1BYW A;  1KE0 A;  5EM1 A;  1HD8 A;  5FQJ A;  2B02 A;  2BTF P;  4GNU A;  4IBR A;  1HTZ A;  3LR3 A;  4OON A;  2Y79 A;  4N9K A;  1F98 A;  1TEM A;  2AVX A;  5DVA A;  3UY6 A;  4WLA A;  4ESP A;  5CEB A;  1F5M A;  1YSQ A;  3LIC A;  4LV0 A;  4FUW A;  4DE2 A;  2KDK A;  2PR5 A;  1VET A;  1XA1 A;  4GJ4 A;  1VEU B;  4MBF A;  3SH8 A;  3EEH A;  4HHD A;  4RX2 A;  2M7U A;  3VSL A;  3W2Z A;  4OQI A;  1H0M A;  3IWQ A;  2H5S A;  1HVB A;  4DKI A;  1XFQ A;  3CMZ A;  2Z2M B;  1BLC A;  2PYP A;  2VV6 A;  5FQM A;  3LR5 A;  1CI8 A;  3B42 A;  1ERM A;  3P7N A;  2X01 A;  1XP4 A;  4EEU A;  5GLB A;  4UAA A;  2H0T A;  5M18 A;  3Q7V A;  4EBN A;  2QPN A;  3PBR A;  1G5U A;  2XA7 M;  4K0W A;  1ONH A;  1L3L A;  5JYP A;  4P6B A;  1ZG6 A;  3P01 A;  3Q81 A;  1S1Z A;  3CUE A;  4NKP A;  3SOI A;  5CTN A;  5CGW A;  1FR1 A;  2Z6C A;  1ZC2 A;  1PFL A;  2PD7 A;  5GHY A;  2HP6 A;  2BAS A;  3C7V A;  3FYZ A;  1IOU A;  4KQR A;  3H7W A;  1GA9 A;  2GZA A;  3NY4 A;  1QMF A;  3LIA A;  1P9R A;  2QJ5 A;  4KZ5 A;  2PR6 A;  2Y2M A;  1XJ3 A;  3W8K A;  1K6S A;  4Q0I A;  3RJU A;  3GVB A;  5AQ9 A;  4OPR A;  3UN7 A;  5HDC A;  5DF8 A;  3NOU C;  4MBH A;  1JWV A;  2ACG A;  3BQA A;  4CLC C;  3ICY A;  2WKI A;  3P09 A;  3QP1 A;  4NXG A;  3ZG7 B;  2XD5 A;  4LLO B;  4P85 A;  3IH9 A;  4OKP A;  5G4Y A;  1IKG A;  5FI2 A;  3TOI A;  4FH2 A;  3B3X A;  4CLC B;  3NC8 A;  4OQG A;  4ME4 A;  3OPP A;  3BWL A;  1U60 A;  3JVU A;  4DMZ A;  2WAD A;  4KQD A;  2HZ5 A;  2PYR A;  1VQQ A;  1WYC A;  1PWD A;  2WGI A;  2ZM8 A;  4N9L A;  5FAT A;  3K3D A;  3T1Q B;  2EX2 A;  4GW9 A;  3MFD A;  4E6W A;  1OJ5 A;  1GHM A;  2LB5 A;  1E3U D;  2VEA A;  4UA7 A;  3CZD A;  3T4L A;  4GN2 A;  3AGF A;  2O0Y A;  4XT2 B;  1DP6 A;  3BJN A;  3G34 A;  2JN7 A;  2YKH A;  2E8J A;  4R3B A;  3ZCZ A;  4KZ3 A;  3R7W A;  1G28 A;  2EA9 A;  4P0M A;  2A24 B;  1I5Q A;  5EE8 A;  3DTI A;  2WKR A;  2ZC5 B;  5F1G A;  2HV1 A;  1GA0 A;  2B18 A;  4MBK A;  4JF4 A;  3IXB A;  4O01 A;  4BBU A;  5L2F A;  3GDI A;  1VB6 A;  4K0X A;  1ES5 A;  1FIL A;  1XJ2 A;  2M7V A;  4ZTK A;  5C5K A;  2HP5 A;  4DXB A;  4OLD A;  1PI5 A;  4NXF A;  3PBT A;  2WUQ A;  2EWV A;  2OAQ 1;  2A24 A;  2Y2K A;  4L9E A;  4IBX A;  4Z1W A;  4BJP A;  5IS1 A;  1MC0 A;  5EOE A;  2PU2 A;  4R4R A;  3CI6 A;  2VX8 A;  3IWI A;  3UE3 A;  1YKD A;  2JE5 A;  3O5Y A;  5A91 A;  3WS4 A;  3GTC A;  3I7J A;  1OPX A;  1J9M A;  4MN6 A;  2XA7 S;  4UA6 A;  4ZJ3 A;  4S2O A;  3ZNY A;  1AWI A;  2Z2L B;  3LR4 A;  3KYQ A;  3G31 A;  1KGG A;  4Y2F A;  1SKO A;  4FOF A;  2Z6D A;  2XGN A;  4WEJ A;  3IT9 A;  2ZL1 B;  3VP0 A;  4Q8I A;  5J4E A;  3CWF A;  1TF1 A;  1VM1 A;  1YLJ A;  2V1Z A;  3W4Q A;  4EUZ A;  4IVK A;  4KEN B;  4WZ5 A;  3UPO A;  1VEU A;  2VZW A;  1GCE A;  1YQS A;  4KZ9 A;  3MXR A;  5L10 A;  3LR0 A;  5FAP A;  5AVE A;  3BFG A;  1OT6 A;  2VV7 A;  4BBT A;  3NEC A;  2Y2H A;  1A0K A;  1XGI A;  1YM1 A;  2HP9 A;  2L4R A;  5AQA A;  4M3K A;  5AQ7 A;  1K4F A;  3UE1 A;  3IF5 A;  5DF9 A;  4JPM A;  4GHI B;  4H6J A;  4QPR A;  4PM8 A;  4P6Z S;  1OTB A;  4LCM A;  4JLF A;  1EI5 A;  1PI4 A;  3RH8 B;  4CQH A;  3EQU A;  3VOY A;  4E3K A;  2W1T A;  1G68 A;  4JXG A;  2IWB A;  5HPI A;  1ESI A;  1SCW A;  4GDB A;  1H5X A;  4Y3I A;  3OOV A;  2EX8 A;  3DBA A;  3HLE A;  4JKT A;  5FSR A;  4HJ3 A;  2O9A A;  3DTE A;  3CPT A;  2R9W A;  3FC7 A;  4LV3 A;  5EVI B;  2WKE A;  2XH9 A;  2OSU A;  4KUK A;  1ERO A;  1NY0 A;  1X0O A;  1JVJ A;  3KYZ A;  4E3N A;  3PAE A;  1XA7 A;  4D2O A;  2ZMV A;  3WS5 A;  3CIT A;  2ZL1 A;  1ES3 A;  2PT7 A;  3HL9 A;  5GL9 A;  3QP8 A;  3WRT A;  4JXV A;  4R1G A;  2Y2P A;  4RVA A;  1K0K A;  3RXX A;  4YFM A;  2L0W A;  5M19 A;  2XR0 A;  3LIF A;  3LYX A;  5TR7 A;  4N1X A;  5TJJ A;  2JKR I;  3FV7 A;  1YT4 A;  4HOI A;  1XFN A;  2K31 A;  5CGX A;  4C6Y A;  2C5W B;  3BEC A;  1MZU A;  1JWZ A;  2ZOI A;  3Q1F A;  4D60 A;  2Y2N A;  3ZG5 A;  1PW1 A;  2X71 A;  4IHQ A;  1MKM A;  3C4O A;  3RFB A;  3BY9 A;  1LSV A;  1TS0 A;  4MCW A;  1PWC A;  4S2N C;  5F83 A;  2JKT M;  1S0W A;  3GRJ A;  5L07 A;  4G3W A;  4I38 A;  3FPV A;  4OOM A;  1FSY A;  3F1N B;  2JBF A;  2XEP A;  3E4Q A;  5E43 A;  5HFO A;  3EQV A;  1BLP A;  2DMW A;  4HJ4 A;  4ZBE A;  2NUT C;  3TE8 A;  3IF6 C;  2Y2I A;  1SKF A;  3HLW A;  4EES A;  4S2P A;  3NI9 A;  4GS9 B;  2CC1 A;  4PAU A;  4L9F A;  2M1C A;  3SZT A;  3GQZ A;  3OPR A;  4YWZ A;  2V8C A;  2KLI A;  5FEG A;  2ZM2 A;  2WGW B;  5CHU A;  1NLZ A;  3PAG A;  1C3B A;  2JKG A;  2H28 A;  3LIB A;  1OJG A;  2ZQC A;  4E3I A;  1KDS A;  1IEM A;  2VGL M;  4JXW A;  5L09 A;  1P97 A;  3NDG A;  3DTK A;  5FEF A;  4UA9 A;  5HSQ A;  2R78 A;  1KVL A;  2UWX A;  3BFE A;  3OLO A;  3ITB A;  2ZBB A;  3E2L A;  2J7V A;  3VE3 A;  2WAE A;  2Y4A A;  4O8G A;  2BG1 A;  3U4L P;  5EOO A;  3BY8 A;  5F6A A;  4KZ7 A;  1JNU A;  1TDG A;  4RYE A;  4GB7 A;  3Q7Z A;  2JCH A;  5CXW A;  3PBN A;  3KSG A;  3A3I A;  1TS8 A;  4O7D A;  4JGO A;  4HP4 A;  3NBL A;  2OWH A;  3C2W A;  2EWW A;  3AGD A;  4KG2 A;  5A92 A;  3MXS A;  4EQ1 A;  5IU1 A;  3V67 A;  4WZ5 C;  4LEN A;  5HX9 A;  1Z6F A;  5E2H A;  3S7O A;  5GHX A;  1KOU A;  3QP5 A;  4DRT A;  2VJW A;  2K7S A;  3LID A;  3MSH A;  4NK3 A;  1Y28 A;  2WKH A;  5DKK A;  1TVF A;  2Y91 A;  1MWS A;  3D72 A;  5U47 A;  4WL9 A;  5HDS A;  3V3S A;  4QHC A;  3MKF A;  4IVI A;  3DTM A;  3HLD A;  3UDI A;  2QZ6 A;  3Q07 A;  4NET A;  1BLS A;  1PW8 A;  1FR6 A;  3C4P A;  3RTY A;  4DJ3 A;  3HLG A;  2XSS A;  3A3E A;  4E3J A;  1K55 C;  4MLL A;  4EWF A;  2A3U A;  1M6K A;  3E98 A;  1UWP X;  3A0R A;  5DJT A;  2EXA A;  4GZB A;  1W8Q A;  1LSX A;  2VGL S;  3TG9 A;  3N4I A;  4E6X A;  4GD8 A;  3PXP A;  4YIN A;  4GDN A;  3FKV A;  4ZDX A;  2Y2O A;  3BYD A;  3JVV A;  3ZHH A;  4XUZ A;  1XX2 A;  1W63 Q;  5HAP A;  1MKI A;  4PMA A;  4JGQ A;  3G4P A;  4LRY C;  2P7J A;  1RP5 A;  5F68 A;  4RX3 A;  2K2N A;  1LHY A;  3H9W A;  3EGX C;  4MN7 A;  1IYP A;  2XF3 A;  2JC7 A;  4OLG A;  3QHY A;  4YOF A;  5CHJ A;  4R0Q A;  3F1P B;  5FAO A;  5HWV A;  4HH2 A;  4E3O A;  1Q2Q A;  3V5M A;  1IYO A;  3UMD A;  1ACF A;  1NZO A;  3G6O A;  1NLY A;  1H8Z A;  2B5R A;  4HIA A;  3CLO A;  4GOG A;  4IED A;  1L0E A;  3UME A;  4I39 A;  4BD0 A;  2EX9 A;  5CX7 A;  1FIK A;  1V9Z A;  4BD1 A;  5HWT A;  2ZQA A;  5F5Y A;  1FCM A;  2ZQ8 A;  2QWS A;  3WRZ A;  3BW6 A;  5IHV A;  1BUL A;  5TBM B;  2V1B A;  3UB5 P;  4EUV A;  4S2J A;  5FA7 A;  4WZ4 A;  1RGY A;  2D01 A;  4CPK A;  2ZM0 A;  3BFF A;  3LY4 A;  4X1M A;  1T18 A;  3UNW A;  3FZC A;  2L1M A;  3ZG8 B;  5FL3 A;  1NZU A;  2IA2 A;  4E04 A;  1BZA A;  1E4D A;  2JKT I;  5DF7 A;  1GHP A;  5E2G A;  5TBM A;  5EPH A;  4ARZ B;  4C75 A;  1JTG A;  3PTE A;  1SHV A;  2HF6 A;  3UB6 A;  4PPR A;  2W27 A;  1V9Y A;  4R70 A;  3SS4 A;  4LV2 A;  2W1R A;  3QP6 A;  1N9N A;  3IX8 A;  5HPF A;  1KVM A;  3M2K A;  2WKP A;  5EVI A;  4A5R A;  2DCF A;  1N9O A;  3D9Y A;  4X69 A;  2W3G A;  1W5D A;  1CJF A;  4K91 A;  3EEA A;  5HZH A;  3G32 A;  1MWU A;  2O99 A;  3O88 A;  4EBL A;  4II7 A;  1YSP A;  3FPW A;  5DTT A;  1PYY A;  3W4P A;  1T1B A;  4JGP A;  5FI6 A;  2W3F A;  1XKZ A;  5HAR A;  2BLS A;  3LUQ A;  2W3H A;  1XPB A;  4QB8 A;  4OVD A;  3QNC A;  1OTD A;  3LY3 A;  3HUN A;  1LI0 A;  1YLP A;  4KG5 A;  5EFW A;  5HL1 A;  2P9V B;  5CHM A;  2EFU A;  4EW7 A;  3BQ8 A;  5LBR A;  3HCY A;  3MQO A;  4H8R A;  1M40 A;  3T4J A;  3EWK A;  3TW8 A;  1CEG A;  3NOT C;  3C38 A;  3K3C A;  2OAP 1;  5F1F A;  2QMI A;  5EVL A;  1ALQ A;  3UDX A;  4K08 A;  5BOH A;  1S4S A;  3NIA A;  1G6A A;  2XFS A;  3A3J A;  3GMW A;  1DJC A;  1TS6 A;  4KZ6 A;  5J7E A;  1K54 C;  3CUE C;  4I3J A;  3VOL A;  1N4O A;  2D02 A;  1D1J A;  4GKU A;  5KSH A;  3SH9 A;  5FQI A;  2V2F F;  4OOL A;  3VOZ A;  4OPY A;  5HDD A;  5A8B A;  1GSW A;  1P0Z A;  1OT9 A;  3QNB A;  4KZ8 A;  5KSC A;  1S6R A;  2HDU A;  4BLM A;  1ZTU A;  4S2I A;  5M1A A;  1S67 L;  3VP4 A;  4O0P A;  2Q0O A;  1BT5 A;  1UWN X;  2PDR A;  5F82 A;  1KE3 A;  4DDS A;  2V0W A;  3E4P A;  3LGO A;  1DP9 A;  5DKL A;  5TGF A;  3DWZ A;  3F1O A;  3WS2 A;  4OP8 A;  1N9L A;  5FAQ A;  2VKS A;  4MNR A;  3EOI A;  1CF0 A;  1FSW A;  3ZFZ A;  1CI9 A;  1UGU A;  2JKR M;  4KZ4 A;  3HLF A;  4XUX A;  4WEL A;  3M6B A;  1W79 A;  3GEC A;  4PKY G;  2OOL A;  3TSG A;  5HAI A;  2ZC6 B;  2JKF A;  4PM9 A;  4R3A A;  4ZRR A;  3IHA A;  1TDL A;  4Y5F A;  3CG5 A;  1MBL A;  4X1L A;  1OTE A;  1ONG A;  3S7N A;  3BRM A;  2E8I A;  4N1H A;  2RCX A;  4KUO A;  2G2U A;  3VSK A;  3PHY A;  3ZQ5 A;  3T1S A;  3P98 A;  4WN5 A;  1WA9 A;  1ESU A;  4U0T A;  4ARZ A;  4QU3 A;  4L0L A;  2P9V A;  1SDE A;  3S7P A;  3G30 A;  4ZJ2 A;  3C7U A;  3G35 A;  4P6Z M;  3BLM A;  3MZD A;  1KGE A;  4R3J A;  2V0U A;  3TRC A;  2Y2Q A;  1GSX A;  5GLA A;  1RCJ A;  1D06 A;  4MEZ A;  1TS7 A;  5HWW A;  5J8X A;  5GLD A;  4HES A;  3HUM A;  1NXY A;  3H82 B;  3DWK A;  5I5L A;  3HLB A;  4F3L A;  1YMX A;  4Y0O A;  3KSH A;  2A2L A;  5KZH A;  3FG8 A;  4NXB A;  4PM5 A;  3IXH A;  2VGJ A;  3ISG A;  2W3D A;  1KE4 A;  1TD5 A;  4CLC A;  1MWR A;  1CEF A;  2NUP C;  4UHU A;  3BFD A;  1PWG A;  2WKQ A;  1NJ4 A;  4U0X A;  2A49 A;  1DY6 A;  3BFC A;  2WK0 A;  4G3K A;  5EV0 A;  1K57 C;  4UQI S;  1L0D A;  1T1A A;  4LRZ E;  3UB7 A;  3HVF A;  3VMA A;  2ZC7 A;  1Y54 A;  3G2Y A;  2FZ0 A;  1LL9 A;  5MC7 A;  3O87 A;  1L0F A;  1XGJ A;  3F1O B;  5FQK A;  4X25 A;  2KOI A;  3A0S A;  3T4T A;  4ZJ1 A;  3SW1 A;  3HLC A;  4EV4 A;  2PBY A;  3M6H A;  2J3T D;  4X55 A;  1S66 L;  3ZGA B;  1LI9 A;  3S4X A;  2EX6 A;  4B9O A;  3CPT B;  4E3L A;  1W8Y A;  2GJ3 A;  1ZKJ A;  5EEC A;  4CJN A;  4EET B;  3AGE A;  4ETX A;  3PBQ A;  5I94 A;  5CEC A;  1DP8 A;  1MY8 A;  2VA0 A;  2LB9 A;  2P04 A;  3U2A A;  1MWT A;  1IYS A;  5EUA A;  2INW A;  2H10 A;  3A3F A;  4LV1 A;  3JPU A;  1Z09 A;  2ZMA A;  2HDR A;  2QHK A;  1T19 A;  4DJ2 A;  2CMN A;  4I5S A;  4HQA A;  5AVF A;  3EGD C;  3RXW A;  1ZG4 A;  2FFF B;  4CLC E;  1D7E A;  2VGK A;  4CLC D;  1S4R A;  4LGW A;  3T1R A;  2ZQ7 A;  3IWO A;  2Q9M A;  2DNS A;  4FCF A;  1E25 A;  1ES2 A;  2X02 A;  1IKI A;  3R7W B;  1XJ6 A;  3N8S A;  4HY8 A;  3MFX A;  3UPN A;  4PKY A;  4DE0 A;  2ZMF A;  5D3O A;  4LCL A;  2HDS A;  1CK3 A;  5FI7 A;  3T12 B;  3IBJ A;  2B95 A;  1BLH A;  4NG2 A;  1FQG A;  3UE6 A;  1WYB A;  4BWI A;  3A0V A;  5DFY A;  3Q82 A;  2V8F A;  3HJK A;  3M2J A;  3C5A A;  4B93 A;  2R9X A;  3IF6 A;  1YLW A;  3WS0 A;  1FCN A;  4Y15 A; 
#chains in the Genus database with same CATH homology
 3S7Q A;  3EEA A;  3D3O A;  1NWZ A;  1X0O A;  5HZH A;  2KX6 A;  1ODV A;  4MDZ A;  3HJI A;  2O99 A;  4FSF A;  4LPZ A;  3KYZ A;  4EEP A;  4II7 A;  4Q0H A;  2GX5 A;  3C8C A;  3IS2 A;  1YSP A;  3OC2 A;  4Q0J A;  3FPW A;  4NEE D;  3T4Q A;  1T1B A;  3OCN A;  2O9B A;  4JGP A;  2ZMV A;  4UEY A;  2ZOH A;  2W3F A;  3CIT A;  3LUQ A;  4PHT A;  2W3H A;  2PT7 A;  2VLG A;  3OBF A;  3NJA A;  1OTD A;  3PBS A;  2FH5 A;  5EFW A;  2L0W A;  4LRX C;  3KX0 X;  3LIF A;  3LYX A;  5TJJ A;  2JKR I;  2W0N A;  4EW7 A;  3TJZ C;  2G7U A;  4HOI A;  2J3W A;  1EW0 A;  3BQ8 A;  1XFN A;  3MF0 A;  5LBR A;  3HCY A;  2K31 A;  3MQO A;  1P9W A;  4M4X A;  1MZU A;  2ZOI A;  3T4J A;  3EWK A;  3TW8 A;  3MJQ A;  3NOT C;  4IHQ A;  1BYW A;  1MKM A;  3C38 A;  3K3C A;  2OAP 1;  2B02 A;  4IUH A;  3RFB A;  3BY9 A;  1LSV A;  2PD8 A;  1T1C A;  4F3L B;  1TS0 A;  4K08 A;  1S4S A;  4MCW A;  2JKT M;  3LR3 A;  3T4O A;  2Y79 A;  3KSF A;  4EER A;  3IS2 B;  1F98 A;  1TS6 A;  4G3W A;  3VV4 A;  5J7E A;  4I38 A;  3CUE C;  3FPV A;  4OOM A;  4I3J A;  3VOL A;  3F1N B;  4WLA A;  1F5M A;  1YSQ A;  3LIC A;  3E4Q A;  2D02 A;  5KSH A;  3EQV A;  4MMN A;  2KDK A;  2PR5 A;  2DMW A;  4HJ4 A;  4OOL A;  1DRM A;  4HJ6 A;  4GJ4 A;  5HDD A;  5AJG A;  2NUT C;  3TE8 A;  5A8B A;  3H7W B;  3EEH A;  1GSW A;  1P0Z A;  4HHD A;  1OT9 A;  2M7U A;  2QJ7 A;  3W2Z A;  5J3W A;  2J80 A;  1XFQ A;  1ZTU A;  3ULF A;  4EES A;  2PYP A;  2VV6 A;  2W3E A;  3LI8 A;  4GS9 B;  3LR5 A;  3UB9 A;  3B42 A;  1S67 L;  3P7N A;  2I9V A;  4O0P A;  2V9A A;  4GCZ A;  4HI4 A;  4PAU A;  2XRN A;  4L9F A;  2M1C A;  1UWN X;  1VHM A;  4EEU A;  2PDR A;  1H8M A;  2V0W A;  3E4P A;  4YNR A;  1DP9 A;  3KO6 A;  4R38 A;  4YWZ A;  2KLI A;  3PBO A;  3PBR A;  3PYP A;  3T4S A;  5DKL A;  5DFX A;  1NLZ A;  3F1O A;  2XA7 M;  1LSW A;  3T4K A;  2H28 A;  3LIB A;  1N9L A;  1OJG A;  2VKS A;  3F1N A;  1OTI A;  4WF0 A;  3EOI A;  2VGL M;  4DN0 A;  1P97 A;  3P01 A;  5HSQ A;  2R78 A;  1S1Z A;  3CUE A;  4NKP A;  1UGU A;  2Y8H A;  2JKR M;  3OLO A;  1W63 M;  2GNX A;  2Z6C A;  1LT0 A;  2PD7 A;  2ZBB A;  5K5B A;  3VE3 A;  2BAS A;  4WEL A;  4O8G A;  1IOU A;  3BY8 A;  3GEC A;  3H7W A;  5F6A A;  2GZA A;  1JNU A;  2OOL A;  4PKY G;  3E4O A;  2HGV A;  3LIA A;  3PBN A;  1P9R A;  2QJ5 A;  4R3A A;  2PR6 A;  3KSG A;  1XJ3 A;  4G3V A;  4ZRR A;  1TS8 A;  4Y5F A;  4Q0I A;  3OCL A;  1OTE A;  1IFQ A;  3S7N A;  4JGO A;  2V1A A;  3NHQ A;  4HP4 A;  5HDC A;  3NOU C;  4KUO A;  4KQO A;  3BQA A;  4CLC C;  3ICY A;  2OWH A;  3MMH A;  4NXG A;  3C2W A;  2EWW A;  4LLO B;  3PHY A;  5G4Y A;  3ZQ5 A;  4WN5 A;  1WA9 A;  4EQ1 A;  5IU1 A;  4ARZ A;  3V67 A;  4L0L A;  4CLC B;  3S7P A;  3S7O A;  4ME4 A;  1KOU A;  3BWL A;  2VJW A;  2K7S A;  4P6Z M;  3LID A;  1Y28 A;  3JVU A;  5DKK A;  4DMZ A;  2OWJ A;  2V0U A;  3TRC A;  4KQD A;  4GS9 A;  4NXE A;  1GSX A;  3D72 A;  3F1P A;  1D06 A;  2PYR A;  3VE4 A;  1TS7 A;  5HWW A;  4UQI M;  3LIE A;  3B47 A;  4WL9 A;  5HDS A;  3CAX A;  4WEK A;  3K3D A;  3H82 B;  4GW9 A;  5I5L A;  2XRO A;  1OJ5 A;  4F3L A;  2LB5 A;  3KSH A;  4IUK A;  2A2L A;  2VEA A;  4JGR A;  3FG8 A;  3UB8 A;  4NXB A;  3RTY A;  4DJ3 A;  3LI9 A;  2PHY A;  3T4L A;  2XSS A;  4MN5 A;  2O0Y A;  2J3T C;  3E98 A;  3C30 A;  4XT2 B;  1DP6 A;  1UWP X;  3T50 A;  3BJN A;  2MJ6 A;  3A0R A;  5DJT A;  2W3D A;  3ZYT A;  4CLC A;  1TD5 A;  1LSX A;  1ZHH B;  2NUP C;  2JN7 A;  2YKH A;  2VGL S;  1OTA A;  2WKQ A;  3PXP A;  3PR6 A;  4G3K A;  3KSI A;  2VV8 A;  4WUJ A;  3R7W A;  1G28 A;  4UQI S;  2EA9 A;  2A24 B;  1T1A A;  4LRZ E;  3UB7 A;  3JVV A;  2WKR A;  5L8M A;  1STZ A;  1W63 Q;  2HV1 A;  4GHI A;  4H6J B;  2FZ0 A;  2B18 A;  5F69 A;  5MC7 A;  2HJE A;  3H82 A;  4ETZ A;  1H3Q A;  4O01 A;  3F1O B;  5HD3 A;  4JGQ A;  4BBU A;  4LRY C;  2P7J A;  4I3I A;  3GDI A;  2KOI A;  1VB6 A;  2W1T B;  3A0S A;  3T4T A;  5F68 A;  3SW1 A;  1S1Y A;  2K2N A;  3H9W A;  1XJ2 A;  3EGX C;  3IBR A;  2M7V A;  3MR0 A;  5C5K A;  4MN7 A;  2J3T D;  4NXF A;  2HJ9 C;  1G6O A;  1S66 L;  3PBT A;  2EWV A;  2OAQ 1;  2A24 A;  4YOF A;  4L9G A;  4L9E A;  3R4K A;  2P08 A;  4XT2 A;  4Z1W A;  4BJP A;  4B9O A;  5IS1 A;  1MC0 A;  2GJ3 A;  3CI6 A;  3F1P B;  2VX8 A;  5HWV A;  4EET B;  3UE3 A;  1XJ4 A;  4GLQ A;  4HH2 A;  1YKD A;  5IT5 A;  4BBV A;  4RQ9 A;  4ETX A;  5HD5 A;  3PBQ A;  1LL8 A;  1DP8 A;  3UMD A;  3O5Y A;  3G6O A;  3LFV A;  2VA0 A;  1NLY A;  2LB9 A;  1OPX A;  2YKF A;  4MN6 A;  2XA7 S;  2P04 A;  4HIA A;  3CLO A;  1GSV A;  3UME A;  3LR4 A;  4I39 A;  3U2A A;  3KYQ A;  3MQ0 A;  2INW A;  4Y2F A;  5CX7 A;  4FOF A;  2Z6D A;  1V9Z A;  3MXQ A;  3B33 A;  4WEJ A;  2QHK A;  1T19 A;  5HWT A;  4BMW A;  4DJ2 A;  2CMN A;  5F5Y A;  4I5S A;  3CWF A;  5J4E A;  1TF1 A;  1NRJ A;  2QWS A;  3BW6 A;  4HQA A;  5AVF A;  4EU0 A;  5TBM B;  3EGD C;  2VZW A;  4I3A A;  3E0Y A;  4CLC E;  2V1B A;  4HP9 A;  1D7E A;  4EUV A;  3LR0 A;  4CLC D;  1S4R A;  5AVE A;  1OT6 A;  2VV7 A;  2QKP A;  4BBT A;  5HL6 A;  2D01 A;  4AFI A;  2L4R A;  3R7W B;  1T18 A;  1XJ6 A;  3NOP C;  2L1M A;  5DF9 A;  4GHI B;  4H6J A;  4HY8 A;  5FL3 A;  4QPR A;  3MFX A;  4P6Z S;  1OTB A;  2IA2 A;  4PKY A;  4HH3 A;  4E04 A;  1F9I A;  2ZMF A;  4IJG A;  2JKT I;  5KIZ A;  3RH8 B;  4CQH A;  3EQU A;  5TBM A;  4ARZ B;  5G4Z A;  2W1T A;  3IBJ A;  5HPI A;  2O9C A;  4HNB A;  2HF6 A;  3UB6 A;  3K2N A;  2QYB A;  3UE6 A;  4BWI A;  3MQQ A;  2W27 A;  1V9Y A;  4Y3I A;  3A0V A;  4R70 A;  5DFY A;  3OOV A;  3HJK A;  2W1R A;  3DBA A;  1N9N A;  5HPF A;  1YAX A;  4HJ3 A;  2O9A A;  2WKP A;  4R6L A;  4B93 A;  1N9O A;  2W3G A;  2JHE A;  3FC7 A;  5DJU A;  4KUK A;  4EXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...