3LUQA

The crystal structure of a pas domain from a sensory box histidine kinase regulator from geobacter sulfurreducens to 2.5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
112
Chain Sequence
b'SDERLRLFTEHAPAALAMFDREMRYLAVSRRWREDYGLGDGDILGMSHYDIFPEIGEEWKSVHRRGLAGEVIRVEEDCFVRGRTQWLRWEVRPWYEGEGRVGGVVIFTEDIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The Crystal Structure of a PAS Domain from a Sensory Box Histidine Kinase Regulator from Geobacter sulfurreducens to 2.5A
rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
total genus 21
structure length 112
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3luqA00
2H28A 5HSQA 1GSWA 5J7EA 4HOIA 4NXEA 4HHDA 5DKLA 2B02A 4DJ2A 1NWZA 4I38A 1Y28A 1TS6A 4I3AA 1D06A 4HJ4A 4NXFA 3VOLA 4JGQA 1G28A 4B9OA 1T19A 4R3AA 5HDDA 2PR6A 1X0OA 3EWKA 3RTYA 3LUQA 4GCZA 3VE3A 3EEHA 3ZQ5A 3BY8A 3H82A 2I9VA 1OT9A 3KX0X 4MN5A 3NHQA 4I3IA 4PKYA 2ZOHA 5I5LA 1T1AA 3ICYA 4EEPA 4GW9A 1P0ZA 3UB6A 5A8BA 5G4ZA 2QKPA 5HZHA 3UMEA 3MQOA 4H6JA 4EERA 1N9OA 4L9GA 1S1ZA 5F68A 3ULFA 3LIDA 4GHIA 1OJ5A 5J3WA 2A24A 3C8CA 4F3LA 3MJQA 4HH3A 1EW0A 1LL8A 3GECA 4YWZA 4GHIB 2KDKA 1XJ4A 4RQ9A 3F1NA 4I3JA 2INWA 2A24B 5KIZA 1F98A 5IU1A 4EXOA 3IBRA 2GJ3A 4JGRA 1OTAA 5F5YA 3PYPA 1GSVA 3C2WA 3F1OA 2K7SA 4KQDA 2OWJA 2D02A 3H7WB 4HJ6A 2L4RA 3CLOA 3LYXA 5J4EA 2J80A 3K3CA 5HDCA 2EA9A 2V0WA 2QJ7A 1UGUA 4R38A 1LSXA 3T50A 3MR0A 4E04A 2JN7A 1V9YA 1S1YA 4I39A 4WN5A 5F6AA 2HV1A 3NOTC 2JHEA 2W27A 2QHKA 3MFXA 4GS9A 2CMNA 4DJ3A 2VV8A 5DJTA 2VV6A 3HJKA 3LIFA 1WA9A 1LSWA 4WLAA 3UB9A 1XJ6A 4HP4A 5DKKA 3IS2A 3BY9A 2VV7A 3H82B 2YKFA 1T1CA 1UWNX 2YKHA 4HH2A 1OTBA 3E4OA 1OTIA 2PYPA 5HWTA 1TS0A 5F69A 2L0WA 5AVEA 2V1AA 3BWLA 1KOUA 2PR5A 5HWVA 5IS1A 3HJIA 1TS7A 1XJ2A 4PKYG 2WKRA 4I5SA 3NOUC 4H6JB 4WL9A 2BASA 4XT2A 1S4SA 3A0SA 4R70A 4F3LB 2OWHA 3OLOA 4EETB 3E4QA 4XT2B 4WUJA 4HNBA 3LI9A 4EEUA 1XFNA 2V1BA 1T18A 3B33A 3F1NB 4NXBA 3LI8A 3CWFA 1OT6A 2L1MA 2P7JA 1BYWA 3F1OB 2PD7A 3UB7A 3D72A 4LRZE 3E4PA 1DP8A 4EQ1A 4HI4A 1JNUA 5HD5A 1XFQA 1DRMA 2PHYA 2PD8A 3NOPC 4M4XA 2D01A 3FG8A 3A0VA 3RH8B 1OTEA 4WF0A 3FC7A 5AVFA 4HY8A 3VE4A 3LIAA 3CAXA 3K3DA 1OTDA 4EESA 4K08A 4L9EA 4BBUA 3LIBA 3SW1A 5EFWA 4MN6A 3H9WA 1MZUA 4L9FA 4KUKA 2R78A 2VEAA 4GS9B 3A0RA 4LPZA 2Z6CA 5HWWA 2QJ5A 1S66L 4JGOA 1LSVA 3LICA 2OOLA 4LLOB 2ZBBA 3MQQA 4BBTA 3IS2B 4HP9A 3UE6A 4R6LA 4EW7A 4HQAA 4KUOA 2PYRA 3P7NA 4LRYC 3LIEA 1GSXA 2PDRA 2W0NA 1D7EA 2V9AA 1UWPX 1DP6A 4JGPA 4HJ3A 4HIAA 5HD3A 5HDSA 5TBMA 3F1PA 5G4YA 3UMDA 2V0UA 3UB8A 4NXGA 1VB6A 2WKQA 1F9IA 1ODVA 2KX6A 5TBMB 1OJGA 1T1BA 1DP9A 2QWSA 3F1PB 2Z6DA 3NJAA 1LT0A 5DJUA 1P97A 1V9ZA 1XJ3A 1N9NA 2WKPA 1S4RA 3GDIA 2M1CA 3G6OA 4BBVA 3MXQA 2ZOIA 3PHYA 2VLGA 1S67L 3H7WA 1TS8A 1N9LA 4LRXC
chains in the Genus database with same CATH superfamily
2H28A 2QPNA 2VX8A 1GSWA 1VEUB 3NDGA 4KZAA 2DCFA 2Y8HA 4B4XA 3EQVA 1FSYA 3TG9A 2P9VA 4HBTA 5AQ9A 3QNCA 4HJ4A 3PBNA 1CI8A 4XXRA 5DFYA 3ITAA 2OV5A 1T19A 2P9VB 3T12B 2WYXA 2O99A 1K57A 2EX8A 2VGJA 1MY8A 3PAGA 4WMCA 3VE3A 1AWIA 3U4LP 3EEHA 1W8YA 1QMFA 5IT5A 5EPHA 4E6XA 1RP5A 3MKEA 2I9VA 1YLTA 2WUQA 1OT9A 2ZQAA 3ZG5A 3KX0X 3N8RA 1BUEA 4PM5A 2BLSA 4PKYA 3G2ZA 1Y4OA 3ICYA 4KZ6A 3O5YA 4MDZA 5AQ7A 3UB6A 2K2NA 2XDMA 2IWDA 1STZA 2QKPA 3ZVTA 1IKIA 1YM1A 2Z2MB 4LFUA 3IH9A 3ULFA 3SOIA 3G32A 4KQOA 1NYYA 2Y2OA 4X1LA 5CGSA 4OH0A 5L2FA 4OPZA 1IOUA 3VP0A 4FOFA 4RQ9A 4DF6A 2HDUA 3BLMA 1XX2A 2O9AA 1W5DA 3S1YA 4JGRA 3T4OA 4AFIA 5CRFA 4X25A 2M7VA 2XK1A 5GHZA 4DDYA 4HJ6A 3EQUA 3PAEA 5FSRA 3LYXA 1IEMA 2HF6A 1IYPA 3FPVA 3BECA 3V5MA 2H10A 4WEJA 5HDCA 3TE8A 3ZG0A 5TGFA 1MKIA 5CTMA 1UGUA 4R38A 1FQGA 3IX3A 5HL6A 2J9PA 4A5RA 4E04A 2XFSA 4I39A 4BD1A 4ZAMA 4Y7PA 4IHQA 3G4PA 4GLQA 5EVIC 2QYBA 4N9KA 1YLJA 4YOFA 3DAVA 5CHUA 2Y2QA 4G3VA 2XSSA 5DJTA 3NC8A 4DE2A 4X1MA 1KVMA 3PBOA 1LSWA 1ONGA 1EWZA 3MSHA 3LR5A 2ZMAA 5HARA 1RGYA 3V3RA 5A91A 4GOGA 4OPYA 3C38A 3D3OA 2VV7A 1K6SA 2O9CA 3H82B 4GKUA 4KZ9A 3TW8A 3SH8A 5EECA 3UDFA 2YKFA 3KO6A 1PW8A 4GZBA 1BLHA 1ERQA 5DTTA 3DWZA 4ARZA 2PYPA 3BW6A 5F69A 2UWXA 5F1FA 4NEED 3BWLA 3AGDA 5HWVA 2WAEA 4E6WA 5M19A 3UE1A 1H8YA 1PW1A 2ZM8A 3VSKA 4EBPA 3ZG7B 2RCXA 3OPHA 1Q2PA 4IBRA 4PKYG 3HUOA 3G35A 4BMWA 3LY3A 4H6JB 4XT2A 4P0MA 3RFBA 5TFQA 1NXYA 5FDSA 4CLCA 4R70A 3CITA 4XT2B 1VM1A 5CEBA 5G18A 2GDNA 2V1BA 1T18A 4Y17A 3CWFA 3OPPA 1GCEA 2P7JA 3GV9A 3IWQA 3F1OB 2LB9A 2WGIA 2GX5A 2ZMFA 3UDIA 4EQ1A 1MWSA 4ME4A 3S4XA 4OPQA 5FL3A 2E8JA 1BZAA 1ONHA 1K56A 5M1AA 4WYYA 4RYEA 2FZ0A 3FV7A 2J3TC 2D01A 1P9WA 4O8GA 3RH8B 1KGGA 5FA7A 1OMEA 1K0KA 3ZYTA 1FOFA 1OTDA 3OPRA 1BULA 4EESA 3MF0A 3W4QA 1KVLA 2Q9NA 4FH2A 2IA2A 4DDSA 5HW3A 4Y2FA 2ZQDA 5EFWA 1KDSA 2XGNA 2JKTI 3L9KA 4MN7A 4E3IA 5HAQA 1NRFA 4GS9B 2EFUA 3A0RA 5EVEA 3S7PA 4IEDA 5CERA 2XH9A 1LSVA 3ZG8B 3ZCZA 2HPBA 2OOLA 2ZBBA 3MQQA 1G5UA 2ZC3B 3IS2B 5DF7A 2HJEA 4HP9A 2PRFA 3WS0A 3W4OA 1K55C 4LV2A 2PYRA 5GLCA 3HUNA 3LIEA 1GSXA 1K54A 2PDRA 2W0NA 2XFTA 3MXSA 1SHVA 3S7OA 2WKEA 1DP6A 3CPTB 2X01A 5HD3A 5TBMA 1E3UD 2WGVA 3Q1FA 2BG1A 1WYBA 4BLMA 2XD5A 2KX6A 3IT9A 5TBMB 2QWSA 3CHWP 3NJAA 4JF5A 4KQQA 5D3OA 5FQIA 1YLYA 1XJ3A 1YSQA 3GDIA 3WS4A 3NIAA 2Y2KA 4MNRA 5HPFA 2VLGA 1S67L 3BQAA 4IUKA 2JCHA 3IXHA 3KYEA 4GDBA 4MBHA 5HX9A 4OP5A 3T4TA 4O01A 4NXEA 1NRJA 5JYPA 5CGXA 2KLIA 1KGEA 2Y2IA 4P85A 5CTNA 1TS6A 3ZNTA 2ZJ9A 2K31A 1J3WA 2ZQCA 1ACFA 4H8RA 4DMZA 4B9OA 4Q8IA 5FI2A 4JPMA 5HDDA 2PR6A 3ZVWA 4JXVA 1TF1A 4KENB 2KOIA 4GCZA 3HLWA 1YQSA 2XROA 2ZL1A 4IJGA 5EOEA 5FAQA 1KE0A 3ZQ5A 2JKFA 3ITBA 2JBFA 3SZTA 1ES2A 3A3IA 4MN5A 2HDSA 4ZJ3A 4I3IA 2J3TD 2ZOHA 5BOHA 1G68A 3G2YA 3HLBA 5I5LA 2Y2PA 3KYZA 5DF9A 1E4DA 1Z6FA 2XF3A 3L7HA 4GN2A 1E25A 3R7WA 2C5WB 3NULA 1XXMA 5G4ZA 1FSWA 3IF6B 3IF5A 3QP5A 5L07A 4II7A 1PWCA 3KSFA 3R7WB 3A3EA 3CZDA 5GLBA 1XPBA 3ZDJA 2P04A 2C6WB 4R4RA 1S1ZA 4Y0UA 5F68A 4GHIA 4DE0A 3BFEA 3N8SA 1NZUA 1YLZA 4F3LA 3IXGA 4DRTA 3VP1A 3FPWA 3VMAA 1LL8A 3GECA 4E3KA 4GHIB 3QHYA 3WS5A 3HLDA 3T1SA 3CUEC 4GJ4A 1F98A 2W1TB 3IBRA 2GJ3A 1OTAA 5F5YA 1GSVA 1ES5A 4S2JA 2W3FA 1GHPA 2H0YA 5GHYA 1IFQA 4QPRA 3ZHHA 2Q0OA 4S2KA 4OQ0A 3C5AA 3KSIA 2L4RA 3VP3A 3CLOA 5FAPA 1K25A 4OQGA 3N6IA 4P87A 4KZBA 2V8CA 3MZEA 1CQAA 1ES4A 4S2LA 2EA9A 4MBFA 1XGJA 5EE8A 2B5RA 1FIKA 1LSXA 2GZAA 4D60A 3T50A 4U3TA 4FUWA 1YAXA 4C3QA 5F6AA 1O7EA 1G6AA 3NBLA 4K0XA 3W2ZA 3DTMA 2Y2HA 2JHEA 3P98A 3RJUA 3HLGA 4GNUA 5EVIA 1KDWA 2W27A 2QHKA 3IHBA 4DJ3A 2VV6A 5FASA 3BFDA 5EVIB 3CG5A 4FH4A 4WLAA 1C3BA 4IUHA 4D2OA 3UB9A 4KZ5A 1AXBA 1XJ6A 1BTLA 5CGWA 5DKKA 1PWDA 4EWFA 3LEQA 4LCLA 4K0WA 2P08A 3LGOA 1UWNX 1LHYA 3Q82A 2VGKA 2ZC4B 5AVEA 1F5MA 3UDXA 3QP8A 4N9LA 1BT5A 1K6RA 3LY4A 3C7VA 1XJ2A 3BYDA 4OQHA 5K5BA 3W8KA 2VA0A 3HUMA 1HZOA 1JTDA 1ZG6A 4DXBA 3D9YA 2DMWA 4WL9A 3T4JA 2V2FF 4NG2A 1DJCA 4QWOA 3A0SA 1H5XA 5L09A 2PAVP 3FWLA 2WGWA 3VP2A 3B33A 4Y3IA 3LI8A 1CEGA 4OQIA 5F83A 5HL1A 3QNBA 3CI6A 2WGWB 4KQRA 2PD7A 2MJ6A 3D72A 4LRZE 3E4PA 2E8IA 4HESA 1DP8A 1YLPA 1O07A 5HD5A 3VFHA 5KZHA 1DRMA 4PHTA 3T4KA 1ERMA 4UA9A 2PHYA 1MC0A 2JKTM 2PD8A 3NOPC 3UE3A 4JBFA 3KYQA 2J9OA 1FCMA 3WRZA 3UPNA 2FFFB 4EV4A 4WF0A 4KZ7A 1ZKJA 1BSGA 4HY8A 2HDQA 4EBNA 2B95A 4ETZA 4O7DA 3CAXA 3KSGA 4NKPA 4L9EA 4BBUA 4Z9QA 4PM8A 2V8FA 5M18A 1DJAA 3BLSA 2HZ5A 1JWVA 4MN6A 1MZUA 1TVFA 1RGZA 4KUKA 3OBFA 1N9BA 3T1RA 1XGIA 4MBKA 4LPZA 5FQJA 3A3JA 4FD8A 4B93A 4JF4A 1YT4A 3LICA 5LBRA 3ZGAB 4LLOB 3I7JA 2EWWA 4BBTA 3DTIA 2Y2GA 5EVLA 3UE6A 1PI5A 4ZDXA 3BRMA 5EM0A 4KUOA 1K55A 2XQZA 3S22A 4LRYC 1MBLA 4RVAA 4U0XA 2QMIA 4ARZB 2W3GA 3ZNYA 4PM7A 1D7EA 2V9AA 3JYIA 3MBZA 1UWPX 4S2NA 1CI9A 1MXOA 2EX2A 3SS4A 3UMDA 5KSHA 5DVAA 3Q7VA 2WADA 5E2EA 2V0UA 4ID4A 4NXGA 2VJWA 1DP9A 3BEBA 4NK3A 3SS5A 5DJUA 1MWRA 1P97A 4ZTKA 4CLCB 4LENA 2ZC7A 4FCFA 1S4RA 2Z2LB 1W63M 5E43A 4CQHA 2DRWA 3G6OA 4C75A 2Y79A 1VHMA 4E3OA 1EROA 4EUZA 2ZOIA 3Q81A 3PHYA 2HJ9C 3H7WA 1FR1A 2J3WA 3MZFA 3GSGA 4E3LA 2QZ6A 5HSQA 3B42A 4E3NA 1YKDA 1MWUA 3EGDC 2B02A 2PT7A 4DJ2A 1NWZA 4I38A 3UO9A 1Y28A 1SKFA 2Y91A 4Q0JA 1HD8A 2G7UA 2JC7A 5FQQA 3UN7A 3VOLA 1G28A 1BLCA 1IYQA 1J9MA 1XA7A 4R3AA 4BENA 2DNSA 4X56A 1X0OA 4ZJ1A 2WK0A 4ZRRA 4E3JA 3LUQA 4NETA 4JF6A 4EUVA 4UHUA 3MKFA 2J7VA 2ZMVA 4UA7A 4U0TA 4Q0HA 3EGXC 2G2UA 3E0YA 2Y59A 2Y2LA 2ZM0A 3RXWA 2A2LA 3BY8A 4N1XA 1QMEA 1SCWA 1S0WA 5A90A 4P6BA 5AJGA 1BLPA 5U47A 4KG5A 5J8XA 5FEFA 1HVBA 5CECA 5A93A 2WZZA 1T1AA 5CXWA 4GW9A 4CJNA 3OC2A 3OPLA 3WS2A 1PRQA 5A8BA 3Q07A 3MQ0A 3VOYA 5TR7A 3JVUA 4OLDA 3UMEA 1YMSA 3ZG9B 1H8ZA 3MQOA 5GLAA 4EERA 3C7UA 1EI5A 3NCKA 4L9GA 1I2WA 3LIDA 4KG6A 1XA1A 1HLUP 4JLFA 4ZBEA 1OJ5A 3GVBA 4R3BA 4G3WA 5J3WA 4MMNA 4OOYA 2A24A 3FZCA 2HGVA 1K4FA 3MJQA 4WMCD 4HH3A 1EW0A 4ESPA 4YWZA 1G6OA 1I5QA 3F1NA 4I3JA 3SH9A 3N7WA 2INWA 2A24B 5KIZA 3CUEA 1H8MA 4X55A 5IU1A 4EXOA 4LGWA 3IQAA 3OZHA 3PYPA 3LR4A 1DJBA 4PPRA 5HAIA 2K7SA 1YPRA 1IELA 2OWJA 2OSUA 5A92A 2D02A 5FATA 4N92A 2ACGA 2J80A 3K3CA 2P74A 4YFMA 3DBAA 2V0WA 4OPRA 2PU2A 2QJ7A 1IYOA 5I94A 4YINA 3IX4A 3BFFA 5C5KA 2EX6A 2JN7A 1V9YA 1S1YA 4JXSA 1K38A 3FKVA 2HV1A 5GLDA 1JVJA 3NOTC 1CK3A 3QP4A 1M40A 1JTGA 3MFXA 5GL9A 3SH7A 3UPPA 2CMNA 4XUZA 2VV8A 3AGEA 4R3JA 2VZWA 3HJKA 3V67A 5TJJA 3LIFA 1VETA 5DTSA 2ZL1B 1ALQA 4HP4A 2H0TA 3T4LA 3BFCA 3V3SA 2W3HA 1VETB 2UV0E 4X68A 3VFFA 4DN0A 2FH5A 1PI4A 2YKHA 1SDEA 3IXBA 2JKRI 1OTIA 2ZC5B 5HWTA 2L0WA 5CX7A 3GRJA 2V1AA 1YLWA 3TJZC 4HBUA 2PR5A 4WZ4A 3HLFA 1TS7A 3CJMA 2XEPA 3IXDA 3S7QA 1YMXA 4BWIA 2VGLM 1D1JA 4MLLA 2WKRA 4G3KA 4ETXA 1S4SA 1M6KA 4F3LB 5E2HA 2A3UA 2OWHA 3UE0A 3E2LA 3KSHA 4KZ8A 4EEUA 2IWCA 5E2GA 4NXBA 1OT6A 4BL3A 2Q9MA 3PBTA 1ZTUA 1BYWA 2PBYA 4PAUA 3EEAA 4Z1WA 4HI4A 1JNUA 2HP6A 1JWPA 4R23A 3FG8A 3A0VA 3BJNA 1LI0A 1OTEA 3WS1A 2OLUA 4M3KA 5FDHA 3FC7A 3TSGA 3E2KA 3JPUA 4LCMA 3LR3A 1E3UA 4RA7A 3B3XA 3K3DA 1PWGA 2BTFP 3O86A 4K08A 4P6ZM 4CLCD 2Y4AA 3LCEA 3H9WA 4L9FA 2R78A 2J8YA 2ZD8A 5KMWA 1GA0A 5HWWA 2QJ5A 1BLSA 1SKOA 3O88A 4CLCE 1S66L 3MZDA 3GR2A 2XLNA 2ZM2A 4WZ5C 5FI6A 1SKOB 4Y13A 4EW7A 1FILA 4ZJ2A 4EQIA 1KE4A 4GD6A 1K56D 3T4SA 4KG2A 3P7NA 1PZOA 3IWOA 3ISGA 2Y55A 3IF6C 5CEDA 1CJFA 2ZLYA 5AQAA 3S7NA 4S2IA 4QY5A 4JGPA 1ES3A 4HJ3A 4HIAA 5HDSA 2Y2JA 3F1PA 1PNEA 3A3FA 3MFDA 4B88A 1VB6A 2WKQA 4MEZA 1F9IA 1ODVA 1SZVA 1T1BA 3NY4A 3ZFZA 1LL5A 3F1PB 1ESUA 2Z6DA 1LT0A 5HPIA 4RX2A 1L0EA 1V9ZA 1XP4A 2M1CA 1IYSA 1HTZA 1DY6A 2WKHA 1GHIA 5FQMA 1PFLA 2H5SA 1N9LA 4LRXC 3PTEA 3OCNA 1Y54A 4IBXA 5EUAA 5J7EA 3OOVA 4HOIA 3E98A 1Z09A 2NUTC 1H3QA 4BQMA 2JKGA 3AGFA 3BFGA 4HHDA 5DKLA 1F2KA 1TEMA 3U2AA 2G2WA 2OLVA 3O87A 2OAP1 3C4PA 4I3AA 1D06A 2I72A 2R9XA 2VGLS 3W4PA 4NXFA 4JGQA 4Y5FA 1N4OA 4E3MA 4UEYA 3N4IA 4IVKA 1K57C 2WAFA 3PR6A 4WELA 3EWKA 3RTYA 1JWZA 3GQZA 5EV0A 4WEKA 4UQIM 2O9BA 4WBGA 3V50A 2PU4A 1TDLA 4KZ4A 5HFOA 3H82A 3HLEA 2VKSA 2R9WA 1W8QA 1MKMA 3M6BA 3NHQA 4JKTA 1S6RA 4OLGA 4X53A 1PZPA 4N1HA 3R4KA 4EEPA 3CMZA 1P0ZA 4EBLA 4QJGA 4K91A 5HZHA 1KE3A 1NLZA 3LO7A 1CEFA 3GMWA 1NYMA 1L0FA 4H6JA 1N9OA 2X71A 3T1XA 4X69A 2ZQ7A 3C30A 4DE1A 3Q7VB 4P6ZS 3C8CA 3FYZA 1RCJA 1SDNA 1ESIA 2KDKA 1XJ4A 2GNXA 1WYCA 5HAPA 4HEFA 4LV0A 3UPOA 1ZHHB 4S2MA 3C2WA 3F1OA 3DTEA 5L10A 4KQDA 4R4SA 3IBJA 4OOLA 2W3EA 2XA7M 3PBQA 1LLBA 4Y15A 4R1GA 1PIOA 3QP2A 1FCOA 3H7WB 2W1RA 2CC1A 4IVIA 5J4EA 3QP6A 1L0GA 5EM1A 3K2NA 3EOIA 3OCLA 2WKIA 3DTKA 4PMAA 1H0MA 4O0PA 2HDRA 2XRNA 3MR0A 3IX8A 2IWBA 1LL9A 3NI9A 4WN5A 4OOMA 3P09A 4UA6A 4YNRA 4DKIA 3MXRA 4OVDA 1MWTA 5EOOA 4GB7A 1ZC2A 4QHCA 4CPKA 4JXGA 2EXAA 4PM9A 2JKRM 4GS9A 1GHMA 3NECA 3UNWA 4R0QA 2XD1A 3QP1A 2AVXA 1WA9A 5GHXA 3DWKA 5DFXA 3IHAA 2M7UA 3IS2A 4BJPA 3BY9A 3WWXA 1NLYA 4FTXA 5DTKA 1T1CA 4HH2A 1OTBA 3VV4A 3E4OA 1XKZA 1TS0A 3BM6A 1KOUA 2PBDP 5IS1A 3HLCA 3HJIA 3CPTA 4LV1A 3UY6A 5KSCA 4Y0TA 2WZXA 3HREA 3MS6A 4L0LA 4GDNA 2LB5A 4UAAA 4I5SA 1L0DA 3NOUC 4PM6A 4S2NC 4F94A 3C4OA 5EVID 2BASA 1TD5A 1L3LA 3VOZA 3IH8A 4CLCC 3LR0A 1NZOA 3OLOA 3VSLA 1FCNA 4EETB 3LEZA 3E4QA 4UQIS 4WUJA 4HNBA 1U60A 3LI9A 4S2PA 4OP8A 1XFNA 3G31A 3F1NB 1NJ4A 1LI9A 1P9RA 4QB8A 2HP5A 3NDEA 3D4FA 2L1MA 3A3DA 3G34A 4QY6A 5FAOA 3O3VA 1KGFA 4WM9A 4XUXA 3UB7A 1L2SA 1CF0A 2A49A 3T4QA 1PYYA 2Y2NA 2EWVA 1XFQA 5FI7A 1A0KA 2HP9A 5FQ9A 2Y2MA 3FKWA 5IHVA 2ZQ9A 5AQBA 1W7FA 3Q7ZA 4M4XA 4B4ZA 5CHMA 3M6HA 2W3DA 3SS3A 5AVFA 4Y0OA 3G30A 3VE4A 3HL9A 4OONA 3LIAA 1I2SA 3PBRA 3N8LA 4MCWA 4LV3A 4QU3A 3LIBA 5L8MA 3SW1A 3MMHA 1OPXA 3HCYA 4RX3A 2VEAA 4DXCA 5F82A 1WE4A 2NUPC 2Z6CA 3M2KA 2FFYA 1TDGA 1W79A 3UB5P 3IWIA 4S2OA 4JGOA 5FEGA 5MC7A 4KZ3A 2ZC6B 4Q0IA 2XA7S 3TOIA 1K4EA 4WZ5A 1GA9A 4C6YA 3M2JA 4R6LA 3V39A 4FSFA 5F1GA 2EXBA 4HQAA 3JVVA 3TRCA 4GD8A 2JE5A 2O0YA 1K54C 1FR6A 3BQ8A 3IF6A 1IKGA 4DE3A 1YSPA 2X02A 3HVFA 3DW0A 2V1ZA 1ZG4A 4JXWA 4OKPA 1MPLA 5G4YA 3PXPA 2OAQ1 3P01A 2VK3A 3UB8A 1VQQA 3PBSA 3WRTA 1OJGA 2RL3A 2EFXA 4BD0A 5DF8A 2V20A 1NY0A 5E2FA 3GTCA 3HBRA 4QD4A 5JYOA 1Q2QA 5FQKA 2W1TA 2ZQ8A 1N9NA 2WKPA 3RXXA 3VP4A 1W63Q 4BBVA 3MXQA 2B18A 1VEUA 3B47A 4EU0A 2XR0A 4BL2A 2EX9A 3LFVA 1TS8A 3T1QB 5CHJA 4X6TA
chains in the Genus database with same CATH topology
2H28A 2VX8A 5HSQA 1GSWA 3T4TA 5J7EA 4O01A 3OOVA 4HOIA 3B42A 3E98A 2NUTC 4NXEA 1H3QA 1NRJA 1YKDA 4HHDA 3EGDC 2B02A 2PT7A 5DKLA 2Y8HA 2KLIA 4DJ2A 1NWZA 3U2AA 4I38A 3EQVA 1Y28A 1TS6A 4Q0JA 2OAP1 2G7UA 4I3AA 1D06A 2K31A 4HJ4A 3PBNA 2VGLS 4NXFA 5DFYA 4JGQA 4Y5FA 3VOLA 1G28A 4DMZA 4B9OA 1T19A 4R3AA 4UEYA 2O99A 5HDDA 2PR6A 1X0OA 3PR6A 4WELA 1TF1A 3EWKA 4ZRRA 3RTYA 3LUQA 4EUVA 2KOIA 4GCZA 4WEKA 2ZMVA 4UQIM 2O9BA 3VE3A 4Q0HA 2XROA 4IJGA 3EGXC 3EEHA 3E0YA 3ZQ5A 5IT5A 2A2LA 3BY8A 3H82A 5AJGA 2VKSA 2I9VA 1OT9A 3KX0X 1MKMA 4MN5A 3NHQA 4I3IA 2J3TD 4PKYA 2ZOHA 5I5LA 5DF9A 3KYZA 1T1AA 3ICYA 3R4KA 4EEPA 3R7WA 4GW9A 3O5YA 1P0ZA 3OC2A 4MDZA 3UB6A 5A8BA 5G4ZA 3MQ0A 2K2NA 1STZA 4II7A 2QKPA 3KSFA 1NLZA 3JVUA 5HZHA 3UMEA 3R7WB 2P04A 3MQOA 4H6JA 4EERA 1N9OA 4L9GA 1S1ZA 5F68A 3ULFA 3LIDA 4GHIA 3C30A 1OJ5A 4KQOA 4G3WA 5J3WA 4MMNA 4P6ZS 2A24A 3C8CA 4F3LA 2HGVA 3MJQA 3FPWA 4HH3A 1EW0A 1LL8A 3GECA 4YWZA 4GHIB 1IOUA 1G6OA 2KDKA 1XJ4A 4FOFA 3F1NA 2GNXA 4I3JA 4RQ9A 2INWA 2A24B 5KIZA 3CUEC 3CUEA 4GJ4A 2O9AA 1F98A 1H8MA 5IU1A 2W1TB 4EXOA 3IBRA 2GJ3A 4JGRA 1OTAA 1ZHHB 5F5YA 3PYPA 3LR4A 1GSVA 3T4OA 4AFIA 3C2WA 3F1OA 2W3FA 2K7SA 4KQDA 3IBJA 2OWJA 1IFQA 4OOLA 4QPRA 2W3EA 2XA7M 3PBQA 2M7VA 2D02A 3H7WB 4HJ6A 3KSIA 2L4RA 3EQUA 2W1RA 3CLOA 3LYXA 2HF6A 5J4EA 3FPVA 2J80A 3K3CA 4WEJA 3TE8A 5HDCA 3K2NA 3DBAA 2EA9A 3EOIA 3OCLA 2V0WA 2QJ7A 1UGUA 4R38A 1LSXA 2GZAA 5C5KA 4O0PA 3T50A 5HL6A 2XRNA 3MR0A 4E04A 2JN7A 1V9YA 1S1YA 1YAXA 4I39A 4WN5A 5F6AA 4OOMA 3W2ZA 2HV1A 4YNRA 4IHQA 3NOTC 4GLQA 2JHEA 2QYBA 2W27A 4YOFA 2QHKA 3MFXA 2JKRM 4GS9A 4G3VA 2CMNA 2XSSA 2VV8A 4DJ3A 5DJTA 2VV6A 2VZWA 3HJKA 3PBOA 3V67A 5TJJA 3LIFA 1WA9A 1LSWA 4WLAA 4IUHA 3LR5A 5DFXA 3UB9A 1XJ6A 4HP4A 5DKKA 3T4LA 2M7UA 3IS2A 4BJPA 3BY9A 3C38A 3D3OA 2VV7A 2O9CA 3H82B 1NLYA 2W3HA 3TW8A 2P08A 2YKFA 3KO6A 1T1CA 4DN0A 1UWNX 2FH5A 2YKHA 4HH2A 1OTBA 3VV4A 3E4OA 2JKRI 1OTIA 4ARZA 2PYPA 3BW6A 5HWTA 1TS0A 5F69A 2L0WA 5AVEA 1F5MA 5CX7A 2V1AA 4NEED 3BWLA 3TJZC 1KOUA 2PR5A 5HWVA 5IS1A 3HJIA 1TS7A 1XJ2A 5K5BA 3S7QA 2VA0A 4BWIA 2VGLM 4L0LA 4PKYG 2WKRA 2LB5A 4G3KA 4I5SA 4ETXA 4BMWA 3NOUC 4H6JB 2DMWA 4WL9A 3T4JA 2BASA 4XT2A 1TD5A 1S4SA 3RFBA 3A0SA 4LRXC 4CLCC 4CLCA 3LR0A 4R70A 4F3LB 2OWHA 3CITA 3OLOA 4EETB 3E4QA 4UQIS 3KSHA 4WUJA 4XT2B 4HNBA 3LI9A 4EEUA 1XFNA 2V1BA 1T18A 3B33A 3F1NB 4NXBA 4Y3IA 1P9RA 3CWFA 3LI8A 1OT6A 2L1MA 2P7JA 3PBTA 3CI6A 1ZTUA 1BYWA 3F1OB 2PD7A 2LB9A 2MJ6A 4PAUA 3D72A 2GX5A 3EEAA 4LRZE 2ZMFA 3E4PA 4Z1WA 3UB7A 1DP8A 3T4QA 4EQ1A 4HI4A 1JNUA 4ME4A 2EWVA 5HD5A 1XFQA 5FL3A 1DRMA 4PHTA 3T4KA 2FZ0A 2PHYA 1MC0A 2JKTM 2PD8A 3NOPC 3UE3A 2J3TC 4M4XA 3KYQA 2D01A 3FG8A 1P9WA 3A0VA 3BJNA 4O8GA 3RH8B 1OTEA 4WF0A 2W3DA 3FC7A 5AVFA 4HY8A 3ZYTA 3VE4A 3LR3A 4ETZA 3LIAA 3PBRA 3CAXA 3KSGA 3K3DA 4MCWA 1OTDA 4NKPA 4EESA 3MF0A 4K08A 4L9EA 4BBUA 4P6ZM 4CLCD 2IA2A 4Y2FA 3LIBA 5L8MA 3SW1A 5EFWA 2JKTI 3MMHA 4MN6A 4MN7A 3H9WA 1MZUA 4L9FA 4KUKA 1OPXA 3OBFA 2R78A 3HCYA 2VEAA 4GS9B 3A0RA 3S7PA 4LPZA 2NUPC 2Z6CA 5HWWA 2QJ5A 4B93A 4CLCE 1S66L 4JGOA 1LSVA 5MC7A 3LICA 2OOLA 5LBRA 4Q0IA 4LLOB 2ZBBA 3MQQA 2EWWA 2XA7S 4BBTA 3IS2B 2HJEA 4HP9A 3UE6A 4R6LA 4EW7A 4FSFA 4HQAA 4KUOA 3JVVA 3T4SA 3TRCA 2PYRA 3P7NA 4LRYC 3LIEA 2O0YA 1GSXA 2PDRA 2W0NA 3BQ8A 4ARZB 1YSPA 2W3GA 3S7NA 1D7EA 2V9AA 1UWPX 3S7OA 1DP6A 4JGPA 4HJ3A 4HIAA 5HD3A 5HDSA 5TBMA 3F1PA 5G4YA 3UMDA 5KSHA 3PXPA 2OAQ1 2V0UA 3P01A 3UB8A 4NXGA 1VB6A 2VJWA 2WKQA 1F9IA 1ODVA 3PBSA 2KX6A 5TBMB 1OJGA 1T1BA 1DP9A 2QWSA 3F1PB 2Z6DA 3NJAA 1LT0A 5DJUA 5HPIA 1P97A 1V9ZA 1XJ3A 2W1TA 4CLCB 1N9NA 2WKPA 1S4RA 1W63M 1YSQA 3GDIA 2M1CA 4CQHA 1W63Q 3G6OA 2Y79A 1VHMA 3MXQA 4BBVA 2B18A 2ZOIA 5HPFA 3B47A 3PHYA 4EU0A 2HJ9C 2VLGA 1S67L 3BQAA 4IUKA 3H7WA 2J3WA 3LFVA 1TS8A 1N9LA 3OCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H28 A;  5HSQ A;  1GSW A;  5J7E A;  4HOI A;  4NXE A;  4HHD A;  5DKL A;  2B02 A;  4DJ2 A;  1NWZ A;  4I38 A;  1Y28 A;  1TS6 A;  4I3A A;  1D06 A;  4HJ4 A;  4NXF A;  3VOL A;  4JGQ A;  1G28 A;  4B9O A;  1T19 A;  4R3A A;  5HDD A;  2PR6 A;  1X0O A;  3EWK A;  3RTY A;  3LUQ A;  4GCZ A;  3VE3 A;  3EEH A;  3ZQ5 A;  3BY8 A;  3H82 A;  2I9V A;  1OT9 A;  3KX0 X;  4MN5 A;  3NHQ A;  4I3I A;  4PKY A;  2ZOH A;  5I5L A;  1T1A A;  3ICY A;  4EEP A;  4GW9 A;  1P0Z A;  3UB6 A;  5A8B A;  5G4Z A;  2QKP A;  5HZH A;  3UME A;  3MQO A;  4H6J A;  4EER A;  1N9O A;  4L9G A;  1S1Z A;  5F68 A;  3ULF A;  3LID A;  4GHI A;  1OJ5 A;  5J3W A;  2A24 A;  3C8C A;  4F3L A;  3MJQ A;  4HH3 A;  1EW0 A;  1LL8 A;  3GEC A;  4YWZ A;  4GHI B;  2KDK A;  1XJ4 A;  4RQ9 A;  3F1N A;  4I3J A;  2INW A;  2A24 B;  5KIZ A;  1F98 A;  5IU1 A;  4EXO A;  3IBR A;  2GJ3 A;  4JGR A;  1OTA A;  5F5Y A;  3PYP A;  1GSV A;  3C2W A;  3F1O A;  2K7S A;  4KQD A;  2OWJ A;  2D02 A;  3H7W B;  4HJ6 A;  2L4R A;  3CLO A;  3LYX A;  5J4E A;  2J80 A;  3K3C A;  5HDC A;  2EA9 A;  2V0W A;  2QJ7 A;  1UGU A;  4R38 A;  1LSX A;  3T50 A;  3MR0 A;  4E04 A;  2JN7 A;  1V9Y A;  1S1Y A;  4I39 A;  4WN5 A;  5F6A A;  2HV1 A;  3NOT C;  2JHE A;  2W27 A;  2QHK A;  3MFX A;  4GS9 A;  2CMN A;  4DJ3 A;  2VV8 A;  5DJT A;  2VV6 A;  3HJK A;  3LIF A;  1WA9 A;  1LSW A;  4WLA A;  3UB9 A;  1XJ6 A;  4HP4 A;  5DKK A;  3IS2 A;  3BY9 A;  2VV7 A;  3H82 B;  2YKF A;  1T1C A;  1UWN X;  2YKH A;  4HH2 A;  1OTB A;  3E4O A;  1OTI A;  2PYP A;  5HWT A;  1TS0 A;  5F69 A;  2L0W A;  5AVE A;  2V1A A;  3BWL A;  1KOU A;  2PR5 A;  5HWV A;  5IS1 A;  3HJI A;  1TS7 A;  1XJ2 A;  4PKY G;  2WKR A;  4I5S A;  3NOU C;  4H6J B;  4WL9 A;  2BAS A;  4XT2 A;  1S4S A;  3A0S A;  4R70 A;  4F3L B;  2OWH A;  3OLO A;  4EET B;  3E4Q A;  4XT2 B;  4WUJ A;  4HNB A;  3LI9 A;  4EEU A;  1XFN A;  2V1B A;  1T18 A;  3B33 A;  3F1N B;  4NXB A;  3LI8 A;  3CWF A;  1OT6 A;  2L1M A;  2P7J A;  1BYW A;  3F1O B;  2PD7 A;  3UB7 A;  3D72 A;  4LRZ E;  3E4P A;  1DP8 A;  4EQ1 A;  4HI4 A;  1JNU A;  5HD5 A;  1XFQ A;  1DRM A;  2PHY A;  2PD8 A;  3NOP C;  4M4X A;  2D01 A;  3FG8 A;  3A0V A;  3RH8 B;  1OTE A;  4WF0 A;  3FC7 A;  5AVF A;  4HY8 A;  3VE4 A;  3LIA A;  3CAX A;  3K3D A;  1OTD A;  4EES A;  4K08 A;  4L9E A;  4BBU A;  3LIB A;  3SW1 A;  5EFW A;  4MN6 A;  3H9W A;  1MZU A;  4L9F A;  4KUK A;  2R78 A;  2VEA A;  4GS9 B;  3A0R A;  4LPZ A;  2Z6C A;  5HWW A;  2QJ5 A;  1S66 L;  4JGO A;  1LSV A;  3LIC A;  2OOL A;  4LLO B;  2ZBB A;  3MQQ A;  4BBT A;  3IS2 B;  4HP9 A;  3UE6 A;  4R6L A;  4EW7 A;  4HQA A;  4KUO A;  2PYR A;  3P7N A;  4LRY C;  3LIE A;  1GSX A;  2PDR A;  2W0N A;  1D7E A;  2V9A A;  1UWP X;  1DP6 A;  4JGP A;  4HJ3 A;  4HIA A;  5HD3 A;  5HDS A;  5TBM A;  3F1P A;  5G4Y A;  3UMD A;  2V0U A;  3UB8 A;  4NXG A;  1VB6 A;  2WKQ A;  1F9I A;  1ODV A;  2KX6 A;  5TBM B;  1OJG A;  1T1B A;  1DP9 A;  2QWS A;  3F1P B;  2Z6D A;  3NJA A;  1LT0 A;  5DJU A;  1P97 A;  1V9Z A;  1XJ3 A;  1N9N A;  2WKP A;  1S4R A;  3GDI A;  2M1C A;  3G6O A;  4BBV A;  3MXQ A;  2ZOI A;  3PHY A;  2VLG A;  1S67 L;  3H7W A;  1TS8 A;  1N9L A;  4LRX C; 
#chains in the Genus database with same CATH topology
 2H28 A;  2QPN A;  2VX8 A;  1GSW A;  1VEU B;  3NDG A;  4KZA A;  2DCF A;  2Y8H A;  4B4X A;  3EQV A;  1FSY A;  3TG9 A;  2P9V A;  4HBT A;  5AQ9 A;  3QNC A;  4HJ4 A;  3PBN A;  1CI8 A;  4XXR A;  5DFY A;  3ITA A;  2OV5 A;  1T19 A;  2P9V B;  3T12 B;  2WYX A;  2O99 A;  1K57 A;  2EX8 A;  2VGJ A;  1MY8 A;  3PAG A;  4WMC A;  3VE3 A;  1AWI A;  3U4L P;  3EEH A;  1W8Y A;  1QMF A;  5IT5 A;  5EPH A;  4E6X A;  1RP5 A;  3MKE A;  2I9V A;  1YLT A;  2WUQ A;  1OT9 A;  2ZQA A;  3ZG5 A;  3KX0 X;  3N8R A;  1BUE A;  4PM5 A;  2BLS A;  4PKY A;  3G2Z A;  1Y4O A;  3ICY A;  4KZ6 A;  3O5Y A;  4MDZ A;  5AQ7 A;  3UB6 A;  2K2N A;  2XDM A;  2IWD A;  1STZ A;  2QKP A;  3ZVT A;  1IKI A;  1YM1 A;  2Z2M B;  4LFU A;  3IH9 A;  3ULF A;  3SOI A;  3G32 A;  4KQO A;  1NYY A;  2Y2O A;  4X1L A;  5CGS A;  4OH0 A;  5L2F A;  4OPZ A;  1IOU A;  3VP0 A;  4FOF A;  4RQ9 A;  4DF6 A;  2HDU A;  3BLM A;  1XX2 A;  2O9A A;  1W5D A;  3S1Y A;  4JGR A;  3T4O A;  4AFI A;  5CRF A;  4X25 A;  2M7V A;  2XK1 A;  5GHZ A;  4DDY A;  4HJ6 A;  3EQU A;  3PAE A;  5FSR A;  3LYX A;  1IEM A;  2HF6 A;  1IYP A;  3FPV A;  3BEC A;  3V5M A;  2H10 A;  4WEJ A;  5HDC A;  3TE8 A;  3ZG0 A;  5TGF A;  1MKI A;  5CTM A;  1UGU A;  4R38 A;  1FQG A;  3IX3 A;  5HL6 A;  2J9P A;  4A5R A;  4E04 A;  2XFS A;  4I39 A;  4BD1 A;  4ZAM A;  4Y7P A;  4IHQ A;  3G4P A;  4GLQ A;  5EVI C;  2QYB A;  4N9K A;  1YLJ A;  4YOF A;  3DAV A;  5CHU A;  2Y2Q A;  4G3V A;  2XSS A;  5DJT A;  3NC8 A;  4DE2 A;  4X1M A;  1KVM A;  3PBO A;  1LSW A;  1ONG A;  1EWZ A;  3MSH A;  3LR5 A;  2ZMA A;  5HAR A;  1RGY A;  3V3R A;  5A91 A;  4GOG A;  4OPY A;  3C38 A;  3D3O A;  2VV7 A;  1K6S A;  2O9C A;  3H82 B;  4GKU A;  4KZ9 A;  3TW8 A;  3SH8 A;  5EEC A;  3UDF A;  2YKF A;  3KO6 A;  1PW8 A;  4GZB A;  1BLH A;  1ERQ A;  5DTT A;  3DWZ A;  4ARZ A;  2PYP A;  3BW6 A;  5F69 A;  2UWX A;  5F1F A;  4NEE D;  3BWL A;  3AGD A;  5HWV A;  2WAE A;  4E6W A;  5M19 A;  3UE1 A;  1H8Y A;  1PW1 A;  2ZM8 A;  3VSK A;  4EBP A;  3ZG7 B;  2RCX A;  3OPH A;  1Q2P A;  4IBR A;  4PKY G;  3HUO A;  3G35 A;  4BMW A;  3LY3 A;  4H6J B;  4XT2 A;  4P0M A;  3RFB A;  5TFQ A;  1NXY A;  5FDS A;  4CLC A;  4R70 A;  3CIT A;  4XT2 B;  1VM1 A;  5CEB A;  5G18 A;  2GDN A;  2V1B A;  1T18 A;  4Y17 A;  3CWF A;  3OPP A;  1GCE A;  2P7J A;  3GV9 A;  3IWQ A;  3F1O B;  2LB9 A;  2WGI A;  2GX5 A;  2ZMF A;  3UDI A;  4EQ1 A;  1MWS A;  4ME4 A;  3S4X A;  4OPQ A;  5FL3 A;  2E8J A;  1BZA A;  1ONH A;  1K56 A;  5M1A A;  4WYY A;  4RYE A;  2FZ0 A;  3FV7 A;  2J3T C;  2D01 A;  1P9W A;  4O8G A;  3RH8 B;  1KGG A;  5FA7 A;  1OME A;  1K0K A;  3ZYT A;  1FOF A;  1OTD A;  3OPR A;  1BUL A;  4EES A;  3MF0 A;  3W4Q A;  1KVL A;  2Q9N A;  4FH2 A;  2IA2 A;  4DDS A;  5HW3 A;  4Y2F A;  2ZQD A;  5EFW A;  1KDS A;  2XGN A;  2JKT I;  3L9K A;  4MN7 A;  4E3I A;  5HAQ A;  1NRF A;  4GS9 B;  2EFU A;  3A0R A;  5EVE A;  3S7P A;  4IED A;  5CER A;  2XH9 A;  1LSV A;  3ZG8 B;  3ZCZ A;  2HPB A;  2OOL A;  2ZBB A;  3MQQ A;  1G5U A;  2ZC3 B;  3IS2 B;  5DF7 A;  2HJE A;  4HP9 A;  2PRF A;  3WS0 A;  3W4O A;  1K55 C;  4LV2 A;  2PYR A;  5GLC A;  3HUN A;  3LIE A;  1GSX A;  1K54 A;  2PDR A;  2W0N A;  2XFT A;  3MXS A;  1SHV A;  3S7O A;  2WKE A;  1DP6 A;  3CPT B;  2X01 A;  5HD3 A;  5TBM A;  1E3U D;  2WGV A;  3Q1F A;  2BG1 A;  1WYB A;  4BLM A;  2XD5 A;  2KX6 A;  3IT9 A;  5TBM B;  2QWS A;  3CHW P;  3NJA A;  4JF5 A;  4KQQ A;  5D3O A;  5FQI A;  1YLY A;  1XJ3 A;  1YSQ A;  3GDI A;  3WS4 A;  3NIA A;  2Y2K A;  4MNR A;  5HPF A;  2VLG A;  1S67 L;  3BQA A;  4IUK A;  2JCH A;  3IXH A;  3KYE A;  4GDB A;  4MBH A;  5HX9 A;  4OP5 A;  3T4T A;  4O01 A;  4NXE A;  1NRJ A;  5JYP A;  5CGX A;  2KLI A;  1KGE A;  2Y2I A;  4P85 A;  5CTN A;  1TS6 A;  3ZNT A;  2ZJ9 A;  2K31 A;  1J3W A;  2ZQC A;  1ACF A;  4H8R A;  4DMZ A;  4B9O A;  4Q8I A;  5FI2 A;  4JPM A;  5HDD A;  2PR6 A;  3ZVW A;  4JXV A;  1TF1 A;  4KEN B;  2KOI A;  4GCZ A;  3HLW A;  1YQS A;  2XRO A;  2ZL1 A;  4IJG A;  5EOE A;  5FAQ A;  1KE0 A;  3ZQ5 A;  2JKF A;  3ITB A;  2JBF A;  3SZT A;  1ES2 A;  3A3I A;  4MN5 A;  2HDS A;  4ZJ3 A;  4I3I A;  2J3T D;  2ZOH A;  5BOH A;  1G68 A;  3G2Y A;  3HLB A;  5I5L A;  2Y2P A;  3KYZ A;  5DF9 A;  1E4D A;  1Z6F A;  2XF3 A;  3L7H A;  4GN2 A;  1E25 A;  3R7W A;  2C5W B;  3NUL A;  1XXM A;  5G4Z A;  1FSW A;  3IF6 B;  3IF5 A;  3QP5 A;  5L07 A;  4II7 A;  1PWC A;  3KSF A;  3R7W B;  3A3E A;  3CZD A;  5GLB A;  1XPB A;  3ZDJ A;  2P04 A;  2C6W B;  4R4R A;  1S1Z A;  4Y0U A;  5F68 A;  4GHI A;  4DE0 A;  3BFE A;  3N8S A;  1NZU A;  1YLZ A;  4F3L A;  3IXG A;  4DRT A;  3VP1 A;  3FPW A;  3VMA A;  1LL8 A;  3GEC A;  4E3K A;  4GHI B;  3QHY A;  3WS5 A;  3HLD A;  3T1S A;  3CUE C;  4GJ4 A;  1F98 A;  2W1T B;  3IBR A;  2GJ3 A;  1OTA A;  5F5Y A;  1GSV A;  1ES5 A;  4S2J A;  2W3F A;  1GHP A;  2H0Y A;  5GHY A;  1IFQ A;  4QPR A;  3ZHH A;  2Q0O A;  4S2K A;  4OQ0 A;  3C5A A;  3KSI A;  2L4R A;  3VP3 A;  3CLO A;  5FAP A;  1K25 A;  4OQG A;  3N6I A;  4P87 A;  4KZB A;  2V8C A;  3MZE A;  1CQA A;  1ES4 A;  4S2L A;  2EA9 A;  4MBF A;  1XGJ A;  5EE8 A;  2B5R A;  1FIK A;  1LSX A;  2GZA A;  4D60 A;  3T50 A;  4U3T A;  4FUW A;  1YAX A;  4C3Q A;  5F6A A;  1O7E A;  1G6A A;  3NBL A;  4K0X A;  3W2Z A;  3DTM A;  2Y2H A;  2JHE A;  3P98 A;  3RJU A;  3HLG A;  4GNU A;  5EVI A;  1KDW A;  2W27 A;  2QHK A;  3IHB A;  4DJ3 A;  2VV6 A;  5FAS A;  3BFD A;  5EVI B;  3CG5 A;  4FH4 A;  4WLA A;  1C3B A;  4IUH A;  4D2O A;  3UB9 A;  4KZ5 A;  1AXB A;  1XJ6 A;  1BTL A;  5CGW A;  5DKK A;  1PWD A;  4EWF A;  3LEQ A;  4LCL A;  4K0W A;  2P08 A;  3LGO A;  1UWN X;  1LHY A;  3Q82 A;  2VGK A;  2ZC4 B;  5AVE A;  1F5M A;  3UDX A;  3QP8 A;  4N9L A;  1BT5 A;  1K6R A;  3LY4 A;  3C7V A;  1XJ2 A;  3BYD A;  4OQH A;  5K5B A;  3W8K A;  2VA0 A;  3HUM A;  1HZO A;  1JTD A;  1ZG6 A;  4DXB A;  3D9Y A;  2DMW A;  4WL9 A;  3T4J A;  2V2F F;  4NG2 A;  1DJC A;  4QWO A;  3A0S A;  1H5X A;  5L09 A;  2PAV P;  3FWL A;  2WGW A;  3VP2 A;  3B33 A;  4Y3I A;  3LI8 A;  1CEG A;  4OQI A;  5F83 A;  5HL1 A;  3QNB A;  3CI6 A;  2WGW B;  4KQR A;  2PD7 A;  2MJ6 A;  3D72 A;  4LRZ E;  3E4P A;  2E8I A;  4HES A;  1DP8 A;  1YLP A;  1O07 A;  5HD5 A;  3VFH A;  5KZH A;  1DRM A;  4PHT A;  3T4K A;  1ERM A;  4UA9 A;  2PHY A;  1MC0 A;  2JKT M;  2PD8 A;  3NOP C;  3UE3 A;  4JBF A;  3KYQ A;  2J9O A;  1FCM A;  3WRZ A;  3UPN A;  2FFF B;  4EV4 A;  4WF0 A;  4KZ7 A;  1ZKJ A;  1BSG A;  4HY8 A;  2HDQ A;  4EBN A;  2B95 A;  4ETZ A;  4O7D A;  3CAX A;  3KSG A;  4NKP A;  4L9E A;  4BBU A;  4Z9Q A;  4PM8 A;  2V8F A;  5M18 A;  1DJA A;  3BLS A;  2HZ5 A;  1JWV A;  4MN6 A;  1MZU A;  1TVF A;  1RGZ A;  4KUK A;  3OBF A;  1N9B A;  3T1R A;  1XGI A;  4MBK A;  4LPZ A;  5FQJ A;  3A3J A;  4FD8 A;  4B93 A;  4JF4 A;  1YT4 A;  3LIC A;  5LBR A;  3ZGA B;  4LLO B;  3I7J A;  2EWW A;  4BBT A;  3DTI A;  2Y2G A;  5EVL A;  3UE6 A;  1PI5 A;  4ZDX A;  3BRM A;  5EM0 A;  4KUO A;  1K55 A;  2XQZ A;  3S22 A;  4LRY C;  1MBL A;  4RVA A;  4U0X A;  2QMI A;  4ARZ B;  2W3G A;  3ZNY A;  4PM7 A;  1D7E A;  2V9A A;  3JYI A;  3MBZ A;  1UWP X;  4S2N A;  1CI9 A;  1MXO A;  2EX2 A;  3SS4 A;  3UMD A;  5KSH A;  5DVA A;  3Q7V A;  2WAD A;  5E2E A;  2V0U A;  4ID4 A;  4NXG A;  2VJW A;  1DP9 A;  3BEB A;  4NK3 A;  3SS5 A;  5DJU A;  1MWR A;  1P97 A;  4ZTK A;  4CLC B;  4LEN A;  2ZC7 A;  4FCF A;  1S4R A;  2Z2L B;  1W63 M;  5E43 A;  4CQH A;  2DRW A;  3G6O A;  4C75 A;  2Y79 A;  1VHM A;  4E3O A;  1ERO A;  4EUZ A;  2ZOI A;  3Q81 A;  3PHY A;  2HJ9 C;  3H7W A;  1FR1 A;  2J3W A;  3MZF A;  3GSG A;  4E3L A;  2QZ6 A;  5HSQ A;  3B42 A;  4E3N A;  1YKD A;  1MWU A;  3EGD C;  2B02 A;  2PT7 A;  4DJ2 A;  1NWZ A;  4I38 A;  3UO9 A;  1Y28 A;  1SKF A;  2Y91 A;  4Q0J A;  1HD8 A;  2G7U A;  2JC7 A;  5FQQ A;  3UN7 A;  3VOL A;  1G28 A;  1BLC A;  1IYQ A;  1J9M A;  1XA7 A;  4R3A A;  4BEN A;  2DNS A;  4X56 A;  1X0O A;  4ZJ1 A;  2WK0 A;  4ZRR A;  4E3J A;  3LUQ A;  4NET A;  4JF6 A;  4EUV A;  4UHU A;  3MKF A;  2J7V A;  2ZMV A;  4UA7 A;  4U0T A;  4Q0H A;  3EGX C;  2G2U A;  3E0Y A;  2Y59 A;  2Y2L A;  2ZM0 A;  3RXW A;  2A2L A;  3BY8 A;  4N1X A;  1QME A;  1SCW A;  1S0W A;  5A90 A;  4P6B A;  5AJG A;  1BLP A;  5U47 A;  4KG5 A;  5J8X A;  5FEF A;  1HVB A;  5CEC A;  5A93 A;  2WZZ A;  1T1A A;  5CXW A;  4GW9 A;  4CJN A;  3OC2 A;  3OPL A;  3WS2 A;  1PRQ A;  5A8B A;  3Q07 A;  3MQ0 A;  3VOY A;  5TR7 A;  3JVU A;  4OLD A;  3UME A;  1YMS A;  3ZG9 B;  1H8Z A;  3MQO A;  5GLA A;  4EER A;  3C7U A;  1EI5 A;  3NCK A;  4L9G A;  1I2W A;  3LID A;  4KG6 A;  1XA1 A;  1HLU P;  4JLF A;  4ZBE A;  1OJ5 A;  3GVB A;  4R3B A;  4G3W A;  5J3W A;  4MMN A;  4OOY A;  2A24 A;  3FZC A;  2HGV A;  1K4F A;  3MJQ A;  4WMC D;  4HH3 A;  1EW0 A;  4ESP A;  4YWZ A;  1G6O A;  1I5Q A;  3F1N A;  4I3J A;  3SH9 A;  3N7W A;  2INW A;  2A24 B;  5KIZ A;  3CUE A;  1H8M A;  4X55 A;  5IU1 A;  4EXO A;  4LGW A;  3IQA A;  3OZH A;  3PYP A;  3LR4 A;  1DJB A;  4PPR A;  5HAI A;  2K7S A;  1YPR A;  1IEL A;  2OWJ A;  2OSU A;  5A92 A;  2D02 A;  5FAT A;  4N92 A;  2ACG A;  2J80 A;  3K3C A;  2P74 A;  4YFM A;  3DBA A;  2V0W A;  4OPR A;  2PU2 A;  2QJ7 A;  1IYO A;  5I94 A;  4YIN A;  3IX4 A;  3BFF A;  5C5K A;  2EX6 A;  2JN7 A;  1V9Y A;  1S1Y A;  4JXS A;  1K38 A;  3FKV A;  2HV1 A;  5GLD A;  1JVJ A;  3NOT C;  1CK3 A;  3QP4 A;  1M40 A;  1JTG A;  3MFX A;  5GL9 A;  3SH7 A;  3UPP A;  2CMN A;  4XUZ A;  2VV8 A;  3AGE A;  4R3J A;  2VZW A;  3HJK A;  3V67 A;  5TJJ A;  3LIF A;  1VET A;  5DTS A;  2ZL1 B;  1ALQ A;  4HP4 A;  2H0T A;  3T4L A;  3BFC A;  3V3S A;  2W3H A;  1VET B;  2UV0 E;  4X68 A;  3VFF A;  4DN0 A;  2FH5 A;  1PI4 A;  2YKH A;  1SDE A;  3IXB A;  2JKR I;  1OTI A;  2ZC5 B;  5HWT A;  2L0W A;  5CX7 A;  3GRJ A;  2V1A A;  1YLW A;  3TJZ C;  4HBU A;  2PR5 A;  4WZ4 A;  3HLF A;  1TS7 A;  3CJM A;  2XEP A;  3IXD A;  3S7Q A;  1YMX A;  4BWI A;  2VGL M;  1D1J A;  4MLL A;  2WKR A;  4G3K A;  4ETX A;  1S4S A;  1M6K A;  4F3L B;  5E2H A;  2A3U A;  2OWH A;  3UE0 A;  3E2L A;  3KSH A;  4KZ8 A;  4EEU A;  2IWC A;  5E2G A;  4NXB A;  1OT6 A;  4BL3 A;  2Q9M A;  3PBT A;  1ZTU A;  1BYW A;  2PBY A;  4PAU A;  3EEA A;  4Z1W A;  4HI4 A;  1JNU A;  2HP6 A;  1JWP A;  4R23 A;  3FG8 A;  3A0V A;  3BJN A;  1LI0 A;  1OTE A;  3WS1 A;  2OLU A;  4M3K A;  5FDH A;  3FC7 A;  3TSG A;  3E2K A;  3JPU A;  4LCM A;  3LR3 A;  1E3U A;  4RA7 A;  3B3X A;  3K3D A;  1PWG A;  2BTF P;  3O86 A;  4K08 A;  4P6Z M;  4CLC D;  2Y4A A;  3LCE A;  3H9W A;  4L9F A;  2R78 A;  2J8Y A;  2ZD8 A;  5KMW A;  1GA0 A;  5HWW A;  2QJ5 A;  1BLS A;  1SKO A;  3O88 A;  4CLC E;  1S66 L;  3MZD A;  3GR2 A;  2XLN A;  2ZM2 A;  4WZ5 C;  5FI6 A;  1SKO B;  4Y13 A;  4EW7 A;  1FIL A;  4ZJ2 A;  4EQI A;  1KE4 A;  4GD6 A;  1K56 D;  3T4S A;  4KG2 A;  3P7N A;  1PZO A;  3IWO A;  3ISG A;  2Y55 A;  3IF6 C;  5CED A;  1CJF A;  2ZLY A;  5AQA A;  3S7N A;  4S2I A;  4QY5 A;  4JGP A;  1ES3 A;  4HJ3 A;  4HIA A;  5HDS A;  2Y2J A;  3F1P A;  1PNE A;  3A3F A;  3MFD A;  4B88 A;  1VB6 A;  2WKQ A;  4MEZ A;  1F9I A;  1ODV A;  1SZV A;  1T1B A;  3NY4 A;  3ZFZ A;  1LL5 A;  3F1P B;  1ESU A;  2Z6D A;  1LT0 A;  5HPI A;  4RX2 A;  1L0E A;  1V9Z A;  1XP4 A;  2M1C A;  1IYS A;  1HTZ A;  1DY6 A;  2WKH A;  1GHI A;  5FQM A;  1PFL A;  2H5S A;  1N9L A;  4LRX C;  3PTE A;  3OCN A;  1Y54 A;  4IBX A;  5EUA A;  5J7E A;  3OOV A;  4HOI A;  3E98 A;  1Z09 A;  2NUT C;  1H3Q A;  4BQM A;  2JKG A;  3AGF A;  3BFG A;  4HHD A;  5DKL A;  1F2K A;  1TEM A;  3U2A A;  2G2W A;  2OLV A;  3O87 A;  2OAP 1;  3C4P A;  4I3A A;  1D06 A;  2I72 A;  2R9X A;  2VGL S;  3W4P A;  4NXF A;  4JGQ A;  4Y5F A;  1N4O A;  4E3M A;  4UEY A;  3N4I A;  4IVK A;  1K57 C;  2WAF A;  3PR6 A;  4WEL A;  3EWK A;  3RTY A;  1JWZ A;  3GQZ A;  5EV0 A;  4WEK A;  4UQI M;  2O9B A;  4WBG A;  3V50 A;  2PU4 A;  1TDL A;  4KZ4 A;  5HFO A;  3H82 A;  3HLE A;  2VKS A;  2R9W A;  1W8Q A;  1MKM A;  3M6B A;  3NHQ A;  4JKT A;  1S6R A;  4OLG A;  4X53 A;  1PZP A;  4N1H A;  3R4K A;  4EEP A;  3CMZ A;  1P0Z A;  4EBL A;  4QJG A;  4K91 A;  5HZH A;  1KE3 A;  1NLZ A;  3LO7 A;  1CEF A;  3GMW A;  1NYM A;  1L0F A;  4H6J A;  1N9O A;  2X71 A;  3T1X A;  4X69 A;  2ZQ7 A;  3C30 A;  4DE1 A;  3Q7V B;  4P6Z S;  3C8C A;  3FYZ A;  1RCJ A;  1SDN A;  1ESI A;  2KDK A;  1XJ4 A;  2GNX A;  1WYC A;  5HAP A;  4HEF A;  4LV0 A;  3UPO A;  1ZHH B;  4S2M A;  3C2W A;  3F1O A;  3DTE A;  5L10 A;  4KQD A;  4R4S A;  3IBJ A;  4OOL A;  2W3E A;  2XA7 M;  3PBQ A;  1LLB A;  4Y15 A;  4R1G A;  1PIO A;  3QP2 A;  1FCO A;  3H7W B;  2W1R A;  2CC1 A;  4IVI A;  5J4E A;  3QP6 A;  1L0G A;  5EM1 A;  3K2N A;  3EOI A;  3OCL A;  2WKI A;  3DTK A;  4PMA A;  1H0M A;  4O0P A;  2HDR A;  2XRN A;  3MR0 A;  3IX8 A;  2IWB A;  1LL9 A;  3NI9 A;  4WN5 A;  4OOM A;  3P09 A;  4UA6 A;  4YNR A;  4DKI A;  3MXR A;  4OVD A;  1MWT A;  5EOO A;  4GB7 A;  1ZC2 A;  4QHC A;  4CPK A;  4JXG A;  2EXA A;  4PM9 A;  2JKR M;  4GS9 A;  1GHM A;  3NEC A;  3UNW A;  4R0Q A;  2XD1 A;  3QP1 A;  2AVX A;  1WA9 A;  5GHX A;  3DWK A;  5DFX A;  3IHA A;  2M7U A;  3IS2 A;  4BJP A;  3BY9 A;  3WWX A;  1NLY A;  4FTX A;  5DTK A;  1T1C A;  4HH2 A;  1OTB A;  3VV4 A;  3E4O A;  1XKZ A;  1TS0 A;  3BM6 A;  1KOU A;  2PBD P;  5IS1 A;  3HLC A;  3HJI A;  3CPT A;  4LV1 A;  3UY6 A;  5KSC A;  4Y0T A;  2WZX A;  3HRE A;  3MS6 A;  4L0L A;  4GDN A;  2LB5 A;  4UAA A;  4I5S A;  1L0D A;  3NOU C;  4PM6 A;  4S2N C;  4F94 A;  3C4O A;  5EVI D;  2BAS A;  1TD5 A;  1L3L A;  3VOZ A;  3IH8 A;  4CLC C;  3LR0 A;  1NZO A;  3OLO A;  3VSL A;  1FCN A;  4EET B;  3LEZ A;  3E4Q A;  4UQI S;  4WUJ A;  4HNB A;  1U60 A;  3LI9 A;  4S2P A;  4OP8 A;  1XFN A;  3G31 A;  3F1N B;  1NJ4 A;  1LI9 A;  1P9R A;  4QB8 A;  2HP5 A;  3NDE A;  3D4F A;  2L1M A;  3A3D A;  3G34 A;  4QY6 A;  5FAO A;  3O3V A;  1KGF A;  4WM9 A;  4XUX A;  3UB7 A;  1L2S A;  1CF0 A;  2A49 A;  3T4Q A;  1PYY A;  2Y2N A;  2EWV A;  1XFQ A;  5FI7 A;  1A0K A;  2HP9 A;  5FQ9 A;  2Y2M A;  3FKW A;  5IHV A;  2ZQ9 A;  5AQB A;  1W7F A;  3Q7Z A;  4M4X A;  4B4Z A;  5CHM A;  3M6H A;  2W3D A;  3SS3 A;  5AVF A;  4Y0O A;  3G30 A;  3VE4 A;  3HL9 A;  4OON A;  3LIA A;  1I2S A;  3PBR A;  3N8L A;  4MCW A;  4LV3 A;  4QU3 A;  3LIB A;  5L8M A;  3SW1 A;  3MMH A;  1OPX A;  3HCY A;  4RX3 A;  2VEA A;  4DXC A;  5F82 A;  1WE4 A;  2NUP C;  2Z6C A;  3M2K A;  2FFY A;  1TDG A;  1W79 A;  3UB5 P;  3IWI A;  4S2O A;  4JGO A;  5FEG A;  5MC7 A;  4KZ3 A;  2ZC6 B;  4Q0I A;  2XA7 S;  3TOI A;  1K4E A;  4WZ5 A;  1GA9 A;  4C6Y A;  3M2J A;  4R6L A;  3V39 A;  4FSF A;  5F1G A;  2EXB A;  4HQA A;  3JVV A;  3TRC A;  4GD8 A;  2JE5 A;  2O0Y A;  1K54 C;  1FR6 A;  3BQ8 A;  3IF6 A;  1IKG A;  4DE3 A;  1YSP A;  2X02 A;  3HVF A;  3DW0 A;  2V1Z A;  1ZG4 A;  4JXW A;  4OKP A;  1MPL A;  5G4Y A;  3PXP A;  2OAQ 1;  3P01 A;  2VK3 A;  3UB8 A;  1VQQ A;  3PBS A;  3WRT A;  1OJG A;  2RL3 A;  2EFX A;  4BD0 A;  5DF8 A;  2V20 A;  1NY0 A;  5E2F A;  3GTC A;  3HBR A;  4QD4 A;  5JYO A;  1Q2Q A;  5FQK A;  2W1T A;  2ZQ8 A;  1N9N A;  2WKP A;  3RXX A;  3VP4 A;  1W63 Q;  4BBV A;  3MXQ A;  2B18 A;  1VEU A;  3B47 A;  4EU0 A;  2XR0 A;  4BL2 A;  2EX9 A;  3LFV A;  1TS8 A;  3T1Q B;  5CHJ A;  4X6T A; 
#chains in the Genus database with same CATH homology
 2H28 A;  2VX8 A;  5HSQ A;  1GSW A;  3T4T A;  5J7E A;  4O01 A;  3OOV A;  4HOI A;  3B42 A;  3E98 A;  2NUT C;  4NXE A;  1H3Q A;  1NRJ A;  1YKD A;  4HHD A;  3EGD C;  2B02 A;  2PT7 A;  5DKL A;  2Y8H A;  2KLI A;  4DJ2 A;  1NWZ A;  3U2A A;  4I38 A;  3EQV A;  1Y28 A;  1TS6 A;  4Q0J A;  2OAP 1;  2G7U A;  4I3A A;  1D06 A;  2K31 A;  4HJ4 A;  3PBN A;  2VGL S;  4NXF A;  5DFY A;  4JGQ A;  4Y5F A;  3VOL A;  1G28 A;  4DMZ A;  4B9O A;  1T19 A;  4R3A A;  4UEY A;  2O99 A;  5HDD A;  2PR6 A;  1X0O A;  3PR6 A;  4WEL A;  1TF1 A;  3EWK A;  4ZRR A;  3RTY A;  3LUQ A;  4EUV A;  2KOI A;  4GCZ A;  4WEK A;  2ZMV A;  4UQI M;  2O9B A;  3VE3 A;  4Q0H A;  2XRO A;  4IJG A;  3EGX C;  3EEH A;  3E0Y A;  3ZQ5 A;  5IT5 A;  2A2L A;  3BY8 A;  3H82 A;  5AJG A;  2VKS A;  2I9V A;  1OT9 A;  3KX0 X;  1MKM A;  4MN5 A;  3NHQ A;  4I3I A;  2J3T D;  4PKY A;  2ZOH A;  5I5L A;  5DF9 A;  3KYZ A;  1T1A A;  3ICY A;  3R4K A;  4EEP A;  3R7W A;  4GW9 A;  3O5Y A;  1P0Z A;  3OC2 A;  4MDZ A;  3UB6 A;  5A8B A;  5G4Z A;  3MQ0 A;  2K2N A;  1STZ A;  4II7 A;  2QKP A;  3KSF A;  1NLZ A;  3JVU A;  5HZH A;  3UME A;  3R7W B;  2P04 A;  3MQO A;  4H6J A;  4EER A;  1N9O A;  4L9G A;  1S1Z A;  5F68 A;  3ULF A;  3LID A;  4GHI A;  3C30 A;  1OJ5 A;  4KQO A;  4G3W A;  5J3W A;  4MMN A;  4P6Z S;  2A24 A;  3C8C A;  4F3L A;  2HGV A;  3MJQ A;  3FPW A;  4HH3 A;  1EW0 A;  1LL8 A;  3GEC A;  4YWZ A;  4GHI B;  1IOU A;  1G6O A;  2KDK A;  1XJ4 A;  4FOF A;  3F1N A;  2GNX A;  4I3J A;  4RQ9 A;  2INW A;  2A24 B;  5KIZ A;  3CUE C;  3CUE A;  4GJ4 A;  2O9A A;  1F98 A;  1H8M A;  5IU1 A;  2W1T B;  4EXO A;  3IBR A;  2GJ3 A;  4JGR A;  1OTA A;  1ZHH B;  5F5Y A;  3PYP A;  3LR4 A;  1GSV A;  3T4O A;  4AFI A;  3C2W A;  3F1O A;  2W3F A;  2K7S A;  4KQD A;  3IBJ A;  2OWJ A;  1IFQ A;  4OOL A;  4QPR A;  2W3E A;  2XA7 M;  3PBQ A;  2M7V A;  2D02 A;  3H7W B;  4HJ6 A;  3KSI A;  2L4R A;  3EQU A;  2W1R A;  3CLO A;  3LYX A;  2HF6 A;  5J4E A;  3FPV A;  2J80 A;  3K3C A;  4WEJ A;  3TE8 A;  5HDC A;  3K2N A;  3DBA A;  2EA9 A;  3EOI A;  3OCL A;  2V0W A;  2QJ7 A;  1UGU A;  4R38 A;  1LSX A;  2GZA A;  5C5K A;  4O0P A;  3T50 A;  5HL6 A;  2XRN A;  3MR0 A;  4E04 A;  2JN7 A;  1V9Y A;  1S1Y A;  1YAX A;  4I39 A;  4WN5 A;  5F6A A;  4OOM A;  3W2Z A;  2HV1 A;  4YNR A;  4IHQ A;  3NOT C;  4GLQ A;  2JHE A;  2QYB A;  2W27 A;  4YOF A;  2QHK A;  3MFX A;  2JKR M;  4GS9 A;  4G3V A;  2CMN A;  2XSS A;  2VV8 A;  4DJ3 A;  5DJT A;  2VV6 A;  2VZW A;  3HJK A;  3PBO A;  3V67 A;  5TJJ A;  3LIF A;  1WA9 A;  1LSW A;  4WLA A;  4IUH A;  3LR5 A;  5DFX A;  3UB9 A;  1XJ6 A;  4HP4 A;  5DKK A;  3T4L A;  2M7U A;  3IS2 A;  4BJP A;  3BY9 A;  3C38 A;  3D3O A;  2VV7 A;  2O9C A;  3H82 B;  1NLY A;  2W3H A;  3TW8 A;  2P08 A;  2YKF A;  3KO6 A;  1T1C A;  4DN0 A;  1UWN X;  2FH5 A;  2YKH A;  4HH2 A;  1OTB A;  3VV4 A;  3E4O A;  2JKR I;  1OTI A;  4ARZ A;  2PYP A;  3BW6 A;  5HWT A;  1TS0 A;  5F69 A;  2L0W A;  5AVE A;  1F5M A;  5CX7 A;  2V1A A;  4NEE D;  3BWL A;  3TJZ C;  1KOU A;  2PR5 A;  5HWV A;  5IS1 A;  3HJI A;  1TS7 A;  1XJ2 A;  5K5B A;  3S7Q A;  2VA0 A;  4BWI A;  2VGL M;  4L0L A;  4PKY G;  2WKR A;  2LB5 A;  4G3K A;  4I5S A;  4ETX A;  4BMW A;  3NOU C;  4H6J B;  2DMW A;  4WL9 A;  3T4J A;  2BAS A;  4XT2 A;  1TD5 A;  1S4S A;  3RFB A;  3A0S A;  4LRX C;  4CLC C;  4CLC A;  3LR0 A;  4R70 A;  4F3L B;  2OWH A;  3CIT A;  3OLO A;  4EET B;  3E4Q A;  4UQI S;  3KSH A;  4WUJ A;  4XT2 B;  4HNB A;  3LI9 A;  4EEU A;  1XFN A;  2V1B A;  1T18 A;  3B33 A;  3F1N B;  4NXB A;  4Y3I A;  1P9R A;  3CWF A;  3LI8 A;  1OT6 A;  2L1M A;  2P7J A;  3PBT A;  3CI6 A;  1ZTU A;  1BYW A;  3F1O B;  2PD7 A;  2LB9 A;  2MJ6 A;  4PAU A;  3D72 A;  2GX5 A;  3EEA A;  4LRZ E;  2ZMF A;  3E4P A;  4Z1W A;  3UB7 A;  1DP8 A;  3T4Q A;  4EQ1 A;  4HI4 A;  1JNU A;  4ME4 A;  2EWV A;  5HD5 A;  1XFQ A;  5FL3 A;  1DRM A;  4PHT A;  3T4K A;  2FZ0 A;  2PHY A;  1MC0 A;  2JKT M;  2PD8 A;  3NOP C;  3UE3 A;  2J3T C;  4M4X A;  3KYQ A;  2D01 A;  3FG8 A;  1P9W A;  3A0V A;  3BJN A;  4O8G A;  3RH8 B;  1OTE A;  4WF0 A;  2W3D A;  3FC7 A;  5AVF A;  4HY8 A;  3ZYT A;  3VE4 A;  3LR3 A;  4ETZ A;  3LIA A;  3PBR A;  3CAX A;  3KSG A;  3K3D A;  4MCW A;  1OTD A;  4NKP A;  4EES A;  3MF0 A;  4K08 A;  4L9E A;  4BBU A;  4P6Z M;  4CLC D;  2IA2 A;  4Y2F A;  3LIB A;  5L8M A;  3SW1 A;  5EFW A;  2JKT I;  3MMH A;  4MN6 A;  4MN7 A;  3H9W A;  1MZU A;  4L9F A;  4KUK A;  1OPX A;  3OBF A;  2R78 A;  3HCY A;  2VEA A;  4GS9 B;  3A0R A;  3S7P A;  4LPZ A;  2NUP C;  2Z6C A;  5HWW A;  2QJ5 A;  4B93 A;  4CLC E;  1S66 L;  4JGO A;  1LSV A;  5MC7 A;  3LIC A;  2OOL A;  5LBR A;  4Q0I A;  4LLO B;  2ZBB A;  3MQQ A;  2EWW A;  2XA7 S;  4BBT A;  3IS2 B;  2HJE A;  4HP9 A;  3UE6 A;  4R6L A;  4EW7 A;  4FSF A;  4HQA A;  4KUO A;  3JVV A;  3T4S A;  3TRC A;  2PYR A;  3P7N A;  4LRY C;  3LIE A;  2O0Y A;  1GSX A;  2PDR A;  2W0N A;  3BQ8 A;  4ARZ B;  1YSP A;  2W3G A;  3S7N A;  1D7E A;  2V9A A;  1UWP X;  3S7O A;  1DP6 A;  4JGP A;  4HJ3 A;  4HIA A;  5HD3 A;  5HDS A;  5TBM A;  3F1P A;  5G4Y A;  3UMD A;  5KSH A;  3PXP A;  2OAQ 1;  2V0U A;  3P01 A;  3UB8 A;  4NXG A;  1VB6 A;  2VJW A;  2WKQ A;  1F9I A;  1ODV A;  3PBS A;  2KX6 A;  5TBM B;  1OJG A;  1T1B A;  1DP9 A;  2QWS A;  3F1P B;  2Z6D A;  3NJA A;  1LT0 A;  5DJU A;  5HPI A;  1P97 A;  1V9Z A;  1XJ3 A;  2W1T A;  4CLC B;  1N9N A;  2WKP A;  1S4R A;  1W63 M;  1YSQ A;  3GDI A;  2M1C A;  4CQH A;  1W63 Q;  3G6O A;  2Y79 A;  1VHM A;  3MXQ A;  4BBV A;  2B18 A;  2ZOI A;  5HPF A;  3B47 A;  3PHY A;  4EU0 A;  2HJ9 C;  2VLG A;  1S67 L;  3BQA A;  4IUK A;  3H7W A;  2J3W A;  3LFV A;  1TS8 A;  1N9L A;  3OCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...