1TS7A

Structure of the pr cis wobble and pr e46q intermediates from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts7A00
2QJ5A 4I3JA 1D06A 2V9AA 1XJ6A 4WUJA 4K08A 2PD7A 2L1MA 5HWVA 1X0OA 4GS9B 1T19A 2JN7A 4NXGA 2R78A 3E4OA 3VE4A 3UB6A 3E4PA 4DJ2A 3HJIA 2WKPA 2I9VA 1TS0A 2QWSA 5F69A 1S67L 1VB6A 3OLOA 1DP9A 4R6LA 4PKYG 4L9FA 4EERA 1OTDA 5HD5A 1OTAA 1TS8A 3H82A 5J3WA 4HP4A 4F3LA 2QKPA 3BWLA 2PR5A 5F68A 4HH3A 3HJKA 3UMEA 5J4EA 5EFWA 5HWTA 2PHYA 3SW1A 1LSWA 4NXBA 1ODVA 1D7EA 3F1NB 4RQ9A 5KIZA 4GHIB 3F1PB 3LIEA 3NOPC 2INWA 3H7WA 3VOLA 5AVFA 2KX6A 4WF0A 1DRMA 4E04A 1G28A 5HWWA 1XJ2A 5G4YA 3G6OA 5I5LA 3F1OA 1EW0A 3LI9A 2CMNA 2BASA 2OOLA 5HDSA 4HHDA 1S1YA 4B9OA 4L9EA 2H28A 1S66L 4M4XA 2W27A 1S1ZA 5DKKA 5IU1A 3EWKA 1OJ5A 2HV1A 2P7JA 4BBTA 4HIAA 2ZOIA 3GDIA 5HDCA 3IBRA 3IS2A 2ZOHA 2KDKA 3NOTC 1WA9A 5DJUA 4WLAA 1GSWA 4XT2A 3UB7A 2V0UA 3NJAA 4GCZA 1XFQA 5HZHA 1JNUA 4H6JA 3MQOA 4I3IA 3MR0A 1T1BA 4JGQA 3KX0X 3UE6A 2V1AA 3VE3A 1XJ3A 4KUKA 4MN6A 3RH8B 4I39A 3C8CA 3EEHA 3H82B 1OT6A 4NXFA 3NHQA 3MFXA 4F3LB 3H9WA 2PYPA 2PDRA 1T1AA 2ZBBA 2YKHA 5HDDA 4GW9A 5IS1A 4EEUA 1XJ4A 1UWNX 4HOIA 4LRXC 1KOUA 1MZUA 3H7WB 2W0NA 3NOUC 2J80A 3UB8A 1T1CA 4I38A 3P7NA 2A24A 3LYXA 1OTIA 4HJ6A 3F1OB 1LT0A 3T50A 1F9IA 4BBVA 3GECA 4R38A 2GJ3A 2YKFA 4WL9A 4EETB 1NWZA 1LSVA 4HH2A 1F98A 4HJ4A 5G4ZA 1DP8A 3UMDA 2JHEA 4MN5A 1Y28A 3MJQA 5F5YA 4LRYC 3IS2B 1OT9A 3LUQA 2M1CA 4KQDA 4I5SA 3LIFA 2EA9A 2L4RA 4EEPA 3RTYA 4XT2B 1DP6A 3B33A 4HY8A 3PYPA 3CLOA 5TBMB 3ULFA 1S4SA 5TBMA 5J7EA 5DJTA 1OTEA 5HD3A 3LICA 1P0ZA 2D02A 2PD8A 4H6JB 4L9GA 3BY8A 2WKRA 3PHYA 4DJ3A 4KUOA 4LRZE 5A8BA 4HNBA 4HI4A 1LSXA 3ICYA 4GS9A 3MXQA 2QHKA 3FC7A 4NXEA 2OWHA 3CAXA 4R70A 1N9NA 2V1BA 1N9LA 1LL8A 2PR6A 4EW7A 2B02A 2VLGA 1GSVA 3MQQA 1S4RA 5AVEA 1XFNA 1OTBA 1UGUA 5F6AA 3A0RA 1T18A 2OWJA 4PKYA 2VV6A 1TS6A 1P97A 4HJ3A 4JGPA 2K7SA 4EESA 4LPZA 3A0VA 3LIBA 4HQAA 4WN5A 4R3AA 2WKQA 2A24B 3CWFA 2D01A 1V9YA 1OJGA 4YWZA 1TS7A 1UWPX 3F1NA 1GSXA 3ZQ5A 2L0WA 2V0WA 4GHIA 3F1PA 2Z6DA 2Z6CA 5DKLA 5HSQA 4EXOA 2VV7A 1V9ZA 2VEAA 4JGRA 4JGOA 3UB9A 3LIAA 3FG8A 3D72A 3C2WA 4BBUA 3K3CA 3A0SA 2QJ7A 3K3DA 3LIDA 3E4QA 1BYWA 4EQ1A 4I3AA 2VV8A 4LLOB 4HP9A 3BY9A 3LI8A 2PYRA 1N9OA
chains in the Genus database with same CATH superfamily
5EOEA 3M6BA 3G2ZA 3PBTA 4WMCD 4O8GA 2W1RA 4ZBEA 3O86A 1FSWA 5A92A 2V9AA 4QD4A 4OPQA 2PAVP 2JKGA 1ES2A 2HDSA 3LGOA 4UA7A 2L1MA 3HCYA 3UB5P 1X0OA 4OP5A 3QNBA 3O87A 5EVID 2JN7A 3T4TA 3SS4A 3WS5A 4P87A 3TW8A 4IUKA 3IF6B 1ACFA 2WZXA 3CUEC 3E4PA 3IQAA 4CLCC 2WKPA 1QMFA 4MBKA 3EGXC 5FQMA 1PW1A 3ZHHA 1IFQA 3LR4A 3OLOA 4R6LA 3CI6A 4PKYG 1EI5A 3MZDA 3V39A 4EERA 4RX3A 3LY4A 3T4LA 3VP3A 2J8YA 2QZ6A 1YSPA 5HD5A 2Y4AA 3H82A 1TEMA 2Y2IA 5GLDA 3FPVA 1S6RA 3IXBA 3ZG0A 4E6WA 3MMHA 4F3LA 2QKPA 3BWLA 5F68A 3VFFA 2IWDA 3HJKA 4ZJ2A 3UMEA 2ZMFA 2O9AA 1NRFA 2W3GA 1G6AA 5FSRA 1JVJA 2PHYA 2RCXA 3SW1A 2HJ9C 5FAOA 4U3TA 1ODVA 1D7EA 1ES5A 3T1XA 5KIZA 3F1PB 4WMCA 3BECA 3NOPC 1TF1A 4JF4A 3BLMA 1W8YA 3L7HA 4PPRA 1M40A 4Y2FA 2BG1A 4II7A 3G6OA 3E2KA 3F1OA 4NEED 2WZZA 1EW0A 2OOLA 2ZD8A 3QP5A 3WS2A 4CQHA 1JWVA 2ZC5B 4DE3A 4ZTKA 1DJBA 2H28A 2WGVA 2HJEA 1NYMA 1VEUB 1XX2A 1FQGA 3C4PA 3DTMA 5FQKA 4X1MA 5EVEA 4BBTA 1S0WA 2Y79A 4LV1A 3SS3A 5HDCA 1E4DA 3IS2A 3W4OA 1MKMA 3N7WA 3NOTC 2PT7A 3GQZA 3FKVA 3UDFA 2XEPA 3HVFA 1ESUA 1IEMA 2E8IA 4GCZA 3C5AA 1IYSA 1DJAA 4BMWA 4JLFA 1NLZA 2OAQ1 3C7UA 3Q7VB 4H6JA 3VOZA 4Q0HA 1L0DA 1K6RA 3UE6A 2V1AA 3A3DA 3T1QB 5FQJA 3ZNTA 3RJUA 3VE3A 4KUKA 1HTZA 4RX2A 3RH8B 3VMAA 1CEGA 4C6YA 1OT6A 2XF3A 4NXFA 3EQVA 1Q2PA 2Y2MA 5EPHA 3H9WA 1IKGA 5FA7A 2XD1A 2JKTI 3S22A 1LLBA 3AGDA 1K57C 1PYYA 4S2NC 4MNRA 1BLPA 2J3WA 2ZC6B 4FTXA 4GW9A 4QU3A 4MBHA 5E2FA 3JPUA 3C30A 4B4XA 2XGNA 1KOUA 3H7WB 5KMWA 1BZAA 4OONA 1VQQA 1KE0A 2A49A 4BL3A 4C75A 3P7NA 2A24A 4ETXA 2EXBA 3BFGA 3PBRA 1LT0A 3IWOA 2Y2HA 2XQZA 1YLWA 3S1YA 3A3IA 2Y2JA 1GHPA 2O99A 3DTEA 4R38A 1YPRA 4WL9A 1NWZA 2VJWA 4JXGA 2H0TA 4Z9QA 5FL3A 3NY4A 1MBLA 4LGWA 4U0TA 4HH2A 3N4IA 1PIOA 5HPIA 2ZC3B 3OPPA 3TRCA 1G6OA 1BTLA 4LRYC 4PMAA 4BL2A 3LCEA 1JTDA 4I5SA 2ZQ9A 4R3BA 2WKEA 3R4KA 4E3KA 3MZEA 4EEPA 3M6HA 4H8RA 3RTYA 3IT9A 1DP6A 4MMNA 5E2HA 3VV4A 3PYPA 4WELA 3D9YA 3BJNA 4MLLA 4Z1WA 1S4SA 4GKUA 2ZJ9A 4K0XA 1OTEA 4G3KA 1P0ZA 5CGXA 3BY8A 1D1JA 1PFLA 2DMWA 2EX8A 2WKRA 4EBLA 1K56D 3RXXA 4E3OA 2ZQCA 4DJ3A 5A8BA 3ZFZA 3S4XA 5HPFA 2OLUA 3MXQA 3CMZA 4DE1A 4NXEA 5BOHA 2OWHA 5C5KA 2J7VA 5EM1A 4UAAA 4DN0A 4DE0A 1N9NA 2HPBA 2ZQAA 2P9VA 3IHBA 4KZBA 2WADA 5AVEA 4E3MA 1XFNA 4WBGA 1UGUA 2H10A 4KZ6A 1IYOA 3PTEA 5CHUA 1IYPA 5TR7A 5FAPA 3PBQA 3MKFA 3VFHA 1GHMA 1IELA 4PKYA 3WWXA 3U4LP 2HGVA 3GR2A 4HJ3A 3FZCA 4LPZA 4HQAA 3KSIA 4R3AA 4LENA 5FAQA 3IXHA 4X6TA 5I94A 2XH9A 5FI6A 4YWZA 2V0WA 2DRWA 4RA7A 1TD5A 2Z6CA 2EFXA 2M7VA 3OOVA 4JGOA 3OPRA 5DTKA 1BLCA 3E2LA 3MBZA 3C2WA 1Q2QA 1NYYA 3OCNA 3K3CA 2P74A 5EM0A 2A3UA 4GD8A 5D3OA 5E43A 3MZFA 4EQ1A 4I3AA 4CJNA 3BY9A 5FI7A 3LI8A 2ZM0A 1PWCA 3MF0A 3U2AA 4P0MA 3FYZA 2ZM2A 1H5XA 2OV5A 4QJGA 4O7DA 4Y5FA 5TFQA 4EQIA 1U60A 2IWBA 4GS9B 1NRJA 1T19A 3KYQA 5DF8A 2H0YA 2WUQA 3G31A 2R78A 3E4OA 3UB6A 5AQBA 1TS0A 1L3LA 4E3IA 1K54A 2XRNA 1O07A 3AGFA 2V1ZA 5J8XA 1BT5A 4GNUA 4GD6A 3R7WB 4LCMA 1XP4A 3BQAA 4ARZB 4IVKA 1OTDA 2R9WA 5G18A 4HEFA 1ERQA 3ZCZA 4QY6A 4XXRA 4WZ5C 4MCWA 2UWXA 4KQQA 5EFWA 2QYBA 1YMSA 4OQHA 1LSWA 2XFTA 2Z2LB 3TJZC 1K6SA 2V2FF 3F1NB 4RQ9A 4GHIB 2EX6A 3LIEA 4BJPA 2HDQA 3VOLA 4X1LA 2KX6A 2WGWA 1DRMA 4F94A 1H8MA 1G28A 4JPMA 3VP4A 1RCJA 4B93A 3QP6A 2BASA 2J3TC 3B47A 5F83A 4HHDA 4OPRA 2CC1A 1VETB 5FQ9A 2Y2QA 3HLGA 1H8ZA 1S66L 2J9PA 2XR0A 5LBRA 1RGYA 2W27A 1H8YA 1AWIA 5IU1A 5M1AA 2Y2PA 3EGDC 4UQIM 1I2WA 4ESPA 5EOOA 2HP6A 5GHXA 1L0EA 4YOFA 4OH0A 1GSWA 4K0WA 3TE8A 1RGZA 4XT2A 2BLSA 3LFVA 3O88A 3T12B 2V0UA 1YLTA 3NJAA 3HLBA 1N9BA 3Q7ZA 4OOMA 4CPKA 5AQ7A 5HZHA 5KZHA 3Q82A 1JNUA 3I7JA 1K0KA 4Y13A 4OOLA 5HFOA 4CLCD 5EVIC 3M2KA 1XJ3A 3HUNA 1HVBA 1XA7A 1CI8A 3C8CA 1CEFA 1CI9A 2JKRM 2HP5A 2Q0OA 4R4SA 1ZHHB 4BENA 4X25A 3UPPA 4DRTA 2ZBBA 2M7UA 3T1RA 2VK3A 1KE3A 5IS1A 4EEUA 3WRTA 3MKEA 3IXGA 4P6BA 1XJ4A 2OSUA 4HOIA 4S2OA 5L07A 1G68A 1MKIA 1YSQA 3DTIA 4X55A 2G7UA 4S2KA 1A0KA 3NOUC 3IF6C 3UY6A 5CXWA 3UB8A 1T1CA 4I38A 2XA7S 1OTIA 2VGLM 4HJ6A 1FOFA 3VSLA 4ETZA 2FFYA 3T50A 3EOIA 3GRJA 1SKOB 1XKZA 2GDNA 2LB5A 4RYEA 4PM7A 1W8QA 3GECA 5DTSA 2YKFA 1C3BA 4EETB 4YINA 3O3VA 2K2NA 5HARA 3CUEA 4CLCA 2HP9A 4ZAMA 4HJ4A 3MJQA 2XD5A 1MWTA 3ZGAB 1OT9A 3IH9A 4Q0IA 2WGIA 2M1CA 4KQDA 3LIFA 2EA9A 3MXRA 3CPTB 4FCFA 1I2SA 3NDEA 4N92A 3WRZA 3B42A 4KENB 3CLOA 5TBMA 4UQIS 3NBLA 3UE1A 3P01A 1PRQA 5DJTA 5HD3A 3LICA 2ZL1A 4KZAA 2PD8A 1GCEA 5L10A 2W3HA 3C38A 3ZG8B 3ZYTA 3IHAA 4FSFA 4PHTA 1NXYA 2ZC4B 4BD0A 3BFFA 4R23A 3V50A 2J9OA 4LRZE 4WM9A 4Q8IA 1SHVA 1GA9A 5FDHA 1LSXA 1TVFA 1YLJA 1XPBA 1NJ4A 3G4PA 3IF6A 2WAEA 3JYIA 2E8JA 1Y4OA 1LL8A 3V67A 2PR6A 5DVAA 3HLDA 3FPWA 5EV0A 1GSVA 2XDMA 3DW0A 4MN7A 5FEFA 1TDGA 3FV7A 4JXSA 5L2FA 1E3UA 5FDSA 1M6KA 2HZ5A 1CQAA 3A0RA 4EUVA 5GHYA 4B4ZA 2PBYA 1P97A 4JGPA 3BM6A 4UA6A 3ITBA 4WN5A 2WKQA 3BLSA 2Y8HA 3KYEA 2X71A 2R9XA 1LL5A 2EFUA 1V9YA 2Q9MA 4KG5A 2LB9A 2EX9A 5AJGA 1FCNA 1UWPX 3UDIA 3OZHA 5DF7A 2L0WA 3ZQ5A 3F1PA 3OC2A 4DXCA 2Z6DA 3T4OA 5DKLA 5HSQA 1H3QA 5DFXA 3UB9A 3DWKA 4DE2A 4JBFA 2VGLS 4XUXA 2JKTM 4FH4A 2VKSA 1MC0A 1PI5A 3SH8A 1LL9A 1Z6FA 3N8RA 2MJ6A 4N9LA 1KGEA 4KZ3A 4DDYA 4PM9A 4WEJA 3UE0A 3BW6A 2PYRA 1LHYA 1N9OA 4EV4A 3EQUA 5CTMA 1K57A 5JYPA 2QJ5A 3JVUA 4S2NA 1LI9A 3GMWA 4I3JA 4BD1A 1XJ6A 3LR0A 2XSSA 5FEGA 5AQ9A 3GVBA 4K08A 2GNXA 5JYOA 3G32A 3S7NA 1XGJA 3PAEA 5HWVA 3G35A 3GSGA 4NXGA 3WS0A 3VE4A 1FCOA 4ID4A 4DJ2A 3Q7VA 3HJIA 4DXBA 4R1GA 4RVAA 4Y15A 1VB6A 1ALQA 2KLIA 1DP9A 5K5BA 2EX2A 4L9FA 3SH9A 1ESIA 3VP0A 3C7VA 1G5UA 5HL1A 3UDXA 4B88A 4KG2A 3L9KA 4E3JA 3P98A 1TS8A 2H5SA 4PM8A 2HF6A 4P85A 4Y0UA 1FR6A 2K31A 4HP4A 4UHUA 3N6IA 1PW8A 4BLMA 4MEZA 2PR5A 5GHZA 5CHJA 3DBAA 4HBUA 5FASA 1SDNA 2B18A 5J4EA 5U47A 3DAVA 3LR3A 1NZUA 2Y55A 3NC8A 2GX5A 1TDLA 1K4EA 4IEDA 5HWTA 4NETA 1MWSA 2NUPC 5IT5A 5HAQA 4NXBA 1JWZA 4X56A 4P6ZM 1L0FA 3UE3A 3IF5A 1JTGA 2WAFA 4MDZA 2A2LA 3H7WA 5MC7A 4X53A 1CF0A 3SH7A 3QP1A 3GV9A 4E04A 5HWWA 5G4YA 5HAIA 3V5MA 1VHMA 2O9CA 3LI9A 4KQRA 4ZRRA 5HDSA 1KE4A 1FILA 3W4PA 1S1YA 4OLGA 3WS4A 4JKTA 3IWQA 5DFYA 4M4XA 3HUOA 5CX7A 2DNSA 4IVIA 3EWKA 3HLFA 2HV1A 4JXVA 4HIAA 4KZ7A 4ME4A 4FUWA 1GHIA 2ZOIA 3GDIA 5GLBA 1MY8A 4NK3A 2ZOHA 3NCKA 2V8FA 1WA9A 2V20A 1PWGA 3KO6A 2VGJA 2P04A 5EUAA 4ZJ3A 1HLUP 1XFQA 1F2KA 4N1XA 1W5DA 2ZC7A 4LV0A 4I3IA 2PRFA 3PBNA 1I5QA 5IHVA 3KX0X 1NY0A 3PAGA 2ZQ7A 4U0XA 3QHYA 4MN6A 2Q9NA 3BYDA 4I39A 5E2GA 1YM1A 4X69A 3EEHA 3H82B 2KOIA 3MS6A 4Y17A 1KGFA 4EWFA 1L2SA 1YQSA 3MXSA 3BQ8A 3MFXA 4F3LB 3DTKA 5CGWA 2JKFA 2PDRA 4JF6A 4G3VA 1T1AA 2YKHA 5HDDA 4XUZA 3N8LA 1YLZA 2AVXA 3MFDA 3IH8A 4O01A 3G2YA 2Y2OA 2W3FA 1UWNX 4S2MA 1PZOA 2JC7A 1MZUA 3IWIA 3V3RA 2W0NA 5CRFA 1L0GA 1W63M 2ZM8A 3B3XA 4AFIA 2J80A 5EECA 5GLCA 5A90A 1STZA 3F1OB 3CITA 3CHWP 3VOYA 1HZOA 3A3JA 2Y91A 1BLHA 2J3TD 2ZMVA 5CEDA 4CLCB 1YT4A 1DJCA 3Q81A 3DWZA 4WYYA 4R4RA 4PM5A 1LSVA 5GLAA 4OQ0A 1SCWA 1DP8A 2JHEA 1Y28A 4GDBA 2C6WB 3IS2B 4IUHA 1RP5A 5A93A 4DDSA 4EBPA 1YAXA 2UV0E 4WEKA 4HY8A 3MQ0A 4WZ5A 5TBMB 3PXPA 3IX8A 4HESA 4EUZA 1ZG6A 4JF5A 2D02A 2PBDP 4H6JB 4L9GA 1GA0A 5HAPA 3M2JA 1BULA 4GJ4A 3CJMA 1KDWA 3S7QA 5CEBA 5F1FA 3NI9A 2ZQDA 4HNBA 1Z09A 4GS9A 1PI4A 3UN7A 2G2WA 2OAP1 4DKIA 3CAXA 4R70A 2P08A 1W79A 2V1BA 5KSCA 1N9LA 3BEBA 2GZAA 4KZ9A 5AQAA 3V3SA 5M18A 4A5RA 3MQQA 1AXBA 4Y3IA 3R7WA 2XLNA 4ARZA 2Y2NA 1PNEA 3SS5A 2W1TA 3S7OA 5CECA 2HDRA 3T1SA 1T18A 3BFCA 3SZTA 2OWJA 1LI0A 4S2LA 3TG9A 2XROA 4IBRA 3NULA 4OLDA 3A0VA 2O9BA 3LIBA 3UPNA 3PBOA 4GN2A 4OQIA 1BSGA 1ES3A 4YFMA 4BWIA 2A24B 5CHMA 3CWFA 2D01A 1WE4A 1P9RA 3E98A 3OBFA 3F1NA 1GSXA 5L09A 4GHIA 3RFBA 2Z2MB 5EVLA 4EXOA 1FIKA 4FOFA 4FD8A 4JGRA 4D2OA 1E3UD 4E3NA 3LEQA 1P9WA 5EVIA 4N9KA 1ZG4A 3QP4A 1KDSA 3VP1A 4Y7PA 3ISGA 4GOGA 3N8SA 1VETA 3A0SA 3K2NA 3LIDA 4N1HA 5M19A 1XGIA 1BYWA 5TGFA 2VV8A 4LV2A 4LLOB 3T4SA 2IA2A 4S2IA 4X68A 1K25A 1XXMA 3VSKA 5HW3A 3BRMA 2ZQ8A 5FQQA 1ES4A 1D06A 2QMIA 4WUJA 4QY5A 4NKPA 4GB7A 3D4FA 3KYZA 3QP8A 3BFDA 3ZG9B 1WYBA 2G2UA 2PD7A 4OKPA 3S7PA 3T4QA 3P09A 3GTCA 3O5YA 3JVVA 3LR5A 1MWRA 2I9VA 2QWSA 5F69A 4PAUA 1S67L 3SOIA 2P9VB 3PBSA 1EROA 1IYQA 2B5RA 2W3EA 3QP2A 4CLCE 1OPXA 2I72A 4S2PA 1OTAA 3ITAA 5J3WA 1W63Q 2HDUA 4HH3A 3IX3A 1MXOA 2JE5A 4KZ4A 2V8CA 3UNWA 4O0PA 2FFFB 5A91A 2ZLYA 2VX8A 3C4OA 1K55C 5CTNA 1J3WA 3E0YA 3LO7A 4LCLA 1CK3A 2INWA 3HL9A 3HLEA 5AVFA 1SDEA 4WF0A 3LY3A 1QMEA 3ZG5A 4IJGA 3OPHA 5CGSA 4Y0OA 3FWLA 1XJ2A 4PM6A 5I5LA 1EWZA 2XK1A 4E3LA 2CMNA 2DCFA 1SKOA 2VA0A 4KQOA 4DF6A 1KVMA 1VM1A 3BFEA 4B9OA 1K4FA 3RXWA 4L9EA 1IKIA 4G3WA 3WS1A 1W7FA 2X02A 1S1ZA 5DKKA 1VEUA 2IWCA 1OJ5A 5E2EA 2P7JA 4BQMA 4OPYA 4EBNA 4QWOA 3G30A 3IBRA 5CERA 4GDNA 2KDKA 5DJUA 3FKWA 4WLAA 3CPTA 4QHCA 4R0QA 3UB7A 2ACGA 2OLVA 1NZOA 1ZTUA 3KSHA 3CZDA 5FI2A 3TOIA 4LFUA 2FZ0A 3MQOA 3MR0A 1T1BA 4IBXA 5HX9A 4IHQA 4JGQA 4D60A 1ONGA 3ZVWA 1K55A 4L0LA 3EEAA 1ERMA 1XA1A 3UO9A 5KSHA 3A3FA 2FH5A 3NDGA 2WKIA 3NHQA 4ZJ1A 1JWPA 3LEZA 1KVLA 5TJJA 2PYPA 3IXDA 3AGEA 3D3OA 4OOYA 3W4QA 1MPLA 3ZNYA 1H0MA 1E25A 3CG5A 4YNRA 1CJFA 3T4JA 2VZWA 3T4KA 4KZ5A 1YLPA 1FCMA 1ZC2A 3NIAA 1KGGA 4LRXC 4GZBA 2NUTC 1J9MA 2Y2LA 5L8MA 3IBJA 2WGWB 4MBFA 1ZKJA 4LV3A 4WZ4A 4Q0JA 4ZDXA 4UEYA 1YMXA 1K54C 3LYXA 1IOUA 4Y0TA 5DTTA 3ZVTA 4NG2A 1F9IA 1BLSA 1YLYA 4BBVA 2GJ3A 1FR1A 1K56A 1SZVA 4QPRA 3IX4A 1PWDA 2PU4A 1F98A 5G4ZA 3KSGA 2JBFA 1NLYA 3UMDA 4MN5A 4DMZA 3MSHA 5F5YA 4OP8A 4R3JA 3LUQA 5FATA 3PR6A 2JCHA 1YKDA 2L4RA 5F82A 5FQIA 4XT2B 3B33A 5F1GA 3ULFA 4FH2A 5EE8A 5J7EA 3TSGA 5GL9A 2B95A 1MWUA 3HLCA 4UA9A 2Y2KA 4JXWA 2EWVA 5DF9A 3HBRA 4HBTA 2O0YA 3NECA 2ZMAA 3PHYA 4KUOA 4OQGA 1N4OA 4HI4A 4M3KA 3ICYA 1DY6A 2RL3A 3QNCA 5HL6A 2WK0A 2QHKA 3FC7A 3Q07A 4S2JA 2Y2GA 1SKFA 4EW7A 2B02A 2VLGA 2WKHA 1WYCA 1S4RA 2W1TB 3HUMA 1OTBA 3HLWA 4K91A 4KZ8A 2QPNA 1FSYA 5F6AA 3ZG7B 2C5WB 2EWWA 1OMEA 3KSFA 2VV6A 1TS6A 2K7SA 2W3DA 4KG6A 4EESA 4OVDA 4E6XA 2X01A 2XA7M 4GLQA 2Y59A 1OJGA 2EXAA 3W2ZA 1TS7A 1PZPA 2VGKA 4P6ZS 3UPOA 3HREA 4EU0A 1BUEA 2VV7A 3Q1FA 1V9ZA 2VEAA 2PU2A 3LIAA 3FG8A 5EVIB 4QB8A 3D72A 3VP2A 2XFSA 1HD8A 1ONHA 3W8KA 2BTFP 3A3EA 4BBUA 3OPLA 3OCLA 4OPZA 1K38A 1O7EA 1Y54A 2QJ7A 3K3DA 1F5MA 3E4QA 3G34A 2WYXA 2JKRI 4HP9A 3ZDJA 4C3QA 2ZL1B
chains in the Genus database with same CATH topology
3EQUA 3PBTA 3MF0A 3U2AA 4O8GA 2QJ5A 2W1RA 3JVUA 4I3JA 1D06A 2V9AA 1XJ6A 4WUJA 4NKPA 3LR0A 3KYZA 2XSSA 4Y5FA 4K08A 2GNXA 2PD7A 3S7NA 2L1MA 3HCYA 5HWVA 1X0OA 4GS9B 3S7PA 3T4QA 1NRJA 1T19A 2JN7A 3KYQA 4NXGA 3O5YA 3T4TA 3TW8A 2R78A 4IUKA 3E4OA 3JVVA 3LR5A 3UB6A 3VE4A 3CUEC 3E4PA 4DJ2A 4CLCC 3HJIA 2WKPA 2I9VA 1TS0A 2QWSA 5F69A 2XRNA 4PAUA 1S67L 3EGXC 3PBSA 1VB6A 2KLIA 1IFQA 3LR4A 3OLOA 2W3EA 1DP9A 4R6LA 5K5BA 4CLCE 3CI6A 4PKYG 4L9FA 1OPXA 3R7WB 4EERA 3T4LA 3BQAA 4ARZB 1OTDA 1YSPA 5HD5A 1OTAA 1TS8A 2HF6A 3H82A 5J3WA 1W63Q 2K31A 4HP4A 3FPVA 3MMHA 4F3LA 2QKPA 3BWLA 2PR5A 5F68A 4MCWA 4HH3A 3DBAA 3HJKA 3UMEA 2ZMFA 2B18A 5J4EA 5EFWA 2O9AA 2QYBA 2W3GA 3LR3A 4O0PA 5HWTA 2GX5A 2VX8A 2PHYA 2NUPC 5IT5A 1LSWA 3SW1A 2HJ9C 4NXBA 1ODVA 4P6ZM 3TJZC 1D7EA 3F1NB 4RQ9A 5KIZA 3UE3A 4GHIB 3F1PB 3LIEA 4BJPA 3E0YA 3NOPC 4MDZA 2INWA 2A2LA 3H7WA 5MC7A 1TF1A 3VOLA 5AVFA 2KX6A 4WF0A 1DRMA 1H8MA 4IJGA 4Y2FA 4E04A 1G28A 4B93A 5HWWA 1XJ2A 5G4YA 4II7A 3G6OA 5I5LA 3F1OA 1VHMA 4NEED 1EW0A 2O9CA 3LI9A 2CMNA 2BASA 2OOLA 4ZRRA 2J3TC 2VA0A 3B47A 5HDSA 4KQOA 4HHDA 4CQHA 1S1YA 4B9OA 4L9EA 5DFYA 2H28A 4G3WA 1S66L 4M4XA 2HJEA 5LBRA 2W27A 1S1ZA 5DKKA 5CX7A 5IU1A 3EGDC 3EWKA 1OJ5A 4UQIM 2HV1A 2P7JA 4BBTA 2Y79A 4HIAA 4ME4A 2ZOIA 3GDIA 5HDCA 3IBRA 3IS2A 2ZOHA 1MKMA 2KDKA 3NOTC 1WA9A 5DJUA 2PT7A 4YOFA 4WLAA 1GSWA 3TE8A 4XT2A 3LFVA 3UB7A 2V0UA 3KO6A 3NJAA 4GCZA 2P04A 1ZTUA 4BMWA 3KSHA 1XFQA 4OOMA 1NLZA 5HZHA 2OAQ1 1JNUA 4H6JA 2FZ0A 4Q0HA 3MQOA 4I3IA 3MR0A 3PBNA 1T1BA 4IHQA 4JGQA 3KX0X 3UE6A 2V1AA 4OOLA 4CLCD 4L0LA 3VE3A 1XJ3A 3EEAA 4KUKA 4MN6A 3RH8B 4I39A 5KSHA 3C8CA 3EEHA 3H82B 2KOIA 2FH5A 1OT6A 4NXFA 2JKRM 3NHQA 3BQ8A 3EQVA 3MFXA 4F3LB 3H9WA 5TJJA 2PYPA 2JKTI 2PDRA 3D3OA 1ZHHB 4G3VA 1T1AA 2ZBBA 2YKHA 5HDDA 2M7UA 4YNRA 3T4JA 2VZWA 3T4KA 2J3WA 4GW9A 4O01A 5IS1A 4EEUA 3C30A 1XJ4A 2W3FA 1UWNX 4HOIA 4LRXC 2NUTC 1KOUA 1MZUA 1YSQA 3H7WB 5L8MA 2W0NA 3IBJA 2G7UA 1W63M 4AFIA 3NOUC 2J80A 4Q0JA 3UB8A 4UEYA 1T1CA 4I38A 3P7NA 2A24A 3LYXA 2XA7S 1OTIA 2VGLM 1IOUA 1STZA 4HJ6A 4ETXA 3F1OB 3PBRA 4ETZA 1LT0A 3T50A 3CITA 3EOIA 1F9IA 2LB5A 2O99A 4BBVA 3GECA 4R38A 2GJ3A 2YKFA 4WL9A 4EETB 1NWZA 2J3TD 2VJWA 2ZMVA 2K2NA 5FL3A 4QPRA 4CLCB 3CUEA 4CLCA 1LSVA 4HH2A 5HPIA 1F98A 4HJ4A 3KSGA 5G4ZA 3TRCA 1DP8A 1G6OA 1NLYA 2JHEA 4MN5A 3UMDA 4DMZA 1Y28A 3MJQA 5F5YA 4LRYC 3IS2B 1OT9A 4IUHA 4Q0IA 3LUQA 2M1CA 1YAXA 4KQDA 3PR6A 4I5SA 3LIFA 3R4KA 2EA9A 1YKDA 4WEKA 2L4RA 4EEPA 3RTYA 4XT2B 1DP6A 3B42A 4MMNA 3B33A 3MQ0A 4HY8A 3PYPA 3VV4A 4WELA 3BJNA 3CLOA 5TBMB 4Z1WA 3ULFA 3PXPA 1S4SA 5TBMA 4UQIS 5J7EA 3P01A 5DJTA 1OTEA 5HD3A 3LICA 4G3KA 1P0ZA 2D02A 2PD8A 4H6JB 4L9GA 2W3HA 3BY8A 3C38A 2EWVA 2DMWA 2WKRA 5DF9A 4FSFA 4PHTA 4GJ4A 3ZYTA 3S7QA 2O0YA 3PHYA 4DJ3A 4KUOA 4LRZE 5A8BA 4HNBA 4HI4A 1LSXA 3ICYA 4GS9A 5HPFA 3MXQA 5HL6A 2OAP1 2QHKA 3FC7A 4NXEA 2OWHA 5C5KA 3CAXA 4DN0A 4R70A 1N9NA 2P08A 2V1BA 1N9LA 1LL8A 2GZAA 3V67A 2PR6A 4EW7A 2B02A 3FPWA 2VLGA 1GSVA 3MQQA 1S4RA 4Y3IA 5AVEA 3R7WA 2W1TB 1XFNA 4MN7A 4ARZA 1OTBA 1UGUA 2W1TA 3S7OA 5F6AA 3PBQA 2EWWA 3A0RA 1T18A 4EUVA 2OWJA 4PKYA 3KSFA 2VV6A 1TS6A 1P97A 2HGVA 2XROA 4HJ3A 4JGPA 2K7SA 2W3DA 4EESA 4LPZA 3A0VA 2O9BA 3LIBA 3PBOA 4HQAA 4WN5A 3KSIA 2WKQA 4R3AA 2Y8HA 2XA7M 4BWIA 2A24B 4GLQA 3CWFA 2D01A 1V9YA 1OJGA 1P9RA 2LB9A 4YWZA 3W2ZA 3E98A 1TS7A 3OBFA 4P6ZS 5AJGA 1UWPX 3F1NA 1GSXA 3ZQ5A 2L0WA 2V0WA 4GHIA 3F1PA 3OC2A 2Z6DA 4EU0A 1TD5A 2Z6CA 3RFBA 3T4OA 2M7VA 5DKLA 5HSQA 4EXOA 2VV7A 3OOVA 1V9ZA 1H3QA 2VEAA 4FOFA 4JGRA 4JGOA 5DFXA 3UB9A 3LIAA 2VGLS 3FG8A 1P9WA 2JKTM 3D72A 3C2WA 2VKSA 1MC0A 4BBUA 3OCLA 3OCNA 3K3CA 2MJ6A 3A0SA 2QJ7A 3K2NA 3K3DA 3LIDA 1F5MA 3E4QA 1BYWA 4WEJA 4EQ1A 2JKRI 4I3AA 2VV8A 4LLOB 3T4SA 4HP9A 3BW6A 2IA2A 3BY9A 3LI8A 2PYRA 1N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ5 A;  4I3J A;  1D06 A;  2V9A A;  1XJ6 A;  4WUJ A;  4K08 A;  2PD7 A;  2L1M A;  5HWV A;  1X0O A;  4GS9 B;  1T19 A;  2JN7 A;  4NXG A;  2R78 A;  3E4O A;  3VE4 A;  3UB6 A;  3E4P A;  4DJ2 A;  3HJI A;  2WKP A;  2I9V A;  1TS0 A;  2QWS A;  5F69 A;  1S67 L;  1VB6 A;  3OLO A;  1DP9 A;  4R6L A;  4PKY G;  4L9F A;  4EER A;  1OTD A;  5HD5 A;  1OTA A;  1TS8 A;  3H82 A;  5J3W A;  4HP4 A;  4F3L A;  2QKP A;  3BWL A;  2PR5 A;  5F68 A;  4HH3 A;  3HJK A;  3UME A;  5J4E A;  5EFW A;  5HWT A;  2PHY A;  3SW1 A;  1LSW A;  4NXB A;  1ODV A;  1D7E A;  3F1N B;  4RQ9 A;  5KIZ A;  4GHI B;  3F1P B;  3LIE A;  3NOP C;  2INW A;  3H7W A;  3VOL A;  5AVF A;  2KX6 A;  4WF0 A;  1DRM A;  4E04 A;  1G28 A;  5HWW A;  1XJ2 A;  5G4Y A;  3G6O A;  5I5L A;  3F1O A;  1EW0 A;  3LI9 A;  2CMN A;  2BAS A;  2OOL A;  5HDS A;  4HHD A;  1S1Y A;  4B9O A;  4L9E A;  2H28 A;  1S66 L;  4M4X A;  2W27 A;  1S1Z A;  5DKK A;  5IU1 A;  3EWK A;  1OJ5 A;  2HV1 A;  2P7J A;  4BBT A;  4HIA A;  2ZOI A;  3GDI A;  5HDC A;  3IBR A;  3IS2 A;  2ZOH A;  2KDK A;  3NOT C;  1WA9 A;  5DJU A;  4WLA A;  1GSW A;  4XT2 A;  3UB7 A;  2V0U A;  3NJA A;  4GCZ A;  1XFQ A;  5HZH A;  1JNU A;  4H6J A;  3MQO A;  4I3I A;  3MR0 A;  1T1B A;  4JGQ A;  3KX0 X;  3UE6 A;  2V1A A;  3VE3 A;  1XJ3 A;  4KUK A;  4MN6 A;  3RH8 B;  4I39 A;  3C8C A;  3EEH A;  3H82 B;  1OT6 A;  4NXF A;  3NHQ A;  3MFX A;  4F3L B;  3H9W A;  2PYP A;  2PDR A;  1T1A A;  2ZBB A;  2YKH A;  5HDD A;  4GW9 A;  5IS1 A;  4EEU A;  1XJ4 A;  1UWN X;  4HOI A;  4LRX C;  1KOU A;  1MZU A;  3H7W B;  2W0N A;  3NOU C;  2J80 A;  3UB8 A;  1T1C A;  4I38 A;  3P7N A;  2A24 A;  3LYX A;  1OTI A;  4HJ6 A;  3F1O B;  1LT0 A;  3T50 A;  1F9I A;  4BBV A;  3GEC A;  4R38 A;  2GJ3 A;  2YKF A;  4WL9 A;  4EET B;  1NWZ A;  1LSV A;  4HH2 A;  1F98 A;  4HJ4 A;  5G4Z A;  1DP8 A;  3UMD A;  2JHE A;  4MN5 A;  1Y28 A;  3MJQ A;  5F5Y A;  4LRY C;  3IS2 B;  1OT9 A;  3LUQ A;  2M1C A;  4KQD A;  4I5S A;  3LIF A;  2EA9 A;  2L4R A;  4EEP A;  3RTY A;  4XT2 B;  1DP6 A;  3B33 A;  4HY8 A;  3PYP A;  3CLO A;  5TBM B;  3ULF A;  1S4S A;  5TBM A;  5J7E A;  5DJT A;  1OTE A;  5HD3 A;  3LIC A;  1P0Z A;  2D02 A;  2PD8 A;  4H6J B;  4L9G A;  3BY8 A;  2WKR A;  3PHY A;  4DJ3 A;  4KUO A;  4LRZ E;  5A8B A;  4HNB A;  4HI4 A;  1LSX A;  3ICY A;  4GS9 A;  3MXQ A;  2QHK A;  3FC7 A;  4NXE A;  2OWH A;  3CAX A;  4R70 A;  1N9N A;  2V1B A;  1N9L A;  1LL8 A;  2PR6 A;  4EW7 A;  2B02 A;  2VLG A;  1GSV A;  3MQQ A;  1S4R A;  5AVE A;  1XFN A;  1OTB A;  1UGU A;  5F6A A;  3A0R A;  1T18 A;  2OWJ A;  4PKY A;  2VV6 A;  1TS6 A;  1P97 A;  4HJ3 A;  4JGP A;  2K7S A;  4EES A;  4LPZ A;  3A0V A;  3LIB A;  4HQA A;  4WN5 A;  4R3A A;  2WKQ A;  2A24 B;  3CWF A;  2D01 A;  1V9Y A;  1OJG A;  4YWZ A;  1TS7 A;  1UWP X;  3F1N A;  1GSX A;  3ZQ5 A;  2L0W A;  2V0W A;  4GHI A;  3F1P A;  2Z6D A;  2Z6C A;  5DKL A;  5HSQ A;  4EXO A;  2VV7 A;  1V9Z A;  2VEA A;  4JGR A;  4JGO A;  3UB9 A;  3LIA A;  3FG8 A;  3D72 A;  3C2W A;  4BBU A;  3K3C A;  3A0S A;  2QJ7 A;  3K3D A;  3LID A;  3E4Q A;  1BYW A;  4EQ1 A;  4I3A A;  2VV8 A;  4LLO B;  4HP9 A;  3BY9 A;  3LI8 A;  2PYR A;  1N9O A; 
#chains in the Genus database with same CATH topology
 5EOE A;  3M6B A;  3G2Z A;  3PBT A;  4WMC D;  4O8G A;  2W1R A;  4ZBE A;  3O86 A;  1FSW A;  5A92 A;  2V9A A;  4QD4 A;  4OPQ A;  2PAV P;  2JKG A;  1ES2 A;  2HDS A;  3LGO A;  4UA7 A;  2L1M A;  3HCY A;  3UB5 P;  1X0O A;  4OP5 A;  3QNB A;  3O87 A;  5EVI D;  2JN7 A;  3T4T A;  3SS4 A;  3WS5 A;  4P87 A;  3TW8 A;  4IUK A;  3IF6 B;  1ACF A;  2WZX A;  3CUE C;  3E4P A;  3IQA A;  4CLC C;  2WKP A;  1QMF A;  4MBK A;  3EGX C;  5FQM A;  1PW1 A;  3ZHH A;  1IFQ A;  3LR4 A;  3OLO A;  4R6L A;  3CI6 A;  4PKY G;  1EI5 A;  3MZD A;  3V39 A;  4EER A;  4RX3 A;  3LY4 A;  3T4L A;  3VP3 A;  2J8Y A;  2QZ6 A;  1YSP A;  5HD5 A;  2Y4A A;  3H82 A;  1TEM A;  2Y2I A;  5GLD A;  3FPV A;  1S6R A;  3IXB A;  3ZG0 A;  4E6W A;  3MMH A;  4F3L A;  2QKP A;  3BWL A;  5F68 A;  3VFF A;  2IWD A;  3HJK A;  4ZJ2 A;  3UME A;  2ZMF A;  2O9A A;  1NRF A;  2W3G A;  1G6A A;  5FSR A;  1JVJ A;  2PHY A;  2RCX A;  3SW1 A;  2HJ9 C;  5FAO A;  4U3T A;  1ODV A;  1D7E A;  1ES5 A;  3T1X A;  5KIZ A;  3F1P B;  4WMC A;  3BEC A;  3NOP C;  1TF1 A;  4JF4 A;  3BLM A;  1W8Y A;  3L7H A;  4PPR A;  1M40 A;  4Y2F A;  2BG1 A;  4II7 A;  3G6O A;  3E2K A;  3F1O A;  4NEE D;  2WZZ A;  1EW0 A;  2OOL A;  2ZD8 A;  3QP5 A;  3WS2 A;  4CQH A;  1JWV A;  2ZC5 B;  4DE3 A;  4ZTK A;  1DJB A;  2H28 A;  2WGV A;  2HJE A;  1NYM A;  1VEU B;  1XX2 A;  1FQG A;  3C4P A;  3DTM A;  5FQK A;  4X1M A;  5EVE A;  4BBT A;  1S0W A;  2Y79 A;  4LV1 A;  3SS3 A;  5HDC A;  1E4D A;  3IS2 A;  3W4O A;  1MKM A;  3N7W A;  3NOT C;  2PT7 A;  3GQZ A;  3FKV A;  3UDF A;  2XEP A;  3HVF A;  1ESU A;  1IEM A;  2E8I A;  4GCZ A;  3C5A A;  1IYS A;  1DJA A;  4BMW A;  4JLF A;  1NLZ A;  2OAQ 1;  3C7U A;  3Q7V B;  4H6J A;  3VOZ A;  4Q0H A;  1L0D A;  1K6R A;  3UE6 A;  2V1A A;  3A3D A;  3T1Q B;  5FQJ A;  3ZNT A;  3RJU A;  3VE3 A;  4KUK A;  1HTZ A;  4RX2 A;  3RH8 B;  3VMA A;  1CEG A;  4C6Y A;  1OT6 A;  2XF3 A;  4NXF A;  3EQV A;  1Q2P A;  2Y2M A;  5EPH A;  3H9W A;  1IKG A;  5FA7 A;  2XD1 A;  2JKT I;  3S22 A;  1LLB A;  3AGD A;  1K57 C;  1PYY A;  4S2N C;  4MNR A;  1BLP A;  2J3W A;  2ZC6 B;  4FTX A;  4GW9 A;  4QU3 A;  4MBH A;  5E2F A;  3JPU A;  3C30 A;  4B4X A;  2XGN A;  1KOU A;  3H7W B;  5KMW A;  1BZA A;  4OON A;  1VQQ A;  1KE0 A;  2A49 A;  4BL3 A;  4C75 A;  3P7N A;  2A24 A;  4ETX A;  2EXB A;  3BFG A;  3PBR A;  1LT0 A;  3IWO A;  2Y2H A;  2XQZ A;  1YLW A;  3S1Y A;  3A3I A;  2Y2J A;  1GHP A;  2O99 A;  3DTE A;  4R38 A;  1YPR A;  4WL9 A;  1NWZ A;  2VJW A;  4JXG A;  2H0T A;  4Z9Q A;  5FL3 A;  3NY4 A;  1MBL A;  4LGW A;  4U0T A;  4HH2 A;  3N4I A;  1PIO A;  5HPI A;  2ZC3 B;  3OPP A;  3TRC A;  1G6O A;  1BTL A;  4LRY C;  4PMA A;  4BL2 A;  3LCE A;  1JTD A;  4I5S A;  2ZQ9 A;  4R3B A;  2WKE A;  3R4K A;  4E3K A;  3MZE A;  4EEP A;  3M6H A;  4H8R A;  3RTY A;  3IT9 A;  1DP6 A;  4MMN A;  5E2H A;  3VV4 A;  3PYP A;  4WEL A;  3D9Y A;  3BJN A;  4MLL A;  4Z1W A;  1S4S A;  4GKU A;  2ZJ9 A;  4K0X A;  1OTE A;  4G3K A;  1P0Z A;  5CGX A;  3BY8 A;  1D1J A;  1PFL A;  2DMW A;  2EX8 A;  2WKR A;  4EBL A;  1K56 D;  3RXX A;  4E3O A;  2ZQC A;  4DJ3 A;  5A8B A;  3ZFZ A;  3S4X A;  5HPF A;  2OLU A;  3MXQ A;  3CMZ A;  4DE1 A;  4NXE A;  5BOH A;  2OWH A;  5C5K A;  2J7V A;  5EM1 A;  4UAA A;  4DN0 A;  4DE0 A;  1N9N A;  2HPB A;  2ZQA A;  2P9V A;  3IHB A;  4KZB A;  2WAD A;  5AVE A;  4E3M A;  1XFN A;  4WBG A;  1UGU A;  2H10 A;  4KZ6 A;  1IYO A;  3PTE A;  5CHU A;  1IYP A;  5TR7 A;  5FAP A;  3PBQ A;  3MKF A;  3VFH A;  1GHM A;  1IEL A;  4PKY A;  3WWX A;  3U4L P;  2HGV A;  3GR2 A;  4HJ3 A;  3FZC A;  4LPZ A;  4HQA A;  3KSI A;  4R3A A;  4LEN A;  5FAQ A;  3IXH A;  4X6T A;  5I94 A;  2XH9 A;  5FI6 A;  4YWZ A;  2V0W A;  2DRW A;  4RA7 A;  1TD5 A;  2Z6C A;  2EFX A;  2M7V A;  3OOV A;  4JGO A;  3OPR A;  5DTK A;  1BLC A;  3E2L A;  3MBZ A;  3C2W A;  1Q2Q A;  1NYY A;  3OCN A;  3K3C A;  2P74 A;  5EM0 A;  2A3U A;  4GD8 A;  5D3O A;  5E43 A;  3MZF A;  4EQ1 A;  4I3A A;  4CJN A;  3BY9 A;  5FI7 A;  3LI8 A;  2ZM0 A;  1PWC A;  3MF0 A;  3U2A A;  4P0M A;  3FYZ A;  2ZM2 A;  1H5X A;  2OV5 A;  4QJG A;  4O7D A;  4Y5F A;  5TFQ A;  4EQI A;  1U60 A;  2IWB A;  4GS9 B;  1NRJ A;  1T19 A;  3KYQ A;  5DF8 A;  2H0Y A;  2WUQ A;  3G31 A;  2R78 A;  3E4O A;  3UB6 A;  5AQB A;  1TS0 A;  1L3L A;  4E3I A;  1K54 A;  2XRN A;  1O07 A;  3AGF A;  2V1Z A;  5J8X A;  1BT5 A;  4GNU A;  4GD6 A;  3R7W B;  4LCM A;  1XP4 A;  3BQA A;  4ARZ B;  4IVK A;  1OTD A;  2R9W A;  5G18 A;  4HEF A;  1ERQ A;  3ZCZ A;  4QY6 A;  4XXR A;  4WZ5 C;  4MCW A;  2UWX A;  4KQQ A;  5EFW A;  2QYB A;  1YMS A;  4OQH A;  1LSW A;  2XFT A;  2Z2L B;  3TJZ C;  1K6S A;  2V2F F;  3F1N B;  4RQ9 A;  4GHI B;  2EX6 A;  3LIE A;  4BJP A;  2HDQ A;  3VOL A;  4X1L A;  2KX6 A;  2WGW A;  1DRM A;  4F94 A;  1H8M A;  1G28 A;  4JPM A;  3VP4 A;  1RCJ A;  4B93 A;  3QP6 A;  2BAS A;  2J3T C;  3B47 A;  5F83 A;  4HHD A;  4OPR A;  2CC1 A;  1VET B;  5FQ9 A;  2Y2Q A;  3HLG A;  1H8Z A;  1S66 L;  2J9P A;  2XR0 A;  5LBR A;  1RGY A;  2W27 A;  1H8Y A;  1AWI A;  5IU1 A;  5M1A A;  2Y2P A;  3EGD C;  4UQI M;  1I2W A;  4ESP A;  5EOO A;  2HP6 A;  5GHX A;  1L0E A;  4YOF A;  4OH0 A;  1GSW A;  4K0W A;  3TE8 A;  1RGZ A;  4XT2 A;  2BLS A;  3LFV A;  3O88 A;  3T12 B;  2V0U A;  1YLT A;  3NJA A;  3HLB A;  1N9B A;  3Q7Z A;  4OOM A;  4CPK A;  5AQ7 A;  5HZH A;  5KZH A;  3Q82 A;  1JNU A;  3I7J A;  1K0K A;  4Y13 A;  4OOL A;  5HFO A;  4CLC D;  5EVI C;  3M2K A;  1XJ3 A;  3HUN A;  1HVB A;  1XA7 A;  1CI8 A;  3C8C A;  1CEF A;  1CI9 A;  2JKR M;  2HP5 A;  2Q0O A;  4R4S A;  1ZHH B;  4BEN A;  4X25 A;  3UPP A;  4DRT A;  2ZBB A;  2M7U A;  3T1R A;  2VK3 A;  1KE3 A;  5IS1 A;  4EEU A;  3WRT A;  3MKE A;  3IXG A;  4P6B A;  1XJ4 A;  2OSU A;  4HOI A;  4S2O A;  5L07 A;  1G68 A;  1MKI A;  1YSQ A;  3DTI A;  4X55 A;  2G7U A;  4S2K A;  1A0K A;  3NOU C;  3IF6 C;  3UY6 A;  5CXW A;  3UB8 A;  1T1C A;  4I38 A;  2XA7 S;  1OTI A;  2VGL M;  4HJ6 A;  1FOF A;  3VSL A;  4ETZ A;  2FFY A;  3T50 A;  3EOI A;  3GRJ A;  1SKO B;  1XKZ A;  2GDN A;  2LB5 A;  4RYE A;  4PM7 A;  1W8Q A;  3GEC A;  5DTS A;  2YKF A;  1C3B A;  4EET B;  4YIN A;  3O3V A;  2K2N A;  5HAR A;  3CUE A;  4CLC A;  2HP9 A;  4ZAM A;  4HJ4 A;  3MJQ A;  2XD5 A;  1MWT A;  3ZGA B;  1OT9 A;  3IH9 A;  4Q0I A;  2WGI A;  2M1C A;  4KQD A;  3LIF A;  2EA9 A;  3MXR A;  3CPT B;  4FCF A;  1I2S A;  3NDE A;  4N92 A;  3WRZ A;  3B42 A;  4KEN B;  3CLO A;  5TBM A;  4UQI S;  3NBL A;  3UE1 A;  3P01 A;  1PRQ A;  5DJT A;  5HD3 A;  3LIC A;  2ZL1 A;  4KZA A;  2PD8 A;  1GCE A;  5L10 A;  2W3H A;  3C38 A;  3ZG8 B;  3ZYT A;  3IHA A;  4FSF A;  4PHT A;  1NXY A;  2ZC4 B;  4BD0 A;  3BFF A;  4R23 A;  3V50 A;  2J9O A;  4LRZ E;  4WM9 A;  4Q8I A;  1SHV A;  1GA9 A;  5FDH A;  1LSX A;  1TVF A;  1YLJ A;  1XPB A;  1NJ4 A;  3G4P A;  3IF6 A;  2WAE A;  3JYI A;  2E8J A;  1Y4O A;  1LL8 A;  3V67 A;  2PR6 A;  5DVA A;  3HLD A;  3FPW A;  5EV0 A;  1GSV A;  2XDM A;  3DW0 A;  4MN7 A;  5FEF A;  1TDG A;  3FV7 A;  4JXS A;  5L2F A;  1E3U A;  5FDS A;  1M6K A;  2HZ5 A;  1CQA A;  3A0R A;  4EUV A;  5GHY A;  4B4Z A;  2PBY A;  1P97 A;  4JGP A;  3BM6 A;  4UA6 A;  3ITB A;  4WN5 A;  2WKQ A;  3BLS A;  2Y8H A;  3KYE A;  2X71 A;  2R9X A;  1LL5 A;  2EFU A;  1V9Y A;  2Q9M A;  4KG5 A;  2LB9 A;  2EX9 A;  5AJG A;  1FCN A;  1UWP X;  3UDI A;  3OZH A;  5DF7 A;  2L0W A;  3ZQ5 A;  3F1P A;  3OC2 A;  4DXC A;  2Z6D A;  3T4O A;  5DKL A;  5HSQ A;  1H3Q A;  5DFX A;  3UB9 A;  3DWK A;  4DE2 A;  4JBF A;  2VGL S;  4XUX A;  2JKT M;  4FH4 A;  2VKS A;  1MC0 A;  1PI5 A;  3SH8 A;  1LL9 A;  1Z6F A;  3N8R A;  2MJ6 A;  4N9L A;  1KGE A;  4KZ3 A;  4DDY A;  4PM9 A;  4WEJ A;  3UE0 A;  3BW6 A;  2PYR A;  1LHY A;  1N9O A;  4EV4 A;  3EQU A;  5CTM A;  1K57 A;  5JYP A;  2QJ5 A;  3JVU A;  4S2N A;  1LI9 A;  3GMW A;  4I3J A;  4BD1 A;  1XJ6 A;  3LR0 A;  2XSS A;  5FEG A;  5AQ9 A;  3GVB A;  4K08 A;  2GNX A;  5JYO A;  3G32 A;  3S7N A;  1XGJ A;  3PAE A;  5HWV A;  3G35 A;  3GSG A;  4NXG A;  3WS0 A;  3VE4 A;  1FCO A;  4ID4 A;  4DJ2 A;  3Q7V A;  3HJI A;  4DXB A;  4R1G A;  4RVA A;  4Y15 A;  1VB6 A;  1ALQ A;  2KLI A;  1DP9 A;  5K5B A;  2EX2 A;  4L9F A;  3SH9 A;  1ESI A;  3VP0 A;  3C7V A;  1G5U A;  5HL1 A;  3UDX A;  4B88 A;  4KG2 A;  3L9K A;  4E3J A;  3P98 A;  1TS8 A;  2H5S A;  4PM8 A;  2HF6 A;  4P85 A;  4Y0U A;  1FR6 A;  2K31 A;  4HP4 A;  4UHU A;  3N6I A;  1PW8 A;  4BLM A;  4MEZ A;  2PR5 A;  5GHZ A;  5CHJ A;  3DBA A;  4HBU A;  5FAS A;  1SDN A;  2B18 A;  5J4E A;  5U47 A;  3DAV A;  3LR3 A;  1NZU A;  2Y55 A;  3NC8 A;  2GX5 A;  1TDL A;  1K4E A;  4IED A;  5HWT A;  4NET A;  1MWS A;  2NUP C;  5IT5 A;  5HAQ A;  4NXB A;  1JWZ A;  4X56 A;  4P6Z M;  1L0F A;  3UE3 A;  3IF5 A;  1JTG A;  2WAF A;  4MDZ A;  2A2L A;  3H7W A;  5MC7 A;  4X53 A;  1CF0 A;  3SH7 A;  3QP1 A;  3GV9 A;  4E04 A;  5HWW A;  5G4Y A;  5HAI A;  3V5M A;  1VHM A;  2O9C A;  3LI9 A;  4KQR A;  4ZRR A;  5HDS A;  1KE4 A;  1FIL A;  3W4P A;  1S1Y A;  4OLG A;  3WS4 A;  4JKT A;  3IWQ A;  5DFY A;  4M4X A;  3HUO A;  5CX7 A;  2DNS A;  4IVI A;  3EWK A;  3HLF A;  2HV1 A;  4JXV A;  4HIA A;  4KZ7 A;  4ME4 A;  4FUW A;  1GHI A;  2ZOI A;  3GDI A;  5GLB A;  1MY8 A;  4NK3 A;  2ZOH A;  3NCK A;  2V8F A;  1WA9 A;  2V20 A;  1PWG A;  3KO6 A;  2VGJ A;  2P04 A;  5EUA A;  4ZJ3 A;  1HLU P;  1XFQ A;  1F2K A;  4N1X A;  1W5D A;  2ZC7 A;  4LV0 A;  4I3I A;  2PRF A;  3PBN A;  1I5Q A;  5IHV A;  3KX0 X;  1NY0 A;  3PAG A;  2ZQ7 A;  4U0X A;  3QHY A;  4MN6 A;  2Q9N A;  3BYD A;  4I39 A;  5E2G A;  1YM1 A;  4X69 A;  3EEH A;  3H82 B;  2KOI A;  3MS6 A;  4Y17 A;  1KGF A;  4EWF A;  1L2S A;  1YQS A;  3MXS A;  3BQ8 A;  3MFX A;  4F3L B;  3DTK A;  5CGW A;  2JKF A;  2PDR A;  4JF6 A;  4G3V A;  1T1A A;  2YKH A;  5HDD A;  4XUZ A;  3N8L A;  1YLZ A;  2AVX A;  3MFD A;  3IH8 A;  4O01 A;  3G2Y A;  2Y2O A;  2W3F A;  1UWN X;  4S2M A;  1PZO A;  2JC7 A;  1MZU A;  3IWI A;  3V3R A;  2W0N A;  5CRF A;  1L0G A;  1W63 M;  2ZM8 A;  3B3X A;  4AFI A;  2J80 A;  5EEC A;  5GLC A;  5A90 A;  1STZ A;  3F1O B;  3CIT A;  3CHW P;  3VOY A;  1HZO A;  3A3J A;  2Y91 A;  1BLH A;  2J3T D;  2ZMV A;  5CED A;  4CLC B;  1YT4 A;  1DJC A;  3Q81 A;  3DWZ A;  4WYY A;  4R4R A;  4PM5 A;  1LSV A;  5GLA A;  4OQ0 A;  1SCW A;  1DP8 A;  2JHE A;  1Y28 A;  4GDB A;  2C6W B;  3IS2 B;  4IUH A;  1RP5 A;  5A93 A;  4DDS A;  4EBP A;  1YAX A;  2UV0 E;  4WEK A;  4HY8 A;  3MQ0 A;  4WZ5 A;  5TBM B;  3PXP A;  3IX8 A;  4HES A;  4EUZ A;  1ZG6 A;  4JF5 A;  2D02 A;  2PBD P;  4H6J B;  4L9G A;  1GA0 A;  5HAP A;  3M2J A;  1BUL A;  4GJ4 A;  3CJM A;  1KDW A;  3S7Q A;  5CEB A;  5F1F A;  3NI9 A;  2ZQD A;  4HNB A;  1Z09 A;  4GS9 A;  1PI4 A;  3UN7 A;  2G2W A;  2OAP 1;  4DKI A;  3CAX A;  4R70 A;  2P08 A;  1W79 A;  2V1B A;  5KSC A;  1N9L A;  3BEB A;  2GZA A;  4KZ9 A;  5AQA A;  3V3S A;  5M18 A;  4A5R A;  3MQQ A;  1AXB A;  4Y3I A;  3R7W A;  2XLN A;  4ARZ A;  2Y2N A;  1PNE A;  3SS5 A;  2W1T A;  3S7O A;  5CEC A;  2HDR A;  3T1S A;  1T18 A;  3BFC A;  3SZT A;  2OWJ A;  1LI0 A;  4S2L A;  3TG9 A;  2XRO A;  4IBR A;  3NUL A;  4OLD A;  3A0V A;  2O9B A;  3LIB A;  3UPN A;  3PBO A;  4GN2 A;  4OQI A;  1BSG A;  1ES3 A;  4YFM A;  4BWI A;  2A24 B;  5CHM A;  3CWF A;  2D01 A;  1WE4 A;  1P9R A;  3E98 A;  3OBF A;  3F1N A;  1GSX A;  5L09 A;  4GHI A;  3RFB A;  2Z2M B;  5EVL A;  4EXO A;  1FIK A;  4FOF A;  4FD8 A;  4JGR A;  4D2O A;  1E3U D;  4E3N A;  3LEQ A;  1P9W A;  5EVI A;  4N9K A;  1ZG4 A;  3QP4 A;  1KDS A;  3VP1 A;  4Y7P A;  3ISG A;  4GOG A;  3N8S A;  1VET A;  3A0S A;  3K2N A;  3LID A;  4N1H A;  5M19 A;  1XGI A;  1BYW A;  5TGF A;  2VV8 A;  4LV2 A;  4LLO B;  3T4S A;  2IA2 A;  4S2I A;  4X68 A;  1K25 A;  1XXM A;  3VSK A;  5HW3 A;  3BRM A;  2ZQ8 A;  5FQQ A;  1ES4 A;  1D06 A;  2QMI A;  4WUJ A;  4QY5 A;  4NKP A;  4GB7 A;  3D4F A;  3KYZ A;  3QP8 A;  3BFD A;  3ZG9 B;  1WYB A;  2G2U A;  2PD7 A;  4OKP A;  3S7P A;  3T4Q A;  3P09 A;  3GTC A;  3O5Y A;  3JVV A;  3LR5 A;  1MWR A;  2I9V A;  2QWS A;  5F69 A;  4PAU A;  1S67 L;  3SOI A;  2P9V B;  3PBS A;  1ERO A;  1IYQ A;  2B5R A;  2W3E A;  3QP2 A;  4CLC E;  1OPX A;  2I72 A;  4S2P A;  1OTA A;  3ITA A;  5J3W A;  1W63 Q;  2HDU A;  4HH3 A;  3IX3 A;  1MXO A;  2JE5 A;  4KZ4 A;  2V8C A;  3UNW A;  4O0P A;  2FFF B;  5A91 A;  2ZLY A;  2VX8 A;  3C4O A;  1K55 C;  5CTN A;  1J3W A;  3E0Y A;  3LO7 A;  4LCL A;  1CK3 A;  2INW A;  3HL9 A;  3HLE A;  5AVF A;  1SDE A;  4WF0 A;  3LY3 A;  1QME A;  3ZG5 A;  4IJG A;  3OPH A;  5CGS A;  4Y0O A;  3FWL A;  1XJ2 A;  4PM6 A;  5I5L A;  1EWZ A;  2XK1 A;  4E3L A;  2CMN A;  2DCF A;  1SKO A;  2VA0 A;  4KQO A;  4DF6 A;  1KVM A;  1VM1 A;  3BFE A;  4B9O A;  1K4F A;  3RXW A;  4L9E A;  1IKI A;  4G3W A;  3WS1 A;  1W7F A;  2X02 A;  1S1Z A;  5DKK A;  1VEU A;  2IWC A;  1OJ5 A;  5E2E A;  2P7J A;  4BQM A;  4OPY A;  4EBN A;  4QWO A;  3G30 A;  3IBR A;  5CER A;  4GDN A;  2KDK A;  5DJU A;  3FKW A;  4WLA A;  3CPT A;  4QHC A;  4R0Q A;  3UB7 A;  2ACG A;  2OLV A;  1NZO A;  1ZTU A;  3KSH A;  3CZD A;  5FI2 A;  3TOI A;  4LFU A;  2FZ0 A;  3MQO A;  3MR0 A;  1T1B A;  4IBX A;  5HX9 A;  4IHQ A;  4JGQ A;  4D60 A;  1ONG A;  3ZVW A;  1K55 A;  4L0L A;  3EEA A;  1ERM A;  1XA1 A;  3UO9 A;  5KSH A;  3A3F A;  2FH5 A;  3NDG A;  2WKI A;  3NHQ A;  4ZJ1 A;  1JWP A;  3LEZ A;  1KVL A;  5TJJ A;  2PYP A;  3IXD A;  3AGE A;  3D3O A;  4OOY A;  3W4Q A;  1MPL A;  3ZNY A;  1H0M A;  1E25 A;  3CG5 A;  4YNR A;  1CJF A;  3T4J A;  2VZW A;  3T4K A;  4KZ5 A;  1YLP A;  1FCM A;  1ZC2 A;  3NIA A;  1KGG A;  4LRX C;  4GZB A;  2NUT C;  1J9M A;  2Y2L A;  5L8M A;  3IBJ A;  2WGW B;  4MBF A;  1ZKJ A;  4LV3 A;  4WZ4 A;  4Q0J A;  4ZDX A;  4UEY A;  1YMX A;  1K54 C;  3LYX A;  1IOU A;  4Y0T A;  5DTT A;  3ZVT A;  4NG2 A;  1F9I A;  1BLS A;  1YLY A;  4BBV A;  2GJ3 A;  1FR1 A;  1K56 A;  1SZV A;  4QPR A;  3IX4 A;  1PWD A;  2PU4 A;  1F98 A;  5G4Z A;  3KSG A;  2JBF A;  1NLY A;  3UMD A;  4MN5 A;  4DMZ A;  3MSH A;  5F5Y A;  4OP8 A;  4R3J A;  3LUQ A;  5FAT A;  3PR6 A;  2JCH A;  1YKD A;  2L4R A;  5F82 A;  5FQI A;  4XT2 B;  3B33 A;  5F1G A;  3ULF A;  4FH2 A;  5EE8 A;  5J7E A;  3TSG A;  5GL9 A;  2B95 A;  1MWU A;  3HLC A;  4UA9 A;  2Y2K A;  4JXW A;  2EWV A;  5DF9 A;  3HBR A;  4HBT A;  2O0Y A;  3NEC A;  2ZMA A;  3PHY A;  4KUO A;  4OQG A;  1N4O A;  4HI4 A;  4M3K A;  3ICY A;  1DY6 A;  2RL3 A;  3QNC A;  5HL6 A;  2WK0 A;  2QHK A;  3FC7 A;  3Q07 A;  4S2J A;  2Y2G A;  1SKF A;  4EW7 A;  2B02 A;  2VLG A;  2WKH A;  1WYC A;  1S4R A;  2W1T B;  3HUM A;  1OTB A;  3HLW A;  4K91 A;  4KZ8 A;  2QPN A;  1FSY A;  5F6A A;  3ZG7 B;  2C5W B;  2EWW A;  1OME A;  3KSF A;  2VV6 A;  1TS6 A;  2K7S A;  2W3D A;  4KG6 A;  4EES A;  4OVD A;  4E6X A;  2X01 A;  2XA7 M;  4GLQ A;  2Y59 A;  1OJG A;  2EXA A;  3W2Z A;  1TS7 A;  1PZP A;  2VGK A;  4P6Z S;  3UPO A;  3HRE A;  4EU0 A;  1BUE A;  2VV7 A;  3Q1F A;  1V9Z A;  2VEA A;  2PU2 A;  3LIA A;  3FG8 A;  5EVI B;  4QB8 A;  3D72 A;  3VP2 A;  2XFS A;  1HD8 A;  1ONH A;  3W8K A;  2BTF P;  3A3E A;  4BBU A;  3OPL A;  3OCL A;  4OPZ A;  1K38 A;  1O7E A;  1Y54 A;  2QJ7 A;  3K3D A;  1F5M A;  3E4Q A;  3G34 A;  2WYX A;  2JKR I;  4HP9 A;  3ZDJ A;  4C3Q A;  2ZL1 B; 
#chains in the Genus database with same CATH homology
 3EQU A;  3PBT A;  3MF0 A;  3U2A A;  4O8G A;  2QJ5 A;  2W1R A;  3JVU A;  4I3J A;  1D06 A;  2V9A A;  1XJ6 A;  4WUJ A;  4NKP A;  3LR0 A;  3KYZ A;  2XSS A;  4Y5F A;  4K08 A;  2GNX A;  2PD7 A;  3S7N A;  2L1M A;  3HCY A;  5HWV A;  1X0O A;  4GS9 B;  3S7P A;  3T4Q A;  1NRJ A;  1T19 A;  2JN7 A;  3KYQ A;  4NXG A;  3O5Y A;  3T4T A;  3TW8 A;  2R78 A;  4IUK A;  3E4O A;  3JVV A;  3LR5 A;  3UB6 A;  3VE4 A;  3CUE C;  3E4P A;  4DJ2 A;  4CLC C;  3HJI A;  2WKP A;  2I9V A;  1TS0 A;  2QWS A;  5F69 A;  2XRN A;  4PAU A;  1S67 L;  3EGX C;  3PBS A;  1VB6 A;  2KLI A;  1IFQ A;  3LR4 A;  3OLO A;  2W3E A;  1DP9 A;  4R6L A;  5K5B A;  4CLC E;  3CI6 A;  4PKY G;  4L9F A;  1OPX A;  3R7W B;  4EER A;  3T4L A;  3BQA A;  4ARZ B;  1OTD A;  1YSP A;  5HD5 A;  1OTA A;  1TS8 A;  2HF6 A;  3H82 A;  5J3W A;  1W63 Q;  2K31 A;  4HP4 A;  3FPV A;  3MMH A;  4F3L A;  2QKP A;  3BWL A;  2PR5 A;  5F68 A;  4MCW A;  4HH3 A;  3DBA A;  3HJK A;  3UME A;  2ZMF A;  2B18 A;  5J4E A;  5EFW A;  2O9A A;  2QYB A;  2W3G A;  3LR3 A;  4O0P A;  5HWT A;  2GX5 A;  2VX8 A;  2PHY A;  2NUP C;  5IT5 A;  1LSW A;  3SW1 A;  2HJ9 C;  4NXB A;  1ODV A;  4P6Z M;  3TJZ C;  1D7E A;  3F1N B;  4RQ9 A;  5KIZ A;  3UE3 A;  4GHI B;  3F1P B;  3LIE A;  4BJP A;  3E0Y A;  3NOP C;  4MDZ A;  2INW A;  2A2L A;  3H7W A;  5MC7 A;  1TF1 A;  3VOL A;  5AVF A;  2KX6 A;  4WF0 A;  1DRM A;  1H8M A;  4IJG A;  4Y2F A;  4E04 A;  1G28 A;  4B93 A;  5HWW A;  1XJ2 A;  5G4Y A;  4II7 A;  3G6O A;  5I5L A;  3F1O A;  1VHM A;  4NEE D;  1EW0 A;  2O9C A;  3LI9 A;  2CMN A;  2BAS A;  2OOL A;  4ZRR A;  2J3T C;  2VA0 A;  3B47 A;  5HDS A;  4KQO A;  4HHD A;  4CQH A;  1S1Y A;  4B9O A;  4L9E A;  5DFY A;  2H28 A;  4G3W A;  1S66 L;  4M4X A;  2HJE A;  5LBR A;  2W27 A;  1S1Z A;  5DKK A;  5CX7 A;  5IU1 A;  3EGD C;  3EWK A;  1OJ5 A;  4UQI M;  2HV1 A;  2P7J A;  4BBT A;  2Y79 A;  4HIA A;  4ME4 A;  2ZOI A;  3GDI A;  5HDC A;  3IBR A;  3IS2 A;  2ZOH A;  1MKM A;  2KDK A;  3NOT C;  1WA9 A;  5DJU A;  2PT7 A;  4YOF A;  4WLA A;  1GSW A;  3TE8 A;  4XT2 A;  3LFV A;  3UB7 A;  2V0U A;  3KO6 A;  3NJA A;  4GCZ A;  2P04 A;  1ZTU A;  4BMW A;  3KSH A;  1XFQ A;  4OOM A;  1NLZ A;  5HZH A;  2OAQ 1;  1JNU A;  4H6J A;  2FZ0 A;  4Q0H A;  3MQO A;  4I3I A;  3MR0 A;  3PBN A;  1T1B A;  4IHQ A;  4JGQ A;  3KX0 X;  3UE6 A;  2V1A A;  4OOL A;  4CLC D;  4L0L A;  3VE3 A;  1XJ3 A;  3EEA A;  4KUK A;  4MN6 A;  3RH8 B;  4I39 A;  5KSH A;  3C8C A;  3EEH A;  3H82 B;  2KOI A;  2FH5 A;  1OT6 A;  4NXF A;  2JKR M;  3NHQ A;  3BQ8 A;  3EQV A;  3MFX A;  4F3L B;  3H9W A;  5TJJ A;  2PYP A;  2JKT I;  2PDR A;  3D3O A;  1ZHH B;  4G3V A;  1T1A A;  2ZBB A;  2YKH A;  5HDD A;  2M7U A;  4YNR A;  3T4J A;  2VZW A;  3T4K A;  2J3W A;  4GW9 A;  4O01 A;  5IS1 A;  4EEU A;  3C30 A;  1XJ4 A;  2W3F A;  1UWN X;  4HOI A;  4LRX C;  2NUT C;  1KOU A;  1MZU A;  1YSQ A;  3H7W B;  5L8M A;  2W0N A;  3IBJ A;  2G7U A;  1W63 M;  4AFI A;  3NOU C;  2J80 A;  4Q0J A;  3UB8 A;  4UEY A;  1T1C A;  4I38 A;  3P7N A;  2A24 A;  3LYX A;  2XA7 S;  1OTI A;  2VGL M;  1IOU A;  1STZ A;  4HJ6 A;  4ETX A;  3F1O B;  3PBR A;  4ETZ A;  1LT0 A;  3T50 A;  3CIT A;  3EOI A;  1F9I A;  2LB5 A;  2O99 A;  4BBV A;  3GEC A;  4R38 A;  2GJ3 A;  2YKF A;  4WL9 A;  4EET B;  1NWZ A;  2J3T D;  2VJW A;  2ZMV A;  2K2N A;  5FL3 A;  4QPR A;  4CLC B;  3CUE A;  4CLC A;  1LSV A;  4HH2 A;  5HPI A;  1F98 A;  4HJ4 A;  3KSG A;  5G4Z A;  3TRC A;  1DP8 A;  1G6O A;  1NLY A;  2JHE A;  4MN5 A;  3UMD A;  4DMZ A;  1Y28 A;  3MJQ A;  5F5Y A;  4LRY C;  3IS2 B;  1OT9 A;  4IUH A;  4Q0I A;  3LUQ A;  2M1C A;  1YAX A;  4KQD A;  3PR6 A;  4I5S A;  3LIF A;  3R4K A;  2EA9 A;  1YKD A;  4WEK A;  2L4R A;  4EEP A;  3RTY A;  4XT2 B;  1DP6 A;  3B42 A;  4MMN A;  3B33 A;  3MQ0 A;  4HY8 A;  3PYP A;  3VV4 A;  4WEL A;  3BJN A;  3CLO A;  5TBM B;  4Z1W A;  3ULF A;  3PXP A;  1S4S A;  5TBM A;  4UQI S;  5J7E A;  3P01 A;  5DJT A;  1OTE A;  5HD3 A;  3LIC A;  4G3K A;  1P0Z A;  2D02 A;  2PD8 A;  4H6J B;  4L9G A;  2W3H A;  3BY8 A;  3C38 A;  2EWV A;  2DMW A;  2WKR A;  5DF9 A;  4FSF A;  4PHT A;  4GJ4 A;  3ZYT A;  3S7Q A;  2O0Y A;  3PHY A;  4DJ3 A;  4KUO A;  4LRZ E;  5A8B A;  4HNB A;  4HI4 A;  1LSX A;  3ICY A;  4GS9 A;  5HPF A;  3MXQ A;  5HL6 A;  2OAP 1;  2QHK A;  3FC7 A;  4NXE A;  2OWH A;  5C5K A;  3CAX A;  4DN0 A;  4R70 A;  1N9N A;  2P08 A;  2V1B A;  1N9L A;  1LL8 A;  2GZA A;  3V67 A;  2PR6 A;  4EW7 A;  2B02 A;  3FPW A;  2VLG A;  1GSV A;  3MQQ A;  1S4R A;  4Y3I A;  5AVE A;  3R7W A;  2W1T B;  1XFN A;  4MN7 A;  4ARZ A;  1OTB A;  1UGU A;  2W1T A;  3S7O A;  5F6A A;  3PBQ A;  2EWW A;  3A0R A;  1T18 A;  4EUV A;  2OWJ A;  4PKY A;  3KSF A;  2VV6 A;  1TS6 A;  1P97 A;  2HGV A;  2XRO A;  4HJ3 A;  4JGP A;  2K7S A;  2W3D A;  4EES A;  4LPZ A;  3A0V A;  2O9B A;  3LIB A;  3PBO A;  4HQA A;  4WN5 A;  3KSI A;  2WKQ A;  4R3A A;  2Y8H A;  2XA7 M;  4BWI A;  2A24 B;  4GLQ A;  3CWF A;  2D01 A;  1V9Y A;  1OJG A;  1P9R A;  2LB9 A;  4YWZ A;  3W2Z A;  3E98 A;  1TS7 A;  3OBF A;  4P6Z S;  5AJG A;  1UWP X;  3F1N A;  1GSX A;  3ZQ5 A;  2L0W A;  2V0W A;  4GHI A;  3F1P A;  3OC2 A;  2Z6D A;  4EU0 A;  1TD5 A;  2Z6C A;  3RFB A;  3T4O A;  2M7V A;  5DKL A;  5HSQ A;  4EXO A;  2VV7 A;  3OOV A;  1V9Z A;  1H3Q A;  2VEA A;  4FOF A;  4JGR A;  4JGO A;  5DFX A;  3UB9 A;  3LIA A;  2VGL S;  3FG8 A;  1P9W A;  2JKT M;  3D72 A;  3C2W A;  2VKS A;  1MC0 A;  4BBU A;  3OCL A;  3OCN A;  3K3C A;  2MJ6 A;  3A0S A;  2QJ7 A;  3K2N A;  3K3D A;  3LID A;  1F5M A;  3E4Q A;  1BYW A;  4WEJ A;  4EQ1 A;  2JKR I;  4I3A A;  2VV8 A;  4LLO B;  3T4S A;  4HP9 A;  3BW6 A;  2IA2 A;  3BY9 A;  3LI8 A;  2PYR A;  1N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...