3LUQA

The crystal structure of a pas domain from a sensory box histidine kinase regulator from geobacter sulfurreducens to 2.5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
112
Chain Sequence
SDERLRLFTEHAPAALAMFDREMRYLAVSRRWREDYGLGDGDILGMSHYDIFPEIGEEWKSVHRRGLAGEVIRVEEDCFVRGRTQWLRWEVRPWYEGEGRVGGVVIFTEDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The Crystal Structure of a PAS Domain from a Sensory Box Histidine Kinase Regulator from Geobacter sulfurreducens to 2.5A
rcsb
source organism Geobacter sulfurreducens
molecule tags Transferase
total genus 21
structure length 112
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3luqA00
1LSVA 1S1YA 2A24B 1XJ2A 5J7EA 4R70A 3UMDA 1LSXA 3CLOA 1XJ3A 1N9OA 4LRXC 3H7WB 4WLAA 3UB7A 3IS2B 3UE6A 4GHIA 4JGRA 4WUJA 1N9NA 5AVFA 3CWFA 2VV8A 4L9FA 5EFWA 4L9EA 4NXEA 4LPZA 5J3WA 1OTAA 4HY8A 1T18A 3ICYA 4HJ6A 5A8BA 1X0OA 2J80A 1KOUA 4MN5A 4BBTA 2OOLA 4NXGA 2W0NA 5IS1A 4BBUA 1TS8A 3VE4A 3LIFA 1OTBA 3D72A 3F1PB 1VB6A 4JGOA 2VEAA 2PR5A 1P0ZA 5TBMA 3UB9A 5HWVA 4I38A 2VV7A 3MQOA 3E4QA 3H82B 4HP9A 2V1AA 3E4PA 4H6JA 5G4YA 2CMNA 3MJQA 2YKHA 4EW7A 3F1NA 4KUOA 5F6AA 3C8CA 1GSWA 3NOTC 4HJ4A 4WF0A 3CAXA 4HI4A 3LIEA 4NXBA 4DJ2A 1LL8A 3FC7A 3LI9A 1TS0A 4GW9A 3F1OB 2QWSA 3RTYA 3LI8A 1V9ZA 5G4ZA 2L0WA 2P7JA 4EEUA 2WKRA 5F69A 2QHKA 1UWNX 3RH8B 1GSXA 1OJGA 3LYXA 3ZQ5A 4GS9A 4L9GA 2L1MA 4EERA 5DJTA 5DJUA 2OWHA 1T1BA 3MFXA 4XT2A 1T1CA 4PKYG 1F9IA 5HWWA 5HDSA 2W27A 2A24A 1MZUA 5AVEA 3H7WA 3IS2A 3LIAA 1LSWA 2QKPA 2WKQA 2ZOIA 1S4SA 2OWJA 1DP8A 3LUQA 2H28A 4F3LA 3T50A 4R3AA 1S66L 1JNUA 2HV1A 4I5SA 5DKKA 3FG8A 3NOUC 3G6OA 1BYWA 2K7SA 2PYRA 2PD8A 1D7EA 4EQ1A 4KQDA 1ODVA 4H6JB 4YWZA 2V1BA 2V9AA 1TS7A 2JN7A 4M4XA 3UMEA 3SW1A 4EETB 5HZHA 2EA9A 5HDDA 1DP6A 3NJAA 3NOPC 3MXQA 3F1PA 1N9LA 3EEHA 4LLOB 3PHYA 3HJIA 1D06A 2ZBBA 2INWA 1WA9A 3EWKA 3OLOA 2BASA 4HOIA 5HWTA 3H82A 1XJ6A 2PYPA 4EESA 2D02A 3ULFA 5HSQA 3P7NA 4I3AA 4HH3A 2Z6DA 3UB8A 4GS9B 2L4RA 4NXFA 3KX0X 4GHIB 1G28A 2WKPA 2I9VA 3GDIA 4HHDA 3BWLA 3HJKA 2PD7A 1OTDA 2QJ7A 3F1OA 3IBRA 4E04A 1V9YA 2KDKA 1XJ4A 4WN5A 5HD5A 1DP9A 1OTIA 2M1CA 2D01A 3PYPA 4JGPA 4JGQA 3B33A 3C2WA 1GSVA 4HJ3A 2JHEA 3K3DA 3VOLA 2PDRA 4HP4A 2V0UA 4F3LB 3A0SA 2VLGA 1S67L 4I39A 1P97A 1Y28A 2Z6CA 1EW0A 3H9WA 4HH2A 1OJ5A 5TBMB 4MN6A 5IU1A 2PHYA 1T19A 3LICA 5I5LA 3MR0A 5HD3A 5KIZA 4EEPA 2ZOHA 1F98A 4HNBA 5DKLA 1DRMA 1NWZA 1TS6A 5F5YA 2KX6A 3F1NB 3BY9A 5HDCA 1OT9A 2B02A 3E4OA 4I3IA 1OT6A 1XFNA 3LIDA 4LRZE 4RQ9A 4BBVA 4B9OA 2PR6A 4KUKA 1UGUA 4HQAA 1OTEA 4DJ3A 4R38A 1T1AA 3GECA 4R6LA 3LIBA 4EXOA 5J4EA 3VE3A 1UWPX 3A0VA 2QJ5A 3A0RA 4K08A 2R78A 1S1ZA 5F68A 2V0WA 4GCZA 4LRYC 3UB6A 2VV6A 1S4RA 3BY8A 2GJ3A 4WL9A 4XT2B 3MQQA 3K3CA 1LT0A 2YKFA 4I3JA 1XFQA 4HIAA 3NHQA 4PKYA
chains in the Genus database with same CATH superfamily
4K91A 2A24B 4O7DA 4R70A 2E8JA 3UMDA 3Q7VB 3NBLA 4FSFA 4LRXC 4KQOA 4N1HA 3UE6A 3FPWA 1YMSA 3A3IA 5DTKA 2IWBA 2ZQ8A 4JGRA 3HREA 4PPRA 3MBZA 1NYMA 3KO6A 5HFOA 3CWFA 1ALQA 1RGZA 4P0MA 5EFWA 4L9EA 4NXEA 2V8FA 3UDFA 4CLCA 4LPZA 1OPXA 1OTAA 4HY8A 3TW8A 1W63M 3DW0A 1T18A 2HZ5A 3TE8A 4HJ6A 3SH9A 2OAQ1 1LL5A 3IWIA 1X0OA 3CPTA 3KSFA 4GDBA 1KOUA 4MN5A 3G2ZA 5CGWA 4NXGA 2HP6A 5IS1A 4BD0A 3BQ8A 2Y2NA 1TS8A 3EOIA 4KZ3A 2FZ0A 5HX9A 2J3WA 3LIFA 4BD1A 3KSIA 4LCMA 2W1TA 2XEPA 4JGOA 2WGWA 2VEAA 5A90A 1K57C 3MF0A 5EVIA 3EQUA 1G68A 5A91A 1FCNA 5FASA 2P04A 3HUOA 1YAXA 2ZL1B 2VV7A 4HP9A 3ITAA 3HLEA 3JVUA 4UHUA 1KE3A 4FTXA 3HLFA 1DJCA 2ZQDA 4H6JA 5G4YA 4UEYA 4KQRA 1KE4A 5DF9A 3IF6A 2VGJA 3IT9A 4Y0OA 3DTIA 4DN0A 4ETXA 1XPBA 5FDHA 3NOTC 4WF0A 2G2WA 4HI4A 4WELA 2Y2HA 2B5RA 2R9WA 2WGIA 4GW9A 4KZ5A 5CHMA 1J3WA 4MMNA 3IXHA 3LI8A 1PRQA 1V9ZA 3AGFA 2L0WA 2V2FF 1ONHA 5GLAA 2WAEA 1GA0A 3RH8B 3U4LP 1OJGA 3LYXA 5F1GA 1N4OA 3BFGA 3VP3A 3C4OA 5DJTA 1SDNA 1GHMA 5FDSA 5GLDA 4DE2A 1ZKJA 5CX7A 3GTCA 3FPVA 4PKYG 4OONA 4UQIM 3OBFA 4DXCA 2XD5A 1ZC2A 3L7HA 5G18A 1MZUA 2ZMAA 4GJ4A 2GNXA 2WKQA 1IYOA 1HD8A 4F3LA 2FH5A 4X68A 4NK3A 4N9LA 4KG2A 2BLSA 4LV3A 4QPRA 1O07A 2HDUA 4AFIA 1NZUA 2JKRM 4KG5A 2M7UA 3AGDA 3DWKA 3SOIA 4KQDA 1YLJA 1K56A 3Q1FA 1KE0A 3N7WA 4MBKA 3NIAA 2JN7A 3UMEA 5AJGA 2XH9A 5HDDA 3ZG5A 4MBHA 1YQSA 3NOPC 1ES3A 3F1PA 1N9LA 2ZQAA 3MXRA 3PHYA 3HJIA 1KVMA 1BLSA 3VP1A 3W8KA 5DF7A 3N6IA 4U3TA 1D06A 4RX3A 2HGVA 3M6BA 2INWA 1WA9A 1DJBA 3EWKA 4A5RA 4HOIA 3EGXC 5FQJA 3S7QA 4ZDXA 4R4SA 1TD5A 3ULFA 4RX2A 2C6WB 3P7NA 1VETB 3ZG9B 1KGGA 3LY4A 3C7VA 1PIOA 3NC8A 4HH3A 4HBUA 2L4RA 4NKPA 3KX0X 1IELA 3LFVA 3EQVA 4IEDA 2OAP1 4IBRA 3WS4A 1PWGA 1YMXA 3HUNA 2Q9MA 4KZ9A 1BZAA 4P6ZS 5EECA 5E2HA 1YSPA 4Y0TA 3G31A 1FOFA 2RCXA 3BWLA 2PD7A 3CMZA 4CLCB 3GR2A 4EBNA 1OTDA 2EFXA 2QJ7A 1FQGA 1MBLA 3MFDA 2KDKA 1TEMA 1RCJA 5HD5A 3OPPA 3CPTB 5FATA 4R4RA 3BEBA 2G7UA 1NYYA 4CPKA 4OQ0A 1CI8A 2ZC4B 3Q7VA 2G2UA 3WS1A 3ZYTA 4E3JA 4HP4A 2W1TB 4WMCA 2VLGA 4R23A 2WGWB 3FYZA 4G3VA 1EI5A 2O0YA 4IBXA 3UE1A 3IXDA 5EVIB 4BJPA 3ZG7B 2Y2LA 1KDWA 4MN6A 4BMWA 4PHTA 5FEGA 4B4ZA 2XR0A 4WYYA 2PHYA 4DE3A 3QP5A 3WS2A 1EWZA 5I5LA 4O0PA 2Y2JA 3MR0A 5E2GA 4CLCC 1XP4A 5F83A 5KIZA 1Q2QA 2Y4AA 1NZOA 3NI9A 2HJ9C 3IF6B 3PR6A 2W3EA 2Y2QA 4MLLA 3NCKA 2B95A 4KZ8A 3WWXA 5HDCA 2HDSA 3W4QA 5FQQA 4RVAA 1H5XA 2Q9NA 3PBTA 3IX4A 2W3FA 2JC7A 2B02A 3E4OA 3ZDJA 1XFNA 2W3GA 5L07A 5KSCA 1YLWA 2CC1A 4B9OA 4YNRA 4JXGA 4DJ3A 3T4SA 1H8ZA 1CEGA 3GECA 1ESIA 4C3QA 1YLZA 4OLDA 3ZG0A 4EXOA 2VK3A 4OP8A 5J4EA 3VE3A 5FA7A 1BUEA 2QJ5A 2ZQ9A 1FCMA 2XSSA 5GLBA 4GCZA 4LRYC 3UB6A 4QY6A 2H0YA 4JXSA 3IF6C 3VSKA 2Y59A 2V20A 4WL9A 5EPHA 4JKTA 5TR7A 1W7FA 1M6KA 3KSGA 4JLFA 5A93A 1MWRA 4I3JA 1XFQA 1LSVA 4CLCD 3N4IA 1XJ2A 5J7EA 4E6XA 1H8MA 1LSXA 3CLOA 1N9OA 4E3KA 4WLAA 3UB7A 4KZAA 3T1XA 2O9AA 2H10A 3GQZA 2VJWA 4WUJA 1N9NA 2Z2MB 2EWVA 1YM1A 2WAFA 3BFEA 3UO9A 3TJZC 4L9FA 1K54A 1Z6FA 3HCYA 3ICYA 3IWQA 1VHMA 4OOLA 4BL3A 3LY3A 2XA7M 1N9BA 3QP6A 4BBUA 1MPLA 3V5MA 2QPNA 5CEDA 3F1PB 1VB6A 3MQ0A 4WM9A 3T4JA 5CECA 3SS5A 4JF4A 3N8LA 4PM7A 2PR5A 1P0ZA 2Y79A 3G35A 1PZOA 3RXXA 1E3UA 5EM0A 3D9YA 3UB9A 5FQKA 2J3TC 5HWVA 4X55A 2A49A 2ACGA 2P08A 1ERQA 3MQOA 3A3FA 5D3OA 2A2LA 1WYCA 1HZOA 4HBTA 2GZAA 4MEZA 2XD1A 1ERMA 4IVKA 2QZ6A 3ITBA 5K5BA 2Y2OA 3SS4A 2HPBA 4HJ4A 3CAXA 4GDNA 3FZCA 4EWFA 4LFUA 1LL8A 3LI9A 2Y2GA 4M3KA 1K55A 4QU3A 3DAVA 3K2NA 3LEZA 5KZHA 4U0TA 4R3JA 1YLYA 2P7JA 4S2NA 1CK3A 3L9KA 2PBYA 2WKRA 3IWOA 1SHVA 3E2KA 2ZQCA 4ETZA 3OCLA 4Y17A 4ARZB 2Y55A 4EERA 5EVEA 2EWWA 4B88A 5AQBA 3DTEA 1PI5A 1T1BA 2J3TD 3WRZA 4XT2A 4LGWA 3WS0A 2O9CA 2PBDP 2HP9A 4E3IA 3QP4A 5HDSA 2W27A 3T4OA 4OQHA 3IS2A 1LSWA 3Q7ZA 5CHJA 1K56D 1PWDA 4OPRA 1XA1A 2HJEA 3UPPA 1MKMA 1C3BA 3T50A 1EROA 3G4PA 3HLBA 1F2KA 3T1SA 1M40A 3C4PA 4Z1WA 4DKIA 3IXGA 2A3UA 5CXWA 3NOUC 1J9MA 4E3NA 4EQ1A 2HF6A 3QHYA 1W8YA 4YWZA 2FFFB 2V1BA 4II7A 3SW1A 5HZHA 3NJAA 3PAGA 5EOEA 1NLYA 2X01A 3TOIA 5TJJA 2WKHA 4P87A 2XQZA 1S6RA 2WKIA 4CLCE 3UPOA 3G2YA 3BQAA 5M1AA 2GX5A 5FQIA 3H82A 4KG6A 4OQIA 4U0XA 3GMWA 2JBFA 4NEED 5HSQA 2HDRA 1YLPA 2EXBA 5EV0A 4I3AA 4D2OA 2Z6DA 2DRWA 4OPYA 2ZC5B 4GS9B 4NXFA 4E6WA 4R3BA 1K6RA 4OPQA 2WKPA 2LB9A 2OSUA 2J9OA 4HHDA 2PU2A 3HJKA 4XUXA 1TDLA 3F1OA 4X1MA 2BTFP 4WMCD 4E04A 3S1YA 2JKTI 3LR3A 3E0YA 1XJ4A 4OLGA 4XUZA 1BLCA 3BRMA 3PYPA 1YKDA 2ZM2A 1PWCA 3LEQA 2JHEA 1GA9A 1FSWA 3O5YA 3KYQA 3DTMA 2PDRA 2JCHA 1K4EA 5A92A 3C38A 3O88A 4EBLA 1HTZA 4I39A 1Y28A 1EW0A 4ESPA 2RL3A 1XX2A 1ACFA 3Q07A 1XA7A 4QD4A 4EUZA 2QYBA 1T19A 3WRTA 1BSGA 2DMWA 5FI7A 5HD3A 3WS5A 1AWIA 1H8YA 1K25A 4EEPA 1K54C 2ZOHA 1JWVA 4HNBA 1DRMA 1P9WA 4FCFA 2IWCA 4CQHA 3QP1A 1KDSA 2Y2IA 4OH0A 4KZ4A 1OT9A 2ZMFA 4HEFA 4LV1A 5KSHA 1MWSA 4Y13A 4I3IA 4OPZA 4X1LA 4C6YA 4LRZE 2VZWA 4BBVA 3CG5A 4PM5A 4QB8A 3M2JA 3MMHA 4LV2A 4KUKA 1UGUA 1OTEA 4ZJ2A 4E3OA 2Y2MA 1PI4A 4NETA 1SCWA 3LIBA 4ZBEA 3IH9A 2XGNA 4Y7PA 2B18A 3A0VA 3IF5A 1STZA 3KYZA 5FL3A 4K08A 2R78A 3PXPA 3CI6A 4GNUA 1G6OA 3MZDA 2QMIA 3IH8A 4XT2B 3K3CA 3UB5P 3VOZA 4PKYA 1S1YA 3IBJA 5HL1A 1QMEA 1QMFA 3HVFA 1XJ3A 3OCNA 3IS2B 3CHWP 4IUKA 4GZBA 5L2FA 2WADA 3BLMA 1DJAA 4S2NC 5JYOA 4MDZA 5AVFA 4ARZA 2VV8A 5CTMA 1O7EA 3S7NA 1ZHHB 1ZG6A 2JKGA 5EE8A 5M18A 4Y3IA 3R4KA 5FAOA 4N92A 5FQ9A 3NULA 4KZ6A 5A8BA 3NECA 1E3UD 1K57A 2OOLA 2W0NA 4BQMA 1MWUA 3ZNYA 3VE4A 4QY5A 4FUWA 5DFXA 1OTBA 3D72A 3R7WA 2VGLS 4P6BA 4Y0UA 4ME4A 2W3HA 5DTTA 4G3WA 3LO7A 3D3OA 3PAEA 4I38A 2XDMA 3CUEA 5EOOA 5HAIA 1CI9A 3VP2A 3E4QA 3H82B 2V1AA 1BT5A 5HW3A 3E4PA 1JTGA 2CMNA 5EVIC 3MJQA 2YKHA 1S0WA 1IEMA 4GD6A 4EUVA 3P09A 4EW7A 1K0KA 4WEJA 1H3QA 4KUOA 5F6AA 4FOFA 3RXWA 2WGVA 1GSWA 3SS3A 4QWOA 1YLTA 4DJ2A 4Y5FA 3FC7A 3UDXA 4GB7A 1IKGA 1WE4A 3GV9A 3GRJA 3F1OB 4R0QA 1ONGA 3ZGAB 1PFLA 4H8RA 2EFUA 1K6SA 5AQ9A 5F69A 2QHKA 1UWNX 4RYEA 2EX9A 1GSXA 4UAAA 2V8CA 1JWPA 1PNEA 2ZQ7A 3BFFA 3P01A 5AQ7A 4GS9A 1NRJA 2L1MA 1TVFA 2J9PA 4OOMA 4DE1A 2WYXA 5FSRA 1CF0A 3MZEA 1CEFA 2OLUA 4B4XA 3MFXA 1F9IA 5CHUA 3GSGA 4JBFA 4P6ZM 1BULA 3BM6A 2WKEA 1BLPA 5EVID 5AVEA 5HPIA 3H7WA 4BLMA 4GOGA 1SZVA 3LIAA 3GVBA 1CQAA 1MC0A 2QKPA 4S2OA 1S4SA 2OWJA 2PT7A 2VX8A 2H28A 4GLQA 2ZC6B 4C75A 1MWTA 1PW8A 3IQAA 1JNUA 3UDIA 2HV1A 2WK0A 2EX2A 3FV7A 5DKKA 3G6OA 3TG9A 1BYWA 5DFYA 2PYRA 2PD8A 1D7EA 1ODVA 5TGFA 2XF3A 3B47A 4S2LA 4UA7A 1BLHA 2V9AA 3V39A 4EETB 2EA9A 2K2NA 4IVIA 1DP6A 4X6TA 1W79A 3EEHA 5CTNA 3DBAA 1MKIA 3QNBA 3C30A 3OPLA 2PU4A 3A3EA 2J8YA 3HLCA 4MN7A 3UY6A 4JF5A 3TSGA 2VGLM 4OP5A 2BASA 5GHYA 2M7VA 3FKWA 2XK1A 1E4DA 1SKOA 2O9BA 4JPMA 2D02A 2ZM0A 4Q8IA 4PM9A 3EGDC 4X53A 5FAPA 4LENA 4HESA 3O86A 3JYIA 1NRFA 3UB8A 3LCEA 1L0DA 3RJUA 3T12B 1VQQA 4WZ5A 4QHCA 1G6AA 2ZM8A 1I5QA 4S2KA 3IHAA 1PYYA 4N1XA 3OOVA 5DF8A 3IBRA 2WZZA 1YT4A 3KYEA 4PM6A 2I72A 4WN5A 1KGFA 4ZAMA 4DXBA 1OTIA 2M1CA 5HPFA 2P9VA 2D01A 5DVAA 4JGPA 3IHBA 3V3SA 3SZTA 4JGQA 2XRNA 1TDGA 3B33A 3VP0A 1W63Q 1GSVA 1FILA 4HJ3A 3NY4A 2V0UA 3NDEA 4WEKA 4BWIA 4EBPA 4LCLA 1OMEA 4OVDA 3R7WB 4N9KA 1P97A 3U2AA 1IKIA 4HH2A 1FSYA 4S2JA 2BG1A 2R9XA 5HAQA 5FQMA 3HBRA 4F94A 1K4FA 3LICA 2EX8A 4DF6A 4EQIA 1SKFA 3A3JA 2Y91A 5E2FA 3FWLA 3PBOA 3S4XA 3VFFA 3T4LA 1NWZA 1TS6A 3OZHA 1MY8A 5F5YA 1ES2A 4YINA 2JKTM 3MKFA 3HLGA 3T4QA 4QJGA 3ZCZA 1KVLA 4ZJ3A 4OQGA 3IXBA 2XFTA 3E98A 1HVBA 4PAUA 4X69A 4RQ9A 3Q82A 3UN7A 3VSLA 1LI9A 4IUHA 3BYDA 2PR6A 3VOYA 4BL2A 4S2IA 1T1AA 2HP5A 3CUEC 2ZLYA 2IWDA 4Q0HA 1K38A 3MS6A 1SDEA 5CERA 3A0RA 3PTEA 1S1ZA 2V0WA 3N8RA 2C5WB 2VV6A 3M2KA 3EEAA 3VMAA 1S4RA 1LL9A 5GHZA 3BY8A 4DRTA 3NDGA 3I7JA 3P98A 3T4TA 1LT0A 4B93A 2K31A 4O8GA 4E3LA 2YKFA 1H0MA 3S22A 3M6HA 4ID4A 3PBRA 3ZNTA 2EXAA 3H7WB 4WBGA 3MSHA 4GHIA 3W2ZA 1JVJA 3HLDA 1FIKA 5HL6A 1P9RA 1Y4OA 3B42A 1W8QA 4MBFA 3V50A 3JPUA 1ZG4A 2XLNA 5J3WA 3FKVA 1JWZA 4UA6A 1E25A 3BLSA 5JYPA 3N8SA 2J80A 4BBTA 4FH2A 1LI0A 5GL9A 1D1JA 2J7VA 3V3RA 1PW1A 4KZBA 3LR0A 2ZMVA 3IX8A 2EX6A 2ZC3B 4ZTKA 1I2SA 5TBMA 4DE0A 3HUMA 3TRCA 1VEUA 3D4FA 5CEBA 4O01A 4OOYA 1SKOB 1L0GA 1L0FA 5F1FA 3BJNA 3C5AA 5M19A 2FFYA 2UWXA 4Y15A 5IT5A 3IX3A 4R1GA 1AXBA 3F1NA 3VV4A 3C8CA 3UE0A 3Q81A 2DCFA 1GCEA 1FCOA 3LIEA 4NXBA 3C7UA 3ISGA 4IHQA 1DY6A 5CGSA 4DDSA 3UE3A 1TS0A 1F5MA 1KGEA 4NG2A 1VM1A 2QWSA 3RTYA 5G4ZA 1IYSA 1LLBA 3ZG8B 4EEUA 5BOHA 5L8MA 2P9VB 3ZVWA 5AQAA 4KQQA 1IFQA 4RA7A 3QP8A 2JKRI 1FR1A 4E3MA 3BFCA 2W1RA 2OV5A 3ZVTA 2GDNA 1K55C 3ZQ5A 1L0EA 4L9GA 4KENB 5DJUA 4D60A 1RP5A 1I2WA 4L0LA 2OWHA 5L10A 4Z9QA 2XA7S 5U47A 1T1CA 3O87A 5HWWA 4P85A 4WZ5C 3OPHA 1RGYA 1ESUA 4DMZA 2A24A 5KMWA 4KZ7A 4ZJ1A 4G3KA 1Z09A 5E2EA 2XFSA 4FD8A 2WZXA 2O99A 2ZC7A 5IHVA 4EU0A 5TFQA 2ZOIA 2X02A 1DP8A 3LUQA 2H5SA 1LHYA 2ZJ9A 3CJMA 4R3AA 1L2SA 1S66L 3QP2A 4I5SA 5L09A 4Y2FA 2VA0A 3FG8A 3LR5A 4PM8A 2K7SA 4XXRA 3KSHA 1ZTUA 3UPNA 4H6JB 1NLZA 1TS7A 4M4XA 2Y8HA 4GD8A 3G32A 2NUTC 3W4PA 5I94A 2VKSA 1GHPA 2E8IA 3MXQA 4LLOB 5MC7A 4IJGA 4GN2A 1NJ4A 2ZBBA 2KOIA 5E43A 5GLCA 1L3LA 3HLWA 3QNCA 3OLOA 4EV4A 3T1RA 2ZL1A 3MZFA 5HWTA 2LB5A 4K0WA 1XJ6A 1XGIA 2PYPA 4Q0IA 4EESA 4PMAA 5C5KA 3DWZA 4ZRRA 4JXWA 1A0KA 5GHXA 5J8XA 3CZDA 3VFHA 1U60A 1JTDA 2H0TA 5EVLA 3BECA 4K0XA 3OPRA 4GHIB 1YPRA 3ZHHA 3S7OA 1Y54A 2Q0OA 1G28A 2OLVA 1XGJA 2I9VA 3GDIA 1YSQA 4YFMA 2AVXA 3DTKA 5DTSA 3LR4A 1G5UA 4X25A 4LV0A 2XROA 5HARA 5LBRA 1WYBA 3G34A 1V9YA 3S7PA 2JKFA 2PAVP 3PBSA 1DP9A 1XKZA 1MXOA 3ZFZA 3B3XA 2V1ZA 3W4OA 4JXVA 3C2WA 5F82A 4BENA 3K3DA 3E2LA 3SH7A 3A3DA 3VOLA 4F3LB 4DDYA 3A0SA 1S67L 2Z6CA 3H9WA 3OC2A 2DNSA 1OJ5A 5CGXA 5TBMB 2KLIA 4GKUA 4JF6A 1VEUB 3RFBA 2MJ6A 1ES4A 2ZD8A 3UNWA 3SH8A 5FI6A 1HLUP 1NY0A 5EUAA 2X71A 5IU1A 1FR6A 5FAQA 2P74A 4UA9A 3PBQA 2NUPC 1IOUA 3O3VA 4MCWA 1GHIA 1F98A 3AGEA 5DKLA 3CITA 1IYPA 4FH4A 3PBNA 5FEFA 4Q0JA 2KX6A 3F1NB 3BY9A 3T1QB 3V67A 5CRFA 3MXSA 2IA2A 1TF1A 2WUQA 1Q2PA 4WZ4A 4CJNA 1BTLA 1ES5A 4S2MA 1OT6A 3JVVA 3LIDA 3G30A 4OKPA 1IYQA 1W5DA 2Y2PA 3BW6A 2W3DA 4HQAA 1NXYA 3BFDA 2HDQA 4R38A 4MNRA 2Y2KA 4X56A 4R6LA 3VP4A 3LGOA 2VGKA 5FI2A 2Z2LB 1UWPX 2JE5A 5F68A 1PZPA 1CJFA 3HL9A 4UQIS 1XXMA 2PRFA 2GJ3A 5HAPA 4S2PA 3MKEA 4YOFA 3MQQA 5EM1A 3T4KA 1VETA 4HIAA 3NHQA 2UV0E
chains in the Genus database with same CATH topology
1LSVA 1S1YA 2A24B 1XJ2A 3IBJA 4CLCD 4R70A 5J7EA 3UMDA 3PBRA 1H8MA 1LSXA 3CLOA 1XJ3A 4FSFA 1N9OA 4LRXC 3OCNA 3H7WB 4WLAA 3UB7A 4KQOA 3IS2B 3UE6A 3FPWA 2O9AA 4GHIA 3W2ZA 4JGRA 4IUKA 2VJWA 4WUJA 1N9NA 2EWVA 5HL6A 1P9RA 4MDZA 3B42A 3KO6A 5AVFA 3CWFA 3TJZC 2VV8A 4ARZA 4L9FA 5EFWA 4L9EA 4NXEA 4CLCA 3S7NA 4LPZA 5J3WA 1ZHHB 1OPXA 1OTAA 3HCYA 4HY8A 3TW8A 1W63M 4Y3IA 1T18A 3R4KA 3TE8A 3ICYA 4HJ6A 5A8BA 1VHMA 2OAQ1 4OOLA 1X0OA 3KSFA 2J80A 1KOUA 4MN5A 4BBTA 2OOLA 4NXGA 2W0NA 2XA7M 5IS1A 3BQ8A 4BBUA 1TS8A 3EOIA 3VE4A 2FZ0A 2J3WA 5DFXA 3LIFA 1OTBA 3LR0A 3D72A 3KSIA 3F1PB 1VB6A 3MQ0A 3T4JA 2ZMVA 2W1TA 4JGOA 3R7WA 2VGLS 2VEAA 2PR5A 1P0ZA 2Y79A 3MF0A 5TBMA 4ME4A 3EQUA 3UB9A 2J3TC 5HWVA 2W3HA 3TRCA 4G3WA 4I38A 3D3OA 2P08A 2P04A 3CUEA 1YAXA 2VV7A 3MQOA 4O01A 3E4QA 3H82B 4HP9A 2V1AA 3JVUA 2A2LA 2GZAA 3E4PA 3BJNA 4H6JA 5G4YA 4UEYA 2CMNA 5DF9A 3MJQA 2YKHA 5IT5A 4EUVA 4EW7A 5K5BA 3F1NA 4WEJA 1H3QA 4KUOA 4DN0A 5F6AA 3VV4A 4ETXA 4FOFA 3C8CA 1GSWA 3NOTC 4HJ4A 4WF0A 3CAXA 4HI4A 4WELA 3LIEA 4NXBA 4DJ2A 4Y5FA 1LL8A 4IHQA 3FC7A 3LI9A 3UE3A 1TS0A 4GW9A 1F5MA 3F1OB 3K2NA 2QWSA 4MMNA 3RTYA 3LI8A 1V9ZA 5G4ZA 2L0WA 2P7JA 4EEUA 5L8MA 2WKRA 5F69A 2QHKA 1UWNX 1IFQA 3RH8B 1GSXA 2JKRI 2W1RA 1OJGA 3LYXA 3P01A 4ETZA 3OCLA 3ZQ5A 4GS9A 1NRJA 4ARZB 4L9GA 2L1MA 4EERA 2EWWA 4OOMA 5DJTA 5DJUA 4L0LA 2OWHA 1T1BA 2J3TD 5CX7A 3MFXA 4XT2A 2XA7S 3FPVA 1T1CA 2O9CA 4PKYG 4UQIM 1F9IA 5HWWA 3OBFA 4P6ZM 4DMZA 5HDSA 2W27A 2A24A 1MZUA 3T4OA 5AVEA 5HPIA 4GJ4A 3H7WA 4G3KA 3IS2A 2O99A 3LIAA 1LSWA 4EU0A 1MC0A 2GNXA 2QKPA 2WKQA 2ZOIA 1S4SA 2HJEA 2OWJA 2PT7A 2VX8A 1DP8A 3LUQA 2H28A 4GLQA 1MKMA 4F3LA 2FH5A 3T50A 4R3AA 1S66L 1JNUA 2HV1A 4I5SA 4Z1WA 4QPRA 4Y2FA 5DKKA 2VA0A 3FG8A 3NOUC 3G6OA 3LR5A 4AFIA 1BYWA 5DFYA 2K7SA 2PYRA 2JKRM 2PD8A 1D7EA 4EQ1A 2HF6A 3KSHA 2M7UA 4KQDA 1ODVA 1ZTUA 4H6JB 3B47A 4YWZA 2V1BA 2V9AA 1NLZA 1TS7A 2JN7A 4II7A 4M4XA 3UMEA 2Y8HA 3SW1A 4EETB 5HZHA 2NUTC 2EA9A 5AJGA 2K2NA 5HDDA 1DP6A 3NJAA 2VKSA 3NOPC 3MXQA 3F1PA 1N9LA 1NLYA 3EEHA 5TJJA 4LLOB 3DBAA 3HJIA 3PHYA 5MC7A 4IJGA 3C30A 1D06A 2HGVA 2ZBBA 2KOIA 4CLCE 4MN7A 2INWA 1WA9A 3BQAA 3EWKA 3OLOA 2VGLM 2GX5A 2BASA 4HOIA 3EGXC 5HWTA 2LB5A 2M7VA 3H82A 1XJ6A 3S7QA 2PYPA 4Q0IA 4EESA 2O9BA 5C5KA 2D02A 1TD5A 3ULFA 4ZRRA 4NEED 5HSQA 3P7NA 3EGDC 4I3AA 4HH3A 2Z6DA 3UB8A 4GS9B 2L4RA 4NKPA 3KX0X 4NXFA 4GHIB 3LFVA 3EQVA 2OAP1 3S7OA 1G28A 2WKPA 2LB9A 2I9VA 4P6ZS 3GDIA 1YSPA 1YSQA 4HHDA 3BWLA 3HJKA 2PD7A 3LR4A 4CLCB 1OTDA 2XROA 3OOVA 2QJ7A 3F1OA 3IBRA 4E04A 5LBRA 2JKTI 3LR3A 1V9YA 2KDKA 1XJ4A 3E0YA 4WN5A 3S7PA 5HD5A 3PBSA 1DP9A 1OTIA 2M1CA 5HPFA 2D01A 3PYPA 4JGPA 1YKDA 2G7UA 4JGQA 2XRNA 3B33A 3C2WA 1W63Q 1GSVA 4HJ3A 2JHEA 3K3DA 3O5YA 3KYQA 3VOLA 3ZYTA 2PDRA 4HP4A 2V0UA 3C38A 4WEKA 4BWIA 4F3LB 2W1TB 3A0SA 2VLGA 3R7WB 1S67L 4G3VA 1P97A 1Y28A 4I39A 2Z6CA 1EW0A 3U2AA 2O0YA 3H9WA 3OC2A 4HH2A 1OJ5A 5TBMB 2KLIA 4BJPA 4MN6A 4BMWA 4PHTA 3RFBA 2MJ6A 2QYBA 5IU1A 2PHYA 1T19A 3LICA 2DMWA 5I5LA 4O0PA 3PBQA 3MR0A 5HD3A 2NUPC 4CLCC 1IOUA 4MCWA 5KIZA 4EEPA 2ZOHA 1F98A 3PBOA 3T4LA 4HNBA 2HJ9C 5DKLA 3CITA 1DRMA 3PR6A 2W3EA 3PBNA 1NWZA 1P9WA 4Q0JA 1TS6A 5F5YA 2KX6A 3F1NB 4CQHA 3BY9A 3V67A 5HDCA 2JKTM 2IA2A 1TF1A 3T4QA 1OT9A 2ZMFA 3PBTA 5KSHA 2W3FA 2B02A 3E4OA 4I3IA 1OT6A 3JVVA 1XFNA 2W3GA 3LIDA 4LRZE 3E98A 2VZWA 4PAUA 4RQ9A 4BBVA 4B9OA 4IUHA 3MMHA 2PR6A 4YNRA 3BW6A 2W3DA 4KUKA 1UGUA 4HQAA 1OTEA 3T4SA 4DJ3A 4R38A 1T1AA 3GECA 4R6LA 3CUEC 3LIBA 4EXOA 5J4EA 4Q0HA 3VE3A 1UWPX 2B18A 3A0VA 1STZA 3KYZA 5FL3A 3A0RA 2QJ5A 4K08A 2R78A 1S1ZA 5F68A 2XSSA 3PXPA 2V0WA 4GCZA 4LRYC 3UB6A 2VV6A 3CI6A 4UQIS 3EEAA 1S4RA 1G6OA 3BY8A 2GJ3A 4WL9A 4XT2B 4YOFA 3MQQA 3K3CA 3T4KA 3T4TA 3KSGA 1LT0A 4B93A 2K31A 4O8GA 2YKFA 4I3JA 1XFQA 4HIAA 3NHQA 4PKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSV A;  1S1Y A;  2A24 B;  1XJ2 A;  5J7E A;  4R70 A;  3UMD A;  1LSX A;  3CLO A;  1XJ3 A;  1N9O A;  4LRX C;  3H7W B;  4WLA A;  3UB7 A;  3IS2 B;  3UE6 A;  4GHI A;  4JGR A;  4WUJ A;  1N9N A;  5AVF A;  3CWF A;  2VV8 A;  4L9F A;  5EFW A;  4L9E A;  4NXE A;  4LPZ A;  5J3W A;  1OTA A;  4HY8 A;  1T18 A;  3ICY A;  4HJ6 A;  5A8B A;  1X0O A;  2J80 A;  1KOU A;  4MN5 A;  4BBT A;  2OOL A;  4NXG A;  2W0N A;  5IS1 A;  4BBU A;  1TS8 A;  3VE4 A;  3LIF A;  1OTB A;  3D72 A;  3F1P B;  1VB6 A;  4JGO A;  2VEA A;  2PR5 A;  1P0Z A;  5TBM A;  3UB9 A;  5HWV A;  4I38 A;  2VV7 A;  3MQO A;  3E4Q A;  3H82 B;  4HP9 A;  2V1A A;  3E4P A;  4H6J A;  5G4Y A;  2CMN A;  3MJQ A;  2YKH A;  4EW7 A;  3F1N A;  4KUO A;  5F6A A;  3C8C A;  1GSW A;  3NOT C;  4HJ4 A;  4WF0 A;  3CAX A;  4HI4 A;  3LIE A;  4NXB A;  4DJ2 A;  1LL8 A;  3FC7 A;  3LI9 A;  1TS0 A;  4GW9 A;  3F1O B;  2QWS A;  3RTY A;  3LI8 A;  1V9Z A;  5G4Z A;  2L0W A;  2P7J A;  4EEU A;  2WKR A;  5F69 A;  2QHK A;  1UWN X;  3RH8 B;  1GSX A;  1OJG A;  3LYX A;  3ZQ5 A;  4GS9 A;  4L9G A;  2L1M A;  4EER A;  5DJT A;  5DJU A;  2OWH A;  1T1B A;  3MFX A;  4XT2 A;  1T1C A;  4PKY G;  1F9I A;  5HWW A;  5HDS A;  2W27 A;  2A24 A;  1MZU A;  5AVE A;  3H7W A;  3IS2 A;  3LIA A;  1LSW A;  2QKP A;  2WKQ A;  2ZOI A;  1S4S A;  2OWJ A;  1DP8 A;  3LUQ A;  2H28 A;  4F3L A;  3T50 A;  4R3A A;  1S66 L;  1JNU A;  2HV1 A;  4I5S A;  5DKK A;  3FG8 A;  3NOU C;  3G6O A;  1BYW A;  2K7S A;  2PYR A;  2PD8 A;  1D7E A;  4EQ1 A;  4KQD A;  1ODV A;  4H6J B;  4YWZ A;  2V1B A;  2V9A A;  1TS7 A;  2JN7 A;  4M4X A;  3UME A;  3SW1 A;  4EET B;  5HZH A;  2EA9 A;  5HDD A;  1DP6 A;  3NJA A;  3NOP C;  3MXQ A;  3F1P A;  1N9L A;  3EEH A;  4LLO B;  3PHY A;  3HJI A;  1D06 A;  2ZBB A;  2INW A;  1WA9 A;  3EWK A;  3OLO A;  2BAS A;  4HOI A;  5HWT A;  3H82 A;  1XJ6 A;  2PYP A;  4EES A;  2D02 A;  3ULF A;  5HSQ A;  3P7N A;  4I3A A;  4HH3 A;  2Z6D A;  3UB8 A;  4GS9 B;  2L4R A;  4NXF A;  3KX0 X;  4GHI B;  1G28 A;  2WKP A;  2I9V A;  3GDI A;  4HHD A;  3BWL A;  3HJK A;  2PD7 A;  1OTD A;  2QJ7 A;  3F1O A;  3IBR A;  4E04 A;  1V9Y A;  2KDK A;  1XJ4 A;  4WN5 A;  5HD5 A;  1DP9 A;  1OTI A;  2M1C A;  2D01 A;  3PYP A;  4JGP A;  4JGQ A;  3B33 A;  3C2W A;  1GSV A;  4HJ3 A;  2JHE A;  3K3D A;  3VOL A;  2PDR A;  4HP4 A;  2V0U A;  4F3L B;  3A0S A;  2VLG A;  1S67 L;  4I39 A;  1P97 A;  1Y28 A;  2Z6C A;  1EW0 A;  3H9W A;  4HH2 A;  1OJ5 A;  5TBM B;  4MN6 A;  5IU1 A;  2PHY A;  1T19 A;  3LIC A;  5I5L A;  3MR0 A;  5HD3 A;  5KIZ A;  4EEP A;  2ZOH A;  1F98 A;  4HNB A;  5DKL A;  1DRM A;  1NWZ A;  1TS6 A;  5F5Y A;  2KX6 A;  3F1N B;  3BY9 A;  5HDC A;  1OT9 A;  2B02 A;  3E4O A;  4I3I A;  1OT6 A;  1XFN A;  3LID A;  4LRZ E;  4RQ9 A;  4BBV A;  4B9O A;  2PR6 A;  4KUK A;  1UGU A;  4HQA A;  1OTE A;  4DJ3 A;  4R38 A;  1T1A A;  3GEC A;  4R6L A;  3LIB A;  4EXO A;  5J4E A;  3VE3 A;  1UWP X;  3A0V A;  2QJ5 A;  3A0R A;  4K08 A;  2R78 A;  1S1Z A;  5F68 A;  2V0W A;  4GCZ A;  4LRY C;  3UB6 A;  2VV6 A;  1S4R A;  3BY8 A;  2GJ3 A;  4WL9 A;  4XT2 B;  3MQQ A;  3K3C A;  1LT0 A;  2YKF A;  4I3J A;  1XFQ A;  4HIA A;  3NHQ A;  4PKY A; 
#chains in the Genus database with same CATH topology
 4K91 A;  2A24 B;  4O7D A;  4R70 A;  2E8J A;  3UMD A;  3Q7V B;  3NBL A;  4FSF A;  4LRX C;  4KQO A;  4N1H A;  3UE6 A;  3FPW A;  1YMS A;  3A3I A;  5DTK A;  2IWB A;  2ZQ8 A;  4JGR A;  3HRE A;  4PPR A;  3MBZ A;  1NYM A;  3KO6 A;  5HFO A;  3CWF A;  1ALQ A;  1RGZ A;  4P0M A;  5EFW A;  4L9E A;  4NXE A;  2V8F A;  3UDF A;  4CLC A;  4LPZ A;  1OPX A;  1OTA A;  4HY8 A;  3TW8 A;  1W63 M;  3DW0 A;  1T18 A;  2HZ5 A;  3TE8 A;  4HJ6 A;  3SH9 A;  2OAQ 1;  1LL5 A;  3IWI A;  1X0O A;  3CPT A;  3KSF A;  4GDB A;  1KOU A;  4MN5 A;  3G2Z A;  5CGW A;  4NXG A;  2HP6 A;  5IS1 A;  4BD0 A;  3BQ8 A;  2Y2N A;  1TS8 A;  3EOI A;  4KZ3 A;  2FZ0 A;  5HX9 A;  2J3W A;  3LIF A;  4BD1 A;  3KSI A;  4LCM A;  2W1T A;  2XEP A;  4JGO A;  2WGW A;  2VEA A;  5A90 A;  1K57 C;  3MF0 A;  5EVI A;  3EQU A;  1G68 A;  5A91 A;  1FCN A;  5FAS A;  2P04 A;  3HUO A;  1YAX A;  2ZL1 B;  2VV7 A;  4HP9 A;  3ITA A;  3HLE A;  3JVU A;  4UHU A;  1KE3 A;  4FTX A;  3HLF A;  1DJC A;  2ZQD A;  4H6J A;  5G4Y A;  4UEY A;  4KQR A;  1KE4 A;  5DF9 A;  3IF6 A;  2VGJ A;  3IT9 A;  4Y0O A;  3DTI A;  4DN0 A;  4ETX A;  1XPB A;  5FDH A;  3NOT C;  4WF0 A;  2G2W A;  4HI4 A;  4WEL A;  2Y2H A;  2B5R A;  2R9W A;  2WGI A;  4GW9 A;  4KZ5 A;  5CHM A;  1J3W A;  4MMN A;  3IXH A;  3LI8 A;  1PRQ A;  1V9Z A;  3AGF A;  2L0W A;  2V2F F;  1ONH A;  5GLA A;  2WAE A;  1GA0 A;  3RH8 B;  3U4L P;  1OJG A;  3LYX A;  5F1G A;  1N4O A;  3BFG A;  3VP3 A;  3C4O A;  5DJT A;  1SDN A;  1GHM A;  5FDS A;  5GLD A;  4DE2 A;  1ZKJ A;  5CX7 A;  3GTC A;  3FPV A;  4PKY G;  4OON A;  4UQI M;  3OBF A;  4DXC A;  2XD5 A;  1ZC2 A;  3L7H A;  5G18 A;  1MZU A;  2ZMA A;  4GJ4 A;  2GNX A;  2WKQ A;  1IYO A;  1HD8 A;  4F3L A;  2FH5 A;  4X68 A;  4NK3 A;  4N9L A;  4KG2 A;  2BLS A;  4LV3 A;  4QPR A;  1O07 A;  2HDU A;  4AFI A;  1NZU A;  2JKR M;  4KG5 A;  2M7U A;  3AGD A;  3DWK A;  3SOI A;  4KQD A;  1YLJ A;  1K56 A;  3Q1F A;  1KE0 A;  3N7W A;  4MBK A;  3NIA A;  2JN7 A;  3UME A;  5AJG A;  2XH9 A;  5HDD A;  3ZG5 A;  4MBH A;  1YQS A;  3NOP C;  1ES3 A;  3F1P A;  1N9L A;  2ZQA A;  3MXR A;  3PHY A;  3HJI A;  1KVM A;  1BLS A;  3VP1 A;  3W8K A;  5DF7 A;  3N6I A;  4U3T A;  1D06 A;  4RX3 A;  2HGV A;  3M6B A;  2INW A;  1WA9 A;  1DJB A;  3EWK A;  4A5R A;  4HOI A;  3EGX C;  5FQJ A;  3S7Q A;  4ZDX A;  4R4S A;  1TD5 A;  3ULF A;  4RX2 A;  2C6W B;  3P7N A;  1VET B;  3ZG9 B;  1KGG A;  3LY4 A;  3C7V A;  1PIO A;  3NC8 A;  4HH3 A;  4HBU A;  2L4R A;  4NKP A;  3KX0 X;  1IEL A;  3LFV A;  3EQV A;  4IED A;  2OAP 1;  4IBR A;  3WS4 A;  1PWG A;  1YMX A;  3HUN A;  2Q9M A;  4KZ9 A;  1BZA A;  4P6Z S;  5EEC A;  5E2H A;  1YSP A;  4Y0T A;  3G31 A;  1FOF A;  2RCX A;  3BWL A;  2PD7 A;  3CMZ A;  4CLC B;  3GR2 A;  4EBN A;  1OTD A;  2EFX A;  2QJ7 A;  1FQG A;  1MBL A;  3MFD A;  2KDK A;  1TEM A;  1RCJ A;  5HD5 A;  3OPP A;  3CPT B;  5FAT A;  4R4R A;  3BEB A;  2G7U A;  1NYY A;  4CPK A;  4OQ0 A;  1CI8 A;  2ZC4 B;  3Q7V A;  2G2U A;  3WS1 A;  3ZYT A;  4E3J A;  4HP4 A;  2W1T B;  4WMC A;  2VLG A;  4R23 A;  2WGW B;  3FYZ A;  4G3V A;  1EI5 A;  2O0Y A;  4IBX A;  3UE1 A;  3IXD A;  5EVI B;  4BJP A;  3ZG7 B;  2Y2L A;  1KDW A;  4MN6 A;  4BMW A;  4PHT A;  5FEG A;  4B4Z A;  2XR0 A;  4WYY A;  2PHY A;  4DE3 A;  3QP5 A;  3WS2 A;  1EWZ A;  5I5L A;  4O0P A;  2Y2J A;  3MR0 A;  5E2G A;  4CLC C;  1XP4 A;  5F83 A;  5KIZ A;  1Q2Q A;  2Y4A A;  1NZO A;  3NI9 A;  2HJ9 C;  3IF6 B;  3PR6 A;  2W3E A;  2Y2Q A;  4MLL A;  3NCK A;  2B95 A;  4KZ8 A;  3WWX A;  5HDC A;  2HDS A;  3W4Q A;  5FQQ A;  4RVA A;  1H5X A;  2Q9N A;  3PBT A;  3IX4 A;  2W3F A;  2JC7 A;  2B02 A;  3E4O A;  3ZDJ A;  1XFN A;  2W3G A;  5L07 A;  5KSC A;  1YLW A;  2CC1 A;  4B9O A;  4YNR A;  4JXG A;  4DJ3 A;  3T4S A;  1H8Z A;  1CEG A;  3GEC A;  1ESI A;  4C3Q A;  1YLZ A;  4OLD A;  3ZG0 A;  4EXO A;  2VK3 A;  4OP8 A;  5J4E A;  3VE3 A;  5FA7 A;  1BUE A;  2QJ5 A;  2ZQ9 A;  1FCM A;  2XSS A;  5GLB A;  4GCZ A;  4LRY C;  3UB6 A;  4QY6 A;  2H0Y A;  4JXS A;  3IF6 C;  3VSK A;  2Y59 A;  2V20 A;  4WL9 A;  5EPH A;  4JKT A;  5TR7 A;  1W7F A;  1M6K A;  3KSG A;  4JLF A;  5A93 A;  1MWR A;  4I3J A;  1XFQ A;  1LSV A;  4CLC D;  3N4I A;  1XJ2 A;  5J7E A;  4E6X A;  1H8M A;  1LSX A;  3CLO A;  1N9O A;  4E3K A;  4WLA A;  3UB7 A;  4KZA A;  3T1X A;  2O9A A;  2H10 A;  3GQZ A;  2VJW A;  4WUJ A;  1N9N A;  2Z2M B;  2EWV A;  1YM1 A;  2WAF A;  3BFE A;  3UO9 A;  3TJZ C;  4L9F A;  1K54 A;  1Z6F A;  3HCY A;  3ICY A;  3IWQ A;  1VHM A;  4OOL A;  4BL3 A;  3LY3 A;  2XA7 M;  1N9B A;  3QP6 A;  4BBU A;  1MPL A;  3V5M A;  2QPN A;  5CED A;  3F1P B;  1VB6 A;  3MQ0 A;  4WM9 A;  3T4J A;  5CEC A;  3SS5 A;  4JF4 A;  3N8L A;  4PM7 A;  2PR5 A;  1P0Z A;  2Y79 A;  3G35 A;  1PZO A;  3RXX A;  1E3U A;  5EM0 A;  3D9Y A;  3UB9 A;  5FQK A;  2J3T C;  5HWV A;  4X55 A;  2A49 A;  2ACG A;  2P08 A;  1ERQ A;  3MQO A;  3A3F A;  5D3O A;  2A2L A;  1WYC A;  1HZO A;  4HBT A;  2GZA A;  4MEZ A;  2XD1 A;  1ERM A;  4IVK A;  2QZ6 A;  3ITB A;  5K5B A;  2Y2O A;  3SS4 A;  2HPB A;  4HJ4 A;  3CAX A;  4GDN A;  3FZC A;  4EWF A;  4LFU A;  1LL8 A;  3LI9 A;  2Y2G A;  4M3K A;  1K55 A;  4QU3 A;  3DAV A;  3K2N A;  3LEZ A;  5KZH A;  4U0T A;  4R3J A;  1YLY A;  2P7J A;  4S2N A;  1CK3 A;  3L9K A;  2PBY A;  2WKR A;  3IWO A;  1SHV A;  3E2K A;  2ZQC A;  4ETZ A;  3OCL A;  4Y17 A;  4ARZ B;  2Y55 A;  4EER A;  5EVE A;  2EWW A;  4B88 A;  5AQB A;  3DTE A;  1PI5 A;  1T1B A;  2J3T D;  3WRZ A;  4XT2 A;  4LGW A;  3WS0 A;  2O9C A;  2PBD P;  2HP9 A;  4E3I A;  3QP4 A;  5HDS A;  2W27 A;  3T4O A;  4OQH A;  3IS2 A;  1LSW A;  3Q7Z A;  5CHJ A;  1K56 D;  1PWD A;  4OPR A;  1XA1 A;  2HJE A;  3UPP A;  1MKM A;  1C3B A;  3T50 A;  1ERO A;  3G4P A;  3HLB A;  1F2K A;  3T1S A;  1M40 A;  3C4P A;  4Z1W A;  4DKI A;  3IXG A;  2A3U A;  5CXW A;  3NOU C;  1J9M A;  4E3N A;  4EQ1 A;  2HF6 A;  3QHY A;  1W8Y A;  4YWZ A;  2FFF B;  2V1B A;  4II7 A;  3SW1 A;  5HZH A;  3NJA A;  3PAG A;  5EOE A;  1NLY A;  2X01 A;  3TOI A;  5TJJ A;  2WKH A;  4P87 A;  2XQZ A;  1S6R A;  2WKI A;  4CLC E;  3UPO A;  3G2Y A;  3BQA A;  5M1A A;  2GX5 A;  5FQI A;  3H82 A;  4KG6 A;  4OQI A;  4U0X A;  3GMW A;  2JBF A;  4NEE D;  5HSQ A;  2HDR A;  1YLP A;  2EXB A;  5EV0 A;  4I3A A;  4D2O A;  2Z6D A;  2DRW A;  4OPY A;  2ZC5 B;  4GS9 B;  4NXF A;  4E6W A;  4R3B A;  1K6R A;  4OPQ A;  2WKP A;  2LB9 A;  2OSU A;  2J9O A;  4HHD A;  2PU2 A;  3HJK A;  4XUX A;  1TDL A;  3F1O A;  4X1M A;  2BTF P;  4WMC D;  4E04 A;  3S1Y A;  2JKT I;  3LR3 A;  3E0Y A;  1XJ4 A;  4OLG A;  4XUZ A;  1BLC A;  3BRM A;  3PYP A;  1YKD A;  2ZM2 A;  1PWC A;  3LEQ A;  2JHE A;  1GA9 A;  1FSW A;  3O5Y A;  3KYQ A;  3DTM A;  2PDR A;  2JCH A;  1K4E A;  5A92 A;  3C38 A;  3O88 A;  4EBL A;  1HTZ A;  4I39 A;  1Y28 A;  1EW0 A;  4ESP A;  2RL3 A;  1XX2 A;  1ACF A;  3Q07 A;  1XA7 A;  4QD4 A;  4EUZ A;  2QYB A;  1T19 A;  3WRT A;  1BSG A;  2DMW A;  5FI7 A;  5HD3 A;  3WS5 A;  1AWI A;  1H8Y A;  1K25 A;  4EEP A;  1K54 C;  2ZOH A;  1JWV A;  4HNB A;  1DRM A;  1P9W A;  4FCF A;  2IWC A;  4CQH A;  3QP1 A;  1KDS A;  2Y2I A;  4OH0 A;  4KZ4 A;  1OT9 A;  2ZMF A;  4HEF A;  4LV1 A;  5KSH A;  1MWS A;  4Y13 A;  4I3I A;  4OPZ A;  4X1L A;  4C6Y A;  4LRZ E;  2VZW A;  4BBV A;  3CG5 A;  4PM5 A;  4QB8 A;  3M2J A;  3MMH A;  4LV2 A;  4KUK A;  1UGU A;  1OTE A;  4ZJ2 A;  4E3O A;  2Y2M A;  1PI4 A;  4NET A;  1SCW A;  3LIB A;  4ZBE A;  3IH9 A;  2XGN A;  4Y7P A;  2B18 A;  3A0V A;  3IF5 A;  1STZ A;  3KYZ A;  5FL3 A;  4K08 A;  2R78 A;  3PXP A;  3CI6 A;  4GNU A;  1G6O A;  3MZD A;  2QMI A;  3IH8 A;  4XT2 B;  3K3C A;  3UB5 P;  3VOZ A;  4PKY A;  1S1Y A;  3IBJ A;  5HL1 A;  1QME A;  1QMF A;  3HVF A;  1XJ3 A;  3OCN A;  3IS2 B;  3CHW P;  4IUK A;  4GZB A;  5L2F A;  2WAD A;  3BLM A;  1DJA A;  4S2N C;  5JYO A;  4MDZ A;  5AVF A;  4ARZ A;  2VV8 A;  5CTM A;  1O7E A;  3S7N A;  1ZHH B;  1ZG6 A;  2JKG A;  5EE8 A;  5M18 A;  4Y3I A;  3R4K A;  5FAO A;  4N92 A;  5FQ9 A;  3NUL A;  4KZ6 A;  5A8B A;  3NEC A;  1E3U D;  1K57 A;  2OOL A;  2W0N A;  4BQM A;  1MWU A;  3ZNY A;  3VE4 A;  4QY5 A;  4FUW A;  5DFX A;  1OTB A;  3D72 A;  3R7W A;  2VGL S;  4P6B A;  4Y0U A;  4ME4 A;  2W3H A;  5DTT A;  4G3W A;  3LO7 A;  3D3O A;  3PAE A;  4I38 A;  2XDM A;  3CUE A;  5EOO A;  5HAI A;  1CI9 A;  3VP2 A;  3E4Q A;  3H82 B;  2V1A A;  1BT5 A;  5HW3 A;  3E4P A;  1JTG A;  2CMN A;  5EVI C;  3MJQ A;  2YKH A;  1S0W A;  1IEM A;  4GD6 A;  4EUV A;  3P09 A;  4EW7 A;  1K0K A;  4WEJ A;  1H3Q A;  4KUO A;  5F6A A;  4FOF A;  3RXW A;  2WGV A;  1GSW A;  3SS3 A;  4QWO A;  1YLT A;  4DJ2 A;  4Y5F A;  3FC7 A;  3UDX A;  4GB7 A;  1IKG A;  1WE4 A;  3GV9 A;  3GRJ A;  3F1O B;  4R0Q A;  1ONG A;  3ZGA B;  1PFL A;  4H8R A;  2EFU A;  1K6S A;  5AQ9 A;  5F69 A;  2QHK A;  1UWN X;  4RYE A;  2EX9 A;  1GSX A;  4UAA A;  2V8C A;  1JWP A;  1PNE A;  2ZQ7 A;  3BFF A;  3P01 A;  5AQ7 A;  4GS9 A;  1NRJ A;  2L1M A;  1TVF A;  2J9P A;  4OOM A;  4DE1 A;  2WYX A;  5FSR A;  1CF0 A;  3MZE A;  1CEF A;  2OLU A;  4B4X A;  3MFX A;  1F9I A;  5CHU A;  3GSG A;  4JBF A;  4P6Z M;  1BUL A;  3BM6 A;  2WKE A;  1BLP A;  5EVI D;  5AVE A;  5HPI A;  3H7W A;  4BLM A;  4GOG A;  1SZV A;  3LIA A;  3GVB A;  1CQA A;  1MC0 A;  2QKP A;  4S2O A;  1S4S A;  2OWJ A;  2PT7 A;  2VX8 A;  2H28 A;  4GLQ A;  2ZC6 B;  4C75 A;  1MWT A;  1PW8 A;  3IQA A;  1JNU A;  3UDI A;  2HV1 A;  2WK0 A;  2EX2 A;  3FV7 A;  5DKK A;  3G6O A;  3TG9 A;  1BYW A;  5DFY A;  2PYR A;  2PD8 A;  1D7E A;  1ODV A;  5TGF A;  2XF3 A;  3B47 A;  4S2L A;  4UA7 A;  1BLH A;  2V9A A;  3V39 A;  4EET B;  2EA9 A;  2K2N A;  4IVI A;  1DP6 A;  4X6T A;  1W79 A;  3EEH A;  5CTN A;  3DBA A;  1MKI A;  3QNB A;  3C30 A;  3OPL A;  2PU4 A;  3A3E A;  2J8Y A;  3HLC A;  4MN7 A;  3UY6 A;  4JF5 A;  3TSG A;  2VGL M;  4OP5 A;  2BAS A;  5GHY A;  2M7V A;  3FKW A;  2XK1 A;  1E4D A;  1SKO A;  2O9B A;  4JPM A;  2D02 A;  2ZM0 A;  4Q8I A;  4PM9 A;  3EGD C;  4X53 A;  5FAP A;  4LEN A;  4HES A;  3O86 A;  3JYI A;  1NRF A;  3UB8 A;  3LCE A;  1L0D A;  3RJU A;  3T12 B;  1VQQ A;  4WZ5 A;  4QHC A;  1G6A A;  2ZM8 A;  1I5Q A;  4S2K A;  3IHA A;  1PYY A;  4N1X A;  3OOV A;  5DF8 A;  3IBR A;  2WZZ A;  1YT4 A;  3KYE A;  4PM6 A;  2I72 A;  4WN5 A;  1KGF A;  4ZAM A;  4DXB A;  1OTI A;  2M1C A;  5HPF A;  2P9V A;  2D01 A;  5DVA A;  4JGP A;  3IHB A;  3V3S A;  3SZT A;  4JGQ A;  2XRN A;  1TDG A;  3B33 A;  3VP0 A;  1W63 Q;  1GSV A;  1FIL A;  4HJ3 A;  3NY4 A;  2V0U A;  3NDE A;  4WEK A;  4BWI A;  4EBP A;  4LCL A;  1OME A;  4OVD A;  3R7W B;  4N9K A;  1P97 A;  3U2A A;  1IKI A;  4HH2 A;  1FSY A;  4S2J A;  2BG1 A;  2R9X A;  5HAQ A;  5FQM A;  3HBR A;  4F94 A;  1K4F A;  3LIC A;  2EX8 A;  4DF6 A;  4EQI A;  1SKF A;  3A3J A;  2Y91 A;  5E2F A;  3FWL A;  3PBO A;  3S4X A;  3VFF A;  3T4L A;  1NWZ A;  1TS6 A;  3OZH A;  1MY8 A;  5F5Y A;  1ES2 A;  4YIN A;  2JKT M;  3MKF A;  3HLG A;  3T4Q A;  4QJG A;  3ZCZ A;  1KVL A;  4ZJ3 A;  4OQG A;  3IXB A;  2XFT A;  3E98 A;  1HVB A;  4PAU A;  4X69 A;  4RQ9 A;  3Q82 A;  3UN7 A;  3VSL A;  1LI9 A;  4IUH A;  3BYD A;  2PR6 A;  3VOY A;  4BL2 A;  4S2I A;  1T1A A;  2HP5 A;  3CUE C;  2ZLY A;  2IWD A;  4Q0H A;  1K38 A;  3MS6 A;  1SDE A;  5CER A;  3A0R A;  3PTE A;  1S1Z A;  2V0W A;  3N8R A;  2C5W B;  2VV6 A;  3M2K A;  3EEA A;  3VMA A;  1S4R A;  1LL9 A;  5GHZ A;  3BY8 A;  4DRT A;  3NDG A;  3I7J A;  3P98 A;  3T4T A;  1LT0 A;  4B93 A;  2K31 A;  4O8G A;  4E3L A;  2YKF A;  1H0M A;  3S22 A;  3M6H A;  4ID4 A;  3PBR A;  3ZNT A;  2EXA A;  3H7W B;  4WBG A;  3MSH A;  4GHI A;  3W2Z A;  1JVJ A;  3HLD A;  1FIK A;  5HL6 A;  1P9R A;  1Y4O A;  3B42 A;  1W8Q A;  4MBF A;  3V50 A;  3JPU A;  1ZG4 A;  2XLN A;  5J3W A;  3FKV A;  1JWZ A;  4UA6 A;  1E25 A;  3BLS A;  5JYP A;  3N8S A;  2J80 A;  4BBT A;  4FH2 A;  1LI0 A;  5GL9 A;  1D1J A;  2J7V A;  3V3R A;  1PW1 A;  4KZB A;  3LR0 A;  2ZMV A;  3IX8 A;  2EX6 A;  2ZC3 B;  4ZTK A;  1I2S A;  5TBM A;  4DE0 A;  3HUM A;  3TRC A;  1VEU A;  3D4F A;  5CEB A;  4O01 A;  4OOY A;  1SKO B;  1L0G A;  1L0F A;  5F1F A;  3BJN A;  3C5A A;  5M19 A;  2FFY A;  2UWX A;  4Y15 A;  5IT5 A;  3IX3 A;  4R1G A;  1AXB A;  3F1N A;  3VV4 A;  3C8C A;  3UE0 A;  3Q81 A;  2DCF A;  1GCE A;  1FCO A;  3LIE A;  4NXB A;  3C7U A;  3ISG A;  4IHQ A;  1DY6 A;  5CGS A;  4DDS A;  3UE3 A;  1TS0 A;  1F5M A;  1KGE A;  4NG2 A;  1VM1 A;  2QWS A;  3RTY A;  5G4Z A;  1IYS A;  1LLB A;  3ZG8 B;  4EEU A;  5BOH A;  5L8M A;  2P9V B;  3ZVW A;  5AQA A;  4KQQ A;  1IFQ A;  4RA7 A;  3QP8 A;  2JKR I;  1FR1 A;  4E3M A;  3BFC A;  2W1R A;  2OV5 A;  3ZVT A;  2GDN A;  1K55 C;  3ZQ5 A;  1L0E A;  4L9G A;  4KEN B;  5DJU A;  4D60 A;  1RP5 A;  1I2W A;  4L0L A;  2OWH A;  5L10 A;  4Z9Q A;  2XA7 S;  5U47 A;  1T1C A;  3O87 A;  5HWW A;  4P85 A;  4WZ5 C;  3OPH A;  1RGY A;  1ESU A;  4DMZ A;  2A24 A;  5KMW A;  4KZ7 A;  4ZJ1 A;  4G3K A;  1Z09 A;  5E2E A;  2XFS A;  4FD8 A;  2WZX A;  2O99 A;  2ZC7 A;  5IHV A;  4EU0 A;  5TFQ A;  2ZOI A;  2X02 A;  1DP8 A;  3LUQ A;  2H5S A;  1LHY A;  2ZJ9 A;  3CJM A;  4R3A A;  1L2S A;  1S66 L;  3QP2 A;  4I5S A;  5L09 A;  4Y2F A;  2VA0 A;  3FG8 A;  3LR5 A;  4PM8 A;  2K7S A;  4XXR A;  3KSH A;  1ZTU A;  3UPN A;  4H6J B;  1NLZ A;  1TS7 A;  4M4X A;  2Y8H A;  4GD8 A;  3G32 A;  2NUT C;  3W4P A;  5I94 A;  2VKS A;  1GHP A;  2E8I A;  3MXQ A;  4LLO B;  5MC7 A;  4IJG A;  4GN2 A;  1NJ4 A;  2ZBB A;  2KOI A;  5E43 A;  5GLC A;  1L3L A;  3HLW A;  3QNC A;  3OLO A;  4EV4 A;  3T1R A;  2ZL1 A;  3MZF A;  5HWT A;  2LB5 A;  4K0W A;  1XJ6 A;  1XGI A;  2PYP A;  4Q0I A;  4EES A;  4PMA A;  5C5K A;  3DWZ A;  4ZRR A;  4JXW A;  1A0K A;  5GHX A;  5J8X A;  3CZD A;  3VFH A;  1U60 A;  1JTD A;  2H0T A;  5EVL A;  3BEC A;  4K0X A;  3OPR A;  4GHI B;  1YPR A;  3ZHH A;  3S7O A;  1Y54 A;  2Q0O A;  1G28 A;  2OLV A;  1XGJ A;  2I9V A;  3GDI A;  1YSQ A;  4YFM A;  2AVX A;  3DTK A;  5DTS A;  3LR4 A;  1G5U A;  4X25 A;  4LV0 A;  2XRO A;  5HAR A;  5LBR A;  1WYB A;  3G34 A;  1V9Y A;  3S7P A;  2JKF A;  2PAV P;  3PBS A;  1DP9 A;  1XKZ A;  1MXO A;  3ZFZ A;  3B3X A;  2V1Z A;  3W4O A;  4JXV A;  3C2W A;  5F82 A;  4BEN A;  3K3D A;  3E2L A;  3SH7 A;  3A3D A;  3VOL A;  4F3L B;  4DDY A;  3A0S A;  1S67 L;  2Z6C A;  3H9W A;  3OC2 A;  2DNS A;  1OJ5 A;  5CGX A;  5TBM B;  2KLI A;  4GKU A;  4JF6 A;  1VEU B;  3RFB A;  2MJ6 A;  1ES4 A;  2ZD8 A;  3UNW A;  3SH8 A;  5FI6 A;  1HLU P;  1NY0 A;  5EUA A;  2X71 A;  5IU1 A;  1FR6 A;  5FAQ A;  2P74 A;  4UA9 A;  3PBQ A;  2NUP C;  1IOU A;  3O3V A;  4MCW A;  1GHI A;  1F98 A;  3AGE A;  5DKL A;  3CIT A;  1IYP A;  4FH4 A;  3PBN A;  5FEF A;  4Q0J A;  2KX6 A;  3F1N B;  3BY9 A;  3T1Q B;  3V67 A;  5CRF A;  3MXS A;  2IA2 A;  1TF1 A;  2WUQ A;  1Q2P A;  4WZ4 A;  4CJN A;  1BTL A;  1ES5 A;  4S2M A;  1OT6 A;  3JVV A;  3LID A;  3G30 A;  4OKP A;  1IYQ A;  1W5D A;  2Y2P A;  3BW6 A;  2W3D A;  4HQA A;  1NXY A;  3BFD A;  2HDQ A;  4R38 A;  4MNR A;  2Y2K A;  4X56 A;  4R6L A;  3VP4 A;  3LGO A;  2VGK A;  5FI2 A;  2Z2L B;  1UWP X;  2JE5 A;  5F68 A;  1PZP A;  1CJF A;  3HL9 A;  4UQI S;  1XXM A;  2PRF A;  2GJ3 A;  5HAP A;  4S2P A;  3MKE A;  4YOF A;  3MQQ A;  5EM1 A;  3T4K A;  1VET A;  4HIA A;  3NHQ A;  2UV0 E; 
#chains in the Genus database with same CATH homology
 1LSV A;  1S1Y A;  2A24 B;  1XJ2 A;  3IBJ A;  4CLC D;  4R70 A;  5J7E A;  3UMD A;  3PBR A;  1H8M A;  1LSX A;  3CLO A;  1XJ3 A;  4FSF A;  1N9O A;  4LRX C;  3OCN A;  3H7W B;  4WLA A;  3UB7 A;  4KQO A;  3IS2 B;  3UE6 A;  3FPW A;  2O9A A;  4GHI A;  3W2Z A;  4JGR A;  4IUK A;  2VJW A;  4WUJ A;  1N9N A;  2EWV A;  5HL6 A;  1P9R A;  4MDZ A;  3B42 A;  3KO6 A;  5AVF A;  3CWF A;  3TJZ C;  2VV8 A;  4ARZ A;  4L9F A;  5EFW A;  4L9E A;  4NXE A;  4CLC A;  3S7N A;  4LPZ A;  5J3W A;  1ZHH B;  1OPX A;  1OTA A;  3HCY A;  4HY8 A;  3TW8 A;  1W63 M;  4Y3I A;  1T18 A;  3R4K A;  3TE8 A;  3ICY A;  4HJ6 A;  5A8B A;  1VHM A;  2OAQ 1;  4OOL A;  1X0O A;  3KSF A;  2J80 A;  1KOU A;  4MN5 A;  4BBT A;  2OOL A;  4NXG A;  2W0N A;  2XA7 M;  5IS1 A;  3BQ8 A;  4BBU A;  1TS8 A;  3EOI A;  3VE4 A;  2FZ0 A;  2J3W A;  5DFX A;  3LIF A;  1OTB A;  3LR0 A;  3D72 A;  3KSI A;  3F1P B;  1VB6 A;  3MQ0 A;  3T4J A;  2ZMV A;  2W1T A;  4JGO A;  3R7W A;  2VGL S;  2VEA A;  2PR5 A;  1P0Z A;  2Y79 A;  3MF0 A;  5TBM A;  4ME4 A;  3EQU A;  3UB9 A;  2J3T C;  5HWV A;  2W3H A;  3TRC A;  4G3W A;  4I38 A;  3D3O A;  2P08 A;  2P04 A;  3CUE A;  1YAX A;  2VV7 A;  3MQO A;  4O01 A;  3E4Q A;  3H82 B;  4HP9 A;  2V1A A;  3JVU A;  2A2L A;  2GZA A;  3E4P A;  3BJN A;  4H6J A;  5G4Y A;  4UEY A;  2CMN A;  5DF9 A;  3MJQ A;  2YKH A;  5IT5 A;  4EUV A;  4EW7 A;  5K5B A;  3F1N A;  4WEJ A;  1H3Q A;  4KUO A;  4DN0 A;  5F6A A;  3VV4 A;  4ETX A;  4FOF A;  3C8C A;  1GSW A;  3NOT C;  4HJ4 A;  4WF0 A;  3CAX A;  4HI4 A;  4WEL A;  3LIE A;  4NXB A;  4DJ2 A;  4Y5F A;  1LL8 A;  4IHQ A;  3FC7 A;  3LI9 A;  3UE3 A;  1TS0 A;  4GW9 A;  1F5M A;  3F1O B;  3K2N A;  2QWS A;  4MMN A;  3RTY A;  3LI8 A;  1V9Z A;  5G4Z A;  2L0W A;  2P7J A;  4EEU A;  5L8M A;  2WKR A;  5F69 A;  2QHK A;  1UWN X;  1IFQ A;  3RH8 B;  1GSX A;  2JKR I;  2W1R A;  1OJG A;  3LYX A;  3P01 A;  4ETZ A;  3OCL A;  3ZQ5 A;  4GS9 A;  1NRJ A;  4ARZ B;  4L9G A;  2L1M A;  4EER A;  2EWW A;  4OOM A;  5DJT A;  5DJU A;  4L0L A;  2OWH A;  1T1B A;  2J3T D;  5CX7 A;  3MFX A;  4XT2 A;  2XA7 S;  3FPV A;  1T1C A;  2O9C A;  4PKY G;  4UQI M;  1F9I A;  5HWW A;  3OBF A;  4P6Z M;  4DMZ A;  5HDS A;  2W27 A;  2A24 A;  1MZU A;  3T4O A;  5AVE A;  5HPI A;  4GJ4 A;  3H7W A;  4G3K A;  3IS2 A;  2O99 A;  3LIA A;  1LSW A;  4EU0 A;  1MC0 A;  2GNX A;  2QKP A;  2WKQ A;  2ZOI A;  1S4S A;  2HJE A;  2OWJ A;  2PT7 A;  2VX8 A;  1DP8 A;  3LUQ A;  2H28 A;  4GLQ A;  1MKM A;  4F3L A;  2FH5 A;  3T50 A;  4R3A A;  1S66 L;  1JNU A;  2HV1 A;  4I5S A;  4Z1W A;  4QPR A;  4Y2F A;  5DKK A;  2VA0 A;  3FG8 A;  3NOU C;  3G6O A;  3LR5 A;  4AFI A;  1BYW A;  5DFY A;  2K7S A;  2PYR A;  2JKR M;  2PD8 A;  1D7E A;  4EQ1 A;  2HF6 A;  3KSH A;  2M7U A;  4KQD A;  1ODV A;  1ZTU A;  4H6J B;  3B47 A;  4YWZ A;  2V1B A;  2V9A A;  1NLZ A;  1TS7 A;  2JN7 A;  4II7 A;  4M4X A;  3UME A;  2Y8H A;  3SW1 A;  4EET B;  5HZH A;  2NUT C;  2EA9 A;  5AJG A;  2K2N A;  5HDD A;  1DP6 A;  3NJA A;  2VKS A;  3NOP C;  3MXQ A;  3F1P A;  1N9L A;  1NLY A;  3EEH A;  5TJJ A;  4LLO B;  3DBA A;  3HJI A;  3PHY A;  5MC7 A;  4IJG A;  3C30 A;  1D06 A;  2HGV A;  2ZBB A;  2KOI A;  4CLC E;  4MN7 A;  2INW A;  1WA9 A;  3BQA A;  3EWK A;  3OLO A;  2VGL M;  2GX5 A;  2BAS A;  4HOI A;  3EGX C;  5HWT A;  2LB5 A;  2M7V A;  3H82 A;  1XJ6 A;  3S7Q A;  2PYP A;  4Q0I A;  4EES A;  2O9B A;  5C5K A;  2D02 A;  1TD5 A;  3ULF A;  4ZRR A;  4NEE D;  5HSQ A;  3P7N A;  3EGD C;  4I3A A;  4HH3 A;  2Z6D A;  3UB8 A;  4GS9 B;  2L4R A;  4NKP A;  3KX0 X;  4NXF A;  4GHI B;  3LFV A;  3EQV A;  2OAP 1;  3S7O A;  1G28 A;  2WKP A;  2LB9 A;  2I9V A;  4P6Z S;  3GDI A;  1YSP A;  1YSQ A;  4HHD A;  3BWL A;  3HJK A;  2PD7 A;  3LR4 A;  4CLC B;  1OTD A;  2XRO A;  3OOV A;  2QJ7 A;  3F1O A;  3IBR A;  4E04 A;  5LBR A;  2JKT I;  3LR3 A;  1V9Y A;  2KDK A;  1XJ4 A;  3E0Y A;  4WN5 A;  3S7P A;  5HD5 A;  3PBS A;  1DP9 A;  1OTI A;  2M1C A;  5HPF A;  2D01 A;  3PYP A;  4JGP A;  1YKD A;  2G7U A;  4JGQ A;  2XRN A;  3B33 A;  3C2W A;  1W63 Q;  1GSV A;  4HJ3 A;  2JHE A;  3K3D A;  3O5Y A;  3KYQ A;  3VOL A;  3ZYT A;  2PDR A;  4HP4 A;  2V0U A;  3C38 A;  4WEK A;  4BWI A;  4F3L B;  2W1T B;  3A0S A;  2VLG A;  3R7W B;  1S67 L;  4G3V A;  1P97 A;  1Y28 A;  4I39 A;  2Z6C A;  1EW0 A;  3U2A A;  2O0Y A;  3H9W A;  3OC2 A;  4HH2 A;  1OJ5 A;  5TBM B;  2KLI A;  4BJP A;  4MN6 A;  4BMW A;  4PHT A;  3RFB A;  2MJ6 A;  2QYB A;  5IU1 A;  2PHY A;  1T19 A;  3LIC A;  2DMW A;  5I5L A;  4O0P A;  3PBQ A;  3MR0 A;  5HD3 A;  2NUP C;  4CLC C;  1IOU A;  4MCW A;  5KIZ A;  4EEP A;  2ZOH A;  1F98 A;  3PBO A;  3T4L A;  4HNB A;  2HJ9 C;  5DKL A;  3CIT A;  1DRM A;  3PR6 A;  2W3E A;  3PBN A;  1NWZ A;  1P9W A;  4Q0J A;  1TS6 A;  5F5Y A;  2KX6 A;  3F1N B;  4CQH A;  3BY9 A;  3V67 A;  5HDC A;  2JKT M;  2IA2 A;  1TF1 A;  3T4Q A;  1OT9 A;  2ZMF A;  3PBT A;  5KSH A;  2W3F A;  2B02 A;  3E4O A;  4I3I A;  1OT6 A;  3JVV A;  1XFN A;  2W3G A;  3LID A;  4LRZ E;  3E98 A;  2VZW A;  4PAU A;  4RQ9 A;  4BBV A;  4B9O A;  4IUH A;  3MMH A;  2PR6 A;  4YNR A;  3BW6 A;  2W3D A;  4KUK A;  1UGU A;  4HQA A;  1OTE A;  3T4S A;  4DJ3 A;  4R38 A;  1T1A A;  3GEC A;  4R6L A;  3CUE C;  3LIB A;  4EXO A;  5J4E A;  4Q0H A;  3VE3 A;  1UWP X;  2B18 A;  3A0V A;  1STZ A;  3KYZ A;  5FL3 A;  3A0R A;  2QJ5 A;  4K08 A;  2R78 A;  1S1Z A;  5F68 A;  2XSS A;  3PXP A;  2V0W A;  4GCZ A;  4LRY C;  3UB6 A;  2VV6 A;  3CI6 A;  4UQI S;  3EEA A;  1S4R A;  1G6O A;  3BY8 A;  2GJ3 A;  4WL9 A;  4XT2 B;  4YOF A;  3MQQ A;  3K3C A;  3T4K A;  3T4T A;  3KSG A;  1LT0 A;  4B93 A;  2K31 A;  4O8G A;  2YKF A;  4I3J A;  1XFQ A;  4HIA A;  3NHQ A;  4PKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...