3LUQA

The crystal structure of a pas domain from a sensory box histidine kinase regulator from geobacter sulfurreducens to 2.5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
112
Chain Sequence
SDERLRLFTEHAPAALAMFDREMRYLAVSRRWREDYGLGDGDILGMSHYDIFPEIGEEWKSVHRRGLAGEVIRVEEDCFVRGRTQWLRWEVRPWYEGEGRVGGVVIFTEDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a PAS Domain from a Sensory Box Histidine Kinase Regulator from Geobacter sulfurreducens to 2.5A
rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
molecule keywords Sensor protein
total genus 21
structure length 112
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3luqA00
1TS8A 2HV1A 5F5YA 2YKFA 3H7WB 3LICA 1XFNA 4GHIA 1OTIA 3F1PA 4NXBA 4EETB 1OJ5A 4HY8A 1BYWA 4NXEA 2VLGA 2W27A 2V9AA 1LSVA 2VV8A 2WKRA 2KX6A 1DRMA 3PHYA 4WN5A 3P7NA 3FG8A 1UWPX 4HIAA 4HOIA 2D02A 4NXGA 1X0OA 1OTEA 2L0WA 1DP9A 3K3CA 4KQDA 1XJ3A 1WA9A 2V0UA 1D7EA 1S66L 2VV6A 3C2WA 1XJ2A 3EWKA 4HNBA 2KDKA 5DJTA 3UB9A 4GS9B 1KOUA 1OJGA 3LIFA 4HI4A 3NHQA 4JGRA 5HSQA 4WF0A 1UWNX 3LUQA 4KUOA 4LRZE 2PYRA 3UB8A 3MXQA 1GSVA 4R6LA 3RTYA 2PD8A 3LIDA 3ICYA 2JN7A 4K08A 4EEPA 2QJ5A 5IU1A 3RH8B 1S1YA 2QKPA 3LI9A 3MQOA 4I39A 5F6AA 3VE3A 3MJQA 1VB6A 5F69A 5J3WA 4BBTA 4F3LA 2P7JA 4LRYC 4JGOA 1G28A 4MN5A 2CMNA 2D01A 4I3AA 3LI8A 1S67L 5DJUA 5HD5A 2W0NA 5HWTA 3ULFA 3UMEA 4L9GA 3UB6A 5HD3A 1ODVA 3LIBA 4EXOA 2ZBBA 2PHYA 4JGPA 3C8CA 2OWJA 1GSWA 2Z6DA 3H9WA 4H6JB 4MN6A 1S4SA 4R38A 3F1PB 2R78A 4YWZA 1OTBA 1XJ6A 4GCZA 1Y28A 3F1NA 1LT0A 5HWWA 1XFQA 3F1OB 4EQ1A 4EW7A 2ZOHA 4LLOB 4HJ6A 2PDRA 4HH3A 4EERA 3LYXA 3CWFA 1D06A 2YKHA 3IS2A 1T1CA 5J4EA 5A8BA 2K7SA 3BY9A 3BWLA 2ZOIA 3F1OA 4NXFA 2I9VA 1P0ZA 2PYPA 2V0WA 3OLOA 1T18A 2BASA 3BY8A 3H82B 1NWZA 4L9FA 1F98A 5DKLA 3CAXA 4HJ3A 4DJ3A 1S1ZA 4I3JA 5HZHA 1T1AA 3VOLA 2B02A 1T19A 1N9NA 4JGQA 4EESA 1MZUA 1UGUA 4GHIB 5EFWA 3VE4A 1TS6A 4I3IA 1LSWA 1OTAA 3NOUC 2OWHA 2VEAA 2INWA 2J80A 2L1MA 3LIAA 3GDIA 3B33A 1LSXA 2A24B 1JNUA 2PD7A 3A0SA 1EW0A 1V9YA 2OOLA 2QWSA 3HJIA 4HQAA 1F9IA 1OT9A 3G6OA 2H28A 3H82A 3E4QA 4GW9A 4HHDA 4EEUA 1S4RA 4HP9A 3E4OA 5AVEA 3NOTC 3GECA 3UE6A 5AVFA 5J7EA 2QHKA 2Z6CA 4LRXC 2QJ7A 1DP6A 4H6JA 4I38A 3ZQ5A 3PYPA 2A24A 2PR5A 1TS7A 1T1BA 4GS9A 4DJ2A 1GSXA 4XT2A 4R3AA 3MQQA 2M1CA 2V1BA 5HDCA 4R70A 5HDSA 3SW1A 1XJ4A 2EA9A 3NOPC 4HJ4A 4M4XA 3T50A 3UB7A 4BBUA 4E04A 3UMDA 5KIZA 1OTDA 1P97A 3KX0X 1N9OA 1OT6A 4I5SA 5I5LA 2PR6A 3E4PA 3IBRA 1LL8A 2V1AA 3MR0A 3A0RA 4WL9A 3MFXA 3HJKA 2WKQA 4WLAA 4BBVA 2JHEA 1TS0A 4PKYA 4PKYG 1DP8A 2WKPA 1N9LA 4HH2A 4WUJA 3D72A 5G4YA 3FC7A 2L4RA 4L9EA 5HDDA 3H7WA 4F3LB 3CLOA 3LIEA 4KUKA 3A0VA 5F68A 4LPZA 3K3DA 4XT2B 5G4ZA 1V9ZA 3NJAA 4RQ9A 5IS1A 5TBMA 2GJ3A 2VV7A 5DKKA 3IS2B 3EEHA 5TBMB 4HP4A 3F1NB 4B9OA 5HWVA
chains in the Genus database with same CATH superfamily
2OV5A 4B4XA 4OVDA 4MBFA 3HBRA 1OJ5A 3OC2A 1QMFA 2V9AA 4P6ZM 4ZJ2A 1UWPX 3HLBA 5L10A 3PBTA 2PT7A 2HJ9C 2JC7A 4HI4A 2B18A 4KUOA 2VA0A 4PM6A 1WYBA 4P0MA 1IKGA 3MJQA 4KZ8A 4JF4A 5KSHA 4JBFA 4CLCB 3W4QA 4YOFA 4JGPA 1KE4A 1NLZA 3S7QA 4O8GA 2EX8A 1BLPA 5CHMA 1PZOA 1I2WA 3RJUA 3IS2A 1KE3A 1Z09A 3IXGA 1YLZA 2V0WA 4FH4A 1S1ZA 4B93A 5HZHA 3S4XA 3TSGA 2IWDA 4JGQA 2VGLS 5FA7A 1TS6A 1FQGA 4WZ5C 2JBFA 2INWA 5GLDA 3T4QA 1SCWA 3T4OA 4E3NA 2P9VA 3E4QA 1JTGA 3MSHA 4HP9A 3LR4A 2X02A 2P9VB 4IJGA 3FKVA 1BUEA 5DFYA 3E4PA 2QMIA 3HJKA 1SHVA 4FTXA 3RXWA 3FC7A 3H7WA 3NIAA 4X55A 2X01A 3SH9A 4QD4A 2FFYA 2GJ3A 4MLLA 3IBJA 4GD6A 4MDZA 2M7VA 1YKDA 2ZC3B 3HUNA 1W63Q 3JYIA 4LGWA 5E2FA 2XA7M 3GR2A 1RGYA 2HGVA 4HOIA 3IXBA 4WEJA 1WA9A 2K31A 4GS9B 2Y55A 2BTFP 1GSVA 3BEBA 1MWRA 4K0WA 4EQIA 4CPKA 3LR3A 1G28A 2J3TC 4MMNA 3WRTA 2QYBA 3WRZA 3LI8A 5HD5A 1ZKJA 3KSHA 5HD3A 4EV4A 3CG5A 3ZG8B 1GSWA 5IS1A 3JVUA 2R78A 1PW8A 4OONA 3PBRA 1XFQA 3F1OB 1MXOA 3LYXA 4Q8IA 4QWOA 3BY9A 3BWLA 3LEZA 3BJNA 1KGEA 3F1OA 3OPLA 3BY8A 5FQKA 1ZTUA 4OPQA 2KOIA 4D2OA 3VV4A 4FSFA 1GA0A 5FDHA 3IXHA 1H0MA 1JNUA 4QY5A 1PZPA 3CJMA 4HHDA 1L2SA 4EEUA 1IYQA 2VX8A 3BQAA 5L07A 2HDSA 1EROA 4GS9A 2VGJA 4B4ZA 4JKTA 4KZ7A 2UWXA 4N1XA 5TR7A 1JTDA 1P9WA 3NBLA 5KIZA 3EEAA 3MFXA 4IVKA 5DTSA 2ZQAA 4JXSA 1N9LA 2W3FA 2L4RA 2WZXA 3TG9A 2H0TA 1JVJA 5CGXA 2K2NA 3G2ZA 4RVAA 3BLMA 1TDLA 5IT5A 4GB7A 5F5YA 2O9BA 2DMWA 1OTIA 2Y2MA 1IYSA 4LV2A 4B88A 1RGZA 4NXEA 5EVEA 2KX6A 3VOYA 4C75A 3FG8A 5EECA 4WEKA 2V0UA 1S66L 4HNBA 1IELA 4C6YA 2KDKA 1OJGA 3M6BA 1FR6A 3N8LA 1Z6FA 2O0YA 5F6AA 2B5RA 4I3AA 2Y2OA 5AQ7A 4L0LA 1ES5A 1OPXA 2OWJA 3OOVA 4H6JB 1SKOA 1U60A 4OPZA 1NY0A 3KSGA 4EW7A 4HJ6A 4ESPA 1T1CA 3N7WA 3LR5A 4IEDA 4DJ3A 3VP0A 5M1AA 5HPIA 1K56A 3NULA 3VE4A 1XA7A 1G6OA 3Q82A 3LIAA 2J8YA 3CUEA 3GTCA 3DAVA 4HQAA 2EXBA 1MC0A 3FZCA 2HP6A 2PBYA 5HAIA 2VK3A 3TE8A 2QJ7A 2PR5A 1T1BA 3B3XA 3SW1A 4HJ4A 3ZVTA 4DE2A 2G7UA 1OT6A 3G32A 4Y0TA 3CLOA 2XH9A 2A49A 2V2FF 1QMEA 2GDNA 5FAQA 5FQMA 3CMZA 3EEHA 5DTTA 4XXRA 5HWVA 3QHYA 3H7WB 3G2YA 3EGXC 2J7VA 1BYWA 1LSVA 3P7NA 4HIAA 1WYCA 5HW3A 3SH8A 4NK3A 4HBUA 1E3UA 4JGRA 3T1SA 2JCHA 4QJGA 5IU1A 2ZQDA 3LI9A 5BOHA 5GHZA 2P7JA 3FV7A 3NDEA 4MN5A 5FSRA 3D3OA 3DBAA 1MY8A 2XGNA 5A92A 3N6IA 1BLCA 2ZBBA 2Y2GA 2WADA 4CLCA 5DF9A 1CJFA 4DRTA 3KSFA 2ZQ8A 1NXYA 4Y2FA 3IWOA 1XGJA 5AQ9A 3GV9A 3CUEC 3B42A 3DTEA 4FD8A 3UPNA 5FQQA 3G34A 2WGVA 3UE1A 4L9FA 4DMZA 5DKLA 1E3UD 4I3JA 3VOLA 5DF7A 3I7JA 3OCNA 3B33A 4BENA 2Y2JA 3FPVA 1TVFA 2MJ6A 1PRQA 3SS3A 4ETZA 5J7EA 5CX7A 1SKOB 4G3VA 3ZQ5A 2V1BA 1ZG6A 3G30A 1NJ4A 2P08A 3Q1FA 3T50A 3NECA 4EU0A 4KZAA 1MWSA 3V50A 1YM1A 3NCKA 4S2NA 4X56A 5DTKA 2E8IA 4WZ4A 4OQGA 5FEGA 4S2IA 2R9WA 5EV0A 4JXGA 1VETA 2OAQ1 5A91A 1YLYA 3WWXA 4PAUA 4IBRA 2V8CA 1DP9A 3IF5A 5GLAA 4UA9A 3EOIA 4OLDA 2WZZA 5EOEA 2PD8A 4K08A 1O07A 3QP4A 2WAEA 3AGFA 1K6SA 1KVLA 2XSSA 4X1MA 4ZJ3A 4GLQA 2OLVA 2Y79A 4H8RA 1XKZA 1GHIA 4GCZA 1S0WA 1TD5A 4EQ1A 3PTEA 4E6XA 5KMWA 1YSQA 4O7DA 1BT5A 4XUZA 5E2HA 3R7WA 1F98A 4UA6A 3BFCA 4OQHA 3V39A 3VFHA 1K4EA 3ITAA 4PMAA 1UGUA 1MWUA 2G2WA 5C5KA 1N9BA 2VEAA 3QNBA 1L0EA 1F9IA 1VQQA 2W1TA 4R3BA 3OBFA 5AVFA 4YNRA 3TOIA 4DE3A 2W3HA 2RCXA 4WMCD 3IXDA 2ZM8A 3T4KA 4ARZA 5AQBA 3MZEA 4PKYA 3V3RA 5HDDA 4II7A 4F3LB 1LHYA 1V9ZA 3T1QB 1LLBA 3C38A 1PYYA 2W3GA 1PW1A 4C3QA 5CTNA 3MXSA 3TJZC 2WKRA 4JF5A 2D02A 2W3DA 4E6WA 3FYZA 4BD1A 5FI6A 4NG2A 4R3JA 5L09A 4EEPA 4OQ0A 1ZG4A 4I39A 4BBTA 5HWTA 1J9MA 1YAXA 4N9LA 4EXOA 2P04A 3CPTB 5L8MA 1IOUA 4UA7A 1ESUA 3F1NA 3TRCA 1D06A 4E3MA 4OOLA 2ZOIA 3SZTA 2BASA 4UHUA 1HD8A 1GCEA 3S7PA 3KSIA 4EESA 4X68A 1LSWA 4KG6A 5DF8A 3GDIA 2IA2A 4BLMA 1SDNA 4OLGA 1KE0A 3SH7A 2Y2QA 1OT9A 2PU4A 4EUVA 4GW9A 2I72A 2VJWA 2J9OA 4GNUA 1ZHHB 1GSXA 3AGEA 4XT2A 3MQQA 5HDCA 5TJJA 4R70A 4Y0OA 3T4SA 3UMDA 1W63M 2XR0A 2CC1A 1MKIA 1K0KA 3LR0A 2WKPA 3S7OA 2OSUA 4RQ9A 3F1NB 4WZ5A 4O0PA 1XFNA 4N9KA 1G68A 4HY8A 3O86A 4R0QA 3HUMA 3WS2A 2WYXA 4X53A 2ZL1A 4EWFA 1XJ3A 3BLSA 5F83A 5DJTA 3UB9A 3VFFA 4PPRA 3ZCZA 1NRJA 2FZ0A 3NHQA 4ZRRA 2DCFA 3S7NA 2PU2A 5EPHA 1ES2A 3ICYA 3S22A 3E0YA 1W7FA 4YINA 3Q07A 3CITA 3U4LP 1ODVA 1IKIA 3MKEA 4DXCA 3QP6A 4MN6A 4R38A 4YWZA 1OTBA 1NYMA 4E3LA 4UAAA 3HLFA 2HP5A 3CI6A 4NKPA 1T18A 1LL5A 2Z2MB 1HVBA 1T19A 1N9NA 1D1JA 5FQIA 3SOIA 1BLSA 1ONGA 3SS5A 3RFBA 1LSXA 2PD7A 1V9YA 4P85A 3TW8A 3FWLA 1ES3A 2JKRI 4R1GA 3W4PA 4S2KA 4DDYA 5A93A 4OOMA 3UE6A 4LRXC 2IWBA 5HDSA 2C6WB 3HLGA 2DRWA 4LCLA 5E2EA 4O01A 2PR6A 3MR0A 3A3DA 2WKQA 1M6KA 4BBVA 2WGWA 4HH2A 4EUZA 3OPRA 3LIEA 4JF6A 3O87A 2VV7A 4UQIS 1SZVA 3IF6A 4GHIA 4U3TA 5KZHA 4WBGA 4NXBA 1ERMA 4EETB 2BLSA 4Z9QA 4OKPA 1D7EA 3UPOA 2WKIA 4WF0A 5EVIA 2PYRA 4FCFA 4Y7PA 4DE0A 5CERA 4LRYC 3D9YA 4WM9A 2PRFA 1YLWA 3VP1A 2PHYA 3NDGA 1S4SA 1CEGA 1C3BA 3EQUA 2ZOHA 2LB9A 5GLCA 4CJNA 4F94A 1H8YA 5J4EA 3L7HA 3W8KA 3UB7A 3HL9A 3QP2A 3CAXA 5G18A 1BLHA 1T1AA 5M19A 2NUTC 3HLWA 3C7VA 5CEBA 4UEYA 3A3FA 2OWHA 2L1MA 3DTKA 1MKMA 3A0SA 4Y15A 4D60A 4BD0A 3NOTC 2Z6CA 2Q9NA 3IX4A 4GZBA 2Y4AA 4QY6A 4KZ5A 5EE8A 5HX9A 3BYDA 1NRFA 1TS0A 2JHEA 3BRMA 3D72A 1XA1A 2O99A 1I5QA 2XF3A 1JWVA 5EUAA 1NZUA 1Y54A 3LICA 4GDNA 5EVLA 3C7UA 3UO9A 2JKTM 1PFLA 4WN5A 4BWIA 4X25A 3P01A 3LCEA 5F82A 5U47A 3KO6A 1WE4A 1ONHA 4KENB 3C5AA 5FQ9A 1S1YA 5FAOA 3MXRA 5DJUA 3QP1A 3IX8A 4Q0HA 2DNSA 5I94A 2PBDP 3T1RA 3UY6A 3F1PB 1AWIA 4RX3A 1XPBA 4DF6A 2ZQCA 3T12B 4QU3A 2ZD8A 3ZDJA 2H10A 1JWPA 3V5MA 4OP8A 3EGDC 4BBUA 1K55A 2XQZA 2HJEA 3PR6A 1MZUA 1KVMA 5TGFA 4JPMA 4K0XA 3T1XA 2KLIA 4KQQA 3PXPA 2QHKA 2C5WB 5A90A 3PYPA 2A24A 2JKRM 1K38A 5HPFA 4MNRA 3QP5A 4QHCA 4FH2A 4A5RA 1N9OA 1G6AA 2V1AA 4PKYG 1DP8A 3WS0A 5FI7A 4BL3A 3C4PA 1XGIA 5F1GA 3GVBA 3MQ0A 3G6OA 3A3JA 1TS8A 2HV1A 2Y59A 2WGIA 4GKUA 4NETA 2UV0E 2XD1A 4S2PA 3LY3A 3KYEA 1KDSA 4R4SA 2HDRA 1NLYA 2XD5A 4EBNA 3EWKA 4FUWA 1FCMA 1UWNX 3LUQA 3BW6A 2EX6A 3BFEA 3O5YA 3WS4A 1HZOA 3RH8B 1GHPA 4IHQA 4G3KA 1YLTA 4KQRA 2D01A 1TEMA 3R4KA 2FH5A 3K2NA 4QB8A 1J3WA 3UB6A 3DWKA 3IQAA 4EBLA 2Z6DA 1H3QA 4CQHA 3HLEA 3MS6A 2J3WA 2VGKA 4LLOB 5A8BA 5FDSA 1F5MA 4KG2A 3OLOA 1BZAA 3QNCA 4ZJ1A 3G35A 1PWDA 4CLCE 3ZVWA 1L0GA 4R4RA 4GJ4A 3VP4A 1W79A 4S2MA 4LENA 5AVEA 4I38A 1DP6A 2HDUA 1TS7A 4M3KA 4P6BA 4LFUA 4E04A 1E4DA 1P97A 4I5SA 4RX2A 5I5LA 1Q2PA 3A0RA 1I2SA 1YMXA 1JWZA 1H5XA 3LO7A 3PAEA 5F68A 1N4OA 1AXBA 4DJ2A 3MKFA 5E2GA 3IH9A 3MZDA 5KSCA 4MBHA 4JLFA 1M40A 4NXGA 4KQDA 1FOFA 4N92A 1XJ2A 5MC7A 4LRZE 4FOFA 4WELA 4R6LA 3AGDA 4E3OA 3IHBA 2QJ5A 3UN7A 5E43A 3T4JA 3ZG9B 5F69A 3E2KA 3BQ8A 3IX3A 1S6RA 2CMNA 3GSGA 3MF0A 1F2KA 3ZFZA 4ARZB 2IWCA 4KG5A 5FL3A 4DXBA 4GD8A 4OP5A 3W4OA 2ZLYA 1K25A 5EM1A 1GHMA 1NWZA 2GX5A 3Q7VA 2QPNA 2ZMAA 4GHIB 3DWZA 3UE3A 3ZGAB 2V1ZA 3NI9A 4WMCA 2Y2NA 2OOLA 2G2UA 2Z2LB 2XFTA 3NY4A 1SDEA 3A3IA 3FPWA 4H6JA 3DTIA 3T4LA 4M4XA 1CI8A 1FILA 2Y2PA 3IS2B 4HP4A 3UE0A 3ZG0A 5EVIB 3OZHA 5LBRA 4BL2A 5M18A 5CGWA 2GZAA 4KZ3A 5EM0A 3P98A 2W27A 2EFUA 3EQVA 5TFQA 5HAPA 3ZHHA 4OPYA 1OTEA 4Y0UA 3GRJA 1XXMA 4P87A 4R23A 4JXVA 3VSLA 1ES4A 1L0DA 4S2OA 4U0TA 4PM9A 2P74A 4CLCD 4LV3A 3MBZA 4IUHA 3PBNA 4Z1WA 4ETXA 1ESIA 2Y2IA 2WK0A 1CQAA 4HESA 1HTZA 1Y28A 5AJGA 5FEFA 3PAGA 4MN7A 2PDRA 1W8YA 3N8RA 4NXFA 4Y5FA 4U0XA 1BSGA 4EBPA 3Q7ZA 1KDWA 2XLNA 1OTAA 2JE5A 3NOUC 3A3EA 1DJBA 1PNEA 2H28A 4ID4A 4S2JA 3ZG7B 3FKWA 4NEED 1YSPA 1GA9A 4R3AA 3UDIA 2M1CA 4E3KA 2A2LA 3NOPC 3JPUA 5EOOA 5IHVA 2Y91A 4MBKA 4N1HA 2NUPC 3VOZA 4WYYA 1LL8A 1TDGA 2V8FA 5GHYA 4WLAA 4WUJA 1E25A 2ZQ9A 1OMEA 4OOYA 5G4ZA 3A0VA 3L9KA 3ITBA 4E3IA 4ZTKA 2X71A 2ZJ9A 3IH8A 5HFOA 3CPTA 3UDFA 2XFSA 3PBQA 3KYZA 2VLGA 2HP9A 1DRMA 1FSWA 4UQIM 1DJCA 2ZQ7A 2HPBA 2L0WA 2ZC4B 2BG1A 2ACGA 1EWZA 3M6HA 3CZDA 5FATA 1VB6A 5J3WA 5L2FA 4OQIA 3SS4A 4RA7A 4IUKA 1DY6A 3LIBA 3ZG5A 3LFVA 2ZMFA 4X1LA 2XROA 1Q2QA 5JYPA 1LI0A 5HWWA 2Y2KA 4KZBA 1FR1A 4HH3A 3CWFA 3MMHA 1DJAA 2ZC5B 2WKHA 3IHAA 4LV0A 4OPRA 3W2ZA 3O3VA 3H82B 3ZNTA 1A0KA 5CEDA 1MPLA 3BECA 5CGSA 3ISGA 2FFFB 4DN0A 5EVIC 5EFWA 1CF0A 4DKIA 2AVXA 4BMWA 3MFDA 1STZA 3D4FA 3E98A 3H82A 4MCWA 1S4RA 4X69A 3E4OA 2B95A 1O7EA 1PIOA 5CRFA 1LI9A 3MZFA 5CXWA 2W1RA 1K54A 1YLPA 5CHUA 2LB5A 1OTDA 3KX0X 1IEMA 3OPHA 1H8ZA 3Q7VB 5G4YA 2Y2HA 4JXWA 4Y17A 2WUQA 4KUKA 5GHXA 3WS1A 5TBMA 2ZMVA 5DKKA 1PI4A 2Q9MA 4B9OA 3VP3A 1Y4OA 4OH0A 3RXXA 3PBSA 2VZWA 1K57A 2VV8A 1CK3A 1L0FA 2VV6A 1VEUA 3OCLA 3VP2A 3E2LA 1ACFA 4MEZA 3RTYA 1NZOA 3LIDA 4G3WA 2V20A 1BULA 1H8MA 3GQZA 5HL1A 4F3LA 3BFGA 3U2AA 3G31A 4PM8A 1ZC2A 1S67L 5CHJA 1YMSA 1VETB 3VMAA 2EWVA 2J9PA 1FCNA 5EVID 3NC8A 4BJPA 3BFDA 2EFXA 3HREA 2VKSA 3LGOA 3IF6C 3V67A 3HCYA 4HJ3A 4KZ4A 5FASA 1K57C 2B02A 4K91A 2WAFA 4LV1A 2Y8HA 1K54C 3IWQA 3N8SA 1IYOA 1ERQA 3HUOA 4I3IA 4ZBEA 4RYEA 2J80A 4ZDXA 3S1YA 1EW0A 3UPPA 5DFXA 3HJIA 2HZ5A 5JYOA 3GECA 3O88A 2XRNA 4GOGA 4IVIA 2Q0OA 2ZM0A 1YQSA 2JKTI 2WKEA 2XK1A 3IBRA 3T4TA 3R7WB 1FIKA 3IWIA 5CECA 2EX2A 1K56D 4XT2B 3NJAA 3ZYTA 3LEQA 3B47A 4BQMA 5HL6A 1VEUB 2YKFA 2XA7S 1HLUP 1TF1A 1NYYA 2XDMA 3PHYA 1MWTA 3UNWA 1CI9A 1X0OA 1KGFA 3G4PA 3DW0A 4ZAMA 5GLBA 3LIFA 1BTLA 1PI5A 3UB8A 3MXQA 3HLCA 1W5DA 4QPRA 3IT9A 4JGOA 2WGWB 1YT4A 2W0NA 3HLDA 1G5UA 5FAPA 4L9GA 2Y2LA 1PWCA 5GL9A 4E3JA 5F1FA 1FSYA 3HVFA 2EXAA 2YKHA 4GDBA 5CTMA 2K7SA 2ZL1B 4S2NC 2PYPA 4AFIA 3Q81A 2VGLM 5FQJA 1YPRA 3LY4A 3N4IA 5D3OA 3V3SA 1YLJA 2OAP1 5J8XA 2HF6A 1ALQA 4Q0IA 4X6TA 1RCJA 2QWSA 5K5BA 4CLCC 1EI5A 4ME4A 2GNXA 4HEFA 3PBOA 5AQAA 2JKFA 1FCOA 4WL9A 4PM7A 1K6RA 4GN2A 2J3TD 2O9AA 1K4FA 3ZNYA 4DE1A 3K3DA 4PM5A 1IYPA 4KZ9A 4L9EA 5DVAA 1K55C 3VSKA 4P6ZS 3F1PA 4S2LA 2E8JA 3IF6B 4KQOA 1VHMA 3K3CA 1LL9A 2R9XA 2ZM2A 3C2WA 3UMEA 5HSQA 1KOUA 4LCMA 2A3UA 2W3EA 2W1TB 3UDXA 3M2JA 2JN7A 2QKPA 3MQOA 3VE3A 5FI2A 3JVVA 3P09A 2O9CA 1KGGA 2EWWA 2EX9A 2H5SA 3ULFA 3CHWP 2QZ6A 2ZC7A 2RL3A 3C8CA 3H9WA 4PHTA 4KZ6A 1XJ6A 1LT0A 3UB5P 4DDSA 4EERA 4XUXA 3DTMA 1XX2A 2OLUA 2I9VA 1P0ZA 4YFMA 3C4OA 1L3LA 2PAVP 2H0YA 3KYQA 1W8QA 2M7UA 1RP5A 4IBXA 2JKGA 1VM1A 4Y13A 5HAQA 1MBLA 2A24B 2XEPA 3C30A 1PWGA 3BFFA 2ZC6B 3M2KA 3QP8A 1P9RA 1XP4A 1XJ4A 2EA9A 3GMWA 1SKFA 4Q0JA 2HDQA 3OPPA 1IFQA 3BM6A 4Y3IA 5HARA 3WS5A 4LPZA 4HBTA 5TBMB 1CEFA
chains in the Genus database with same CATH topology
3LICA 2OAQ1 3PBQA 1OJ5A 4PAUA 3KYZA 2VLGA 3OC2A 2V9AA 2JKTM 4P6ZM 1DRMA 4WN5A 4BWIA 1UWPX 4UQIM 3PBTA 2L0WA 1DP9A 2PT7A 2HJ9C 3P01A 3EOIA 4HI4A 2B18A 3KO6A 2VA0A 4KUOA 2PD8A 4K08A 1S1YA 3MJQA 1VB6A 5J3WA 2XSSA 5DJUA 5KSHA 4Q0HA 4IUKA 4CLCB 4GLQA 3LIBA 4YOFA 4JGPA 3LFVA 2Y79A 2ZMFA 3F1PB 2XROA 1NLZA 4GCZA 4O8GA 3S7QA 5HWWA 1TD5A 4EQ1A 4HH3A 3CWFA 3IS2A 3MMHA 1YSQA 3EGDC 3W2ZA 4BBUA 2V0WA 3H82B 3R7WA 1F98A 1S1ZA 4B93A 5HZHA 2HJEA 3PR6A 4JGQA 2VGLS 4DN0A 1MZUA 1UGUA 5EFWA 1TS6A 5C5KA 4BMWA 2VEAA 2INWA 1STZA 3T4QA 2KLIA 3E98A 3T4OA 1F9IA 2W1TA 3H82A 3PXPA 3E4QA 4MCWA 1S4RA 3OBFA 3E4OA 3LR4A 4HP9A 5AVFA 2QHKA 4YNRA 3PYPA 2A24A 2JKRM 5HPFA 2W3HA 4IJGA 2W1RA 2LB5A 1OTDA 3KX0X 3T4KA 1N9OA 5DFYA 3E4PA 2V1AA 4ARZA 3HJKA 4PKYA 4PKYG 1DP8A 5G4YA 3FC7A 5HDDA 3H7WA 4II7A 4F3LB 4KUKA 1V9ZA 5TBMA 2ZMVA 2GJ3A 5DKKA 3MQ0A 3G6OA 3C38A 4B9OA 3IBJA 4MDZA 1TS8A 2HV1A 2M7VA 2W3GA 1YKDA 1W63Q 3TJZC 3PBSA 2VZWA 2WKRA 2VV8A 2XA7M 2HGVA 4HOIA 2D02A 2W3DA 1NLYA 4WEJA 1WA9A 2VV6A 3EWKA 2K31A 4GS9B 3OCLA 1UWNX 3LUQA 1GSVA 3BW6A 3RTYA 3LIDA 4G3WA 4EEPA 3O5YA 1H8MA 3RH8B 4IHQA 4I39A 4G3KA 4BBTA 4F3LA 3U2AA 3LR3A 1G28A 2J3TC 4MMNA 2QYBA 2D01A 3R4KA 3LI8A 2FH5A 1S67L 3K2NA 5HD5A 5HWTA 3KSHA 3UB6A 5HD3A 1YAXA 4EXOA 2P04A 5L8MA 1IOUA 1GSWA 2Z6DA 5IS1A 3JVUA 2R78A 2EWVA 3F1NA 1H3QA 3PBRA 4CQHA 1XFQA 3F1OB 3TRCA 4BJPA 2J3WA 4LLOB 3LYXA 1D06A 4OOLA 5A8BA 3BY9A 1F5MA 3BWLA 2ZOIA 2VKSA 3BJNA 3F1OA 3OLOA 2BASA 3V67A 3BY8A 3HCYA 4HJ3A 2B02A 1ZTUA 2KOIA 3S7PA 2Y8HA 3KSIA 3VV4A 4EESA 4FSFA 4I3IA 1LSWA 4CLCE 2J80A 3GDIA 2IA2A 4GJ4A 1JNUA 1EW0A 5DFXA 3HJIA 1OT9A 4EUVA 4HHDA 4GW9A 4EEUA 2VJWA 5AVEA 2VX8A 3GECA 3BQAA 4I38A 1DP6A 2XRNA 1TS7A 1ZHHB 4GS9A 1GSXA 4XT2A 3MQQA 5HDCA 5TJJA 4R70A 3T4SA 4E04A 2JKTI 3UMDA 1W63M 1P9WA 5KIZA 1P97A 4I5SA 3EEAA 5I5LA 3IBRA 3A0RA 3T4TA 3MFXA 3R7WB 3LR0A 2WKPA 1N9LA 2W3FA 3S7OA 2L4RA 5F68A 4XT2B 3NJAA 4RQ9A 3ZYTA 3B47A 2K2NA 4DJ2A 3F1NB 5HL6A 5IT5A 4O0PA 5F5YA 2YKFA 2XA7S 1XFNA 2O9BA 2DMWA 1OTIA 4HY8A 1TF1A 4NXEA 2KX6A 3PHYA 3FG8A 4NXGA 1X0OA 4KQDA 1XJ3A 4WEKA 2V0UA 1S66L 5DJTA 3UB9A 1XJ2A 4HNBA 2KDKA 5MC7A 1OJGA 3LIFA 3NHQA 1NRJA 2FZ0A 4ZRRA 4LRZE 4FOFA 4WELA 3UB8A 3MXQA 3S7NA 4R6LA 3ICYA 2QJ5A 3T4JA 2O0YA 5F6AA 3E0YA 4QPRA 5F69A 3BQ8A 4JGOA 2CMNA 3CITA 4I3AA 2W0NA 3MF0A 4L0LA 4L9GA 4ARZB 1ODVA 4MN6A 4R38A 1OPXA 2OWJA 3OOVA 4YWZA 4H6JB 5FL3A 1OTBA 3KSGA 4EW7A 4HJ6A 2YKHA 3CI6A 1T1CA 2K7SA 3LR5A 4NKPA 2PYPA 1T18A 4AFIA 1NWZA 4DJ3A 2VGLM 5HPIA 1T19A 2GX5A 1N9NA 3VE4A 4GHIB 2OAP1 1G6OA 2HF6A 3LIAA 3UE3A 3RFBA 1LSXA 2PD7A 4Q0IA 1V9YA 3CUEA 3TW8A 2OOLA 2JKRI 2QWSA 4HQAA 1MC0A 4OOMA 3FPWA 3TE8A 3UE6A 4LRXC 2QJ7A 4H6JA 5K5BA 2PR5A 4CLCC 1T1BA 4ME4A 3T4LA 2GNXA 5HDSA 3PBOA 3SW1A 4M4XA 4HJ4A 2G7UA 1OT6A 4O01A 2PR6A 3MR0A 4WL9A 2WKQA 4BBVA 4HH2A 2J3TD 2O9AA 3CLOA 3LIEA 3K3DA 2VV7A 3IS2B 3EEHA 4HP4A 4L9EA 5HWVA 4UQIS 3H7WB 5LBRA 4P6ZS 4GHIA 3EGXC 3F1PA 2GZAA 4NXBA 4EETB 1BYWA 2W27A 1LSVA 3EQVA 3P7NA 4HIAA 4KQOA 1VHMA 1OTEA 3K3CA 1D7EA 3C2WA 3UMEA 5HSQA 1KOUA 4JGRA 2W3EA 4WF0A 2W1TB 2PYRA 2JN7A 5IU1A 2QKPA 3LI9A 3MQOA 3VE3A 4CLCD 3JVVA 2O9CA 2P7JA 4LRYC 4MN5A 2EWWA 3D3OA 3DBAA 3PBNA 4IUHA 4Z1WA 3ULFA 4ETXA 2ZBBA 2PHYA 4CLCA 5DF9A 3C8CA 3H9WA 4PHTA 1S4SA 3KSFA 3EQUA 1XJ6A 1Y28A 4Y2FA 5AJGA 1LT0A 3CUEC 3B42A 4MN7A 2ZOHA 2LB9A 4EERA 2PDRA 5J4EA 4NXFA 2I9VA 1P0ZA 3UB7A 4L9FA 4DMZA 5DKLA 4Y5FA 3CAXA 4I3JA 1T1AA 3VOLA 3KYQA 2NUTC 2M7UA 4UEYA 1OTAA 3NOUC 2OWHA 3OCNA 2L1MA 3B33A 2A24B 1MKMA 3A0SA 3FPVA 3C30A 2MJ6A 2H28A 4ETZA 3NOTC 4NEED 5J7EA 2Z6CA 5CX7A 4G3VA 3ZQ5A 1YSPA 4R3AA 2M1CA 1P9RA 2V1BA 2P08A 1XJ4A 2A2LA 2EA9A 3NOPC 3T50A 4EU0A 2NUPC 4Q0JA 1LL8A 4WLAA 1IFQA 1TS0A 2JHEA 4WUJA 3D72A 4Y3IA 2O99A 5G4ZA 3A0VA 4LPZA 5TBMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS8 A;  2HV1 A;  5F5Y A;  2YKF A;  3H7W B;  3LIC A;  1XFN A;  4GHI A;  1OTI A;  3F1P A;  4NXB A;  4EET B;  1OJ5 A;  4HY8 A;  1BYW A;  4NXE A;  2VLG A;  2W27 A;  2V9A A;  1LSV A;  2VV8 A;  2WKR A;  2KX6 A;  1DRM A;  3PHY A;  4WN5 A;  3P7N A;  3FG8 A;  1UWP X;  4HIA A;  4HOI A;  2D02 A;  4NXG A;  1X0O A;  1OTE A;  2L0W A;  1DP9 A;  3K3C A;  4KQD A;  1XJ3 A;  1WA9 A;  2V0U A;  1D7E A;  1S66 L;  2VV6 A;  3C2W A;  1XJ2 A;  3EWK A;  4HNB A;  2KDK A;  5DJT A;  3UB9 A;  4GS9 B;  1KOU A;  1OJG A;  3LIF A;  4HI4 A;  3NHQ A;  4JGR A;  5HSQ A;  4WF0 A;  1UWN X;  3LUQ A;  4KUO A;  4LRZ E;  2PYR A;  3UB8 A;  3MXQ A;  1GSV A;  4R6L A;  3RTY A;  2PD8 A;  3LID A;  3ICY A;  2JN7 A;  4K08 A;  4EEP A;  2QJ5 A;  5IU1 A;  3RH8 B;  1S1Y A;  2QKP A;  3LI9 A;  3MQO A;  4I39 A;  5F6A A;  3VE3 A;  3MJQ A;  1VB6 A;  5F69 A;  5J3W A;  4BBT A;  4F3L A;  2P7J A;  4LRY C;  4JGO A;  1G28 A;  4MN5 A;  2CMN A;  2D01 A;  4I3A A;  3LI8 A;  1S67 L;  5DJU A;  5HD5 A;  2W0N A;  5HWT A;  3ULF A;  3UME A;  4L9G A;  3UB6 A;  5HD3 A;  1ODV A;  3LIB A;  4EXO A;  2ZBB A;  2PHY A;  4JGP A;  3C8C A;  2OWJ A;  1GSW A;  2Z6D A;  3H9W A;  4H6J B;  4MN6 A;  1S4S A;  4R38 A;  3F1P B;  2R78 A;  4YWZ A;  1OTB A;  1XJ6 A;  4GCZ A;  1Y28 A;  3F1N A;  1LT0 A;  5HWW A;  1XFQ A;  3F1O B;  4EQ1 A;  4EW7 A;  2ZOH A;  4LLO B;  4HJ6 A;  2PDR A;  4HH3 A;  4EER A;  3LYX A;  3CWF A;  1D06 A;  2YKH A;  3IS2 A;  1T1C A;  5J4E A;  5A8B A;  2K7S A;  3BY9 A;  3BWL A;  2ZOI A;  3F1O A;  4NXF A;  2I9V A;  1P0Z A;  2PYP A;  2V0W A;  3OLO A;  1T18 A;  2BAS A;  3BY8 A;  3H82 B;  1NWZ A;  4L9F A;  1F98 A;  5DKL A;  3CAX A;  4HJ3 A;  4DJ3 A;  1S1Z A;  4I3J A;  5HZH A;  1T1A A;  3VOL A;  2B02 A;  1T19 A;  1N9N A;  4JGQ A;  4EES A;  1MZU A;  1UGU A;  4GHI B;  5EFW A;  3VE4 A;  1TS6 A;  4I3I A;  1LSW A;  1OTA A;  3NOU C;  2OWH A;  2VEA A;  2INW A;  2J80 A;  2L1M A;  3LIA A;  3GDI A;  3B33 A;  1LSX A;  2A24 B;  1JNU A;  2PD7 A;  3A0S A;  1EW0 A;  1V9Y A;  2OOL A;  2QWS A;  3HJI A;  4HQA A;  1F9I A;  1OT9 A;  3G6O A;  2H28 A;  3H82 A;  3E4Q A;  4GW9 A;  4HHD A;  4EEU A;  1S4R A;  4HP9 A;  3E4O A;  5AVE A;  3NOT C;  3GEC A;  3UE6 A;  5AVF A;  5J7E A;  2QHK A;  2Z6C A;  4LRX C;  2QJ7 A;  1DP6 A;  4H6J A;  4I38 A;  3ZQ5 A;  3PYP A;  2A24 A;  2PR5 A;  1TS7 A;  1T1B A;  4GS9 A;  4DJ2 A;  1GSX A;  4XT2 A;  4R3A A;  3MQQ A;  2M1C A;  2V1B A;  5HDC A;  4R70 A;  5HDS A;  3SW1 A;  1XJ4 A;  2EA9 A;  3NOP C;  4HJ4 A;  4M4X A;  3T50 A;  3UB7 A;  4BBU A;  4E04 A;  3UMD A;  5KIZ A;  1OTD A;  1P97 A;  3KX0 X;  1N9O A;  1OT6 A;  4I5S A;  5I5L A;  2PR6 A;  3E4P A;  3IBR A;  1LL8 A;  2V1A A;  3MR0 A;  3A0R A;  4WL9 A;  3MFX A;  3HJK A;  2WKQ A;  4WLA A;  4BBV A;  2JHE A;  1TS0 A;  4PKY A;  4PKY G;  1DP8 A;  2WKP A;  1N9L A;  4HH2 A;  4WUJ A;  3D72 A;  5G4Y A;  3FC7 A;  2L4R A;  4L9E A;  5HDD A;  3H7W A;  4F3L B;  3CLO A;  3LIE A;  4KUK A;  3A0V A;  5F68 A;  4LPZ A;  3K3D A;  4XT2 B;  5G4Z A;  1V9Z A;  3NJA A;  4RQ9 A;  5IS1 A;  5TBM A;  2GJ3 A;  2VV7 A;  5DKK A;  3IS2 B;  3EEH A;  5TBM B;  4HP4 A;  3F1N B;  4B9O A;  5HWV A; 
#chains in the Genus database with same CATH topology
 2OV5 A;  4B4X A;  4OVD A;  4MBF A;  3HBR A;  1OJ5 A;  3OC2 A;  1QMF A;  2V9A A;  4P6Z M;  4ZJ2 A;  1UWP X;  3HLB A;  5L10 A;  3PBT A;  2PT7 A;  2HJ9 C;  2JC7 A;  4HI4 A;  2B18 A;  4KUO A;  2VA0 A;  4PM6 A;  1WYB A;  4P0M A;  1IKG A;  3MJQ A;  4KZ8 A;  4JF4 A;  5KSH A;  4JBF A;  4CLC B;  3W4Q A;  4YOF A;  4JGP A;  1KE4 A;  1NLZ A;  3S7Q A;  4O8G A;  2EX8 A;  1BLP A;  5CHM A;  1PZO A;  1I2W A;  3RJU A;  3IS2 A;  1KE3 A;  1Z09 A;  3IXG A;  1YLZ A;  2V0W A;  4FH4 A;  1S1Z A;  4B93 A;  5HZH A;  3S4X A;  3TSG A;  2IWD A;  4JGQ A;  2VGL S;  5FA7 A;  1TS6 A;  1FQG A;  4WZ5 C;  2JBF A;  2INW A;  5GLD A;  3T4Q A;  1SCW A;  3T4O A;  4E3N A;  2P9V A;  3E4Q A;  1JTG A;  3MSH A;  4HP9 A;  3LR4 A;  2X02 A;  2P9V B;  4IJG A;  3FKV A;  1BUE A;  5DFY A;  3E4P A;  2QMI A;  3HJK A;  1SHV A;  4FTX A;  3RXW A;  3FC7 A;  3H7W A;  3NIA A;  4X55 A;  2X01 A;  3SH9 A;  4QD4 A;  2FFY A;  2GJ3 A;  4MLL A;  3IBJ A;  4GD6 A;  4MDZ A;  2M7V A;  1YKD A;  2ZC3 B;  3HUN A;  1W63 Q;  3JYI A;  4LGW A;  5E2F A;  2XA7 M;  3GR2 A;  1RGY A;  2HGV A;  4HOI A;  3IXB A;  4WEJ A;  1WA9 A;  2K31 A;  4GS9 B;  2Y55 A;  2BTF P;  1GSV A;  3BEB A;  1MWR A;  4K0W A;  4EQI A;  4CPK A;  3LR3 A;  1G28 A;  2J3T C;  4MMN A;  3WRT A;  2QYB A;  3WRZ A;  3LI8 A;  5HD5 A;  1ZKJ A;  3KSH A;  5HD3 A;  4EV4 A;  3CG5 A;  3ZG8 B;  1GSW A;  5IS1 A;  3JVU A;  2R78 A;  1PW8 A;  4OON A;  3PBR A;  1XFQ A;  3F1O B;  1MXO A;  3LYX A;  4Q8I A;  4QWO A;  3BY9 A;  3BWL A;  3LEZ A;  3BJN A;  1KGE A;  3F1O A;  3OPL A;  3BY8 A;  5FQK A;  1ZTU A;  4OPQ A;  2KOI A;  4D2O A;  3VV4 A;  4FSF A;  1GA0 A;  5FDH A;  3IXH A;  1H0M A;  1JNU A;  4QY5 A;  1PZP A;  3CJM A;  4HHD A;  1L2S A;  4EEU A;  1IYQ A;  2VX8 A;  3BQA A;  5L07 A;  2HDS A;  1ERO A;  4GS9 A;  2VGJ A;  4B4Z A;  4JKT A;  4KZ7 A;  2UWX A;  4N1X A;  5TR7 A;  1JTD A;  1P9W A;  3NBL A;  5KIZ A;  3EEA A;  3MFX A;  4IVK A;  5DTS A;  2ZQA A;  4JXS A;  1N9L A;  2W3F A;  2L4R A;  2WZX A;  3TG9 A;  2H0T A;  1JVJ A;  5CGX A;  2K2N A;  3G2Z A;  4RVA A;  3BLM A;  1TDL A;  5IT5 A;  4GB7 A;  5F5Y A;  2O9B A;  2DMW A;  1OTI A;  2Y2M A;  1IYS A;  4LV2 A;  4B88 A;  1RGZ A;  4NXE A;  5EVE A;  2KX6 A;  3VOY A;  4C75 A;  3FG8 A;  5EEC A;  4WEK A;  2V0U A;  1S66 L;  4HNB A;  1IEL A;  4C6Y A;  2KDK A;  1OJG A;  3M6B A;  1FR6 A;  3N8L A;  1Z6F A;  2O0Y A;  5F6A A;  2B5R A;  4I3A A;  2Y2O A;  5AQ7 A;  4L0L A;  1ES5 A;  1OPX A;  2OWJ A;  3OOV A;  4H6J B;  1SKO A;  1U60 A;  4OPZ A;  1NY0 A;  3KSG A;  4EW7 A;  4HJ6 A;  4ESP A;  1T1C A;  3N7W A;  3LR5 A;  4IED A;  4DJ3 A;  3VP0 A;  5M1A A;  5HPI A;  1K56 A;  3NUL A;  3VE4 A;  1XA7 A;  1G6O A;  3Q82 A;  3LIA A;  2J8Y A;  3CUE A;  3GTC A;  3DAV A;  4HQA A;  2EXB A;  1MC0 A;  3FZC A;  2HP6 A;  2PBY A;  5HAI A;  2VK3 A;  3TE8 A;  2QJ7 A;  2PR5 A;  1T1B A;  3B3X A;  3SW1 A;  4HJ4 A;  3ZVT A;  4DE2 A;  2G7U A;  1OT6 A;  3G32 A;  4Y0T A;  3CLO A;  2XH9 A;  2A49 A;  2V2F F;  1QME A;  2GDN A;  5FAQ A;  5FQM A;  3CMZ A;  3EEH A;  5DTT A;  4XXR A;  5HWV A;  3QHY A;  3H7W B;  3G2Y A;  3EGX C;  2J7V A;  1BYW A;  1LSV A;  3P7N A;  4HIA A;  1WYC A;  5HW3 A;  3SH8 A;  4NK3 A;  4HBU A;  1E3U A;  4JGR A;  3T1S A;  2JCH A;  4QJG A;  5IU1 A;  2ZQD A;  3LI9 A;  5BOH A;  5GHZ A;  2P7J A;  3FV7 A;  3NDE A;  4MN5 A;  5FSR A;  3D3O A;  3DBA A;  1MY8 A;  2XGN A;  5A92 A;  3N6I A;  1BLC A;  2ZBB A;  2Y2G A;  2WAD A;  4CLC A;  5DF9 A;  1CJF A;  4DRT A;  3KSF A;  2ZQ8 A;  1NXY A;  4Y2F A;  3IWO A;  1XGJ A;  5AQ9 A;  3GV9 A;  3CUE C;  3B42 A;  3DTE A;  4FD8 A;  3UPN A;  5FQQ A;  3G34 A;  2WGV A;  3UE1 A;  4L9F A;  4DMZ A;  5DKL A;  1E3U D;  4I3J A;  3VOL A;  5DF7 A;  3I7J A;  3OCN A;  3B33 A;  4BEN A;  2Y2J A;  3FPV A;  1TVF A;  2MJ6 A;  1PRQ A;  3SS3 A;  4ETZ A;  5J7E A;  5CX7 A;  1SKO B;  4G3V A;  3ZQ5 A;  2V1B A;  1ZG6 A;  3G30 A;  1NJ4 A;  2P08 A;  3Q1F A;  3T50 A;  3NEC A;  4EU0 A;  4KZA A;  1MWS A;  3V50 A;  1YM1 A;  3NCK A;  4S2N A;  4X56 A;  5DTK A;  2E8I A;  4WZ4 A;  4OQG A;  5FEG A;  4S2I A;  2R9W A;  5EV0 A;  4JXG A;  1VET A;  2OAQ 1;  5A91 A;  1YLY A;  3WWX A;  4PAU A;  4IBR A;  2V8C A;  1DP9 A;  3IF5 A;  5GLA A;  4UA9 A;  3EOI A;  4OLD A;  2WZZ A;  5EOE A;  2PD8 A;  4K08 A;  1O07 A;  3QP4 A;  2WAE A;  3AGF A;  1K6S A;  1KVL A;  2XSS A;  4X1M A;  4ZJ3 A;  4GLQ A;  2OLV A;  2Y79 A;  4H8R A;  1XKZ A;  1GHI A;  4GCZ A;  1S0W A;  1TD5 A;  4EQ1 A;  3PTE A;  4E6X A;  5KMW A;  1YSQ A;  4O7D A;  1BT5 A;  4XUZ A;  5E2H A;  3R7W A;  1F98 A;  4UA6 A;  3BFC A;  4OQH A;  3V39 A;  3VFH A;  1K4E A;  3ITA A;  4PMA A;  1UGU A;  1MWU A;  2G2W A;  5C5K A;  1N9B A;  2VEA A;  3QNB A;  1L0E A;  1F9I A;  1VQQ A;  2W1T A;  4R3B A;  3OBF A;  5AVF A;  4YNR A;  3TOI A;  4DE3 A;  2W3H A;  2RCX A;  4WMC D;  3IXD A;  2ZM8 A;  3T4K A;  4ARZ A;  5AQB A;  3MZE A;  4PKY A;  3V3R A;  5HDD A;  4II7 A;  4F3L B;  1LHY A;  1V9Z A;  3T1Q B;  1LLB A;  3C38 A;  1PYY A;  2W3G A;  1PW1 A;  4C3Q A;  5CTN A;  3MXS A;  3TJZ C;  2WKR A;  4JF5 A;  2D02 A;  2W3D A;  4E6W A;  3FYZ A;  4BD1 A;  5FI6 A;  4NG2 A;  4R3J A;  5L09 A;  4EEP A;  4OQ0 A;  1ZG4 A;  4I39 A;  4BBT A;  5HWT A;  1J9M A;  1YAX A;  4N9L A;  4EXO A;  2P04 A;  3CPT B;  5L8M A;  1IOU A;  4UA7 A;  1ESU A;  3F1N A;  3TRC A;  1D06 A;  4E3M A;  4OOL A;  2ZOI A;  3SZT A;  2BAS A;  4UHU A;  1HD8 A;  1GCE A;  3S7P A;  3KSI A;  4EES A;  4X68 A;  1LSW A;  4KG6 A;  5DF8 A;  3GDI A;  2IA2 A;  4BLM A;  1SDN A;  4OLG A;  1KE0 A;  3SH7 A;  2Y2Q A;  1OT9 A;  2PU4 A;  4EUV A;  4GW9 A;  2I72 A;  2VJW A;  2J9O A;  4GNU A;  1ZHH B;  1GSX A;  3AGE A;  4XT2 A;  3MQQ A;  5HDC A;  5TJJ A;  4R70 A;  4Y0O A;  3T4S A;  3UMD A;  1W63 M;  2XR0 A;  2CC1 A;  1MKI A;  1K0K A;  3LR0 A;  2WKP A;  3S7O A;  2OSU A;  4RQ9 A;  3F1N B;  4WZ5 A;  4O0P A;  1XFN A;  4N9K A;  1G68 A;  4HY8 A;  3O86 A;  4R0Q A;  3HUM A;  3WS2 A;  2WYX A;  4X53 A;  2ZL1 A;  4EWF A;  1XJ3 A;  3BLS A;  5F83 A;  5DJT A;  3UB9 A;  3VFF A;  4PPR A;  3ZCZ A;  1NRJ A;  2FZ0 A;  3NHQ A;  4ZRR A;  2DCF A;  3S7N A;  2PU2 A;  5EPH A;  1ES2 A;  3ICY A;  3S22 A;  3E0Y A;  1W7F A;  4YIN A;  3Q07 A;  3CIT A;  3U4L P;  1ODV A;  1IKI A;  3MKE A;  4DXC A;  3QP6 A;  4MN6 A;  4R38 A;  4YWZ A;  1OTB A;  1NYM A;  4E3L A;  4UAA A;  3HLF A;  2HP5 A;  3CI6 A;  4NKP A;  1T18 A;  1LL5 A;  2Z2M B;  1HVB A;  1T19 A;  1N9N A;  1D1J A;  5FQI A;  3SOI A;  1BLS A;  1ONG A;  3SS5 A;  3RFB A;  1LSX A;  2PD7 A;  1V9Y A;  4P85 A;  3TW8 A;  3FWL A;  1ES3 A;  2JKR I;  4R1G A;  3W4P A;  4S2K A;  4DDY A;  5A93 A;  4OOM A;  3UE6 A;  4LRX C;  2IWB A;  5HDS A;  2C6W B;  3HLG A;  2DRW A;  4LCL A;  5E2E A;  4O01 A;  2PR6 A;  3MR0 A;  3A3D A;  2WKQ A;  1M6K A;  4BBV A;  2WGW A;  4HH2 A;  4EUZ A;  3OPR A;  3LIE A;  4JF6 A;  3O87 A;  2VV7 A;  4UQI S;  1SZV A;  3IF6 A;  4GHI A;  4U3T A;  5KZH A;  4WBG A;  4NXB A;  1ERM A;  4EET B;  2BLS A;  4Z9Q A;  4OKP A;  1D7E A;  3UPO A;  2WKI A;  4WF0 A;  5EVI A;  2PYR A;  4FCF A;  4Y7P A;  4DE0 A;  5CER A;  4LRY C;  3D9Y A;  4WM9 A;  2PRF A;  1YLW A;  3VP1 A;  2PHY A;  3NDG A;  1S4S A;  1CEG A;  1C3B A;  3EQU A;  2ZOH A;  2LB9 A;  5GLC A;  4CJN A;  4F94 A;  1H8Y A;  5J4E A;  3L7H A;  3W8K A;  3UB7 A;  3HL9 A;  3QP2 A;  3CAX A;  5G18 A;  1BLH A;  1T1A A;  5M19 A;  2NUT C;  3HLW A;  3C7V A;  5CEB A;  4UEY A;  3A3F A;  2OWH A;  2L1M A;  3DTK A;  1MKM A;  3A0S A;  4Y15 A;  4D60 A;  4BD0 A;  3NOT C;  2Z6C A;  2Q9N A;  3IX4 A;  4GZB A;  2Y4A A;  4QY6 A;  4KZ5 A;  5EE8 A;  5HX9 A;  3BYD A;  1NRF A;  1TS0 A;  2JHE A;  3BRM A;  3D72 A;  1XA1 A;  2O99 A;  1I5Q A;  2XF3 A;  1JWV A;  5EUA A;  1NZU A;  1Y54 A;  3LIC A;  4GDN A;  5EVL A;  3C7U A;  3UO9 A;  2JKT M;  1PFL A;  4WN5 A;  4BWI A;  4X25 A;  3P01 A;  3LCE A;  5F82 A;  5U47 A;  3KO6 A;  1WE4 A;  1ONH A;  4KEN B;  3C5A A;  5FQ9 A;  1S1Y A;  5FAO A;  3MXR A;  5DJU A;  3QP1 A;  3IX8 A;  4Q0H A;  2DNS A;  5I94 A;  2PBD P;  3T1R A;  3UY6 A;  3F1P B;  1AWI A;  4RX3 A;  1XPB A;  4DF6 A;  2ZQC A;  3T12 B;  4QU3 A;  2ZD8 A;  3ZDJ A;  2H10 A;  1JWP A;  3V5M A;  4OP8 A;  3EGD C;  4BBU A;  1K55 A;  2XQZ A;  2HJE A;  3PR6 A;  1MZU A;  1KVM A;  5TGF A;  4JPM A;  4K0X A;  3T1X A;  2KLI A;  4KQQ A;  3PXP A;  2QHK A;  2C5W B;  5A90 A;  3PYP A;  2A24 A;  2JKR M;  1K38 A;  5HPF A;  4MNR A;  3QP5 A;  4QHC A;  4FH2 A;  4A5R A;  1N9O A;  1G6A A;  2V1A A;  4PKY G;  1DP8 A;  3WS0 A;  5FI7 A;  4BL3 A;  3C4P A;  1XGI A;  5F1G A;  3GVB A;  3MQ0 A;  3G6O A;  3A3J A;  1TS8 A;  2HV1 A;  2Y59 A;  2WGI A;  4GKU A;  4NET A;  2UV0 E;  2XD1 A;  4S2P A;  3LY3 A;  3KYE A;  1KDS A;  4R4S A;  2HDR A;  1NLY A;  2XD5 A;  4EBN A;  3EWK A;  4FUW A;  1FCM A;  1UWN X;  3LUQ A;  3BW6 A;  2EX6 A;  3BFE A;  3O5Y A;  3WS4 A;  1HZO A;  3RH8 B;  1GHP A;  4IHQ A;  4G3K A;  1YLT A;  4KQR A;  2D01 A;  1TEM A;  3R4K A;  2FH5 A;  3K2N A;  4QB8 A;  1J3W A;  3UB6 A;  3DWK A;  3IQA A;  4EBL A;  2Z6D A;  1H3Q A;  4CQH A;  3HLE A;  3MS6 A;  2J3W A;  2VGK A;  4LLO B;  5A8B A;  5FDS A;  1F5M A;  4KG2 A;  3OLO A;  1BZA A;  3QNC A;  4ZJ1 A;  3G35 A;  1PWD A;  4CLC E;  3ZVW A;  1L0G A;  4R4R A;  4GJ4 A;  3VP4 A;  1W79 A;  4S2M A;  4LEN A;  5AVE A;  4I38 A;  1DP6 A;  2HDU A;  1TS7 A;  4M3K A;  4P6B A;  4LFU A;  4E04 A;  1E4D A;  1P97 A;  4I5S A;  4RX2 A;  5I5L A;  1Q2P A;  3A0R A;  1I2S A;  1YMX A;  1JWZ A;  1H5X A;  3LO7 A;  3PAE A;  5F68 A;  1N4O A;  1AXB A;  4DJ2 A;  3MKF A;  5E2G A;  3IH9 A;  3MZD A;  5KSC A;  4MBH A;  4JLF A;  1M40 A;  4NXG A;  4KQD A;  1FOF A;  4N92 A;  1XJ2 A;  5MC7 A;  4LRZ E;  4FOF A;  4WEL A;  4R6L A;  3AGD A;  4E3O A;  3IHB A;  2QJ5 A;  3UN7 A;  5E43 A;  3T4J A;  3ZG9 B;  5F69 A;  3E2K A;  3BQ8 A;  3IX3 A;  1S6R A;  2CMN A;  3GSG A;  3MF0 A;  1F2K A;  3ZFZ A;  4ARZ B;  2IWC A;  4KG5 A;  5FL3 A;  4DXB A;  4GD8 A;  4OP5 A;  3W4O A;  2ZLY A;  1K25 A;  5EM1 A;  1GHM A;  1NWZ A;  2GX5 A;  3Q7V A;  2QPN A;  2ZMA A;  4GHI B;  3DWZ A;  3UE3 A;  3ZGA B;  2V1Z A;  3NI9 A;  4WMC A;  2Y2N A;  2OOL A;  2G2U A;  2Z2L B;  2XFT A;  3NY4 A;  1SDE A;  3A3I A;  3FPW A;  4H6J A;  3DTI A;  3T4L A;  4M4X A;  1CI8 A;  1FIL A;  2Y2P A;  3IS2 B;  4HP4 A;  3UE0 A;  3ZG0 A;  5EVI B;  3OZH A;  5LBR A;  4BL2 A;  5M18 A;  5CGW A;  2GZA A;  4KZ3 A;  5EM0 A;  3P98 A;  2W27 A;  2EFU A;  3EQV A;  5TFQ A;  5HAP A;  3ZHH A;  4OPY A;  1OTE A;  4Y0U A;  3GRJ A;  1XXM A;  4P87 A;  4R23 A;  4JXV A;  3VSL A;  1ES4 A;  1L0D A;  4S2O A;  4U0T A;  4PM9 A;  2P74 A;  4CLC D;  4LV3 A;  3MBZ A;  4IUH A;  3PBN A;  4Z1W A;  4ETX A;  1ESI A;  2Y2I A;  2WK0 A;  1CQA A;  4HES A;  1HTZ A;  1Y28 A;  5AJG A;  5FEF A;  3PAG A;  4MN7 A;  2PDR A;  1W8Y A;  3N8R A;  4NXF A;  4Y5F A;  4U0X A;  1BSG A;  4EBP A;  3Q7Z A;  1KDW A;  2XLN A;  1OTA A;  2JE5 A;  3NOU C;  3A3E A;  1DJB A;  1PNE A;  2H28 A;  4ID4 A;  4S2J A;  3ZG7 B;  3FKW A;  4NEE D;  1YSP A;  1GA9 A;  4R3A A;  3UDI A;  2M1C A;  4E3K A;  2A2L A;  3NOP C;  3JPU A;  5EOO A;  5IHV A;  2Y91 A;  4MBK A;  4N1H A;  2NUP C;  3VOZ A;  4WYY A;  1LL8 A;  1TDG A;  2V8F A;  5GHY A;  4WLA A;  4WUJ A;  1E25 A;  2ZQ9 A;  1OME A;  4OOY A;  5G4Z A;  3A0V A;  3L9K A;  3ITB A;  4E3I A;  4ZTK A;  2X71 A;  2ZJ9 A;  3IH8 A;  5HFO A;  3CPT A;  3UDF A;  2XFS A;  3PBQ A;  3KYZ A;  2VLG A;  2HP9 A;  1DRM A;  1FSW A;  4UQI M;  1DJC A;  2ZQ7 A;  2HPB A;  2L0W A;  2ZC4 B;  2BG1 A;  2ACG A;  1EWZ A;  3M6H A;  3CZD A;  5FAT A;  1VB6 A;  5J3W A;  5L2F A;  4OQI A;  3SS4 A;  4RA7 A;  4IUK A;  1DY6 A;  3LIB A;  3ZG5 A;  3LFV A;  2ZMF A;  4X1L A;  2XRO A;  1Q2Q A;  5JYP A;  1LI0 A;  5HWW A;  2Y2K A;  4KZB A;  1FR1 A;  4HH3 A;  3CWF A;  3MMH A;  1DJA A;  2ZC5 B;  2WKH A;  3IHA A;  4LV0 A;  4OPR A;  3W2Z A;  3O3V A;  3H82 B;  3ZNT A;  1A0K A;  5CED A;  1MPL A;  3BEC A;  5CGS A;  3ISG A;  2FFF B;  4DN0 A;  5EVI C;  5EFW A;  1CF0 A;  4DKI A;  2AVX A;  4BMW A;  3MFD A;  1STZ A;  3D4F A;  3E98 A;  3H82 A;  4MCW A;  1S4R A;  4X69 A;  3E4O A;  2B95 A;  1O7E A;  1PIO A;  5CRF A;  1LI9 A;  3MZF A;  5CXW A;  2W1R A;  1K54 A;  1YLP A;  5CHU A;  2LB5 A;  1OTD A;  3KX0 X;  1IEM A;  3OPH A;  1H8Z A;  3Q7V B;  5G4Y A;  2Y2H A;  4JXW A;  4Y17 A;  2WUQ A;  4KUK A;  5GHX A;  3WS1 A;  5TBM A;  2ZMV A;  5DKK A;  1PI4 A;  2Q9M A;  4B9O A;  3VP3 A;  1Y4O A;  4OH0 A;  3RXX A;  3PBS A;  2VZW A;  1K57 A;  2VV8 A;  1CK3 A;  1L0F A;  2VV6 A;  1VEU A;  3OCL A;  3VP2 A;  3E2L A;  1ACF A;  4MEZ A;  3RTY A;  1NZO A;  3LID A;  4G3W A;  2V20 A;  1BUL A;  1H8M A;  3GQZ A;  5HL1 A;  4F3L A;  3BFG A;  3U2A A;  3G31 A;  4PM8 A;  1ZC2 A;  1S67 L;  5CHJ A;  1YMS A;  1VET B;  3VMA A;  2EWV A;  2J9P A;  1FCN A;  5EVI D;  3NC8 A;  4BJP A;  3BFD A;  2EFX A;  3HRE A;  2VKS A;  3LGO A;  3IF6 C;  3V67 A;  3HCY A;  4HJ3 A;  4KZ4 A;  5FAS A;  1K57 C;  2B02 A;  4K91 A;  2WAF A;  4LV1 A;  2Y8H A;  1K54 C;  3IWQ A;  3N8S A;  1IYO A;  1ERQ A;  3HUO A;  4I3I A;  4ZBE A;  4RYE A;  2J80 A;  4ZDX A;  3S1Y A;  1EW0 A;  3UPP A;  5DFX A;  3HJI A;  2HZ5 A;  5JYO A;  3GEC A;  3O88 A;  2XRN A;  4GOG A;  4IVI A;  2Q0O A;  2ZM0 A;  1YQS A;  2JKT I;  2WKE A;  2XK1 A;  3IBR A;  3T4T A;  3R7W B;  1FIK A;  3IWI A;  5CEC A;  2EX2 A;  1K56 D;  4XT2 B;  3NJA A;  3ZYT A;  3LEQ A;  3B47 A;  4BQM A;  5HL6 A;  1VEU B;  2YKF A;  2XA7 S;  1HLU P;  1TF1 A;  1NYY A;  2XDM A;  3PHY A;  1MWT A;  3UNW A;  1CI9 A;  1X0O A;  1KGF A;  3G4P A;  3DW0 A;  4ZAM A;  5GLB A;  3LIF A;  1BTL A;  1PI5 A;  3UB8 A;  3MXQ A;  3HLC A;  1W5D A;  4QPR A;  3IT9 A;  4JGO A;  2WGW B;  1YT4 A;  2W0N A;  3HLD A;  1G5U A;  5FAP A;  4L9G A;  2Y2L A;  1PWC A;  5GL9 A;  4E3J A;  5F1F A;  1FSY A;  3HVF A;  2EXA A;  2YKH A;  4GDB A;  5CTM A;  2K7S A;  2ZL1 B;  4S2N C;  2PYP A;  4AFI A;  3Q81 A;  2VGL M;  5FQJ A;  1YPR A;  3LY4 A;  3N4I A;  5D3O A;  3V3S A;  1YLJ A;  2OAP 1;  5J8X A;  2HF6 A;  1ALQ A;  4Q0I A;  4X6T A;  1RCJ A;  2QWS A;  5K5B A;  4CLC C;  1EI5 A;  4ME4 A;  2GNX A;  4HEF A;  3PBO A;  5AQA A;  2JKF A;  1FCO A;  4WL9 A;  4PM7 A;  1K6R A;  4GN2 A;  2J3T D;  2O9A A;  1K4F A;  3ZNY A;  4DE1 A;  3K3D A;  4PM5 A;  1IYP A;  4KZ9 A;  4L9E A;  5DVA A;  1K55 C;  3VSK A;  4P6Z S;  3F1P A;  4S2L A;  2E8J A;  3IF6 B;  4KQO A;  1VHM A;  3K3C A;  1LL9 A;  2R9X A;  2ZM2 A;  3C2W A;  3UME A;  5HSQ A;  1KOU A;  4LCM A;  2A3U A;  2W3E A;  2W1T B;  3UDX A;  3M2J A;  2JN7 A;  2QKP A;  3MQO A;  3VE3 A;  5FI2 A;  3JVV A;  3P09 A;  2O9C A;  1KGG A;  2EWW A;  2EX9 A;  2H5S A;  3ULF A;  3CHW P;  2QZ6 A;  2ZC7 A;  2RL3 A;  3C8C A;  3H9W A;  4PHT A;  4KZ6 A;  1XJ6 A;  1LT0 A;  3UB5 P;  4DDS A;  4EER A;  4XUX A;  3DTM A;  1XX2 A;  2OLU A;  2I9V A;  1P0Z A;  4YFM A;  3C4O A;  1L3L A;  2PAV P;  2H0Y A;  3KYQ A;  1W8Q A;  2M7U A;  1RP5 A;  4IBX A;  2JKG A;  1VM1 A;  4Y13 A;  5HAQ A;  1MBL A;  2A24 B;  2XEP A;  3C30 A;  1PWG A;  3BFF A;  2ZC6 B;  3M2K A;  3QP8 A;  1P9R A;  1XP4 A;  1XJ4 A;  2EA9 A;  3GMW A;  1SKF A;  4Q0J A;  2HDQ A;  3OPP A;  1IFQ A;  3BM6 A;  4Y3I A;  5HAR A;  3WS5 A;  4LPZ A;  4HBT A;  5TBM B;  1CEF A; 
#chains in the Genus database with same CATH homology
 3LIC A;  2OAQ 1;  3PBQ A;  1OJ5 A;  4PAU A;  3KYZ A;  2VLG A;  3OC2 A;  2V9A A;  2JKT M;  4P6Z M;  1DRM A;  4WN5 A;  4BWI A;  1UWP X;  4UQI M;  3PBT A;  2L0W A;  1DP9 A;  2PT7 A;  2HJ9 C;  3P01 A;  3EOI A;  4HI4 A;  2B18 A;  3KO6 A;  2VA0 A;  4KUO A;  2PD8 A;  4K08 A;  1S1Y A;  3MJQ A;  1VB6 A;  5J3W A;  2XSS A;  5DJU A;  5KSH A;  4Q0H A;  4IUK A;  4CLC B;  4GLQ A;  3LIB A;  4YOF A;  4JGP A;  3LFV A;  2Y79 A;  2ZMF A;  3F1P B;  2XRO A;  1NLZ A;  4GCZ A;  4O8G A;  3S7Q A;  5HWW A;  1TD5 A;  4EQ1 A;  4HH3 A;  3CWF A;  3IS2 A;  3MMH A;  1YSQ A;  3EGD C;  3W2Z A;  4BBU A;  2V0W A;  3H82 B;  3R7W A;  1F98 A;  1S1Z A;  4B93 A;  5HZH A;  2HJE A;  3PR6 A;  4JGQ A;  2VGL S;  4DN0 A;  1MZU A;  1UGU A;  5EFW A;  1TS6 A;  5C5K A;  4BMW A;  2VEA A;  2INW A;  1STZ A;  3T4Q A;  2KLI A;  3E98 A;  3T4O A;  1F9I A;  2W1T A;  3H82 A;  3PXP A;  3E4Q A;  4MCW A;  1S4R A;  3OBF A;  3E4O A;  3LR4 A;  4HP9 A;  5AVF A;  2QHK A;  4YNR A;  3PYP A;  2A24 A;  2JKR M;  5HPF A;  2W3H A;  4IJG A;  2W1R A;  2LB5 A;  1OTD A;  3KX0 X;  3T4K A;  1N9O A;  5DFY A;  3E4P A;  2V1A A;  4ARZ A;  3HJK A;  4PKY A;  4PKY G;  1DP8 A;  5G4Y A;  3FC7 A;  5HDD A;  3H7W A;  4II7 A;  4F3L B;  4KUK A;  1V9Z A;  5TBM A;  2ZMV A;  2GJ3 A;  5DKK A;  3MQ0 A;  3G6O A;  3C38 A;  4B9O A;  3IBJ A;  4MDZ A;  1TS8 A;  2HV1 A;  2M7V A;  2W3G A;  1YKD A;  1W63 Q;  3TJZ C;  3PBS A;  2VZW A;  2WKR A;  2VV8 A;  2XA7 M;  2HGV A;  4HOI A;  2D02 A;  2W3D A;  1NLY A;  4WEJ A;  1WA9 A;  2VV6 A;  3EWK A;  2K31 A;  4GS9 B;  3OCL A;  1UWN X;  3LUQ A;  1GSV A;  3BW6 A;  3RTY A;  3LID A;  4G3W A;  4EEP A;  3O5Y A;  1H8M A;  3RH8 B;  4IHQ A;  4I39 A;  4G3K A;  4BBT A;  4F3L A;  3U2A A;  3LR3 A;  1G28 A;  2J3T C;  4MMN A;  2QYB A;  2D01 A;  3R4K A;  3LI8 A;  2FH5 A;  1S67 L;  3K2N A;  5HD5 A;  5HWT A;  3KSH A;  3UB6 A;  5HD3 A;  1YAX A;  4EXO A;  2P04 A;  5L8M A;  1IOU A;  1GSW A;  2Z6D A;  5IS1 A;  3JVU A;  2R78 A;  2EWV A;  3F1N A;  1H3Q A;  3PBR A;  4CQH A;  1XFQ A;  3F1O B;  3TRC A;  4BJP A;  2J3W A;  4LLO B;  3LYX A;  1D06 A;  4OOL A;  5A8B A;  3BY9 A;  1F5M A;  3BWL A;  2ZOI A;  2VKS A;  3BJN A;  3F1O A;  3OLO A;  2BAS A;  3V67 A;  3BY8 A;  3HCY A;  4HJ3 A;  2B02 A;  1ZTU A;  2KOI A;  3S7P A;  2Y8H A;  3KSI A;  3VV4 A;  4EES A;  4FSF A;  4I3I A;  1LSW A;  4CLC E;  2J80 A;  3GDI A;  2IA2 A;  4GJ4 A;  1JNU A;  1EW0 A;  5DFX A;  3HJI A;  1OT9 A;  4EUV A;  4HHD A;  4GW9 A;  4EEU A;  2VJW A;  5AVE A;  2VX8 A;  3GEC A;  3BQA A;  4I38 A;  1DP6 A;  2XRN A;  1TS7 A;  1ZHH B;  4GS9 A;  1GSX A;  4XT2 A;  3MQQ A;  5HDC A;  5TJJ A;  4R70 A;  3T4S A;  4E04 A;  2JKT I;  3UMD A;  1W63 M;  1P9W A;  5KIZ A;  1P97 A;  4I5S A;  3EEA A;  5I5L A;  3IBR A;  3A0R A;  3T4T A;  3MFX A;  3R7W B;  3LR0 A;  2WKP A;  1N9L A;  2W3F A;  3S7O A;  2L4R A;  5F68 A;  4XT2 B;  3NJA A;  4RQ9 A;  3ZYT A;  3B47 A;  2K2N A;  4DJ2 A;  3F1N B;  5HL6 A;  5IT5 A;  4O0P A;  5F5Y A;  2YKF A;  2XA7 S;  1XFN A;  2O9B A;  2DMW A;  1OTI A;  4HY8 A;  1TF1 A;  4NXE A;  2KX6 A;  3PHY A;  3FG8 A;  4NXG A;  1X0O A;  4KQD A;  1XJ3 A;  4WEK A;  2V0U A;  1S66 L;  5DJT A;  3UB9 A;  1XJ2 A;  4HNB A;  2KDK A;  5MC7 A;  1OJG A;  3LIF A;  3NHQ A;  1NRJ A;  2FZ0 A;  4ZRR A;  4LRZ E;  4FOF A;  4WEL A;  3UB8 A;  3MXQ A;  3S7N A;  4R6L A;  3ICY A;  2QJ5 A;  3T4J A;  2O0Y A;  5F6A A;  3E0Y A;  4QPR A;  5F69 A;  3BQ8 A;  4JGO A;  2CMN A;  3CIT A;  4I3A A;  2W0N A;  3MF0 A;  4L0L A;  4L9G A;  4ARZ B;  1ODV A;  4MN6 A;  4R38 A;  1OPX A;  2OWJ A;  3OOV A;  4YWZ A;  4H6J B;  5FL3 A;  1OTB A;  3KSG A;  4EW7 A;  4HJ6 A;  2YKH A;  3CI6 A;  1T1C A;  2K7S A;  3LR5 A;  4NKP A;  2PYP A;  1T18 A;  4AFI A;  1NWZ A;  4DJ3 A;  2VGL M;  5HPI A;  1T19 A;  2GX5 A;  1N9N A;  3VE4 A;  4GHI B;  2OAP 1;  1G6O A;  2HF6 A;  3LIA A;  3UE3 A;  3RFB A;  1LSX A;  2PD7 A;  4Q0I A;  1V9Y A;  3CUE A;  3TW8 A;  2OOL A;  2JKR I;  2QWS A;  4HQA A;  1MC0 A;  4OOM A;  3FPW A;  3TE8 A;  3UE6 A;  4LRX C;  2QJ7 A;  4H6J A;  5K5B A;  2PR5 A;  4CLC C;  1T1B A;  4ME4 A;  3T4L A;  2GNX A;  5HDS A;  3PBO A;  3SW1 A;  4M4X A;  4HJ4 A;  2G7U A;  1OT6 A;  4O01 A;  2PR6 A;  3MR0 A;  4WL9 A;  2WKQ A;  4BBV A;  4HH2 A;  2J3T D;  2O9A A;  3CLO A;  3LIE A;  3K3D A;  2VV7 A;  3IS2 B;  3EEH A;  4HP4 A;  4L9E A;  5HWV A;  4UQI S;  3H7W B;  5LBR A;  4P6Z S;  4GHI A;  3EGX C;  3F1P A;  2GZA A;  4NXB A;  4EET B;  1BYW A;  2W27 A;  1LSV A;  3EQV A;  3P7N A;  4HIA A;  4KQO A;  1VHM A;  1OTE A;  3K3C A;  1D7E A;  3C2W A;  3UME A;  5HSQ A;  1KOU A;  4JGR A;  2W3E A;  4WF0 A;  2W1T B;  2PYR A;  2JN7 A;  5IU1 A;  2QKP A;  3LI9 A;  3MQO A;  3VE3 A;  4CLC D;  3JVV A;  2O9C A;  2P7J A;  4LRY C;  4MN5 A;  2EWW A;  3D3O A;  3DBA A;  3PBN A;  4IUH A;  4Z1W A;  3ULF A;  4ETX A;  2ZBB A;  2PHY A;  4CLC A;  5DF9 A;  3C8C A;  3H9W A;  4PHT A;  1S4S A;  3KSF A;  3EQU A;  1XJ6 A;  1Y28 A;  4Y2F A;  5AJG A;  1LT0 A;  3CUE C;  3B42 A;  4MN7 A;  2ZOH A;  2LB9 A;  4EER A;  2PDR A;  5J4E A;  4NXF A;  2I9V A;  1P0Z A;  3UB7 A;  4L9F A;  4DMZ A;  5DKL A;  4Y5F A;  3CAX A;  4I3J A;  1T1A A;  3VOL A;  3KYQ A;  2NUT C;  2M7U A;  4UEY A;  1OTA A;  3NOU C;  2OWH A;  3OCN A;  2L1M A;  3B33 A;  2A24 B;  1MKM A;  3A0S A;  3FPV A;  3C30 A;  2MJ6 A;  2H28 A;  4ETZ A;  3NOT C;  4NEE D;  5J7E A;  2Z6C A;  5CX7 A;  4G3V A;  3ZQ5 A;  1YSP A;  4R3A A;  2M1C A;  1P9R A;  2V1B A;  2P08 A;  1XJ4 A;  2A2L A;  2EA9 A;  3NOP C;  3T50 A;  4EU0 A;  2NUP C;  4Q0J A;  1LL8 A;  4WLA A;  1IFQ A;  1TS0 A;  2JHE A;  4WUJ A;  3D72 A;  4Y3I A;  2O99 A;  5G4Z A;  3A0V A;  4LPZ A;  5TBM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...