3LUQA

The crystal structure of a pas domain from a sensory box histidine kinase regulator from geobacter sulfurreducens to 2.5a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
112
Chain Sequence
SDERLRLFTEHAPAALAMFDREMRYLAVSRRWREDYGLGDGDILGMSHYDIFPEIGEEWKSVHRRGLAGEVIRVEEDCFVRGRTQWLRWEVRPWYEGEGRVGGVVIFTEDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title The Crystal Structure of a PAS Domain from a Sensory Box Histidine Kinase Regulator from Geobacter sulfurreducens to 2.5A
rcsb
source organism Geobacter sulfurreducens
total genus 21
structure length 112
sequence length 114
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3luqA00
1UGUA 1OT6A 3GDIA 2JHEA 1TS0A 4L9EA 3UE6A 4H6JB 4KQDA 5EFWA 1OTDA 4RQ9A 3VE4A 3MFXA 4NXFA 5J3WA 4BBUA 1T1BA 2QKPA 2L1MA 4LRXC 2V0WA 3NOTC 1ODVA 5I5LA 5J7EA 3H7WA 5J4EA 3NOPC 3VOLA 5HDCA 2OOLA 4PKYA 1XFQA 1LSWA 1XJ6A 4XT2B 1XJ4A 2PDRA 1OJ5A 3MJQA 1F9IA 2KX6A 2VEAA 1TS8A 3K3CA 2PR5A 3SW1A 3B33A 5F5YA 3UB8A 2INWA 3OLOA 2M1CA 3LI8A 4WL9A 2VLGA 3LICA 1JNUA 4JGRA 4I39A 1DRMA 3KX0X 4HJ6A 4L9GA 4M4XA 3CLOA 4R70A 4JGPA 3UB7A 1GSXA 2ZBBA 2QJ5A 3BWLA 4HH2A 4LRZE 3MR0A 2R78A 1S1ZA 1OJGA 3ZQ5A 2L4RA 3H7WB 2A24A 4I3IA 4I3JA 2ZOHA 3UMDA 4EEUA 3EWKA 4NXGA 2Z6CA 5HWVA 4HIAA 3NHQA 4KUOA 4HNBA 1D06A 4K08A 4NXEA 1EW0A 2W27A 2EA9A 3LIAA 3PYPA 4LRYC 2P7JA 3MXQA 2B02A 2QHKA 3BY8A 1XFNA 4EEPA 4MN5A 4HQAA 2PHYA 5HWWA 3GECA 3BY9A 4EERA 1T1AA 4GCZA 3K3DA 2J80A 4DJ2A 4DJ3A 5TBMA 3IBRA 1N9LA 5DJUA 2WKQA 1LL8A 3H82A 3RH8B 5HSQA 5HD5A 3EEHA 4I5SA 1DP6A 4F3LB 3UB9A 1UWNX 5A8BA 1N9NA 2I9VA 2KDKA 4GW9A 3IS2A 4GS9A 4HI4A 3A0SA 2QJ7A 3E4PA 5G4YA 4R3AA 2PYPA 5F68A 1TS6A 5HDDA 2H28A 4I38A 5TBMB 3LIFA 1BYWA 4EETB 2V1AA 5AVFA 3C8CA 2BASA 1T19A 4HH3A 3F1NA 5HWTA 3LIBA 2D02A 2PD8A 5HDSA 3LIDA 2V1BA 5DKKA 5F69A 2YKFA 2D01A 3LIEA 1P0ZA 2PR6A 3VE3A 2Z6DA 4JGOA 4WF0A 2QWSA 3IS2B 2WKPA 3ULFA 5DJTA 2V0UA 4GS9B 1S1YA 3F1PA 1WA9A 2GJ3A 4EW7A 4HP4A 3CWFA 1V9ZA 1OTBA 2W0NA 3F1OA 3D72A 4E04A 3ICYA 2VV7A 4I3AA 1GSWA 4L9FA 5HZHA 1N9OA 3C2WA 4HJ3A 3T50A 3F1NB 1P97A 4LPZA 5G4ZA 1KOUA 1X0OA 4HY8A 4PKYG 3CAXA 1V9YA 1VB6A 2A24B 1XJ2A 4BBVA 3A0RA 5IU1A 1Y28A 4BBTA 3PHYA 3F1PB 2YKHA 1S67L 4GHIA 4R6LA 3E4QA 3MQQA 1TS7A 4HP9A 1OTEA 3A0VA 3F1OB 1S4SA 3G6OA 4HOIA 4KUKA 2OWJA 1XJ3A 5F6AA 2PYRA 1S4RA 4R38A 1LSXA 5DKLA 3FC7A 3MQOA 1T18A 1D7EA 3H82B 2PD7A 3E4OA 2JN7A 1MZUA 4MN6A 4NXBA 4HHDA 4WUJA 3RTYA 1DP8A 1OTIA 4GHIB 3UB6A 3HJKA 1GSVA 2OWHA 5HD3A 2ZOIA 4HJ4A 3HJIA 1LSVA 1G28A 1OT9A 4EQ1A 1LT0A 4H6JA 2WKRA 2L0WA 3FG8A 2HV1A 2VV6A 4EESA 1DP9A 4F3LA 2K7SA 1F98A 4JGQA 4EXOA 3P7NA 3NJAA 3LYXA 1UWPX 1NWZA 4WN5A 4XT2A 4LLOB 5AVEA 4B9OA 5IS1A 5KIZA 3LI9A 4WLAA 3LUQA 1S66L 2VV8A 3NOUC 3UMEA 1T1CA 2V9AA 2CMNA 4YWZA 1OTAA 3H9WA
chains in the Genus database with same CATH superfamily
1YMXA 1F2KA 3GDIA 3IF6C 2OSUA 4ESPA 3EOIA 2GNXA 4L9EA 2O9AA 4H6JB 5EVEA 2WAFA 4KQDA 3VE4A 2VKSA 3G35A 5J3WA 4P6BA 2Y2GA 4JF4A 3MBZA 5FAPA 2V0WA 3BFEA 5EE8A 5I5LA 4QU3A 1CJFA 2ZD8A 3NOPC 1K4FA 2OOLA 5JYPA 3VFHA 4WM9A 1CI8A 1KVLA 1FQGA 1F9IA 2Y2QA 5DF9A 4KQRA 4Y13A 1AWIA 2RL3A 1TS8A 3CPTB 4E3KA 4IUKA 5FQQA 1K54A 2Q0OA 2M1CA 3LI8A 3BLSA 3ZYTA 4E6XA 1G6OA 2ZC3B 2HP6A 1WYCA 4ETXA 5DTTA 4O01A 3UB7A 3WRZA 1K4EA 1ZKJA 4ZTKA 1CQAA 2HDUA 4IVIA 4LRZE 1YT4A 3GRJA 1FCNA 1RCJA 1HLUP 3H7WB 3E0YA 3CUEC 3C7VA 4LENA 4UEYA 2ZOHA 3UMDA 3EWKA 1D1JA 1O7EA 5HWVA 4KUOA 4JXGA 3GSGA 4MN7A 2WUQA 1EW0A 1K25A 4Q8IA 1YLWA 3T4KA 3WS4A 3A3JA 1PWGA 4EU0A 1E3UA 1RGZA 2EFUA 4KG6A 4G3KA 1ES4A 4LRYC 4S2KA 5FQKA 2OAQ1 4KZ5A 3MXQA 4LCLA 4P0MA 2ACGA 1SDNA 4MN5A 2PHYA 4BMWA 1Q2PA 1Z09A 3MXRA 3TOIA 2B18A 2XH9A 2X01A 4DJ3A 1LL5A 3I7JA 5A93A 1LL8A 3OBFA 4OOMA 2UWXA 3W2ZA 2ZM2A 4P6ZS 4I5SA 2JC7A 4F3LB 2IWBA 3QP6A 3P09A 2VX8A 1UWNX 2FH5A 5A8BA 1PW8A 3BJNA 3IWIA 1N9NA 3JVVA 4JF5A 1SHVA 5E2FA 5GLAA 2XF3A 3KSGA 3T4LA 3VOZA 4B4ZA 4GS9A 2G7UA 3PTEA 2QJ7A 2IWCA 3K2NA 2WGIA 4OVDA 4R3AA 4AFIA 2I72A 2J3TC 4BLMA 1K55A 5F68A 2ZL1B 2X02A 1TS6A 2JKTI 4EBNA 2Y79A 5IT5A 2JCHA 5TBMB 2Y2KA 4U3TA 3T1SA 2BASA 1TVFA 3UB5P 3DTEA 1KGFA 4HH3A 1Y4OA 3LIBA 4X1LA 2EX9A 1L0EA 2D02A 2YKFA 4R23A 2Z2MB 4KZ6A 1P0ZA 1OMEA 3VE3A 3TW8A 3O3VA 4FH4A 4WF0A 5L09A 3IS2B 5EVLA 2XRNA 2J9OA 4K0WA 4WMCD 3ULFA 5DJTA 2V0UA 4NEED 2B5RA 5U47A 4EW7A 3WS2A 3CWFA 5EVIA 4FH2A 4PM7A 2VV7A 3HCYA 1OPXA 4DE0A 1MY8A 5CECA 5K5BA 5HZHA 3U4LP 3CHWP 5CRFA 3KYEA 2Q9MA 3C2WA 2HP9A 3T50A 2NUTC 5TJJA 2EWWA 4IBRA 2QPNA 2WKEA 1KGEA 1V9YA 4OOLA 4IUHA 4WELA 5FASA 4GD8A 4S2OA 2HDQA 2JKTM 2Y4AA 1Y28A 3MQ0A 4BBTA 4PM9A 4OQIA 3E98A 2WZXA 2XLNA 4GHIA 2C5WB 1J9MA 3NECA 1HZOA 4HP9A 5DF8A 4DF6A 4Z9QA 3T1QB 2W3DA 1L0DA 3QP1A 1XP4A 2OWJA 3G6OA 4KUKA 2E8IA 1XJ3A 2HZ5A 1W63M 4JBFA 4X68A 4R1GA 4MBFA 4R38A 4E3NA 4JPMA 4JXSA 1LSXA 5HAIA 1ES5A 5FEGA 3QHYA 1ZC2A 3MQOA 2FFYA 1H8MA 1XPBA 3MZDA 4DRTA 2X71A 3G31A 3VMAA 1MWSA 1MZUA 4MN6A 1K57C 4F94A 3RTYA 3KSHA 1W5DA 1OTIA 1WYBA 3G30A 1NYYA 4RYEA 5EUAA 4M3KA 3ZHHA 2OAP1 4OLDA 3RXXA 4LV0A 4HJ4A 2Y2MA 3ZVTA 3JVUA 4MEZA 4EQ1A 1YKDA 1ONGA 3IWQA 3HLCA 2XK1A 2VGLS 4KZ8A 3FG8A 1PZOA 4MCWA 2V2FF 3T4OA 1VEUB 2Y2OA 4S2MA 3P7NA 4S2LA 2EX8A 2R9WA 4CPKA 4QPRA 1NWZA 4XT2A 2OV5A 4CLCB 5A92A 4X1MA 3FPVA 4LLOB 3AGDA 5KIZA 5IS1A 4WLAA 3LUQA 4QY5A 3HUMA 4NG2A 4QWOA 4UA9A 2V9AA 4GDBA 3PBSA 4EV4A 1OTAA 1OT6A 4O0PA 5CHUA 4B93A 4UA7A 1MBLA 5KZHA 4R0QA 5EFWA 4RQ9A 1MWRA 2LB5A 2ZQAA 4BBUA 3LY4A 2QKPA 5HX9A 4CJNA 4LRXC 5HDCA 1BTLA 4KQQA 1XFQA 1P9RA 1LSWA 1XJ6A 3BFCA 4FCFA 3FKVA 1VETB 1FOFA 2PR5A 4DXCA 1LL9A 5FI6A 3UB8A 4NK3A 4IEDA 4ZAMA 4HESA 3C4PA 4FTXA 3M6BA 4G3VA 2VLGA 3Q81A 4WMCA 2V8CA 1NLZA 1GHIA 5TFQA 1PZPA 4GLQA 4MNRA 2P08A 3BQAA 4L9GA 1BZAA 4M4XA 3CLOA 4ZRRA 1TF1A 4JGPA 4CLCC 3QNCA 2QJ5A 4KZBA 4OKPA 4HH2A 4PM5A 5D3OA 2R78A 1OJGA 2XR0A 3P98A 3ZQ5A 3E2LA 3ISGA 1ONHA 4I3JA 2Z6CA 5CERA 3ZG0A 3NDGA 2VK3A 2EA9A 1CI9A 3LIAA 4RX3A 4EBLA 4DE2A 2PBDP 2MJ6A 3ZG8B 3FKWA 4LV2A 3VP4A 4KZ3A 3DTKA 1NY0A 3MXSA 1G68A 1QMEA 1A0KA 1P9WA 1J3WA 4WZ5C 5AQ9A 2W1RA 3MZEA 3V39A 5DFXA 1XFNA 5AQ7A 5MC7A 4HQAA 4YINA 2GZAA 3GECA 5FEFA 3BY9A 5GHYA 1YLZA 1T1AA 4BWIA 4E3IA 4GCZA 2VA0A 3VP0A 3GV9A 1JWVA 3V3RA 4DJ2A 2HP5A 2W1TA 3OPHA 3IBRA 1N9LA 2KOIA 3H82A 1SCWA 5HARA 4S2NC 3B3XA 3TE8A 5HSQA 1FILA 1DP6A 1JVJA 2VZWA 3UB9A 5HAQA 4U0TA 1LLBA 3SZTA 3MZFA 3RJUA 5EM1A 2I9VA 3OPLA 3OCNA 3PBNA 5L07A 1M40A 3PBOA 1BSGA 2KDKA 4N92A 3EEAA 1WE4A 3BM6A 2PT7A 1NZUA 1STZA 3EGXC 2WGWA 3S7NA 3C5AA 4GJ4A 4CLCE 3OPPA 2PYPA 2J9PA 5FA7A 1MKIA 4UAAA 2XSSA 4IBXA 5HDDA 4A5RA 2H28A 4QHCA 3V50A 2PU2A 3BRMA 1K54C 3IF5A 1T19A 3IX3A 1BT5A 3EGDC 3F1NA 3CG5A 3GTCA 5CTNA 5BOHA 2Z2LB 3IXBA 4IHQA 3LIDA 5F69A 4UA6A 3IQAA 4JXVA 2ZC6B 5KSCA 4JGOA 2XFSA 3BW6A 5E2HA 1FSWA 2PAVP 2PU4A 4GS9B 4EBPA 1CK3A 3IH9A 3N6IA 5CGXA 1FR1A 1W8YA 3BFGA 3ZNYA 3D72A 3PXPA 1BLHA 2ZQ7A 4N1XA 4FD8A 4BENA 3A3FA 1TD5A 3FYZA 1PI4A 4GN2A 2B95A 1P97A 5G4ZA 2BLSA 1KOUA 1X0OA 3UPNA 5FDSA 1VB6A 2A24B 4BBVA 3MSHA 2IA2A 2P04A 4X55A 4WBGA 4ARZA 1H8YA 1LHYA 3LR5A 4C3QA 4QY6A 1G5UA 2FZ0A 1XX2A 4X69A 3TRCA 5EVIB 1OTEA 1ERMA 3A0VA 5HPFA 1BLCA 1H8ZA 3E2KA 3ZG7B 2ZQ9A 4U0XA 3QP8A 3EQUA 2HDRA 3T4JA 1CF0A 4R3JA 3UE3A 4DXBA 4PM8A 4OQGA 5F6AA 5EECA 5CTMA 3GMWA 2A3UA 1S4RA 4ME4A 4E3JA 3PBTA 4PMAA 5DKLA 3N7WA 1T18A 1HVBA 4LCMA 5DTKA 3G2ZA 1D7EA 5L2FA 1NXYA 5CX7A 1K55C 2ZLYA 4Y3IA 3W8KA 1VQQA 3CI6A 5G18A 4L0LA 4KENB 1KE3A 3HLEA 4GHIB 5FQ9A 3UB6A 4PHTA 3HJKA 3LR4A 3HLWA 4S2PA 5CHJA 3Q7VA 5CEDA 3VSLA 1IOUA 3PAGA 3HJIA 3ZFZA 3HREA 1G28A 1LT0A 4YNRA 1N4OA 2WKRA 1IKGA 4CLCD 2VV6A 2Y91A 4EESA 5L8MA 1ESUA 4JKTA 2H0TA 4BQMA 4F3LA 2ZM0A 3T4SA 2XGNA 2Y59A 1CEGA 4PM6A 5EVIC 1EROA 3NJAA 4R4SA 3LYXA 4WN5A 4OH0A 4ZJ3A 4GZBA 3HLGA 2G2UA 2O9BA 1FSYA 3N8LA 4B9OA 3UNWA 2WAEA 3LI9A 1ZHHB 1S66L 3S7QA 1LI0A 1PYYA 4RA7A 2V8FA 1GCEA 3P01A 3N4IA 3D3OA 1FR6A 4R4RA 3UE6A 2HPBA 3CJMA 1OTDA 4GD6A 1YSQA 3ITAA 1AXBA 3MFXA 1T1BA 3QNBA 4YFMA 3MKEA 1JTGA 1XKZA 3HL9A 3AGFA 3IX8A 3SS3A 3NOTC 3QP4A 4KZ7A 5J4EA 3CMZA 4GOGA 5GLCA 4DE1A 5HAPA 4C75A 1M6KA 4XT2B 2BG1A 2PDRA 1OJ5A 2V1ZA 2V20A 2KX6A 4ZDXA 2ZMFA 4MBHA 1EWZA 5FL3A 3BFFA 4OP5A 3K3CA 4XUZA 1GA0A 3HUOA 2ZMAA 3B33A 5JYOA 5F5YA 2INWA 3IWOA 1K0KA 5EPHA 4ETZA 4LGWA 5CGWA 2XD5A 4X6TA 4WL9A 3LICA 4LFUA 1K57A 4JGRA 2XEPA 3KX0X 3AGEA 2DNSA 1ERQA 4EQIA 4R70A 5KSHA 2WKIA 2Y2PA 4KG5A 3UN7A 2J7VA 3MR0A 3PAEA 1S1ZA 4IVKA 3DWZA 1ALQA 2L4RA 4II7A 1IYSA 1Z6FA 4I3IA 3T4TA 2VJWA 2M7VA 3OC2A 4HIAA 3NHQA 3UPOA 1D06A 4K08A 1L3LA 3Q82A 2W27A 2P9VA 1XXMA 3CZDA 5FQMA 5HPIA 3Q7ZA 2Y8HA 5AQAA 4FSFA 2QHKA 2EX2A 5I94A 3SH7A 1KE4A 5AQBA 3R7WA 1PWDA 2J80A 3O87A 4Z1WA 1NZOA 5M19A 2XDMA 2XA7M 3LEZA 3B47A 4QJGA 2ZMVA 4GB7A 4H8RA 1NJ4A 1MKMA 1NYMA 3W4OA 3NI9A 2JKFA 3C38A 3NULA 3MKFA 1O07A 2JBFA 1XGIA 1L0FA 1NRJA 2DMWA 4N9LA 2WYXA 4HI4A 5TGFA 4YOFA 3A0SA 3ZGAB 4DE3A 2WZZA 4RVAA 1N9BA 3E4PA 4N9KA 1MPLA 5G4YA 1IFQA 1G6AA 2H0YA 2ZC7A 3ZG9B 3UDFA 2Y2NA 5EOEA 5IHVA 1MC0A 3O86A 4KZAA 3WS1A 1VEUA 4I38A 2W1TB 3A3DA 1BUEA 1BYWA 1JWZA 4UQIM 4EETB 5AJGA 2JE5A 3C8CA 2J3TD 4E3OA 3LCEA 3T1XA 3NC8A 4E6WA 4CLCA 2PD8A 5HL1A 2HGVA 4P87A 4EWFA 3HLBA 2W3GA 4OLGA 3W4QA 2D01A 3LIEA 4OP8A 2Y2IA 2PR6A 5F1FA 3FPWA 4OPRA 2QWSA 3DW0A 4OPYA 1ES3A 4EUZA 5DVAA 3LO7A 3MMHA 3F1PA 1WA9A 1SZVA 4OQ0A 4O7DA 2GJ3A 4EUVA 3WRTA 5FAQA 1PI5A 1I2SA 1ZG4A 1V9ZA 3N8SA 2W0NA 4PPRA 3QP5A 3F1OA 4E04A 3ICYA 3PBQA 2EXAA 4E3LA 3IXDA 3C30A 1YMSA 1CEFA 5FQJA 4L9FA 1SKOA 3MS6A 1N9OA 4BJPA 3LEQA 3NY4A 3F1NB 4N1HA 2IWDA 3IF6A 4HY8A 5FI7A 2WKHA 3CAXA 1MXOA 3IBJA 5EVID 3VP1A 1XJ2A 3A0RA 3HLFA 4D60A 5IU1A 4Y0UA 4UHUA 1TDLA 1W79A 1F5MA 2A2LA 5EM0A 4S2NA 3UDIA 1BLSA 3DTIA 3FWLA 3CITA 3W4PA 3EQVA 3MQQA 3SS5A 4Y2FA 1SDEA 3S7PA 1IELA 1YPRA 1U60A 4BD0A 1Q2QA 4GNUA 3NBLA 4MBKA 1S4SA 4KG2A 3VV4A 3L7HA 4S2IA 4Y17A 3C4OA 4KZ4A 2PYRA 1PRQA 2LB9A 3OCLA 1XA1A 4Y5FA 3T4QA 1YLTA 1YLPA 1S6RA 4E3MA 1ZG6A 3BYDA 1GHPA 3ZG5A 3E4OA 5FATA 1NRFA 2JN7A 3FV7A 4ARZB 3OPRA 4ZBEA 4HHDA 4WUJA 2EX6A 3KSIA 4G3WA 3IHAA 3WS0A 1MWUA 2Q9NA 2DRWA 1PW1A 3G34A 3KYQA 2M7UA 3S22A 3CUEA 3V67A 4BL2A 3QP2A 1ACFA 5FSRA 5CGSA 2ZOIA 5GHXA 1IYOA 1C3BA 2WGVA 2XD1A 2XA7S 4QD4A 3SH9A 4H6JA 5L10A 1YM1A 3IXHA 3BQ8A 1RGYA 2L0WA 3JPUA 4OOYA 3LGOA 2ZJ9A 5F82A 1DP9A 2UV0E 2ZQ8A 5EOOA 4MDZA 3V5MA 4GDNA 2P74A 4JGQA 4EXOA 3UO9A 5LBRA 5E2GA 4R3BA 1UWPX 3BFDA 5CHMA 4Q0HA 1DJAA 5AVEA 4B88A 4OONA 3IT9A 3CPTA 3NOUC 3UMEA 3U2AA 4FUWA 1W8QA 1ZTUA 3A3EA 2CMNA 3BLMA 3Q7VB 1L2SA 4YWZA 3H9WA 1UGUA 2E8JA 4UQIS 2JHEA 3T1RA 1TS0A 1YQSA 2H5SA 2HJ9C 4NXFA 3DAVA 3PR6A 2VGLM 3IXGA 2L1MA 3NIAA 1ODVA 4NKPA 3ZDJA 4RX2A 5J7EA 3H7WA 3L9KA 3VOLA 4PKYA 4DMZA 3VP3A 1XJ4A 5M1AA 3BECA 3MJQA 2EWVA 3D9YA 2VEAA 1JTDA 4ID4A 4WEKA 3SW1A 3S1YA 3OLOA 1H5XA 2EXBA 4LV3A 3IHBA 2OLUA 1QMFA 4Y7PA 1JNUA 3NDEA 4I39A 1DRMA 5GLBA 1DJCA 1YAXA 2CC1A 4HJ6A 3HUNA 4Y0OA 3G4PA 1GSXA 1KVMA 2ZBBA 3ZCZA 3BWLA 4HEFA 2ZC5B 2H10A 1SKFA 2A24A 1K38A 3UE0A 3M6HA 4EEUA 4NXGA 2BTFP 4HNBA 1BULA 2QYBA 3B42A 4NXEA 1RP5A 1W63Q 1DJBA 4MMNA 2Y2JA 3PYPA 3N8RA 5GLDA 3VSKA 2J8YA 4BD1A 4NETA 3ZVWA 1I5QA 2P7JA 3OZHA 2O99A 1K56D 2B02A 2DCFA 3BY8A 5A91A 4EEPA 3RXWA 5HWWA 4MLLA 1YLYA 4EERA 2ZL1A 4WZ4A 1PWCA 3K3DA 4B4XA 1KGGA 2HDSA 3PBRA 5TBMA 5DJUA 5HFOA 2WKQA 2QZ6A 1K6SA 3RH8B 2XROA 5M18A 3LFVA 1IKIA 1FCMA 5HD5A 3EEHA 2WK0A 2OLVA 2P9VB 5A90A 3V3SA 2C6WB 4GW9A 3T12B 4K91A 2QMIA 1I2WA 5FAOA 3IS2A 5CXWA 1MWTA 1KDSA 1KDWA 2J3WA 5GHZA 2NUPC 4WYYA 4D2OA 4WEJA 4C6YA 1JWPA 3HLDA 3NCKA 1E4DA 3R7WB 3G32A 3LIFA 3HBRA 1FCOA 2V1AA 5AVFA 5HL6A 2JKRI 4CQHA 2A49A 3C7UA 5HWTA 5DF7A 3WWXA 2W3EA 4DDSA 3LR3A 1ES2A 5HDSA 3SS4A 5DKKA 2V1BA 2RCXA 1H3QA 5GL9A 1IYQA 4DN0A 5E2EA 2EFXA 2ZC4B 2Z6DA 1HTZA 1XA7A 2WKPA 4ZJ1A 5KMWA 1S1YA 3VP2A 2K31A 3D4FA 3DWKA 4GKUA 2GX5A 4HP4A 2FFFB 3WS5A 1OTBA 4JLFA 1NLYA 3IX4A 4Q0IA 1PNEA 4JF6A 3OOVA 4I3AA 1GSWA 3RFBA 3R4KA 5FI2A 3FZCA 1S0WA 1VHMA 1PFLA 3HVFA 4OPZA 4HJ3A 3GR2A 4K0XA 3UPPA 4LPZA 2ZQCA 2PBYA 4PKYG 4PAUA 3VOYA 3DBAA 1E3UD 1PIOA 1ESIA 3SH8A 3M2KA 1YLJA 2XFTA 1HD8A 4X25A 3PHYA 4KQOA 3F1PB 2YKHA 2O9CA 5E43A 5FQIA 2JKRM 3G2YA 1S67L 2VGKA 3ZNTA 4R6LA 3E4QA 1EI5A 3KYZA 1TS7A 1H0MA 1GHMA 1LI9A 3F1OB 4S2JA 4O8GA 3TJZC 4OQHA 3VFFA 4XXRA 3UDXA 1TEMA 4HOIA 1SKOB 2KLIA 5J8XA 4LV1A 4FOFA 3FC7A 1IYPA 4Y0TA 3JYIA 1E25A 3IF6B 3SOIA 2HF6A 3IH8A 3H82B 1KE0A 3A3IA 2PD7A 4X53A 1XGJA 1Y54A 2Y2HA 2W3FA 4BL3A 1VM1A 2G2WA 2R9XA 4NXBA 2WADA 3UE1A 3O88A 4QB8A 4X56A 3TSGA 4P6ZM 2O0YA 1DP8A 5DTSA 5C5KA 1L0GA 3MF0A 1FIKA 2VGJA 2W3HA 3KO6A 1BLPA 4JXWA 3MFDA 2AVXA 3LR0A 4ZJ2A 3TG9A 2WGWB 1GSVA 2OWHA 5HD3A 1IEMA 1LSVA 3S4XA 1OT9A 5DFYA 4OPQA 2Y2LA 3DTMA 5FDHA 2HJEA 4Q0JA 3BEBA 1YSPA 2K2NA 1K56A 4Y15A 4P85A 2HV1A 3Q07A 2GDNA 3UY6A 5F1GA 4XUXA 4HBTA 2ZQDA 4IJGA 4HBUA 2K7SA 2XQZA 4WZ5A 4KZ9A 1F98A 5CEBA 3GQZA 3M2JA 3KSFA 1W7FA 3GVBA 3S7OA 2PRFA 5HW3A 1GA9A 3ITBA 3O5YA 1VETA 5EV0A 3Q1FA 1DY6A 2Y55A 2JKGA 2VV8A 4DDYA 1TDGA 3LY3A 5TR7A 1T1CA 1K6RA 4DKIA 5F83A 2ZM8A
chains in the Genus database with same CATH topology
1UGUA 1OT6A 3D3OA 4O0PA 3GDIA 4UQIS 4B93A 2JHEA 3EOIA 2GNXA 1TS0A 4L9EA 3UE6A 2O9AA 4H6JB 4KQDA 5EFWA 1OTDA 1YSQA 4RQ9A 2HJ9C 3VE4A 3MFXA 4NXFA 2LB5A 2VKSA 3PR6A 5J3WA 4BBUA 1T1BA 2VGLM 2QKPA 2L1MA 4LRXC 2V0WA 3NOTC 1ODVA 5I5LA 4NKPA 5J7EA 3H7WA 5J4EA 3NOPC 3VOLA 5HDCA 2OOLA 4PKYA 1XFQA 1P9RA 4DMZA 1LSWA 1XJ6A 4XT2B 1XJ4A 2PDRA 1OJ5A 3MJQA 1F9IA 2KX6A 2EWVA 2ZMFA 5DF9A 2VEAA 5FL3A 1TS8A 3K3CA 2PR5A 4WEKA 3SW1A 3B33A 5F5YA 4IUKA 3UB8A 2INWA 3OLOA 4ETZA 2M1CA 3LI8A 4WL9A 3ZYTA 4G3VA 2VLGA 1G6OA 3LICA 1JNUA 4JGRA 1NLZA 1DRMA 4I39A 3KX0X 4ETXA 1YAXA 4GLQA 4HJ6A 2P08A 3BQAA 4L9GA 4O01A 4M4XA 3CLOA 4R70A 4ZRRA 1TF1A 5KSHA 4JGPA 3UB7A 4CLCC 1GSXA 2ZBBA 2QJ5A 3BWLA 4HH2A 4LRZE 3MR0A 2R78A 1S1ZA 1OJGA 3ZQ5A 2L4RA 3H7WB 4II7A 2A24A 3E0YA 4I3IA 3CUEC 4I3JA 3T4TA 4UEYA 2ZOHA 3UMDA 4EEUA 2VJWA 3EWKA 4NXGA 2M7VA 2Z6CA 3OC2A 4HIAA 5HWVA 3NHQA 4KUOA 4HNBA 4MN7A 1D06A 4K08A 2QYBA 3B42A 4NXEA 1EW0A 2W27A 1W63Q 2EA9A 4MMNA 3T4KA 3LIAA 3PYPA 2MJ6A 4EU0A 4G3KA 4LRYC 5HPIA 2P7JA 1P9WA 2Y8HA 2OAQ1 4FSFA 2O99A 2W1RA 3MXQA 2B02A 2QHKA 3BY8A 5DFXA 1XFNA 5MC7A 4EEPA 4MN5A 4HQAA 2PHYA 5HWWA 2GZAA 3GECA 4BMWA 3BY9A 4EERA 1T1AA 4BWIA 2B18A 4GCZA 3R7WA 3K3DA 2VA0A 2J80A 4Z1WA 4DJ2A 4DJ3A 2W1TA 3PBRA 5TBMA 3IBRA 1N9LA 5DJUA 2KOIA 2WKQA 1LL8A 3H82A 2XA7M 3OBFA 3B47A 3RH8B 2XROA 4OOMA 2ZMVA 3LFVA 3TE8A 5HSQA 3W2ZA 4P6ZS 1MKMA 3EEHA 4I5SA 5HD5A 1DP6A 4F3LB 2VZWA 2VX8A 3UB9A 1UWNX 3C38A 2FH5A 5A8BA 3BJNA 1N9NA 2I9VA 3JVVA 3OCNA 3PBNA 3PBOA 2KDKA 4GW9A 3EEAA 3KSGA 1NRJA 2DMWA 2PT7A 1STZA 3EGXC 3IS2A 3S7NA 3T4LA 4GS9A 4HI4A 2J3WA 4YOFA 4GJ4A 2NUPC 3A0SA 4CLCE 2G7UA 2QJ7A 3K2NA 3E4PA 4WEJA 5G4YA 1IFQA 4R3AA 4AFIA 2J3TC 2PYPA 5F68A 2XSSA 3R7WB 1TS6A 5HDDA 2JKTI 1MC0A 2Y79A 5IT5A 2H28A 4I38A 2W1TB 3LIFA 5TBMB 1BYWA 4UQIM 4EETB 2V1AA 5AJGA 5AVFA 5HL6A 3C8CA 2J3TD 2JKRI 2BASA 1T19A 4HH3A 3EGDC 4CQHA 3F1NA 5HWTA 3LIBA 2W3EA 4CLCA 2D02A 2PD8A 4IHQA 2HGVA 3LR3A 5HDSA 3LIDA 2V1BA 5DKKA 5F69A 2YKFA 2W3GA 1H3QA 2D01A 3LIEA 4DN0A 1P0ZA 2PR6A 3VE3A 3FPWA 2Z6DA 3TW8A 4JGOA 4WF0A 2QWSA 3BW6A 3IS2B 2WKPA 2XRNA 3ULFA 5DJTA 2V0UA 4GS9B 4NEED 3MMHA 1S1YA 2K31A 3F1PA 1WA9A 2GJ3A 4EUVA 4EW7A 2GX5A 4HP4A 3CWFA 1V9ZA 1OTBA 2W0NA 3F1OA 1NLYA 3D72A 3ICYA 4E04A 3PXPA 3PBQA 2VV7A 4Q0IA 3HCYA 3C30A 1OPXA 3OOVA 4I3AA 1GSWA 3RFBA 3R4KA 4L9FA 5K5BA 5HZHA 1VHMA 1N9OA 4BJPA 1TD5A 3C2WA 4HJ3A 3T50A 3F1NB 2NUTC 1P97A 4LPZA 5G4ZA 5TJJA 1KOUA 2EWWA 1X0OA 4HY8A 4PKYG 3IBJA 3CAXA 1V9YA 1VB6A 4OOLA 4PAUA 2A24B 1XJ2A 4BBVA 3A0RA 3DBAA 4IUHA 4WELA 5IU1A 2IA2A 2P04A 1F5MA 2A2LA 2JKTM 4ARZA 1Y28A 3MQ0A 4BBTA 3LR5A 3PHYA 4KQOA 3F1PB 2FZ0A 2YKHA 2O9CA 2JKRM 3E98A 1S67L 3CITA 3EQVA 4GHIA 4R6LA 3E4QA 3MQQA 3TRCA 3KYZA 1TS7A 4HP9A 1OTEA 3A0VA 5HPFA 4Y2FA 3S7PA 3F1OB 3EQUA 4O8GA 3T4JA 3TJZC 3UE3A 2W3DA 1S4SA 3G6OA 2OWJA 4HOIA 4KUKA 3VV4A 1XJ3A 5F6AA 1W63M 2PYRA 1S4RA 4ME4A 2KLIA 4R38A 3PBTA 2LB9A 3OCLA 1LSXA 5DKLA 4FOFA 3FC7A 4Y5FA 3T4QA 3MQOA 1T18A 2HF6A 1H8MA 1D7EA 3H82B 2PD7A 3E4OA 5CX7A 2W3FA 2JN7A 4Y3IA 4ARZB 1MZUA 3CI6A 4MN6A 4NXBA 4HHDA 4WUJA 3KSIA 4G3WA 3RTYA 3KSHA 4P6ZM 2O0YA 1DP8A 1OTIA 4L0LA 5C5KA 3MF0A 3KYQA 2M7UA 2W3HA 3KO6A 4GHIB 3UB6A 4PHTA 3HJKA 3LR4A 3CUEA 3LR0A 3V67A 2OAP1 1GSVA 2OWHA 5HD3A 1IOUA 2ZOIA 4HJ4A 3HJIA 1LSVA 3JVUA 1G28A 1OT9A 4EQ1A 1LT0A 5DFYA 1YKDA 2XA7S 4YNRA 4H6JA 2HJEA 4Q0JA 2WKRA 3BQ8A 1YSPA 2L0WA 2K2NA 2VGLS 3FG8A 4CLCD 2HV1A 2VV6A 4EESA 5L8MA 1DP9A 4MCWA 4IJGA 3T4OA 2K7SA 4F3LA 4MDZA 1F98A 3T4SA 4JGQA 4EXOA 3P7NA 3NJAA 5LBRA 3KSFA 3LYXA 1UWPX 3S7OA 4QPRA 1NWZA 4WN5A 4XT2A 4Q0HA 4CLCB 3O5YA 3FPVA 2O9BA 4LLOB 5AVEA 4B9OA 5IS1A 5KIZA 3LI9A 1ZHHB 4WLAA 3LUQA 1S66L 2VV8A 3S7QA 3NOUC 3UMEA 3U2AA 1T1CA 1ZTUA 2V9AA 3PBSA 2CMNA 4YWZA 1OTAA 3H9WA 3P01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGU A;  1OT6 A;  3GDI A;  2JHE A;  1TS0 A;  4L9E A;  3UE6 A;  4H6J B;  4KQD A;  5EFW A;  1OTD A;  4RQ9 A;  3VE4 A;  3MFX A;  4NXF A;  5J3W A;  4BBU A;  1T1B A;  2QKP A;  2L1M A;  4LRX C;  2V0W A;  3NOT C;  1ODV A;  5I5L A;  5J7E A;  3H7W A;  5J4E A;  3NOP C;  3VOL A;  5HDC A;  2OOL A;  4PKY A;  1XFQ A;  1LSW A;  1XJ6 A;  4XT2 B;  1XJ4 A;  2PDR A;  1OJ5 A;  3MJQ A;  1F9I A;  2KX6 A;  2VEA A;  1TS8 A;  3K3C A;  2PR5 A;  3SW1 A;  3B33 A;  5F5Y A;  3UB8 A;  2INW A;  3OLO A;  2M1C A;  3LI8 A;  4WL9 A;  2VLG A;  3LIC A;  1JNU A;  4JGR A;  4I39 A;  1DRM A;  3KX0 X;  4HJ6 A;  4L9G A;  4M4X A;  3CLO A;  4R70 A;  4JGP A;  3UB7 A;  1GSX A;  2ZBB A;  2QJ5 A;  3BWL A;  4HH2 A;  4LRZ E;  3MR0 A;  2R78 A;  1S1Z A;  1OJG A;  3ZQ5 A;  2L4R A;  3H7W B;  2A24 A;  4I3I A;  4I3J A;  2ZOH A;  3UMD A;  4EEU A;  3EWK A;  4NXG A;  2Z6C A;  5HWV A;  4HIA A;  3NHQ A;  4KUO A;  4HNB A;  1D06 A;  4K08 A;  4NXE A;  1EW0 A;  2W27 A;  2EA9 A;  3LIA A;  3PYP A;  4LRY C;  2P7J A;  3MXQ A;  2B02 A;  2QHK A;  3BY8 A;  1XFN A;  4EEP A;  4MN5 A;  4HQA A;  2PHY A;  5HWW A;  3GEC A;  3BY9 A;  4EER A;  1T1A A;  4GCZ A;  3K3D A;  2J80 A;  4DJ2 A;  4DJ3 A;  5TBM A;  3IBR A;  1N9L A;  5DJU A;  2WKQ A;  1LL8 A;  3H82 A;  3RH8 B;  5HSQ A;  5HD5 A;  3EEH A;  4I5S A;  1DP6 A;  4F3L B;  3UB9 A;  1UWN X;  5A8B A;  1N9N A;  2I9V A;  2KDK A;  4GW9 A;  3IS2 A;  4GS9 A;  4HI4 A;  3A0S A;  2QJ7 A;  3E4P A;  5G4Y A;  4R3A A;  2PYP A;  5F68 A;  1TS6 A;  5HDD A;  2H28 A;  4I38 A;  5TBM B;  3LIF A;  1BYW A;  4EET B;  2V1A A;  5AVF A;  3C8C A;  2BAS A;  1T19 A;  4HH3 A;  3F1N A;  5HWT A;  3LIB A;  2D02 A;  2PD8 A;  5HDS A;  3LID A;  2V1B A;  5DKK A;  5F69 A;  2YKF A;  2D01 A;  3LIE A;  1P0Z A;  2PR6 A;  3VE3 A;  2Z6D A;  4JGO A;  4WF0 A;  2QWS A;  3IS2 B;  2WKP A;  3ULF A;  5DJT A;  2V0U A;  4GS9 B;  1S1Y A;  3F1P A;  1WA9 A;  2GJ3 A;  4EW7 A;  4HP4 A;  3CWF A;  1V9Z A;  1OTB A;  2W0N A;  3F1O A;  3D72 A;  4E04 A;  3ICY A;  2VV7 A;  4I3A A;  1GSW A;  4L9F A;  5HZH A;  1N9O A;  3C2W A;  4HJ3 A;  3T50 A;  3F1N B;  1P97 A;  4LPZ A;  5G4Z A;  1KOU A;  1X0O A;  4HY8 A;  4PKY G;  3CAX A;  1V9Y A;  1VB6 A;  2A24 B;  1XJ2 A;  4BBV A;  3A0R A;  5IU1 A;  1Y28 A;  4BBT A;  3PHY A;  3F1P B;  2YKH A;  1S67 L;  4GHI A;  4R6L A;  3E4Q A;  3MQQ A;  1TS7 A;  4HP9 A;  1OTE A;  3A0V A;  3F1O B;  1S4S A;  3G6O A;  4HOI A;  4KUK A;  2OWJ A;  1XJ3 A;  5F6A A;  2PYR A;  1S4R A;  4R38 A;  1LSX A;  5DKL A;  3FC7 A;  3MQO A;  1T18 A;  1D7E A;  3H82 B;  2PD7 A;  3E4O A;  2JN7 A;  1MZU A;  4MN6 A;  4NXB A;  4HHD A;  4WUJ A;  3RTY A;  1DP8 A;  1OTI A;  4GHI B;  3UB6 A;  3HJK A;  1GSV A;  2OWH A;  5HD3 A;  2ZOI A;  4HJ4 A;  3HJI A;  1LSV A;  1G28 A;  1OT9 A;  4EQ1 A;  1LT0 A;  4H6J A;  2WKR A;  2L0W A;  3FG8 A;  2HV1 A;  2VV6 A;  4EES A;  1DP9 A;  4F3L A;  2K7S A;  1F98 A;  4JGQ A;  4EXO A;  3P7N A;  3NJA A;  3LYX A;  1UWP X;  1NWZ A;  4WN5 A;  4XT2 A;  4LLO B;  5AVE A;  4B9O A;  5IS1 A;  5KIZ A;  3LI9 A;  4WLA A;  3LUQ A;  1S66 L;  2VV8 A;  3NOU C;  3UME A;  1T1C A;  2V9A A;  2CMN A;  4YWZ A;  1OTA A;  3H9W A; 
#chains in the Genus database with same CATH topology
 1YMX A;  1F2K A;  3GDI A;  3IF6 C;  2OSU A;  4ESP A;  3EOI A;  2GNX A;  4L9E A;  2O9A A;  4H6J B;  5EVE A;  2WAF A;  4KQD A;  3VE4 A;  2VKS A;  3G35 A;  5J3W A;  4P6B A;  2Y2G A;  4JF4 A;  3MBZ A;  5FAP A;  2V0W A;  3BFE A;  5EE8 A;  5I5L A;  4QU3 A;  1CJF A;  2ZD8 A;  3NOP C;  1K4F A;  2OOL A;  5JYP A;  3VFH A;  4WM9 A;  1CI8 A;  1KVL A;  1FQG A;  1F9I A;  2Y2Q A;  5DF9 A;  4KQR A;  4Y13 A;  1AWI A;  2RL3 A;  1TS8 A;  3CPT B;  4E3K A;  4IUK A;  5FQQ A;  1K54 A;  2Q0O A;  2M1C A;  3LI8 A;  3BLS A;  3ZYT A;  4E6X A;  1G6O A;  2ZC3 B;  2HP6 A;  1WYC A;  4ETX A;  5DTT A;  4O01 A;  3UB7 A;  3WRZ A;  1K4E A;  1ZKJ A;  4ZTK A;  1CQA A;  2HDU A;  4IVI A;  4LRZ E;  1YT4 A;  3GRJ A;  1FCN A;  1RCJ A;  1HLU P;  3H7W B;  3E0Y A;  3CUE C;  3C7V A;  4LEN A;  4UEY A;  2ZOH A;  3UMD A;  3EWK A;  1D1J A;  1O7E A;  5HWV A;  4KUO A;  4JXG A;  3GSG A;  4MN7 A;  2WUQ A;  1EW0 A;  1K25 A;  4Q8I A;  1YLW A;  3T4K A;  3WS4 A;  3A3J A;  1PWG A;  4EU0 A;  1E3U A;  1RGZ A;  2EFU A;  4KG6 A;  4G3K A;  1ES4 A;  4LRY C;  4S2K A;  5FQK A;  2OAQ 1;  4KZ5 A;  3MXQ A;  4LCL A;  4P0M A;  2ACG A;  1SDN A;  4MN5 A;  2PHY A;  4BMW A;  1Q2P A;  1Z09 A;  3MXR A;  3TOI A;  2B18 A;  2XH9 A;  2X01 A;  4DJ3 A;  1LL5 A;  3I7J A;  5A93 A;  1LL8 A;  3OBF A;  4OOM A;  2UWX A;  3W2Z A;  2ZM2 A;  4P6Z S;  4I5S A;  2JC7 A;  4F3L B;  2IWB A;  3QP6 A;  3P09 A;  2VX8 A;  1UWN X;  2FH5 A;  5A8B A;  1PW8 A;  3BJN A;  3IWI A;  1N9N A;  3JVV A;  4JF5 A;  1SHV A;  5E2F A;  5GLA A;  2XF3 A;  3KSG A;  3T4L A;  3VOZ A;  4B4Z A;  4GS9 A;  2G7U A;  3PTE A;  2QJ7 A;  2IWC A;  3K2N A;  2WGI A;  4OVD A;  4R3A A;  4AFI A;  2I72 A;  2J3T C;  4BLM A;  1K55 A;  5F68 A;  2ZL1 B;  2X02 A;  1TS6 A;  2JKT I;  4EBN A;  2Y79 A;  5IT5 A;  2JCH A;  5TBM B;  2Y2K A;  4U3T A;  3T1S A;  2BAS A;  1TVF A;  3UB5 P;  3DTE A;  1KGF A;  4HH3 A;  1Y4O A;  3LIB A;  4X1L A;  2EX9 A;  1L0E A;  2D02 A;  2YKF A;  4R23 A;  2Z2M B;  4KZ6 A;  1P0Z A;  1OME A;  3VE3 A;  3TW8 A;  3O3V A;  4FH4 A;  4WF0 A;  5L09 A;  3IS2 B;  5EVL A;  2XRN A;  2J9O A;  4K0W A;  4WMC D;  3ULF A;  5DJT A;  2V0U A;  4NEE D;  2B5R A;  5U47 A;  4EW7 A;  3WS2 A;  3CWF A;  5EVI A;  4FH2 A;  4PM7 A;  2VV7 A;  3HCY A;  1OPX A;  4DE0 A;  1MY8 A;  5CEC A;  5K5B A;  5HZH A;  3U4L P;  3CHW P;  5CRF A;  3KYE A;  2Q9M A;  3C2W A;  2HP9 A;  3T50 A;  2NUT C;  5TJJ A;  2EWW A;  4IBR A;  2QPN A;  2WKE A;  1KGE A;  1V9Y A;  4OOL A;  4IUH A;  4WEL A;  5FAS A;  4GD8 A;  4S2O A;  2HDQ A;  2JKT M;  2Y4A A;  1Y28 A;  3MQ0 A;  4BBT A;  4PM9 A;  4OQI A;  3E98 A;  2WZX A;  2XLN A;  4GHI A;  2C5W B;  1J9M A;  3NEC A;  1HZO A;  4HP9 A;  5DF8 A;  4DF6 A;  4Z9Q A;  3T1Q B;  2W3D A;  1L0D A;  3QP1 A;  1XP4 A;  2OWJ A;  3G6O A;  4KUK A;  2E8I A;  1XJ3 A;  2HZ5 A;  1W63 M;  4JBF A;  4X68 A;  4R1G A;  4MBF A;  4R38 A;  4E3N A;  4JPM A;  4JXS A;  1LSX A;  5HAI A;  1ES5 A;  5FEG A;  3QHY A;  1ZC2 A;  3MQO A;  2FFY A;  1H8M A;  1XPB A;  3MZD A;  4DRT A;  2X71 A;  3G31 A;  3VMA A;  1MWS A;  1MZU A;  4MN6 A;  1K57 C;  4F94 A;  3RTY A;  3KSH A;  1W5D A;  1OTI A;  1WYB A;  3G30 A;  1NYY A;  4RYE A;  5EUA A;  4M3K A;  3ZHH A;  2OAP 1;  4OLD A;  3RXX A;  4LV0 A;  4HJ4 A;  2Y2M A;  3ZVT A;  3JVU A;  4MEZ A;  4EQ1 A;  1YKD A;  1ONG A;  3IWQ A;  3HLC A;  2XK1 A;  2VGL S;  4KZ8 A;  3FG8 A;  1PZO A;  4MCW A;  2V2F F;  3T4O A;  1VEU B;  2Y2O A;  4S2M A;  3P7N A;  4S2L A;  2EX8 A;  2R9W A;  4CPK A;  4QPR A;  1NWZ A;  4XT2 A;  2OV5 A;  4CLC B;  5A92 A;  4X1M A;  3FPV A;  4LLO B;  3AGD A;  5KIZ A;  5IS1 A;  4WLA A;  3LUQ A;  4QY5 A;  3HUM A;  4NG2 A;  4QWO A;  4UA9 A;  2V9A A;  4GDB A;  3PBS A;  4EV4 A;  1OTA A;  1OT6 A;  4O0P A;  5CHU A;  4B93 A;  4UA7 A;  1MBL A;  5KZH A;  4R0Q A;  5EFW A;  4RQ9 A;  1MWR A;  2LB5 A;  2ZQA A;  4BBU A;  3LY4 A;  2QKP A;  5HX9 A;  4CJN A;  4LRX C;  5HDC A;  1BTL A;  4KQQ A;  1XFQ A;  1P9R A;  1LSW A;  1XJ6 A;  3BFC A;  4FCF A;  3FKV A;  1VET B;  1FOF A;  2PR5 A;  4DXC A;  1LL9 A;  5FI6 A;  3UB8 A;  4NK3 A;  4IED A;  4ZAM A;  4HES A;  3C4P A;  4FTX A;  3M6B A;  4G3V A;  2VLG A;  3Q81 A;  4WMC A;  2V8C A;  1NLZ A;  1GHI A;  5TFQ A;  1PZP A;  4GLQ A;  4MNR A;  2P08 A;  3BQA A;  4L9G A;  1BZA A;  4M4X A;  3CLO A;  4ZRR A;  1TF1 A;  4JGP A;  4CLC C;  3QNC A;  2QJ5 A;  4KZB A;  4OKP A;  4HH2 A;  4PM5 A;  5D3O A;  2R78 A;  1OJG A;  2XR0 A;  3P98 A;  3ZQ5 A;  3E2L A;  3ISG A;  1ONH A;  4I3J A;  2Z6C A;  5CER A;  3ZG0 A;  3NDG A;  2VK3 A;  2EA9 A;  1CI9 A;  3LIA A;  4RX3 A;  4EBL A;  4DE2 A;  2PBD P;  2MJ6 A;  3ZG8 B;  3FKW A;  4LV2 A;  3VP4 A;  4KZ3 A;  3DTK A;  1NY0 A;  3MXS A;  1G68 A;  1QME A;  1A0K A;  1P9W A;  1J3W A;  4WZ5 C;  5AQ9 A;  2W1R A;  3MZE A;  3V39 A;  5DFX A;  1XFN A;  5AQ7 A;  5MC7 A;  4HQA A;  4YIN A;  2GZA A;  3GEC A;  5FEF A;  3BY9 A;  5GHY A;  1YLZ A;  1T1A A;  4BWI A;  4E3I A;  4GCZ A;  2VA0 A;  3VP0 A;  3GV9 A;  1JWV A;  3V3R A;  4DJ2 A;  2HP5 A;  2W1T A;  3OPH A;  3IBR A;  1N9L A;  2KOI A;  3H82 A;  1SCW A;  5HAR A;  4S2N C;  3B3X A;  3TE8 A;  5HSQ A;  1FIL A;  1DP6 A;  1JVJ A;  2VZW A;  3UB9 A;  5HAQ A;  4U0T A;  1LLB A;  3SZT A;  3MZF A;  3RJU A;  5EM1 A;  2I9V A;  3OPL A;  3OCN A;  3PBN A;  5L07 A;  1M40 A;  3PBO A;  1BSG A;  2KDK A;  4N92 A;  3EEA A;  1WE4 A;  3BM6 A;  2PT7 A;  1NZU A;  1STZ A;  3EGX C;  2WGW A;  3S7N A;  3C5A A;  4GJ4 A;  4CLC E;  3OPP A;  2PYP A;  2J9P A;  5FA7 A;  1MKI A;  4UAA A;  2XSS A;  4IBX A;  5HDD A;  4A5R A;  2H28 A;  4QHC A;  3V50 A;  2PU2 A;  3BRM A;  1K54 C;  3IF5 A;  1T19 A;  3IX3 A;  1BT5 A;  3EGD C;  3F1N A;  3CG5 A;  3GTC A;  5CTN A;  5BOH A;  2Z2L B;  3IXB A;  4IHQ A;  3LID A;  5F69 A;  4UA6 A;  3IQA A;  4JXV A;  2ZC6 B;  5KSC A;  4JGO A;  2XFS A;  3BW6 A;  5E2H A;  1FSW A;  2PAV P;  2PU4 A;  4GS9 B;  4EBP A;  1CK3 A;  3IH9 A;  3N6I A;  5CGX A;  1FR1 A;  1W8Y A;  3BFG A;  3ZNY A;  3D72 A;  3PXP A;  1BLH A;  2ZQ7 A;  4N1X A;  4FD8 A;  4BEN A;  3A3F A;  1TD5 A;  3FYZ A;  1PI4 A;  4GN2 A;  2B95 A;  1P97 A;  5G4Z A;  2BLS A;  1KOU A;  1X0O A;  3UPN A;  5FDS A;  1VB6 A;  2A24 B;  4BBV A;  3MSH A;  2IA2 A;  2P04 A;  4X55 A;  4WBG A;  4ARZ A;  1H8Y A;  1LHY A;  3LR5 A;  4C3Q A;  4QY6 A;  1G5U A;  2FZ0 A;  1XX2 A;  4X69 A;  3TRC A;  5EVI B;  1OTE A;  1ERM A;  3A0V A;  5HPF A;  1BLC A;  1H8Z A;  3E2K A;  3ZG7 B;  2ZQ9 A;  4U0X A;  3QP8 A;  3EQU A;  2HDR A;  3T4J A;  1CF0 A;  4R3J A;  3UE3 A;  4DXB A;  4PM8 A;  4OQG A;  5F6A A;  5EEC A;  5CTM A;  3GMW A;  2A3U A;  1S4R A;  4ME4 A;  4E3J A;  3PBT A;  4PMA A;  5DKL A;  3N7W A;  1T18 A;  1HVB A;  4LCM A;  5DTK A;  3G2Z A;  1D7E A;  5L2F A;  1NXY A;  5CX7 A;  1K55 C;  2ZLY A;  4Y3I A;  3W8K A;  1VQQ A;  3CI6 A;  5G18 A;  4L0L A;  4KEN B;  1KE3 A;  3HLE A;  4GHI B;  5FQ9 A;  3UB6 A;  4PHT A;  3HJK A;  3LR4 A;  3HLW A;  4S2P A;  5CHJ A;  3Q7V A;  5CED A;  3VSL A;  1IOU A;  3PAG A;  3HJI A;  3ZFZ A;  3HRE A;  1G28 A;  1LT0 A;  4YNR A;  1N4O A;  2WKR A;  1IKG A;  4CLC D;  2VV6 A;  2Y91 A;  4EES A;  5L8M A;  1ESU A;  4JKT A;  2H0T A;  4BQM A;  4F3L A;  2ZM0 A;  3T4S A;  2XGN A;  2Y59 A;  1CEG A;  4PM6 A;  5EVI C;  1ERO A;  3NJA A;  4R4S A;  3LYX A;  4WN5 A;  4OH0 A;  4ZJ3 A;  4GZB A;  3HLG A;  2G2U A;  2O9B A;  1FSY A;  3N8L A;  4B9O A;  3UNW A;  2WAE A;  3LI9 A;  1ZHH B;  1S66 L;  3S7Q A;  1LI0 A;  1PYY A;  4RA7 A;  2V8F A;  1GCE A;  3P01 A;  3N4I A;  3D3O A;  1FR6 A;  4R4R A;  3UE6 A;  2HPB A;  3CJM A;  1OTD A;  4GD6 A;  1YSQ A;  3ITA A;  1AXB A;  3MFX A;  1T1B A;  3QNB A;  4YFM A;  3MKE A;  1JTG A;  1XKZ A;  3HL9 A;  3AGF A;  3IX8 A;  3SS3 A;  3NOT C;  3QP4 A;  4KZ7 A;  5J4E A;  3CMZ A;  4GOG A;  5GLC A;  4DE1 A;  5HAP A;  4C75 A;  1M6K A;  4XT2 B;  2BG1 A;  2PDR A;  1OJ5 A;  2V1Z A;  2V20 A;  2KX6 A;  4ZDX A;  2ZMF A;  4MBH A;  1EWZ A;  5FL3 A;  3BFF A;  4OP5 A;  3K3C A;  4XUZ A;  1GA0 A;  3HUO A;  2ZMA A;  3B33 A;  5JYO A;  5F5Y A;  2INW A;  3IWO A;  1K0K A;  5EPH A;  4ETZ A;  4LGW A;  5CGW A;  2XD5 A;  4X6T A;  4WL9 A;  3LIC A;  4LFU A;  1K57 A;  4JGR A;  2XEP A;  3KX0 X;  3AGE A;  2DNS A;  1ERQ A;  4EQI A;  4R70 A;  5KSH A;  2WKI A;  2Y2P A;  4KG5 A;  3UN7 A;  2J7V A;  3MR0 A;  3PAE A;  1S1Z A;  4IVK A;  3DWZ A;  1ALQ A;  2L4R A;  4II7 A;  1IYS A;  1Z6F A;  4I3I A;  3T4T A;  2VJW A;  2M7V A;  3OC2 A;  4HIA A;  3NHQ A;  3UPO A;  1D06 A;  4K08 A;  1L3L A;  3Q82 A;  2W27 A;  2P9V A;  1XXM A;  3CZD A;  5FQM A;  5HPI A;  3Q7Z A;  2Y8H A;  5AQA A;  4FSF A;  2QHK A;  2EX2 A;  5I94 A;  3SH7 A;  1KE4 A;  5AQB A;  3R7W A;  1PWD A;  2J80 A;  3O87 A;  4Z1W A;  1NZO A;  5M19 A;  2XDM A;  2XA7 M;  3LEZ A;  3B47 A;  4QJG A;  2ZMV A;  4GB7 A;  4H8R A;  1NJ4 A;  1MKM A;  1NYM A;  3W4O A;  3NI9 A;  2JKF A;  3C38 A;  3NUL A;  3MKF A;  1O07 A;  2JBF A;  1XGI A;  1L0F A;  1NRJ A;  2DMW A;  4N9L A;  2WYX A;  4HI4 A;  5TGF A;  4YOF A;  3A0S A;  3ZGA B;  4DE3 A;  2WZZ A;  4RVA A;  1N9B A;  3E4P A;  4N9K A;  1MPL A;  5G4Y A;  1IFQ A;  1G6A A;  2H0Y A;  2ZC7 A;  3ZG9 B;  3UDF A;  2Y2N A;  5EOE A;  5IHV A;  1MC0 A;  3O86 A;  4KZA A;  3WS1 A;  1VEU A;  4I38 A;  2W1T B;  3A3D A;  1BUE A;  1BYW A;  1JWZ A;  4UQI M;  4EET B;  5AJG A;  2JE5 A;  3C8C A;  2J3T D;  4E3O A;  3LCE A;  3T1X A;  3NC8 A;  4E6W A;  4CLC A;  2PD8 A;  5HL1 A;  2HGV A;  4P87 A;  4EWF A;  3HLB A;  2W3G A;  4OLG A;  3W4Q A;  2D01 A;  3LIE A;  4OP8 A;  2Y2I A;  2PR6 A;  5F1F A;  3FPW A;  4OPR A;  2QWS A;  3DW0 A;  4OPY A;  1ES3 A;  4EUZ A;  5DVA A;  3LO7 A;  3MMH A;  3F1P A;  1WA9 A;  1SZV A;  4OQ0 A;  4O7D A;  2GJ3 A;  4EUV A;  3WRT A;  5FAQ A;  1PI5 A;  1I2S A;  1ZG4 A;  1V9Z A;  3N8S A;  2W0N A;  4PPR A;  3QP5 A;  3F1O A;  4E04 A;  3ICY A;  3PBQ A;  2EXA A;  4E3L A;  3IXD A;  3C30 A;  1YMS A;  1CEF A;  5FQJ A;  4L9F A;  1SKO A;  3MS6 A;  1N9O A;  4BJP A;  3LEQ A;  3NY4 A;  3F1N B;  4N1H A;  2IWD A;  3IF6 A;  4HY8 A;  5FI7 A;  2WKH A;  3CAX A;  1MXO A;  3IBJ A;  5EVI D;  3VP1 A;  1XJ2 A;  3A0R A;  3HLF A;  4D60 A;  5IU1 A;  4Y0U A;  4UHU A;  1TDL A;  1W79 A;  1F5M A;  2A2L A;  5EM0 A;  4S2N A;  3UDI A;  1BLS A;  3DTI A;  3FWL A;  3CIT A;  3W4P A;  3EQV A;  3MQQ A;  3SS5 A;  4Y2F A;  1SDE A;  3S7P A;  1IEL A;  1YPR A;  1U60 A;  4BD0 A;  1Q2Q A;  4GNU A;  3NBL A;  4MBK A;  1S4S A;  4KG2 A;  3VV4 A;  3L7H A;  4S2I A;  4Y17 A;  3C4O A;  4KZ4 A;  2PYR A;  1PRQ A;  2LB9 A;  3OCL A;  1XA1 A;  4Y5F A;  3T4Q A;  1YLT A;  1YLP A;  1S6R A;  4E3M A;  1ZG6 A;  3BYD A;  1GHP A;  3ZG5 A;  3E4O A;  5FAT A;  1NRF A;  2JN7 A;  3FV7 A;  4ARZ B;  3OPR A;  4ZBE A;  4HHD A;  4WUJ A;  2EX6 A;  3KSI A;  4G3W A;  3IHA A;  3WS0 A;  1MWU A;  2Q9N A;  2DRW A;  1PW1 A;  3G34 A;  3KYQ A;  2M7U A;  3S22 A;  3CUE A;  3V67 A;  4BL2 A;  3QP2 A;  1ACF A;  5FSR A;  5CGS A;  2ZOI A;  5GHX A;  1IYO A;  1C3B A;  2WGV A;  2XD1 A;  2XA7 S;  4QD4 A;  3SH9 A;  4H6J A;  5L10 A;  1YM1 A;  3IXH A;  3BQ8 A;  1RGY A;  2L0W A;  3JPU A;  4OOY A;  3LGO A;  2ZJ9 A;  5F82 A;  1DP9 A;  2UV0 E;  2ZQ8 A;  5EOO A;  4MDZ A;  3V5M A;  4GDN A;  2P74 A;  4JGQ A;  4EXO A;  3UO9 A;  5LBR A;  5E2G A;  4R3B A;  1UWP X;  3BFD A;  5CHM A;  4Q0H A;  1DJA A;  5AVE A;  4B88 A;  4OON A;  3IT9 A;  3CPT A;  3NOU C;  3UME A;  3U2A A;  4FUW A;  1W8Q A;  1ZTU A;  3A3E A;  2CMN A;  3BLM A;  3Q7V B;  1L2S A;  4YWZ A;  3H9W A;  1UGU A;  2E8J A;  4UQI S;  2JHE A;  3T1R A;  1TS0 A;  1YQS A;  2H5S A;  2HJ9 C;  4NXF A;  3DAV A;  3PR6 A;  2VGL M;  3IXG A;  2L1M A;  3NIA A;  1ODV A;  4NKP A;  3ZDJ A;  4RX2 A;  5J7E A;  3H7W A;  3L9K A;  3VOL A;  4PKY A;  4DMZ A;  3VP3 A;  1XJ4 A;  5M1A A;  3BEC A;  3MJQ A;  2EWV A;  3D9Y A;  2VEA A;  1JTD A;  4ID4 A;  4WEK A;  3SW1 A;  3S1Y A;  3OLO A;  1H5X A;  2EXB A;  4LV3 A;  3IHB A;  2OLU A;  1QMF A;  4Y7P A;  1JNU A;  3NDE A;  4I39 A;  1DRM A;  5GLB A;  1DJC A;  1YAX A;  2CC1 A;  4HJ6 A;  3HUN A;  4Y0O A;  3G4P A;  1GSX A;  1KVM A;  2ZBB A;  3ZCZ A;  3BWL A;  4HEF A;  2ZC5 B;  2H10 A;  1SKF A;  2A24 A;  1K38 A;  3UE0 A;  3M6H A;  4EEU A;  4NXG A;  2BTF P;  4HNB A;  1BUL A;  2QYB A;  3B42 A;  4NXE A;  1RP5 A;  1W63 Q;  1DJB A;  4MMN A;  2Y2J A;  3PYP A;  3N8R A;  5GLD A;  3VSK A;  2J8Y A;  4BD1 A;  4NET A;  3ZVW A;  1I5Q A;  2P7J A;  3OZH A;  2O99 A;  1K56 D;  2B02 A;  2DCF A;  3BY8 A;  5A91 A;  4EEP A;  3RXW A;  5HWW A;  4MLL A;  1YLY A;  4EER A;  2ZL1 A;  4WZ4 A;  1PWC A;  3K3D A;  4B4X A;  1KGG A;  2HDS A;  3PBR A;  5TBM A;  5DJU A;  5HFO A;  2WKQ A;  2QZ6 A;  1K6S A;  3RH8 B;  2XRO A;  5M18 A;  3LFV A;  1IKI A;  1FCM A;  5HD5 A;  3EEH A;  2WK0 A;  2OLV A;  2P9V B;  5A90 A;  3V3S A;  2C6W B;  4GW9 A;  3T12 B;  4K91 A;  2QMI A;  1I2W A;  5FAO A;  3IS2 A;  5CXW A;  1MWT A;  1KDS A;  1KDW A;  2J3W A;  5GHZ A;  2NUP C;  4WYY A;  4D2O A;  4WEJ A;  4C6Y A;  1JWP A;  3HLD A;  3NCK A;  1E4D A;  3R7W B;  3G32 A;  3LIF A;  3HBR A;  1FCO A;  2V1A A;  5AVF A;  5HL6 A;  2JKR I;  4CQH A;  2A49 A;  3C7U A;  5HWT A;  5DF7 A;  3WWX A;  2W3E A;  4DDS A;  3LR3 A;  1ES2 A;  5HDS A;  3SS4 A;  5DKK A;  2V1B A;  2RCX A;  1H3Q A;  5GL9 A;  1IYQ A;  4DN0 A;  5E2E A;  2EFX A;  2ZC4 B;  2Z6D A;  1HTZ A;  1XA7 A;  2WKP A;  4ZJ1 A;  5KMW A;  1S1Y A;  3VP2 A;  2K31 A;  3D4F A;  3DWK A;  4GKU A;  2GX5 A;  4HP4 A;  2FFF B;  3WS5 A;  1OTB A;  4JLF A;  1NLY A;  3IX4 A;  4Q0I A;  1PNE A;  4JF6 A;  3OOV A;  4I3A A;  1GSW A;  3RFB A;  3R4K A;  5FI2 A;  3FZC A;  1S0W A;  1VHM A;  1PFL A;  3HVF A;  4OPZ A;  4HJ3 A;  3GR2 A;  4K0X A;  3UPP A;  4LPZ A;  2ZQC A;  2PBY A;  4PKY G;  4PAU A;  3VOY A;  3DBA A;  1E3U D;  1PIO A;  1ESI A;  3SH8 A;  3M2K A;  1YLJ A;  2XFT A;  1HD8 A;  4X25 A;  3PHY A;  4KQO A;  3F1P B;  2YKH A;  2O9C A;  5E43 A;  5FQI A;  2JKR M;  3G2Y A;  1S67 L;  2VGK A;  3ZNT A;  4R6L A;  3E4Q A;  1EI5 A;  3KYZ A;  1TS7 A;  1H0M A;  1GHM A;  1LI9 A;  3F1O B;  4S2J A;  4O8G A;  3TJZ C;  4OQH A;  3VFF A;  4XXR A;  3UDX A;  1TEM A;  4HOI A;  1SKO B;  2KLI A;  5J8X A;  4LV1 A;  4FOF A;  3FC7 A;  1IYP A;  4Y0T A;  3JYI A;  1E25 A;  3IF6 B;  3SOI A;  2HF6 A;  3IH8 A;  3H82 B;  1KE0 A;  3A3I A;  2PD7 A;  4X53 A;  1XGJ A;  1Y54 A;  2Y2H A;  2W3F A;  4BL3 A;  1VM1 A;  2G2W A;  2R9X A;  4NXB A;  2WAD A;  3UE1 A;  3O88 A;  4QB8 A;  4X56 A;  3TSG A;  4P6Z M;  2O0Y A;  1DP8 A;  5DTS A;  5C5K A;  1L0G A;  3MF0 A;  1FIK A;  2VGJ A;  2W3H A;  3KO6 A;  1BLP A;  4JXW A;  3MFD A;  2AVX A;  3LR0 A;  4ZJ2 A;  3TG9 A;  2WGW B;  1GSV A;  2OWH A;  5HD3 A;  1IEM A;  1LSV A;  3S4X A;  1OT9 A;  5DFY A;  4OPQ A;  2Y2L A;  3DTM A;  5FDH A;  2HJE A;  4Q0J A;  3BEB A;  1YSP A;  2K2N A;  1K56 A;  4Y15 A;  4P85 A;  2HV1 A;  3Q07 A;  2GDN A;  3UY6 A;  5F1G A;  4XUX A;  4HBT A;  2ZQD A;  4IJG A;  4HBU A;  2K7S A;  2XQZ A;  4WZ5 A;  4KZ9 A;  1F98 A;  5CEB A;  3GQZ A;  3M2J A;  3KSF A;  1W7F A;  3GVB A;  3S7O A;  2PRF A;  5HW3 A;  1GA9 A;  3ITB A;  3O5Y A;  1VET A;  5EV0 A;  3Q1F A;  1DY6 A;  2Y55 A;  2JKG A;  2VV8 A;  4DDY A;  1TDG A;  3LY3 A;  5TR7 A;  1T1C A;  1K6R A;  4DKI A;  5F83 A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 1UGU A;  1OT6 A;  3D3O A;  4O0P A;  3GDI A;  4UQI S;  4B93 A;  2JHE A;  3EOI A;  2GNX A;  1TS0 A;  4L9E A;  3UE6 A;  2O9A A;  4H6J B;  4KQD A;  5EFW A;  1OTD A;  1YSQ A;  4RQ9 A;  2HJ9 C;  3VE4 A;  3MFX A;  4NXF A;  2LB5 A;  2VKS A;  3PR6 A;  5J3W A;  4BBU A;  1T1B A;  2VGL M;  2QKP A;  2L1M A;  4LRX C;  2V0W A;  3NOT C;  1ODV A;  5I5L A;  4NKP A;  5J7E A;  3H7W A;  5J4E A;  3NOP C;  3VOL A;  5HDC A;  2OOL A;  4PKY A;  1XFQ A;  1P9R A;  4DMZ A;  1LSW A;  1XJ6 A;  4XT2 B;  1XJ4 A;  2PDR A;  1OJ5 A;  3MJQ A;  1F9I A;  2KX6 A;  2EWV A;  2ZMF A;  5DF9 A;  2VEA A;  5FL3 A;  1TS8 A;  3K3C A;  2PR5 A;  4WEK A;  3SW1 A;  3B33 A;  5F5Y A;  4IUK A;  3UB8 A;  2INW A;  3OLO A;  4ETZ A;  2M1C A;  3LI8 A;  4WL9 A;  3ZYT A;  4G3V A;  2VLG A;  1G6O A;  3LIC A;  1JNU A;  4JGR A;  1NLZ A;  1DRM A;  4I39 A;  3KX0 X;  4ETX A;  1YAX A;  4GLQ A;  4HJ6 A;  2P08 A;  3BQA A;  4L9G A;  4O01 A;  4M4X A;  3CLO A;  4R70 A;  4ZRR A;  1TF1 A;  5KSH A;  4JGP A;  3UB7 A;  4CLC C;  1GSX A;  2ZBB A;  2QJ5 A;  3BWL A;  4HH2 A;  4LRZ E;  3MR0 A;  2R78 A;  1S1Z A;  1OJG A;  3ZQ5 A;  2L4R A;  3H7W B;  4II7 A;  2A24 A;  3E0Y A;  4I3I A;  3CUE C;  4I3J A;  3T4T A;  4UEY A;  2ZOH A;  3UMD A;  4EEU A;  2VJW A;  3EWK A;  4NXG A;  2M7V A;  2Z6C A;  3OC2 A;  4HIA A;  5HWV A;  3NHQ A;  4KUO A;  4HNB A;  4MN7 A;  1D06 A;  4K08 A;  2QYB A;  3B42 A;  4NXE A;  1EW0 A;  2W27 A;  1W63 Q;  2EA9 A;  4MMN A;  3T4K A;  3LIA A;  3PYP A;  2MJ6 A;  4EU0 A;  4G3K A;  4LRY C;  5HPI A;  2P7J A;  1P9W A;  2Y8H A;  2OAQ 1;  4FSF A;  2O99 A;  2W1R A;  3MXQ A;  2B02 A;  2QHK A;  3BY8 A;  5DFX A;  1XFN A;  5MC7 A;  4EEP A;  4MN5 A;  4HQA A;  2PHY A;  5HWW A;  2GZA A;  3GEC A;  4BMW A;  3BY9 A;  4EER A;  1T1A A;  4BWI A;  2B18 A;  4GCZ A;  3R7W A;  3K3D A;  2VA0 A;  2J80 A;  4Z1W A;  4DJ2 A;  4DJ3 A;  2W1T A;  3PBR A;  5TBM A;  3IBR A;  1N9L A;  5DJU A;  2KOI A;  2WKQ A;  1LL8 A;  3H82 A;  2XA7 M;  3OBF A;  3B47 A;  3RH8 B;  2XRO A;  4OOM A;  2ZMV A;  3LFV A;  3TE8 A;  5HSQ A;  3W2Z A;  4P6Z S;  1MKM A;  3EEH A;  4I5S A;  5HD5 A;  1DP6 A;  4F3L B;  2VZW A;  2VX8 A;  3UB9 A;  1UWN X;  3C38 A;  2FH5 A;  5A8B A;  3BJN A;  1N9N A;  2I9V A;  3JVV A;  3OCN A;  3PBN A;  3PBO A;  2KDK A;  4GW9 A;  3EEA A;  3KSG A;  1NRJ A;  2DMW A;  2PT7 A;  1STZ A;  3EGX C;  3IS2 A;  3S7N A;  3T4L A;  4GS9 A;  4HI4 A;  2J3W A;  4YOF A;  4GJ4 A;  2NUP C;  3A0S A;  4CLC E;  2G7U A;  2QJ7 A;  3K2N A;  3E4P A;  4WEJ A;  5G4Y A;  1IFQ A;  4R3A A;  4AFI A;  2J3T C;  2PYP A;  5F68 A;  2XSS A;  3R7W B;  1TS6 A;  5HDD A;  2JKT I;  1MC0 A;  2Y79 A;  5IT5 A;  2H28 A;  4I38 A;  2W1T B;  3LIF A;  5TBM B;  1BYW A;  4UQI M;  4EET B;  2V1A A;  5AJG A;  5AVF A;  5HL6 A;  3C8C A;  2J3T D;  2JKR I;  2BAS A;  1T19 A;  4HH3 A;  3EGD C;  4CQH A;  3F1N A;  5HWT A;  3LIB A;  2W3E A;  4CLC A;  2D02 A;  2PD8 A;  4IHQ A;  2HGV A;  3LR3 A;  5HDS A;  3LID A;  2V1B A;  5DKK A;  5F69 A;  2YKF A;  2W3G A;  1H3Q A;  2D01 A;  3LIE A;  4DN0 A;  1P0Z A;  2PR6 A;  3VE3 A;  3FPW A;  2Z6D A;  3TW8 A;  4JGO A;  4WF0 A;  2QWS A;  3BW6 A;  3IS2 B;  2WKP A;  2XRN A;  3ULF A;  5DJT A;  2V0U A;  4GS9 B;  4NEE D;  3MMH A;  1S1Y A;  2K31 A;  3F1P A;  1WA9 A;  2GJ3 A;  4EUV A;  4EW7 A;  2GX5 A;  4HP4 A;  3CWF A;  1V9Z A;  1OTB A;  2W0N A;  3F1O A;  1NLY A;  3D72 A;  3ICY A;  4E04 A;  3PXP A;  3PBQ A;  2VV7 A;  4Q0I A;  3HCY A;  3C30 A;  1OPX A;  3OOV A;  4I3A A;  1GSW A;  3RFB A;  3R4K A;  4L9F A;  5K5B A;  5HZH A;  1VHM A;  1N9O A;  4BJP A;  1TD5 A;  3C2W A;  4HJ3 A;  3T50 A;  3F1N B;  2NUT C;  1P97 A;  4LPZ A;  5G4Z A;  5TJJ A;  1KOU A;  2EWW A;  1X0O A;  4HY8 A;  4PKY G;  3IBJ A;  3CAX A;  1V9Y A;  1VB6 A;  4OOL A;  4PAU A;  2A24 B;  1XJ2 A;  4BBV A;  3A0R A;  3DBA A;  4IUH A;  4WEL A;  5IU1 A;  2IA2 A;  2P04 A;  1F5M A;  2A2L A;  2JKT M;  4ARZ A;  1Y28 A;  3MQ0 A;  4BBT A;  3LR5 A;  3PHY A;  4KQO A;  3F1P B;  2FZ0 A;  2YKH A;  2O9C A;  2JKR M;  3E98 A;  1S67 L;  3CIT A;  3EQV A;  4GHI A;  4R6L A;  3E4Q A;  3MQQ A;  3TRC A;  3KYZ A;  1TS7 A;  4HP9 A;  1OTE A;  3A0V A;  5HPF A;  4Y2F A;  3S7P A;  3F1O B;  3EQU A;  4O8G A;  3T4J A;  3TJZ C;  3UE3 A;  2W3D A;  1S4S A;  3G6O A;  2OWJ A;  4HOI A;  4KUK A;  3VV4 A;  1XJ3 A;  5F6A A;  1W63 M;  2PYR A;  1S4R A;  4ME4 A;  2KLI A;  4R38 A;  3PBT A;  2LB9 A;  3OCL A;  1LSX A;  5DKL A;  4FOF A;  3FC7 A;  4Y5F A;  3T4Q A;  3MQO A;  1T18 A;  2HF6 A;  1H8M A;  1D7E A;  3H82 B;  2PD7 A;  3E4O A;  5CX7 A;  2W3F A;  2JN7 A;  4Y3I A;  4ARZ B;  1MZU A;  3CI6 A;  4MN6 A;  4NXB A;  4HHD A;  4WUJ A;  3KSI A;  4G3W A;  3RTY A;  3KSH A;  4P6Z M;  2O0Y A;  1DP8 A;  1OTI A;  4L0L A;  5C5K A;  3MF0 A;  3KYQ A;  2M7U A;  2W3H A;  3KO6 A;  4GHI B;  3UB6 A;  4PHT A;  3HJK A;  3LR4 A;  3CUE A;  3LR0 A;  3V67 A;  2OAP 1;  1GSV A;  2OWH A;  5HD3 A;  1IOU A;  2ZOI A;  4HJ4 A;  3HJI A;  1LSV A;  3JVU A;  1G28 A;  1OT9 A;  4EQ1 A;  1LT0 A;  5DFY A;  1YKD A;  2XA7 S;  4YNR A;  4H6J A;  2HJE A;  4Q0J A;  2WKR A;  3BQ8 A;  1YSP A;  2L0W A;  2K2N A;  2VGL S;  3FG8 A;  4CLC D;  2HV1 A;  2VV6 A;  4EES A;  5L8M A;  1DP9 A;  4MCW A;  4IJG A;  3T4O A;  2K7S A;  4F3L A;  4MDZ A;  1F98 A;  3T4S A;  4JGQ A;  4EXO A;  3P7N A;  3NJA A;  5LBR A;  3KSF A;  3LYX A;  1UWP X;  3S7O A;  4QPR A;  1NWZ A;  4WN5 A;  4XT2 A;  4Q0H A;  4CLC B;  3O5Y A;  3FPV A;  2O9B A;  4LLO B;  5AVE A;  4B9O A;  5IS1 A;  5KIZ A;  3LI9 A;  1ZHH B;  4WLA A;  3LUQ A;  1S66 L;  2VV8 A;  3S7Q A;  3NOU C;  3UME A;  3U2A A;  1T1C A;  1ZTU A;  2V9A A;  3PBS A;  2CMN A;  4YWZ A;  1OTA A;  3H9W A;  3P01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...