1TS7A

Structure of the pr cis wobble and pr e46q intermediates from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts7A00
5HDCA 1TS0A 3MXQA 4MN6A 3P7NA 4JGRA 4HP4A 1LL8A 4HI4A 4XT2A 1ODVA 3LIBA 4HJ3A 3NOUC 4R6LA 2KX6A 2JHEA 1BYWA 3H7WA 3LICA 3G6OA 5TBMA 2W27A 4I3IA 5HD3A 3NJAA 1OT6A 1OTAA 1OTIA 3A0VA 1D06A 3VE4A 5KIZA 3MFXA 4HJ6A 3FG8A 3A0RA 4LPZA 2VV8A 2H28A 3VE3A 4I39A 3H9WA 1S4SA 5F68A 1OJ5A 5DJUA 1DP8A 2Z6CA 5J3WA 4HQAA 3HJKA 2YKFA 3ULFA 3BY8A 4H6JA 5HWVA 3E4OA 2V0WA 1UWNX 4EEUA 2V1AA 3CLOA 3K3CA 4R3AA 4RQ9A 4L9EA 4JGQA 4WL9A 1S67L 2PHYA 2VV6A 3F1PB 1OT9A 4WN5A 4EW7A 4GHIB 1TS8A 3F1NB 2GJ3A 3LI8A 5HSQA 3IBRA 1VB6A 2A24B 3C8CA 1GSVA 1LSVA 1T18A 2L1MA 3MR0A 4EEPA 4F3LA 4NXBA 2KDKA 3CWFA 4EXOA 1GSXA 3UMDA 3GDIA 4HOIA 4KUKA 2OWHA 3LIFA 4LLOB 4DJ3A 4EESA 1TS6A 2EA9A 3D72A 3EEHA 2ZBBA 4NXGA 5DKLA 1DP6A 3RH8B 2BASA 2QWSA 3IS2B 2D01A 2Z6DA 4EETB 1S4RA 4B9OA 2L4RA 5HWWA 1LSXA 4E04A 3NOPC 4I38A 1T1BA 1F9IA 4WLAA 4HP9A 3H7WB 4HNBA 5TBMB 3FC7A 3OLOA 5AVEA 2WKRA 1T1CA 5HDDA 2PYPA 3RTYA 2J80A 3BY9A 1NWZA 4WF0A 2VV7A 1G28A 1T19A 4EERA 1LT0A 3LUQA 4HY8A 1DP9A 3UB6A 2PD8A 4LRZE 1XJ3A 1XJ6A 4I5SA 1F98A 2V1BA 2K7SA 4LRYC 4GS9A 4H6JB 5HZHA 3ICYA 4BBVA 2R78A 3UE6A 2PR6A 1LSWA 3H82A 3A0SA 1X0OA 1WA9A 5F5YA 5HDSA 2QKPA 2PYRA 3E4PA 1XFNA 3HJIA 3CAXA 4L9GA 4KQDA 4M4XA 1EW0A 3C2WA 3F1NA 4GW9A 4NXFA 3NHQA 2A24A 2QJ7A 1N9NA 3LYXA 3F1OA 1DRMA 2QJ5A 2HV1A 1D7EA 4DJ2A 4BBUA 2W0NA 3NOTC 1T1AA 4F3LB 4PKYA 3VOLA 1MZUA 1V9ZA 2PR5A 4YWZA 5J7EA 4HH2A 3PHYA 3UB7A 2B02A 1XJ4A 2OOLA 2WKPA 5DKKA 4PKYG 4XT2B 3IS2A 3UB9A 1OTBA 2WKQA 1OJGA 3UMEA 3LI9A 5A8BA 1S66L 2ZOIA 1OTEA 1Y28A 4HHDA 1GSWA 2CMNA 2V9AA 3K3DA 5J4EA 3ZQ5A 1S1YA 1XJ2A 3KX0X 5I5LA 2INWA 2I9VA 3PYPA 2L0WA 4HJ4A 1P97A 2PD7A 2VEAA 2VLGA 3LIAA 4LRXC 3BWLA 4NXEA 5IS1A 1OTDA 5F6AA 5DJTA 3UB8A 4HH3A 4L9FA 4GS9B 4K08A 4R38A 5G4ZA 2P7JA 2V0UA 4EQ1A 1XFQA 2JN7A 2ZOHA 1JNUA 5HWTA 3F1PA 3E4QA 5F69A 4KUOA 4BBTA 3H82B 1N9OA 3B33A 5EFWA 4HIAA 4I3AA 4MN5A 4GHIA 3T50A 3SW1A 2OWJA 3MQOA 3LIEA 3GECA 1UGUA 5IU1A 1TS7A 4JGOA 5HD5A 4R70A 2PDRA 1P0ZA 4GCZA 4WUJA 2M1CA 3F1OB 4JGPA 4I3JA 1S1ZA 1KOUA 2YKHA 3MJQA 1N9LA 3MQQA 2D02A 1V9YA 1UWPX 5G4YA 3EWKA 3LIDA 5AVFA 2QHKA
chains in the Genus database with same CATH superfamily
3OBFA 3A3IA 2X02A 4MN6A 3IXDA 4JGRA 1ZKJA 4G3WA 3MF0A 4OKPA 4PMAA 3EGXC 4OPZA 1MXOA 2EXBA 4E3LA 1CEFA 1SDNA 3NOUC 1ONHA 4OQGA 3LICA 3G6OA 5TBMA 3P98A 2W27A 2QZ6A 3BJNA 1PI5A 2XSSA 3BFFA 3ITAA 4U0XA 5GHYA 3QP8A 1YLZA 2ZM0A 3KO6A 3R7WB 3CPTA 3A0VA 5LBRA 5FL3A 3IH8A 4ETZA 3Q7VB 3W2ZA 3KYEA 2Y2PA 3ZNTA 4CLCD 3MFXA 3A0RA 1CF0A 4I39A 3PXPA 3VE3A 3BFEA 2A2LA 3EOIA 4JF6A 1YM1A 2BG1A 3H9WA 1S4SA 1NY0A 2ZQDA 3ULFA 3BY8A 2Y2IA 2JKRM 3E4OA 4EEUA 3CLOA 5EM0A 2ZC7A 3PBQA 1W8QA 3IF5A 2PHYA 2VV6A 2J8YA 3VP3A 1LL5A 4X68A 3F1NB 1VETB 5HSQA 1GSVA 4KZ5A 2WADA 1T18A 1U60A 2NUPC 4EEPA 4F3LA 3UN7A 2M7VA 4DE1A 4JBFA 4KUKA 2OWHA 5GLAA 2WK0A 4GD6A 4DJ3A 2EFUA 2W1TB 3EEHA 3B47A 2AVXA 4PM6A 4WELA 4Q0JA 5L10A 5FQIA 3PBTA 2G7UA 2QWSA 4NG2A 4Y5FA 1FCMA 2Z6DA 4EETB 3Q81A 1IYPA 5E2HA 2J9OA 2Z2LB 2WZXA 1K54C 2J9PA 1QMFA 3NOPC 1F9IA 1FR1A 5EVIB 2XD5A 2ACGA 2ZQCA 4HP9A 1K55C 4K0XA 3H7WB 1E25A 4QB8A 5E2EA 3OLOA 4LENA 4LV2A 2J80A 3BY9A 1NWZA 3R7WA 2HDSA 1G28A 2VV7A 5FAPA 1IOUA 3Q7VA 4Y17A 1LI0A 4EERA 1KVLA 2HGVA 5E43A 5FAOA 3UB6A 5TR7A 4LRZE 4UA6A 3KSIA 2Y2MA 2ZC3B 3HBRA 2J3WA 3ZCZA 3O87A 3DW0A 1G5UA 3MZEA 1M6KA 3RXXA 4ARZA 4FH2A 2R78A 3UE6A 5A90A 1EWZA 4FOFA 4RYEA 2Q9MA 1VEUA 1RGYA 3LR5A 3UNWA 2P08A 3SOIA 4EBPA 2HDUA 1H0MA 1OPXA 3QNBA 1KE4A 2EX8A 4MNRA 5FQMA 1MC0A 1EW0A 3F1NA 4Y2FA 3HLCA 3ZVWA 2VKSA 4X1MA 2QYBA 4NXFA 3T1RA 2QJ7A 3FV7A 1N9NA 1NRFA 5HW3A 3DBAA 1FR6A 4PM7A 3IWIA 2QJ5A 4LCMA 1D7EA 2J3TD 1T1AA 3LFVA 4PM8A 2OAQ1 1P9WA 3T4KA 1V9ZA 4F94A 4YWZA 3TSGA 5GLCA 5J7EA 3S4XA 3O88A 2H10A 5G18A 3T4LA 4BD1A 4X56A 4PAUA 3IQAA 2VGLM 3W4PA 4BENA 1VQQA 2M7UA 5DKKA 4XT2B 1FOFA 3LR3A 3BM6A 4JLFA 3CUEC 1FIKA 2GX5A 1GHIA 2RCXA 1WYBA 1WYCA 4N9KA 1MY8A 2XRNA 1TDLA 3N7WA 3UE1A 3LCEA 3A3EA 3CITA 3LY3A 2PAVP 4HHDA 3ZYTA 5BOHA 3M6BA 3IXBA 4C75A 4N9LA 5GLBA 2Y2JA 3KSHA 3OPRA 3KYQA 2UWXA 3G2YA 4BL3A 3EQVA 2I9VA 2L0WA 1TEMA 1P97A 4OP5A 3LIAA 4LRXC 5GHZA 3BEBA 1FQGA 4Y0OA 5CEDA 5L07A 2A3UA 4UAAA 5F6AA 4BQMA 3HUNA 1L2SA 5CTMA 5GL9A 5KSHA 2O9AA 3KSFA 3A3FA 3C5AA 5J8XA 4R38A 3SH7A 2WZZA 3Q1FA 5CTNA 4RVAA 5IT5A 3F1PA 2KOIA 1NRJA 4PHTA 5FQJA 3IXGA 2JKRI 3JPUA 3T4SA 2P9VB 2PU2A 5FI2A 4E3OA 4EBLA 3IHBA 1N9BA 2DMWA 5DF9A 1KE3A 3GQZA 1UGUA 1BLPA 5GLDA 5IU1A 3P01A 3VFFA 4JGOA 2ZD8A 4ID4A 1IYSA 3HLFA 2PDRA 1P0ZA 1RP5A 1IYOA 2ZMFA 3OPHA 3BW6A 2H0TA 3E98A 2YKHA 1Q2PA 2D02A 4OLDA 4E6WA 4G3VA 4OONA 4BMWA 1NXYA 3HUOA 3MFDA 3LIDA 2QHKA 1PZOA 2JKTM 2XA7M 3VSKA 5HDCA 3O3VA 4LCLA 4DE3A 4O7DA 3P7NA 4O01A 4BL2A 3QP4A 1ERMA 1PRQA 4KZ3A 4XT2A 3TJZC 3DTEA 1H8ZA 1ODVA 3LIBA 2XD1A 4HESA 3Q07A 2ZC5B 2KX6A 5HL1A 2V2FF 3N6IA 1PW8A 3IX3A 1SKFA 5DFYA 2XGNA 5HD3A 3UE3A 1GHMA 1K0KA 3NJAA 1K54A 4QPRA 1OTAA 3HLEA 2HJEA 1D1JA 1S0WA 1K55A 4DF6A 4S2LA 1CI9A 1W63M 4R3JA 2ZL1B 1LL9A 4IVIA 1J9MA 3VE4A 1K25A 2JE5A 5CGXA 4QY5A 2PT7A 4FH4A 5F68A 4E3NA 1DP8A 5J3WA 4HQAA 3HJKA 1ACFA 2YKFA 4H6JA 4ZRRA 3AGDA 2VX8A 3DWZA 1P9RA 1TD5A 4R3AA 4L9EA 1PWDA 2ZQ8A 1S67L 1I5QA 2VJWA 1MWTA 5DFXA 3LI8A 5AQ9A 3VV4A 1W8YA 2HJ9C 3IBRA 1ES5A 2H5SA 3FKWA 4BWIA 1LSVA 2L1MA 2WKEA 1L0EA 3PR6A 3P09A 1XA1A 2KDKA 3CWFA 2HF6A 3UMDA 4DDSA 4OOYA 2RL3A 3GDIA 5EUAA 4BD0A 4HOIA 3GR2A 4Q8IA 4KZBA 4DKIA 4B4XA 2Q0OA 4EESA 1TS6A 3HCYA 3D72A 1FCNA 2I72A 2VK3A 3L7HA 3MKEA 4NXGA 1NYYA 3SZTA 3RH8B 2WGIA 3T4QA 3K2NA 3NULA 1K38A 2D01A 5EVIC 3D3OA 1DJAA 3MXRA 5FAQA 3NECA 1ZHHB 4GKUA 4B9OA 1OMEA 5CX7A 3C4OA 2Y2NA 4KG6A 5FI6A 3T1SA 4GNUA 4I38A 3CUEA 4LGWA 3HREA 1HZOA 1XX2A 4HNBA 5CRFA 4KG5A 2XK1A 3UDFA 3WS0A 5F82A 3E2KA 3N4IA 3LEZA 4WF0A 1L0FA 1HLUP 1LT0A 4HY8A 1DP9A 5D3OA 2PD8A 3S7QA 1ONGA 3V50A 5KSCA 4P85A 2WGWA 3SS5A 2B18A 3OPPA 3UY6A 2ZQ7A 3WRZA 4N1HA 5HZHA 4P87A 4IUKA 1O7EA 3ICYA 1C3BA 4WEKA 2PR6A 3H82A 3A0SA 1X0OA 2ZMVA 3CHWP 1WA9A 5HDSA 2HPBA 3BQ8A 1DJCA 3E4PA 4HBTA 4MCWA 1CJFA 3CJMA 3V39A 4M4XA 4GN2A 2W3HA 1FSYA 3CG5A 2EX2A 4KQQA 1XKZA 3ZVTA 3LYXA 3F1OA 1BTLA 2Q9NA 5CECA 4DJ2A 4E3JA 2W0NA 3NOTC 4Y3IA 2EX6A 5JYPA 5KMWA 3S7PA 3RFBA 1K6SA 3DTIA 5KZHA 1NZOA 2PR5A 4X53A 1W5DA 3UDXA 1BLCA 3PHYA 2HP9A 1AXBA 2HP5A 2B02A 3CZDA 4QD4A 1N4OA 2IWDA 3PBNA 2W3DA 3B3XA 2OOLA 4X69A 1SCWA 3LO7A 4QHCA 5CHMA 4WMCA 3HLWA 2DNSA 2XR0A 3UB9A 4S2PA 2WKQA 3NI9A 1XXMA 3EGDC 1HVBA 1S66L 4QWOA 2JKTI 2W3EA 2V8CA 1W79A 3LY4A 3QP2A 3C4PA 3BECA 3C7VA 2ZOIA 2IWCA 2W3FA 1Y28A 2X71A 4R23A 2K2NA 4ZTKA 2CMNA 2Y59A 4DE0A 2V9AA 5J4EA 3WS1A 2IWBA 1SKOB 2IA2A 1K56A 2INWA 2V20A 1ES2A 4Z1WA 5I94A 1YAXA 1MKMA 5EVLA 2O99A 1KVMA 4ZJ1A 3M2KA 4GOGA 3MKFA 3UPOA 4MBKA 5DJTA 5DTSA 1G6AA 2XDMA 4HH3A 3HL9A 4GS9B 5G4ZA 2P7JA 4EQ1A 5TJJA 4EUVA 2JN7A 1JNUA 1MWSA 3E4QA 1ES4A 1FSWA 1QMEA 4RX2A 5EFWA 4FUWA 4I3AA 4BLMA 3TE8A 4YOFA 2E8JA 5U47A 5EE8A 1VETA 2BLSA 3VSLA 2OWJA 3SW1A 3MQOA 3QP5A 5CXWA 4R4SA 1WE4A 2LB9A 4HBUA 3WS4A 1STZA 1TS7A 1XPBA 4NEED 3IF6B 4GD8A 2PBYA 2XFTA 3CMZA 4GCZA 4X1LA 1JWVA 3ISGA 2OLVA 1S1ZA 4Z9QA 4BJPA 4WMCD 3PBSA 5FDSA 4EBNA 1L0DA 1N9LA 1PZPA 3MQQA 3TG9A 5DTTA 4E3MA 4MN7A 2W1TA 5F1GA 1UWPX 3SS3A 5G4YA 4X25A 4JXSA 3EWKA 3BRMA 3EEAA 4OQ0A 1TS0A 3MXQA 4GB7A 3VOZA 1K4FA 4IJGA 3VFHA 4HP4A 1LL8A 4HI4A 2ZM8A 2WKHA 1YLPA 4LFUA 1K4EA 4JF5A 4M3KA 5M1AA 4CPKA 5JYOA 1K56D 5EVIA 5F83A 2JCHA 4R6LA 1NYMA 2JHEA 1BYWA 5L8MA 3H7WA 4S2JA 3DAVA 4I3IA 4JXWA 2LB5A 2HDRA 2R9WA 3T1QB 4NETA 3DTKA 2XROA 5CHJA 2Y8HA 1D06A 3R4KA 4MBHA 3W4OA 2V8FA 1BLSA 3FG8A 4LPZA 1YPRA 2VV8A 5F1FA 3IX8A 2O0YA 2XEPA 3FPVA 3BYDA 1JVJA 1OJ5A 3NCKA 4MDZA 3SS4A 2BTFP 2Z6CA 2KLIA 4XUZA 4DE2A 2Y4AA 4K91A 5EVEA 5HWVA 2WGVA 2V0WA 4Y7PA 1UWNX 1YLTA 5FQQA 3K3CA 4IVKA 4CLCB 3NBLA 4LV0A 2ZQAA 4RQ9A 3DWKA 4JGQA 4WL9A 4Q0HA 3W4QA 5FASA 3G35A 4WN5A 4GHIB 1TS8A 4MLLA 2GJ3A 3S7OA 4GJ4A 5EM1A 1XGJA 2VGJA 3C8CA 3ITBA 1MWUA 3GRJA 5HL6A 2UV0E 3MR0A 4PM5A 2X01A 1EROA 1GSXA 1PW1A 2Y2QA 2W1RA 4OH0A 1IEMA 3TRCA 4R0QA 1XP4A 3V3RA 3M2JA 4N92A 2OAP1 3ZG8B 4LLOB 4S2KA 1J3WA 5EVID 2OV5A 4E3KA 5DKLA 1NZUA 2BASA 3T4TA 3JYIA 1ES3A 4MMNA 3T12B 3GSGA 4KQRA 4Y0TA 1NLYA 5HWWA 1LSXA 5M18A 4E04A 3V3SA 3UE0A 4WLAA 3BQAA 2CC1A 5TBMB 3FPWA 3FC7A 4ZJ2A 4UA9A 5AVEA 1T1CA 4ZBEA 5HDDA 1YLJA 3RTYA 4IUHA 5FATA 1DJBA 3UDIA 3NIAA 1ZTUA 3CPTB 1DY6A 1YQSA 3MXSA 1G6OA 2JKGA 2OLUA 3LUQA 3ZG0A 3S1YA 4OPRA 4UHUA 4WYYA 4B93A 1ERQA 1H3QA 2V1BA 5HX9A 3MBZA 2V1ZA 1XA7A 1I2SA 3BLMA 1VM1A 3GMWA 1Z6FA 1MKIA 4BBVA 1NLZA 2P74A 3LGOA 2H0YA 5HAIA 1LSWA 1SZVA 4L0LA 4A5RA 5F5YA 3E2LA 4Q0IA 3LR4A 2P9VA 1XFNA 4FTXA 1A0KA 1YLYA 5HAPA 4KQDA 3C2WA 2B95A 2ZC4B 2ZM2A 4GW9A 3NHQA 4O8GA 2HV1A 2XF3A 5MC7A 1PYYA 4F3LB 3HVFA 4PKYA 1JWPA 3WRTA 4D60A 1H8YA 4QJGA 2VZWA 1CEGA 4P0MA 4OVDA 4P6ZS 1PI4A 3UB7A 3U4LP 3T1XA 1XJ4A 3N8LA 3E0YA 2Y55A 2HZ5A 4XXRA 4OP8A 4H8RA 4ZDXA 4ETXA 1NJ4A 1OTBA 2EXAA 3FYZA 3UMEA 3LI9A 4Y15A 1W63Q 5CGWA 4KZ7A 4E3IA 2JKFA 3NY4A 1PWCA 4WZ4A 3UPPA 1PIOA 5L2FA 3MSHA 3T4OA 5EECA 4YFMA 1I2WA 3K3DA 4U0TA 3MZDA 1ZG6A 2W3GA 4ME4A 2Y91A 1ESUA 3ZHHA 3KX0X 5I5LA 2ZL1A 2Y2HA 3UO9A 3B42A 3S22A 3IWOA 1IELA 2XA7S 3PYPA 4UA7A 5TFQA 4LV3A 2EWVA 4HJ4A 2PD7A 2VEAA 2VLGA 1CI8A 3QHYA 3BWLA 3IHAA 3S7NA 4IEDA 3IWQA 3HLBA 4KZ8A 3MQ0A 1MBLA 3KYZA 3N8SA 1K6RA 2WAEA 3UB8A 3BLSA 5HPIA 4L9FA 5E2FA 4K08A 1GCEA 1YMSA 5HFOA 3G31A 4ARZB 1XFQA 1G68A 5HWTA 3WS2A 3ZFZA 4JXVA 5F69A 3ZG5A 2Y79A 5EOOA 4RX3A 1N9OA 4U3TA 1TVFA 3B33A 4IBXA 4K0WA 1VEUB 3LR0A 4OLGA 5CGSA 4S2IA 3IF6C 2GDNA 2E8IA 3T50A 1ESIA 3DTMA 5DF8A 4CQHA 5DVAA 1Y4OA 3JVVA 5HPFA 3BFDA 2R9XA 5IHVA 4UQIS 4CJNA 1KGGA 3QNCA 4WUJA 1ZC2A 2VA0A 4KZ9A 3ZGAB 2GZAA 3G30A 4JGPA 4RA7A 1KOUA 1PWGA 5AQBA 3MJQA 4O0PA 4AFIA 1V9YA 1BZAA 4JKTA 2G2WA 3WWXA 1ZG4A 5FQKA 5AVFA 1LLBA 3G32A 4S2OA 4FCFA 4EWFA 1YSQA 2GNXA 4UEYA 3G2ZA 4S2NC 4HJ3A 3OOVA 1FCOA 4DRTA 1H5XA 5CERA 3WS5A 1Y54A 3VP0A 1XGIA 3FWLA 4S2MA 1IKIA 1S6RA 4JXGA 1OT6A 2NUTC 2EWWA 4EQIA 4B4ZA 4DN0A 1YMXA 3HLGA 1OTIA 3MZFA 2HP6A 1F2KA 2FFYA 3GV9A 2ZJ9A 1PNEA 1L0GA 1EI5A 1BSGA 5KIZA 5FSRA 4HJ6A 4KQOA 4R3BA 4R1GA 2WKIA 4EUZA 4IHQA 2H28A 4WEJA 2ZMAA 5HAQA 4CLCC 5A92A 2FZ0A 1BUEA 5DJUA 4JPMA 4DMZA 2EX9A 2ZQ9A 3I7JA 1TF1A 2Y2LA 3NDGA 3PBRA 1SHVA 2V1AA 1YSPA 3QP6A 1Q2QA 4WZ5C 5L09A 5EV0A 3V67A 5A91A 3C30A 5M19A 3F1PB 1OT9A 3GVBA 3PAGA 3D9YA 3Q82A 1KE0A 3SH8A 1W7FA 5TGFA 1BULA 5K5BA 4EW7A 1K57C 4ZAMA 5DTKA 4PM9A 1VB6A 2A24B 3AGEA 4OOMA 1GHPA 3PBOA 1JWZA 2PRFA 2DCFA 4NXBA 4EXOA 3ZG7B 3GTCA 3BFCA 2J7VA 4DXCA 4OOLA 1YLWA 4X6TA 3G4PA 3LIFA 4KZ6A 2XQZA 1M40A 3CI6A 2EA9A 4LV1A 2ZBBA 2Y2GA 1DP6A 3W8KA 3A3DA 3VP2A 4GZBA 2QMIA 3IS2B 2FH5A 3KSGA 2QPNA 1S4RA 2L4RA 3EQUA 3OZHA 4ZJ3A 4R4RA 3TOIA 5DF7A 1F5MA 2WYXA 4HEFA 1T1BA 4OQIA 3G34A 1KGEA 2JC7A 4C6YA 4E6XA 3VMAA 3RJUA 4P6BA 1SKOA 2WKRA 4DDYA 1RCJA 1JTGA 2PYPA 4IBRA 1E3UA 5AQ7A 2OSUA 3D4FA 2PBDP 2WAFA 1JTDA 1T19A 1H8MA 2ZC6B 5AJGA 3V5MA 4EU0A 4QY6A 4FSFA 1MWRA 3AGFA 1HD8A 3UPNA 1XJ3A 1XJ6A 4GDNA 4I5SA 1F98A 3PAEA 1ALQA 4WBGA 2K7SA 4LRYC 4WM9A 1LHYA 1HTZA 4GS9A 4H6JB 2C5WB 1E4DA 5FEGA 1IFQA 4MEZA 1Z09A 1FILA 4B88A 2DRWA 2VGKA 2PU4A 3IXHA 3O5YA 5CEBA 3QP1A 2QKPA 2PYRA 4P6ZM 4QU3A 1SDEA 3HJIA 3CAXA 1AWIA 4L9GA 1GA9A 4OPQA 3N8RA 3L9KA 4GDBA 1KDWA 2Z2MB 2WUQA 4JF4A 3IF6A 1MPLA 3FKVA 3OCLA 2A24A 3PTEA 1DRMA 2ZLYA 3OC2A 2XFSA 1YKDA 4BBUA 1IKGA 5GHXA 3T4JA 1IYQA 3VOLA 1MZUA 2J3TC 2MJ6A 3OPLA 4KZAA 3VOYA 4HH2A 1CK3A 1O07A 1GA0A 3IT9A 5A93A 1LI9A 2WKPA 3OCNA 3NC8A 2C6WB 4X55A 4PKYG 3IS2A 4OPYA 4PPRA 1OJGA 3IH9A 2B5RA 3C7UA 2P04A 5A8BA 1YT4A 4EV4A 4KG2A 1E3UD 5C5KA 1CQAA 3IX4A 2FFFB 3O86A 2EFXA 3MS6A 5AQAA 1OTEA 3A3JA 1GSWA 5HARA 4OQHA 4C3QA 3BFGA 4S2NA 3IBJA 2XLNA 2Y2OA 1VHMA 3ZQ5A 1S1YA 1TDGA 1XJ2A 2G2UA 2VGLS 3VP1A 2O9CA 4II7A 3RXWA 3ZG9B 5EOEA 3LEQA 4NXEA 5IS1A 1OTDA 2Y2KA 4NKPA 5FA7A 1KGFA 2WGWB 4UQIM 4YINA 1PFLA 3SH9A 1BLHA 4ESPA 4CLCA 2V0UA 4YNRA 3NDEA 2ZOHA 3Q7ZA 3UB5P 3HUMA 5FEFA 4KUOA 4BBTA 1KDSA 4KZ4A 4Y0UA 4G3KA 3H82B 3VP4A 4GLQA 3C38A 1RGZA 4HIAA 5E2GA 4WZ5A 2HDQA 4MN5A 2A49A 3M6HA 5FDHA 2K31A 4GHIA 4Y13A 3ZNYA 1L3LA 1BT5A 3LIEA 3FZCA 3GECA 3HLDA 4N1XA 4NK3A 4XUXA 5HD5A 4R70A 2XH9A 4D2OA 1K57A 5FI7A 2M1CA 3MMHA 3F1OB 4FD8A 4MBFA 4CLCE 4I3JA 4KENB 4DXBA 3U2AA 3JVUA 3TW8A 3ZDJA 2O9BA 5FQ9A 2JBFA 5CHUA 5EPHA
chains in the Genus database with same CATH topology
5HDCA 1TS0A 3OBFA 3MXQA 4MN6A 3P7NA 4O01A 4IJGA 4JGRA 4G3WA 1LL8A 4HI4A 4HP4A 3MF0A 4XT2A 3TJZC 1YSQA 2GNXA 4UEYA 1ODVA 3LIBA 3EGXC 4HJ3A 3OOVA 3NOUC 4R6LA 2KX6A 2JHEA 1BYWA 5L8MA 3H7WA 3LICA 3G6OA 5TBMA 5DFYA 2W27A 4I3IA 5HD3A 2LB5A 3UE3A 3NJAA 3BJNA 1OT6A 2NUTC 2EWWA 4QPRA 2XSSA 1OTAA 2HJEA 4DN0A 2XROA 3KO6A 1OTIA 3R7WB 2Y8HA 3A0VA 5LBRA 5FL3A 1W63M 4ETZA 1D06A 3R4KA 3W2ZA 3VE4A 5KIZA 4CLCD 3MFXA 4HJ6A 4KQOA 3FG8A 3A0RA 4LPZA 2VV8A 4IHQA 2H28A 3VE3A 4I39A 3PXPA 4WEJA 2A2LA 3EOIA 2O0YA 3FPVA 2PT7A 3H9WA 4CLCC 1S4SA 2FZ0A 5F68A 1OJ5A 5DJUA 1DP8A 4MDZA 4DMZA 2Z6CA 2KLIA 5J3WA 4HQAA 3HJKA 2YKFA 3ULFA 3BY8A 4H6JA 5HWVA 2JKRM 3E4OA 2V0WA 4ZRRA 1TF1A 2VX8A 1UWNX 4EEUA 3PBRA 2V1AA 1P9RA 1YSPA 3CLOA 1TD5A 3K3CA 4CLCB 3V67A 4R3AA 4RQ9A 4L9EA 3PBQA 4JGQA 4WL9A 4Q0HA 1S67L 2PHYA 3C30A 2VV6A 3F1PB 1OT9A 4WN5A 2VJWA 5DFXA 5K5BA 4EW7A 4GHIB 1TS8A 3F1NB 2GJ3A 3LI8A 3S7OA 3VV4A 5HSQA 4GJ4A 2HJ9C 3IBRA 1VB6A 2A24B 3C8CA 1GSVA 4OOMA 4BWIA 1LSVA 3PBOA 1T18A 2L1MA 2NUPC 5HL6A 3MR0A 3PR6A 4EEPA 4F3LA 4NXBA 2KDKA 3CWFA 4EXOA 1GSXA 2HF6A 3UMDA 2W1RA 2M7VA 3GDIA 4OOLA 4HOIA 3TRCA 4KUKA 2OWHA 3LIFA 2OAP1 4LLOB 3CI6A 4DJ3A 4EESA 2W1TB 1TS6A 2EA9A 3HCYA 3D72A 3EEHA 2ZBBA 3B47A 4NXGA 5DKLA 1DP6A 3RH8B 3T4QA 3K2NA 2BASA 3T4TA 4WELA 4Q0JA 4MMNA 3PBTA 2G7UA 2QWSA 3IS2B 2FH5A 4Y5FA 2D01A 2Z6DA 3D3OA 3KSGA 4EETB 1S4RA 1ZHHB 4B9OA 1NLYA 2L4RA 3EQUA 5HWWA 5CX7A 1LSXA 4E04A 1F5MA 3NOPC 4I38A 1T1BA 1F9IA 3CUEA 4WLAA 3BQAA 4HP9A 3H7WB 4HNBA 5TBMB 3FPWA 3FC7A 3OLOA 5AVEA 2WKRA 1T1CA 5HDDA 2PYPA 3RTYA 2J80A 4IUHA 3BY9A 1NWZA 4WF0A 1ZTUA 3R7WA 2VV7A 1G28A 1T19A 1IOUA 1H8MA 5AJGA 4EU0A 1G6OA 4EERA 1LT0A 2HGVA 4FSFA 3LUQA 4HY8A 1DP9A 3UB6A 2PD8A 4LRZE 1XJ3A 3S7QA 1XJ6A 3KSIA 4I5SA 1F98A 4B93A 1H3QA 2B18A 2V1BA 2K7SA 2J3WA 4LRYC 4GS9A 4H6JB 5HZHA 4IUKA 1IFQA 4ARZA 3ICYA 4BBVA 1NLZA 2R78A 3UE6A 4WEKA 2PR6A 1LSWA 3H82A 3A0SA 4FOFA 1X0OA 2ZMVA 3LR5A 4L0LA 3O5YA 1WA9A 5F5YA 5HDSA 2P08A 4Q0IA 3LR4A 3BQ8A 2QKPA 2PYRA 4P6ZM 3E4PA 1XFNA 3HJIA 1OPXA 4MCWA 3CAXA 4L9GA 1MC0A 4KQDA 4M4XA 1EW0A 3C2WA 3F1NA 4Y2FA 2W3HA 2VKSA 4GW9A 2QYBA 4NXFA 3NHQA 3OCLA 2A24A 2QJ7A 1N9NA 3LYXA 3F1OA 3DBAA 4O8GA 1DRMA 2QJ5A 2HV1A 3OC2A 1D7EA 4DJ2A 1YKDA 2J3TD 4BBUA 5MC7A 2W0NA 3NOTC 4Y3IA 1T1AA 4F3LB 3LFVA 3S7PA 3RFBA 4PKYA 2OAQ1 3T4JA 1P9WA 3T4KA 3VOLA 1MZUA 1V9ZA 2J3TC 2MJ6A 2PR5A 4YWZA 5J7EA 4HH2A 3PHYA 2VZWA 4P6ZS 3UB7A 2B02A 1XJ4A 3T4LA 3PBNA 2W3DA 2OOLA 4PAUA 3E0YA 2WKPA 2VGLM 3OCNA 2M7UA 5DKKA 4PKYG 4XT2B 3IS2A 3LR3A 3UB9A 4ETXA 3CUEC 1OTBA 2GX5A 2WKQA 1OJGA 3UMEA 3LI9A 1W63Q 2P04A 5A8BA 3EGDC 1S66L 2JKTI 2W3EA 2XRNA 5C5KA 2ZOIA 1OTEA 1Y28A 2W3FA 3CITA 3T4OA 4HHDA 2K2NA 1GSWA 3IBJA 3ZYTA 2CMNA 2V9AA 3K3DA 5J4EA 1VHMA 3ZQ5A 2W3GA 4ME4A 1S1YA 1XJ2A 3KX0X 3KSHA 2IA2A 3KYQA 5I5LA 2VGLS 3EQVA 2O9CA 2INWA 3B42A 2I9VA 2XA7S 4II7A 4Z1WA 3PYPA 2L0WA 2EWVA 4HJ4A 1P97A 2PD7A 2VEAA 2VLGA 1YAXA 3LIAA 4LRXC 1MKMA 3BWLA 4NXEA 2O99A 3S7NA 5IS1A 3MQ0A 3KYZA 1OTDA 5F6AA 5DJTA 4NKPA 4UQIM 5KSHA 2O9AA 3UB8A 3KSFA 4HH3A 5HPIA 4L9FA 4GS9B 4K08A 4R38A 5G4ZA 4CLCA 2P7JA 2V0UA 4EQ1A 5TJJA 4EUVA 4YNRA 4ARZB 1XFQA 2JN7A 2ZOHA 1JNUA 5HWTA 5IT5A 3F1PA 3E4QA 5F69A 4KUOA 4BBTA 2KOIA 2Y79A 1NRJA 4G3KA 3H82B 4PHTA 4GLQA 1N9OA 3B33A 3C38A 5EFWA 3LR0A 2JKRI 4HIAA 4I3AA 4MN5A 3T4SA 2K31A 3TE8A 4YOFA 4GHIA 3T50A 2DMWA 3SW1A 2OWJA 3MQOA 3LIEA 5DF9A 4CQHA 3JVVA 2LB9A 3GECA 5HPFA 1UGUA 1STZA 5IU1A 1TS7A 4NEED 3P01A 4JGOA 4UQIS 5HD5A 4R70A 2PDRA 1P0ZA 4GCZA 4WUJA 2M1CA 2VA0A 3MMHA 3F1OB 2GZAA 4JGPA 2ZMFA 4CLCE 3BW6A 4I3JA 1S1ZA 1KOUA 4BJPA 3E98A 3PBSA 2YKHA 3MJQA 1N9LA 4O0PA 3MQQA 2D02A 4MN7A 3U2AA 2W1TA 1V9YA 4AFIA 3JVUA 3TW8A 1UWPX 2O9BA 5G4YA 4G3VA 4BMWA 3EWKA 3LIDA 5AVFA 2QHKA 2XA7M 2JKTM 3EEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDC A;  1TS0 A;  3MXQ A;  4MN6 A;  3P7N A;  4JGR A;  4HP4 A;  1LL8 A;  4HI4 A;  4XT2 A;  1ODV A;  3LIB A;  4HJ3 A;  3NOU C;  4R6L A;  2KX6 A;  2JHE A;  1BYW A;  3H7W A;  3LIC A;  3G6O A;  5TBM A;  2W27 A;  4I3I A;  5HD3 A;  3NJA A;  1OT6 A;  1OTA A;  1OTI A;  3A0V A;  1D06 A;  3VE4 A;  5KIZ A;  3MFX A;  4HJ6 A;  3FG8 A;  3A0R A;  4LPZ A;  2VV8 A;  2H28 A;  3VE3 A;  4I39 A;  3H9W A;  1S4S A;  5F68 A;  1OJ5 A;  5DJU A;  1DP8 A;  2Z6C A;  5J3W A;  4HQA A;  3HJK A;  2YKF A;  3ULF A;  3BY8 A;  4H6J A;  5HWV A;  3E4O A;  2V0W A;  1UWN X;  4EEU A;  2V1A A;  3CLO A;  3K3C A;  4R3A A;  4RQ9 A;  4L9E A;  4JGQ A;  4WL9 A;  1S67 L;  2PHY A;  2VV6 A;  3F1P B;  1OT9 A;  4WN5 A;  4EW7 A;  4GHI B;  1TS8 A;  3F1N B;  2GJ3 A;  3LI8 A;  5HSQ A;  3IBR A;  1VB6 A;  2A24 B;  3C8C A;  1GSV A;  1LSV A;  1T18 A;  2L1M A;  3MR0 A;  4EEP A;  4F3L A;  4NXB A;  2KDK A;  3CWF A;  4EXO A;  1GSX A;  3UMD A;  3GDI A;  4HOI A;  4KUK A;  2OWH A;  3LIF A;  4LLO B;  4DJ3 A;  4EES A;  1TS6 A;  2EA9 A;  3D72 A;  3EEH A;  2ZBB A;  4NXG A;  5DKL A;  1DP6 A;  3RH8 B;  2BAS A;  2QWS A;  3IS2 B;  2D01 A;  2Z6D A;  4EET B;  1S4R A;  4B9O A;  2L4R A;  5HWW A;  1LSX A;  4E04 A;  3NOP C;  4I38 A;  1T1B A;  1F9I A;  4WLA A;  4HP9 A;  3H7W B;  4HNB A;  5TBM B;  3FC7 A;  3OLO A;  5AVE A;  2WKR A;  1T1C A;  5HDD A;  2PYP A;  3RTY A;  2J80 A;  3BY9 A;  1NWZ A;  4WF0 A;  2VV7 A;  1G28 A;  1T19 A;  4EER A;  1LT0 A;  3LUQ A;  4HY8 A;  1DP9 A;  3UB6 A;  2PD8 A;  4LRZ E;  1XJ3 A;  1XJ6 A;  4I5S A;  1F98 A;  2V1B A;  2K7S A;  4LRY C;  4GS9 A;  4H6J B;  5HZH A;  3ICY A;  4BBV A;  2R78 A;  3UE6 A;  2PR6 A;  1LSW A;  3H82 A;  3A0S A;  1X0O A;  1WA9 A;  5F5Y A;  5HDS A;  2QKP A;  2PYR A;  3E4P A;  1XFN A;  3HJI A;  3CAX A;  4L9G A;  4KQD A;  4M4X A;  1EW0 A;  3C2W A;  3F1N A;  4GW9 A;  4NXF A;  3NHQ A;  2A24 A;  2QJ7 A;  1N9N A;  3LYX A;  3F1O A;  1DRM A;  2QJ5 A;  2HV1 A;  1D7E A;  4DJ2 A;  4BBU A;  2W0N A;  3NOT C;  1T1A A;  4F3L B;  4PKY A;  3VOL A;  1MZU A;  1V9Z A;  2PR5 A;  4YWZ A;  5J7E A;  4HH2 A;  3PHY A;  3UB7 A;  2B02 A;  1XJ4 A;  2OOL A;  2WKP A;  5DKK A;  4PKY G;  4XT2 B;  3IS2 A;  3UB9 A;  1OTB A;  2WKQ A;  1OJG A;  3UME A;  3LI9 A;  5A8B A;  1S66 L;  2ZOI A;  1OTE A;  1Y28 A;  4HHD A;  1GSW A;  2CMN A;  2V9A A;  3K3D A;  5J4E A;  3ZQ5 A;  1S1Y A;  1XJ2 A;  3KX0 X;  5I5L A;  2INW A;  2I9V A;  3PYP A;  2L0W A;  4HJ4 A;  1P97 A;  2PD7 A;  2VEA A;  2VLG A;  3LIA A;  4LRX C;  3BWL A;  4NXE A;  5IS1 A;  1OTD A;  5F6A A;  5DJT A;  3UB8 A;  4HH3 A;  4L9F A;  4GS9 B;  4K08 A;  4R38 A;  5G4Z A;  2P7J A;  2V0U A;  4EQ1 A;  1XFQ A;  2JN7 A;  2ZOH A;  1JNU A;  5HWT A;  3F1P A;  3E4Q A;  5F69 A;  4KUO A;  4BBT A;  3H82 B;  1N9O A;  3B33 A;  5EFW A;  4HIA A;  4I3A A;  4MN5 A;  4GHI A;  3T50 A;  3SW1 A;  2OWJ A;  3MQO A;  3LIE A;  3GEC A;  1UGU A;  5IU1 A;  1TS7 A;  4JGO A;  5HD5 A;  4R70 A;  2PDR A;  1P0Z A;  4GCZ A;  4WUJ A;  2M1C A;  3F1O B;  4JGP A;  4I3J A;  1S1Z A;  1KOU A;  2YKH A;  3MJQ A;  1N9L A;  3MQQ A;  2D02 A;  1V9Y A;  1UWP X;  5G4Y A;  3EWK A;  3LID A;  5AVF A;  2QHK A; 
#chains in the Genus database with same CATH topology
 3OBF A;  3A3I A;  2X02 A;  4MN6 A;  3IXD A;  4JGR A;  1ZKJ A;  4G3W A;  3MF0 A;  4OKP A;  4PMA A;  3EGX C;  4OPZ A;  1MXO A;  2EXB A;  4E3L A;  1CEF A;  1SDN A;  3NOU C;  1ONH A;  4OQG A;  3LIC A;  3G6O A;  5TBM A;  3P98 A;  2W27 A;  2QZ6 A;  3BJN A;  1PI5 A;  2XSS A;  3BFF A;  3ITA A;  4U0X A;  5GHY A;  3QP8 A;  1YLZ A;  2ZM0 A;  3KO6 A;  3R7W B;  3CPT A;  3A0V A;  5LBR A;  5FL3 A;  3IH8 A;  4ETZ A;  3Q7V B;  3W2Z A;  3KYE A;  2Y2P A;  3ZNT A;  4CLC D;  3MFX A;  3A0R A;  1CF0 A;  4I39 A;  3PXP A;  3VE3 A;  3BFE A;  2A2L A;  3EOI A;  4JF6 A;  1YM1 A;  2BG1 A;  3H9W A;  1S4S A;  1NY0 A;  2ZQD A;  3ULF A;  3BY8 A;  2Y2I A;  2JKR M;  3E4O A;  4EEU A;  3CLO A;  5EM0 A;  2ZC7 A;  3PBQ A;  1W8Q A;  3IF5 A;  2PHY A;  2VV6 A;  2J8Y A;  3VP3 A;  1LL5 A;  4X68 A;  3F1N B;  1VET B;  5HSQ A;  1GSV A;  4KZ5 A;  2WAD A;  1T18 A;  1U60 A;  2NUP C;  4EEP A;  4F3L A;  3UN7 A;  2M7V A;  4DE1 A;  4JBF A;  4KUK A;  2OWH A;  5GLA A;  2WK0 A;  4GD6 A;  4DJ3 A;  2EFU A;  2W1T B;  3EEH A;  3B47 A;  2AVX A;  4PM6 A;  4WEL A;  4Q0J A;  5L10 A;  5FQI A;  3PBT A;  2G7U A;  2QWS A;  4NG2 A;  4Y5F A;  1FCM A;  2Z6D A;  4EET B;  3Q81 A;  1IYP A;  5E2H A;  2J9O A;  2Z2L B;  2WZX A;  1K54 C;  2J9P A;  1QMF A;  3NOP C;  1F9I A;  1FR1 A;  5EVI B;  2XD5 A;  2ACG A;  2ZQC A;  4HP9 A;  1K55 C;  4K0X A;  3H7W B;  1E25 A;  4QB8 A;  5E2E A;  3OLO A;  4LEN A;  4LV2 A;  2J80 A;  3BY9 A;  1NWZ A;  3R7W A;  2HDS A;  1G28 A;  2VV7 A;  5FAP A;  1IOU A;  3Q7V A;  4Y17 A;  1LI0 A;  4EER A;  1KVL A;  2HGV A;  5E43 A;  5FAO A;  3UB6 A;  5TR7 A;  4LRZ E;  4UA6 A;  3KSI A;  2Y2M A;  2ZC3 B;  3HBR A;  2J3W A;  3ZCZ A;  3O87 A;  3DW0 A;  1G5U A;  3MZE A;  1M6K A;  3RXX A;  4ARZ A;  4FH2 A;  2R78 A;  3UE6 A;  5A90 A;  1EWZ A;  4FOF A;  4RYE A;  2Q9M A;  1VEU A;  1RGY A;  3LR5 A;  3UNW A;  2P08 A;  3SOI A;  4EBP A;  2HDU A;  1H0M A;  1OPX A;  3QNB A;  1KE4 A;  2EX8 A;  4MNR A;  5FQM A;  1MC0 A;  1EW0 A;  3F1N A;  4Y2F A;  3HLC A;  3ZVW A;  2VKS A;  4X1M A;  2QYB A;  4NXF A;  3T1R A;  2QJ7 A;  3FV7 A;  1N9N A;  1NRF A;  5HW3 A;  3DBA A;  1FR6 A;  4PM7 A;  3IWI A;  2QJ5 A;  4LCM A;  1D7E A;  2J3T D;  1T1A A;  3LFV A;  4PM8 A;  2OAQ 1;  1P9W A;  3T4K A;  1V9Z A;  4F94 A;  4YWZ A;  3TSG A;  5GLC A;  5J7E A;  3S4X A;  3O88 A;  2H10 A;  5G18 A;  3T4L A;  4BD1 A;  4X56 A;  4PAU A;  3IQA A;  2VGL M;  3W4P A;  4BEN A;  1VQQ A;  2M7U A;  5DKK A;  4XT2 B;  1FOF A;  3LR3 A;  3BM6 A;  4JLF A;  3CUE C;  1FIK A;  2GX5 A;  1GHI A;  2RCX A;  1WYB A;  1WYC A;  4N9K A;  1MY8 A;  2XRN A;  1TDL A;  3N7W A;  3UE1 A;  3LCE A;  3A3E A;  3CIT A;  3LY3 A;  2PAV P;  4HHD A;  3ZYT A;  5BOH A;  3M6B A;  3IXB A;  4C75 A;  4N9L A;  5GLB A;  2Y2J A;  3KSH A;  3OPR A;  3KYQ A;  2UWX A;  3G2Y A;  4BL3 A;  3EQV A;  2I9V A;  2L0W A;  1TEM A;  1P97 A;  4OP5 A;  3LIA A;  4LRX C;  5GHZ A;  3BEB A;  1FQG A;  4Y0O A;  5CED A;  5L07 A;  2A3U A;  4UAA A;  5F6A A;  4BQM A;  3HUN A;  1L2S A;  5CTM A;  5GL9 A;  5KSH A;  2O9A A;  3KSF A;  3A3F A;  3C5A A;  5J8X A;  4R38 A;  3SH7 A;  2WZZ A;  3Q1F A;  5CTN A;  4RVA A;  5IT5 A;  3F1P A;  2KOI A;  1NRJ A;  4PHT A;  5FQJ A;  3IXG A;  2JKR I;  3JPU A;  3T4S A;  2P9V B;  2PU2 A;  5FI2 A;  4E3O A;  4EBL A;  3IHB A;  1N9B A;  2DMW A;  5DF9 A;  1KE3 A;  3GQZ A;  1UGU A;  1BLP A;  5GLD A;  5IU1 A;  3P01 A;  3VFF A;  4JGO A;  2ZD8 A;  4ID4 A;  1IYS A;  3HLF A;  2PDR A;  1P0Z A;  1RP5 A;  1IYO A;  2ZMF A;  3OPH A;  3BW6 A;  2H0T A;  3E98 A;  2YKH A;  1Q2P A;  2D02 A;  4OLD A;  4E6W A;  4G3V A;  4OON A;  4BMW A;  1NXY A;  3HUO A;  3MFD A;  3LID A;  2QHK A;  1PZO A;  2JKT M;  2XA7 M;  3VSK A;  5HDC A;  3O3V A;  4LCL A;  4DE3 A;  4O7D A;  3P7N A;  4O01 A;  4BL2 A;  3QP4 A;  1ERM A;  1PRQ A;  4KZ3 A;  4XT2 A;  3TJZ C;  3DTE A;  1H8Z A;  1ODV A;  3LIB A;  2XD1 A;  4HES A;  3Q07 A;  2ZC5 B;  2KX6 A;  5HL1 A;  2V2F F;  3N6I A;  1PW8 A;  3IX3 A;  1SKF A;  5DFY A;  2XGN A;  5HD3 A;  3UE3 A;  1GHM A;  1K0K A;  3NJA A;  1K54 A;  4QPR A;  1OTA A;  3HLE A;  2HJE A;  1D1J A;  1S0W A;  1K55 A;  4DF6 A;  4S2L A;  1CI9 A;  1W63 M;  4R3J A;  2ZL1 B;  1LL9 A;  4IVI A;  1J9M A;  3VE4 A;  1K25 A;  2JE5 A;  5CGX A;  4QY5 A;  2PT7 A;  4FH4 A;  5F68 A;  4E3N A;  1DP8 A;  5J3W A;  4HQA A;  3HJK A;  1ACF A;  2YKF A;  4H6J A;  4ZRR A;  3AGD A;  2VX8 A;  3DWZ A;  1P9R A;  1TD5 A;  4R3A A;  4L9E A;  1PWD A;  2ZQ8 A;  1S67 L;  1I5Q A;  2VJW A;  1MWT A;  5DFX A;  3LI8 A;  5AQ9 A;  3VV4 A;  1W8Y A;  2HJ9 C;  3IBR A;  1ES5 A;  2H5S A;  3FKW A;  4BWI A;  1LSV A;  2L1M A;  2WKE A;  1L0E A;  3PR6 A;  3P09 A;  1XA1 A;  2KDK A;  3CWF A;  2HF6 A;  3UMD A;  4DDS A;  4OOY A;  2RL3 A;  3GDI A;  5EUA A;  4BD0 A;  4HOI A;  3GR2 A;  4Q8I A;  4KZB A;  4DKI A;  4B4X A;  2Q0O A;  4EES A;  1TS6 A;  3HCY A;  3D72 A;  1FCN A;  2I72 A;  2VK3 A;  3L7H A;  3MKE A;  4NXG A;  1NYY A;  3SZT A;  3RH8 B;  2WGI A;  3T4Q A;  3K2N A;  3NUL A;  1K38 A;  2D01 A;  5EVI C;  3D3O A;  1DJA A;  3MXR A;  5FAQ A;  3NEC A;  1ZHH B;  4GKU A;  4B9O A;  1OME A;  5CX7 A;  3C4O A;  2Y2N A;  4KG6 A;  5FI6 A;  3T1S A;  4GNU A;  4I38 A;  3CUE A;  4LGW A;  3HRE A;  1HZO A;  1XX2 A;  4HNB A;  5CRF A;  4KG5 A;  2XK1 A;  3UDF A;  3WS0 A;  5F82 A;  3E2K A;  3N4I A;  3LEZ A;  4WF0 A;  1L0F A;  1HLU P;  1LT0 A;  4HY8 A;  1DP9 A;  5D3O A;  2PD8 A;  3S7Q A;  1ONG A;  3V50 A;  5KSC A;  4P85 A;  2WGW A;  3SS5 A;  2B18 A;  3OPP A;  3UY6 A;  2ZQ7 A;  3WRZ A;  4N1H A;  5HZH A;  4P87 A;  4IUK A;  1O7E A;  3ICY A;  1C3B A;  4WEK A;  2PR6 A;  3H82 A;  3A0S A;  1X0O A;  2ZMV A;  3CHW P;  1WA9 A;  5HDS A;  2HPB A;  3BQ8 A;  1DJC A;  3E4P A;  4HBT A;  4MCW A;  1CJF A;  3CJM A;  3V39 A;  4M4X A;  4GN2 A;  2W3H A;  1FSY A;  3CG5 A;  2EX2 A;  4KQQ A;  1XKZ A;  3ZVT A;  3LYX A;  3F1O A;  1BTL A;  2Q9N A;  5CEC A;  4DJ2 A;  4E3J A;  2W0N A;  3NOT C;  4Y3I A;  2EX6 A;  5JYP A;  5KMW A;  3S7P A;  3RFB A;  1K6S A;  3DTI A;  5KZH A;  1NZO A;  2PR5 A;  4X53 A;  1W5D A;  3UDX A;  1BLC A;  3PHY A;  2HP9 A;  1AXB A;  2HP5 A;  2B02 A;  3CZD A;  4QD4 A;  1N4O A;  2IWD A;  3PBN A;  2W3D A;  3B3X A;  2OOL A;  4X69 A;  1SCW A;  3LO7 A;  4QHC A;  5CHM A;  4WMC A;  3HLW A;  2DNS A;  2XR0 A;  3UB9 A;  4S2P A;  2WKQ A;  3NI9 A;  1XXM A;  3EGD C;  1HVB A;  1S66 L;  4QWO A;  2JKT I;  2W3E A;  2V8C A;  1W79 A;  3LY4 A;  3QP2 A;  3C4P A;  3BEC A;  3C7V A;  2ZOI A;  2IWC A;  2W3F A;  1Y28 A;  2X71 A;  4R23 A;  2K2N A;  4ZTK A;  2CMN A;  2Y59 A;  4DE0 A;  2V9A A;  5J4E A;  3WS1 A;  2IWB A;  1SKO B;  2IA2 A;  1K56 A;  2INW A;  2V20 A;  1ES2 A;  4Z1W A;  5I94 A;  1YAX A;  1MKM A;  5EVL A;  2O99 A;  1KVM A;  4ZJ1 A;  3M2K A;  4GOG A;  3MKF A;  3UPO A;  4MBK A;  5DJT A;  5DTS A;  1G6A A;  2XDM A;  4HH3 A;  3HL9 A;  4GS9 B;  5G4Z A;  2P7J A;  4EQ1 A;  5TJJ A;  4EUV A;  2JN7 A;  1JNU A;  1MWS A;  3E4Q A;  1ES4 A;  1FSW A;  1QME A;  4RX2 A;  5EFW A;  4FUW A;  4I3A A;  4BLM A;  3TE8 A;  4YOF A;  2E8J A;  5U47 A;  5EE8 A;  1VET A;  2BLS A;  3VSL A;  2OWJ A;  3SW1 A;  3MQO A;  3QP5 A;  5CXW A;  4R4S A;  1WE4 A;  2LB9 A;  4HBU A;  3WS4 A;  1STZ A;  1TS7 A;  1XPB A;  4NEE D;  3IF6 B;  4GD8 A;  2PBY A;  2XFT A;  3CMZ A;  4GCZ A;  4X1L A;  1JWV A;  3ISG A;  2OLV A;  1S1Z A;  4Z9Q A;  4BJP A;  4WMC D;  3PBS A;  5FDS A;  4EBN A;  1L0D A;  1N9L A;  1PZP A;  3MQQ A;  3TG9 A;  5DTT A;  4E3M A;  4MN7 A;  2W1T A;  5F1G A;  1UWP X;  3SS3 A;  5G4Y A;  4X25 A;  4JXS A;  3EWK A;  3BRM A;  3EEA A;  4OQ0 A;  1TS0 A;  3MXQ A;  4GB7 A;  3VOZ A;  1K4F A;  4IJG A;  3VFH A;  4HP4 A;  1LL8 A;  4HI4 A;  2ZM8 A;  2WKH A;  1YLP A;  4LFU A;  1K4E A;  4JF5 A;  4M3K A;  5M1A A;  4CPK A;  5JYO A;  1K56 D;  5EVI A;  5F83 A;  2JCH A;  4R6L A;  1NYM A;  2JHE A;  1BYW A;  5L8M A;  3H7W A;  4S2J A;  3DAV A;  4I3I A;  4JXW A;  2LB5 A;  2HDR A;  2R9W A;  3T1Q B;  4NET A;  3DTK A;  2XRO A;  5CHJ A;  2Y8H A;  1D06 A;  3R4K A;  4MBH A;  3W4O A;  2V8F A;  1BLS A;  3FG8 A;  4LPZ A;  1YPR A;  2VV8 A;  5F1F A;  3IX8 A;  2O0Y A;  2XEP A;  3FPV A;  3BYD A;  1JVJ A;  1OJ5 A;  3NCK A;  4MDZ A;  3SS4 A;  2BTF P;  2Z6C A;  2KLI A;  4XUZ A;  4DE2 A;  2Y4A A;  4K91 A;  5EVE A;  5HWV A;  2WGV A;  2V0W A;  4Y7P A;  1UWN X;  1YLT A;  5FQQ A;  3K3C A;  4IVK A;  4CLC B;  3NBL A;  4LV0 A;  2ZQA A;  4RQ9 A;  3DWK A;  4JGQ A;  4WL9 A;  4Q0H A;  3W4Q A;  5FAS A;  3G35 A;  4WN5 A;  4GHI B;  1TS8 A;  4MLL A;  2GJ3 A;  3S7O A;  4GJ4 A;  5EM1 A;  1XGJ A;  2VGJ A;  3C8C A;  3ITB A;  1MWU A;  3GRJ A;  5HL6 A;  2UV0 E;  3MR0 A;  4PM5 A;  2X01 A;  1ERO A;  1GSX A;  1PW1 A;  2Y2Q A;  2W1R A;  4OH0 A;  1IEM A;  3TRC A;  4R0Q A;  1XP4 A;  3V3R A;  3M2J A;  4N92 A;  2OAP 1;  3ZG8 B;  4LLO B;  4S2K A;  1J3W A;  5EVI D;  2OV5 A;  4E3K A;  5DKL A;  1NZU A;  2BAS A;  3T4T A;  3JYI A;  1ES3 A;  4MMN A;  3T12 B;  3GSG A;  4KQR A;  4Y0T A;  1NLY A;  5HWW A;  1LSX A;  5M18 A;  4E04 A;  3V3S A;  3UE0 A;  4WLA A;  3BQA A;  2CC1 A;  5TBM B;  3FPW A;  3FC7 A;  4ZJ2 A;  4UA9 A;  5AVE A;  1T1C A;  4ZBE A;  5HDD A;  1YLJ A;  3RTY A;  4IUH A;  5FAT A;  1DJB A;  3UDI A;  3NIA A;  1ZTU A;  3CPT B;  1DY6 A;  1YQS A;  3MXS A;  1G6O A;  2JKG A;  2OLU A;  3LUQ A;  3ZG0 A;  3S1Y A;  4OPR A;  4UHU A;  4WYY A;  4B93 A;  1ERQ A;  1H3Q A;  2V1B A;  5HX9 A;  3MBZ A;  2V1Z A;  1XA7 A;  1I2S A;  3BLM A;  1VM1 A;  3GMW A;  1Z6F A;  1MKI A;  4BBV A;  1NLZ A;  2P74 A;  3LGO A;  2H0Y A;  5HAI A;  1LSW A;  1SZV A;  4L0L A;  4A5R A;  5F5Y A;  3E2L A;  4Q0I A;  3LR4 A;  2P9V A;  1XFN A;  4FTX A;  1A0K A;  1YLY A;  5HAP A;  4KQD A;  3C2W A;  2B95 A;  2ZC4 B;  2ZM2 A;  4GW9 A;  3NHQ A;  4O8G A;  2HV1 A;  2XF3 A;  5MC7 A;  1PYY A;  4F3L B;  3HVF A;  4PKY A;  1JWP A;  3WRT A;  4D60 A;  1H8Y A;  4QJG A;  2VZW A;  1CEG A;  4P0M A;  4OVD A;  4P6Z S;  1PI4 A;  3UB7 A;  3U4L P;  3T1X A;  1XJ4 A;  3N8L A;  3E0Y A;  2Y55 A;  2HZ5 A;  4XXR A;  4OP8 A;  4H8R A;  4ZDX A;  4ETX A;  1NJ4 A;  1OTB A;  2EXA A;  3FYZ A;  3UME A;  3LI9 A;  4Y15 A;  1W63 Q;  5CGW A;  4KZ7 A;  4E3I A;  2JKF A;  3NY4 A;  1PWC A;  4WZ4 A;  3UPP A;  1PIO A;  5L2F A;  3MSH A;  3T4O A;  5EEC A;  4YFM A;  1I2W A;  3K3D A;  4U0T A;  3MZD A;  1ZG6 A;  2W3G A;  4ME4 A;  2Y91 A;  1ESU A;  3ZHH A;  3KX0 X;  5I5L A;  2ZL1 A;  2Y2H A;  3UO9 A;  3B42 A;  3S22 A;  3IWO A;  1IEL A;  2XA7 S;  3PYP A;  4UA7 A;  5TFQ A;  4LV3 A;  2EWV A;  4HJ4 A;  2PD7 A;  2VEA A;  2VLG A;  1CI8 A;  3QHY A;  3BWL A;  3IHA A;  3S7N A;  4IED A;  3IWQ A;  3HLB A;  4KZ8 A;  3MQ0 A;  1MBL A;  3KYZ A;  3N8S A;  1K6R A;  2WAE A;  3UB8 A;  3BLS A;  5HPI A;  4L9F A;  5E2F A;  4K08 A;  1GCE A;  1YMS A;  5HFO A;  3G31 A;  4ARZ B;  1XFQ A;  1G68 A;  5HWT A;  3WS2 A;  3ZFZ A;  4JXV A;  5F69 A;  3ZG5 A;  2Y79 A;  5EOO A;  4RX3 A;  1N9O A;  4U3T A;  1TVF A;  3B33 A;  4IBX A;  4K0W A;  1VEU B;  3LR0 A;  4OLG A;  5CGS A;  4S2I A;  3IF6 C;  2GDN A;  2E8I A;  3T50 A;  1ESI A;  3DTM A;  5DF8 A;  4CQH A;  5DVA A;  1Y4O A;  3JVV A;  5HPF A;  3BFD A;  2R9X A;  5IHV A;  4UQI S;  4CJN A;  1KGG A;  3QNC A;  4WUJ A;  1ZC2 A;  2VA0 A;  4KZ9 A;  3ZGA B;  2GZA A;  3G30 A;  4JGP A;  4RA7 A;  1KOU A;  1PWG A;  5AQB A;  3MJQ A;  4O0P A;  4AFI A;  1V9Y A;  1BZA A;  4JKT A;  2G2W A;  3WWX A;  1ZG4 A;  5FQK A;  5AVF A;  1LLB A;  3G32 A;  4S2O A;  4FCF A;  4EWF A;  1YSQ A;  2GNX A;  4UEY A;  3G2Z A;  4S2N C;  4HJ3 A;  3OOV A;  1FCO A;  4DRT A;  1H5X A;  5CER A;  3WS5 A;  1Y54 A;  3VP0 A;  1XGI A;  3FWL A;  4S2M A;  1IKI A;  1S6R A;  4JXG A;  1OT6 A;  2NUT C;  2EWW A;  4EQI A;  4B4Z A;  4DN0 A;  1YMX A;  3HLG A;  1OTI A;  3MZF A;  2HP6 A;  1F2K A;  2FFY A;  3GV9 A;  2ZJ9 A;  1PNE A;  1L0G A;  1EI5 A;  1BSG A;  5KIZ A;  5FSR A;  4HJ6 A;  4KQO A;  4R3B A;  4R1G A;  2WKI A;  4EUZ A;  4IHQ A;  2H28 A;  4WEJ A;  2ZMA A;  5HAQ A;  4CLC C;  5A92 A;  2FZ0 A;  1BUE A;  5DJU A;  4JPM A;  4DMZ A;  2EX9 A;  2ZQ9 A;  3I7J A;  1TF1 A;  2Y2L A;  3NDG A;  3PBR A;  1SHV A;  2V1A A;  1YSP A;  3QP6 A;  1Q2Q A;  4WZ5 C;  5L09 A;  5EV0 A;  3V67 A;  5A91 A;  3C30 A;  5M19 A;  3F1P B;  1OT9 A;  3GVB A;  3PAG A;  3D9Y A;  3Q82 A;  1KE0 A;  3SH8 A;  1W7F A;  5TGF A;  1BUL A;  5K5B A;  4EW7 A;  1K57 C;  4ZAM A;  5DTK A;  4PM9 A;  1VB6 A;  2A24 B;  3AGE A;  4OOM A;  1GHP A;  3PBO A;  1JWZ A;  2PRF A;  2DCF A;  4NXB A;  4EXO A;  3ZG7 B;  3GTC A;  3BFC A;  2J7V A;  4DXC A;  4OOL A;  1YLW A;  4X6T A;  3G4P A;  3LIF A;  4KZ6 A;  2XQZ A;  1M40 A;  3CI6 A;  2EA9 A;  4LV1 A;  2ZBB A;  2Y2G A;  1DP6 A;  3W8K A;  3A3D A;  3VP2 A;  4GZB A;  2QMI A;  3IS2 B;  2FH5 A;  3KSG A;  2QPN A;  1S4R A;  2L4R A;  3EQU A;  3OZH A;  4ZJ3 A;  4R4R A;  3TOI A;  5DF7 A;  1F5M A;  2WYX A;  4HEF A;  1T1B A;  4OQI A;  3G34 A;  1KGE A;  2JC7 A;  4C6Y A;  4E6X A;  3VMA A;  3RJU A;  4P6B A;  1SKO A;  2WKR A;  4DDY A;  1RCJ A;  1JTG A;  2PYP A;  4IBR A;  1E3U A;  5AQ7 A;  2OSU A;  3D4F A;  2PBD P;  2WAF A;  1JTD A;  1T19 A;  1H8M A;  2ZC6 B;  5AJG A;  3V5M A;  4EU0 A;  4QY6 A;  4FSF A;  1MWR A;  3AGF A;  1HD8 A;  3UPN A;  1XJ3 A;  1XJ6 A;  4GDN A;  4I5S A;  1F98 A;  3PAE A;  1ALQ A;  4WBG A;  2K7S A;  4LRY C;  4WM9 A;  1LHY A;  1HTZ A;  4GS9 A;  4H6J B;  2C5W B;  1E4D A;  5FEG A;  1IFQ A;  4MEZ A;  1Z09 A;  1FIL A;  4B88 A;  2DRW A;  2VGK A;  2PU4 A;  3IXH A;  3O5Y A;  5CEB A;  3QP1 A;  2QKP A;  2PYR A;  4P6Z M;  4QU3 A;  1SDE A;  3HJI A;  3CAX A;  1AWI A;  4L9G A;  1GA9 A;  4OPQ A;  3N8R A;  3L9K A;  4GDB A;  1KDW A;  2Z2M B;  2WUQ A;  4JF4 A;  3IF6 A;  1MPL A;  3FKV A;  3OCL A;  2A24 A;  3PTE A;  1DRM A;  2ZLY A;  3OC2 A;  2XFS A;  1YKD A;  4BBU A;  1IKG A;  5GHX A;  3T4J A;  1IYQ A;  3VOL A;  1MZU A;  2J3T C;  2MJ6 A;  3OPL A;  4KZA A;  3VOY A;  4HH2 A;  1CK3 A;  1O07 A;  1GA0 A;  3IT9 A;  5A93 A;  1LI9 A;  2WKP A;  3OCN A;  3NC8 A;  2C6W B;  4X55 A;  4PKY G;  3IS2 A;  4OPY A;  4PPR A;  1OJG A;  3IH9 A;  2B5R A;  3C7U A;  2P04 A;  5A8B A;  1YT4 A;  4EV4 A;  4KG2 A;  1E3U D;  5C5K A;  1CQA A;  3IX4 A;  2FFF B;  3O86 A;  2EFX A;  3MS6 A;  5AQA A;  1OTE A;  3A3J A;  1GSW A;  5HAR A;  4OQH A;  4C3Q A;  3BFG A;  4S2N A;  3IBJ A;  2XLN A;  2Y2O A;  1VHM A;  3ZQ5 A;  1S1Y A;  1TDG A;  1XJ2 A;  2G2U A;  2VGL S;  3VP1 A;  2O9C A;  4II7 A;  3RXW A;  3ZG9 B;  5EOE A;  3LEQ A;  4NXE A;  5IS1 A;  1OTD A;  2Y2K A;  4NKP A;  5FA7 A;  1KGF A;  2WGW B;  4UQI M;  4YIN A;  1PFL A;  3SH9 A;  1BLH A;  4ESP A;  4CLC A;  2V0U A;  4YNR A;  3NDE A;  2ZOH A;  3Q7Z A;  3UB5 P;  3HUM A;  5FEF A;  4KUO A;  4BBT A;  1KDS A;  4KZ4 A;  4Y0U A;  4G3K A;  3H82 B;  3VP4 A;  4GLQ A;  3C38 A;  1RGZ A;  4HIA A;  5E2G A;  4WZ5 A;  2HDQ A;  4MN5 A;  2A49 A;  3M6H A;  5FDH A;  2K31 A;  4GHI A;  4Y13 A;  3ZNY A;  1L3L A;  1BT5 A;  3LIE A;  3FZC A;  3GEC A;  3HLD A;  4N1X A;  4NK3 A;  4XUX A;  5HD5 A;  4R70 A;  2XH9 A;  4D2O A;  1K57 A;  5FI7 A;  2M1C A;  3MMH A;  3F1O B;  4FD8 A;  4MBF A;  4CLC E;  4I3J A;  4KEN B;  4DXB A;  3U2A A;  3JVU A;  3TW8 A;  3ZDJ A;  2O9B A;  5FQ9 A;  2JBF A;  5CHU A;  5EPH A; 
#chains in the Genus database with same CATH homology
 5HDC A;  1TS0 A;  3OBF A;  3MXQ A;  4MN6 A;  3P7N A;  4O01 A;  4IJG A;  4JGR A;  4G3W A;  1LL8 A;  4HI4 A;  4HP4 A;  3MF0 A;  4XT2 A;  3TJZ C;  1YSQ A;  2GNX A;  4UEY A;  1ODV A;  3LIB A;  3EGX C;  4HJ3 A;  3OOV A;  3NOU C;  4R6L A;  2KX6 A;  2JHE A;  1BYW A;  5L8M A;  3H7W A;  3LIC A;  3G6O A;  5TBM A;  5DFY A;  2W27 A;  4I3I A;  5HD3 A;  2LB5 A;  3UE3 A;  3NJA A;  3BJN A;  1OT6 A;  2NUT C;  2EWW A;  4QPR A;  2XSS A;  1OTA A;  2HJE A;  4DN0 A;  2XRO A;  3KO6 A;  1OTI A;  3R7W B;  2Y8H A;  3A0V A;  5LBR A;  5FL3 A;  1W63 M;  4ETZ A;  1D06 A;  3R4K A;  3W2Z A;  3VE4 A;  5KIZ A;  4CLC D;  3MFX A;  4HJ6 A;  4KQO A;  3FG8 A;  3A0R A;  4LPZ A;  2VV8 A;  4IHQ A;  2H28 A;  3VE3 A;  4I39 A;  3PXP A;  4WEJ A;  2A2L A;  3EOI A;  2O0Y A;  3FPV A;  2PT7 A;  3H9W A;  4CLC C;  1S4S A;  2FZ0 A;  5F68 A;  1OJ5 A;  5DJU A;  1DP8 A;  4MDZ A;  4DMZ A;  2Z6C A;  2KLI A;  5J3W A;  4HQA A;  3HJK A;  2YKF A;  3ULF A;  3BY8 A;  4H6J A;  5HWV A;  2JKR M;  3E4O A;  2V0W A;  4ZRR A;  1TF1 A;  2VX8 A;  1UWN X;  4EEU A;  3PBR A;  2V1A A;  1P9R A;  1YSP A;  3CLO A;  1TD5 A;  3K3C A;  4CLC B;  3V67 A;  4R3A A;  4RQ9 A;  4L9E A;  3PBQ A;  4JGQ A;  4WL9 A;  4Q0H A;  1S67 L;  2PHY A;  3C30 A;  2VV6 A;  3F1P B;  1OT9 A;  4WN5 A;  2VJW A;  5DFX A;  5K5B A;  4EW7 A;  4GHI B;  1TS8 A;  3F1N B;  2GJ3 A;  3LI8 A;  3S7O A;  3VV4 A;  5HSQ A;  4GJ4 A;  2HJ9 C;  3IBR A;  1VB6 A;  2A24 B;  3C8C A;  1GSV A;  4OOM A;  4BWI A;  1LSV A;  3PBO A;  1T18 A;  2L1M A;  2NUP C;  5HL6 A;  3MR0 A;  3PR6 A;  4EEP A;  4F3L A;  4NXB A;  2KDK A;  3CWF A;  4EXO A;  1GSX A;  2HF6 A;  3UMD A;  2W1R A;  2M7V A;  3GDI A;  4OOL A;  4HOI A;  3TRC A;  4KUK A;  2OWH A;  3LIF A;  2OAP 1;  4LLO B;  3CI6 A;  4DJ3 A;  4EES A;  2W1T B;  1TS6 A;  2EA9 A;  3HCY A;  3D72 A;  3EEH A;  2ZBB A;  3B47 A;  4NXG A;  5DKL A;  1DP6 A;  3RH8 B;  3T4Q A;  3K2N A;  2BAS A;  3T4T A;  4WEL A;  4Q0J A;  4MMN A;  3PBT A;  2G7U A;  2QWS A;  3IS2 B;  2FH5 A;  4Y5F A;  2D01 A;  2Z6D A;  3D3O A;  3KSG A;  4EET B;  1S4R A;  1ZHH B;  4B9O A;  1NLY A;  2L4R A;  3EQU A;  5HWW A;  5CX7 A;  1LSX A;  4E04 A;  1F5M A;  3NOP C;  4I38 A;  1T1B A;  1F9I A;  3CUE A;  4WLA A;  3BQA A;  4HP9 A;  3H7W B;  4HNB A;  5TBM B;  3FPW A;  3FC7 A;  3OLO A;  5AVE A;  2WKR A;  1T1C A;  5HDD A;  2PYP A;  3RTY A;  2J80 A;  4IUH A;  3BY9 A;  1NWZ A;  4WF0 A;  1ZTU A;  3R7W A;  2VV7 A;  1G28 A;  1T19 A;  1IOU A;  1H8M A;  5AJG A;  4EU0 A;  1G6O A;  4EER A;  1LT0 A;  2HGV A;  4FSF A;  3LUQ A;  4HY8 A;  1DP9 A;  3UB6 A;  2PD8 A;  4LRZ E;  1XJ3 A;  3S7Q A;  1XJ6 A;  3KSI A;  4I5S A;  1F98 A;  4B93 A;  1H3Q A;  2B18 A;  2V1B A;  2K7S A;  2J3W A;  4LRY C;  4GS9 A;  4H6J B;  5HZH A;  4IUK A;  1IFQ A;  4ARZ A;  3ICY A;  4BBV A;  1NLZ A;  2R78 A;  3UE6 A;  4WEK A;  2PR6 A;  1LSW A;  3H82 A;  3A0S A;  4FOF A;  1X0O A;  2ZMV A;  3LR5 A;  4L0L A;  3O5Y A;  1WA9 A;  5F5Y A;  5HDS A;  2P08 A;  4Q0I A;  3LR4 A;  3BQ8 A;  2QKP A;  2PYR A;  4P6Z M;  3E4P A;  1XFN A;  3HJI A;  1OPX A;  4MCW A;  3CAX A;  4L9G A;  1MC0 A;  4KQD A;  4M4X A;  1EW0 A;  3C2W A;  3F1N A;  4Y2F A;  2W3H A;  2VKS A;  4GW9 A;  2QYB A;  4NXF A;  3NHQ A;  3OCL A;  2A24 A;  2QJ7 A;  1N9N A;  3LYX A;  3F1O A;  3DBA A;  4O8G A;  1DRM A;  2QJ5 A;  2HV1 A;  3OC2 A;  1D7E A;  4DJ2 A;  1YKD A;  2J3T D;  4BBU A;  5MC7 A;  2W0N A;  3NOT C;  4Y3I A;  1T1A A;  4F3L B;  3LFV A;  3S7P A;  3RFB A;  4PKY A;  2OAQ 1;  3T4J A;  1P9W A;  3T4K A;  3VOL A;  1MZU A;  1V9Z A;  2J3T C;  2MJ6 A;  2PR5 A;  4YWZ A;  5J7E A;  4HH2 A;  3PHY A;  2VZW A;  4P6Z S;  3UB7 A;  2B02 A;  1XJ4 A;  3T4L A;  3PBN A;  2W3D A;  2OOL A;  4PAU A;  3E0Y A;  2WKP A;  2VGL M;  3OCN A;  2M7U A;  5DKK A;  4PKY G;  4XT2 B;  3IS2 A;  3LR3 A;  3UB9 A;  4ETX A;  3CUE C;  1OTB A;  2GX5 A;  2WKQ A;  1OJG A;  3UME A;  3LI9 A;  1W63 Q;  2P04 A;  5A8B A;  3EGD C;  1S66 L;  2JKT I;  2W3E A;  2XRN A;  5C5K A;  2ZOI A;  1OTE A;  1Y28 A;  2W3F A;  3CIT A;  3T4O A;  4HHD A;  2K2N A;  1GSW A;  3IBJ A;  3ZYT A;  2CMN A;  2V9A A;  3K3D A;  5J4E A;  1VHM A;  3ZQ5 A;  2W3G A;  4ME4 A;  1S1Y A;  1XJ2 A;  3KX0 X;  3KSH A;  2IA2 A;  3KYQ A;  5I5L A;  2VGL S;  3EQV A;  2O9C A;  2INW A;  3B42 A;  2I9V A;  2XA7 S;  4II7 A;  4Z1W A;  3PYP A;  2L0W A;  2EWV A;  4HJ4 A;  1P97 A;  2PD7 A;  2VEA A;  2VLG A;  1YAX A;  3LIA A;  4LRX C;  1MKM A;  3BWL A;  4NXE A;  2O99 A;  3S7N A;  5IS1 A;  3MQ0 A;  3KYZ A;  1OTD A;  5F6A A;  5DJT A;  4NKP A;  4UQI M;  5KSH A;  2O9A A;  3UB8 A;  3KSF A;  4HH3 A;  5HPI A;  4L9F A;  4GS9 B;  4K08 A;  4R38 A;  5G4Z A;  4CLC A;  2P7J A;  2V0U A;  4EQ1 A;  5TJJ A;  4EUV A;  4YNR A;  4ARZ B;  1XFQ A;  2JN7 A;  2ZOH A;  1JNU A;  5HWT A;  5IT5 A;  3F1P A;  3E4Q A;  5F69 A;  4KUO A;  4BBT A;  2KOI A;  2Y79 A;  1NRJ A;  4G3K A;  3H82 B;  4PHT A;  4GLQ A;  1N9O A;  3B33 A;  3C38 A;  5EFW A;  3LR0 A;  2JKR I;  4HIA A;  4I3A A;  4MN5 A;  3T4S A;  2K31 A;  3TE8 A;  4YOF A;  4GHI A;  3T50 A;  2DMW A;  3SW1 A;  2OWJ A;  3MQO A;  3LIE A;  5DF9 A;  4CQH A;  3JVV A;  2LB9 A;  3GEC A;  5HPF A;  1UGU A;  1STZ A;  5IU1 A;  1TS7 A;  4NEE D;  3P01 A;  4JGO A;  4UQI S;  5HD5 A;  4R70 A;  2PDR A;  1P0Z A;  4GCZ A;  4WUJ A;  2M1C A;  2VA0 A;  3MMH A;  3F1O B;  2GZA A;  4JGP A;  2ZMF A;  4CLC E;  3BW6 A;  4I3J A;  1S1Z A;  1KOU A;  4BJP A;  3E98 A;  3PBS A;  2YKH A;  3MJQ A;  1N9L A;  4O0P A;  3MQQ A;  2D02 A;  4MN7 A;  3U2A A;  2W1T A;  1V9Y A;  4AFI A;  3JVU A;  3TW8 A;  1UWP X;  2O9B A;  5G4Y A;  4G3V A;  4BMW A;  3EWK A;  3LID A;  5AVF A;  2QHK A;  2XA7 M;  2JKT M;  3EEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...