1BZAA

Beta-lactamase toho-1 from escherichia coli tuh12191
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
257
structure length
257
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Crystal structure of the E166A mutant of extended-spectrum beta-lactamase Toho-1 at 1.8 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1998-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1bzaA00
1NZUA 3CMZA 3GSGA 5EVID 3UDXA 1GHPA 3A3EA 1BLHA 4OOMA 1XA7A 4OPZA 2P9VA 4Y0OA 4D2OA 4X6TA 3Q07A 3N8RA 2QZ6A 5HAIA 5A91A 3IH9A 4X53A 1BLSA 1RGYA 3D4FA 1W7FA 3C7VA 4YINA 4BD0A 3Q7ZA 4OQ0A 1ESIA 1NJ4A 1IEMA 4HEFA 2ZC3B 5A90A 5AQ7A 1DJBA 1PW1A 2IWCA 3BLMA 4XUZA 4EV4A 3GV9A 4E3IA 3SS5A 2XH9A 2HPBA 1S0WA 4K0XA 3V3RA 3VMAA 1K56D 5GHYA 1YMSA 4CJNA 3IF5A 3ITBA 4GD6A 1PWGA 4DF6A 4GDBA 1K55A 3TOIA 5A92A 3RXXA 1YLJA 2G2UA 5D3OA 1BULA 1SHVA 2EX2A 4KENB 4OKPA 4X55A 5TR7A 3SH8A 2H10A 1MWUA 4LENA 4OQHA 4N1XA 5JYOA 1BUEA 4WEJA 3AGFA 3G32A 3ZFZA 4LCMA 4BENA 2X02A 1YLWA 4HBTA 5DF8A 3C4PA 5F83A 1W5DA 4U3TA 5HL1A 1HVBA 1BTLA 5FAQA 1ERMA 1ES2A 1E3UA 1Z6FA 3FWLA 1FSWA 3NC8A 5DTTA 2B5RA 3AGEA 3LY4A 5FI2A 5GHZA 4CPKA 3PBTA 1KDWA 4JF4A 1K55C 2RL3A 2WKEA 2XR0A 4OOLA 5FSRA 1BLPA 4P6BA 3RJUA 1HZOA 2WGVA 3VP2A 1GA0A 5CECA 4P87A 3WRTA 5E43A 1YLYA 5FA7A 5FQQA 2HDQA 2FFFB 2ZM8A 3W4QA 5DF7A 4WELA 5EUAA 3NIAA 5CHMA 4E3KA 3UO9A 4UHUA 2IWBA 3AGDA 2WADA 4OVDA 4GKUA 4KZ8A 1XPBA 2J9PA 2VGKA 3PTEA 2C6WB 3WS1A 2Y2GA 4KG6A 3BFCA 1MWSA 1BLCA 1O07A 2Y2HA 3VP3A 4DRTA 4S2KA 4Y7PA 3C5AA 1WYCA 1DY6A 3G31A 5HFOA 1TDLA 3OZHA 4KZ9A 4JBFA 1VQQA 1PI5A 4ZJ2A 4QHCA 2WGWB 5FAPA 4JPMA 4N9KA 3NDEA 4LV0A 3O86A 4OH0A 5CTNA 1K4EA 3MFDA 5TGFA 4C3QA 4FH4A 1SDEA 3S1YA 1FOFA 3G4PA 2X01A 4P0MA 4PM5A 3HUMA 3BM6A 3GQZA 3P09A 4OP8A 4OPYA 5KSHA 3Q7VA 1CI8A 2Y4AA 2XD1A 4L0LA 1FCNA 5EE8A 3UNWA 4BQMA 2OLUA 1Y54A 4O7DA 4OONA 4E3LA 3C7UA 3V3SA 1PZOA 3ZG9B 3BLSA 5CGSA 2RCXA 2XQZA 1IYSA 1E25A 1K6RA 4OOYA 1ONGA 2C5WB 4BJPA 2EX8A 2JC7A 3MZFA 1XGIA 4LV2A 3UE3A 1S6RA 5GLBA 3M6HA 1JWVA 2HP9A 5IHVA 1ES4A 1XP4A 1PZPA 2JCHA 4UA7A 3QNCA 4HESA 3OCLA 3TSGA 1KGEA 3HUNA 3VFHA 2BLSA 4S2JA 4OPRA 4GNUA 1ES3A 5CXWA 1WE4A 1KVLA 1K4FA 4JKTA 3Q81A 2CC1A 5DVAA 3CJMA 5E2FA 1EI5A 1MKIA 3OPHA 4Y0TA 5F82A 3MKEA 4E3MA 3UPPA 3BFEA 3I7JA 1EROA 1QMFA 3C4OA 5CGWA 2Z2LB 3MXSA 4RX3A 3GTCA 4RVAA 2H0YA 2P74A 5EOEA 4QY6A 2JE5A 1ZC2A 3IXDA 1CEGA 2EX6A 4ZTKA 5M19A 1H8ZA 2OSUA 4ZDXA 3N8LA 1NY0A 4GDNA 1ZKJA 3IQAA 4WZ5A 4H8RA 3MZDA 4P85A 3N8SA 1VM1A 2ZQ8A 1K38A 3IXHA 4QD4A 4RYEA 4WYYA 5HX9A 2A3UA 4MLLA 5FDHA 5AQBA 3UDFA 3DWKA 4A5RA 2V1ZA 3PBNA 1TDGA 2Q9NA 1GCEA 4KZ3A 3P98A 2P9VB 3WS0A 1L2SA 3FYZA 2Y2QA 1JVJA 3CG5A 4KZ5A 4X69A 4R3JA 2ZQAA 3EQVA 3M2KA 3ZCZA 5E2GA 3FV7A 2WKHA 3ZNYA 5E2EA 1FR6A 4FD8A 1LLBA 3ZG8B 3PBOA 1EWZA 4EWFA 3IWIA 4EBLA 2XGNA 4WZ5C 2WAEA 4S2LA 3SH9A 3NCKA 4Q8IA 4E6XA 1FQGA 1IKIA 5TFQA 3GMWA 3TG9A 3A3IA 4JXVA 3ZHHA 4OP5A 2HDRA 5DTSA 4U0XA 4JF5A 2OV5A 3LY3A 4N9LA 1YQSA 1FR1A 3EQUA 3O87A 2ZQ9A 3LCEA 1ESUA 3G2ZA 4MBKA 2V2FF 2G2WA 4DKIA 1SCWA 1YLTA 3IWOA 2ZMAA 3ZG0A 1YMXA 5EVIA 4PM6A 3FKVA 4PMAA 5GLAA 3ITAA 1N9BA 1JTGA 1SKFA 1BSGA 1NZOA 1YLZA 3HL9A 4JF6A 4NETA 5HAPA 4R1GA 4R0QA 1IYOA 4FCFA 3WRZA 3HLGA 2HP5A 3JYIA 4LV3A 3HLBA 4M3KA 3BEBA 3DW0A 4FH2A 3NY4A 4K0WA 1FCMA 1SDNA 1YLPA 3IF6A 2XDMA 1GA9A 3ZVWA 2DRWA 4S2NA 1K54A 1PWDA 2ZM2A 2EXBA 1TVFA 4UA9A 1OMEA 5A93A 1L0FA 5DTKA 4OLGA 3VSKA 2H5SA 2GDNA 1PI4A 1W8QA 2WAFA 4QB8A 5EVIC 3UY6A 1G68A 2DNSA 1TEMA 1E4DA 1NXYA 5J8XA 2Z2MB 2WGIA 3IHAA 1ZG4A 5FQJA 2Q9MA 5FI7A 2Y2MA 4EQIA 2HDSA 2ZD8A 1IELA 4E3JA 4DE2A 4EBNA 5FQIA 4IBRA 4MBFA 1IYQA 2A49A 1I2SA 1K6SA 2X71A 4C75A 1JTDA 2Y2KA 1NRFA 3IF6C 5HARA 4S2NC 3VP1A 1K54C 1XA1A 3NDGA 1M6KA 2Y59A 4RA7A 4KG2A 2R9XA 1AXBA 2JBFA 3M6BA 3BYDA 4WMCA 4X56A 5CEBA 3G30A 1XKZA 5E2HA 5EVLA 3ISGA 3LO7A 3Q7VB 1ERQA 1WYBA 4OPQA 3IHBA 4KZAA 2VGJA 1U60A 1CI9A 1LL9A 3SS4A 3S22A 2EXAA 5AQAA 5CTMA 1K57A 2Y2OA 4B88A 4IEDA 4X68A 1MXOA 4DE0A 3BFDA 3HLDA 1L0EA 4MEZA 3WS2A 3VP4A 3IT9A 3HREA 1KDSA 4EUZA 2V20A 5GHXA 2WZZA 4B4ZA 1ALQA 4EBPA 1FCOA 3VP0A 1E3UD 1QMEA 4WM9A 2XD5A 2ZC7A 1MWRA 2PU4A 1DJCA 5JYPA 3UPOA 3A3FA 4MNRA 1PYYA 5KSCA 3GVBA 5FAOA 1I5QA 5FATA 3UDIA 3G2YA 5CGXA 4ID4A 4R4SA 4PM7A 4LCLA 4UA6A 3WWXA 1KE0A 3V39A 4GD8A 1K25A 4IVIA 4E3NA 2WUQA 1PIOA 1K57C 1MBLA 2Y2LA 3HLCA 3HVFA 3NBLA 3UN7A 3ZG5A 3WS4A 3FZCA 4ZBEA 3S4XA 1J9MA 4PPRA 4QU3A 4E6WA 4GOGA 4RX2A 4N92A 4XUXA 3QNBA 3V5MA 5M1AA 1LL5A 5FQMA 4R23A 4DXBA 1HD8A 1JWZA 1XXMA 5CHJA 1H8YA 3OPLA 3ZDJA 3IWQA 2XFTA 4KQQA 3E2KA 4YFMA 3SOIA 1LI0A 2Y91A 1YM1A 2ZC6B 2ZQ7A 3CZDA 1L0DA 3A3DA 4QY5A 2QMIA 4WBGA 3V50A 3IH8A 2UWXA 4BLMA 4BD1A 5M18A 3O3VA 1LI9A 5EECA 2OLVA 4MBHA 2ZJ9A 1YT4A 2Y55A 3BECA 4PM9A 1IKGA 3ZNTA 2I72A 1GHMA 4DDSA 4K91A 5HW3A 1MWTA 2XFSA 4FSFA 4XXRA 3Q82A 2XF3A 1DJAA 2H0TA 3UE0A 1ONHA 2PU2A 4R3BA 1NYMA 3N4IA 3O88A 3GR2A 4ZAMA 2BG1A 5BOHA 3HUOA 3HLEA 2EFXA 1W8YA 5CEDA 2DCFA 5GLCA 5G18A 2ZQDA 1HTZA 2WYXA 4OQIA 3IXBA 4NK3A 4DE3A 5CERA 2XK1A 5U47A 3SH7A 1KGFA 3QHYA 4JXSA 4KZ4A 3PBQA 4WMCD 4OQGA 3VFFA 2PBYA 2XLNA 2ZM0A 3PBRA 3Q1FA 5GLDA 3ZG7B 4PM8A 3B3XA 3N6IA 2XEPA 4UAAA 3VOZA 1RGZA 4KG5A 3VOYA 2ZLYA 2Y2PA 1IYPA 4JLFA 4S2OA 1KE4A 1I2WA 3OC2A 2WK0A 4KZ7A 2WGWA 3BFFA 4DDYA 5EVIB 3LEZA 3PBSA 2Y2NA 2ZC5B 4IVKA 5DF9A 3DWZA 4JXGA 4E3OA 5FQ9A 1K56A 2J9OA 3PAGA 4WZ4A 1FSYA 5FQKA 1KVMA 5GL9A 4R4RA 4WEKA 4DXCA 1NYYA 1MY8A 4S2PA 1L0GA 4C6YA 2IWDA 5KZHA 2J7VA 1XGJA 3N7WA 4IBXA 5L2FA 1RCJA 3BRMA 5FASA 1Q2QA 3IF6B 3SS3A 4S2IA 4DE1A 2HP6A 3FKWA 1PWCA 3A3JA 5CHUA 1N4OA 3G34A 3W4OA 4OLDA 3W8KA 3GRJA 5EPHA 2E8IA 3VSLA 2FFYA 2J8YA 4U0TA 4HBUA 4KQOA 1Q2PA 4ZJ3A 1G6AA 1BT5A 1MPLA 1LHYA 1GHIA 2ZC4B 3MKFA 5EOOA 3HLFA 3RXWA 3HBRA 1BZAA 2QPNA 3HLWA 3OCNA 4N1HA 5F1GA 4GN2A 3G35A 2WKIA 1C3BA 3UE1A 3W4PA 3M2JA 1KE3A 3MZEA 4S2MA 1O7EA 5KMWA 4ZJ1A 3ZVTA 1ZG6A 3MBZA 4LV1A 1JWPA 1CK3A 2R9WA 3MXRA 4Y0UA 3DTMA 1RP5A 3IXGA 1PW8A 1ES5A 3OPPA 4Z9QA 5FI6A 3NI9A 4JXWA 4KZ6A 3OPRA 3UPNA 4F94A 2HDUA 2EX9A 1CEFA 3E2LA 2Y2IA 5HAQA 4B4XA 1W79A 2EFUA 4QJGA 5I94A 5F1FA 3ZGAB 1H5XA 4GB7A 4KQRA 3BFGA 3WS5A 1KGGA 4GZBA 4BL3A 4BL2A 3PAEA 5CRFA 4KZBA 1M40A 5AQ9A 2Y2JA 2ZQCA 2WZXA 1XX2A
chains in the Genus database with same CATH superfamily
1NZUA 3CMZA 3FPWA 2O9AA 3UDXA 2XRNA 1BLHA 2Y79A 4OOMA 4EW7A 4OPZA 4DJ2A 3N8RA 5FL3A 3PXPA 3OBFA 5A91A 1RGYA 4UQIM 1W7FA 2V9AA 4HEFA 1T1CA 1GSWA 3BLMA 4H6JB 4E3IA 3SS5A 3A0SA 3C8CA 3VMAA 4GD6A 4JGOA 5HL6A 2ZBBA 5A92A 2EX2A 4KENB 1V9ZA 3D9YA 4GLQA 4HJ4A 1FIKA 3KYZA 1J3WA 3G32A 1VHMA 2P7JA 4HBTA 3R7WA 3LR3A 4U3TA 2VX8A 5FAQA 3G6OA 1ERMA 1ES2A 2O99A 1E3UA 3NC8A 2B5RA 3LY4A 5GHZA 4CPKA 2RL3A 2W3DA 2WKEA 5FSRA 4P6BA 2WGVA 2HV1A 4P87A 3IBJA 2ZM8A 1NLYA 4E3KA 2V8FA 4KZ8A 2VGKA 1D7EA 5EVEA 1O07A 4PAUA 1WYCA 2EWVA 3T4QA 1DY6A 5HFOA 4BWIA 4ZJ2A 4N9KA 5CTNA 4C3QA 4OH0A 5TGFA 4IUKA 2MJ6A 1FOFA 3G4PA 2X01A 4P0MA 3GQZA 3P09A 2Y4AA 1FCNA 1T1BA 4O7DA 1OTBA 1MKMA 1PZOA 4HQAA 2VK3A 2RCXA 2XQZA 1IYSA 4NXGA 4B9OA 2D01A 2EX8A 3MZFA 5F6AA 3S7QA 3OOVA 2OWHA 1P9RA 5GLBA 3SW1A 1XP4A 1PZPA 3VFHA 4HESA 4ARZB 1K4FA 2PDRA 3LI8A 1ODVA 3LI9A 2M7VA 1MKIA 3OPHA 3BFEA 1ZHHB 1G6OA 3F1NA 4RX3A 5TJJA 2P74A 1CEGA 2EX6A 5M19A 4ZDXA 2JKFA 1ZKJA 4RYEA 2P04A 4MLLA 4A5RA 4WL9A 3PBNA 1TDGA 4KQDA 1G28A 1JVJA 4X69A 3M2KA 4WLAA 2WKHA 3ZNYA 5E2EA 1FR6A 4FD8A 4EQ1A 3IX8A 2KOIA 3IS2B 4PKYG 4E6XA 4I3AA 3GMWA 3CLOA 3A3IA 3TG9A 2HDRA 4U0XA 1N9NA 3O87A 4MDZA 4PM6A 3FKVA 1BSGA 4NETA 4JF6A 2W0NA 3MXQA 3JYIA 1MZUA 4K0WA 1YLPA 3IF6A 2XDMA 1GA9A 2VV6A 3ZVWA 2JKRM 3R4KA 3SZTA 4AFIA 5DTKA 4X25A 3VSKA 2PD8A 5HDDA 5EVIC 2WAFA 3UY6A 5HD3A 1H8MA 2WGIA 3MS6A 5FQJA 2Q9MA 3ICYA 4JGRA 4E3JA 4IBRA 5HARA 1M6KA 5HWVA 2R9XA 1AXBA 3JVUA 4BBUA 3BYDA 1XJ2A 3ISGA 1HLUP 1WYBA 4OPQA 3IHBA 2KDKA 1U60A 5CTMA 3LYXA 4X68A 4IHQA 2PYPA 4MEZA 1JNUA 1T18A 1S67L 3VP4A 1KDSA 4EUZA 2XA7M 4EBPA 4LFUA 4B4ZA 2QWSA 4Y3IA 3VP0A 2ZC7A 1MWRA 2PU4A 1DJCA 5FEFA 5JYPA 3UB5P 4HNBA 3F1OB 3UDIA 5CGXA 4UA6A 4GD8A 4H6JA 1K25A 4E3NA 3NBLA 1K57C 4QU3A 4E6WA 1YSQA 3MQOA 4RX2A 2K7SA 2GJ3A 4DXBA 3OPLA 5FEGA 4KQQA 2XFTA 3LIFA 1L0DA 3A3DA 3LIEA 1YKDA 2UWXA 5M18A 3O3VA 3T4KA 2Q0OA 2V8CA 1EW0A 4MBHA 1YT4A 3ZNTA 1W63Q 2XFSA 4FSFA 5F69A 3VOLA 2XF3A 1DJAA 3RH8B 4Y15A 2VGLM 2W3HA 4LLOB 2DCFA 2OAP1 2ZQDA 3LFVA 2V1AA 4NK3A 4HY8A 3U4LP 5U47A 1KGFA 1YAXA 1OT9A 4KZ4A 5L09A 3PBQA 3ZG7B 2ZM0A 3PBRA 2ACGA 2YKHA 3C2WA 4L9GA 2B02A 2VA0A 2WKRA 1RGZA 5L07A 4S2OA 1KE4A 4GW9A 1I2WA 3OC2A 4CQHA 5EVIB 3KYQA 3LEZA 2ZC5B 1FSYA 4I39A 4DXCA 1NYYA 4DMZA 1RCJA 1Q2QA 2HP6A 1N4OA 3G34A 4OLDA 1MPLA 1GHIA 3HBRA 3HLWA 3OCNA 4R70A 1C3BA 3M2JA 4ARZA 5MC7A 3MBZA 4R3AA 2AVXA 2PR5A 3MXRA 4Y0UA 1PW8A 5FI6A 4F94A 4MN7A 3UB8A 2Y2IA 4B4XA 3ZGAB 4KQRA 3BFGA 1KGGA 5CRFA 1M40A 2Y2JA 5AVFA 4UA9A 2O9BA 3MQ0A 5EVID 3A3EA 1XA7A 4EUVA 2QZ6A 5HAIA 3IH9A 4X53A 5HPIA 4FUWA 3C7VA 3F1PB 1ESIA 1NJ4A 1IEMA 2ZC3B 4WF0A 5AQ7A 1PW1A 3IS2A 2HPBA 3V3RA 5GHYA 2VV8A 4HOIA 1PWGA 4HIAA 4GDBA 1YLJA 4P6ZS 5D3OA 3MQQA 5TR7A 4LENA 4OQHA 2M7UA 1BUEA 3ZFZA 3FG8A 2PR6A 1BTLA 1HVBA 3CAXA 2G7UA 4I3JA 1GSVA 1GSXA 2XR0A 1HZOA 4HP4A 3WRTA 4Y5FA 1YLYA 2HDQA 5DF7A 3LGOA 4WELA 5CHMA 4HH3A 2WADA 1TD5A 3T4OA 3PTEA 2Y2GA 3BFCA 1MWSA 1P9WA 3OZHA 1NLZA 1VQQA 4JPMA 4LV0A 3MFDA 3NECA 4Q0HA 2L1MA 2XD1A 4L0LA 4BQMA 1Y54A 3C7UA 3GDIA 3V3SA 3ZG9B 4BJPA 2JC7A 1XGIA 4LV2A 1PFLA 1S6RA 3TW8A 1JWVA 2HP9A 1N9OA 3QNCA 3TSGA 4LRYC 2BLSA 4S2JA 3F1OA 4GNUA 2PBDP 4JKTA 3LICA 4F3LB 2B95A 3MKEA 4E3MA 1EROA 2Z2LB 5A8BA 3UMDA 5EOEA 1CQAA 4QY6A 3IXDA 1H8ZA 2OSUA 2ZMFA 1NY0A 4GDNA 5G4YA 4H8RA 5DKLA 3MZDA 1F5MA 4WYYA 4QD4A 2A3UA 5AQBA 2V1ZA 1S4RA 2HJEA 3WS0A 1L2SA 2ZQAA 3EQVA 1CJFA 3ZG8B 4Q8IA 1IKIA 5TFQA 3ZHHA 5DTSA 2W3EA 2OV5A 3LY3A 4MN5A 1LSXA 4MBKA 3CPTB 3FPVA 2QJ7A 3ZG0A 5EVIA 2INWA 3ITAA 3PYPA 5HAPA 3HL9A 4R1GA 1IYOA 1LL8A 3HLGA 1D1JA 3BEBA 4FH2A 3NOUC 3NY4A 1FCMA 5HWTA 2DRWA 2EXBA 1TVFA 4L9FA 4CLCD 1OMEA 2GNXA 1L0FA 3CWFA 4QB8A 1TF1A 2DNSA 3MJQA 2ZL1B 2Z2MB 3IHAA 2Y2MA 5J7EA 5I5LA 3VE3A 2ZD8A 1IELA 1OTAA 5AJGA 2VJWA 1IYQA 2L0WA 4EERA 1I2SA 1JTDA 2K2NA 4S2NC 3VP1A 1XA1A 3NDGA 3VE4A 4KG2A 4IUHA 2JBFA 1XKZA 5E2HA 5FDSA 3LO7A 3Q7VB 1CI9A 5KIZA 2EXAA 2D02A 1K57A 4B88A 1LSWA 4DE0A 3HLDA 1L0EA 2HF6A 3L7HA 3IT9A 4LRXC 3T1SA 1ALQA 4LRZE 1QMEA 4WM9A 5HZHA 3F1PA 3EGDC 3G2YA 1OTIA 3NJAA 4R4SA 4LCLA 4NXEA 1PIOA 3UN7A 5C5KA 3WS4A 4ZBEA 3UMEA 4GOGA 4XUXA 1UWNX 3JVVA 1HD8A 1JWZA 1XFQA 5CHJA 1OPXA 3IX3A 5J4EA 4QY5A 4WBGA 2E8JA 3ZYTA 3IH8A 2J80A 2JKRI 2OLVA 2R78A 2J3WA 2Z6DA 4PM9A 1IKGA 1GHMA 2DMWA 4DDSA 5HW3A 1XFNA 2H0TA 1ONHA 2PU2A 2V0WA 3O88A 3O5YA 5J3WA 2BG1A 5BOHA 3NHQA 3HUOA 2EFXA 1W8YA 2PHYA 2JHEA 3IXBA 2EWWA 4X1LA 3MMHA 4JXSA 4WMCD 4OQGA 2XLNA 3Q1FA 4PM8A 4G3WA 4MCWA 3VOZA 2QJ5A 2Y2PA 1IYPA 2ZOHA 4JLFA 3RTYA 4KZ7A 2HZ5A 4DDYA 4IVKA 4JXGA 4NXFA 3PAGA 4WZ4A 3K3CA 3LEQA 4WEKA 4C6YA 1MY8A 4I5SA 5KZHA 2J7VA 3N7WA 4Y17A 4Y13A 3H7WB 3VV4A 3BRMA 4S2IA 4DE1A 1A0KA 2WKQA 3FKWA 3UB6A 3DTEA 2UV0E 3W8KA 5EPHA 2E8IA 4HBUA 1Q2PA 1BT5A 3KX0X 3MKFA 1BZAA 4GN2A 3UE1A 5KMWA 5F68A 1ZG6A 2R9WA 3B42A 4F3LA 4Z9QA 3NI9A 2V0UA 2EX9A 3E2LA 2Z6CA 4KUOA 5HAQA 1ACFA 4GB7A 3WS5A 4GZBA 4BL2A 3PAEA 5A90A 1GHPA 5L10A 5TBMB 3D4FA 4HH2A 4YINA 2Y8HA 3Q7ZA 5CX7A 4X1MA 5L8MA 2VEAA 1DJBA 4EV4A 3C38A 3E4OA 2XH9A 3E4PA 3MSHA 4RQ9A 1K56D 1YMSA 4QPRA 3IF5A 3QP5A 1DP6A 3TOIA 3RXXA 2VGLS 1TS7A 3CPTA 1BULA 1SHVA 1Z09A 1MWUA 3D72A 3D3OA 1DP8A 4WEJA 4LCMA 4BENA 2X02A 3T4LA 5DF8A 3C4PA 5F83A 1W5DA 1FSWA 5DTTA 4YNRA 4KUKA 4O0PA 3KO6A 1KDWA 4JF4A 1K55C 4OOLA 1TS6A 1BLPA 5DKKA 4WN5A 1GA0A 5CECA 3P01A 4NKPA 5FA7A 2FFFB 3W4QA 3NIAA 4UHUA 2FH5A 2H28A 2ZL1A 4OVDA 2W1RA 4II7A 4GKUA 4KG6A 4DRTA 4S2KA 3P7NA 1LSVA 3G31A 1TDLA 4KZ9A 3T50A 5FAPA 3NDEA 3BJNA 4PM5A 3HUMA 2JKTI 3BM6A 4OP8A 3Q7VA 3KSIA 2VZWA 5DFXA 3PHYA 1NWZA 3UNWA 4I38A 4OONA 4E3LA 5DJTA 1STZA 5IT5A 3BLSA 3KYEA 1K6RA 4OOYA 1ONGA 2C5WB 3UE3A 2JCHA 4UA7A 3LUQA 1KGEA 5DFYA 2PT7A 1ES3A 4L9EA 5CXWA 2CC1A 5DVAA 3CJMA 4R38A 1S66L 5HD5A 3T1RA 4DN0A 5F82A 4Y2FA 3UPPA 4EEUA 1QMFA 3C4OA 5CGWA 1D06A 3MXSA 2H0YA 4ZTKA 1ZC2A 3N8LA 2W27A 3IQAA 3N8SA 3LR4A 1VM1A 2ZQ8A 1K38A 3IXHA 4GS9B 3TE8A 4D60A 5FDHA 3DWKA 5HDCA 1OTEA 4CLCC 1GCEA 1H0MA 3P98A 2P9VB 2M1CA 2Y2QA 4KZ5A 3EEAA 1EWZA 4GCZA 3TRCA 4WZ5C 2WAEA 4S2LA 1VB6A 3NCKA 3FC7A 5HSQA 3LIBA 4OP5A 1NRJA 1AWIA 4N9LA 1YQSA 3S7NA 5IS1A 1ESUA 1SCWA 1YLTA 1XJ6A 4P6ZM 5DJUA 1YMXA 2KX6A 4PMAA 5GLAA 1YLZA 4R0QA 1FILA 3WRZA 3IX4A 1P97A 3BW6A 2HP5A 3EOIA 4HHDA 4M3KA 3DW0A 4HI4A 3H7WA 5HPFA 2BASA 3V67A 4S2NA 5IU1A 2OWJA 1OJ5A 5A93A 1T19A 2QHKA 3ULFA 1PI4A 1W8QA 1G68A 3LIAA 1NXYA 5J8XA 1VETB 2PRFA 1ZG4A 3CUEA 3HJKA 1ZTUA 4DE2A 4EBNA 5FQIA 2A24A 2X71A 1NRFA 1K54C 2Y59A 3M6BA 4X56A 3E4QA 5G4ZA 1LL9A 1UGUA 2ZMVA 4YOFA 2Y2OA 1F9IA 1TS8A 2FZ0A 1VEUB 3HREA 5GHXA 4UQIS 1PNEA 5TBMA 4O8GA 2J3TD 3A3FA 4MNRA 1PYYA 5FATA 3BY9A 4ID4A 3WWXA 3V39A 4CLCB 4IVIA 1L3LA 3S4XA 3QP2A 4N92A 3QNBA 3V5MA 1XXMA 1H8YA 3NOTC 3ZDJA 3IWQA 3E2KA 4YFMA 3SOIA 4NG2A 2Y91A 1YM1A 2ZC6B 2ZQ7A 3CI6A 4HP9A 3CZDA 3V50A 2QMIA 1LI9A 2ZJ9A 4BBTA 2Y55A 2NUTC 1YPRA 3BY8A 4K91A 4XXRA 3UE0A 3C30A 2ZOIA 3GR2A 4G3KA 4ZAMA 1CF0A 4EESA 5CEDA 1IOUA 5G18A 3KSHA 1HTZA 3QP1A 4DE3A 5EM0A 5CERA 2XK1A 3S7PA 3SH7A 3QHYA 4XT2B 5GLDA 4EEPA 3B3XA 5HWWA 4UAAA 4JGPA 4KG5A 1XJ4A 3JPUA 4FOFA 4MN6A 4ETXA 3BFFA 3LR0A 3PBSA 5DF9A 3DWZA 5FQ9A 2K31A 2LB9A 1F98A 5FQKA 1KVMA 4R6LA 4NXBA 5GL9A 4Q0IA 2I9VA 1XGJA 4IBXA 5L2FA 3SS3A 4DJ3A 3QP8A 3A3JA 5CHUA 3GRJA 3KSGA 3VSLA 4KQOA 2ZC4B 4CLCE 5EOOA 3HLFA 2QPNA 4N1HA 5F1GA 3G35A 2WKIA 3W4PA 4S2MA 2OOLA 3CUEC 4ZJ1A 3ZVTA 1JWPA 2QKPA 1RP5A 1ES5A 3HCYA 3BQ8A 3OPRA 1F2KA 2HDUA 4K08A 5LBRA 1W79A 2EFUA 4QJGA 5I94A 1N9LA 1H5XA 3ZQ5A 1Y28A 4KZBA 4GS9A 3EGXC 1XX2A 2VLGA 3GSGA 2IA2A 2P9VA 4Y0OA 4D2OA 4X6TA 3Q07A 4ME4A 1BLSA 3PR6A 5F5YA 2VKSA 4BD0A 3T12B 4OQ0A 4PKYA 1PRQA 2IWCA 4XUZA 3GV9A 1S0WA 4K0XA 4CJNA 3DTIA 3ITBA 1YSPA 2VV7A 1K0KA 4DF6A 1K55A 5EM1A 2G2UA 4EETB 1T1AA 4OKPA 3SH8A 3LR5A 4X55A 5HDSA 2H10A 4N1XA 5JYOA 3NOPC 3AGFA 5K5BA 3T1QB 5EV0A 1YLWA 3QP4A 5HL1A 1DRMA 2V1BA 4QWOA 1Z6FA 3FWLA 3T4TA 3AGEA 5FI2A 1TS0A 3CITA 3PBTA 3RJUA 3VP2A 1W63M 4GHIB 5E43A 5FQQA 5EUAA 3UO9A 2IWBA 3AGDA 1VETA 1XPBA 2J9PA 1H3QA 2C6WB 3WS1A 2O0YA 1BLCA 3VP3A 2Y2HA 3CHWP 4Y7PA 3C5AA 2QYBA 2PD7A 4JBFA 1PI5A 3L9KA 4QHCA 2WGWB 1KOUA 3O86A 1K4EA 4FH4A 1SDEA 3S1YA 4EU0A 3E0YA 4OPYA 5KSHA 1CI8A 5EE8A 2OLUA 2W1TB 2A24B 3HJIA 1BYWA 5CGSA 1E25A 2XA7S 4BMWA 1VEUA 2PAVP 3MF0A 3H82B 1SKOB 3M6HA 5IHVA 2GX5A 1ES4A 4HJ3A 2HJ9C 3OCLA 3HUNA 4OPRA 1WE4A 1KVLA 3Q81A 4CLCA 2P08A 3K2NA 5E2FA 1DP9A 1EI5A 4HJ6A 4Y0TA 3I7JA 2A2LA 3UB9A 4UEYA 3GTCA 4RVAA 4Z1WA 2JE5A 1UWPX 4WZ5A 2JKGA 4P85A 5HX9A 3UDFA 2BTFP 2Q9NA 4YWZA 4NEED 4KZ3A 3FYZA 3CG5A 3MR0A 4GJ4A 4R3JA 3ZCZA 5E2GA 3FV7A 3EWKA 3S7OA 1LLBA 3PBOA 4EWFA 3IWIA 4EBLA 2XGNA 3SH9A 1FQGA 4JXVA 4XT2A 3DAVA 4JF5A 2XSSA 1FR1A 2NUPC 3EQUA 2ZQ9A 3LCEA 3G2ZA 1MC0A 2V2FF 2G2WA 2WKPA 4DKIA 3IWOA 3H9WA 2ZMAA 3W2ZA 2W3GA 1N9BA 1JTGA 1SKFA 1NZOA 3R7WB 5EFWA 4FCFA 4FTXA 3MFXA 4LV3A 3HLBA 1SDNA 4ZRRA 2J3TC 1S4SA 1K54A 1PWDA 2ZM2A 3UB7A 3BQAA 2KLIA 4ETZA 4OLGA 4M4XA 2H5SA 2GDNA 2OAQ1 1TEMA 1E4DA 1XJ3A 3K3DA 5FI7A 4EQIA 2HDSA 4I3IA 4MBFA 2A49A 1K6SA 4C75A 3T4JA 3IF6C 2Y2KA 3OLOA 1P0ZA 2YKFA 4RA7A 3QP6A 4WMCA 5CEBA 3G30A 4LGWA 5EVLA 1S1YA 1ERQA 4KZAA 2VGJA 4IJGA 3SS4A 3S22A 4ESPA 5AQAA 4IEDA 1MXOA 3BFDA 1G5UA 3WS2A 3A0RA 2V20A 2WZZA 4WUJA 1FCOA 1E3UD 3A0VA 2B18A 2XD5A 2JN7A 2W3FA 3UPOA 5KSCA 3GVBA 5FAOA 1I5QA 4PM7A 1KE0A 2HGVA 2JKTM 2WUQA 3HVFA 1MBLA 2Y2LA 3HLCA 4MMNA 3ZG5A 3BWLA 2O9CA 3FZCA 1J9MA 4PPRA 3DBAA 3T1XA 3F1NB 3B33A 5M1AA 1LL5A 5FQMA 4R23A 2CMNA 1LI0A 2XROA 2L4RA 4BLMA 4BD1A 3TJZC 5EECA 3BECA 2I72A 3T4SA 4LPZA 1MWTA 3Q82A 3B47A 1X0OA 4R3BA 1NYMA 3N4IA 4Q0JA 2PYRA 3IBRA 3HLEA 3UE6A 1LT0A 4G3VA 5GLCA 4GHIA 1OT6A 2WYXA 4OQIA 4B93A 3VFFA 2PBYA 3N6IA 2XEPA 3VOYA 2ZLYA 3EEHA 1OTDA 3LIDA 1SZVA 2WK0A 2GZAA 2WGWA 3DTKA 2Y2NA 2EA9A 4E3OA 1K56A 2J9OA 1WA9A 3GECA 4JGQA 4R4RA 1V9YA 4S2PA 1L0GA 5AVEA 2IWDA 3NULA 1IFQA 5FASA 3IF6B 2W1TA 1PWCA 3W4OA 3KSFA 2FFYA 2J8YA 2LB5A 4U0TA 1Y4OA 4ZJ3A 1G6AA 3H82A 1LHYA 1SKOA 4O01A 3RXWA 3RFBA 1OJGA 4BBVA 4EXOA 1KE3A 3MZEA 1O7EA 3U2AA 4PHTA 4E04A 3E98A 4LV1A 1CK3A 3DTMA 3IXGA 3OPPA 4JXWA 4KZ6A 3UPNA 1S1ZA 1CEFA 5F1FA 4BL3A 5AQ9A 2ZQCA 2WZXA
chains in the Genus database with same CATH topology
1NZUA 3CMZA 3GSGA 5EVID 3UDXA 1GHPA 3A3EA 1BLHA 4OOMA 1XA7A 4OPZA 2P9VA 4Y0OA 4D2OA 4X6TA 3Q07A 3N8RA 2QZ6A 5HAIA 5A91A 3IH9A 4X53A 1BLSA 1RGYA 3D4FA 1W7FA 3C7VA 4YINA 4BD0A 3Q7ZA 4OQ0A 1ESIA 1NJ4A 1IEMA 4HEFA 2ZC3B 5A90A 5AQ7A 1DJBA 1PW1A 2IWCA 3BLMA 4XUZA 4EV4A 3GV9A 4E3IA 3SS5A 2XH9A 2HPBA 1S0WA 4K0XA 3V3RA 3VMAA 1K56D 5GHYA 1YMSA 4CJNA 3IF5A 3ITBA 4GD6A 1PWGA 4DF6A 4GDBA 1K55A 3TOIA 5A92A 3RXXA 1YLJA 2G2UA 5D3OA 1BULA 1SHVA 2EX2A 4KENB 4OKPA 4X55A 5TR7A 3SH8A 2H10A 1MWUA 4LENA 4OQHA 4N1XA 5JYOA 1BUEA 4WEJA 3AGFA 3G32A 3ZFZA 4LCMA 4BENA 2X02A 1YLWA 4HBTA 5DF8A 3C4PA 5F83A 1W5DA 4U3TA 5HL1A 1HVBA 1BTLA 5FAQA 1ERMA 1ES2A 1E3UA 1Z6FA 3FWLA 1FSWA 3NC8A 5DTTA 2B5RA 3AGEA 3LY4A 5FI2A 5GHZA 4CPKA 3PBTA 1KDWA 4JF4A 1K55C 2RL3A 2WKEA 2XR0A 4OOLA 5FSRA 1BLPA 4P6BA 3RJUA 1HZOA 2WGVA 3VP2A 1GA0A 5CECA 4P87A 3WRTA 5E43A 1YLYA 5FA7A 5FQQA 2HDQA 2FFFB 2ZM8A 3W4QA 5DF7A 4WELA 5EUAA 3NIAA 5CHMA 4E3KA 3UO9A 4UHUA 2IWBA 3AGDA 2WADA 4OVDA 4GKUA 4KZ8A 1XPBA 2J9PA 2VGKA 3PTEA 2C6WB 3WS1A 2Y2GA 4KG6A 3BFCA 1MWSA 1BLCA 1O07A 2Y2HA 3VP3A 4DRTA 4S2KA 4Y7PA 3C5AA 1WYCA 1DY6A 3G31A 5HFOA 1TDLA 3OZHA 4KZ9A 4JBFA 1VQQA 1PI5A 4ZJ2A 4QHCA 2WGWB 5FAPA 4JPMA 4N9KA 3NDEA 4LV0A 3O86A 4OH0A 5CTNA 1K4EA 3MFDA 5TGFA 4C3QA 4FH4A 1SDEA 3S1YA 1FOFA 3G4PA 2X01A 4P0MA 4PM5A 3HUMA 3BM6A 3GQZA 3P09A 4OP8A 4OPYA 5KSHA 3Q7VA 1CI8A 2Y4AA 2XD1A 4L0LA 1FCNA 5EE8A 3UNWA 4BQMA 2OLUA 1Y54A 4O7DA 4OONA 4E3LA 3C7UA 3V3SA 1PZOA 3ZG9B 3BLSA 5CGSA 2RCXA 2XQZA 1IYSA 1E25A 1K6RA 4OOYA 1ONGA 2C5WB 4BJPA 2EX8A 2JC7A 3MZFA 1XGIA 4LV2A 3UE3A 1S6RA 5GLBA 3M6HA 1JWVA 2HP9A 5IHVA 1ES4A 1XP4A 1PZPA 2JCHA 4UA7A 3QNCA 4HESA 3OCLA 3TSGA 1KGEA 3HUNA 3VFHA 2BLSA 4S2JA 4OPRA 4GNUA 1ES3A 5CXWA 1WE4A 1KVLA 1K4FA 4JKTA 3Q81A 2CC1A 5DVAA 3CJMA 5E2FA 1EI5A 1MKIA 3OPHA 4Y0TA 5F82A 3MKEA 4E3MA 3UPPA 3BFEA 3I7JA 1EROA 1QMFA 3C4OA 5CGWA 2Z2LB 3MXSA 4RX3A 3GTCA 4RVAA 2H0YA 2P74A 5EOEA 4QY6A 2JE5A 1ZC2A 3IXDA 1CEGA 2EX6A 4ZTKA 5M19A 1H8ZA 2OSUA 4ZDXA 3N8LA 1NY0A 4GDNA 1ZKJA 3IQAA 4WZ5A 4H8RA 3MZDA 4P85A 3N8SA 1VM1A 2ZQ8A 1K38A 3IXHA 4QD4A 4RYEA 4WYYA 5HX9A 2A3UA 4MLLA 5FDHA 5AQBA 3UDFA 3DWKA 4A5RA 2V1ZA 3PBNA 1TDGA 2Q9NA 1GCEA 4KZ3A 3P98A 2P9VB 3WS0A 1L2SA 3FYZA 2Y2QA 1JVJA 3CG5A 4KZ5A 4X69A 4R3JA 2ZQAA 3EQVA 3M2KA 3ZCZA 5E2GA 3FV7A 2WKHA 3ZNYA 5E2EA 1FR6A 4FD8A 1LLBA 3ZG8B 3PBOA 1EWZA 4EWFA 3IWIA 4EBLA 2XGNA 4WZ5C 2WAEA 4S2LA 3SH9A 3NCKA 4Q8IA 4E6XA 1FQGA 1IKIA 5TFQA 3GMWA 3TG9A 3A3IA 4JXVA 3ZHHA 4OP5A 2HDRA 5DTSA 4U0XA 4JF5A 2OV5A 3LY3A 4N9LA 1YQSA 1FR1A 3EQUA 3O87A 2ZQ9A 3LCEA 1ESUA 3G2ZA 4MBKA 2V2FF 2G2WA 4DKIA 1SCWA 1YLTA 3IWOA 2ZMAA 3ZG0A 1YMXA 5EVIA 4PM6A 3FKVA 4PMAA 5GLAA 3ITAA 1N9BA 1JTGA 1SKFA 1BSGA 1NZOA 1YLZA 3HL9A 4JF6A 4NETA 5HAPA 4R1GA 4R0QA 1IYOA 4FCFA 3WRZA 3HLGA 2HP5A 3JYIA 4LV3A 3HLBA 4M3KA 3BEBA 3DW0A 4FH2A 3NY4A 4K0WA 1FCMA 1SDNA 1YLPA 3IF6A 2XDMA 1GA9A 3ZVWA 2DRWA 4S2NA 1K54A 1PWDA 2ZM2A 2EXBA 1TVFA 4UA9A 1OMEA 5A93A 1L0FA 5DTKA 4OLGA 3VSKA 2H5SA 2GDNA 1PI4A 1W8QA 2WAFA 4QB8A 5EVIC 3UY6A 1G68A 2DNSA 1TEMA 1E4DA 1NXYA 5J8XA 2Z2MB 2WGIA 3IHAA 1ZG4A 5FQJA 2Q9MA 5FI7A 2Y2MA 4EQIA 2HDSA 2ZD8A 1IELA 4E3JA 4DE2A 4EBNA 5FQIA 4IBRA 4MBFA 1IYQA 2A49A 1I2SA 1K6SA 2X71A 4C75A 1JTDA 2Y2KA 1NRFA 3IF6C 5HARA 4S2NC 3VP1A 1K54C 1XA1A 3NDGA 1M6KA 2Y59A 4RA7A 4KG2A 2R9XA 1AXBA 2JBFA 3M6BA 3BYDA 4WMCA 4X56A 5CEBA 3G30A 1XKZA 5E2HA 5EVLA 3ISGA 3LO7A 3Q7VB 1ERQA 1WYBA 4OPQA 3IHBA 4KZAA 2VGJA 1U60A 1CI9A 1LL9A 3SS4A 3S22A 2EXAA 5AQAA 5CTMA 1K57A 2Y2OA 4B88A 4IEDA 4X68A 1MXOA 4DE0A 3BFDA 3HLDA 1L0EA 4MEZA 3WS2A 3VP4A 3IT9A 3HREA 1KDSA 4EUZA 2V20A 5GHXA 2WZZA 4B4ZA 1ALQA 4EBPA 1FCOA 3VP0A 1E3UD 1QMEA 4WM9A 2XD5A 2ZC7A 1MWRA 2PU4A 1DJCA 5JYPA 3UPOA 3A3FA 4MNRA 1PYYA 5KSCA 3GVBA 5FAOA 1I5QA 5FATA 3UDIA 3G2YA 5CGXA 4ID4A 4R4SA 4PM7A 4LCLA 4UA6A 3WWXA 1KE0A 3V39A 4GD8A 1K25A 4IVIA 4E3NA 2WUQA 1PIOA 1K57C 1MBLA 2Y2LA 3HLCA 3HVFA 3NBLA 3UN7A 3ZG5A 3WS4A 3FZCA 4ZBEA 3S4XA 1J9MA 4PPRA 4QU3A 4E6WA 4GOGA 4RX2A 4N92A 4XUXA 3QNBA 3V5MA 5M1AA 1LL5A 5FQMA 4R23A 4DXBA 1HD8A 1JWZA 1XXMA 5CHJA 1H8YA 3OPLA 3ZDJA 3IWQA 2XFTA 4KQQA 3E2KA 4YFMA 3SOIA 1LI0A 2Y91A 1YM1A 2ZC6B 2ZQ7A 3CZDA 1L0DA 3A3DA 4QY5A 2QMIA 4WBGA 3V50A 3IH8A 2UWXA 4BLMA 4BD1A 5M18A 3O3VA 1LI9A 5EECA 2OLVA 4MBHA 2ZJ9A 1YT4A 2Y55A 3BECA 4PM9A 1IKGA 3ZNTA 2I72A 1GHMA 4DDSA 4K91A 5HW3A 1MWTA 2XFSA 4FSFA 4XXRA 3Q82A 2XF3A 1DJAA 2H0TA 3UE0A 1ONHA 2PU2A 4R3BA 1NYMA 3N4IA 3O88A 3GR2A 4ZAMA 2BG1A 5BOHA 3HUOA 3HLEA 2EFXA 1W8YA 5CEDA 2DCFA 5GLCA 5G18A 2ZQDA 1HTZA 2WYXA 4OQIA 3IXBA 4NK3A 4DE3A 5CERA 2XK1A 5U47A 3SH7A 1KGFA 3QHYA 4JXSA 4KZ4A 3PBQA 4WMCD 4OQGA 3VFFA 2PBYA 2XLNA 2ZM0A 3PBRA 3Q1FA 5GLDA 3ZG7B 4PM8A 3B3XA 3N6IA 2XEPA 4UAAA 3VOZA 1RGZA 4KG5A 3VOYA 2ZLYA 2Y2PA 1IYPA 4JLFA 4S2OA 1KE4A 1I2WA 3OC2A 2WK0A 4KZ7A 2WGWA 3BFFA 4DDYA 5EVIB 3LEZA 3PBSA 2Y2NA 2ZC5B 4IVKA 5DF9A 3DWZA 4JXGA 4E3OA 5FQ9A 1K56A 2J9OA 3PAGA 4WZ4A 1FSYA 5FQKA 1KVMA 5GL9A 4R4RA 4WEKA 4DXCA 1NYYA 1MY8A 4S2PA 1L0GA 4C6YA 2IWDA 5KZHA 2J7VA 1XGJA 3N7WA 4IBXA 5L2FA 1RCJA 3BRMA 5FASA 1Q2QA 3IF6B 3SS3A 4S2IA 4DE1A 2HP6A 3FKWA 1PWCA 3A3JA 5CHUA 1N4OA 3G34A 3W4OA 4OLDA 3W8KA 3GRJA 5EPHA 2E8IA 3VSLA 2FFYA 2J8YA 4U0TA 4HBUA 4KQOA 1Q2PA 4ZJ3A 1G6AA 1BT5A 1MPLA 1LHYA 1GHIA 2ZC4B 3MKFA 5EOOA 3HLFA 3RXWA 3HBRA 1BZAA 2QPNA 3HLWA 3OCNA 4N1HA 5F1GA 4GN2A 3G35A 2WKIA 1C3BA 3UE1A 3W4PA 3M2JA 1KE3A 3MZEA 4S2MA 1O7EA 5KMWA 4ZJ1A 3ZVTA 1ZG6A 3MBZA 4LV1A 1JWPA 1CK3A 2R9WA 3MXRA 4Y0UA 3DTMA 1RP5A 3IXGA 1PW8A 1ES5A 3OPPA 4Z9QA 5FI6A 3NI9A 4JXWA 4KZ6A 3OPRA 3UPNA 4F94A 2HDUA 2EX9A 1CEFA 3E2LA 2Y2IA 5HAQA 4B4XA 1W79A 2EFUA 4QJGA 5I94A 5F1FA 3ZGAB 1H5XA 4GB7A 4KQRA 3BFGA 3WS5A 1KGGA 4GZBA 4BL3A 4BL2A 3PAEA 5CRFA 4KZBA 1M40A 5AQ9A 2Y2JA 2ZQCA 2WZXA 1XX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZU A;  3CMZ A;  3GSG A;  5EVI D;  3UDX A;  1GHP A;  3A3E A;  1BLH A;  4OOM A;  1XA7 A;  4OPZ A;  2P9V A;  4Y0O A;  4D2O A;  4X6T A;  3Q07 A;  3N8R A;  2QZ6 A;  5HAI A;  5A91 A;  3IH9 A;  4X53 A;  1BLS A;  1RGY A;  3D4F A;  1W7F A;  3C7V A;  4YIN A;  4BD0 A;  3Q7Z A;  4OQ0 A;  1ESI A;  1NJ4 A;  1IEM A;  4HEF A;  2ZC3 B;  5A90 A;  5AQ7 A;  1DJB A;  1PW1 A;  2IWC A;  3BLM A;  4XUZ A;  4EV4 A;  3GV9 A;  4E3I A;  3SS5 A;  2XH9 A;  2HPB A;  1S0W A;  4K0X A;  3V3R A;  3VMA A;  1K56 D;  5GHY A;  1YMS A;  4CJN A;  3IF5 A;  3ITB A;  4GD6 A;  1PWG A;  4DF6 A;  4GDB A;  1K55 A;  3TOI A;  5A92 A;  3RXX A;  1YLJ A;  2G2U A;  5D3O A;  1BUL A;  1SHV A;  2EX2 A;  4KEN B;  4OKP A;  4X55 A;  5TR7 A;  3SH8 A;  2H10 A;  1MWU A;  4LEN A;  4OQH A;  4N1X A;  5JYO A;  1BUE A;  4WEJ A;  3AGF A;  3G32 A;  3ZFZ A;  4LCM A;  4BEN A;  2X02 A;  1YLW A;  4HBT A;  5DF8 A;  3C4P A;  5F83 A;  1W5D A;  4U3T A;  5HL1 A;  1HVB A;  1BTL A;  5FAQ A;  1ERM A;  1ES2 A;  1E3U A;  1Z6F A;  3FWL A;  1FSW A;  3NC8 A;  5DTT A;  2B5R A;  3AGE A;  3LY4 A;  5FI2 A;  5GHZ A;  4CPK A;  3PBT A;  1KDW A;  4JF4 A;  1K55 C;  2RL3 A;  2WKE A;  2XR0 A;  4OOL A;  5FSR A;  1BLP A;  4P6B A;  3RJU A;  1HZO A;  2WGV A;  3VP2 A;  1GA0 A;  5CEC A;  4P87 A;  3WRT A;  5E43 A;  1YLY A;  5FA7 A;  5FQQ A;  2HDQ A;  2FFF B;  2ZM8 A;  3W4Q A;  5DF7 A;  4WEL A;  5EUA A;  3NIA A;  5CHM A;  4E3K A;  3UO9 A;  4UHU A;  2IWB A;  3AGD A;  2WAD A;  4OVD A;  4GKU A;  4KZ8 A;  1XPB A;  2J9P A;  2VGK A;  3PTE A;  2C6W B;  3WS1 A;  2Y2G A;  4KG6 A;  3BFC A;  1MWS A;  1BLC A;  1O07 A;  2Y2H A;  3VP3 A;  4DRT A;  4S2K A;  4Y7P A;  3C5A A;  1WYC A;  1DY6 A;  3G31 A;  5HFO A;  1TDL A;  3OZH A;  4KZ9 A;  4JBF A;  1VQQ A;  1PI5 A;  4ZJ2 A;  4QHC A;  2WGW B;  5FAP A;  4JPM A;  4N9K A;  3NDE A;  4LV0 A;  3O86 A;  4OH0 A;  5CTN A;  1K4E A;  3MFD A;  5TGF A;  4C3Q A;  4FH4 A;  1SDE A;  3S1Y A;  1FOF A;  3G4P A;  2X01 A;  4P0M A;  4PM5 A;  3HUM A;  3BM6 A;  3GQZ A;  3P09 A;  4OP8 A;  4OPY A;  5KSH A;  3Q7V A;  1CI8 A;  2Y4A A;  2XD1 A;  4L0L A;  1FCN A;  5EE8 A;  3UNW A;  4BQM A;  2OLU A;  1Y54 A;  4O7D A;  4OON A;  4E3L A;  3C7U A;  3V3S A;  1PZO A;  3ZG9 B;  3BLS A;  5CGS A;  2RCX A;  2XQZ A;  1IYS A;  1E25 A;  1K6R A;  4OOY A;  1ONG A;  2C5W B;  4BJP A;  2EX8 A;  2JC7 A;  3MZF A;  1XGI A;  4LV2 A;  3UE3 A;  1S6R A;  5GLB A;  3M6H A;  1JWV A;  2HP9 A;  5IHV A;  1ES4 A;  1XP4 A;  1PZP A;  2JCH A;  4UA7 A;  3QNC A;  4HES A;  3OCL A;  3TSG A;  1KGE A;  3HUN A;  3VFH A;  2BLS A;  4S2J A;  4OPR A;  4GNU A;  1ES3 A;  5CXW A;  1WE4 A;  1KVL A;  1K4F A;  4JKT A;  3Q81 A;  2CC1 A;  5DVA A;  3CJM A;  5E2F A;  1EI5 A;  1MKI A;  3OPH A;  4Y0T A;  5F82 A;  3MKE A;  4E3M A;  3UPP A;  3BFE A;  3I7J A;  1ERO A;  1QMF A;  3C4O A;  5CGW A;  2Z2L B;  3MXS A;  4RX3 A;  3GTC A;  4RVA A;  2H0Y A;  2P74 A;  5EOE A;  4QY6 A;  2JE5 A;  1ZC2 A;  3IXD A;  1CEG A;  2EX6 A;  4ZTK A;  5M19 A;  1H8Z A;  2OSU A;  4ZDX A;  3N8L A;  1NY0 A;  4GDN A;  1ZKJ A;  3IQA A;  4WZ5 A;  4H8R A;  3MZD A;  4P85 A;  3N8S A;  1VM1 A;  2ZQ8 A;  1K38 A;  3IXH A;  4QD4 A;  4RYE A;  4WYY A;  5HX9 A;  2A3U A;  4MLL A;  5FDH A;  5AQB A;  3UDF A;  3DWK A;  4A5R A;  2V1Z A;  3PBN A;  1TDG A;  2Q9N A;  1GCE A;  4KZ3 A;  3P98 A;  2P9V B;  3WS0 A;  1L2S A;  3FYZ A;  2Y2Q A;  1JVJ A;  3CG5 A;  4KZ5 A;  4X69 A;  4R3J A;  2ZQA A;  3EQV A;  3M2K A;  3ZCZ A;  5E2G A;  3FV7 A;  2WKH A;  3ZNY A;  5E2E A;  1FR6 A;  4FD8 A;  1LLB A;  3ZG8 B;  3PBO A;  1EWZ A;  4EWF A;  3IWI A;  4EBL A;  2XGN A;  4WZ5 C;  2WAE A;  4S2L A;  3SH9 A;  3NCK A;  4Q8I A;  4E6X A;  1FQG A;  1IKI A;  5TFQ A;  3GMW A;  3TG9 A;  3A3I A;  4JXV A;  3ZHH A;  4OP5 A;  2HDR A;  5DTS A;  4U0X A;  4JF5 A;  2OV5 A;  3LY3 A;  4N9L A;  1YQS A;  1FR1 A;  3EQU A;  3O87 A;  2ZQ9 A;  3LCE A;  1ESU A;  3G2Z A;  4MBK A;  2V2F F;  2G2W A;  4DKI A;  1SCW A;  1YLT A;  3IWO A;  2ZMA A;  3ZG0 A;  1YMX A;  5EVI A;  4PM6 A;  3FKV A;  4PMA A;  5GLA A;  3ITA A;  1N9B A;  1JTG A;  1SKF A;  1BSG A;  1NZO A;  1YLZ A;  3HL9 A;  4JF6 A;  4NET A;  5HAP A;  4R1G A;  4R0Q A;  1IYO A;  4FCF A;  3WRZ A;  3HLG A;  2HP5 A;  3JYI A;  4LV3 A;  3HLB A;  4M3K A;  3BEB A;  3DW0 A;  4FH2 A;  3NY4 A;  4K0W A;  1FCM A;  1SDN A;  1YLP A;  3IF6 A;  2XDM A;  1GA9 A;  3ZVW A;  2DRW A;  4S2N A;  1K54 A;  1PWD A;  2ZM2 A;  2EXB A;  1TVF A;  4UA9 A;  1OME A;  5A93 A;  1L0F A;  5DTK A;  4OLG A;  3VSK A;  2H5S A;  2GDN A;  1PI4 A;  1W8Q A;  2WAF A;  4QB8 A;  5EVI C;  3UY6 A;  1G68 A;  2DNS A;  1TEM A;  1E4D A;  1NXY A;  5J8X A;  2Z2M B;  2WGI A;  3IHA A;  1ZG4 A;  5FQJ A;  2Q9M A;  5FI7 A;  2Y2M A;  4EQI A;  2HDS A;  2ZD8 A;  1IEL A;  4E3J A;  4DE2 A;  4EBN A;  5FQI A;  4IBR A;  4MBF A;  1IYQ A;  2A49 A;  1I2S A;  1K6S A;  2X71 A;  4C75 A;  1JTD A;  2Y2K A;  1NRF A;  3IF6 C;  5HAR A;  4S2N C;  3VP1 A;  1K54 C;  1XA1 A;  3NDG A;  1M6K A;  2Y59 A;  4RA7 A;  4KG2 A;  2R9X A;  1AXB A;  2JBF A;  3M6B A;  3BYD A;  4WMC A;  4X56 A;  5CEB A;  3G30 A;  1XKZ A;  5E2H A;  5EVL A;  3ISG A;  3LO7 A;  3Q7V B;  1ERQ A;  1WYB A;  4OPQ A;  3IHB A;  4KZA A;  2VGJ A;  1U60 A;  1CI9 A;  1LL9 A;  3SS4 A;  3S22 A;  2EXA A;  5AQA A;  5CTM A;  1K57 A;  2Y2O A;  4B88 A;  4IED A;  4X68 A;  1MXO A;  4DE0 A;  3BFD A;  3HLD A;  1L0E A;  4MEZ A;  3WS2 A;  3VP4 A;  3IT9 A;  3HRE A;  1KDS A;  4EUZ A;  2V20 A;  5GHX A;  2WZZ A;  4B4Z A;  1ALQ A;  4EBP A;  1FCO A;  3VP0 A;  1E3U D;  1QME A;  4WM9 A;  2XD5 A;  2ZC7 A;  1MWR A;  2PU4 A;  1DJC A;  5JYP A;  3UPO A;  3A3F A;  4MNR A;  1PYY A;  5KSC A;  3GVB A;  5FAO A;  1I5Q A;  5FAT A;  3UDI A;  3G2Y A;  5CGX A;  4ID4 A;  4R4S A;  4PM7 A;  4LCL A;  4UA6 A;  3WWX A;  1KE0 A;  3V39 A;  4GD8 A;  1K25 A;  4IVI A;  4E3N A;  2WUQ A;  1PIO A;  1K57 C;  1MBL A;  2Y2L A;  3HLC A;  3HVF A;  3NBL A;  3UN7 A;  3ZG5 A;  3WS4 A;  3FZC A;  4ZBE A;  3S4X A;  1J9M A;  4PPR A;  4QU3 A;  4E6W A;  4GOG A;  4RX2 A;  4N92 A;  4XUX A;  3QNB A;  3V5M A;  5M1A A;  1LL5 A;  5FQM A;  4R23 A;  4DXB A;  1HD8 A;  1JWZ A;  1XXM A;  5CHJ A;  1H8Y A;  3OPL A;  3ZDJ A;  3IWQ A;  2XFT A;  4KQQ A;  3E2K A;  4YFM A;  3SOI A;  1LI0 A;  2Y91 A;  1YM1 A;  2ZC6 B;  2ZQ7 A;  3CZD A;  1L0D A;  3A3D A;  4QY5 A;  2QMI A;  4WBG A;  3V50 A;  3IH8 A;  2UWX A;  4BLM A;  4BD1 A;  5M18 A;  3O3V A;  1LI9 A;  5EEC A;  2OLV A;  4MBH A;  2ZJ9 A;  1YT4 A;  2Y55 A;  3BEC A;  4PM9 A;  1IKG A;  3ZNT A;  2I72 A;  1GHM A;  4DDS A;  4K91 A;  5HW3 A;  1MWT A;  2XFS A;  4FSF A;  4XXR A;  3Q82 A;  2XF3 A;  1DJA A;  2H0T A;  3UE0 A;  1ONH A;  2PU2 A;  4R3B A;  1NYM A;  3N4I A;  3O88 A;  3GR2 A;  4ZAM A;  2BG1 A;  5BOH A;  3HUO A;  3HLE A;  2EFX A;  1W8Y A;  5CED A;  2DCF A;  5GLC A;  5G18 A;  2ZQD A;  1HTZ A;  2WYX A;  4OQI A;  3IXB A;  4NK3 A;  4DE3 A;  5CER A;  2XK1 A;  5U47 A;  3SH7 A;  1KGF A;  3QHY A;  4JXS A;  4KZ4 A;  3PBQ A;  4WMC D;  4OQG A;  3VFF A;  2PBY A;  2XLN A;  2ZM0 A;  3PBR A;  3Q1F A;  5GLD A;  3ZG7 B;  4PM8 A;  3B3X A;  3N6I A;  2XEP A;  4UAA A;  3VOZ A;  1RGZ A;  4KG5 A;  3VOY A;  2ZLY A;  2Y2P A;  1IYP A;  4JLF A;  4S2O A;  1KE4 A;  1I2W A;  3OC2 A;  2WK0 A;  4KZ7 A;  2WGW A;  3BFF A;  4DDY A;  5EVI B;  3LEZ A;  3PBS A;  2Y2N A;  2ZC5 B;  4IVK A;  5DF9 A;  3DWZ A;  4JXG A;  4E3O A;  5FQ9 A;  1K56 A;  2J9O A;  3PAG A;  4WZ4 A;  1FSY A;  5FQK A;  1KVM A;  5GL9 A;  4R4R A;  4WEK A;  4DXC A;  1NYY A;  1MY8 A;  4S2P A;  1L0G A;  4C6Y A;  2IWD A;  5KZH A;  2J7V A;  1XGJ A;  3N7W A;  4IBX A;  5L2F A;  1RCJ A;  3BRM A;  5FAS A;  1Q2Q A;  3IF6 B;  3SS3 A;  4S2I A;  4DE1 A;  2HP6 A;  3FKW A;  1PWC A;  3A3J A;  5CHU A;  1N4O A;  3G34 A;  3W4O A;  4OLD A;  3W8K A;  3GRJ A;  5EPH A;  2E8I A;  3VSL A;  2FFY A;  2J8Y A;  4U0T A;  4HBU A;  4KQO A;  1Q2P A;  4ZJ3 A;  1G6A A;  1BT5 A;  1MPL A;  1LHY A;  1GHI A;  2ZC4 B;  3MKF A;  5EOO A;  3HLF A;  3RXW A;  3HBR A;  1BZA A;  2QPN A;  3HLW A;  3OCN A;  4N1H A;  5F1G A;  4GN2 A;  3G35 A;  2WKI A;  1C3B A;  3UE1 A;  3W4P A;  3M2J A;  1KE3 A;  3MZE A;  4S2M A;  1O7E A;  5KMW A;  4ZJ1 A;  3ZVT A;  1ZG6 A;  3MBZ A;  4LV1 A;  1JWP A;  1CK3 A;  2R9W A;  3MXR A;  4Y0U A;  3DTM A;  1RP5 A;  3IXG A;  1PW8 A;  1ES5 A;  3OPP A;  4Z9Q A;  5FI6 A;  3NI9 A;  4JXW A;  4KZ6 A;  3OPR A;  3UPN A;  4F94 A;  2HDU A;  2EX9 A;  1CEF A;  3E2L A;  2Y2I A;  5HAQ A;  4B4X A;  1W79 A;  2EFU A;  4QJG A;  5I94 A;  5F1F A;  3ZGA B;  1H5X A;  4GB7 A;  4KQR A;  3BFG A;  3WS5 A;  1KGG A;  4GZB A;  4BL3 A;  4BL2 A;  3PAE A;  5CRF A;  4KZB A;  1M40 A;  5AQ9 A;  2Y2J A;  2ZQC A;  2WZX A;  1XX2 A; 
#chains in the Genus database with same CATH topology
 1NZU A;  3CMZ A;  3FPW A;  2O9A A;  3UDX A;  2XRN A;  1BLH A;  2Y79 A;  4OOM A;  4EW7 A;  4OPZ A;  4DJ2 A;  3N8R A;  5FL3 A;  3PXP A;  3OBF A;  5A91 A;  1RGY A;  4UQI M;  1W7F A;  2V9A A;  4HEF A;  1T1C A;  1GSW A;  3BLM A;  4H6J B;  4E3I A;  3SS5 A;  3A0S A;  3C8C A;  3VMA A;  4GD6 A;  4JGO A;  5HL6 A;  2ZBB A;  5A92 A;  2EX2 A;  4KEN B;  1V9Z A;  3D9Y A;  4GLQ A;  4HJ4 A;  1FIK A;  3KYZ A;  1J3W A;  3G32 A;  1VHM A;  2P7J A;  4HBT A;  3R7W A;  3LR3 A;  4U3T A;  2VX8 A;  5FAQ A;  3G6O A;  1ERM A;  1ES2 A;  2O99 A;  1E3U A;  3NC8 A;  2B5R A;  3LY4 A;  5GHZ A;  4CPK A;  2RL3 A;  2W3D A;  2WKE A;  5FSR A;  4P6B A;  2WGV A;  2HV1 A;  4P87 A;  3IBJ A;  2ZM8 A;  1NLY A;  4E3K A;  2V8F A;  4KZ8 A;  2VGK A;  1D7E A;  5EVE A;  1O07 A;  4PAU A;  1WYC A;  2EWV A;  3T4Q A;  1DY6 A;  5HFO A;  4BWI A;  4ZJ2 A;  4N9K A;  5CTN A;  4C3Q A;  4OH0 A;  5TGF A;  4IUK A;  2MJ6 A;  1FOF A;  3G4P A;  2X01 A;  4P0M A;  3GQZ A;  3P09 A;  2Y4A A;  1FCN A;  1T1B A;  4O7D A;  1OTB A;  1MKM A;  1PZO A;  4HQA A;  2VK3 A;  2RCX A;  2XQZ A;  1IYS A;  4NXG A;  4B9O A;  2D01 A;  2EX8 A;  3MZF A;  5F6A A;  3S7Q A;  3OOV A;  2OWH A;  1P9R A;  5GLB A;  3SW1 A;  1XP4 A;  1PZP A;  3VFH A;  4HES A;  4ARZ B;  1K4F A;  2PDR A;  3LI8 A;  1ODV A;  3LI9 A;  2M7V A;  1MKI A;  3OPH A;  3BFE A;  1ZHH B;  1G6O A;  3F1N A;  4RX3 A;  5TJJ A;  2P74 A;  1CEG A;  2EX6 A;  5M19 A;  4ZDX A;  2JKF A;  1ZKJ A;  4RYE A;  2P04 A;  4MLL A;  4A5R A;  4WL9 A;  3PBN A;  1TDG A;  4KQD A;  1G28 A;  1JVJ A;  4X69 A;  3M2K A;  4WLA A;  2WKH A;  3ZNY A;  5E2E A;  1FR6 A;  4FD8 A;  4EQ1 A;  3IX8 A;  2KOI A;  3IS2 B;  4PKY G;  4E6X A;  4I3A A;  3GMW A;  3CLO A;  3A3I A;  3TG9 A;  2HDR A;  4U0X A;  1N9N A;  3O87 A;  4MDZ A;  4PM6 A;  3FKV A;  1BSG A;  4NET A;  4JF6 A;  2W0N A;  3MXQ A;  3JYI A;  1MZU A;  4K0W A;  1YLP A;  3IF6 A;  2XDM A;  1GA9 A;  2VV6 A;  3ZVW A;  2JKR M;  3R4K A;  3SZT A;  4AFI A;  5DTK A;  4X25 A;  3VSK A;  2PD8 A;  5HDD A;  5EVI C;  2WAF A;  3UY6 A;  5HD3 A;  1H8M A;  2WGI A;  3MS6 A;  5FQJ A;  2Q9M A;  3ICY A;  4JGR A;  4E3J A;  4IBR A;  5HAR A;  1M6K A;  5HWV A;  2R9X A;  1AXB A;  3JVU A;  4BBU A;  3BYD A;  1XJ2 A;  3ISG A;  1HLU P;  1WYB A;  4OPQ A;  3IHB A;  2KDK A;  1U60 A;  5CTM A;  3LYX A;  4X68 A;  4IHQ A;  2PYP A;  4MEZ A;  1JNU A;  1T18 A;  1S67 L;  3VP4 A;  1KDS A;  4EUZ A;  2XA7 M;  4EBP A;  4LFU A;  4B4Z A;  2QWS A;  4Y3I A;  3VP0 A;  2ZC7 A;  1MWR A;  2PU4 A;  1DJC A;  5FEF A;  5JYP A;  3UB5 P;  4HNB A;  3F1O B;  3UDI A;  5CGX A;  4UA6 A;  4GD8 A;  4H6J A;  1K25 A;  4E3N A;  3NBL A;  1K57 C;  4QU3 A;  4E6W A;  1YSQ A;  3MQO A;  4RX2 A;  2K7S A;  2GJ3 A;  4DXB A;  3OPL A;  5FEG A;  4KQQ A;  2XFT A;  3LIF A;  1L0D A;  3A3D A;  3LIE A;  1YKD A;  2UWX A;  5M18 A;  3O3V A;  3T4K A;  2Q0O A;  2V8C A;  1EW0 A;  4MBH A;  1YT4 A;  3ZNT A;  1W63 Q;  2XFS A;  4FSF A;  5F69 A;  3VOL A;  2XF3 A;  1DJA A;  3RH8 B;  4Y15 A;  2VGL M;  2W3H A;  4LLO B;  2DCF A;  2OAP 1;  2ZQD A;  3LFV A;  2V1A A;  4NK3 A;  4HY8 A;  3U4L P;  5U47 A;  1KGF A;  1YAX A;  1OT9 A;  4KZ4 A;  5L09 A;  3PBQ A;  3ZG7 B;  2ZM0 A;  3PBR A;  2ACG A;  2YKH A;  3C2W A;  4L9G A;  2B02 A;  2VA0 A;  2WKR A;  1RGZ A;  5L07 A;  4S2O A;  1KE4 A;  4GW9 A;  1I2W A;  3OC2 A;  4CQH A;  5EVI B;  3KYQ A;  3LEZ A;  2ZC5 B;  1FSY A;  4I39 A;  4DXC A;  1NYY A;  4DMZ A;  1RCJ A;  1Q2Q A;  2HP6 A;  1N4O A;  3G34 A;  4OLD A;  1MPL A;  1GHI A;  3HBR A;  3HLW A;  3OCN A;  4R70 A;  1C3B A;  3M2J A;  4ARZ A;  5MC7 A;  3MBZ A;  4R3A A;  2AVX A;  2PR5 A;  3MXR A;  4Y0U A;  1PW8 A;  5FI6 A;  4F94 A;  4MN7 A;  3UB8 A;  2Y2I A;  4B4X A;  3ZGA B;  4KQR A;  3BFG A;  1KGG A;  5CRF A;  1M40 A;  2Y2J A;  5AVF A;  4UA9 A;  2O9B A;  3MQ0 A;  5EVI D;  3A3E A;  1XA7 A;  4EUV A;  2QZ6 A;  5HAI A;  3IH9 A;  4X53 A;  5HPI A;  4FUW A;  3C7V A;  3F1P B;  1ESI A;  1NJ4 A;  1IEM A;  2ZC3 B;  4WF0 A;  5AQ7 A;  1PW1 A;  3IS2 A;  2HPB A;  3V3R A;  5GHY A;  2VV8 A;  4HOI A;  1PWG A;  4HIA A;  4GDB A;  1YLJ A;  4P6Z S;  5D3O A;  3MQQ A;  5TR7 A;  4LEN A;  4OQH A;  2M7U A;  1BUE A;  3ZFZ A;  3FG8 A;  2PR6 A;  1BTL A;  1HVB A;  3CAX A;  2G7U A;  4I3J A;  1GSV A;  1GSX A;  2XR0 A;  1HZO A;  4HP4 A;  3WRT A;  4Y5F A;  1YLY A;  2HDQ A;  5DF7 A;  3LGO A;  4WEL A;  5CHM A;  4HH3 A;  2WAD A;  1TD5 A;  3T4O A;  3PTE A;  2Y2G A;  3BFC A;  1MWS A;  1P9W A;  3OZH A;  1NLZ A;  1VQQ A;  4JPM A;  4LV0 A;  3MFD A;  3NEC A;  4Q0H A;  2L1M A;  2XD1 A;  4L0L A;  4BQM A;  1Y54 A;  3C7U A;  3GDI A;  3V3S A;  3ZG9 B;  4BJP A;  2JC7 A;  1XGI A;  4LV2 A;  1PFL A;  1S6R A;  3TW8 A;  1JWV A;  2HP9 A;  1N9O A;  3QNC A;  3TSG A;  4LRY C;  2BLS A;  4S2J A;  3F1O A;  4GNU A;  2PBD P;  4JKT A;  3LIC A;  4F3L B;  2B95 A;  3MKE A;  4E3M A;  1ERO A;  2Z2L B;  5A8B A;  3UMD A;  5EOE A;  1CQA A;  4QY6 A;  3IXD A;  1H8Z A;  2OSU A;  2ZMF A;  1NY0 A;  4GDN A;  5G4Y A;  4H8R A;  5DKL A;  3MZD A;  1F5M A;  4WYY A;  4QD4 A;  2A3U A;  5AQB A;  2V1Z A;  1S4R A;  2HJE A;  3WS0 A;  1L2S A;  2ZQA A;  3EQV A;  1CJF A;  3ZG8 B;  4Q8I A;  1IKI A;  5TFQ A;  3ZHH A;  5DTS A;  2W3E A;  2OV5 A;  3LY3 A;  4MN5 A;  1LSX A;  4MBK A;  3CPT B;  3FPV A;  2QJ7 A;  3ZG0 A;  5EVI A;  2INW A;  3ITA A;  3PYP A;  5HAP A;  3HL9 A;  4R1G A;  1IYO A;  1LL8 A;  3HLG A;  1D1J A;  3BEB A;  4FH2 A;  3NOU C;  3NY4 A;  1FCM A;  5HWT A;  2DRW A;  2EXB A;  1TVF A;  4L9F A;  4CLC D;  1OME A;  2GNX A;  1L0F A;  3CWF A;  4QB8 A;  1TF1 A;  2DNS A;  3MJQ A;  2ZL1 B;  2Z2M B;  3IHA A;  2Y2M A;  5J7E A;  5I5L A;  3VE3 A;  2ZD8 A;  1IEL A;  1OTA A;  5AJG A;  2VJW A;  1IYQ A;  2L0W A;  4EER A;  1I2S A;  1JTD A;  2K2N A;  4S2N C;  3VP1 A;  1XA1 A;  3NDG A;  3VE4 A;  4KG2 A;  4IUH A;  2JBF A;  1XKZ A;  5E2H A;  5FDS A;  3LO7 A;  3Q7V B;  1CI9 A;  5KIZ A;  2EXA A;  2D02 A;  1K57 A;  4B88 A;  1LSW A;  4DE0 A;  3HLD A;  1L0E A;  2HF6 A;  3L7H A;  3IT9 A;  4LRX C;  3T1S A;  1ALQ A;  4LRZ E;  1QME A;  4WM9 A;  5HZH A;  3F1P A;  3EGD C;  3G2Y A;  1OTI A;  3NJA A;  4R4S A;  4LCL A;  4NXE A;  1PIO A;  3UN7 A;  5C5K A;  3WS4 A;  4ZBE A;  3UME A;  4GOG A;  4XUX A;  1UWN X;  3JVV A;  1HD8 A;  1JWZ A;  1XFQ A;  5CHJ A;  1OPX A;  3IX3 A;  5J4E A;  4QY5 A;  4WBG A;  2E8J A;  3ZYT A;  3IH8 A;  2J80 A;  2JKR I;  2OLV A;  2R78 A;  2J3W A;  2Z6D A;  4PM9 A;  1IKG A;  1GHM A;  2DMW A;  4DDS A;  5HW3 A;  1XFN A;  2H0T A;  1ONH A;  2PU2 A;  2V0W A;  3O88 A;  3O5Y A;  5J3W A;  2BG1 A;  5BOH A;  3NHQ A;  3HUO A;  2EFX A;  1W8Y A;  2PHY A;  2JHE A;  3IXB A;  2EWW A;  4X1L A;  3MMH A;  4JXS A;  4WMC D;  4OQG A;  2XLN A;  3Q1F A;  4PM8 A;  4G3W A;  4MCW A;  3VOZ A;  2QJ5 A;  2Y2P A;  1IYP A;  2ZOH A;  4JLF A;  3RTY A;  4KZ7 A;  2HZ5 A;  4DDY A;  4IVK A;  4JXG A;  4NXF A;  3PAG A;  4WZ4 A;  3K3C A;  3LEQ A;  4WEK A;  4C6Y A;  1MY8 A;  4I5S A;  5KZH A;  2J7V A;  3N7W A;  4Y17 A;  4Y13 A;  3H7W B;  3VV4 A;  3BRM A;  4S2I A;  4DE1 A;  1A0K A;  2WKQ A;  3FKW A;  3UB6 A;  3DTE A;  2UV0 E;  3W8K A;  5EPH A;  2E8I A;  4HBU A;  1Q2P A;  1BT5 A;  3KX0 X;  3MKF A;  1BZA A;  4GN2 A;  3UE1 A;  5KMW A;  5F68 A;  1ZG6 A;  2R9W A;  3B42 A;  4F3L A;  4Z9Q A;  3NI9 A;  2V0U A;  2EX9 A;  3E2L A;  2Z6C A;  4KUO A;  5HAQ A;  1ACF A;  4GB7 A;  3WS5 A;  4GZB A;  4BL2 A;  3PAE A;  5A90 A;  1GHP A;  5L10 A;  5TBM B;  3D4F A;  4HH2 A;  4YIN A;  2Y8H A;  3Q7Z A;  5CX7 A;  4X1M A;  5L8M A;  2VEA A;  1DJB A;  4EV4 A;  3C38 A;  3E4O A;  2XH9 A;  3E4P A;  3MSH A;  4RQ9 A;  1K56 D;  1YMS A;  4QPR A;  3IF5 A;  3QP5 A;  1DP6 A;  3TOI A;  3RXX A;  2VGL S;  1TS7 A;  3CPT A;  1BUL A;  1SHV A;  1Z09 A;  1MWU A;  3D72 A;  3D3O A;  1DP8 A;  4WEJ A;  4LCM A;  4BEN A;  2X02 A;  3T4L A;  5DF8 A;  3C4P A;  5F83 A;  1W5D A;  1FSW A;  5DTT A;  4YNR A;  4KUK A;  4O0P A;  3KO6 A;  1KDW A;  4JF4 A;  1K55 C;  4OOL A;  1TS6 A;  1BLP A;  5DKK A;  4WN5 A;  1GA0 A;  5CEC A;  3P01 A;  4NKP A;  5FA7 A;  2FFF B;  3W4Q A;  3NIA A;  4UHU A;  2FH5 A;  2H28 A;  2ZL1 A;  4OVD A;  2W1R A;  4II7 A;  4GKU A;  4KG6 A;  4DRT A;  4S2K A;  3P7N A;  1LSV A;  3G31 A;  1TDL A;  4KZ9 A;  3T50 A;  5FAP A;  3NDE A;  3BJN A;  4PM5 A;  3HUM A;  2JKT I;  3BM6 A;  4OP8 A;  3Q7V A;  3KSI A;  2VZW A;  5DFX A;  3PHY A;  1NWZ A;  3UNW A;  4I38 A;  4OON A;  4E3L A;  5DJT A;  1STZ A;  5IT5 A;  3BLS A;  3KYE A;  1K6R A;  4OOY A;  1ONG A;  2C5W B;  3UE3 A;  2JCH A;  4UA7 A;  3LUQ A;  1KGE A;  5DFY A;  2PT7 A;  1ES3 A;  4L9E A;  5CXW A;  2CC1 A;  5DVA A;  3CJM A;  4R38 A;  1S66 L;  5HD5 A;  3T1R A;  4DN0 A;  5F82 A;  4Y2F A;  3UPP A;  4EEU A;  1QMF A;  3C4O A;  5CGW A;  1D06 A;  3MXS A;  2H0Y A;  4ZTK A;  1ZC2 A;  3N8L A;  2W27 A;  3IQA A;  3N8S A;  3LR4 A;  1VM1 A;  2ZQ8 A;  1K38 A;  3IXH A;  4GS9 B;  3TE8 A;  4D60 A;  5FDH A;  3DWK A;  5HDC A;  1OTE A;  4CLC C;  1GCE A;  1H0M A;  3P98 A;  2P9V B;  2M1C A;  2Y2Q A;  4KZ5 A;  3EEA A;  1EWZ A;  4GCZ A;  3TRC A;  4WZ5 C;  2WAE A;  4S2L A;  1VB6 A;  3NCK A;  3FC7 A;  5HSQ A;  3LIB A;  4OP5 A;  1NRJ A;  1AWI A;  4N9L A;  1YQS A;  3S7N A;  5IS1 A;  1ESU A;  1SCW A;  1YLT A;  1XJ6 A;  4P6Z M;  5DJU A;  1YMX A;  2KX6 A;  4PMA A;  5GLA A;  1YLZ A;  4R0Q A;  1FIL A;  3WRZ A;  3IX4 A;  1P97 A;  3BW6 A;  2HP5 A;  3EOI A;  4HHD A;  4M3K A;  3DW0 A;  4HI4 A;  3H7W A;  5HPF A;  2BAS A;  3V67 A;  4S2N A;  5IU1 A;  2OWJ A;  1OJ5 A;  5A93 A;  1T19 A;  2QHK A;  3ULF A;  1PI4 A;  1W8Q A;  1G68 A;  3LIA A;  1NXY A;  5J8X A;  1VET B;  2PRF A;  1ZG4 A;  3CUE A;  3HJK A;  1ZTU A;  4DE2 A;  4EBN A;  5FQI A;  2A24 A;  2X71 A;  1NRF A;  1K54 C;  2Y59 A;  3M6B A;  4X56 A;  3E4Q A;  5G4Z A;  1LL9 A;  1UGU A;  2ZMV A;  4YOF A;  2Y2O A;  1F9I A;  1TS8 A;  2FZ0 A;  1VEU B;  3HRE A;  5GHX A;  4UQI S;  1PNE A;  5TBM A;  4O8G A;  2J3T D;  3A3F A;  4MNR A;  1PYY A;  5FAT A;  3BY9 A;  4ID4 A;  3WWX A;  3V39 A;  4CLC B;  4IVI A;  1L3L A;  3S4X A;  3QP2 A;  4N92 A;  3QNB A;  3V5M A;  1XXM A;  1H8Y A;  3NOT C;  3ZDJ A;  3IWQ A;  3E2K A;  4YFM A;  3SOI A;  4NG2 A;  2Y91 A;  1YM1 A;  2ZC6 B;  2ZQ7 A;  3CI6 A;  4HP9 A;  3CZD A;  3V50 A;  2QMI A;  1LI9 A;  2ZJ9 A;  4BBT A;  2Y55 A;  2NUT C;  1YPR A;  3BY8 A;  4K91 A;  4XXR A;  3UE0 A;  3C30 A;  2ZOI A;  3GR2 A;  4G3K A;  4ZAM A;  1CF0 A;  4EES A;  5CED A;  1IOU A;  5G18 A;  3KSH A;  1HTZ A;  3QP1 A;  4DE3 A;  5EM0 A;  5CER A;  2XK1 A;  3S7P A;  3SH7 A;  3QHY A;  4XT2 B;  5GLD A;  4EEP A;  3B3X A;  5HWW A;  4UAA A;  4JGP A;  4KG5 A;  1XJ4 A;  3JPU A;  4FOF A;  4MN6 A;  4ETX A;  3BFF A;  3LR0 A;  3PBS A;  5DF9 A;  3DWZ A;  5FQ9 A;  2K31 A;  2LB9 A;  1F98 A;  5FQK A;  1KVM A;  4R6L A;  4NXB A;  5GL9 A;  4Q0I A;  2I9V A;  1XGJ A;  4IBX A;  5L2F A;  3SS3 A;  4DJ3 A;  3QP8 A;  3A3J A;  5CHU A;  3GRJ A;  3KSG A;  3VSL A;  4KQO A;  2ZC4 B;  4CLC E;  5EOO A;  3HLF A;  2QPN A;  4N1H A;  5F1G A;  3G35 A;  2WKI A;  3W4P A;  4S2M A;  2OOL A;  3CUE C;  4ZJ1 A;  3ZVT A;  1JWP A;  2QKP A;  1RP5 A;  1ES5 A;  3HCY A;  3BQ8 A;  3OPR A;  1F2K A;  2HDU A;  4K08 A;  5LBR A;  1W79 A;  2EFU A;  4QJG A;  5I94 A;  1N9L A;  1H5X A;  3ZQ5 A;  1Y28 A;  4KZB A;  4GS9 A;  3EGX C;  1XX2 A;  2VLG A;  3GSG A;  2IA2 A;  2P9V A;  4Y0O A;  4D2O A;  4X6T A;  3Q07 A;  4ME4 A;  1BLS A;  3PR6 A;  5F5Y A;  2VKS A;  4BD0 A;  3T12 B;  4OQ0 A;  4PKY A;  1PRQ A;  2IWC A;  4XUZ A;  3GV9 A;  1S0W A;  4K0X A;  4CJN A;  3DTI A;  3ITB A;  1YSP A;  2VV7 A;  1K0K A;  4DF6 A;  1K55 A;  5EM1 A;  2G2U A;  4EET B;  1T1A A;  4OKP A;  3SH8 A;  3LR5 A;  4X55 A;  5HDS A;  2H10 A;  4N1X A;  5JYO A;  3NOP C;  3AGF A;  5K5B A;  3T1Q B;  5EV0 A;  1YLW A;  3QP4 A;  5HL1 A;  1DRM A;  2V1B A;  4QWO A;  1Z6F A;  3FWL A;  3T4T A;  3AGE A;  5FI2 A;  1TS0 A;  3CIT A;  3PBT A;  3RJU A;  3VP2 A;  1W63 M;  4GHI B;  5E43 A;  5FQQ A;  5EUA A;  3UO9 A;  2IWB A;  3AGD A;  1VET A;  1XPB A;  2J9P A;  1H3Q A;  2C6W B;  3WS1 A;  2O0Y A;  1BLC A;  3VP3 A;  2Y2H A;  3CHW P;  4Y7P A;  3C5A A;  2QYB A;  2PD7 A;  4JBF A;  1PI5 A;  3L9K A;  4QHC A;  2WGW B;  1KOU A;  3O86 A;  1K4E A;  4FH4 A;  1SDE A;  3S1Y A;  4EU0 A;  3E0Y A;  4OPY A;  5KSH A;  1CI8 A;  5EE8 A;  2OLU A;  2W1T B;  2A24 B;  3HJI A;  1BYW A;  5CGS A;  1E25 A;  2XA7 S;  4BMW A;  1VEU A;  2PAV P;  3MF0 A;  3H82 B;  1SKO B;  3M6H A;  5IHV A;  2GX5 A;  1ES4 A;  4HJ3 A;  2HJ9 C;  3OCL A;  3HUN A;  4OPR A;  1WE4 A;  1KVL A;  3Q81 A;  4CLC A;  2P08 A;  3K2N A;  5E2F A;  1DP9 A;  1EI5 A;  4HJ6 A;  4Y0T A;  3I7J A;  2A2L A;  3UB9 A;  4UEY A;  3GTC A;  4RVA A;  4Z1W A;  2JE5 A;  1UWP X;  4WZ5 A;  2JKG A;  4P85 A;  5HX9 A;  3UDF A;  2BTF P;  2Q9N A;  4YWZ A;  4NEE D;  4KZ3 A;  3FYZ A;  3CG5 A;  3MR0 A;  4GJ4 A;  4R3J A;  3ZCZ A;  5E2G A;  3FV7 A;  3EWK A;  3S7O A;  1LLB A;  3PBO A;  4EWF A;  3IWI A;  4EBL A;  2XGN A;  3SH9 A;  1FQG A;  4JXV A;  4XT2 A;  3DAV A;  4JF5 A;  2XSS A;  1FR1 A;  2NUP C;  3EQU A;  2ZQ9 A;  3LCE A;  3G2Z A;  1MC0 A;  2V2F F;  2G2W A;  2WKP A;  4DKI A;  3IWO A;  3H9W A;  2ZMA A;  3W2Z A;  2W3G A;  1N9B A;  1JTG A;  1SKF A;  1NZO A;  3R7W B;  5EFW A;  4FCF A;  4FTX A;  3MFX A;  4LV3 A;  3HLB A;  1SDN A;  4ZRR A;  2J3T C;  1S4S A;  1K54 A;  1PWD A;  2ZM2 A;  3UB7 A;  3BQA A;  2KLI A;  4ETZ A;  4OLG A;  4M4X A;  2H5S A;  2GDN A;  2OAQ 1;  1TEM A;  1E4D A;  1XJ3 A;  3K3D A;  5FI7 A;  4EQI A;  2HDS A;  4I3I A;  4MBF A;  2A49 A;  1K6S A;  4C75 A;  3T4J A;  3IF6 C;  2Y2K A;  3OLO A;  1P0Z A;  2YKF A;  4RA7 A;  3QP6 A;  4WMC A;  5CEB A;  3G30 A;  4LGW A;  5EVL A;  1S1Y A;  1ERQ A;  4KZA A;  2VGJ A;  4IJG A;  3SS4 A;  3S22 A;  4ESP A;  5AQA A;  4IED A;  1MXO A;  3BFD A;  1G5U A;  3WS2 A;  3A0R A;  2V20 A;  2WZZ A;  4WUJ A;  1FCO A;  1E3U D;  3A0V A;  2B18 A;  2XD5 A;  2JN7 A;  2W3F A;  3UPO A;  5KSC A;  3GVB A;  5FAO A;  1I5Q A;  4PM7 A;  1KE0 A;  2HGV A;  2JKT M;  2WUQ A;  3HVF A;  1MBL A;  2Y2L A;  3HLC A;  4MMN A;  3ZG5 A;  3BWL A;  2O9C A;  3FZC A;  1J9M A;  4PPR A;  3DBA A;  3T1X A;  3F1N B;  3B33 A;  5M1A A;  1LL5 A;  5FQM A;  4R23 A;  2CMN A;  1LI0 A;  2XRO A;  2L4R A;  4BLM A;  4BD1 A;  3TJZ C;  5EEC A;  3BEC A;  2I72 A;  3T4S A;  4LPZ A;  1MWT A;  3Q82 A;  3B47 A;  1X0O A;  4R3B A;  1NYM A;  3N4I A;  4Q0J A;  2PYR A;  3IBR A;  3HLE A;  3UE6 A;  1LT0 A;  4G3V A;  5GLC A;  4GHI A;  1OT6 A;  2WYX A;  4OQI A;  4B93 A;  3VFF A;  2PBY A;  3N6I A;  2XEP A;  3VOY A;  2ZLY A;  3EEH A;  1OTD A;  3LID A;  1SZV A;  2WK0 A;  2GZA A;  2WGW A;  3DTK A;  2Y2N A;  2EA9 A;  4E3O A;  1K56 A;  2J9O A;  1WA9 A;  3GEC A;  4JGQ A;  4R4R A;  1V9Y A;  4S2P A;  1L0G A;  5AVE A;  2IWD A;  3NUL A;  1IFQ A;  5FAS A;  3IF6 B;  2W1T A;  1PWC A;  3W4O A;  3KSF A;  2FFY A;  2J8Y A;  2LB5 A;  4U0T A;  1Y4O A;  4ZJ3 A;  1G6A A;  3H82 A;  1LHY A;  1SKO A;  4O01 A;  3RXW A;  3RFB A;  1OJG A;  4BBV A;  4EXO A;  1KE3 A;  3MZE A;  1O7E A;  3U2A A;  4PHT A;  4E04 A;  3E98 A;  4LV1 A;  1CK3 A;  3DTM A;  3IXG A;  3OPP A;  4JXW A;  4KZ6 A;  3UPN A;  1S1Z A;  1CEF A;  5F1F A;  4BL3 A;  5AQ9 A;  2ZQC A;  2WZX A; 
#chains in the Genus database with same CATH homology
 1NZU A;  3CMZ A;  3GSG A;  5EVI D;  3UDX A;  1GHP A;  3A3E A;  1BLH A;  4OOM A;  1XA7 A;  4OPZ A;  2P9V A;  4Y0O A;  4D2O A;  4X6T A;  3Q07 A;  3N8R A;  2QZ6 A;  5HAI A;  5A91 A;  3IH9 A;  4X53 A;  1BLS A;  1RGY A;  3D4F A;  1W7F A;  3C7V A;  4YIN A;  4BD0 A;  3Q7Z A;  4OQ0 A;  1ESI A;  1NJ4 A;  1IEM A;  4HEF A;  2ZC3 B;  5A90 A;  5AQ7 A;  1DJB A;  1PW1 A;  2IWC A;  3BLM A;  4XUZ A;  4EV4 A;  3GV9 A;  4E3I A;  3SS5 A;  2XH9 A;  2HPB A;  1S0W A;  4K0X A;  3V3R A;  3VMA A;  1K56 D;  5GHY A;  1YMS A;  4CJN A;  3IF5 A;  3ITB A;  4GD6 A;  1PWG A;  4DF6 A;  4GDB A;  1K55 A;  3TOI A;  5A92 A;  3RXX A;  1YLJ A;  2G2U A;  5D3O A;  1BUL A;  1SHV A;  2EX2 A;  4KEN B;  4OKP A;  4X55 A;  5TR7 A;  3SH8 A;  2H10 A;  1MWU A;  4LEN A;  4OQH A;  4N1X A;  5JYO A;  1BUE A;  4WEJ A;  3AGF A;  3G32 A;  3ZFZ A;  4LCM A;  4BEN A;  2X02 A;  1YLW A;  4HBT A;  5DF8 A;  3C4P A;  5F83 A;  1W5D A;  4U3T A;  5HL1 A;  1HVB A;  1BTL A;  5FAQ A;  1ERM A;  1ES2 A;  1E3U A;  1Z6F A;  3FWL A;  1FSW A;  3NC8 A;  5DTT A;  2B5R A;  3AGE A;  3LY4 A;  5FI2 A;  5GHZ A;  4CPK A;  3PBT A;  1KDW A;  4JF4 A;  1K55 C;  2RL3 A;  2WKE A;  2XR0 A;  4OOL A;  5FSR A;  1BLP A;  4P6B A;  3RJU A;  1HZO A;  2WGV A;  3VP2 A;  1GA0 A;  5CEC A;  4P87 A;  3WRT A;  5E43 A;  1YLY A;  5FA7 A;  5FQQ A;  2HDQ A;  2FFF B;  2ZM8 A;  3W4Q A;  5DF7 A;  4WEL A;  5EUA A;  3NIA A;  5CHM A;  4E3K A;  3UO9 A;  4UHU A;  2IWB A;  3AGD A;  2WAD A;  4OVD A;  4GKU A;  4KZ8 A;  1XPB A;  2J9P A;  2VGK A;  3PTE A;  2C6W B;  3WS1 A;  2Y2G A;  4KG6 A;  3BFC A;  1MWS A;  1BLC A;  1O07 A;  2Y2H A;  3VP3 A;  4DRT A;  4S2K A;  4Y7P A;  3C5A A;  1WYC A;  1DY6 A;  3G31 A;  5HFO A;  1TDL A;  3OZH A;  4KZ9 A;  4JBF A;  1VQQ A;  1PI5 A;  4ZJ2 A;  4QHC A;  2WGW B;  5FAP A;  4JPM A;  4N9K A;  3NDE A;  4LV0 A;  3O86 A;  4OH0 A;  5CTN A;  1K4E A;  3MFD A;  5TGF A;  4C3Q A;  4FH4 A;  1SDE A;  3S1Y A;  1FOF A;  3G4P A;  2X01 A;  4P0M A;  4PM5 A;  3HUM A;  3BM6 A;  3GQZ A;  3P09 A;  4OP8 A;  4OPY A;  5KSH A;  3Q7V A;  1CI8 A;  2Y4A A;  2XD1 A;  4L0L A;  1FCN A;  5EE8 A;  3UNW A;  4BQM A;  2OLU A;  1Y54 A;  4O7D A;  4OON A;  4E3L A;  3C7U A;  3V3S A;  1PZO A;  3ZG9 B;  3BLS A;  5CGS A;  2RCX A;  2XQZ A;  1IYS A;  1E25 A;  1K6R A;  4OOY A;  1ONG A;  2C5W B;  4BJP A;  2EX8 A;  2JC7 A;  3MZF A;  1XGI A;  4LV2 A;  3UE3 A;  1S6R A;  5GLB A;  3M6H A;  1JWV A;  2HP9 A;  5IHV A;  1ES4 A;  1XP4 A;  1PZP A;  2JCH A;  4UA7 A;  3QNC A;  4HES A;  3OCL A;  3TSG A;  1KGE A;  3HUN A;  3VFH A;  2BLS A;  4S2J A;  4OPR A;  4GNU A;  1ES3 A;  5CXW A;  1WE4 A;  1KVL A;  1K4F A;  4JKT A;  3Q81 A;  2CC1 A;  5DVA A;  3CJM A;  5E2F A;  1EI5 A;  1MKI A;  3OPH A;  4Y0T A;  5F82 A;  3MKE A;  4E3M A;  3UPP A;  3BFE A;  3I7J A;  1ERO A;  1QMF A;  3C4O A;  5CGW A;  2Z2L B;  3MXS A;  4RX3 A;  3GTC A;  4RVA A;  2H0Y A;  2P74 A;  5EOE A;  4QY6 A;  2JE5 A;  1ZC2 A;  3IXD A;  1CEG A;  2EX6 A;  4ZTK A;  5M19 A;  1H8Z A;  2OSU A;  4ZDX A;  3N8L A;  1NY0 A;  4GDN A;  1ZKJ A;  3IQA A;  4WZ5 A;  4H8R A;  3MZD A;  4P85 A;  3N8S A;  1VM1 A;  2ZQ8 A;  1K38 A;  3IXH A;  4QD4 A;  4RYE A;  4WYY A;  5HX9 A;  2A3U A;  4MLL A;  5FDH A;  5AQB A;  3UDF A;  3DWK A;  4A5R A;  2V1Z A;  3PBN A;  1TDG A;  2Q9N A;  1GCE A;  4KZ3 A;  3P98 A;  2P9V B;  3WS0 A;  1L2S A;  3FYZ A;  2Y2Q A;  1JVJ A;  3CG5 A;  4KZ5 A;  4X69 A;  4R3J A;  2ZQA A;  3EQV A;  3M2K A;  3ZCZ A;  5E2G A;  3FV7 A;  2WKH A;  3ZNY A;  5E2E A;  1FR6 A;  4FD8 A;  1LLB A;  3ZG8 B;  3PBO A;  1EWZ A;  4EWF A;  3IWI A;  4EBL A;  2XGN A;  4WZ5 C;  2WAE A;  4S2L A;  3SH9 A;  3NCK A;  4Q8I A;  4E6X A;  1FQG A;  1IKI A;  5TFQ A;  3GMW A;  3TG9 A;  3A3I A;  4JXV A;  3ZHH A;  4OP5 A;  2HDR A;  5DTS A;  4U0X A;  4JF5 A;  2OV5 A;  3LY3 A;  4N9L A;  1YQS A;  1FR1 A;  3EQU A;  3O87 A;  2ZQ9 A;  3LCE A;  1ESU A;  3G2Z A;  4MBK A;  2V2F F;  2G2W A;  4DKI A;  1SCW A;  1YLT A;  3IWO A;  2ZMA A;  3ZG0 A;  1YMX A;  5EVI A;  4PM6 A;  3FKV A;  4PMA A;  5GLA A;  3ITA A;  1N9B A;  1JTG A;  1SKF A;  1BSG A;  1NZO A;  1YLZ A;  3HL9 A;  4JF6 A;  4NET A;  5HAP A;  4R1G A;  4R0Q A;  1IYO A;  4FCF A;  3WRZ A;  3HLG A;  2HP5 A;  3JYI A;  4LV3 A;  3HLB A;  4M3K A;  3BEB A;  3DW0 A;  4FH2 A;  3NY4 A;  4K0W A;  1FCM A;  1SDN A;  1YLP A;  3IF6 A;  2XDM A;  1GA9 A;  3ZVW A;  2DRW A;  4S2N A;  1K54 A;  1PWD A;  2ZM2 A;  2EXB A;  1TVF A;  4UA9 A;  1OME A;  5A93 A;  1L0F A;  5DTK A;  4OLG A;  3VSK A;  2H5S A;  2GDN A;  1PI4 A;  1W8Q A;  2WAF A;  4QB8 A;  5EVI C;  3UY6 A;  1G68 A;  2DNS A;  1TEM A;  1E4D A;  1NXY A;  5J8X A;  2Z2M B;  2WGI A;  3IHA A;  1ZG4 A;  5FQJ A;  2Q9M A;  5FI7 A;  2Y2M A;  4EQI A;  2HDS A;  2ZD8 A;  1IEL A;  4E3J A;  4DE2 A;  4EBN A;  5FQI A;  4IBR A;  4MBF A;  1IYQ A;  2A49 A;  1I2S A;  1K6S A;  2X71 A;  4C75 A;  1JTD A;  2Y2K A;  1NRF A;  3IF6 C;  5HAR A;  4S2N C;  3VP1 A;  1K54 C;  1XA1 A;  3NDG A;  1M6K A;  2Y59 A;  4RA7 A;  4KG2 A;  2R9X A;  1AXB A;  2JBF A;  3M6B A;  3BYD A;  4WMC A;  4X56 A;  5CEB A;  3G30 A;  1XKZ A;  5E2H A;  5EVL A;  3ISG A;  3LO7 A;  3Q7V B;  1ERQ A;  1WYB A;  4OPQ A;  3IHB A;  4KZA A;  2VGJ A;  1U60 A;  1CI9 A;  1LL9 A;  3SS4 A;  3S22 A;  2EXA A;  5AQA A;  5CTM A;  1K57 A;  2Y2O A;  4B88 A;  4IED A;  4X68 A;  1MXO A;  4DE0 A;  3BFD A;  3HLD A;  1L0E A;  4MEZ A;  3WS2 A;  3VP4 A;  3IT9 A;  3HRE A;  1KDS A;  4EUZ A;  2V20 A;  5GHX A;  2WZZ A;  4B4Z A;  1ALQ A;  4EBP A;  1FCO A;  3VP0 A;  1E3U D;  1QME A;  4WM9 A;  2XD5 A;  2ZC7 A;  1MWR A;  2PU4 A;  1DJC A;  5JYP A;  3UPO A;  3A3F A;  4MNR A;  1PYY A;  5KSC A;  3GVB A;  5FAO A;  1I5Q A;  5FAT A;  3UDI A;  3G2Y A;  5CGX A;  4ID4 A;  4R4S A;  4PM7 A;  4LCL A;  4UA6 A;  3WWX A;  1KE0 A;  3V39 A;  4GD8 A;  1K25 A;  4IVI A;  4E3N A;  2WUQ A;  1PIO A;  1K57 C;  1MBL A;  2Y2L A;  3HLC A;  3HVF A;  3NBL A;  3UN7 A;  3ZG5 A;  3WS4 A;  3FZC A;  4ZBE A;  3S4X A;  1J9M A;  4PPR A;  4QU3 A;  4E6W A;  4GOG A;  4RX2 A;  4N92 A;  4XUX A;  3QNB A;  3V5M A;  5M1A A;  1LL5 A;  5FQM A;  4R23 A;  4DXB A;  1HD8 A;  1JWZ A;  1XXM A;  5CHJ A;  1H8Y A;  3OPL A;  3ZDJ A;  3IWQ A;  2XFT A;  4KQQ A;  3E2K A;  4YFM A;  3SOI A;  1LI0 A;  2Y91 A;  1YM1 A;  2ZC6 B;  2ZQ7 A;  3CZD A;  1L0D A;  3A3D A;  4QY5 A;  2QMI A;  4WBG A;  3V50 A;  3IH8 A;  2UWX A;  4BLM A;  4BD1 A;  5M18 A;  3O3V A;  1LI9 A;  5EEC A;  2OLV A;  4MBH A;  2ZJ9 A;  1YT4 A;  2Y55 A;  3BEC A;  4PM9 A;  1IKG A;  3ZNT A;  2I72 A;  1GHM A;  4DDS A;  4K91 A;  5HW3 A;  1MWT A;  2XFS A;  4FSF A;  4XXR A;  3Q82 A;  2XF3 A;  1DJA A;  2H0T A;  3UE0 A;  1ONH A;  2PU2 A;  4R3B A;  1NYM A;  3N4I A;  3O88 A;  3GR2 A;  4ZAM A;  2BG1 A;  5BOH A;  3HUO A;  3HLE A;  2EFX A;  1W8Y A;  5CED A;  2DCF A;  5GLC A;  5G18 A;  2ZQD A;  1HTZ A;  2WYX A;  4OQI A;  3IXB A;  4NK3 A;  4DE3 A;  5CER A;  2XK1 A;  5U47 A;  3SH7 A;  1KGF A;  3QHY A;  4JXS A;  4KZ4 A;  3PBQ A;  4WMC D;  4OQG A;  3VFF A;  2PBY A;  2XLN A;  2ZM0 A;  3PBR A;  3Q1F A;  5GLD A;  3ZG7 B;  4PM8 A;  3B3X A;  3N6I A;  2XEP A;  4UAA A;  3VOZ A;  1RGZ A;  4KG5 A;  3VOY A;  2ZLY A;  2Y2P A;  1IYP A;  4JLF A;  4S2O A;  1KE4 A;  1I2W A;  3OC2 A;  2WK0 A;  4KZ7 A;  2WGW A;  3BFF A;  4DDY A;  5EVI B;  3LEZ A;  3PBS A;  2Y2N A;  2ZC5 B;  4IVK A;  5DF9 A;  3DWZ A;  4JXG A;  4E3O A;  5FQ9 A;  1K56 A;  2J9O A;  3PAG A;  4WZ4 A;  1FSY A;  5FQK A;  1KVM A;  5GL9 A;  4R4R A;  4WEK A;  4DXC A;  1NYY A;  1MY8 A;  4S2P A;  1L0G A;  4C6Y A;  2IWD A;  5KZH A;  2J7V A;  1XGJ A;  3N7W A;  4IBX A;  5L2F A;  1RCJ A;  3BRM A;  5FAS A;  1Q2Q A;  3IF6 B;  3SS3 A;  4S2I A;  4DE1 A;  2HP6 A;  3FKW A;  1PWC A;  3A3J A;  5CHU A;  1N4O A;  3G34 A;  3W4O A;  4OLD A;  3W8K A;  3GRJ A;  5EPH A;  2E8I A;  3VSL A;  2FFY A;  2J8Y A;  4U0T A;  4HBU A;  4KQO A;  1Q2P A;  4ZJ3 A;  1G6A A;  1BT5 A;  1MPL A;  1LHY A;  1GHI A;  2ZC4 B;  3MKF A;  5EOO A;  3HLF A;  3RXW A;  3HBR A;  1BZA A;  2QPN A;  3HLW A;  3OCN A;  4N1H A;  5F1G A;  4GN2 A;  3G35 A;  2WKI A;  1C3B A;  3UE1 A;  3W4P A;  3M2J A;  1KE3 A;  3MZE A;  4S2M A;  1O7E A;  5KMW A;  4ZJ1 A;  3ZVT A;  1ZG6 A;  3MBZ A;  4LV1 A;  1JWP A;  1CK3 A;  2R9W A;  3MXR A;  4Y0U A;  3DTM A;  1RP5 A;  3IXG A;  1PW8 A;  1ES5 A;  3OPP A;  4Z9Q A;  5FI6 A;  3NI9 A;  4JXW A;  4KZ6 A;  3OPR A;  3UPN A;  4F94 A;  2HDU A;  2EX9 A;  1CEF A;  3E2L A;  2Y2I A;  5HAQ A;  4B4X A;  1W79 A;  2EFU A;  4QJG A;  5I94 A;  5F1F A;  3ZGA B;  1H5X A;  4GB7 A;  4KQR A;  3BFG A;  3WS5 A;  1KGG A;  4GZB A;  4BL3 A;  4BL2 A;  3PAE A;  5CRF A;  4KZB A;  1M40 A;  5AQ9 A;  2Y2J A;  2ZQC A;  2WZX A;  1XX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...