1TS7A

Structure of the pr cis wobble and pr e46q intermediates from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts7A00
5AVEA 1F98A 3UB7A 4RQ9A 4I3IA 2EA9A 3E4QA 3MR0A 1P0ZA 2GJ3A 1MZUA 4R6LA 5HDCA 1JNUA 1XJ6A 2B02A 2QKPA 4LRZE 1DP8A 1S1ZA 2V1AA 5AVFA 2W27A 2QWSA 3LIEA 2VV6A 3UMDA 3A0SA 4NXFA 4KQDA 2VV7A 1TS6A 1UGUA 1S4RA 3PHYA 3MQOA 3H82B 3UMEA 5TBMA 4L9FA 4R3AA 4MN5A 2WKQA 2D01A 2A24A 3UB8A 1NWZA 3NJAA 4F3LB 2PR5A 3CAXA 4JGPA 3NOTC 4K08A 4HOIA 4KUKA 3HJKA 5F5YA 3E4PA 3FG8A 2L1MA 4HJ6A 4L9EA 3EEHA 2YKFA 3IS2B 5F68A 4GS9A 1GSWA 5IU1A 1LSWA 1OT9A 3F1NB 1LL8A 3H82A 4HNBA 5A8BA 2ZOHA 5HD3A 3NOUC 2I9VA 5J4EA 3ZQ5A 5F69A 4F3LA 4HHDA 1X0OA 5DJUA 2PYPA 1OJGA 5DKLA 3F1PA 2W0NA 5DJTA 5HZHA 3LIDA 4WL9A 5HWWA 2K7SA 2PD7A 4I3AA 4HI4A 3LIAA 4HH3A 3IS2A 1F9IA 3VE4A 3RH8B 1D06A 2VLGA 2V0WA 5F6AA 2CMNA 5DKKA 2PDRA 4EW7A 4PKYG 3F1NA 1KOUA 1G28A 4LPZA 4R38A 3FC7A 4I39A 4E04A 4H6JB 3K3DA 3MQQA 4I3JA 1D7EA 1LSVA 3D72A 2J80A 4XT2B 4EEUA 3A0RA 2BASA 3VE3A 1S1YA 3H7WB 1ODVA 4BBTA 2PYRA 3PYPA 4WLAA 3SW1A 2KX6A 2PD8A 4WUJA 3A0VA 4GHIB 5G4ZA 4MN6A 1OJ5A 4DJ3A 1UWNX 1OTEA 1S66L 1GSXA 1LT0A 2OWJA 1TS7A 1N9LA 5HWTA 1BYWA 3C8CA 3P7NA 3CWFA 3LUQA 1DRMA 3LYXA 3LICA 4HP4A 3UB6A 2OOLA 2WKRA 2QHKA 1T1CA 1GSVA 4EERA 4LLOB 2YKHA 4H6JA 5HD5A 5J7EA 3BY8A 4B9OA 4XT2A 1V9YA 4BBVA 4GW9A 2QJ7A 3E4OA 5EFWA 4JGOA 3LIFA 3MXQA 1XJ4A 4GCZA 5HSQA 3LI9A 3F1OB 4BBUA 3T50A 4GHIA 1TS8A 1XJ2A 2V9AA 3UB9A 4EXOA 2Z6DA 3IBRA 3H9WA 1UWPX 4KUOA 3GECA 2M1CA 2JN7A 2H28A 1OTDA 4YWZA 3K3CA 3ULFA 4HIAA 2L4RA 1P97A 5I5LA 3G6OA 2A24B 4DJ2A 2V0UA 4HY8A 2VV8A 3B33A 4NXBA 3BY9A 2PR6A 4L9GA 3F1OA 1S67L 3EWKA 3OLOA 5KIZA 1VB6A 2VEAA 1T18A 1XFNA 3VOLA 5IS1A 3NOPC 5HDDA 4EETB 4GS9B 4HQAA 2PHYA 5G4YA 4HP9A 2ZOIA 4R70A 3HJIA 4LRXC 4I5SA 2INWA 4PKYA 1LSXA 2D02A 4HJ4A 3ICYA 1XFQA 4EEPA 3MJQA 2Z6CA 1OT6A 4NXEA 2P7JA 3LI8A 4HJ3A 2JHEA 3KX0X 2OWHA 4NXGA 3C2WA 1S4SA 3NHQA 3F1PB 4EQ1A 1EW0A 1V9ZA 1Y28A 3RTYA 1T1BA 3GDIA 3H7WA 5HWVA 1OTBA 2QJ5A 3LIBA 2L0WA 3UE6A 2WKPA 2KDKA 4WF0A 4WN5A 4HH2A 4JGRA 1TS0A 2ZBBA 3MFXA 1DP9A 1OTIA 5HDSA 2V1BA 3BWLA 4EESA 3CLOA 2R78A 1T1AA 2HV1A 1T19A 4LRYC 1N9NA 1WA9A 1DP6A 1N9OA 4M4XA 5J3WA 4JGQA 5TBMB 4I38A 1XJ3A 1OTAA
chains in the Genus database with same CATH superfamily
1MWTA 2QZ6A 3UB7A 2M7VA 2EFXA 5U47A 1MY8A 4Y7PA 4DN0A 4Y15A 3C4OA 1KGFA 3Q7VB 1JNUA 3VOZA 3U2AA 2QKPA 1RGZA 1DP8A 4G3KA 3HVFA 1ES2A 5AVFA 4PAUA 1I2SA 3W8KA 3T12B 1FSWA 3LIEA 1XKZA 4BD1A 4KQDA 4CLCA 4KG6A 3MFDA 5HL1A 3OPPA 2VV7A 1LI9A 5EUAA 1TS6A 2EWVA 3UDXA 3MQOA 5FAQA 4GB7A 4R3AA 3BYDA 2OAQ1 1YLJA 2A24A 5CGWA 2Y2HA 1WYBA 2Y2QA 3FPVA 2PR5A 5EOEA 1YPRA 4OQIA 1K25A 2W3HA 4MMNA 1YMSA 3Q7VA 4Y2FA 1YLTA 2GNXA 2DCFA 1BT5A 3D9YA 1K54A 4XUXA 4K08A 2HPBA 1H8MA 2ZQDA 3WRZA 3E4PA 3SH7A 2JC7A 2L1MA 3L7HA 1IKGA 4L9EA 3GMWA 5F68A 5IU1A 4DXCA 4CLCD 3BW6A 3MZDA 3NIAA 3IH9A 3D4FA 2NUTC 3IWIA 4IVKA 3IBJA 3NOUC 1YLZA 3UDIA 1Q2PA 5J4EA 1VETB 3ZQ5A 4GNUA 3W2ZA 1NZUA 1X0OA 4A5RA 3E98A 4DDSA 3V39A 3C4PA 5FDSA 4S2JA 4BL3A 3LIDA 3MXSA 1BSGA 1PZPA 2VZWA 5E2FA 4HBTA 4HI4A 3LIAA 1FCOA 4Y17A 3TG9A 2ZMFA 3VE4A 1D06A 4PM6A 2V0WA 5MC7A 5FEFA 5F6AA 5HAQA 2CMNA 1GHIA 2Y2OA 2PDRA 1MPLA 5FQIA 1G28A 4KG2A 3PBTA 4FSFA 4N9LA 1IYPA 3S7OA 3UE0A 4I39A 5HAPA 3K3DA 4I3JA 3QHYA 1LSVA 4EEUA 2ZC5B 4DE0A 4BBTA 3FKVA 3PYPA 2OLVA 3LFVA 2PBYA 4GHIB 4KZ3A 5FI6A 3Q7ZA 3W4PA 3KO6A 1FILA 1UWNX 3MBZA 3SS3A 3WS1A 1YLWA 2H10A 3EGXC 1LT0A 2OWJA 5DTKA 2ZQ7A 1TS7A 1ZHHB 1A0KA 1AXBA 2HF6A 4Y3IA 4R23A 4MBFA 1Z09A 1DRMA 2R9WA 4HP4A 3PBNA 3AGFA 1PWDA 3IH8A 1NLZA 2OV5A 3UO9A 4FH2A 2JKTM 4UAAA 3IWQA 1IYQA 3A3FA 4PM8A 2XFSA 1SHVA 4S2KA 3T4TA 1H0MA 4BBVA 3HREA 4Z9QA 4OVDA 3KSHA 5EFWA 3OPLA 4LV1A 3LI9A 3IT9A 1IOUA 5DFYA 4GHIA 1XJ2A 1QMFA 2WGVA 3NULA 1ESUA 3IBRA 5FL3A 3G2ZA 1XP4A 2WYXA 5DF8A 4LENA 5GL9A 2XDMA 3P09A 3OZHA 3EQVA 3C30A 2H28A 4NK3A 3PBRA 3VFFA 1SZVA 3K3CA 2Q9MA 1STZA 3QP2A 4HIAA 2L4RA 1SKOB 4L0LA 4KENB 4B4XA 1P9RA 4QJGA 5C5KA 3IF5A 4DJ2A 1D1JA 3CPTB 4YINA 3KYEA 1P9WA 3QP6A 4HY8A 3B33A 4UQIS 2E8JA 3BLMA 3BY9A 1SDNA 4KZ7A 3DTEA 5KZHA 2HDUA 2W1RA 2ZQ9A 1S67L 3EWKA 2Y2JA 4MDZA 3VP0A 2J3WA 4XUZA 1N9BA 1TDGA 3R4KA 1N4OA 4GS9B 1RCJA 1FCNA 2Q9NA 4ME4A 4KZAA 5G4YA 4X55A 3LY4A 5F1FA 4BENA 3C38A 3HJIA 2J3TC 4I5SA 3SOIA 1HLUP 2KLIA 1EI5A 3CI6A 2INWA 1SKOA 1NLYA 2D02A 4WZ5C 2OSUA 3IF6B 4RVAA 4KZBA 4HJ4A 4D60A 3NBLA 2Q0OA 4EEPA 3CPTA 3ZG5A 1OT6A 2PBDP 3EQUA 4O01A 4E3KA 5HFOA 4EUVA 2FH5A 4FH4A 5EVLA 3GRJA 2W3FA 1S4SA 1DJAA 1Y4OA 2HDRA 4OPRA 2HDQA 3NHQA 4KQQA 2LB5A 1EW0A 1KGGA 5AJGA 1T1BA 2ZC4B 2EFUA 2QJ5A 1L0GA 3ZNTA 4OOYA 3IQAA 1GA0A 1W5DA 4WN5A 2RCXA 5FAPA 4R1GA 1L3LA 1YLPA 1S6RA 5HDSA 1ZC2A 3ZNYA 3BWLA 2R78A 4S2NC 2J3TD 2V1ZA 5FDHA 2BTFP 1N9OA 1MKIA 4P6ZS 5CGXA 2WAFA 5KSHA 1F98A 4NG2A 1W8YA 5FASA 3S22A 1YMXA 4I3IA 2EA9A 4KZ5A 3CITA 3E4QA 5A92A 3MR0A 2QYBA 4R6LA 1DJBA 2O9AA 1XJ6A 3G35A 4U0TA 3GTCA 3P01A 4P85A 4LRZE 2IWBA 3BFEA 3G4PA 2V1AA 3HBRA 3UPNA 1HVBA 2OAP1 2W27A 2VV6A 3UMDA 2FZ0A 3A0SA 2ZC7A 3PAGA 4QY5A 4O0PA 2XR0A 2FFYA 1ZKJA 2XRNA 1LL9A 1S4RA 4ESPA 5FQJA 3H82B 2Y2MA 4K0WA 2MJ6A 3UMEA 3RXXA 3BECA 2WKQA 4JXVA 4MN5A 4DF6A 1YT4A 3NJAA 1LL5A 1ACFA 4R3BA 3FYZA 3EEAA 3CAXA 2AVXA 5KMWA 4Y0OA 3CHWP 1XA1A 2KOIA 3O3VA 4HOIA 1FR1A 4MBKA 1I5QA 2PAVP 5F5YA 2GDNA 3G31A 4HJ6A 2YKFA 4YNRA 4WEKA 4EWFA 1VEUB 5CECA 2ZJ9A 3F1NB 2WGWA 1LL8A 1CEGA 3H82A 4GDBA 5A8BA 1MBLA 5GLAA 5HD3A 4B88A 1PIOA 2I9VA 2EWWA 2X02A 4R0QA 1NZOA 4HHDA 3TE8A 3BQAA 1PI5A 3VV4A 3HLEA 4ETXA 1BULA 3A3EA 4JXGA 5DKLA 4LV0A 3VSLA 4C75A 2W0NA 2ZMVA 3DAVA 2BG1A 5HWWA 4ZTKA 2H0TA 3P98A 4IUHA 2PD7A 1BLSA 2P9VB 4PM5A 5GLBA 4EUZA 3UNWA 3KSFA 1VEUA 5DKKA 3NCKA 4PKYG 3F1NA 4CLCC 2JBFA 4O7DA 4LPZA 3FC7A 4H6JB 2A3UA 3B47A 4WYYA 3UE1A 4XT2B 3D72A 2E8IA 3A0RA 2BASA 1IEMA 3VE3A 4DDYA 2KX6A 1CI9A 2PD8A 3OBFA 5L8MA 4YOFA 2J7VA 4MN6A 3B3XA 2B18A 5FATA 1H3QA 5HPFA 4GD6A 2VJWA 1N9LA 1K54C 2XK1A 2DMWA 3I7JA 4WBGA 3P7NA 2X71A 2P9VA 2PT7A 1KVMA 3CWFA 1YKDA 3LYXA 3UB6A 2VA0A 2Y2PA 1MKMA 1ONGA 1PRQA 4CJNA 5CTMA 1GSVA 3LR3A 2YKHA 4H6JA 4JF5A 3LY3A 1KE0A 3BFGA 3BY8A 3WS5A 1E3UD 4CLCE 2P74A 2PU4A 3T4LA 4XT2A 1V9YA 5HARA 1BLPA 1H8YA 4Q0IA 4HEFA 2W3GA 4GW9A 3GVBA 4QPRA 3OPHA 3E4OA 3MXQA 3LIFA 4GCZA 4E3IA 3F1OB 4BBUA 1OPXA 2V9AA 3Q82A 1IKIA 2Z6DA 3H9WA 4ID4A 1Y54A 4UA6A 2A49A 3TSGA 3GECA 3SS4A 2M1CA 3CG5A 3UPPA 2G2WA 1OTDA 3LO7A 4ZBEA 3AGDA 4YWZA 3HL9A 1BLHA 1TEMA 2P08A 4O8GA 2K31A 5TJJA 2JKTI 1VHMA 2EX9A 1KDWA 3A3DA 5I5LA 1NJ4A 1K6SA 4PHTA 3WRTA 3V3SA 2EX8A 4MEZA 3T1SA 4OPYA 3T1XA 2VV8A 3LEQA 4D2OA 1AWIA 3T4QA 3IX3A 4L9GA 1PNEA 3O88A 4Q0JA 3F1OA 2ZQ8A 4X1LA 1C3BA 4BLMA 3OLOA 4UEYA 4OQGA 3QP5A 3IHAA 4FUWA 5GHXA 1VETA 2IWDA 2VEAA 5AQAA 5FQKA 3OCNA 3A3JA 2V8FA 1GHPA 2XEPA 3ZG8B 3LCEA 5TFQA 2VKSA 2H5SA 1K4FA 4HQAA 3VSKA 3N8SA 3CMZA 5CXWA 1ZTUA 5FSRA 2XFTA 3DWKA 3IXBA 1K57C 4ZDXA 4LRXC 4GDNA 5I94A 1K57A 4R4RA 4OOLA 1LSXA 1LHYA 4X68A 3HUMA 3ICYA 1KDSA 4DMZA 3MJQA 2W1TB 4R3JA 4NXEA 2P7JA 2R9XA 5AQBA 4HJ3A 2JHEA 2UV0E 3KX0X 4GD8A 1JTGA 3V67A 3NDGA 4PMAA 3F1PB 4G3WA 3RTYA 2A2LA 2Y8HA 3IX8A 3GDIA 5FQMA 1PWGA 5J8XA 4WF0A 4CPKA 3V3RA 2Y2IA 1MC0A 1TS0A 2XD5A 4JXSA 2B95A 4QY6A 3R7WB 2HP9A 4JPMA 1OTIA 4H8RA 4X69A 5TGFA 5E43A 3T1RA 1PW1A 2V1BA 3GSGA 1PWCA 3CLOA 5DTTA 1MXOA 1IFQA 3L9KA 2W1TA 2HV1A 5TBMB 1PFLA 1QMEA 3WS0A 4F94A 5EVIB 2Y4AA 5AVEA 4RQ9A 3BQ8A 1JWVA 2JE5A 3ITBA 4X56A 3ZG7B 3IHBA 1P0ZA 1TDLA 1MZUA 5HDCA 2ZM2A 1W63Q 5D3OA 2WZXA 4OLGA 3T4KA 3FV7A 1CQAA 1J9MA 5E2EA 1S1ZA 2JCHA 3R7WA 2ZD8A 3KSGA 2QWSA 5FAOA 4NXFA 4JLFA 1IYOA 1PI4A 4WEJA 2EX2A 2WAEA 1LLBA 1UGUA 3MF0A 4B93A 5E2HA 4X1MA 4RYEA 5IT5A 5CTNA 5TBMA 4L9FA 4KQRA 2DRWA 2LB9A 3KYQA 4F3LB 3NECA 3ZHHA 1EROA 1BTLA 2O99A 4JGPA 3GV9A 3NOTC 3T4OA 3S7QA 3DTMA 3FG8A 2UWXA 1IYSA 3EEHA 3K2NA 2I72A 1VM1A 4K91A 1JWZA 4GS9A 1GSWA 2WKIA 4OQ0A 4Y0TA 2PU2A 3MKEA 3MS6A 1NXYA 2EX6A 3WS4A 3IF6C 2ZOHA 3MZEA 5GHZA 5HW3A 3IF6A 4F3LA 2GZAA 1E25A 3JPUA 4PM9A 1EWZA 3LGOA 3N8RA 1G6OA 1F2KA 4MBHA 2PYPA 4EBNA 2M7UA 1JWPA 4GJ4A 5HZHA 2HP6A 4ZJ3A 4E6WA 2K7SA 3CUEC 3KYZA 1JTDA 3N4IA 3C5AA 4KZ4A 4I3AA 3CUEA 4HH3A 5CEDA 5EM0A 2WGIA 1YLYA 5BOHA 3RH8B 2VLGA 3NY4A 1L0FA 3FPWA 1ALQA 4EW7A 2EXAA 1KOUA 3G32A 5GLDA 1CI8A 3SH8A 2JKRI 4E04A 1CK3A 3MQQA 1XPBA 4EBLA 2Y79A 3LR0A 4S2IA 2J80A 4S2OA 3HLFA 3UY6A 1S1YA 3Q1FA 1ONHA 3H7WB 4Y13A 4WUJA 1ES3A 2ZQCA 3A0VA 3HLDA 4E6XA 2GX5A 2G2UA 1OTEA 2WKEA 1M40A 3M2KA 1S66L 1HTZA 1HD8A 1SKFA 5HWTA 3LR4A 2J8YA 2V2FF 1BYWA 2VK3A 3LUQA 5G18A 1J3WA 3BJNA 3LICA 4B4ZA 3VP3A 1K6RA 2OOLA 2VGKA 2QHKA 5CERA 3S7NA 4ZAMA 4JBFA 2ZMAA 4GN2A 3LR5A 4LCMA 3KSIA 4MCWA 4EERA 4LLOB 3TOIA 3VOYA 4U3TA 5HD5A 5J7EA 1ERQA 4ETZA 3TW8A 3MKFA 5AQ9A 2Y2KA 3ZVTA 4P87A 1KGEA 3CJMA 4OLDA 3G30A 5HSQA 2JKRM 3SZTA 2HZ5A 5HAIA 5L07A 1ES4A 1NY0A 4EXOA 4KUOA 2QPNA 4X6TA 1K55C 4ZRRA 4E3OA 2O0YA 5JYPA 3WS2A 4S2MA 1K55A 1IELA 3UPOA 2JN7A 3ZG9B 3B42A 3BEBA 3E0YA 1L0EA 3G34A 3E2LA 1NYMA 4MLLA 1YM1A 2DNSA 1MWRA 3AGEA 3W4QA 1LI0A 1WYCA 3G6OA 2A24B 3Q07A 1DY6A 3VP1A 2C5WB 4Q0HA 1NYYA 3NC8A 4QB8A 4RX2A 3LEZA 3UN7A 4UHUA 4NXBA 2PR6A 4C6YA 3FKWA 3HUOA 1E3UA 2XA7M 2JKFA 2XF3A 1BLCA 2G7UA 1G6AA 3O87A 1O07A 3DTIA 4JF4A 2XA7S 4EETB 2W3DA 2Y2GA 3DBAA 2J9PA 1ZG6A 2PHYA 4EBPA 3HLCA 3RXWA 1SDEA 4HP9A 2ZOIA 3IWOA 4R70A 2FFFB 5AQ7A 5F83A 2Z2LB 2ZC6B 2XSSA 4ARZB 4G3VA 3W4OA 1XFQA 2WUQA 2Z6CA 3PBOA 3HUNA 4RA7A 4NETA 5F82A 3CZDA 2OWHA 4NXGA 5DFXA 5DTSA 1VQQA 4E3JA 1YAXA 3UDFA 3G2YA 1F5MA 1YQSA 1V9ZA 1Y28A 3PBSA 4WM9A 2O9BA 1YSQA 3HLBA 3IXGA 3UE3A 4BD0A 1W8QA 2B5RA 2L0WA 3UE6A 2WKPA 4HH2A 4JGRA 3M6HA 2ZBBA 3MFXA 1DP9A 3C7VA 3ZGAB 4IBXA 4OKPA 3ISGA 5FQ9A 4UA7A 4U0XA 2Y91A 5M1AA 3VMAA 2X01A 5EM1A 4GKUA 4ARZA 1S0WA 4EESA 4WELA 1GHMA 4E3LA 1GCEA 3TJZC 1H5XA 2ZC3B 4C3QA 2WK0A 1N9NA 1DP6A 5J3WA 4M4XA 4JGQA 2IWCA 4QHCA 3GR2A 5A91A 1XJ3A 4BQMA 1OTAA 2PRFA 5EPHA 5DF9A 2Z2MB 4QD4A 2OLUA 5L09A 3JVVA 4YFMA 1TD5A 2V20A 4LV2A 2GJ3A 1XGJA 5CHJA 5CX7A 3T1QB 4ZJ1A 2B02A 3BFCA 5M19A 4E3MA 4UA9A 4IEDA 5F1GA 3V5MA 4KZ8A 5EECA 4RX3A 3OC2A 1KVLA 4LCLA 2ZM0A 5JYOA 4AFIA 4KG5A 3RJUA 3PHYA 4X53A 1XXMA 1TVFA 1H8ZA 3IXDA 3VP4A 3S4XA 3ZVWA 2D01A 1G68A 1XX2A 3UB8A 1NWZA 4IVIA 5CRFA 3E2KA 1L0DA 1FSYA 3FWLA 3UB5P 1K56A 3PBQA 1BUEA 1M6KA 1MWUA 1HZOA 3BRMA 4KUKA 4ZJ2A 3HJKA 2P04A 4OONA 3HCYA 2NUPC 3ZG0A 3IS2B 4E3NA 1W79A 2XGNA 2BLSA 1LSWA 1OT9A 3IX4A 3TRCA 5EE8A 2K2NA 2VGLM 4HNBA 4LV3A 2WKHA 5GHYA 1PW8A 4JXWA 3ZCZA 3D3OA 3S1YA 3MQ0A 1FCMA 5F69A 4BMWA 4KZ6A 4PM7A 2VGLS 4MN7A 1YSPA 5CHMA 5DJUA 3OCLA 1OJGA 4DKIA 1CJFA 1K56D 3ZFZA 3WWXA 3QNCA 3VP2A 3F1PA 1NRFA 5DJTA 5DF7A 4WL9A 1KE3A 3MXRA 5EVEA 4UQIM 5TR7A 2ZLYA 4R4SA 3C7UA 2XD1A 3IS2A 1F9IA 3NDEA 3O5YA 3SH9A 2Y2NA 3M2JA 3N7WA 4JF6A 1BZAA 3DTKA 3Q81A 2EXBA 3SS5A 2VGJA 4R38A 1RGYA 4OPQA 2HDSA 1L2SA 3T4JA 1D7EA 5IHVA 4OP5A 3RFBA 3BM6A 2HJEA 2Y59A 2W3EA 2XROA 1ODVA 5EVIC 2PYRA 4WLAA 4Y0UA 1Q2QA 3SW1A 3OOVA 3QP1A 4DE1A 5EVIA 2JKGA 5M18A 5G4ZA 2IA2A 3EGDC 1OJ5A 2V8CA 4KZ9A 4N1XA 2O9CA 4N92A 4DJ3A 3PTEA 1PYYA 1MWSA 4IBRA 1GSXA 1KE4A 1JVJA 2Y2LA 1SCWA 4EV4A 3C8CA 4II7A 1WE4A 3U4LP 5EOOA 4WZ5A 1XGIA 2WKRA 1CF0A 4K0XA 4HESA 3M6BA 2Y55A 3QNBA 1T1CA 2QMIA 2C6WB 3GQZA 1DJCA 2J9OA 3VFHA 4QWOA 2HGVA 1I2WA 4B9OA 4S2LA 4DRTA 4Z1WA 4P6BA 4QU3A 4IUKA 4OQHA 2QJ7A 5KSCA 3MMHA 4JGOA 4OH0A 1XJ4A 3T50A 3V50A 1TS8A 5CGSA 4BL2A 5EVID 3OPRA 3UB9A 3N6IA 3DW0A 5FEGA 2XH9A 4FTXA 1UWPX 3A3IA 2HJ9C 4HBUA 5L10A 1CEFA 4Q8IA 1W7FA 4P6ZM 4GLQA 5DVAA 1NRJA 1XA7A 3BFDA 1PZOA 4DE3A 3HLGA 4MNRA 2ZL1B 1TF1A 4S2NA 1ERMA 3ULFA 1P97A 4LFUA 4NKPA 4S2PA 3NI9A 1FIKA 4NEED 3ZYTA 2RL3A 2V0UA 4BJPA 2H0YA 4P0MA 2ACGA 4FD8A 3QP4A 2XQZA 4Y5FA 2XLNA 1GA9A 2ZQAA 5KIZA 5K5BA 4WMCA 2WZZA 1VB6A 1T18A 4PPRA 1XFNA 1K38A 3VOLA 5FI7A 5IS1A 3O86A 1ES5A 3NOPC 5HDDA 2CC1A 5HL6A 4KQOA 5CHUA 3QP8A 3BLSA 3PXPA 1ZG4A 4EU0A 1OMEA 5E2GA 2ZL1A 1E4DA 3JYIA 3T4SA 4DXBA 2HP5A 3DWZA 2WGWB 4GOGA 3ITAA 4PKYA 1O7EA 4XXRA 1FR6A 5HPIA 5FQQA 5FA7A 5EV0A 1RP5A 3MSHA 5HX9A 5A93A 1W63M 3S7PA 3FZCA 1K4EA 3LI8A 4OP8A 3BFFA 1G5UA 4GZBA 3C2WA 2ZM8A 1Z6FA 4FOFA 1FQGA 4X25A 4N1HA 5CEBA 3N8LA 4WZ4A 4EQ1A 4LGWA 4OPZA 3JVUA 1FOFA 3H7WA 4DE2A 5HWVA 2WADA 1OTBA 4WMCD 3PAEA 5L2FA 3LIBA 2KDKA 1U60A 3EOIA 5FI2A 3MZFA 5A90A 4M3KA 2VX8A 4OOMA 4N9KA 5LBRA 4CLCB 4FCFA 5GLCA 1K0KA 4IJGA 4IHQA 4BWIA 1T1AA 3ZDJA 1ESIA 4JKTA 1T19A 4LRYC 3IXHA 1WA9A 4CQHA 4I38A 4EQIA 3PR6A 3HLWA
chains in the Genus database with same CATH topology
5AVEA 5KSHA 1F98A 3UB7A 2M7VA 4RQ9A 4I3IA 2EA9A 3BQ8A 3CITA 3E4QA 3JVVA 1TD5A 3MR0A 2QYBA 4DN0A 1P0ZA 2GJ3A 1MZUA 4R6LA 5CX7A 5HDCA 1JNUA 2O9AA 1XJ6A 2B02A 1W63Q 3U2AA 3P01A 3T4KA 2QKPA 4LRZE 1DP8A 4G3KA 1S1ZA 3R7WA 2V1AA 5AVFA 4PAUA 3KSGA 2OAP1 2W27A 2QWSA 3LIEA 2VV6A 3UMDA 2FZ0A 3A0SA 4NXFA 4KQDA 4CLCA 3OC2A 4WEJA 2VV7A 4O0PA 1TS6A 4AFIA 1UGUA 2XRNA 3MF0A 1S4RA 2EWVA 3PHYA 4B93A 3MQOA 3H82B 2MJ6A 3UMEA 5IT5A 5TBMA 4L9FA 4R3AA 4MN5A 2WKQA 2D01A 2OAQ1 2A24A 3UB8A 2LB9A 1NWZA 3NJAA 3KYQA 3FPVA 4F3LB 2PR5A 3EEAA 3CAXA 2W3HA 2O99A 4MMNA 4JGPA 3PBQA 4Y2FA 2GNXA 3NOTC 2KOIA 3T4OA 3S7QA 4K08A 4HOIA 4KUKA 3HJKA 5F5YA 1H8MA 2P04A 3E4PA 3FG8A 2L1MA 3HCYA 4HJ6A 2NUPC 4L9EA 3EEHA 2YKFA 3K2NA 4YNRA 4WEKA 3IS2B 5F68A 4GS9A 1GSWA 5IU1A 1LSWA 1OT9A 4CLCD 3BW6A 3TRCA 2NUTC 3F1NB 2K2NA 1LL8A 2VGLM 3H82A 4HNBA 5A8BA 2ZOHA 3IBJA 5HD3A 3NOUC 2I9VA 3D3OA 2EWWA 3MQ0A 5J4EA 3ZQ5A 5F69A 3W2ZA 4BMWA 4F3LA 4HHDA 2VGLS 2GZAA 3TE8A 1X0OA 3BQAA 4MN7A 3VV4A 1YSPA 4ETXA 1G6OA 3E98A 5DJUA 2PYPA 3OCLA 1OJGA 5DKLA 2M7UA 3F1PA 4GJ4A 2W0NA 5DJTA 2ZMVA 5HZHA 3LIDA 4WL9A 5HWWA 2K7SA 3CUEC 3KYZA 4IUHA 2VZWA 4UQIM 2PD7A 4I3AA 4HI4A 3LIAA 3CUEA 4HH3A 2ZMFA 1F9IA 3IS2A 3VE4A 3RH8B 1D06A 2VLGA 3O5YA 3FPWA 2V0WA 3KSFA 5MC7A 5F6AA 2CMNA 5DKKA 2PDRA 4EW7A 4PKYG 3F1NA 4CLCC 1KOUA 1G28A 3PBTA 4FSFA 3S7OA 4LPZA 2JKRI 3FC7A 4I39A 4R38A 4E04A 4H6JB 3B47A 3K3DA 3MQQA 3T4JA 4I3JA 2Y79A 3LR0A 1D7EA 1LSVA 3D72A 2J80A 4XT2B 4EEUA 3A0RA 2BASA 3RFBA 3VE3A 1S1YA 2HJEA 2W3EA 2XROA 3H7WB 1ODVA 4BBTA 2PYRA 3PYPA 4WLAA 3SW1A 2KX6A 2PD8A 3OBFA 3OOVA 3LFVA 4WUJA 4YOFA 5L8MA 3A0VA 4GHIB 5G4ZA 2IA2A 4MN6A 3EGDC 2B18A 1H3QA 1OJ5A 3KO6A 5HPFA 2O9CA 4DJ3A 1UWNX 2GX5A 1OTEA 1S66L 2VJWA 1GSXA 3EGXC 1LT0A 2OWJA 1TS7A 1ZHHB 1N9LA 5HWTA 2HF6A 3LR4A 4Y3IA 2DMWA 1BYWA 3C8CA 3P7NA 2PT7A 3CWFA 1YKDA 3LUQA 4II7A 1DRMA 3LYXA 3BJNA 3LICA 4HP4A 3PBNA 3UB6A 2VA0A 2OOLA 1MKMA 2QHKA 2WKRA 3S7NA 1NLZA 3LR5A 2JKTM 1T1CA 3KSIA 4MCWA 1GSVA 3LR3A 4EERA 4LLOB 2YKHA 4H6JA 5HD5A 5J7EA 3BY8A 4ETZA 3TW8A 2HGVA 4CLCE 3T4TA 3T4LA 4XT2A 4B9OA 1V9YA 4Z1WA 4Q0IA 4BBVA 2W3GA 4IUKA 4GW9A 2QJ7A 3KSHA 4QPRA 3E4OA 5EFWA 3MMHA 3MXQA 3LIFA 4GCZA 1XJ4A 4JGOA 5HSQA 3LI9A 3F1OB 4BBUA 1IOUA 3T50A 5DFYA 1OPXA 2JKRM 4GHIA 1TS8A 1XJ2A 2V9AA 3UB9A 4EXOA 2Z6DA 3IBRA 5FL3A 3H9WA 1UWPX 4KUOA 2HJ9C 4ZRRA 2O0YA 3GECA 3EQVA 2M1CA 3C30A 2JN7A 2H28A 3B42A 4P6ZM 4GLQA 1OTDA 1NRJA 3E0YA 1TF1A 3PBRA 4YWZA 3K3CA 2P08A 4O8GA 3ULFA 2K31A 5TJJA 2JKTI 1VHMA 1STZA 4HIAA 2L4RA 1P97A 4NKPA 4L0LA 4NEED 1P9RA 5I5LA 3ZYTA 5C5KA 3G6OA 2A24B 4DJ2A 4PHTA 2V0UA 1P9WA 4BJPA 4Q0HA 4HY8A 2VV8A 3B33A 4UQIS 4NXBA 3BY9A 2PR6A 2XA7M 2W1RA 3T4QA 4L9GA 4Q0JA 3F1OA 1S67L 2G7UA 3EWKA 4Y5FA 3OLOA 4UEYA 4MDZA 5KIZA 5K5BA 1VB6A 2VEAA 1T18A 1XFNA 3OCNA 2XA7S 3VOLA 5IS1A 2J3WA 3NOPC 5HDDA 5HL6A 3R4KA 4KQOA 2VKSA 4EETB 2W3DA 3DBAA 3PXPA 4GS9B 4HQAA 2PHYA 4ME4A 4EU0A 1ZTUA 5G4YA 4HP9A 2ZOIA 3T4SA 4R70A 3C38A 3HJIA 2J3TC 4LRXC 4I5SA 2KLIA 3CI6A 4OOLA 2INWA 2XSSA 4PKYA 1LSXA 4ARZB 1NLYA 2D02A 4G3VA 4HJ4A 5HPIA 3ICYA 1XFQA 4DMZA 4EEPA 3MJQA 2W1TB 2Z6CA 1OT6A 1W63M 3PBOA 4NXEA 3S7PA 2P7JA 3EQUA 4O01A 4EUVA 3LI8A 4HJ3A 2JHEA 2FH5A 3KX0X 2OWHA 4NXGA 5DFXA 3C2WA 1YAXA 2W3FA 4FOFA 3V67A 1S4SA 3NHQA 1F5MA 3F1PB 4EQ1A 2LB5A 1EW0A 4G3WA 5AJGA 1V9ZA 1Y28A 3RTYA 3PBSA 2A2LA 2Y8HA 1T1BA 2O9BA 1YSQA 3GDIA 3JVUA 3H7WA 3UE3A 5HWVA 1OTBA 2QJ5A 3LIBA 2L0WA 3UE6A 2WKPA 2KDKA 4WF0A 4WN5A 4HH2A 4JGRA 3EOIA 1MC0A 1TS0A 2ZBBA 3MFXA 3R7WB 1DP9A 1OTIA 2VX8A 4OOMA 5HDSA 5LBRA 4CLCB 2V1BA 3BWLA 4ARZA 4EESA 3CLOA 4WELA 2R78A 4IJGA 4IHQA 1IFQA 2J3TD 4BWIA 1T1AA 3TJZC 2W1TA 2HV1A 1T19A 4LRYC 1N9NA 1WA9A 1DP6A 1N9OA 4M4XA 5J3WA 4JGQA 5TBMB 4CQHA 4I38A 1XJ3A 1OTAA 3PR6A 4P6ZS 5DF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVE A;  1F98 A;  3UB7 A;  4RQ9 A;  4I3I A;  2EA9 A;  3E4Q A;  3MR0 A;  1P0Z A;  2GJ3 A;  1MZU A;  4R6L A;  5HDC A;  1JNU A;  1XJ6 A;  2B02 A;  2QKP A;  4LRZ E;  1DP8 A;  1S1Z A;  2V1A A;  5AVF A;  2W27 A;  2QWS A;  3LIE A;  2VV6 A;  3UMD A;  3A0S A;  4NXF A;  4KQD A;  2VV7 A;  1TS6 A;  1UGU A;  1S4R A;  3PHY A;  3MQO A;  3H82 B;  3UME A;  5TBM A;  4L9F A;  4R3A A;  4MN5 A;  2WKQ A;  2D01 A;  2A24 A;  3UB8 A;  1NWZ A;  3NJA A;  4F3L B;  2PR5 A;  3CAX A;  4JGP A;  3NOT C;  4K08 A;  4HOI A;  4KUK A;  3HJK A;  5F5Y A;  3E4P A;  3FG8 A;  2L1M A;  4HJ6 A;  4L9E A;  3EEH A;  2YKF A;  3IS2 B;  5F68 A;  4GS9 A;  1GSW A;  5IU1 A;  1LSW A;  1OT9 A;  3F1N B;  1LL8 A;  3H82 A;  4HNB A;  5A8B A;  2ZOH A;  5HD3 A;  3NOU C;  2I9V A;  5J4E A;  3ZQ5 A;  5F69 A;  4F3L A;  4HHD A;  1X0O A;  5DJU A;  2PYP A;  1OJG A;  5DKL A;  3F1P A;  2W0N A;  5DJT A;  5HZH A;  3LID A;  4WL9 A;  5HWW A;  2K7S A;  2PD7 A;  4I3A A;  4HI4 A;  3LIA A;  4HH3 A;  3IS2 A;  1F9I A;  3VE4 A;  3RH8 B;  1D06 A;  2VLG A;  2V0W A;  5F6A A;  2CMN A;  5DKK A;  2PDR A;  4EW7 A;  4PKY G;  3F1N A;  1KOU A;  1G28 A;  4LPZ A;  4R38 A;  3FC7 A;  4I39 A;  4E04 A;  4H6J B;  3K3D A;  3MQQ A;  4I3J A;  1D7E A;  1LSV A;  3D72 A;  2J80 A;  4XT2 B;  4EEU A;  3A0R A;  2BAS A;  3VE3 A;  1S1Y A;  3H7W B;  1ODV A;  4BBT A;  2PYR A;  3PYP A;  4WLA A;  3SW1 A;  2KX6 A;  2PD8 A;  4WUJ A;  3A0V A;  4GHI B;  5G4Z A;  4MN6 A;  1OJ5 A;  4DJ3 A;  1UWN X;  1OTE A;  1S66 L;  1GSX A;  1LT0 A;  2OWJ A;  1TS7 A;  1N9L A;  5HWT A;  1BYW A;  3C8C A;  3P7N A;  3CWF A;  3LUQ A;  1DRM A;  3LYX A;  3LIC A;  4HP4 A;  3UB6 A;  2OOL A;  2WKR A;  2QHK A;  1T1C A;  1GSV A;  4EER A;  4LLO B;  2YKH A;  4H6J A;  5HD5 A;  5J7E A;  3BY8 A;  4B9O A;  4XT2 A;  1V9Y A;  4BBV A;  4GW9 A;  2QJ7 A;  3E4O A;  5EFW A;  4JGO A;  3LIF A;  3MXQ A;  1XJ4 A;  4GCZ A;  5HSQ A;  3LI9 A;  3F1O B;  4BBU A;  3T50 A;  4GHI A;  1TS8 A;  1XJ2 A;  2V9A A;  3UB9 A;  4EXO A;  2Z6D A;  3IBR A;  3H9W A;  1UWP X;  4KUO A;  3GEC A;  2M1C A;  2JN7 A;  2H28 A;  1OTD A;  4YWZ A;  3K3C A;  3ULF A;  4HIA A;  2L4R A;  1P97 A;  5I5L A;  3G6O A;  2A24 B;  4DJ2 A;  2V0U A;  4HY8 A;  2VV8 A;  3B33 A;  4NXB A;  3BY9 A;  2PR6 A;  4L9G A;  3F1O A;  1S67 L;  3EWK A;  3OLO A;  5KIZ A;  1VB6 A;  2VEA A;  1T18 A;  1XFN A;  3VOL A;  5IS1 A;  3NOP C;  5HDD A;  4EET B;  4GS9 B;  4HQA A;  2PHY A;  5G4Y A;  4HP9 A;  2ZOI A;  4R70 A;  3HJI A;  4LRX C;  4I5S A;  2INW A;  4PKY A;  1LSX A;  2D02 A;  4HJ4 A;  3ICY A;  1XFQ A;  4EEP A;  3MJQ A;  2Z6C A;  1OT6 A;  4NXE A;  2P7J A;  3LI8 A;  4HJ3 A;  2JHE A;  3KX0 X;  2OWH A;  4NXG A;  3C2W A;  1S4S A;  3NHQ A;  3F1P B;  4EQ1 A;  1EW0 A;  1V9Z A;  1Y28 A;  3RTY A;  1T1B A;  3GDI A;  3H7W A;  5HWV A;  1OTB A;  2QJ5 A;  3LIB A;  2L0W A;  3UE6 A;  2WKP A;  2KDK A;  4WF0 A;  4WN5 A;  4HH2 A;  4JGR A;  1TS0 A;  2ZBB A;  3MFX A;  1DP9 A;  1OTI A;  5HDS A;  2V1B A;  3BWL A;  4EES A;  3CLO A;  2R78 A;  1T1A A;  2HV1 A;  1T19 A;  4LRY C;  1N9N A;  1WA9 A;  1DP6 A;  1N9O A;  4M4X A;  5J3W A;  4JGQ A;  5TBM B;  4I38 A;  1XJ3 A;  1OTA A; 
#chains in the Genus database with same CATH topology
 1MWT A;  2QZ6 A;  3UB7 A;  2M7V A;  2EFX A;  5U47 A;  1MY8 A;  4Y7P A;  4DN0 A;  4Y15 A;  3C4O A;  1KGF A;  3Q7V B;  1JNU A;  3VOZ A;  3U2A A;  2QKP A;  1RGZ A;  1DP8 A;  4G3K A;  3HVF A;  1ES2 A;  5AVF A;  4PAU A;  1I2S A;  3W8K A;  3T12 B;  1FSW A;  3LIE A;  1XKZ A;  4BD1 A;  4KQD A;  4CLC A;  4KG6 A;  3MFD A;  5HL1 A;  3OPP A;  2VV7 A;  1LI9 A;  5EUA A;  1TS6 A;  2EWV A;  3UDX A;  3MQO A;  5FAQ A;  4GB7 A;  4R3A A;  3BYD A;  2OAQ 1;  1YLJ A;  2A24 A;  5CGW A;  2Y2H A;  1WYB A;  2Y2Q A;  3FPV A;  2PR5 A;  5EOE A;  1YPR A;  4OQI A;  1K25 A;  2W3H A;  4MMN A;  1YMS A;  3Q7V A;  4Y2F A;  1YLT A;  2GNX A;  2DCF A;  1BT5 A;  3D9Y A;  1K54 A;  4XUX A;  4K08 A;  2HPB A;  1H8M A;  2ZQD A;  3WRZ A;  3E4P A;  3SH7 A;  2JC7 A;  2L1M A;  3L7H A;  1IKG A;  4L9E A;  3GMW A;  5F68 A;  5IU1 A;  4DXC A;  4CLC D;  3BW6 A;  3MZD A;  3NIA A;  3IH9 A;  3D4F A;  2NUT C;  3IWI A;  4IVK A;  3IBJ A;  3NOU C;  1YLZ A;  3UDI A;  1Q2P A;  5J4E A;  1VET B;  3ZQ5 A;  4GNU A;  3W2Z A;  1NZU A;  1X0O A;  4A5R A;  3E98 A;  4DDS A;  3V39 A;  3C4P A;  5FDS A;  4S2J A;  4BL3 A;  3LID A;  3MXS A;  1BSG A;  1PZP A;  2VZW A;  5E2F A;  4HBT A;  4HI4 A;  3LIA A;  1FCO A;  4Y17 A;  3TG9 A;  2ZMF A;  3VE4 A;  1D06 A;  4PM6 A;  2V0W A;  5MC7 A;  5FEF A;  5F6A A;  5HAQ A;  2CMN A;  1GHI A;  2Y2O A;  2PDR A;  1MPL A;  5FQI A;  1G28 A;  4KG2 A;  3PBT A;  4FSF A;  4N9L A;  1IYP A;  3S7O A;  3UE0 A;  4I39 A;  5HAP A;  3K3D A;  4I3J A;  3QHY A;  1LSV A;  4EEU A;  2ZC5 B;  4DE0 A;  4BBT A;  3FKV A;  3PYP A;  2OLV A;  3LFV A;  2PBY A;  4GHI B;  4KZ3 A;  5FI6 A;  3Q7Z A;  3W4P A;  3KO6 A;  1FIL A;  1UWN X;  3MBZ A;  3SS3 A;  3WS1 A;  1YLW A;  2H10 A;  3EGX C;  1LT0 A;  2OWJ A;  5DTK A;  2ZQ7 A;  1TS7 A;  1ZHH B;  1A0K A;  1AXB A;  2HF6 A;  4Y3I A;  4R23 A;  4MBF A;  1Z09 A;  1DRM A;  2R9W A;  4HP4 A;  3PBN A;  3AGF A;  1PWD A;  3IH8 A;  1NLZ A;  2OV5 A;  3UO9 A;  4FH2 A;  2JKT M;  4UAA A;  3IWQ A;  1IYQ A;  3A3F A;  4PM8 A;  2XFS A;  1SHV A;  4S2K A;  3T4T A;  1H0M A;  4BBV A;  3HRE A;  4Z9Q A;  4OVD A;  3KSH A;  5EFW A;  3OPL A;  4LV1 A;  3LI9 A;  3IT9 A;  1IOU A;  5DFY A;  4GHI A;  1XJ2 A;  1QMF A;  2WGV A;  3NUL A;  1ESU A;  3IBR A;  5FL3 A;  3G2Z A;  1XP4 A;  2WYX A;  5DF8 A;  4LEN A;  5GL9 A;  2XDM A;  3P09 A;  3OZH A;  3EQV A;  3C30 A;  2H28 A;  4NK3 A;  3PBR A;  3VFF A;  1SZV A;  3K3C A;  2Q9M A;  1STZ A;  3QP2 A;  4HIA A;  2L4R A;  1SKO B;  4L0L A;  4KEN B;  4B4X A;  1P9R A;  4QJG A;  5C5K A;  3IF5 A;  4DJ2 A;  1D1J A;  3CPT B;  4YIN A;  3KYE A;  1P9W A;  3QP6 A;  4HY8 A;  3B33 A;  4UQI S;  2E8J A;  3BLM A;  3BY9 A;  1SDN A;  4KZ7 A;  3DTE A;  5KZH A;  2HDU A;  2W1R A;  2ZQ9 A;  1S67 L;  3EWK A;  2Y2J A;  4MDZ A;  3VP0 A;  2J3W A;  4XUZ A;  1N9B A;  1TDG A;  3R4K A;  1N4O A;  4GS9 B;  1RCJ A;  1FCN A;  2Q9N A;  4ME4 A;  4KZA A;  5G4Y A;  4X55 A;  3LY4 A;  5F1F A;  4BEN A;  3C38 A;  3HJI A;  2J3T C;  4I5S A;  3SOI A;  1HLU P;  2KLI A;  1EI5 A;  3CI6 A;  2INW A;  1SKO A;  1NLY A;  2D02 A;  4WZ5 C;  2OSU A;  3IF6 B;  4RVA A;  4KZB A;  4HJ4 A;  4D60 A;  3NBL A;  2Q0O A;  4EEP A;  3CPT A;  3ZG5 A;  1OT6 A;  2PBD P;  3EQU A;  4O01 A;  4E3K A;  5HFO A;  4EUV A;  2FH5 A;  4FH4 A;  5EVL A;  3GRJ A;  2W3F A;  1S4S A;  1DJA A;  1Y4O A;  2HDR A;  4OPR A;  2HDQ A;  3NHQ A;  4KQQ A;  2LB5 A;  1EW0 A;  1KGG A;  5AJG A;  1T1B A;  2ZC4 B;  2EFU A;  2QJ5 A;  1L0G A;  3ZNT A;  4OOY A;  3IQA A;  1GA0 A;  1W5D A;  4WN5 A;  2RCX A;  5FAP A;  4R1G A;  1L3L A;  1YLP A;  1S6R A;  5HDS A;  1ZC2 A;  3ZNY A;  3BWL A;  2R78 A;  4S2N C;  2J3T D;  2V1Z A;  5FDH A;  2BTF P;  1N9O A;  1MKI A;  4P6Z S;  5CGX A;  2WAF A;  5KSH A;  1F98 A;  4NG2 A;  1W8Y A;  5FAS A;  3S22 A;  1YMX A;  4I3I A;  2EA9 A;  4KZ5 A;  3CIT A;  3E4Q A;  5A92 A;  3MR0 A;  2QYB A;  4R6L A;  1DJB A;  2O9A A;  1XJ6 A;  3G35 A;  4U0T A;  3GTC A;  3P01 A;  4P85 A;  4LRZ E;  2IWB A;  3BFE A;  3G4P A;  2V1A A;  3HBR A;  3UPN A;  1HVB A;  2OAP 1;  2W27 A;  2VV6 A;  3UMD A;  2FZ0 A;  3A0S A;  2ZC7 A;  3PAG A;  4QY5 A;  4O0P A;  2XR0 A;  2FFY A;  1ZKJ A;  2XRN A;  1LL9 A;  1S4R A;  4ESP A;  5FQJ A;  3H82 B;  2Y2M A;  4K0W A;  2MJ6 A;  3UME A;  3RXX A;  3BEC A;  2WKQ A;  4JXV A;  4MN5 A;  4DF6 A;  1YT4 A;  3NJA A;  1LL5 A;  1ACF A;  4R3B A;  3FYZ A;  3EEA A;  3CAX A;  2AVX A;  5KMW A;  4Y0O A;  3CHW P;  1XA1 A;  2KOI A;  3O3V A;  4HOI A;  1FR1 A;  4MBK A;  1I5Q A;  2PAV P;  5F5Y A;  2GDN A;  3G31 A;  4HJ6 A;  2YKF A;  4YNR A;  4WEK A;  4EWF A;  1VEU B;  5CEC A;  2ZJ9 A;  3F1N B;  2WGW A;  1LL8 A;  1CEG A;  3H82 A;  4GDB A;  5A8B A;  1MBL A;  5GLA A;  5HD3 A;  4B88 A;  1PIO A;  2I9V A;  2EWW A;  2X02 A;  4R0Q A;  1NZO A;  4HHD A;  3TE8 A;  3BQA A;  1PI5 A;  3VV4 A;  3HLE A;  4ETX A;  1BUL A;  3A3E A;  4JXG A;  5DKL A;  4LV0 A;  3VSL A;  4C75 A;  2W0N A;  2ZMV A;  3DAV A;  2BG1 A;  5HWW A;  4ZTK A;  2H0T A;  3P98 A;  4IUH A;  2PD7 A;  1BLS A;  2P9V B;  4PM5 A;  5GLB A;  4EUZ A;  3UNW A;  3KSF A;  1VEU A;  5DKK A;  3NCK A;  4PKY G;  3F1N A;  4CLC C;  2JBF A;  4O7D A;  4LPZ A;  3FC7 A;  4H6J B;  2A3U A;  3B47 A;  4WYY A;  3UE1 A;  4XT2 B;  3D72 A;  2E8I A;  3A0R A;  2BAS A;  1IEM A;  3VE3 A;  4DDY A;  2KX6 A;  1CI9 A;  2PD8 A;  3OBF A;  5L8M A;  4YOF A;  2J7V A;  4MN6 A;  3B3X A;  2B18 A;  5FAT A;  1H3Q A;  5HPF A;  4GD6 A;  2VJW A;  1N9L A;  1K54 C;  2XK1 A;  2DMW A;  3I7J A;  4WBG A;  3P7N A;  2X71 A;  2P9V A;  2PT7 A;  1KVM A;  3CWF A;  1YKD A;  3LYX A;  3UB6 A;  2VA0 A;  2Y2P A;  1MKM A;  1ONG A;  1PRQ A;  4CJN A;  5CTM A;  1GSV A;  3LR3 A;  2YKH A;  4H6J A;  4JF5 A;  3LY3 A;  1KE0 A;  3BFG A;  3BY8 A;  3WS5 A;  1E3U D;  4CLC E;  2P74 A;  2PU4 A;  3T4L A;  4XT2 A;  1V9Y A;  5HAR A;  1BLP A;  1H8Y A;  4Q0I A;  4HEF A;  2W3G A;  4GW9 A;  3GVB A;  4QPR A;  3OPH A;  3E4O A;  3MXQ A;  3LIF A;  4GCZ A;  4E3I A;  3F1O B;  4BBU A;  1OPX A;  2V9A A;  3Q82 A;  1IKI A;  2Z6D A;  3H9W A;  4ID4 A;  1Y54 A;  4UA6 A;  2A49 A;  3TSG A;  3GEC A;  3SS4 A;  2M1C A;  3CG5 A;  3UPP A;  2G2W A;  1OTD A;  3LO7 A;  4ZBE A;  3AGD A;  4YWZ A;  3HL9 A;  1BLH A;  1TEM A;  2P08 A;  4O8G A;  2K31 A;  5TJJ A;  2JKT I;  1VHM A;  2EX9 A;  1KDW A;  3A3D A;  5I5L A;  1NJ4 A;  1K6S A;  4PHT A;  3WRT A;  3V3S A;  2EX8 A;  4MEZ A;  3T1S A;  4OPY A;  3T1X A;  2VV8 A;  3LEQ A;  4D2O A;  1AWI A;  3T4Q A;  3IX3 A;  4L9G A;  1PNE A;  3O88 A;  4Q0J A;  3F1O A;  2ZQ8 A;  4X1L A;  1C3B A;  4BLM A;  3OLO A;  4UEY A;  4OQG A;  3QP5 A;  3IHA A;  4FUW A;  5GHX A;  1VET A;  2IWD A;  2VEA A;  5AQA A;  5FQK A;  3OCN A;  3A3J A;  2V8F A;  1GHP A;  2XEP A;  3ZG8 B;  3LCE A;  5TFQ A;  2VKS A;  2H5S A;  1K4F A;  4HQA A;  3VSK A;  3N8S A;  3CMZ A;  5CXW A;  1ZTU A;  5FSR A;  2XFT A;  3DWK A;  3IXB A;  1K57 C;  4ZDX A;  4LRX C;  4GDN A;  5I94 A;  1K57 A;  4R4R A;  4OOL A;  1LSX A;  1LHY A;  4X68 A;  3HUM A;  3ICY A;  1KDS A;  4DMZ A;  3MJQ A;  2W1T B;  4R3J A;  4NXE A;  2P7J A;  2R9X A;  5AQB A;  4HJ3 A;  2JHE A;  2UV0 E;  3KX0 X;  4GD8 A;  1JTG A;  3V67 A;  3NDG A;  4PMA A;  3F1P B;  4G3W A;  3RTY A;  2A2L A;  2Y8H A;  3IX8 A;  3GDI A;  5FQM A;  1PWG A;  5J8X A;  4WF0 A;  4CPK A;  3V3R A;  2Y2I A;  1MC0 A;  1TS0 A;  2XD5 A;  4JXS A;  2B95 A;  4QY6 A;  3R7W B;  2HP9 A;  4JPM A;  1OTI A;  4H8R A;  4X69 A;  5TGF A;  5E43 A;  3T1R A;  1PW1 A;  2V1B A;  3GSG A;  1PWC A;  3CLO A;  5DTT A;  1MXO A;  1IFQ A;  3L9K A;  2W1T A;  2HV1 A;  5TBM B;  1PFL A;  1QME A;  3WS0 A;  4F94 A;  5EVI B;  2Y4A A;  5AVE A;  4RQ9 A;  3BQ8 A;  1JWV A;  2JE5 A;  3ITB A;  4X56 A;  3ZG7 B;  3IHB A;  1P0Z A;  1TDL A;  1MZU A;  5HDC A;  2ZM2 A;  1W63 Q;  5D3O A;  2WZX A;  4OLG A;  3T4K A;  3FV7 A;  1CQA A;  1J9M A;  5E2E A;  1S1Z A;  2JCH A;  3R7W A;  2ZD8 A;  3KSG A;  2QWS A;  5FAO A;  4NXF A;  4JLF A;  1IYO A;  1PI4 A;  4WEJ A;  2EX2 A;  2WAE A;  1LLB A;  1UGU A;  3MF0 A;  4B93 A;  5E2H A;  4X1M A;  4RYE A;  5IT5 A;  5CTN A;  5TBM A;  4L9F A;  4KQR A;  2DRW A;  2LB9 A;  3KYQ A;  4F3L B;  3NEC A;  3ZHH A;  1ERO A;  1BTL A;  2O99 A;  4JGP A;  3GV9 A;  3NOT C;  3T4O A;  3S7Q A;  3DTM A;  3FG8 A;  2UWX A;  1IYS A;  3EEH A;  3K2N A;  2I72 A;  1VM1 A;  4K91 A;  1JWZ A;  4GS9 A;  1GSW A;  2WKI A;  4OQ0 A;  4Y0T A;  2PU2 A;  3MKE A;  3MS6 A;  1NXY A;  2EX6 A;  3WS4 A;  3IF6 C;  2ZOH A;  3MZE A;  5GHZ A;  5HW3 A;  3IF6 A;  4F3L A;  2GZA A;  1E25 A;  3JPU A;  4PM9 A;  1EWZ A;  3LGO A;  3N8R A;  1G6O A;  1F2K A;  4MBH A;  2PYP A;  4EBN A;  2M7U A;  1JWP A;  4GJ4 A;  5HZH A;  2HP6 A;  4ZJ3 A;  4E6W A;  2K7S A;  3CUE C;  3KYZ A;  1JTD A;  3N4I A;  3C5A A;  4KZ4 A;  4I3A A;  3CUE A;  4HH3 A;  5CED A;  5EM0 A;  2WGI A;  1YLY A;  5BOH A;  3RH8 B;  2VLG A;  3NY4 A;  1L0F A;  3FPW A;  1ALQ A;  4EW7 A;  2EXA A;  1KOU A;  3G32 A;  5GLD A;  1CI8 A;  3SH8 A;  2JKR I;  4E04 A;  1CK3 A;  3MQQ A;  1XPB A;  4EBL A;  2Y79 A;  3LR0 A;  4S2I A;  2J80 A;  4S2O A;  3HLF A;  3UY6 A;  1S1Y A;  3Q1F A;  1ONH A;  3H7W B;  4Y13 A;  4WUJ A;  1ES3 A;  2ZQC A;  3A0V A;  3HLD A;  4E6X A;  2GX5 A;  2G2U A;  1OTE A;  2WKE A;  1M40 A;  3M2K A;  1S66 L;  1HTZ A;  1HD8 A;  1SKF A;  5HWT A;  3LR4 A;  2J8Y A;  2V2F F;  1BYW A;  2VK3 A;  3LUQ A;  5G18 A;  1J3W A;  3BJN A;  3LIC A;  4B4Z A;  3VP3 A;  1K6R A;  2OOL A;  2VGK A;  2QHK A;  5CER A;  3S7N A;  4ZAM A;  4JBF A;  2ZMA A;  4GN2 A;  3LR5 A;  4LCM A;  3KSI A;  4MCW A;  4EER A;  4LLO B;  3TOI A;  3VOY A;  4U3T A;  5HD5 A;  5J7E A;  1ERQ A;  4ETZ A;  3TW8 A;  3MKF A;  5AQ9 A;  2Y2K A;  3ZVT A;  4P87 A;  1KGE A;  3CJM A;  4OLD A;  3G30 A;  5HSQ A;  2JKR M;  3SZT A;  2HZ5 A;  5HAI A;  5L07 A;  1ES4 A;  1NY0 A;  4EXO A;  4KUO A;  2QPN A;  4X6T A;  1K55 C;  4ZRR A;  4E3O A;  2O0Y A;  5JYP A;  3WS2 A;  4S2M A;  1K55 A;  1IEL A;  3UPO A;  2JN7 A;  3ZG9 B;  3B42 A;  3BEB A;  3E0Y A;  1L0E A;  3G34 A;  3E2L A;  1NYM A;  4MLL A;  1YM1 A;  2DNS A;  1MWR A;  3AGE A;  3W4Q A;  1LI0 A;  1WYC A;  3G6O A;  2A24 B;  3Q07 A;  1DY6 A;  3VP1 A;  2C5W B;  4Q0H A;  1NYY A;  3NC8 A;  4QB8 A;  4RX2 A;  3LEZ A;  3UN7 A;  4UHU A;  4NXB A;  2PR6 A;  4C6Y A;  3FKW A;  3HUO A;  1E3U A;  2XA7 M;  2JKF A;  2XF3 A;  1BLC A;  2G7U A;  1G6A A;  3O87 A;  1O07 A;  3DTI A;  4JF4 A;  2XA7 S;  4EET B;  2W3D A;  2Y2G A;  3DBA A;  2J9P A;  1ZG6 A;  2PHY A;  4EBP A;  3HLC A;  3RXW A;  1SDE A;  4HP9 A;  2ZOI A;  3IWO A;  4R70 A;  2FFF B;  5AQ7 A;  5F83 A;  2Z2L B;  2ZC6 B;  2XSS A;  4ARZ B;  4G3V A;  3W4O A;  1XFQ A;  2WUQ A;  2Z6C A;  3PBO A;  3HUN A;  4RA7 A;  4NET A;  5F82 A;  3CZD A;  2OWH A;  4NXG A;  5DFX A;  5DTS A;  1VQQ A;  4E3J A;  1YAX A;  3UDF A;  3G2Y A;  1F5M A;  1YQS A;  1V9Z A;  1Y28 A;  3PBS A;  4WM9 A;  2O9B A;  1YSQ A;  3HLB A;  3IXG A;  3UE3 A;  4BD0 A;  1W8Q A;  2B5R A;  2L0W A;  3UE6 A;  2WKP A;  4HH2 A;  4JGR A;  3M6H A;  2ZBB A;  3MFX A;  1DP9 A;  3C7V A;  3ZGA B;  4IBX A;  4OKP A;  3ISG A;  5FQ9 A;  4UA7 A;  4U0X A;  2Y91 A;  5M1A A;  3VMA A;  2X01 A;  5EM1 A;  4GKU A;  4ARZ A;  1S0W A;  4EES A;  4WEL A;  1GHM A;  4E3L A;  1GCE A;  3TJZ C;  1H5X A;  2ZC3 B;  4C3Q A;  2WK0 A;  1N9N A;  1DP6 A;  5J3W A;  4M4X A;  4JGQ A;  2IWC A;  4QHC A;  3GR2 A;  5A91 A;  1XJ3 A;  4BQM A;  1OTA A;  2PRF A;  5EPH A;  5DF9 A;  2Z2M B;  4QD4 A;  2OLU A;  5L09 A;  3JVV A;  4YFM A;  1TD5 A;  2V20 A;  4LV2 A;  2GJ3 A;  1XGJ A;  5CHJ A;  5CX7 A;  3T1Q B;  4ZJ1 A;  2B02 A;  3BFC A;  5M19 A;  4E3M A;  4UA9 A;  4IED A;  5F1G A;  3V5M A;  4KZ8 A;  5EEC A;  4RX3 A;  3OC2 A;  1KVL A;  4LCL A;  2ZM0 A;  5JYO A;  4AFI A;  4KG5 A;  3RJU A;  3PHY A;  4X53 A;  1XXM A;  1TVF A;  1H8Z A;  3IXD A;  3VP4 A;  3S4X A;  3ZVW A;  2D01 A;  1G68 A;  1XX2 A;  3UB8 A;  1NWZ A;  4IVI A;  5CRF A;  3E2K A;  1L0D A;  1FSY A;  3FWL A;  3UB5 P;  1K56 A;  3PBQ A;  1BUE A;  1M6K A;  1MWU A;  1HZO A;  3BRM A;  4KUK A;  4ZJ2 A;  3HJK A;  2P04 A;  4OON A;  3HCY A;  2NUP C;  3ZG0 A;  3IS2 B;  4E3N A;  1W79 A;  2XGN A;  2BLS A;  1LSW A;  1OT9 A;  3IX4 A;  3TRC A;  5EE8 A;  2K2N A;  2VGL M;  4HNB A;  4LV3 A;  2WKH A;  5GHY A;  1PW8 A;  4JXW A;  3ZCZ A;  3D3O A;  3S1Y A;  3MQ0 A;  1FCM A;  5F69 A;  4BMW A;  4KZ6 A;  4PM7 A;  2VGL S;  4MN7 A;  1YSP A;  5CHM A;  5DJU A;  3OCL A;  1OJG A;  4DKI A;  1CJF A;  1K56 D;  3ZFZ A;  3WWX A;  3QNC A;  3VP2 A;  3F1P A;  1NRF A;  5DJT A;  5DF7 A;  4WL9 A;  1KE3 A;  3MXR A;  5EVE A;  4UQI M;  5TR7 A;  2ZLY A;  4R4S A;  3C7U A;  2XD1 A;  3IS2 A;  1F9I A;  3NDE A;  3O5Y A;  3SH9 A;  2Y2N A;  3M2J A;  3N7W A;  4JF6 A;  1BZA A;  3DTK A;  3Q81 A;  2EXB A;  3SS5 A;  2VGJ A;  4R38 A;  1RGY A;  4OPQ A;  2HDS A;  1L2S A;  3T4J A;  1D7E A;  5IHV A;  4OP5 A;  3RFB A;  3BM6 A;  2HJE A;  2Y59 A;  2W3E A;  2XRO A;  1ODV A;  5EVI C;  2PYR A;  4WLA A;  4Y0U A;  1Q2Q A;  3SW1 A;  3OOV A;  3QP1 A;  4DE1 A;  5EVI A;  2JKG A;  5M18 A;  5G4Z A;  2IA2 A;  3EGD C;  1OJ5 A;  2V8C A;  4KZ9 A;  4N1X A;  2O9C A;  4N92 A;  4DJ3 A;  3PTE A;  1PYY A;  1MWS A;  4IBR A;  1GSX A;  1KE4 A;  1JVJ A;  2Y2L A;  1SCW A;  4EV4 A;  3C8C A;  4II7 A;  1WE4 A;  3U4L P;  5EOO A;  4WZ5 A;  1XGI A;  2WKR A;  1CF0 A;  4K0X A;  4HES A;  3M6B A;  2Y55 A;  3QNB A;  1T1C A;  2QMI A;  2C6W B;  3GQZ A;  1DJC A;  2J9O A;  3VFH A;  4QWO A;  2HGV A;  1I2W A;  4B9O A;  4S2L A;  4DRT A;  4Z1W A;  4P6B A;  4QU3 A;  4IUK A;  4OQH A;  2QJ7 A;  5KSC A;  3MMH A;  4JGO A;  4OH0 A;  1XJ4 A;  3T50 A;  3V50 A;  1TS8 A;  5CGS A;  4BL2 A;  5EVI D;  3OPR A;  3UB9 A;  3N6I A;  3DW0 A;  5FEG A;  2XH9 A;  4FTX A;  1UWP X;  3A3I A;  2HJ9 C;  4HBU A;  5L10 A;  1CEF A;  4Q8I A;  1W7F A;  4P6Z M;  4GLQ A;  5DVA A;  1NRJ A;  1XA7 A;  3BFD A;  1PZO A;  4DE3 A;  3HLG A;  4MNR A;  2ZL1 B;  1TF1 A;  4S2N A;  1ERM A;  3ULF A;  1P97 A;  4LFU A;  4NKP A;  4S2P A;  3NI9 A;  1FIK A;  4NEE D;  3ZYT A;  2RL3 A;  2V0U A;  4BJP A;  2H0Y A;  4P0M A;  2ACG A;  4FD8 A;  3QP4 A;  2XQZ A;  4Y5F A;  2XLN A;  1GA9 A;  2ZQA A;  5KIZ A;  5K5B A;  4WMC A;  2WZZ A;  1VB6 A;  1T18 A;  4PPR A;  1XFN A;  1K38 A;  3VOL A;  5FI7 A;  5IS1 A;  3O86 A;  1ES5 A;  3NOP C;  5HDD A;  2CC1 A;  5HL6 A;  4KQO A;  5CHU A;  3QP8 A;  3BLS A;  3PXP A;  1ZG4 A;  4EU0 A;  1OME A;  5E2G A;  2ZL1 A;  1E4D A;  3JYI A;  3T4S A;  4DXB A;  2HP5 A;  3DWZ A;  2WGW B;  4GOG A;  3ITA A;  4PKY A;  1O7E A;  4XXR A;  1FR6 A;  5HPI A;  5FQQ A;  5FA7 A;  5EV0 A;  1RP5 A;  3MSH A;  5HX9 A;  5A93 A;  1W63 M;  3S7P A;  3FZC A;  1K4E A;  3LI8 A;  4OP8 A;  3BFF A;  1G5U A;  4GZB A;  3C2W A;  2ZM8 A;  1Z6F A;  4FOF A;  1FQG A;  4X25 A;  4N1H A;  5CEB A;  3N8L A;  4WZ4 A;  4EQ1 A;  4LGW A;  4OPZ A;  3JVU A;  1FOF A;  3H7W A;  4DE2 A;  5HWV A;  2WAD A;  1OTB A;  4WMC D;  3PAE A;  5L2F A;  3LIB A;  2KDK A;  1U60 A;  3EOI A;  5FI2 A;  3MZF A;  5A90 A;  4M3K A;  2VX8 A;  4OOM A;  4N9K A;  5LBR A;  4CLC B;  4FCF A;  5GLC A;  1K0K A;  4IJG A;  4IHQ A;  4BWI A;  1T1A A;  3ZDJ A;  1ESI A;  4JKT A;  1T19 A;  4LRY C;  3IXH A;  1WA9 A;  4CQH A;  4I38 A;  4EQI A;  3PR6 A;  3HLW A; 
#chains in the Genus database with same CATH homology
 5AVE A;  5KSH A;  1F98 A;  3UB7 A;  2M7V A;  4RQ9 A;  4I3I A;  2EA9 A;  3BQ8 A;  3CIT A;  3E4Q A;  3JVV A;  1TD5 A;  3MR0 A;  2QYB A;  4DN0 A;  1P0Z A;  2GJ3 A;  1MZU A;  4R6L A;  5CX7 A;  5HDC A;  1JNU A;  2O9A A;  1XJ6 A;  2B02 A;  1W63 Q;  3U2A A;  3P01 A;  3T4K A;  2QKP A;  4LRZ E;  1DP8 A;  4G3K A;  1S1Z A;  3R7W A;  2V1A A;  5AVF A;  4PAU A;  3KSG A;  2OAP 1;  2W27 A;  2QWS A;  3LIE A;  2VV6 A;  3UMD A;  2FZ0 A;  3A0S A;  4NXF A;  4KQD A;  4CLC A;  3OC2 A;  4WEJ A;  2VV7 A;  4O0P A;  1TS6 A;  4AFI A;  1UGU A;  2XRN A;  3MF0 A;  1S4R A;  2EWV A;  3PHY A;  4B93 A;  3MQO A;  3H82 B;  2MJ6 A;  3UME A;  5IT5 A;  5TBM A;  4L9F A;  4R3A A;  4MN5 A;  2WKQ A;  2D01 A;  2OAQ 1;  2A24 A;  3UB8 A;  2LB9 A;  1NWZ A;  3NJA A;  3KYQ A;  3FPV A;  4F3L B;  2PR5 A;  3EEA A;  3CAX A;  2W3H A;  2O99 A;  4MMN A;  4JGP A;  3PBQ A;  4Y2F A;  2GNX A;  3NOT C;  2KOI A;  3T4O A;  3S7Q A;  4K08 A;  4HOI A;  4KUK A;  3HJK A;  5F5Y A;  1H8M A;  2P04 A;  3E4P A;  3FG8 A;  2L1M A;  3HCY A;  4HJ6 A;  2NUP C;  4L9E A;  3EEH A;  2YKF A;  3K2N A;  4YNR A;  4WEK A;  3IS2 B;  5F68 A;  4GS9 A;  1GSW A;  5IU1 A;  1LSW A;  1OT9 A;  4CLC D;  3BW6 A;  3TRC A;  2NUT C;  3F1N B;  2K2N A;  1LL8 A;  2VGL M;  3H82 A;  4HNB A;  5A8B A;  2ZOH A;  3IBJ A;  5HD3 A;  3NOU C;  2I9V A;  3D3O A;  2EWW A;  3MQ0 A;  5J4E A;  3ZQ5 A;  5F69 A;  3W2Z A;  4BMW A;  4F3L A;  4HHD A;  2VGL S;  2GZA A;  3TE8 A;  1X0O A;  3BQA A;  4MN7 A;  3VV4 A;  1YSP A;  4ETX A;  1G6O A;  3E98 A;  5DJU A;  2PYP A;  3OCL A;  1OJG A;  5DKL A;  2M7U A;  3F1P A;  4GJ4 A;  2W0N A;  5DJT A;  2ZMV A;  5HZH A;  3LID A;  4WL9 A;  5HWW A;  2K7S A;  3CUE C;  3KYZ A;  4IUH A;  2VZW A;  4UQI M;  2PD7 A;  4I3A A;  4HI4 A;  3LIA A;  3CUE A;  4HH3 A;  2ZMF A;  1F9I A;  3IS2 A;  3VE4 A;  3RH8 B;  1D06 A;  2VLG A;  3O5Y A;  3FPW A;  2V0W A;  3KSF A;  5MC7 A;  5F6A A;  2CMN A;  5DKK A;  2PDR A;  4EW7 A;  4PKY G;  3F1N A;  4CLC C;  1KOU A;  1G28 A;  3PBT A;  4FSF A;  3S7O A;  4LPZ A;  2JKR I;  3FC7 A;  4I39 A;  4R38 A;  4E04 A;  4H6J B;  3B47 A;  3K3D A;  3MQQ A;  3T4J A;  4I3J A;  2Y79 A;  3LR0 A;  1D7E A;  1LSV A;  3D72 A;  2J80 A;  4XT2 B;  4EEU A;  3A0R A;  2BAS A;  3RFB A;  3VE3 A;  1S1Y A;  2HJE A;  2W3E A;  2XRO A;  3H7W B;  1ODV A;  4BBT A;  2PYR A;  3PYP A;  4WLA A;  3SW1 A;  2KX6 A;  2PD8 A;  3OBF A;  3OOV A;  3LFV A;  4WUJ A;  4YOF A;  5L8M A;  3A0V A;  4GHI B;  5G4Z A;  2IA2 A;  4MN6 A;  3EGD C;  2B18 A;  1H3Q A;  1OJ5 A;  3KO6 A;  5HPF A;  2O9C A;  4DJ3 A;  1UWN X;  2GX5 A;  1OTE A;  1S66 L;  2VJW A;  1GSX A;  3EGX C;  1LT0 A;  2OWJ A;  1TS7 A;  1ZHH B;  1N9L A;  5HWT A;  2HF6 A;  3LR4 A;  4Y3I A;  2DMW A;  1BYW A;  3C8C A;  3P7N A;  2PT7 A;  3CWF A;  1YKD A;  3LUQ A;  4II7 A;  1DRM A;  3LYX A;  3BJN A;  3LIC A;  4HP4 A;  3PBN A;  3UB6 A;  2VA0 A;  2OOL A;  1MKM A;  2QHK A;  2WKR A;  3S7N A;  1NLZ A;  3LR5 A;  2JKT M;  1T1C A;  3KSI A;  4MCW A;  1GSV A;  3LR3 A;  4EER A;  4LLO B;  2YKH A;  4H6J A;  5HD5 A;  5J7E A;  3BY8 A;  4ETZ A;  3TW8 A;  2HGV A;  4CLC E;  3T4T A;  3T4L A;  4XT2 A;  4B9O A;  1V9Y A;  4Z1W A;  4Q0I A;  4BBV A;  2W3G A;  4IUK A;  4GW9 A;  2QJ7 A;  3KSH A;  4QPR A;  3E4O A;  5EFW A;  3MMH A;  3MXQ A;  3LIF A;  4GCZ A;  1XJ4 A;  4JGO A;  5HSQ A;  3LI9 A;  3F1O B;  4BBU A;  1IOU A;  3T50 A;  5DFY A;  1OPX A;  2JKR M;  4GHI A;  1TS8 A;  1XJ2 A;  2V9A A;  3UB9 A;  4EXO A;  2Z6D A;  3IBR A;  5FL3 A;  3H9W A;  1UWP X;  4KUO A;  2HJ9 C;  4ZRR A;  2O0Y A;  3GEC A;  3EQV A;  2M1C A;  3C30 A;  2JN7 A;  2H28 A;  3B42 A;  4P6Z M;  4GLQ A;  1OTD A;  1NRJ A;  3E0Y A;  1TF1 A;  3PBR A;  4YWZ A;  3K3C A;  2P08 A;  4O8G A;  3ULF A;  2K31 A;  5TJJ A;  2JKT I;  1VHM A;  1STZ A;  4HIA A;  2L4R A;  1P97 A;  4NKP A;  4L0L A;  4NEE D;  1P9R A;  5I5L A;  3ZYT A;  5C5K A;  3G6O A;  2A24 B;  4DJ2 A;  4PHT A;  2V0U A;  1P9W A;  4BJP A;  4Q0H A;  4HY8 A;  2VV8 A;  3B33 A;  4UQI S;  4NXB A;  3BY9 A;  2PR6 A;  2XA7 M;  2W1R A;  3T4Q A;  4L9G A;  4Q0J A;  3F1O A;  1S67 L;  2G7U A;  3EWK A;  4Y5F A;  3OLO A;  4UEY A;  4MDZ A;  5KIZ A;  5K5B A;  1VB6 A;  2VEA A;  1T18 A;  1XFN A;  3OCN A;  2XA7 S;  3VOL A;  5IS1 A;  2J3W A;  3NOP C;  5HDD A;  5HL6 A;  3R4K A;  4KQO A;  2VKS A;  4EET B;  2W3D A;  3DBA A;  3PXP A;  4GS9 B;  4HQA A;  2PHY A;  4ME4 A;  4EU0 A;  1ZTU A;  5G4Y A;  4HP9 A;  2ZOI A;  3T4S A;  4R70 A;  3C38 A;  3HJI A;  2J3T C;  4LRX C;  4I5S A;  2KLI A;  3CI6 A;  4OOL A;  2INW A;  2XSS A;  4PKY A;  1LSX A;  4ARZ B;  1NLY A;  2D02 A;  4G3V A;  4HJ4 A;  5HPI A;  3ICY A;  1XFQ A;  4DMZ A;  4EEP A;  3MJQ A;  2W1T B;  2Z6C A;  1OT6 A;  1W63 M;  3PBO A;  4NXE A;  3S7P A;  2P7J A;  3EQU A;  4O01 A;  4EUV A;  3LI8 A;  4HJ3 A;  2JHE A;  2FH5 A;  3KX0 X;  2OWH A;  4NXG A;  5DFX A;  3C2W A;  1YAX A;  2W3F A;  4FOF A;  3V67 A;  1S4S A;  3NHQ A;  1F5M A;  3F1P B;  4EQ1 A;  2LB5 A;  1EW0 A;  4G3W A;  5AJG A;  1V9Z A;  1Y28 A;  3RTY A;  3PBS A;  2A2L A;  2Y8H A;  1T1B A;  2O9B A;  1YSQ A;  3GDI A;  3JVU A;  3H7W A;  3UE3 A;  5HWV A;  1OTB A;  2QJ5 A;  3LIB A;  2L0W A;  3UE6 A;  2WKP A;  2KDK A;  4WF0 A;  4WN5 A;  4HH2 A;  4JGR A;  3EOI A;  1MC0 A;  1TS0 A;  2ZBB A;  3MFX A;  3R7W B;  1DP9 A;  1OTI A;  2VX8 A;  4OOM A;  5HDS A;  5LBR A;  4CLC B;  2V1B A;  3BWL A;  4ARZ A;  4EES A;  3CLO A;  4WEL A;  2R78 A;  4IJG A;  4IHQ A;  1IFQ A;  2J3T D;  4BWI A;  1T1A A;  3TJZ C;  2W1T A;  2HV1 A;  1T19 A;  4LRY C;  1N9N A;  1WA9 A;  1DP6 A;  1N9O A;  4M4X A;  5J3W A;  4JGQ A;  5TBM B;  4CQH A;  4I38 A;  1XJ3 A;  1OTA A;  3PR6 A;  4P6Z S;  5DF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...