1TS7A

Structure of the pr cis wobble and pr e46q intermediates from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts7A00
5J7EA 2W27A 2QHKA 2OWHA 4MN6A 2K7SA 2PDRA 3BWLA 2L1MA 5IU1A 2QJ5A 4HJ3A 3MQOA 1F98A 2D02A 3BY8A 3ZQ5A 4E04A 5HSQA 1S1ZA 1T18A 1TS8A 2PYRA 2V0UA 4HQAA 4I38A 1LL8A 4EEPA 1GSVA 2L4RA 2QKPA 2VLGA 4GS9A 1N9OA 5F68A 4WUJA 1GSXA 3NOUC 4HJ6A 5HDDA 4NXGA 1DP9A 1LSVA 3LIAA 1V9ZA 2WKPA 5HD5A 5J3WA 2M1CA 3IS2A 2ZOHA 4WN5A 3F1PA 1LSWA 5F69A 3CWFA 2JHEA 4HP4A 1S4SA 2GJ3A 4EERA 4EXOA 2B02A 1TS6A 4GHIB 4HH3A 1KOUA 3LIDA 2OWJA 3B33A 4XT2B 4R3AA 4GW9A 4HP9A 3MFXA 5HZHA 3G6OA 1VB6A 2QWSA 1GSWA 1S66L 3H82B 4I3IA 2A24B 4LRXC 3BY9A 1NWZA 1UGUA 4H6JA 4PKYA 5AVEA 4R6LA 2V9AA 5HWTA 3GDIA 2I9VA 2YKFA 5DJTA 3MJQA 1UWPX 2A24A 1TS7A 2PHYA 2Z6DA 3LIFA 3MXQA 3NOPC 4GS9B 4EQ1A 5HWWA 5DKLA 1WA9A 1OTAA 2J80A 3PHYA 4HH2A 4HNBA 4I3JA 4KUKA 5F6AA 4M4XA 4F3LA 2BASA 2R78A 4I39A 3UE6A 1P0ZA 3NHQA 2V0WA 1OT6A 2ZBBA 3F1PB 4HHDA 4I3AA 3NOTC 4DJ2A 3LI8A 4LPZA 1T1CA 3K3CA 3LIEA 3LUQA 4GHIA 4PKYG 1T1BA 4B9OA 1DP6A 2L0WA 4XT2A 2WKQA 4KUOA 1LT0A 1XJ2A 3ICYA 1F9IA 5I5LA 4EESA 4EW7A 5IS1A 4NXEA 3FC7A 3NJAA 2HV1A 4HIAA 2ZOIA 3A0RA 3RH8B 3VOLA 4BBUA 4HY8A 3E4QA 5HWVA 2KDKA 1XJ3A 2W0NA 3KX0X 3MR0A 4WF0A 1V9YA 5AVFA 3H9WA 4HJ4A 3H7WB 3IBRA 5HDCA 1BYWA 1MZUA 1DP8A 1S67L 3LIBA 4EETB 2KX6A 2Z6CA 1XFQA 1TS0A 4L9FA 3RTYA 3UMDA 5HD3A 4KQDA 2V1BA 2P7JA 1XFNA 5G4YA 3LICA 4L9EA 2OOLA 2VEAA 3GECA 2PYPA 2INWA 5J4EA 5HDSA 2V1AA 3UB8A 3MQQA 3PYPA 4H6JB 1OTBA 1OTIA 5TBMA 1LSXA 2QJ7A 2VV8A 3K3DA 1P97A 1ODVA 4JGQA 5DJUA 3A0VA 4LRZE 3HJIA 3EEHA 3OLOA 1DRMA 3LYXA 4JGPA 4RQ9A 3T50A 3VE3A 2D01A 3H7WA 5F5YA 3UB9A 3FG8A 3ULFA 1G28A 1EW0A 3LI9A 5EFWA 3CLOA 3UB6A 2EA9A 2WKRA 4NXBA 4JGOA 3CAXA 3E4OA 2PD8A 1OJ5A 2PD7A 2VV7A 2H28A 4R70A 1JNUA 2VV6A 5DKKA 1OTEA 1T1AA 3C2WA 3VE4A 5A8BA 1OT9A 5KIZA 4F3LB 3IS2B 4R38A 1UWNX 3H82A 3F1OB 3E4PA 1D06A 1N9LA 4LLOB 4JGRA 1S1YA 4BBTA 4EEUA 3SW1A 4DJ3A 3F1OA 3P7NA 1OTDA 2CMNA 3HJKA 1XJ6A 4HOIA 3D72A 1X0OA 1T19A 4BBVA 1S4RA 1Y28A 4I5SA 3F1NA 4GCZA 4L9GA 1N9NA 5G4ZA 2PR6A 1OJGA 4WL9A 4LRYC 2JN7A 2PR5A 3F1NB 4NXFA 3EWKA 4K08A 4YWZA 4HI4A 4WLAA 1XJ4A 3UB7A 3UMEA 2YKHA 4MN5A 1D7EA 5TBMB 3A0SA 3C8CA
chains in the Genus database with same CATH superfamily
2H10A 2Y2HA 1HLUP 3AGEA 3JYIA 2ZLYA 5IU1A 2IWDA 3ITBA 1IKGA 1NYMA 2WAFA 4IHQA 3VOZA 3HLWA 4NXGA 1V9ZA 3B47A 5FI7A 2EWVA 2ZOHA 3FKWA 3PBSA 4ZJ2A 2C6WB 2WKEA 4R4SA 3B3XA 2XFSA 3LR3A 4GDBA 2E8JA 2ZQDA 4PKYA 3Q7VB 4ID4A 3OCLA 3MXQA 3QNBA 4HH2A 4I3JA 4Z1WA 2BASA 5E2HA 1WYBA 4DXBA 1YMXA 4Q0JA 2AVXA 3ICYA 4JF4A 5CEBA 2HV1A 2PT7A 3ZG9B 3IHAA 3N8RA 3CMZA 4EETB 4UQIM 3C38A 1TVFA 1YLTA 4Y15A 5HPIA 3DBAA 3GECA 3K3DA 3LYXA 4WZ5C 4X56A 1DY6A 2JKRI 3CUEA 3E4OA 1XA1A 3BFGA 3MKFA 3VP4A 4LENA 2O9CA 2XEPA 5EPHA 2B18A 1E4DA 4R38A 4JXGA 3ZNTA 2JKGA 3OBFA 1BLCA 3HJKA 2O9AA 3D3OA 3HL9A 3QHYA 3BFFA 4KZ9A 1IYSA 4WL9A 3SS5A 4WLAA 2PR5A 3ZFZA 1VEUA 4E3JA 3N8LA 4ZJ1A 4EUZA 1YLWA 2QHKA 3SH8A 4P6ZM 2VJWA 2PDRA 5GHZA 4HJ3A 4B4XA 2O99A 1PI4A 5LBRA 5FDSA 2L4RA 2QKPA 4GJ4A 4WELA 5F68A 3I7JA 4U0XA 3IS2A 2HJ9C 1YPRA 4X53A 1S4SA 3S4XA 1S66L 1ALQA 5FATA 3GR2A 3S7QA 4R6LA 5F1GA 3GDIA 1VETA 3T4OA 5EE8A 4XUZA 2M7VA 3LO7A 2ACGA 1JWVA 3FYZA 3PAGA 4QWOA 4E6WA 2P9VB 1L2SA 1ZHHB 4NEED 3TSGA 1CQAA 1TS0A 4O01A 1EI5A 1YT4A 1CEGA 3PBQA 4XXRA 1IYQA 1NZOA 5DJUA 2P9VA 3IF6A 2VGJA 5F5YA 3A3FA 4OQIA 1OJ5A 5EVIB 4FSFA 4S2IA 5L8MA 2ZL1B 3UE1A 1S0WA 3UE0A 3IX3A 4U0TA 2PR6A 3WS4A 3F1NB 3NCKA 4IUHA 4Y3IA 3A0SA 4R1GA 3C8CA 5EUAA 4MN6A 4OPRA 3P98A 3OZHA 2L1MA 3SZTA 5HSQA 2PU2A 2ZQ7A 5M19A 5E2FA 3CPTB 4CLCA 3EQUA 1YMSA 5F69A 3IWOA 1KOUA 3B33A 3AGFA 3C30A 1K57C 3MXRA 4I3IA 4D2OA 4MEZA 4H6JA 4DKIA 2I9VA 2YKFA 3LR0A 5FDHA 1KGGA 3BQAA 4GN2A 3BFDA 1RGZA 5F6AA 2R78A 1BUEA 1YAXA 4G3VA 3V5MA 3WS1A 2L0WA 5I5LA 5C5KA 5IS1A 3LCEA 2XRNA 2XA7S 3LY4A 4BBUA 4Q0HA 3IXHA 2VGKA 3E2KA 3HUMA 2K2NA 3LIBA 3UB5P 4YINA 2V1BA 3GV9A 5KSCA 1ES3A 4ETZA 4S2PA 3UN7A 4BD1A 4DF6A 2ZMFA 3Q7VA 1KGFA 3BECA 4RA7A 1GHIA 1I5QA 5CGWA 3S1YA 5CGXA 4E6XA 5DKKA 4KQRA 1LL5A 1IELA 4EEUA 2X71A 4OPYA 2Q9NA 4DN0A 2Y2OA 4HOIA 5FI6A 1I2SA 4DE3A 4L9GA 3HUNA 5HFOA 1BLSA 3P01A 2NUPC 4MN5A 2XA7M 3RXXA 3KSGA 3UDIA 3DTIA 2V0UA 1LL8A 2JCHA 1VETB 1DJAA 2WK0A 1DP9A 1K0KA 4KZ5A 1D1JA 2PU4A 3EGXC 1DJCA 5EVID 5FAOA 1GSWA 3LR4A 5J7EA 3WS5A 2PHYA 5A91A 1YM1A 2V0WA 2ZBBA 3NOTC 1MXOA 3KSFA 5EOOA 3VP3A 4LPZA 4WMCD 2XR0A 4ARZA 2WKQA 1HD8A 4OONA 2ZOIA 2XD1A 4HY8A 2Y8HA 5IHVA 5CTMA 3R7WA 1MY8A 1JTDA 1ZKJA 4X68A 1S67L 2W3DA 4KQDA 1TF1A 3JPUA 4Y0TA 1VEUB 2HPBA 3VE3A 4MBFA 4C6YA 1KDWA 1GHMA 3T1XA 1SKOB 5I94A 3Q7ZA 4N1XA 3VP0A 1MWRA 4ZJ3A 3EEAA 4IEDA 5EV0A 2B5RA 4LLOB 4KG6A 4BBTA 3F1OA 5FQQA 4DE2A 2WGIA 3NC8A 2Y2JA 5L2FA 1PIOA 4F94A 3T4SA 3T4QA 3BLMA 1K56A 3C4PA 4S2NA 3LEQA 5L09A 2D02A 2Y2KA 4P6ZS 1AXBA 3IF6C 4MBHA 1S1ZA 1FR1A 1GSVA 2EFUA 1ERQA 5AQAA 3F1PA 1LSWA 1ACFA 3E0YA 5GLBA 2I72A 3M6HA 1IKIA 5CHUA 2HJEA 4N9LA 3W4OA 5F83A 5AVEA 5DF9A 3P09A 4P87A 3LIFA 3EGDC 1P0ZA 1F5MA 2B95A 4GHIA 4PHTA 5EVLA 3HVFA 2ZC7A 1YLZA 5JYPA 2W0NA 1TDLA 3LGOA 1V9YA 3CITA 2KOIA 4CLCE 4ZRRA 2Z6CA 2FH5A 2V2FF 5HD3A 3QP6A 2PBDP 3G30A 1DJBA 4RVAA 2OLVA 4H6JB 4JXVA 5KMWA 3KO6A 4MN7A 3V39A 5CXWA 3G4PA 4NXBA 3MSHA 4GDNA 1IEMA 2WKIA 3FKVA 5D3OA 5FQKA 1P9WA 3UE3A 1T1AA 5KIZA 1OT9A 2M7UA 2XLNA 4WEKA 1GHPA 1OTDA 2CMNA 4LCLA 4PM7A 1KE3A 5EVEA 3BJNA 1SZVA 1IYPA 4K0WA 5DTSA 1P9RA 2E8IA 1D7EA 4KQQA 1FCMA 3BLSA 3SOIA 2MJ6A 4R4RA 4WM9A 3ZQ5A 5GHYA 1JWZA 2W3EA 4EEPA 3TOIA 3NDGA 2ZC5B 4BL3A 1GCEA 2JHEA 5MC7A 2GDNA 4HEFA 1TS6A 1LI9A 3DWZA 3KYEA 1VB6A 4DDYA 3T4KA 3B42A 3UDFA 3MZFA 4OLDA 1NLYA 3IWIA 4OKPA 5DKLA 1OTAA 4I39A 2Y2LA 4XT2A 3BM6A 2ZJ9A 3TG9A 5HWVA 5AJGA 3W8KA 1NJ4A 3IF5A 2O9BA 4KG2A 5HDCA 4II7A 4ZBEA 2X01A 1H3QA 5A93A 4KZ6A 4L9EA 5CHJA 5HX9A 3PYPA 4P0MA 1PWGA 1NZUA 3ZG5A 2W3HA 3CJMA 2Y2GA 2HZ5A 1FCOA 3O5YA 4JXSA 4IVIA 3M2JA 1KVLA 5FQMA 2W1TA 5L07A 2Y4AA 5AQBA 3C2WA 2R9XA 3DTKA 1NY0A 3F1OB 3PR6A 4OP5A 4QU3A 4KZ4A 3A3IA 3OC2A 2ZM0A 4RX2A 1XXMA 1X0OA 1Y28A 3IXGA 4EUVA 1MWSA 2IWCA 3EWKA 4E3IA 2J9OA 1IFQA 3ZG0A 2JKTI 5CHMA 1VHMA 2QJ5A 1F98A 1WE4A 3HBRA 1F2KA 1HVBA 4I38A 5E43A 4EQIA 5CERA 4BWIA 1Q2PA 4OOLA 2QZ6A 4MNRA 2WKPA 2WGWB 3PBNA 4G3KA 4GHIB 3FWLA 4HP9A 4JBFA 5HZHA 3JVVA 1TEMA 5HL6A 2G2UA 4GS9B 3DAVA 4NK3A 1ONHA 1H5XA 4QY5A 1T1CA 5IT5A 1U60A 4L0LA 4LV3A 1XJ3A 3MR0A 3OCNA 3M6BA 3VP1A 1SDEA 4OP8A 1HZOA 1L0EA 3LICA 4S2OA 5FEFA 2VEAA 2P74A 3MQQA 2V8CA 1LSXA 3AGDA 3EEHA 4CJNA 1RP5A 1G6OA 1KE0A 3CLOA 4FH2A 4ZTKA 2PD7A 4HESA 2VV7A 2H28A 1JNUA 4FH4A 3EOIA 4E3KA 3JVUA 5TR7A 3U2AA 3PBRA 3HLBA 1QMEA 1S6RA 3A3EA 3S7NA 2ZQ9A 3QP1A 3A3DA 2HDSA 4EBPA 1CEFA 4X6TA 1G6AA 4WZ4A 3CZDA 3DTEA 3SS4A 2J9PA 1TS8A 2ZM8A 2A2LA 2VLGA 1YQSA 4HJ6A 5HDDA 2A3UA 3UPPA 3OOVA 3UO9A 1K55C 2ZL1A 2EFXA 1ES5A 2V9AA 3CI6A 3LEZA 1UWPX 2A24A 2HP6A 5HWWA 3VSLA 2ZQCA 2PAVP 4HNBA 4U3TA 3RXWA 4HHDA 4PKYG 4EW7A 5A92A 1STZA 3RH8B 3E4QA 3H7WB 3R7WB 5FA7A 5EVIC 5J8XA 4L9FA 3UMDA 2V8FA 4BLMA 1PZOA 1YSPA 4UA9A 3V3SA 1I2WA 3LR5A 3V3RA 4XUXA 1OTBA 2W3FA 3A0VA 4JGPA 4P6BA 2Z2LB 1EWZA 2DMWA 3LI9A 4UAAA 4DXCA 2EA9A 3CAXA 4GB7A 4OPZA 1XPBA 4R70A 2ZM2A 2BTFP 1MWUA 3VSKA 1NYYA 4DRTA 5GLDA 4R3BA 3P7NA 5F82A 1PRQA 2HDRA 1FQGA 4OVDA 3IH8A 3MQ0A 5A90A 2JBFA 4LRYC 4KZAA 1L0GA 3PBTA 2YKHA 2XGNA 4PPRA 2Y2MA 2EXAA 2IA2A 5FQ9A 2QMIA 1MBLA 1N9OA 1K6RA 3O86A 3TE8A 3LIAA 2J3TD 3O3VA 5KZHA 5J3WA 3HLCA 4EXOA 5DTTA 4R3AA 4QD4A 3MFXA 2QWSA 3D9YA 1BZAA 4IBXA 2BG1A 4H8RA 5FI2A 5HWTA 2WGVA 2EWWA 1WA9A 3PHYA 2Y2IA 2Y91A 4R23A 2WYXA 3K3CA 3LUQA 2XF3A 1F9IA 1ESIA 4Y17A 5DFXA 4Y0OA 4QPRA 2VX8A 5AVFA 1NRJA 2WZZA 3MF0A 1DP8A 2QYBA 2KX6A 4BL2A 1H8MA 3DTMA 2G2WA 1KDSA 5J4EA 2DCFA 4FUWA 4QJGA 1P97A 5DVAA 4YNRA 2HP9A 3A3JA 3ULFA 4S2KA 5FASA 4RYEA 2PD8A 3E2LA 1PNEA 3PXPA 3VFHA 3PBOA 4UA6A 4EBLA 1PZPA 1MKIA 1W8YA 1E3UD 3ZHHA 3VOYA 4QY6A 4M3KA 3IX8A 3D72A 3UY6A 2JKRM 1K56D 4DMZA 3G34A 4YWZA 1XJ4A 3C4OA 1CI8A 5TBMB 3IXDA 3ZGAB 4K0XA 4BMWA 4Q8IA 3MQOA 3IF6B 5GLCA 4Y2FA 5E2GA 4WUJA 1GSXA 3BRMA 3G31A 2ZC4B 3K2NA 4NG2A 3ZG7B 3QP2A 3T4TA 2NUTC 4GW9A 3T4LA 3H82B 2A24B 4LRXC 3L7HA 3MXSA 4EQ1A 2QPNA 4D60A 3F1PB 4B93A 2Y59A 4KUOA 2O0YA 2XD5A 2OSUA 4FTXA 4HBTA 4HIAA 4LV2A 5FAQA 5HAQA 3KX0X 3SH7A 4WF0A 1ESUA 4OOYA 5DF8A 3O88A 3N6IA 4LCMA 2C5WB 3SH9A 3N8SA 1L0FA 5HDSA 4N1HA 1IOUA 4JGQA 3W4PA 1K54C 1DRMA 1G68A 3Q07A 3W2ZA 3D4FA 2XROA 5TGFA 1W5DA 5GLAA 3IWQA 4O8GA 3IS2B 3E98A 1UWNX 4Z9QA 4JXWA 1N9LA 2XDMA 2EX9A 4IJGA 4I5SA 4GOGA 3VP2A 3HLGA 3UNWA 4C3QA 5FQJA 4LGWA 3L9KA 4E3OA 3OPLA 3HREA 2OWHA 3ZCZA 4Y7PA 1H0MA 2LB5A 1YLJA 5CRFA 4KZBA 3G2YA 2UV0E 2K31A 3FPVA 1XP4A 4HP4A 3BEBA 1PW1A 4HH3A 4P85A 4YFMA 1W63Q 3TRCA 4F3LB 2Z6DA 4GD6A 4CLCC 3CG5A 1OT6A 4I3AA 3LFVA 3HCYA 3LI8A 4DDSA 2H0TA 5HAPA 1XJ2A 1KVMA 4WBGA 3HLEA 2PBYA 4CQHA 4LV0A 1ZC2A 1CK3A 2G7UA 5F1FA 4GNUA 3GVBA 1XFQA 5HW3A 3IXBA 5FQIA 3KYQA 3UB8A 1N9BA 1ODVA 1Y54A 3NBLA 4EU0A 4WYYA 2VA0A 1ERMA 5K5BA 2JC7A 1JWPA 2XSSA 3OPHA 5AQ9A 2RCXA 2XFTA 1YLYA 3CPTA 3VE4A 2ZMAA 2JKTM 3PTEA 3TW8A 4BJPA 3IX4A 5HPFA 1GA0A 1S1YA 3ZVTA 1Y4OA 4N9KA 5EM0A 2Q9MA 1A0KA 1ONGA 5KSHA 2Y2PA 1O7EA 3KSIA 1LLBA 1J3WA 3ZNYA 2WAEA 4NXFA 1ZG4A 3UB7A 3UMEA 2WGWA 4S2JA 3VV4A 2H0YA 4QB8A 1YLPA 2V1ZA 4KG5A 3BWLA 3WS0A 3T1RA 3S7PA 2PYRA 2DRWA 3MZEA 3GRJA 5TJJA 2VZWA 2JE5A 5EVIA 2GJ3A 1L3LA 2XQZA 4KZ7A 1NWZA 3TJZC 1XKZA 5DJTA 1BULA 4EV4A 2ZQAA 4M4XA 4MDZA 1K6SA 3DWKA 3BFCA 2J3TC 3C7VA 4O7DA 3ZYTA 4RX3A 4B9OA 4KZ3A 5TFQA 2W1TB 3IBJA 4PM8A 3FC7A 2Y2QA 4PM9A 1BLHA 3BFEA 1L0DA 1LI0A 1W79A 2EX8A 3IBRA 1CJFA 3MZDA 4NETA 4PM6A 5CX7A 1LHYA 3IT9A 2HDQA 2OOLA 3O87A 1FIKA 1SHVA 5TBMA 2QJ7A 2VV8A 1KE4A 1NLZA 1OMEA 2HGVA 3QP8A 3OLOA 3N7WA 4ZAMA 5DFYA 2EX2A 4CPKA 1MKMA 1H8ZA 5EOEA 2LB9A 3E4PA 4JPMA 1D06A 3QP5A 4WZ5A 3GSGA 5DF7A 1OPXA 3HLDA 4UEYA 2W1RA 4ME4A 1S4RA 3IHBA 5FEGA 5G4ZA 1O07A 4HI4A 2JKFA 4IBRA 3NDEA 2W27A 3C5AA 1K55A 2Y79A 4MMNA 4B4ZA 4Q0IA 1K4FA 5DTKA 5CEDA 4A5RA 1Q2QA 3BY8A 3MBZA 1N4OA 1K57A 3FZCA 3T1SA 3NOUC 2GNXA 1SCWA 4DE1A 5JYOA 1K4EA 3CWFA 4GZBA 2W3GA 1BTLA 4X1LA 1H8YA 3ZDJA 2HF6A 3LY3A 3BY9A 3GQZA 5FSRA 4R0QA 1TS7A 3G35A 1IYOA 1VM1A 2FFYA 3G32A 4G3WA 3Q1FA 4HBUA 2PRFA 3UPNA 3VOLA 2XK1A 1PFLA 1PYYA 1MZUA 3IH9A 4O0PA 3RTYA 5AQ7A 1XGIA 1XFNA 1ES4A 2PYPA 1PWDA 4UHUA 3HJIA 4Y13A 1KGEA 2D01A 3H7WA 4AFIA 5G18A 3UB6A 2WKRA 5M18A 3OPRA 3WRZA 4ETXA 2VV6A 4JF6A 3U4LP 1FCNA 5A8BA 4X1MA 3H82A 3QP4A 4JGRA 1NXYA 3N4IA 1ZG6A 1N9NA 1OJGA 4OQGA 1MC0A 1W63M 2ZC6B 1VQQA 4C75A 2CC1A 2EXBA 1M6KA 4QHCA 1CF0A 1Z09A 3PAEA 3CUEC 4GKUA 2Y2NA 1T18A 3ZVWA 1HTZA 4BQMA 5HL1A 1Z6FA 3WS2A 5FAPA 2ZC3B 4IUKA 1ZTUA 1GA9A 1G5UA 3WRTA 4CLCD 5M1AA 3VFFA 2J7VA 5CGSA 2WKHA 4ESPA 2OAQ1 2R9WA 1DP6A 4S2NC 4EESA 1JVJA 3NULA 2OAP1 1YKDA 2KDKA 3NY4A 1FSWA 4HJ4A 1ES2A 3WWXA 5EM1A 4LV1A 4NKPA 2J3WA 3RJUA 1W7FA 2WADA 2OLUA 2VGLM 4S2LA 1PWCA 5L10A 1K25A 3RFBA 4X55A 3BQ8A 4LRZE 4N92A 4KZ8A 1FOFA 1EW0A 5EFWA 4BENA 4JGOA 4PM5A 2IWBA 1TD5A 4JLFA 3GTCA 4X25A 4WEJA 3SW1A 4DJ3A 2DNSA 1K54A 1XJ6A 1RCJA 2KLIA 3MKEA 3V67A 3SS3A 4WMCA 3MFDA 4BBVA 3F1NA 5EECA 2JN7A 2HDUA 4JF5A 4EBNA 4GD8A 3FPWA 2UWXA 4GS9A 2RL3A 4MCWA 3VMAA 4OOMA 1LSVA 3NIAA 5HD5A 2M1CA 4JKTA 2VGLS 4WN5A 2WUQA 4E3MA 4EERA 4ZDXA 1FSYA 4KQOA 3G6OA 1BT5A 3G2ZA 2Y55A 3MJQA 4IVKA 3R4KA 1SKFA 1E3UA 3OPPA 4E04A 4EWFA 4F3LA 4KUKA 1XX2A 3FV7A 3NHQA 2Q0OA 4DJ2A 4MLLA 2P04A 3LIEA 4OLGA 1T1BA 3NI9A 5FL3A 3Q82A 5GL9A 4NXEA 4ARZB 3KSHA 1BLPA 2BLSA 3NECA 3S22A 1SDNA 1MPLA 2HP5A 3H9WA 5E2EA 3BW6A 4DE0A 3UPOA 1QMFA 4OQHA 4E3LA 4K91A 4CLCB 2P7JA 5G4YA 2INWA 2VKSA 1OTIA 3CHWP 2V20A 3M2KA 4RQ9A 1G28A 3BYDA 1EROA 4MBKA 5HARA 1OTEA 4UA7A 1MWTA 4PMAA 1XGJA 3QNCA 3ITAA 4B88A 2ZMVA 1T19A 3S7OA 4GCZA 4BD0A 1TDGA 1BSGA 3C7UA 3ISGA 2OV5A 1W8QA 2X02A 1JTGA 2K7SA 3HUOA 2J8YA 5U47A 3MS6A 4FOFA 4HQAA 3KYZA 2GZAA 2GX5A 2B02A 3LIDA 4Y0UA 2OWJA 2Z2MB 4XT2B 4S2MA 3IQAA 2P08A 1UGUA 4FCFA 3MMHA 3NOPC 2J80A 1YSQA 3UE6A 5CTNA 4R3JA 4OQ0A 2WZXA 2ZD8A 2VK3A 1C3BA 1LT0A 5HAIA 2XH9A 3ZG8B 3UDXA 3NJAA 3A0RA 4LFUA 1NRFA 1BYWA 1RGYA 4PAUA 4E3NA 3W4QA 3EQVA 3Q81A 2H5SA 2V1AA 4X69A 4YOFA 3T50A 1XA7A 1PW8A 3UB9A 3FG8A 4FD8A 5GHXA 1CI9A 1PI5A 4Y5FA 1FR6A 1SKOA 3HLFA 4OH0A 5CECA 2ZQ8A 1M40A 5BOHA 2A49A 2FFFB 2FZ0A 4GLQA 3T1QB 1WYCA 1LL9A 3GMWA 1J9MA 1K38A 4OPQA 1AWIA 2EX6A 1E25A 4UQIS 3T4JA 1FILA 4K08A 3DW0A 3V50A 4KENB 3T12B
chains in the Genus database with same CATH topology
2W27A 2Y79A 4MMNA 4Q0IA 5IU1A 2D02A 3BY8A 4P6ZS 1S1ZA 2IA2A 4IHQA 1GSVA 1N9OA 3NOUC 2GNXA 4NXGA 3TE8A 3LIAA 1V9ZA 2J3TD 3B47A 5J3WA 2EWVA 2ZOHA 3F1PA 1LSWA 3CWFA 3PBSA 3E0YA 4EXOA 2W3GA 4R3AA 2HF6A 3MFXA 2QWSA 3LR3A 2HJEA 3BY9A 5AVEA 4PKYA 5HWTA 5DF9A 3LIFA 1TS7A 3OCLA 3MXQA 2EWWA 3EGDC 1WA9A 3PHYA 4HH2A 4I3JA 4Z1WA 2BASA 1P0ZA 1F5MA 3K3CA 3LUQA 4GHIA 4PHTA 4Q0JA 3ICYA 4G3WA 1F9IA 5DFXA 2HV1A 3VOLA 4QPRA 2W0NA 2PT7A 2VX8A 1V9YA 5AVFA 3CITA 1NRJA 2KOIA 3MF0A 4CLCE 1MZUA 1DP8A 2QYBA 4EETB 4ZRRA 2KX6A 2Z6CA 4UQIM 3C38A 2FH5A 4O0PA 3RTYA 1H8MA 5HD3A 5HPIA 1XFNA 3DBAA 3GECA 2PYPA 5J4EA 4H6JB 3K3DA 1P97A 3KO6A 3HJIA 4YNRA 3LYXA 4MN7A 2D01A 3H7WA 4AFIA 3ULFA 3UB6A 4NXBA 2WKRA 2JKRI 3CUEA 3E4OA 2PD8A 3PXPA 4ETXA 1P9WA 2O9CA 2VV6A 3PBOA 3UE3A 1T1AA 5KIZA 5A8BA 1OT9A 2B18A 2M7UA 4R38A 3H82A 4JGRA 3OBFA 4WEKA 1OTDA 2CMNA 3HJKA 2O9AA 3D3OA 3D72A 3BJNA 2JKRM 1N9NA 1OJGA 4WL9A 4DMZA 4YWZA 4WLAA 1XJ4A 1P9RA 2PR5A 1D7EA 1MC0A 5TBMB 1W63M 2QHKA 2MJ6A 2VJWA 4P6ZM 2PDRA 4BMWA 4HJ3A 3MQOA 3ZQ5A 3CUEC 1T18A 2O99A 2W3EA 4EEPA 5LBRA 2L4RA 2QKPA 4GJ4A 4WELA 4Y2FA 5F68A 4WUJA 1GSXA 3IS2A 2HJ9C 3K2NA 2JHEA 1S4SA 5MC7A 1TS6A 3T4TA 2NUTC 4IUKA 4GW9A 1ZTUA 3T4LA 1VB6A 3H82B 1S66L 3T4KA 3B42A 2A24B 4LRXC 1NLYA 4CLCD 3S7QA 4R6LA 3GDIA 4EQ1A 5DKLA 3T4OA 1OTAA 4I39A 3F1PB 2M7VA 4B93A 2OAQ1 1DP6A 4XT2A 4EESA 4KUOA 2O0YA 4HIAA 2OAP1 5HWVA 5AJGA 1YKDA 2KDKA 1ZHHB 3KX0X 4WF0A 4HJ4A 2O9BA 5HDCA 4II7A 4NEED 4NKPA 2J3WA 1TS0A 4O01A 1H3QA 2VGLM 4L9EA 3PBQA 5HDSA 3PYPA 3RFBA 5DJUA 1IOUA 4JGQA 2W3HA 3BQ8A 4LRZE 1DRMA 3W2ZA 5F5YA 3O5YA 5EFWA 1EW0A 2XROA 4JGOA 1OJ5A 2W1TA 1TD5A 4FSFA 3C2WA 4O8GA 4WEJA 3IS2B 3E98A 1UWNX 3F1OB 1N9LA 3PR6A 3SW1A 4DJ3A 5L8MA 1XJ6A 2KLIA 3OC2A 3V67A 1X0OA 4IJGA 4BBVA 1Y28A 4I5SA 3F1NA 4EUVA 2PR6A 2JN7A 3F1NB 3EWKA 1IFQA 4IUHA 4Y3IA 3A0SA 3C8CA 2JKTI 2OWHA 4MN6A 2L1MA 1VHMA 2QJ5A 1F98A 2LB5A 3FPWA 5HSQA 4I38A 4GS9A 4MCWA 4BWIA 4OOLA 4OOMA 1LSVA 2K31A 4CLCA 2WKPA 3EQUA 5HD5A 3FPVA 2M1CA 2VGLS 4WN5A 5F69A 3PBNA 4EERA 4HP4A 4G3KA 4GHIB 4HH3A 1KOUA 3B33A 4KQOA 3C30A 4HP9A 5HZHA 3G6OA 3JVVA 4I3IA 1W63Q 5HL6A 4H6JA 3TRCA 2I9VA 2YKFA 3LR0A 3MJQA 2Z6DA 4GS9B 3R4KA 4F3LB 4CLCC 3BQAA 4E04A 4F3LA 4KUKA 5F6AA 2R78A 3NHQA 1OT6A 4I3AA 3LFVA 1YAXA 4G3VA 4DJ2A 3HCYA 3LI8A 2P04A 1T1CA 5IT5A 3LIEA 1T1BA 2L0WA 4L0LA 5FL3A 1XJ2A 5I5LA 5C5KA 5IS1A 4NXEA 2XRNA 4ARZB 3KSHA 2XA7S 4BBUA 4Q0HA 1XJ3A 3MR0A 3OCNA 4CQHA 3H9WA 3BW6A 2G7UA 2K2NA 3LIBA 1XFQA 4CLCB 2V1BA 2P7JA 5G4YA 3LICA 4ETZA 2VEAA 2INWA 3KYQA 2VKSA 3UB8A 3MQQA 2ZMFA 1OTIA 1LSXA 1ODVA 4EU0A 3EEHA 4RQ9A 1G6OA 2VA0A 5K5BA 1G28A 2XSSA 3CLOA 2PD7A 2VV7A 2H28A 1JNUA 3EOIA 5DKKA 1OTEA 3VE4A 3JVUA 2JKTM 3TW8A 4BJPA 3U2AA 5HPFA 3PBRA 1S1YA 4EEUA 4DN0A 4HOIA 5KSHA 2ZMVA 1T19A 3S7NA 3S7OA 4GCZA 3KSIA 4L9GA 4NXFA 3UB7A 3P01A 2NUPC 3UMEA 4MN5A 3VV4A 2K7SA 2XA7M 3BWLA 3KSGA 3S7PA 1TS8A 2A2LA 2PYRA 2V0UA 4FOFA 4HQAA 1LL8A 3KYZA 2VLGA 5TJJA 4HJ6A 5HDDA 2VZWA 1DP9A 2GZAA 2GJ3A 3OOVA 2GX5A 2B02A 3LIDA 2OWJA 4XT2B 3EGXC 1GSWA 3LR4A 1NWZA 1UGUA 2P08A 3TJZC 5J7EA 2V9AA 3CI6A 5DJTA 1UWPX 2A24A 2PHYA 3MMHA 3NOPC 5HWWA 2J80A 4HNBA 1YSQA 4M4XA 4MDZA 3UE6A 4HHDA 2V0WA 2ZBBA 2J3TC 3NOTC 3KSFA 3ZYTA 4LPZA 4B9OA 4PKYG 2W1TB 4ARZA 2WKQA 3IBJA 1LT0A 4EW7A 3FC7A 3NJAA 1STZA 2ZOIA 3A0RA 3RH8B 4HY8A 2Y8HA 3E4QA 3R7WA 3H7WB 3IBRA 3R7WB 5CX7A 1BYWA 1S67L 2W3DA 4PAUA 4L9FA 3UMDA 4KQDA 1TF1A 1YSPA 3EQVA 2OOLA 3LR5A 2V1AA 1OTBA 5TBMA 2QJ7A 2VV8A 4YOFA 1NLZA 2W3FA 2HGVA 3A0VA 3OLOA 4JGPA 3VE3A 3T50A 3UB9A 3FG8A 2DMWA 3LI9A 2EA9A 3CAXA 4Y5FA 4R70A 5DFYA 1MKMA 3EEAA 2LB9A 3E4PA 1D06A 4LLOB 4BBTA 3F1OA 3P7NA 2FZ0A 1OPXA 4GLQA 4UEYA 2W1RA 1S4RA 4ME4A 5G4ZA 3MQ0A 4LRYC 3T4SA 4UQIS 3T4JA 4K08A 3T4QA 4HI4A 3PBTA 2YKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J7E A;  2W27 A;  2QHK A;  2OWH A;  4MN6 A;  2K7S A;  2PDR A;  3BWL A;  2L1M A;  5IU1 A;  2QJ5 A;  4HJ3 A;  3MQO A;  1F98 A;  2D02 A;  3BY8 A;  3ZQ5 A;  4E04 A;  5HSQ A;  1S1Z A;  1T18 A;  1TS8 A;  2PYR A;  2V0U A;  4HQA A;  4I38 A;  1LL8 A;  4EEP A;  1GSV A;  2L4R A;  2QKP A;  2VLG A;  4GS9 A;  1N9O A;  5F68 A;  4WUJ A;  1GSX A;  3NOU C;  4HJ6 A;  5HDD A;  4NXG A;  1DP9 A;  1LSV A;  3LIA A;  1V9Z A;  2WKP A;  5HD5 A;  5J3W A;  2M1C A;  3IS2 A;  2ZOH A;  4WN5 A;  3F1P A;  1LSW A;  5F69 A;  3CWF A;  2JHE A;  4HP4 A;  1S4S A;  2GJ3 A;  4EER A;  4EXO A;  2B02 A;  1TS6 A;  4GHI B;  4HH3 A;  1KOU A;  3LID A;  2OWJ A;  3B33 A;  4XT2 B;  4R3A A;  4GW9 A;  4HP9 A;  3MFX A;  5HZH A;  3G6O A;  1VB6 A;  2QWS A;  1GSW A;  1S66 L;  3H82 B;  4I3I A;  2A24 B;  4LRX C;  3BY9 A;  1NWZ A;  1UGU A;  4H6J A;  4PKY A;  5AVE A;  4R6L A;  2V9A A;  5HWT A;  3GDI A;  2I9V A;  2YKF A;  5DJT A;  3MJQ A;  1UWP X;  2A24 A;  1TS7 A;  2PHY A;  2Z6D A;  3LIF A;  3MXQ A;  3NOP C;  4GS9 B;  4EQ1 A;  5HWW A;  5DKL A;  1WA9 A;  1OTA A;  2J80 A;  3PHY A;  4HH2 A;  4HNB A;  4I3J A;  4KUK A;  5F6A A;  4M4X A;  4F3L A;  2BAS A;  2R78 A;  4I39 A;  3UE6 A;  1P0Z A;  3NHQ A;  2V0W A;  1OT6 A;  2ZBB A;  3F1P B;  4HHD A;  4I3A A;  3NOT C;  4DJ2 A;  3LI8 A;  4LPZ A;  1T1C A;  3K3C A;  3LIE A;  3LUQ A;  4GHI A;  4PKY G;  1T1B A;  4B9O A;  1DP6 A;  2L0W A;  4XT2 A;  2WKQ A;  4KUO A;  1LT0 A;  1XJ2 A;  3ICY A;  1F9I A;  5I5L A;  4EES A;  4EW7 A;  5IS1 A;  4NXE A;  3FC7 A;  3NJA A;  2HV1 A;  4HIA A;  2ZOI A;  3A0R A;  3RH8 B;  3VOL A;  4BBU A;  4HY8 A;  3E4Q A;  5HWV A;  2KDK A;  1XJ3 A;  2W0N A;  3KX0 X;  3MR0 A;  4WF0 A;  1V9Y A;  5AVF A;  3H9W A;  4HJ4 A;  3H7W B;  3IBR A;  5HDC A;  1BYW A;  1MZU A;  1DP8 A;  1S67 L;  3LIB A;  4EET B;  2KX6 A;  2Z6C A;  1XFQ A;  1TS0 A;  4L9F A;  3RTY A;  3UMD A;  5HD3 A;  4KQD A;  2V1B A;  2P7J A;  1XFN A;  5G4Y A;  3LIC A;  4L9E A;  2OOL A;  2VEA A;  3GEC A;  2PYP A;  2INW A;  5J4E A;  5HDS A;  2V1A A;  3UB8 A;  3MQQ A;  3PYP A;  4H6J B;  1OTB A;  1OTI A;  5TBM A;  1LSX A;  2QJ7 A;  2VV8 A;  3K3D A;  1P97 A;  1ODV A;  4JGQ A;  5DJU A;  3A0V A;  4LRZ E;  3HJI A;  3EEH A;  3OLO A;  1DRM A;  3LYX A;  4JGP A;  4RQ9 A;  3T50 A;  3VE3 A;  2D01 A;  3H7W A;  5F5Y A;  3UB9 A;  3FG8 A;  3ULF A;  1G28 A;  1EW0 A;  3LI9 A;  5EFW A;  3CLO A;  3UB6 A;  2EA9 A;  2WKR A;  4NXB A;  4JGO A;  3CAX A;  3E4O A;  2PD8 A;  1OJ5 A;  2PD7 A;  2VV7 A;  2H28 A;  4R70 A;  1JNU A;  2VV6 A;  5DKK A;  1OTE A;  1T1A A;  3C2W A;  3VE4 A;  5A8B A;  1OT9 A;  5KIZ A;  4F3L B;  3IS2 B;  4R38 A;  1UWN X;  3H82 A;  3F1O B;  3E4P A;  1D06 A;  1N9L A;  4LLO B;  4JGR A;  1S1Y A;  4BBT A;  4EEU A;  3SW1 A;  4DJ3 A;  3F1O A;  3P7N A;  1OTD A;  2CMN A;  3HJK A;  1XJ6 A;  4HOI A;  3D72 A;  1X0O A;  1T19 A;  4BBV A;  1S4R A;  1Y28 A;  4I5S A;  3F1N A;  4GCZ A;  4L9G A;  1N9N A;  5G4Z A;  2PR6 A;  1OJG A;  4WL9 A;  4LRY C;  2JN7 A;  2PR5 A;  3F1N B;  4NXF A;  3EWK A;  4K08 A;  4YWZ A;  4HI4 A;  4WLA A;  1XJ4 A;  3UB7 A;  3UME A;  2YKH A;  4MN5 A;  1D7E A;  5TBM B;  3A0S A;  3C8C A; 
#chains in the Genus database with same CATH topology
 2H10 A;  2Y2H A;  1HLU P;  3AGE A;  3JYI A;  2ZLY A;  5IU1 A;  2IWD A;  3ITB A;  1IKG A;  1NYM A;  2WAF A;  4IHQ A;  3VOZ A;  3HLW A;  4NXG A;  1V9Z A;  3B47 A;  5FI7 A;  2EWV A;  2ZOH A;  3FKW A;  3PBS A;  4ZJ2 A;  2C6W B;  2WKE A;  4R4S A;  3B3X A;  2XFS A;  3LR3 A;  4GDB A;  2E8J A;  2ZQD A;  4PKY A;  3Q7V B;  4ID4 A;  3OCL A;  3MXQ A;  3QNB A;  4HH2 A;  4I3J A;  4Z1W A;  2BAS A;  5E2H A;  1WYB A;  4DXB A;  1YMX A;  4Q0J A;  2AVX A;  3ICY A;  4JF4 A;  5CEB A;  2HV1 A;  2PT7 A;  3ZG9 B;  3IHA A;  3N8R A;  3CMZ A;  4EET B;  4UQI M;  3C38 A;  1TVF A;  1YLT A;  4Y15 A;  5HPI A;  3DBA A;  3GEC A;  3K3D A;  3LYX A;  4WZ5 C;  4X56 A;  1DY6 A;  2JKR I;  3CUE A;  3E4O A;  1XA1 A;  3BFG A;  3MKF A;  3VP4 A;  4LEN A;  2O9C A;  2XEP A;  5EPH A;  2B18 A;  1E4D A;  4R38 A;  4JXG A;  3ZNT A;  2JKG A;  3OBF A;  1BLC A;  3HJK A;  2O9A A;  3D3O A;  3HL9 A;  3QHY A;  3BFF A;  4KZ9 A;  1IYS A;  4WL9 A;  3SS5 A;  4WLA A;  2PR5 A;  3ZFZ A;  1VEU A;  4E3J A;  3N8L A;  4ZJ1 A;  4EUZ A;  1YLW A;  2QHK A;  3SH8 A;  4P6Z M;  2VJW A;  2PDR A;  5GHZ A;  4HJ3 A;  4B4X A;  2O99 A;  1PI4 A;  5LBR A;  5FDS A;  2L4R A;  2QKP A;  4GJ4 A;  4WEL A;  5F68 A;  3I7J A;  4U0X A;  3IS2 A;  2HJ9 C;  1YPR A;  4X53 A;  1S4S A;  3S4X A;  1S66 L;  1ALQ A;  5FAT A;  3GR2 A;  3S7Q A;  4R6L A;  5F1G A;  3GDI A;  1VET A;  3T4O A;  5EE8 A;  4XUZ A;  2M7V A;  3LO7 A;  2ACG A;  1JWV A;  3FYZ A;  3PAG A;  4QWO A;  4E6W A;  2P9V B;  1L2S A;  1ZHH B;  4NEE D;  3TSG A;  1CQA A;  1TS0 A;  4O01 A;  1EI5 A;  1YT4 A;  1CEG A;  3PBQ A;  4XXR A;  1IYQ A;  1NZO A;  5DJU A;  2P9V A;  3IF6 A;  2VGJ A;  5F5Y A;  3A3F A;  4OQI A;  1OJ5 A;  5EVI B;  4FSF A;  4S2I A;  5L8M A;  2ZL1 B;  3UE1 A;  1S0W A;  3UE0 A;  3IX3 A;  4U0T A;  2PR6 A;  3WS4 A;  3F1N B;  3NCK A;  4IUH A;  4Y3I A;  3A0S A;  4R1G A;  3C8C A;  5EUA A;  4MN6 A;  4OPR A;  3P98 A;  3OZH A;  2L1M A;  3SZT A;  5HSQ A;  2PU2 A;  2ZQ7 A;  5M19 A;  5E2F A;  3CPT B;  4CLC A;  3EQU A;  1YMS A;  5F69 A;  3IWO A;  1KOU A;  3B33 A;  3AGF A;  3C30 A;  1K57 C;  3MXR A;  4I3I A;  4D2O A;  4MEZ A;  4H6J A;  4DKI A;  2I9V A;  2YKF A;  3LR0 A;  5FDH A;  1KGG A;  3BQA A;  4GN2 A;  3BFD A;  1RGZ A;  5F6A A;  2R78 A;  1BUE A;  1YAX A;  4G3V A;  3V5M A;  3WS1 A;  2L0W A;  5I5L A;  5C5K A;  5IS1 A;  3LCE A;  2XRN A;  2XA7 S;  3LY4 A;  4BBU A;  4Q0H A;  3IXH A;  2VGK A;  3E2K A;  3HUM A;  2K2N A;  3LIB A;  3UB5 P;  4YIN A;  2V1B A;  3GV9 A;  5KSC A;  1ES3 A;  4ETZ A;  4S2P A;  3UN7 A;  4BD1 A;  4DF6 A;  2ZMF A;  3Q7V A;  1KGF A;  3BEC A;  4RA7 A;  1GHI A;  1I5Q A;  5CGW A;  3S1Y A;  5CGX A;  4E6X A;  5DKK A;  4KQR A;  1LL5 A;  1IEL A;  4EEU A;  2X71 A;  4OPY A;  2Q9N A;  4DN0 A;  2Y2O A;  4HOI A;  5FI6 A;  1I2S A;  4DE3 A;  4L9G A;  3HUN A;  5HFO A;  1BLS A;  3P01 A;  2NUP C;  4MN5 A;  2XA7 M;  3RXX A;  3KSG A;  3UDI A;  3DTI A;  2V0U A;  1LL8 A;  2JCH A;  1VET B;  1DJA A;  2WK0 A;  1DP9 A;  1K0K A;  4KZ5 A;  1D1J A;  2PU4 A;  3EGX C;  1DJC A;  5EVI D;  5FAO A;  1GSW A;  3LR4 A;  5J7E A;  3WS5 A;  2PHY A;  5A91 A;  1YM1 A;  2V0W A;  2ZBB A;  3NOT C;  1MXO A;  3KSF A;  5EOO A;  3VP3 A;  4LPZ A;  4WMC D;  2XR0 A;  4ARZ A;  2WKQ A;  1HD8 A;  4OON A;  2ZOI A;  2XD1 A;  4HY8 A;  2Y8H A;  5IHV A;  5CTM A;  3R7W A;  1MY8 A;  1JTD A;  1ZKJ A;  4X68 A;  1S67 L;  2W3D A;  4KQD A;  1TF1 A;  3JPU A;  4Y0T A;  1VEU B;  2HPB A;  3VE3 A;  4MBF A;  4C6Y A;  1KDW A;  1GHM A;  3T1X A;  1SKO B;  5I94 A;  3Q7Z A;  4N1X A;  3VP0 A;  1MWR A;  4ZJ3 A;  3EEA A;  4IED A;  5EV0 A;  2B5R A;  4LLO B;  4KG6 A;  4BBT A;  3F1O A;  5FQQ A;  4DE2 A;  2WGI A;  3NC8 A;  2Y2J A;  5L2F A;  1PIO A;  4F94 A;  3T4S A;  3T4Q A;  3BLM A;  1K56 A;  3C4P A;  4S2N A;  3LEQ A;  5L09 A;  2D02 A;  2Y2K A;  4P6Z S;  1AXB A;  3IF6 C;  4MBH A;  1S1Z A;  1FR1 A;  1GSV A;  2EFU A;  1ERQ A;  5AQA A;  3F1P A;  1LSW A;  1ACF A;  3E0Y A;  5GLB A;  2I72 A;  3M6H A;  1IKI A;  5CHU A;  2HJE A;  4N9L A;  3W4O A;  5F83 A;  5AVE A;  5DF9 A;  3P09 A;  4P87 A;  3LIF A;  3EGD C;  1P0Z A;  1F5M A;  2B95 A;  4GHI A;  4PHT A;  5EVL A;  3HVF A;  2ZC7 A;  1YLZ A;  5JYP A;  2W0N A;  1TDL A;  3LGO A;  1V9Y A;  3CIT A;  2KOI A;  4CLC E;  4ZRR A;  2Z6C A;  2FH5 A;  2V2F F;  5HD3 A;  3QP6 A;  2PBD P;  3G30 A;  1DJB A;  4RVA A;  2OLV A;  4H6J B;  4JXV A;  5KMW A;  3KO6 A;  4MN7 A;  3V39 A;  5CXW A;  3G4P A;  4NXB A;  3MSH A;  4GDN A;  1IEM A;  2WKI A;  3FKV A;  5D3O A;  5FQK A;  1P9W A;  3UE3 A;  1T1A A;  5KIZ A;  1OT9 A;  2M7U A;  2XLN A;  4WEK A;  1GHP A;  1OTD A;  2CMN A;  4LCL A;  4PM7 A;  1KE3 A;  5EVE A;  3BJN A;  1SZV A;  1IYP A;  4K0W A;  5DTS A;  1P9R A;  2E8I A;  1D7E A;  4KQQ A;  1FCM A;  3BLS A;  3SOI A;  2MJ6 A;  4R4R A;  4WM9 A;  3ZQ5 A;  5GHY A;  1JWZ A;  2W3E A;  4EEP A;  3TOI A;  3NDG A;  2ZC5 B;  4BL3 A;  1GCE A;  2JHE A;  5MC7 A;  2GDN A;  4HEF A;  1TS6 A;  1LI9 A;  3DWZ A;  3KYE A;  1VB6 A;  4DDY A;  3T4K A;  3B42 A;  3UDF A;  3MZF A;  4OLD A;  1NLY A;  3IWI A;  4OKP A;  5DKL A;  1OTA A;  4I39 A;  2Y2L A;  4XT2 A;  3BM6 A;  2ZJ9 A;  3TG9 A;  5HWV A;  5AJG A;  3W8K A;  1NJ4 A;  3IF5 A;  2O9B A;  4KG2 A;  5HDC A;  4II7 A;  4ZBE A;  2X01 A;  1H3Q A;  5A93 A;  4KZ6 A;  4L9E A;  5CHJ A;  5HX9 A;  3PYP A;  4P0M A;  1PWG A;  1NZU A;  3ZG5 A;  2W3H A;  3CJM A;  2Y2G A;  2HZ5 A;  1FCO A;  3O5Y A;  4JXS A;  4IVI A;  3M2J A;  1KVL A;  5FQM A;  2W1T A;  5L07 A;  2Y4A A;  5AQB A;  3C2W A;  2R9X A;  3DTK A;  1NY0 A;  3F1O B;  3PR6 A;  4OP5 A;  4QU3 A;  4KZ4 A;  3A3I A;  3OC2 A;  2ZM0 A;  4RX2 A;  1XXM A;  1X0O A;  1Y28 A;  3IXG A;  4EUV A;  1MWS A;  2IWC A;  3EWK A;  4E3I A;  2J9O A;  1IFQ A;  3ZG0 A;  2JKT I;  5CHM A;  1VHM A;  2QJ5 A;  1F98 A;  1WE4 A;  3HBR A;  1F2K A;  1HVB A;  4I38 A;  5E43 A;  4EQI A;  5CER A;  4BWI A;  1Q2P A;  4OOL A;  2QZ6 A;  4MNR A;  2WKP A;  2WGW B;  3PBN A;  4G3K A;  4GHI B;  3FWL A;  4HP9 A;  4JBF A;  5HZH A;  3JVV A;  1TEM A;  5HL6 A;  2G2U A;  4GS9 B;  3DAV A;  4NK3 A;  1ONH A;  1H5X A;  4QY5 A;  1T1C A;  5IT5 A;  1U60 A;  4L0L A;  4LV3 A;  1XJ3 A;  3MR0 A;  3OCN A;  3M6B A;  3VP1 A;  1SDE A;  4OP8 A;  1HZO A;  1L0E A;  3LIC A;  4S2O A;  5FEF A;  2VEA A;  2P74 A;  3MQQ A;  2V8C A;  1LSX A;  3AGD A;  3EEH A;  4CJN A;  1RP5 A;  1G6O A;  1KE0 A;  3CLO A;  4FH2 A;  4ZTK A;  2PD7 A;  4HES A;  2VV7 A;  2H28 A;  1JNU A;  4FH4 A;  3EOI A;  4E3K A;  3JVU A;  5TR7 A;  3U2A A;  3PBR A;  3HLB A;  1QME A;  1S6R A;  3A3E A;  3S7N A;  2ZQ9 A;  3QP1 A;  3A3D A;  2HDS A;  4EBP A;  1CEF A;  4X6T A;  1G6A A;  4WZ4 A;  3CZD A;  3DTE A;  3SS4 A;  2J9P A;  1TS8 A;  2ZM8 A;  2A2L A;  2VLG A;  1YQS A;  4HJ6 A;  5HDD A;  2A3U A;  3UPP A;  3OOV A;  3UO9 A;  1K55 C;  2ZL1 A;  2EFX A;  1ES5 A;  2V9A A;  3CI6 A;  3LEZ A;  1UWP X;  2A24 A;  2HP6 A;  5HWW A;  3VSL A;  2ZQC A;  2PAV P;  4HNB A;  4U3T A;  3RXW A;  4HHD A;  4PKY G;  4EW7 A;  5A92 A;  1STZ A;  3RH8 B;  3E4Q A;  3H7W B;  3R7W B;  5FA7 A;  5EVI C;  5J8X A;  4L9F A;  3UMD A;  2V8F A;  4BLM A;  1PZO A;  1YSP A;  4UA9 A;  3V3S A;  1I2W A;  3LR5 A;  3V3R A;  4XUX A;  1OTB A;  2W3F A;  3A0V A;  4JGP A;  4P6B A;  2Z2L B;  1EWZ A;  2DMW A;  3LI9 A;  4UAA A;  4DXC A;  2EA9 A;  3CAX A;  4GB7 A;  4OPZ A;  1XPB A;  4R70 A;  2ZM2 A;  2BTF P;  1MWU A;  3VSK A;  1NYY A;  4DRT A;  5GLD A;  4R3B A;  3P7N A;  5F82 A;  1PRQ A;  2HDR A;  1FQG A;  4OVD A;  3IH8 A;  3MQ0 A;  5A90 A;  2JBF A;  4LRY C;  4KZA A;  1L0G A;  3PBT A;  2YKH A;  2XGN A;  4PPR A;  2Y2M A;  2EXA A;  2IA2 A;  5FQ9 A;  2QMI A;  1MBL A;  1N9O A;  1K6R A;  3O86 A;  3TE8 A;  3LIA A;  2J3T D;  3O3V A;  5KZH A;  5J3W A;  3HLC A;  4EXO A;  5DTT A;  4R3A A;  4QD4 A;  3MFX A;  2QWS A;  3D9Y A;  1BZA A;  4IBX A;  2BG1 A;  4H8R A;  5FI2 A;  5HWT A;  2WGV A;  2EWW A;  1WA9 A;  3PHY A;  2Y2I A;  2Y91 A;  4R23 A;  2WYX A;  3K3C A;  3LUQ A;  2XF3 A;  1F9I A;  1ESI A;  4Y17 A;  5DFX A;  4Y0O A;  4QPR A;  2VX8 A;  5AVF A;  1NRJ A;  2WZZ A;  3MF0 A;  1DP8 A;  2QYB A;  2KX6 A;  4BL2 A;  1H8M A;  3DTM A;  2G2W A;  1KDS A;  5J4E A;  2DCF A;  4FUW A;  4QJG A;  1P97 A;  5DVA A;  4YNR A;  2HP9 A;  3A3J A;  3ULF A;  4S2K A;  5FAS A;  4RYE A;  2PD8 A;  3E2L A;  1PNE A;  3PXP A;  3VFH A;  3PBO A;  4UA6 A;  4EBL A;  1PZP A;  1MKI A;  1W8Y A;  1E3U D;  3ZHH A;  3VOY A;  4QY6 A;  4M3K A;  3IX8 A;  3D72 A;  3UY6 A;  2JKR M;  1K56 D;  4DMZ A;  3G34 A;  4YWZ A;  1XJ4 A;  3C4O A;  1CI8 A;  5TBM B;  3IXD A;  3ZGA B;  4K0X A;  4BMW A;  4Q8I A;  3MQO A;  3IF6 B;  5GLC A;  4Y2F A;  5E2G A;  4WUJ A;  1GSX A;  3BRM A;  3G31 A;  2ZC4 B;  3K2N A;  4NG2 A;  3ZG7 B;  3QP2 A;  3T4T A;  2NUT C;  4GW9 A;  3T4L A;  3H82 B;  2A24 B;  4LRX C;  3L7H A;  3MXS A;  4EQ1 A;  2QPN A;  4D60 A;  3F1P B;  4B93 A;  2Y59 A;  4KUO A;  2O0Y A;  2XD5 A;  2OSU A;  4FTX A;  4HBT A;  4HIA A;  4LV2 A;  5FAQ A;  5HAQ A;  3KX0 X;  3SH7 A;  4WF0 A;  1ESU A;  4OOY A;  5DF8 A;  3O88 A;  3N6I A;  4LCM A;  2C5W B;  3SH9 A;  3N8S A;  1L0F A;  5HDS A;  4N1H A;  1IOU A;  4JGQ A;  3W4P A;  1K54 C;  1DRM A;  1G68 A;  3Q07 A;  3W2Z A;  3D4F A;  2XRO A;  5TGF A;  1W5D A;  5GLA A;  3IWQ A;  4O8G A;  3IS2 B;  3E98 A;  1UWN X;  4Z9Q A;  4JXW A;  1N9L A;  2XDM A;  2EX9 A;  4IJG A;  4I5S A;  4GOG A;  3VP2 A;  3HLG A;  3UNW A;  4C3Q A;  5FQJ A;  4LGW A;  3L9K A;  4E3O A;  3OPL A;  3HRE A;  2OWH A;  3ZCZ A;  4Y7P A;  1H0M A;  2LB5 A;  1YLJ A;  5CRF A;  4KZB A;  3G2Y A;  2UV0 E;  2K31 A;  3FPV A;  1XP4 A;  4HP4 A;  3BEB A;  1PW1 A;  4HH3 A;  4P85 A;  4YFM A;  1W63 Q;  3TRC A;  4F3L B;  2Z6D A;  4GD6 A;  4CLC C;  3CG5 A;  1OT6 A;  4I3A A;  3LFV A;  3HCY A;  3LI8 A;  4DDS A;  2H0T A;  5HAP A;  1XJ2 A;  1KVM A;  4WBG A;  3HLE A;  2PBY A;  4CQH A;  4LV0 A;  1ZC2 A;  1CK3 A;  2G7U A;  5F1F A;  4GNU A;  3GVB A;  1XFQ A;  5HW3 A;  3IXB A;  5FQI A;  3KYQ A;  3UB8 A;  1N9B A;  1ODV A;  1Y54 A;  3NBL A;  4EU0 A;  4WYY A;  2VA0 A;  1ERM A;  5K5B A;  2JC7 A;  1JWP A;  2XSS A;  3OPH A;  5AQ9 A;  2RCX A;  2XFT A;  1YLY A;  3CPT A;  3VE4 A;  2ZMA A;  2JKT M;  3PTE A;  3TW8 A;  4BJP A;  3IX4 A;  5HPF A;  1GA0 A;  1S1Y A;  3ZVT A;  1Y4O A;  4N9K A;  5EM0 A;  2Q9M A;  1A0K A;  1ONG A;  5KSH A;  2Y2P A;  1O7E A;  3KSI A;  1LLB A;  1J3W A;  3ZNY A;  2WAE A;  4NXF A;  1ZG4 A;  3UB7 A;  3UME A;  2WGW A;  4S2J A;  3VV4 A;  2H0Y A;  4QB8 A;  1YLP A;  2V1Z A;  4KG5 A;  3BWL A;  3WS0 A;  3T1R A;  3S7P A;  2PYR A;  2DRW A;  3MZE A;  3GRJ A;  5TJJ A;  2VZW A;  2JE5 A;  5EVI A;  2GJ3 A;  1L3L A;  2XQZ A;  4KZ7 A;  1NWZ A;  3TJZ C;  1XKZ A;  5DJT A;  1BUL A;  4EV4 A;  2ZQA A;  4M4X A;  4MDZ A;  1K6S A;  3DWK A;  3BFC A;  2J3T C;  3C7V A;  4O7D A;  3ZYT A;  4RX3 A;  4B9O A;  4KZ3 A;  5TFQ A;  2W1T B;  3IBJ A;  4PM8 A;  3FC7 A;  2Y2Q A;  4PM9 A;  1BLH A;  3BFE A;  1L0D A;  1LI0 A;  1W79 A;  2EX8 A;  3IBR A;  1CJF A;  3MZD A;  4NET A;  4PM6 A;  5CX7 A;  1LHY A;  3IT9 A;  2HDQ A;  2OOL A;  3O87 A;  1FIK A;  1SHV A;  5TBM A;  2QJ7 A;  2VV8 A;  1KE4 A;  1NLZ A;  1OME A;  2HGV A;  3QP8 A;  3OLO A;  3N7W A;  4ZAM A;  5DFY A;  2EX2 A;  4CPK A;  1MKM A;  1H8Z A;  5EOE A;  2LB9 A;  3E4P A;  4JPM A;  1D06 A;  3QP5 A;  4WZ5 A;  3GSG A;  5DF7 A;  1OPX A;  3HLD A;  4UEY A;  2W1R A;  4ME4 A;  1S4R A;  3IHB A;  5FEG A;  5G4Z A;  1O07 A;  4HI4 A;  2JKF A;  4IBR A;  3NDE A;  2W27 A;  3C5A A;  1K55 A;  2Y79 A;  4MMN A;  4B4Z A;  4Q0I A;  1K4F A;  5DTK A;  5CED A;  4A5R A;  1Q2Q A;  3BY8 A;  3MBZ A;  1N4O A;  1K57 A;  3FZC A;  3T1S A;  3NOU C;  2GNX A;  1SCW A;  4DE1 A;  5JYO A;  1K4E A;  3CWF A;  4GZB A;  2W3G A;  1BTL A;  4X1L A;  1H8Y A;  3ZDJ A;  2HF6 A;  3LY3 A;  3BY9 A;  3GQZ A;  5FSR A;  4R0Q A;  1TS7 A;  3G35 A;  1IYO A;  1VM1 A;  2FFY A;  3G32 A;  4G3W A;  3Q1F A;  4HBU A;  2PRF A;  3UPN A;  3VOL A;  2XK1 A;  1PFL A;  1PYY A;  1MZU A;  3IH9 A;  4O0P A;  3RTY A;  5AQ7 A;  1XGI A;  1XFN A;  1ES4 A;  2PYP A;  1PWD A;  4UHU A;  3HJI A;  4Y13 A;  1KGE A;  2D01 A;  3H7W A;  4AFI A;  5G18 A;  3UB6 A;  2WKR A;  5M18 A;  3OPR A;  3WRZ A;  4ETX A;  2VV6 A;  4JF6 A;  3U4L P;  1FCN A;  5A8B A;  4X1M A;  3H82 A;  3QP4 A;  4JGR A;  1NXY A;  3N4I A;  1ZG6 A;  1N9N A;  1OJG A;  4OQG A;  1MC0 A;  1W63 M;  2ZC6 B;  1VQQ A;  4C75 A;  2CC1 A;  2EXB A;  1M6K A;  4QHC A;  1CF0 A;  1Z09 A;  3PAE A;  3CUE C;  4GKU A;  2Y2N A;  1T18 A;  3ZVW A;  1HTZ A;  4BQM A;  5HL1 A;  1Z6F A;  3WS2 A;  5FAP A;  2ZC3 B;  4IUK A;  1ZTU A;  1GA9 A;  1G5U A;  3WRT A;  4CLC D;  5M1A A;  3VFF A;  2J7V A;  5CGS A;  2WKH A;  4ESP A;  2OAQ 1;  2R9W A;  1DP6 A;  4S2N C;  4EES A;  1JVJ A;  3NUL A;  2OAP 1;  1YKD A;  2KDK A;  3NY4 A;  1FSW A;  4HJ4 A;  1ES2 A;  3WWX A;  5EM1 A;  4LV1 A;  4NKP A;  2J3W A;  3RJU A;  1W7F A;  2WAD A;  2OLU A;  2VGL M;  4S2L A;  1PWC A;  5L10 A;  1K25 A;  3RFB A;  4X55 A;  3BQ8 A;  4LRZ E;  4N92 A;  4KZ8 A;  1FOF A;  1EW0 A;  5EFW A;  4BEN A;  4JGO A;  4PM5 A;  2IWB A;  1TD5 A;  4JLF A;  3GTC A;  4X25 A;  4WEJ A;  3SW1 A;  4DJ3 A;  2DNS A;  1K54 A;  1XJ6 A;  1RCJ A;  2KLI A;  3MKE A;  3V67 A;  3SS3 A;  4WMC A;  3MFD A;  4BBV A;  3F1N A;  5EEC A;  2JN7 A;  2HDU A;  4JF5 A;  4EBN A;  4GD8 A;  3FPW A;  2UWX A;  4GS9 A;  2RL3 A;  4MCW A;  3VMA A;  4OOM A;  1LSV A;  3NIA A;  5HD5 A;  2M1C A;  4JKT A;  2VGL S;  4WN5 A;  2WUQ A;  4E3M A;  4EER A;  4ZDX A;  1FSY A;  4KQO A;  3G6O A;  1BT5 A;  3G2Z A;  2Y55 A;  3MJQ A;  4IVK A;  3R4K A;  1SKF A;  1E3U A;  3OPP A;  4E04 A;  4EWF A;  4F3L A;  4KUK A;  1XX2 A;  3FV7 A;  3NHQ A;  2Q0O A;  4DJ2 A;  4MLL A;  2P04 A;  3LIE A;  4OLG A;  1T1B A;  3NI9 A;  5FL3 A;  3Q82 A;  5GL9 A;  4NXE A;  4ARZ B;  3KSH A;  1BLP A;  2BLS A;  3NEC A;  3S22 A;  1SDN A;  1MPL A;  2HP5 A;  3H9W A;  5E2E A;  3BW6 A;  4DE0 A;  3UPO A;  1QMF A;  4OQH A;  4E3L A;  4K91 A;  4CLC B;  2P7J A;  5G4Y A;  2INW A;  2VKS A;  1OTI A;  3CHW P;  2V20 A;  3M2K A;  4RQ9 A;  1G28 A;  3BYD A;  1ERO A;  4MBK A;  5HAR A;  1OTE A;  4UA7 A;  1MWT A;  4PMA A;  1XGJ A;  3QNC A;  3ITA A;  4B88 A;  2ZMV A;  1T19 A;  3S7O A;  4GCZ A;  4BD0 A;  1TDG A;  1BSG A;  3C7U A;  3ISG A;  2OV5 A;  1W8Q A;  2X02 A;  1JTG A;  2K7S A;  3HUO A;  2J8Y A;  5U47 A;  3MS6 A;  4FOF A;  4HQA A;  3KYZ A;  2GZA A;  2GX5 A;  2B02 A;  3LID A;  4Y0U A;  2OWJ A;  2Z2M B;  4XT2 B;  4S2M A;  3IQA A;  2P08 A;  1UGU A;  4FCF A;  3MMH A;  3NOP C;  2J80 A;  1YSQ A;  3UE6 A;  5CTN A;  4R3J A;  4OQ0 A;  2WZX A;  2ZD8 A;  2VK3 A;  1C3B A;  1LT0 A;  5HAI A;  2XH9 A;  3ZG8 B;  3UDX A;  3NJA A;  3A0R A;  4LFU A;  1NRF A;  1BYW A;  1RGY A;  4PAU A;  4E3N A;  3W4Q A;  3EQV A;  3Q81 A;  2H5S A;  2V1A A;  4X69 A;  4YOF A;  3T50 A;  1XA7 A;  1PW8 A;  3UB9 A;  3FG8 A;  4FD8 A;  5GHX A;  1CI9 A;  1PI5 A;  4Y5F A;  1FR6 A;  1SKO A;  3HLF A;  4OH0 A;  5CEC A;  2ZQ8 A;  1M40 A;  5BOH A;  2A49 A;  2FFF B;  2FZ0 A;  4GLQ A;  3T1Q B;  1WYC A;  1LL9 A;  3GMW A;  1J9M A;  1K38 A;  4OPQ A;  1AWI A;  2EX6 A;  1E25 A;  4UQI S;  3T4J A;  1FIL A;  4K08 A;  3DW0 A;  3V50 A;  4KEN B;  3T12 B; 
#chains in the Genus database with same CATH homology
 2W27 A;  2Y79 A;  4MMN A;  4Q0I A;  5IU1 A;  2D02 A;  3BY8 A;  4P6Z S;  1S1Z A;  2IA2 A;  4IHQ A;  1GSV A;  1N9O A;  3NOU C;  2GNX A;  4NXG A;  3TE8 A;  3LIA A;  1V9Z A;  2J3T D;  3B47 A;  5J3W A;  2EWV A;  2ZOH A;  3F1P A;  1LSW A;  3CWF A;  3PBS A;  3E0Y A;  4EXO A;  2W3G A;  4R3A A;  2HF6 A;  3MFX A;  2QWS A;  3LR3 A;  2HJE A;  3BY9 A;  5AVE A;  4PKY A;  5HWT A;  5DF9 A;  3LIF A;  1TS7 A;  3OCL A;  3MXQ A;  2EWW A;  3EGD C;  1WA9 A;  3PHY A;  4HH2 A;  4I3J A;  4Z1W A;  2BAS A;  1P0Z A;  1F5M A;  3K3C A;  3LUQ A;  4GHI A;  4PHT A;  4Q0J A;  3ICY A;  4G3W A;  1F9I A;  5DFX A;  2HV1 A;  3VOL A;  4QPR A;  2W0N A;  2PT7 A;  2VX8 A;  1V9Y A;  5AVF A;  3CIT A;  1NRJ A;  2KOI A;  3MF0 A;  4CLC E;  1MZU A;  1DP8 A;  2QYB A;  4EET B;  4ZRR A;  2KX6 A;  2Z6C A;  4UQI M;  3C38 A;  2FH5 A;  4O0P A;  3RTY A;  1H8M A;  5HD3 A;  5HPI A;  1XFN A;  3DBA A;  3GEC A;  2PYP A;  5J4E A;  4H6J B;  3K3D A;  1P97 A;  3KO6 A;  3HJI A;  4YNR A;  3LYX A;  4MN7 A;  2D01 A;  3H7W A;  4AFI A;  3ULF A;  3UB6 A;  4NXB A;  2WKR A;  2JKR I;  3CUE A;  3E4O A;  2PD8 A;  3PXP A;  4ETX A;  1P9W A;  2O9C A;  2VV6 A;  3PBO A;  3UE3 A;  1T1A A;  5KIZ A;  5A8B A;  1OT9 A;  2B18 A;  2M7U A;  4R38 A;  3H82 A;  4JGR A;  3OBF A;  4WEK A;  1OTD A;  2CMN A;  3HJK A;  2O9A A;  3D3O A;  3D72 A;  3BJN A;  2JKR M;  1N9N A;  1OJG A;  4WL9 A;  4DMZ A;  4YWZ A;  4WLA A;  1XJ4 A;  1P9R A;  2PR5 A;  1D7E A;  1MC0 A;  5TBM B;  1W63 M;  2QHK A;  2MJ6 A;  2VJW A;  4P6Z M;  2PDR A;  4BMW A;  4HJ3 A;  3MQO A;  3ZQ5 A;  3CUE C;  1T18 A;  2O99 A;  2W3E A;  4EEP A;  5LBR A;  2L4R A;  2QKP A;  4GJ4 A;  4WEL A;  4Y2F A;  5F68 A;  4WUJ A;  1GSX A;  3IS2 A;  2HJ9 C;  3K2N A;  2JHE A;  1S4S A;  5MC7 A;  1TS6 A;  3T4T A;  2NUT C;  4IUK A;  4GW9 A;  1ZTU A;  3T4L A;  1VB6 A;  3H82 B;  1S66 L;  3T4K A;  3B42 A;  2A24 B;  4LRX C;  1NLY A;  4CLC D;  3S7Q A;  4R6L A;  3GDI A;  4EQ1 A;  5DKL A;  3T4O A;  1OTA A;  4I39 A;  3F1P B;  2M7V A;  4B93 A;  2OAQ 1;  1DP6 A;  4XT2 A;  4EES A;  4KUO A;  2O0Y A;  4HIA A;  2OAP 1;  5HWV A;  5AJG A;  1YKD A;  2KDK A;  1ZHH B;  3KX0 X;  4WF0 A;  4HJ4 A;  2O9B A;  5HDC A;  4II7 A;  4NEE D;  4NKP A;  2J3W A;  1TS0 A;  4O01 A;  1H3Q A;  2VGL M;  4L9E A;  3PBQ A;  5HDS A;  3PYP A;  3RFB A;  5DJU A;  1IOU A;  4JGQ A;  2W3H A;  3BQ8 A;  4LRZ E;  1DRM A;  3W2Z A;  5F5Y A;  3O5Y A;  5EFW A;  1EW0 A;  2XRO A;  4JGO A;  1OJ5 A;  2W1T A;  1TD5 A;  4FSF A;  3C2W A;  4O8G A;  4WEJ A;  3IS2 B;  3E98 A;  1UWN X;  3F1O B;  1N9L A;  3PR6 A;  3SW1 A;  4DJ3 A;  5L8M A;  1XJ6 A;  2KLI A;  3OC2 A;  3V67 A;  1X0O A;  4IJG A;  4BBV A;  1Y28 A;  4I5S A;  3F1N A;  4EUV A;  2PR6 A;  2JN7 A;  3F1N B;  3EWK A;  1IFQ A;  4IUH A;  4Y3I A;  3A0S A;  3C8C A;  2JKT I;  2OWH A;  4MN6 A;  2L1M A;  1VHM A;  2QJ5 A;  1F98 A;  2LB5 A;  3FPW A;  5HSQ A;  4I38 A;  4GS9 A;  4MCW A;  4BWI A;  4OOL A;  4OOM A;  1LSV A;  2K31 A;  4CLC A;  2WKP A;  3EQU A;  5HD5 A;  3FPV A;  2M1C A;  2VGL S;  4WN5 A;  5F69 A;  3PBN A;  4EER A;  4HP4 A;  4G3K A;  4GHI B;  4HH3 A;  1KOU A;  3B33 A;  4KQO A;  3C30 A;  4HP9 A;  5HZH A;  3G6O A;  3JVV A;  4I3I A;  1W63 Q;  5HL6 A;  4H6J A;  3TRC A;  2I9V A;  2YKF A;  3LR0 A;  3MJQ A;  2Z6D A;  4GS9 B;  3R4K A;  4F3L B;  4CLC C;  3BQA A;  4E04 A;  4F3L A;  4KUK A;  5F6A A;  2R78 A;  3NHQ A;  1OT6 A;  4I3A A;  3LFV A;  1YAX A;  4G3V A;  4DJ2 A;  3HCY A;  3LI8 A;  2P04 A;  1T1C A;  5IT5 A;  3LIE A;  1T1B A;  2L0W A;  4L0L A;  5FL3 A;  1XJ2 A;  5I5L A;  5C5K A;  5IS1 A;  4NXE A;  2XRN A;  4ARZ B;  3KSH A;  2XA7 S;  4BBU A;  4Q0H A;  1XJ3 A;  3MR0 A;  3OCN A;  4CQH A;  3H9W A;  3BW6 A;  2G7U A;  2K2N A;  3LIB A;  1XFQ A;  4CLC B;  2V1B A;  2P7J A;  5G4Y A;  3LIC A;  4ETZ A;  2VEA A;  2INW A;  3KYQ A;  2VKS A;  3UB8 A;  3MQQ A;  2ZMF A;  1OTI A;  1LSX A;  1ODV A;  4EU0 A;  3EEH A;  4RQ9 A;  1G6O A;  2VA0 A;  5K5B A;  1G28 A;  2XSS A;  3CLO A;  2PD7 A;  2VV7 A;  2H28 A;  1JNU A;  3EOI A;  5DKK A;  1OTE A;  3VE4 A;  3JVU A;  2JKT M;  3TW8 A;  4BJP A;  3U2A A;  5HPF A;  3PBR A;  1S1Y A;  4EEU A;  4DN0 A;  4HOI A;  5KSH A;  2ZMV A;  1T19 A;  3S7N A;  3S7O A;  4GCZ A;  3KSI A;  4L9G A;  4NXF A;  3UB7 A;  3P01 A;  2NUP C;  3UME A;  4MN5 A;  3VV4 A;  2K7S A;  2XA7 M;  3BWL A;  3KSG A;  3S7P A;  1TS8 A;  2A2L A;  2PYR A;  2V0U A;  4FOF A;  4HQA A;  1LL8 A;  3KYZ A;  2VLG A;  5TJJ A;  4HJ6 A;  5HDD A;  2VZW A;  1DP9 A;  2GZA A;  2GJ3 A;  3OOV A;  2GX5 A;  2B02 A;  3LID A;  2OWJ A;  4XT2 B;  3EGX C;  1GSW A;  3LR4 A;  1NWZ A;  1UGU A;  2P08 A;  3TJZ C;  5J7E A;  2V9A A;  3CI6 A;  5DJT A;  1UWP X;  2A24 A;  2PHY A;  3MMH A;  3NOP C;  5HWW A;  2J80 A;  4HNB A;  1YSQ A;  4M4X A;  4MDZ A;  3UE6 A;  4HHD A;  2V0W A;  2ZBB A;  2J3T C;  3NOT C;  3KSF A;  3ZYT A;  4LPZ A;  4B9O A;  4PKY G;  2W1T B;  4ARZ A;  2WKQ A;  3IBJ A;  1LT0 A;  4EW7 A;  3FC7 A;  3NJA A;  1STZ A;  2ZOI A;  3A0R A;  3RH8 B;  4HY8 A;  2Y8H A;  3E4Q A;  3R7W A;  3H7W B;  3IBR A;  3R7W B;  5CX7 A;  1BYW A;  1S67 L;  2W3D A;  4PAU A;  4L9F A;  3UMD A;  4KQD A;  1TF1 A;  1YSP A;  3EQV A;  2OOL A;  3LR5 A;  2V1A A;  1OTB A;  5TBM A;  2QJ7 A;  2VV8 A;  4YOF A;  1NLZ A;  2W3F A;  2HGV A;  3A0V A;  3OLO A;  4JGP A;  3VE3 A;  3T50 A;  3UB9 A;  3FG8 A;  2DMW A;  3LI9 A;  2EA9 A;  3CAX A;  4Y5F A;  4R70 A;  5DFY A;  1MKM A;  3EEA A;  2LB9 A;  3E4P A;  1D06 A;  4LLO B;  4BBT A;  3F1O A;  3P7N A;  2FZ0 A;  1OPX A;  4GLQ A;  4UEY A;  2W1R A;  1S4R A;  4ME4 A;  5G4Z A;  3MQ0 A;  4LRY C;  3T4S A;  4UQI S;  3T4J A;  4K08 A;  3T4Q A;  4HI4 A;  3PBT A;  2YKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...