2M7UA

Blue light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methyl-accepting chemotaxis protein
publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
total genus 32
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7uA00
2XROA 4IJGA 3IBJA 2XRNA 3KSIA 1TD5A 2B18A 3IBRA 4Y3IA 2G7UA 1YSQA 2K2NA 2O9BA 4BWIA 4R6LA 3ZQ5A 4DMZA 3W2ZA 2LB5A 4DN0A 3O5YA 3NOPC 2XSSA 4G3KA 4YOFA 4RQ9A 2LB9A 5DFYA 4MCWA 1YKDA 3VV4A 4LRXC 2M7VA 4QPRA 3C2WA 5TJJA 1TF1A 2W3GA 3NHQA 5HPIA 4Q0IA 2O9AA 4ETXA 4EUVA 2VZWA 3MMHA 5HL6A 4FOFA 4YNRA 2IA2A 3KSHA 4MN7A 2W1RA 3HCYA 2OOLA 4ZRRA 1VHMA 4MMNA 4GLQA 4O01A 5LBRA 3MQ0A 3OOVA 2ZMFA 2W1TB 3CITA 4Q0HA 5HSQA 5HPFA 3KO6A 2K31A 3KSFA 3EEAA 3LFVA 2O0YA 4Q0JA 5DFXA 4Z1WA 3S7OA 3S7NA 3NOTC 3TRCA 1STZA 3G6OA 2W3DA 4G3VA 3RFBA 2O9CA 4EU0A 5K5BA 5AJGA 4G3WA 2M7UA 4O0PA 4R70A 4ETZA 1YSPA 1MC0A 2W3FA 1MKMA 4Y5FA 3S7QA 4CQHA 4LRYC 2VEAA 3NOUC 3BJNA 4GW9A 3S7PA 2W1TA 1F5MA 4MDZA 2Y8HA 4IUKA 5L8MA 3D3OA 2QYBA 2KOIA 5I5LA 1ZTUA 4LRZE 4ME4A 3K2NA 2KLIA 3E0YA 4O8GA 2VJWA 3R4KA 4PAUA 2GX5A 4E04A 2W3HA 3OBFA 5C5KA 3CI6A 2W3EA 2Y79A 2O99A 3KSGA 4Y2FA 4IUHA 2HGVA 3DBAA 2VKSA 3MF0A 3E98A
chains in the Genus database with same CATH superfamily
3E2LA 4GDNA 1TD5A 5FSRA 1TS8A 4IEDA 3ZG9B 4D60A 1HLUP 3PBOA 2HDSA 2WGWB 1TDGA 1J3WA 3EEHA 2JN7A 3V67A 4GCZA 3R7WA 2Y2KA 3JVUA 4JGPA 3AGEA 4CJNA 2V8CA 2ZJ9A 4MN7A 2ZC5B 1WE4A 4MMNA 1IKIA 3SS5A 3T1SA 5CERA 3FZCA 2UV0E 5HSQA 3N8SA 4WYYA 4OPRA 2OWHA 3H9WA 5CECA 2VGLS 3BRMA 4L9GA 1MKIA 3L9KA 3BW6A 3FKVA 3MZFA 2KDKA 1VETA 4P85A 4O0PA 5DF7A 4I5SA 4Y5FA 3S7QA 2VV6A 1EW0A 1D06A 2VV7A 2W1TA 2Y8HA 1LLBA 2KX6A 2UWXA 2XEPA 5KSHA 4HBTA 1KVLA 3E0YA 1QMEA 3A3FA 3TJZC 3F1NB 1XJ3A 2EX9A 5C5KA 4WUJA 4OQIA 3Q07A 3DBAA 4S2LA 5CHUA 4KG2A 4WMCD 3R7WB 3TE8A 2WYXA 1S1YA 4KZ6A 3M2JA 3Q82A 1JTDA 5HWTA 1KGGA 4E3MA 4RX3A 3TW8A 4EXOA 5U47A 1XA7A 2W0NA 2LB5A 2OAQ1 3WS5A 3FC7A 2M7VA 4XXRA 3FYZA 3UB7A 4BD0A 1WYCA 2OSUA 2L4RA 4EESA 1XA1A 4E3JA 3EGDC 5DKKA 3C7VA 4EUVA 1ONHA 3GMWA 1VETB 5HL6A 1ES4A 1CEFA 4QU3A 1PFLA 1K25A 3MSHA 2W1TB 2Y4AA 2OV5A 1D7EA 1K55C 4BMWA 3LFVA 3EEAA 4P6ZS 1OT6A 2V1ZA 1Z09A 3MQOA 5AVEA 3CMZA 1BSGA 1NRJA 1PWGA 2Y55A 3KYEA 4G3VA 1IYSA 4EU0A 2H28A 1RGYA 4JKTA 2HJEA 2V2FF 1FILA 4E6WA 2PYRA 2P7JA 3E4QA 1XGIA 4DE2A 4PM8A 3SH8A 3NY4A 4UA7A 3VE4A 3IF6C 3Q7VA 3W4PA 2FFFB 4WMCA 1CI8A 3ZNYA 2WKHA 3HJIA 3Q81A 4BLMA 4KG5A 1SKOA 4Z9QA 4S2PA 3T4TA 1XGJA 4KQDA 1OMEA 4KZ3A 3FV7A 3NCKA 4E3KA 3SOIA 3N7WA 4K91A 4OP5A 5CHJA 3C7UA 2VGJA 4X1LA 3KX0X 2RL3A 2ZBBA 2EX2A 2HDUA 1SKFA 4BWIA 2Y59A 3OPLA 2Y2PA 2DNSA 1YKDA 3K3CA 3PR6A 3OC2A 2A24A 3HJKA 4OP8A 4B9OA 3N6IA 2R9WA 3VP1A 3LUQA 4OQ0A 1OTBA 3BY9A 1VEUA 3UMEA 3N8RA 1H0MA 2ZMFA 2YKFA 3EWKA 3HL9A 3Q7VB 2R78A 2XK1A 3DAVA 2L0WA 4X6TA 3LY3A 3EGXC 3G6OA 5AJGA 1SKOB 1PNEA 2PR5A 3V39A 1KE3A 4I39A 4BBUA 5EVID 3G2YA 5EECA 3HLGA 1F5MA 5AQ7A 1PZPA 1NZOA 2ZQ7A 4M4XA 4KUKA 1LHYA 5I5LA 4HH3A 4LV2A 4EEPA 4R3AA 4N9KA 1W63M 5I94A 1Q2PA 2XQZA 1PIOA 4YINA 3OBFA 4GZBA 1MWTA 4GHIA 2Y79A 4QD4A 2J7VA 3V50A 4LFUA 1GCEA 1K57C 2A24B 3OPPA 3P09A 4KQRA 4Q8IA 3IBRA 4Y3IA 5EUAA 3ULFA 1XPBA 1YSQA 3G34A 5FA7A 1O07A 5DTKA 4MN5A 3LR5A 1W7FA 1KE4A 4FH4A 4OQGA 4EWFA 1CK3A 4ZTKA 1L0GA 3O86A 2VGLM 3HLFA 4JPMA 2J3WA 1P9WA 5AQ9A 3BFCA 1LL9A 1IFQA 3CWFA 1N4OA 1T18A 3HUMA 3VP0A 3RH8B 3S1YA 1S4RA 2ZC3B 4S2NC 5EVIA 4PM9A 2IWDA 3VOLA 1DP8A 2ZC7A 2WKEA 4DE3A 1H8MA 5FAPA 4B93A 3O88A 4E3OA 3PAEA 3BWLA 4RX2A 1K55A 1YSPA 4GHIB 5DTSA 4JXGA 1SDNA 2HP6A 5M1AA 3TSGA 1EI5A 3HREA 3C8CA 3BJNA 3IH9A 4OH0A 4R0QA 1YM1A 3VSLA 2OLUA 3GVBA 3D72A 1K4FA 5DVAA 3W4QA 5MC7A 2WKQA 5DKLA 2XA7M 4WELA 1BLSA 4OPZA 3VSKA 2B5RA 3MF0A 1RGZA 1OTAA 1VB6A 5CHMA 3V3RA 2Q9NA 4FUWA 2G7UA 3GSGA 1LL8A 3WS0A 4PHTA 1L0FA 4DMZA 3IHAA 5EVIB 3ZCZA 3WWXA 4PM7A 4H8RA 5D3OA 4MCWA 2G2WA 4P6ZM 3VV4A 5EOOA 4QPRA 5HFOA 5HPIA 2Z6DA 3PAGA 2PU4A 5HW3A 3IXGA 4U0TA 1OJ5A 2Q0OA 4Y0OA 3W8KA 2XDMA 2VV8A 3NIAA 1ACFA 2HV1A 3QNCA 2WGIA 1IOUA 4MBFA 3WRTA 2JE5A 1CJFA 4NKPA 2RCXA 4YFMA 3IXDA 4MBKA 3MZDA 3VP4A 1DP9A 2WK0A 2JBFA 3IXHA 3DWZA 1NLZA 2QKPA 2WZZA 1S4SA 4OPYA 3PYPA 5L2FA 1NJ4A 2VEAA 4LLOB 4ARZB 1ONGA 3SZTA 2ZL1B 4GNUA 2VX8A 1F98A 1LI9A 5DJUA 4M3KA 2Y2IA 1ZKJA 3KYZA 4LV1A 1G6OA 5DJTA 2DRWA 3IHBA 3T50A 4IUHA 2XD1A 1KGEA 2R9XA 1TS6A 4K08A 1FR6A 2V0UA 3MKEA 3GV9A 3DWKA 3C38A 4BD1A 1MBLA 1W8QA 3K3DA 3VMAA 5A93A 1K57A 5HDSA 1ZG6A 4U0XA 2V9AA 2Y2LA 3UPPA 3OCNA 4BBVA 2EWVA 5F69A 3UDIA 4EERA 3LO7A 3IF5A 3IQAA 3SS4A 3HVFA 1BLPA 4GOGA 2O9AA 5EPHA 2PU2A 1K6RA 4YNRA 3IWIA 3F1NA 5CXWA 1T19A 3QP5A 4KQQA 3NI9A 1XP4A 1CI9A 5E2GA 3T4SA 2QJ7A 1ERQA 2BTFP 2VGKA 4DJ3A 1P97A 5F1GA 4EQ1A 3E4PA 4Q0JA 2Z6CA 2H0TA 3NOTC 4OOYA 4S2NA 1DJBA 1TDLA 3AGDA 3LY4A 2B02A 3VOZA 4K0WA 5HARA 4S2JA 4HI4A 3G32A 2WKIA 3IX3A 5L10A 1K54C 3T4QA 2WKPA 3S7PA 4S2MA 1XFNA 2Y2NA 2KOIA 5F5YA 2WAFA 2WADA 4F3LA 2PRFA 3DW0A 2VJWA 1I2SA 3UPOA 1MWSA 2PR6A 2O99A 3N4IA 4OPQA 1MXOA 4X68A 4Y0UA 5IT5A 4C3QA 4UA6A 1SHVA 4PKYG 3UN7A 3MXQA 4NG2A 3E4OA 1H8YA 1C3BA 3PBRA 3S4XA 4HP9A 3LIFA 3IXBA 2HPBA 3GRJA 1NYYA 2H0YA 4JXSA 3C5AA 4E6XA 3P7NA 1XXMA 3ZFZA 3HUOA 3EQVA 4WF0A 4YWZA 2CMNA 3ZG7B 3T4JA 4GKUA 4RVAA 4PM6A 1K0KA 3JPUA 3PHYA 2Z2LB 1Q2QA 1H3QA 4R4RA 2EWWA 2VLGA 1FSYA 4KZ7A 4JF5A 2XA7S 3B3XA 4MEZA 3C30A 4X25A 4LENA 1H5XA 4F3LB 3LR4A 1FIKA 1STZA 2W3DA 3UE3A 4CPKA 2W3FA 1YLWA 4LRYC 4KZ9A 4EBLA 4S2KA 3D4FA 5IU1A 3BLMA 1GSWA 1UGUA 3MKFA 4DXCA 2WZXA 1L2SA 4DKIA 4DDSA 2KLIA 1YMXA 2WGVA 1E4DA 3S22A 5TBMB 4KZ8A 4R4SA 1LSXA 2ZLYA 3L7HA 5G18A 2W3HA 4Y2FA 1ZG4A 5GHZA 5KIZA 5L07A 5CEBA 5AQBA 5EVEA 5EM0A 4H6JA 4GD8A 3FPVA 2H5SA 4K0XA 3V3SA 2X01A 2XRNA 2JCHA 4WEJA 3A0RA 1YPRA 1IYQA 5KSCA 3GTCA 2XSSA 5G4YA 4RQ9A 1IELA 1K56D 1DY6A 3G4PA 1LI0A 1TF1A 4NK3A 5GHXA 2L1MA 3LR3A 5L09A 3ZYTA 4F94A 4N1XA 3JVVA 5GHYA 1W63Q 2VZWA 3LGOA 1UWPX 3ZDJA 3N8LA 3GQZA 4OKPA 4LCMA 4Y15A 3H82A 4Q0HA 4P87A 5HZHA 1NXYA 3G31A 2Y2QA 3SH9A 4EETB 1I5QA 2E8IA 2V0WA 3T1RA 2W27A 2O9CA 1W79A 2XR0A 5K5BA 3UB9A 1LSVA 4GB7A 4GDBA 2ZC4B 2C6WB 1VM1A 1JWVA 3V5MA 2JKFA 1YLPA 4EEUA 4IBRA 1CEGA 2BG1A 5FATA 2ZQCA 4H6JB 4CLCC 4LCLA 5M19A 5FI2A 5TGFA 4HH2A 1JWZA 2P04A 2PD7A 5CRFA 1S1ZA 3C4OA 5CGXA 5GLCA 3ZNTA 3CI6A 3MJQA 1SZVA 3M6HA 3KSGA 4HP4A 4HIAA 4LV0A 1T1CA 3MZEA 1K56A 1YQSA 1JNUA 4I38A 1ZC2A 4IJGA 4CLCE 4KZ5A 4I3JA 4ID4A 3MXRA 2K2NA 4E3IA 3I7JA 4L0LA 4II7A 1TS7A 3W2ZA 2PYPA 4PKYA 3H82B 1GA9A 5EFWA 1PW1A 5FI7A 4IBXA 3NULA 1G68A 5FQKA 4Q0IA 5F68A 5HDDA 4OLGA 3KYQA 5AVFA 5G4ZA 3BY8A 1YMSA 1P0ZA 3LI9A 1YT4A 1OT9A 1QMFA 2CC1A 1EROA 5E2EA 1VQQA 4KENB 4MBHA 4LPZA 5HAPA 4B88A 2O0YA 3MS6A 4WZ5C 1E3UD 5DFXA 5HDCA 3S7NA 4EBPA 4Y13A 4R70A 3QNBA 1MKMA 2J9PA 1YLYA 2X71A 1F9IA 4GW9A 5F83A 4MDZA 2X02A 4IUKA 1NRFA 3BFFA 4JGOA 2QPNA 3R4KA 5EM1A 2GX5A 5GLBA 3H7WA 2EXBA 1MZUA 1OPXA 2XGNA 1BZAA 1OTEA 3BLSA 3QP1A 1PYYA 3SH7A 4KG6A 4HEFA 5FAOA 4NETA 4JXWA 3A3JA 2D01A 3LICA 5KMWA 3LIEA 3B33A 1JTGA 3F1OA 3IH8A 1BLCA 1NYMA 3W4OA 4WLAA 2HZ5A 1Y54A 5FEFA 4CLCD 5A92A 3IF6A 3UB6A 4O7DA 2HDQA 3IX4A 3NDEA 1PWCA 1CF0A 3A0SA 2MJ6A 5DFYA 1N9NA 2Y2MA 1ALQA 4ARZA 5TJJA 2W3GA 2ZL1A 3CPTA 1E3UA 3ITAA 4QY6A 3ZHHA 3D9YA 3RTYA 3QP6A 1IEMA 2IA2A 2NUPC 4UQIS 2GNXA 2OOLA 4FSFA 4N1HA 2HP5A 2FZ0A 2PDRA 5CGWA 5BOHA 3CITA 1YAXA 5HPFA 1S6RA 3LCEA 5HWVA 3MXSA 3T4KA 1MY8A 1IYPA 2XFTA 3BM6A 4HJ4A 3RFBA 2C5WB 3H7WB 1HD8A 4FTXA 4PMAA 2INWA 3U4LP 2BLSA 5FASA 2P9VA 2P08A 3IWOA 1GHMA 4MNRA 3VP2A 3T4OA 4R38A 2QMIA 4QWOA 3OLOA 3T4LA 2JHEA 3VP3A 3DTKA 5AQAA 3F1OB 4HESA 4JGQA 3IF6B 1N9BA 5CGSA 1DJAA 1E25A 3HLWA 3T1XA 5DTTA 4HQAA 1XJ4A 3T12B 5FQIA 3CPTB 1BULA 2XF3A 1ESIA 1PRQA 4WN5A 5FDHA 1ZHHB 4AFIA 2A3UA 2O9BA 1GHIA 2JKTM 5DF8A 1XX2A 3LYXA 3B47A 2VK3A 3O5YA 4YOFA 5TR7A 5FAQA 4X56A 1O7EA 4JGRA 1JVJA 3KSHA 2W1RA 4KZ4A 1KDWA 3MFXA 3HCYA 4Y0TA 2P9VB 1WYBA 5LBRA 2BASA 1Y4OA 1OTIA 3F1PA 4WBGA 5HWWA 2ZQAA 3UE1A 3PBSA 3Q1FA 2EFXA 3SS3A 3FWLA 4E3NA 2EXAA 4I3IA 2G2UA 2M7UA 3OPHA 3UPNA 4CLCB 1KOUA 5GL9A 4MLLA 2XD5A 5IHVA 4OONA 2WAEA 4DF6A 5JYPA 4RYEA 3GDIA 3UB8A 5EVLA 3UB5P 5CTNA 4DDYA 3NOUC 2HDRA 4UAAA 2ZM2A 3D3OA 2I9VA 4KUOA 1ZTUA 4LRZE 4ME4A 4ZBEA 5GLAA 3BQAA 5FI6A 3DTMA 3CJMA 2ZOIA 2NUTC 1K4EA 3LIAA 4QHCA 2J3TC 1PWDA 3A0VA 4R3BA 5EV0A 4HBUA 1ESUA 4P6BA 2V8FA 3M2KA 2XROA 4MN6A 2A49A 3BFEA 3IT9A 3CG5A 2B18A 2PBYA 4HJ6A 4EV4A 3CHWP 4R6LA 5E2HA 3B42A 4S2OA 3GR2A 3F1PB 1M6KA 3LEQA 4LRXC 2Z2MB 1PI4A 2JC7A 1FSWA 1N9OA 2GJ3A 3EOIA 1GSVA 2ZQ8A 4B4ZA 5TBMA 1VHMA 3WS1A 1A0KA 3UE6A 3MQ0A 3NBLA 1XKZA 4GS9B 4Z1WA 2VA0A 3DTEA 2D02A 1PZOA 1NLYA 5J8XA 4IHQA 2ZQDA 4OQHA 3ZG5A 3CUEC 4XUXA 4DJ2A 4IVIA 4GJ4A 3MFDA 4A5RA 4LGWA 3OZHA 1KE0A 3ZGAB 4C6YA 1G28A 2PBDP 2JKRM 3C4PA 2QZ6A 3QP8A 4RA7A 5L8MA 4QJGA 3M6BA 4X1MA 4L9FA 1N9LA 1NZUA 2I72A 3RXWA 2P74A 5FQQA 1G6AA 1ES2A 1Z6FA 3WS4A 3UDFA 2W3EA 3A3IA 3LI8A 4JF6A 3SW1A 4JF4A 5GLDA 2AVXA 2VKSA 3DTIA 2H10A 3TOIA 1FOFA 2B95A 3VE3A 3E98A 1HVBA 3PTEA 3RXXA 5EVIC 3IBJA 2FFYA 2XH9A 2JKTI 1LL5A 3FG8A 2Y2OA 4LV3A 4UQIM 3ITBA 1YLZA 5CEDA 4C75A 3P01A 3ZVWA 4NXEA 3TG9A 2Y2HA 1BYWA 3IS2A 2DCFA 4OOLA 3C2WA 1PW8A 4NXGA 1D1JA 4R23A 1F2KA 3NHQA 2J3TD 1BTLA 5FQMA 3MMHA 5HAIA 1L3LA 4FOFA 5M18A 5HD3A 3U2AA 1L0DA 2Y2JA 5FQJA 1PI5A 4ZRRA 5TFQA 1W5DA 4N9LA 1ODVA 2GZAA 3QHYA 2V20A 3IWQA 4JXVA 4BBTA 4BQMA 3TRCA 5A8BA 2XFSA 3E2KA 4ETZA 4EUZA 1MC0A 1V9ZA 3HLBA 5HAQA 4CQHA 2Q9MA 4X69A 4UHUA 4ZJ2A 1CQAA 4Y7PA 5E43A 3A3EA 5EOEA 3UNWA 3BFDA 1HZOA 4OLDA 4WL9A 1NWZA 3VFFA 1S67L 4O8GA 1OJGA 2ZMAA 3QP2A 2PAVP 3BYDA 2IWCA 1DP6A 4WEKA 2V1AA 2OLVA 1YLJA 3IS2B 4FCFA 3CAXA 2QHKA 4HNBA 5HD5A 4PM5A 5KZHA 2J80A 2DMWA 1AWIA 1K54A 1W8YA 1V9YA 4I3AA 5F1FA 5HX9A 1ERMA 5FEGA 3NOPC 5FL3A 5IS1A 2LB9A 1EWZA 4DE1A 3G30A 4ZAMA 1FQGA 3LIDA 3QP4A 2M1CA 3HBRA 5A91A 2E8JA 3NECA 4GN2A 1H8ZA 1IYOA 1Y28A 1KGFA 3ZG8B 1S0WA 1P9RA 3NDGA 1X0OA 3PBTA 2XLNA 4FH2A 1GSXA 2J9OA 2IWBA 1DRMA 4DRTA 3CLOA 4E3LA 4EBNA 4KZAA 2EX6A 2WUQA 4UEYA 5EE8A 2EX8A 5J7EA 2JKRI 1U60A 3HLEA 1GA0A 1TVFA 4BJPA 4NXFA 2QWSA 1T1BA 2FH5A 4OOMA 3UE0A 3CUEA 1J9MA 3VFHA 4S2IA 4P0MA 4ESPA 4GD6A 4ZJ3A 1VEUB 3RJUA 2K7SA 2V1BA 1MWRA 5DF9A 3A3DA 4HHDA 3BECA 3PBQA 3UDXA 3MR0A 5FDSA 4U3TA 1JWPA 1T1AA 3NC8A 4BL2A 1I2WA 2HF6A 4NXBA 1RP5A 2QJ5A 4HJ3A 3OPRA 4HOIA 4DN0A 4XUZA 1IKGA 4G3KA 4OVDA 3UMDA 3FKWA 3G2ZA 5HL1A 2ZOHA 5J3WA 3O3VA 1BT5A 1FR1A 4ETXA 4EQIA 1K38A 4R1GA 2ZC6B 3OCLA 4WZ4A 1HTZA 5CTMA 2PD8A 4GLQA 4O01A 1XJ2A 3OOVA 1YLTA 3JYIA 2EFUA 1SDEA 3KO6A 1L0EA 1SCWA 4KQOA 2Y2GA 2OAP1 4EW7A 4BENA 3S7OA 1TS0A 3P98A 3G35A 4ZJ1A 3NJAA 4JBFA 3HUNA 1RCJA 3LEZA 3ICYA 1LSWA 4Y17A 4WM9A 1UWNX 1OTDA 2QYBA 3PXPA 5JYOA 3VOYA 5A90A 3LIBA 4ZDXA 3EQUA 3FPWA 4X53A 5F6AA 4R3JA 2ZM0A 3ISGA 5FQ9A 2PHYA 3BEBA 3WS2A 3ZVTA 2HP9A 4XT2A 1TEMA 1AXBA 4QB8A 1LT0A 1MWUA 3KSIA 2J8YA 2Y91A 1WA9A 1XFQA 2ZMVA 4D2OA 4CLCA 4L9EA 3ZQ5A 2OWJA 4QY5A 2A2LA 1FCOA 3O87A 3GECA 3MQQA 3UY6A 1ES5A 3HLDA 4B4XA 3LR0A 2EA9A 3IX8A 1KVMA 3ZG0A 3BFGA 5F82A 1FCNA 4HY8A 2WGWA 1NY0A 5CX7A 1K6SA 3BQ8A 3KSFA 2K31A 4NEED 1DJCA 3MBZA 4DXBA 3PBNA 2JKGA 1KDSA 2YKHA 2HJ9C 4X55A 2ZQ9A 4G3WA 1S66L 1MPLA 1BUEA 1ES3A 4BL3A 1GHPA 1M40A 1G5UA 2PT7A 4KZBA 3WRZA 2GDNA 4XT2B 4JLFA 3Q7ZA 1BLHA 4DE0A 1FCMA 2ACGA 4UA9A 1XJ6A 2WKRA 3K2NA 2ZM8A 4PAUA 3CZDA 2ZD8A 4FD8A 4E04A 3HLCA 4WZ5A 5J4EA 4PPRA 5E2FA 3T1QB 2HGVA 4N92A 3AGFA 4IVKA 3UO9A 4GS9A
chains in the Genus database with same CATH topology
4I38A 4IJGA 3IBJA 4CLCE 2JKTI 3FG8A 1TD5A 4I3JA 2G7UA 1TS8A 2K2NA 4UQIM 1LL8A 1VB6A 4L0LA 4II7A 4PHTA 1TS7A 3PBOA 3P01A 4DMZA 3W2ZA 4NXEA 2PYPA 4PKYA 4MCWA 1BYWA 3H82B 3IS2A 4P6ZM 5EFWA 3EEHA 2JN7A 4OOLA 3VV4A 4QPRA 3C2WA 4NXGA 3V67A 4GCZA 3R7WA 3JVUA 3NHQA 5HPIA 4JGPA 2Z6DA 4Q0IA 5F68A 5HDDA 2J3TD 1OJ5A 3KYQA 5AVFA 3MMHA 5G4ZA 4FOFA 3BY8A 2VV8A 5HD3A 3U2AA 2HV1A 4MN7A 1P0ZA 3LI9A 4ZRRA 4MMNA 1IOUA 1OT9A 1ODVA 2GZAA 5HSQA 4LPZA 4NKPA 2O0YA 2OWHA 3H9WA 5DFXA 2VGLS 4BBTA 5HDCA 4L9GA 3S7NA 3TRCA 1DP9A 3BW6A 5A8BA 2KDKA 1NLZA 2QKPA 4O0PA 1S4SA 3PYPA 4R70A 4ETZA 1MC0A 4I5SA 1MKMA 1V9ZA 4Y5FA 3S7QA 4CQHA 2VV6A 1EW0A 2VEAA 1F9IA 4GW9A 4LLOB 1D06A 2VV7A 2W1TA 4ARZB 4MDZA 2Y8HA 4IUKA 2VX8A 1F98A 2KX6A 5DJUA 5KSHA 4JGOA 4WL9A 1NWZA 1S67L 3E0YA 4O8GA 3R4KA 2GX5A 3TJZC 3H7WA 3KYZA 1OJGA 1G6OA 5DJTA 3F1NB 1XJ3A 5C5KA 1MZUA 4WEKA 1DP6A 4WUJA 3T50A 1OPXA 2V1AA 4IUHA 1OTEA 3DBAA 3IS2B 1TS6A 3CAXA 2QHKA 4K08A 2V0UA 3R7WB 3TE8A 4HNBA 5HD5A 1S1YA 2D01A 3LICA 3C38A 2J80A 3LIEA 3B33A 2DMWA 3F1OA 5HWTA 4WLAA 1V9YA 3K3DA 4I3AA 4CLCD 3UB6A 3TW8A 5HDSA 4EXOA 2W0NA 2V9AA 2LB5A 2OAQ1 3NOPC 5FL3A 5IS1A 3A0SA 3OCNA 2LB9A 2MJ6A 5DFYA 1N9NA 4BBVA 2EWVA 3FC7A 5F69A 2M7VA 4EERA 4ARZA 5TJJA 2W3GA 3UB7A 2L4RA 4EESA 3EGDC 5DKKA 2O9AA 4EUVA 3RTYA 3LIDA 5HL6A 4YNRA 2M1CA 2IA2A 2NUPC 3F1NA 4UQIS 1T19A 2GNXA 2OOLA 4FSFA 1Y28A 3T4SA 2QJ7A 2FZ0A 2PDRA 2W1TB 3CITA 4DJ3A 1P9RA 1P97A 1YAXA 1D7EA 4BMWA 5HPFA 3LFVA 1X0OA 3EEAA 4P6ZS 1OT6A 4EQ1A 3E4PA 5HWVA 3PBTA 5AVEA 3MQOA 4Q0JA 2Z6CA 3T4KA 1GSXA 1NRJA 1DRMA 3NOTC 3CLOA 4G3VA 4HJ4A 3RFBA 4EU0A 2H28A 3H7WB 2B02A 4UEYA 2HJEA 2INWA 2P7JA 2PYRA 3E4QA 4HI4A 5J7EA 2JKRI 3T4QA 2P08A 2WKPA 4BJPA 4NXFA 2QWSA 1T1BA 2FH5A 3S7PA 3VE4A 3T4OA 1XFNA 4R38A 2KOIA 4OOMA 3OLOA 5F5YA 2JHEA 3T4LA 3CUEA 4F3LA 3HJIA 3F1OB 2VJWA 2K7SA 4JGQA 2V1BA 2PR6A 2O99A 5DF9A 3T4TA 4KQDA 5IT5A 4HHDA 3PBQA 4HQAA 1XJ4A 4PKYG 3MXQA 3MR0A 3E4OA 3PBRA 4WN5A 1T1AA 3KX0X 1ZHHB 4HP9A 4AFIA 3LIFA 2HF6A 2O9BA 2ZBBA 4NXBA 2QJ5A 4HJ3A 4BWIA 2JKTM 3LYXA 4HOIA 4DN0A 3P7NA 3B47A 3O5YA 4G3KA 3UMDA 4YOFA 1YKDA 3K3CA 3PR6A 2ZOHA 5J3WA 3EQVA 3OC2A 4WF0A 2A24A 3HJKA 4YWZA 2CMNA 3T4JA 4B9OA 4ETXA 3LUQA 4JGRA 1OTBA 3PHYA 3BY9A 3KSHA 3UMEA 2W1RA 3MFXA 1H3QA 3HCYA 2EWWA 2VLGA 3OCLA 2PD8A 4GLQA 4O01A 5LBRA 2BASA 2XA7S 1XJ2A 1OTIA 2ZMFA 3OOVA 3F1PA 2YKFA 3EWKA 5HWWA 3KO6A 3C30A 2R78A 3PBSA 4KQOA 2L0WA 4EW7A 2OAP1 4F3LB 3S7OA 3EGXC 1TS0A 3LR4A 1STZA 3G6OA 2W3DA 4I3IA 5AJGA 3NJAA 2M7UA 2PR5A 1OTAA 3UE3A 4CLCB 1KOUA 2W3FA 4I39A 4LRYC 4BBUA 3ICYA 3GDIA 5IU1A 3UB8A 1LSWA 3NOUC 1GSWA 1UGUA 1F5MA 1UWNX 1OTDA 3D3OA 2QYBA 4M4XA 3PXPA 2I9VA 4KUKA 4KUOA 5I5LA 1ZTUA 4HH3A 4LRZE 4ME4A 4EEPA 2KLIA 3LIBA 4R3AA 3BQAA 3EQUA 3FPWA 1W63M 5F6AA 2ZOIA 5TBMB 2NUTC 1LSXA 2W3HA 3OBFA 4GHIA 2PHYA 2Y79A 3LIAA 4Y2FA 2J3TC 3A0VA 5KIZA 4XT2A 2A24B 4H6JA 3FPVA 2XROA 1LT0A 4MN6A 2XRNA 3KSIA 2B18A 3IBRA 4Y3IA 3ULFA 1YSQA 4HJ6A 1WA9A 1XFQA 2ZMVA 4WEJA 3A0RA 4MN5A 4R6LA 4L9EA 4CLCA 3ZQ5A 2OWJA 3LR5A 3B42A 2XSSA 2A2LA 5G4YA 3F1PB 4RQ9A 3GECA 3MQQA 4LRXC 2VGLM 1TF1A 3LR0A 2J3WA 2L1MA 3LR3A 2EA9A 3ZYTA 1P9WA 1N9OA 3JVVA 2GJ3A 1W63Q 3EOIA 1GSVA 2VZWA 1IFQA 3CWFA 1T18A 1UWPX 5TBMA 3RH8B 1S4RA 1VHMA 4HY8A 3UE6A 3MQ0A 3H82A 4Q0HA 5CX7A 3VOLA 1DP8A 3BQ8A 3KSFA 2K31A 4GS9B 4NEED 5HZHA 1H8MA 4Z1WA 2VA0A 4B93A 4EETB 3PBNA 2D02A 2YKHA 2V0WA 1NLYA 2W27A 2HJ9C 2O9CA 3BWLA 5K5BA 4G3WA 1S66L 4IHQA 3UB9A 1LSVA 1YSPA 3CUEC 4GHIB 4DJ2A 4GJ4A 2PT7A 4EEUA 3C8CA 3BJNA 4XT2B 1G28A 4H6JB 4CLCC 2JKRM 5L8MA 4HH2A 2P04A 4L9FA 1N9LA 1XJ6A 2WKRA 2PD7A 3D72A 3K2NA 1S1ZA 5MC7A 4PAUA 2WKQA 4E04A 3CI6A 5DKLA 2W3EA 3MJQA 2XA7M 4WELA 3KSGA 4HP4A 5J4EA 2HGVA 3LI8A 4HIAA 3SW1A 1T1CA 2VKSA 3MF0A 3VE3A 1JNUA 4GS9A 3E98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRO A;  4IJG A;  3IBJ A;  2XRN A;  3KSI A;  1TD5 A;  2B18 A;  3IBR A;  4Y3I A;  2G7U A;  1YSQ A;  2K2N A;  2O9B A;  4BWI A;  4R6L A;  3ZQ5 A;  4DMZ A;  3W2Z A;  2LB5 A;  4DN0 A;  3O5Y A;  3NOP C;  2XSS A;  4G3K A;  4YOF A;  4RQ9 A;  2LB9 A;  5DFY A;  4MCW A;  1YKD A;  3VV4 A;  4LRX C;  2M7V A;  4QPR A;  3C2W A;  5TJJ A;  1TF1 A;  2W3G A;  3NHQ A;  5HPI A;  4Q0I A;  2O9A A;  4ETX A;  4EUV A;  2VZW A;  3MMH A;  5HL6 A;  4FOF A;  4YNR A;  2IA2 A;  3KSH A;  4MN7 A;  2W1R A;  3HCY A;  2OOL A;  4ZRR A;  1VHM A;  4MMN A;  4GLQ A;  4O01 A;  5LBR A;  3MQ0 A;  3OOV A;  2ZMF A;  2W1T B;  3CIT A;  4Q0H A;  5HSQ A;  5HPF A;  3KO6 A;  2K31 A;  3KSF A;  3EEA A;  3LFV A;  2O0Y A;  4Q0J A;  5DFX A;  4Z1W A;  3S7O A;  3S7N A;  3NOT C;  3TRC A;  1STZ A;  3G6O A;  2W3D A;  4G3V A;  3RFB A;  2O9C A;  4EU0 A;  5K5B A;  5AJG A;  4G3W A;  2M7U A;  4O0P A;  4R70 A;  4ETZ A;  1YSP A;  1MC0 A;  2W3F A;  1MKM A;  4Y5F A;  3S7Q A;  4CQH A;  4LRY C;  2VEA A;  3NOU C;  3BJN A;  4GW9 A;  3S7P A;  2W1T A;  1F5M A;  4MDZ A;  2Y8H A;  4IUK A;  5L8M A;  3D3O A;  2QYB A;  2KOI A;  5I5L A;  1ZTU A;  4LRZ E;  4ME4 A;  3K2N A;  2KLI A;  3E0Y A;  4O8G A;  2VJW A;  3R4K A;  4PAU A;  2GX5 A;  4E04 A;  2W3H A;  3OBF A;  5C5K A;  3CI6 A;  2W3E A;  2Y79 A;  2O99 A;  3KSG A;  4Y2F A;  4IUH A;  2HGV A;  3DBA A;  2VKS A;  3MF0 A;  3E98 A; 
#chains in the Genus database with same CATH topology
 3E2L A;  4GDN A;  1TD5 A;  5FSR A;  1TS8 A;  4IED A;  3ZG9 B;  4D60 A;  1HLU P;  3PBO A;  2HDS A;  2WGW B;  1TDG A;  1J3W A;  3EEH A;  2JN7 A;  3V67 A;  4GCZ A;  3R7W A;  2Y2K A;  3JVU A;  4JGP A;  3AGE A;  4CJN A;  2V8C A;  2ZJ9 A;  4MN7 A;  2ZC5 B;  1WE4 A;  4MMN A;  1IKI A;  3SS5 A;  3T1S A;  5CER A;  3FZC A;  2UV0 E;  5HSQ A;  3N8S A;  4WYY A;  4OPR A;  2OWH A;  3H9W A;  5CEC A;  2VGL S;  3BRM A;  4L9G A;  1MKI A;  3L9K A;  3BW6 A;  3FKV A;  3MZF A;  2KDK A;  1VET A;  4P85 A;  4O0P A;  5DF7 A;  4I5S A;  4Y5F A;  3S7Q A;  2VV6 A;  1EW0 A;  1D06 A;  2VV7 A;  2W1T A;  2Y8H A;  1LLB A;  2KX6 A;  2UWX A;  2XEP A;  5KSH A;  4HBT A;  1KVL A;  3E0Y A;  1QME A;  3A3F A;  3TJZ C;  3F1N B;  1XJ3 A;  2EX9 A;  5C5K A;  4WUJ A;  4OQI A;  3Q07 A;  3DBA A;  4S2L A;  5CHU A;  4KG2 A;  4WMC D;  3R7W B;  3TE8 A;  2WYX A;  1S1Y A;  4KZ6 A;  3M2J A;  3Q82 A;  1JTD A;  5HWT A;  1KGG A;  4E3M A;  4RX3 A;  3TW8 A;  4EXO A;  5U47 A;  1XA7 A;  2W0N A;  2LB5 A;  2OAQ 1;  3WS5 A;  3FC7 A;  2M7V A;  4XXR A;  3FYZ A;  3UB7 A;  4BD0 A;  1WYC A;  2OSU A;  2L4R A;  4EES A;  1XA1 A;  4E3J A;  3EGD C;  5DKK A;  3C7V A;  4EUV A;  1ONH A;  3GMW A;  1VET B;  5HL6 A;  1ES4 A;  1CEF A;  4QU3 A;  1PFL A;  1K25 A;  3MSH A;  2W1T B;  2Y4A A;  2OV5 A;  1D7E A;  1K55 C;  4BMW A;  3LFV A;  3EEA A;  4P6Z S;  1OT6 A;  2V1Z A;  1Z09 A;  3MQO A;  5AVE A;  3CMZ A;  1BSG A;  1NRJ A;  1PWG A;  2Y55 A;  3KYE A;  4G3V A;  1IYS A;  4EU0 A;  2H28 A;  1RGY A;  4JKT A;  2HJE A;  2V2F F;  1FIL A;  4E6W A;  2PYR A;  2P7J A;  3E4Q A;  1XGI A;  4DE2 A;  4PM8 A;  3SH8 A;  3NY4 A;  4UA7 A;  3VE4 A;  3IF6 C;  3Q7V A;  3W4P A;  2FFF B;  4WMC A;  1CI8 A;  3ZNY A;  2WKH A;  3HJI A;  3Q81 A;  4BLM A;  4KG5 A;  1SKO A;  4Z9Q A;  4S2P A;  3T4T A;  1XGJ A;  4KQD A;  1OME A;  4KZ3 A;  3FV7 A;  3NCK A;  4E3K A;  3SOI A;  3N7W A;  4K91 A;  4OP5 A;  5CHJ A;  3C7U A;  2VGJ A;  4X1L A;  3KX0 X;  2RL3 A;  2ZBB A;  2EX2 A;  2HDU A;  1SKF A;  4BWI A;  2Y59 A;  3OPL A;  2Y2P A;  2DNS A;  1YKD A;  3K3C A;  3PR6 A;  3OC2 A;  2A24 A;  3HJK A;  4OP8 A;  4B9O A;  3N6I A;  2R9W A;  3VP1 A;  3LUQ A;  4OQ0 A;  1OTB A;  3BY9 A;  1VEU A;  3UME A;  3N8R A;  1H0M A;  2ZMF A;  2YKF A;  3EWK A;  3HL9 A;  3Q7V B;  2R78 A;  2XK1 A;  3DAV A;  2L0W A;  4X6T A;  3LY3 A;  3EGX C;  3G6O A;  5AJG A;  1SKO B;  1PNE A;  2PR5 A;  3V39 A;  1KE3 A;  4I39 A;  4BBU A;  5EVI D;  3G2Y A;  5EEC A;  3HLG A;  1F5M A;  5AQ7 A;  1PZP A;  1NZO A;  2ZQ7 A;  4M4X A;  4KUK A;  1LHY A;  5I5L A;  4HH3 A;  4LV2 A;  4EEP A;  4R3A A;  4N9K A;  1W63 M;  5I94 A;  1Q2P A;  2XQZ A;  1PIO A;  4YIN A;  3OBF A;  4GZB A;  1MWT A;  4GHI A;  2Y79 A;  4QD4 A;  2J7V A;  3V50 A;  4LFU A;  1GCE A;  1K57 C;  2A24 B;  3OPP A;  3P09 A;  4KQR A;  4Q8I A;  3IBR A;  4Y3I A;  5EUA A;  3ULF A;  1XPB A;  1YSQ A;  3G34 A;  5FA7 A;  1O07 A;  5DTK A;  4MN5 A;  3LR5 A;  1W7F A;  1KE4 A;  4FH4 A;  4OQG A;  4EWF A;  1CK3 A;  4ZTK A;  1L0G A;  3O86 A;  2VGL M;  3HLF A;  4JPM A;  2J3W A;  1P9W A;  5AQ9 A;  3BFC A;  1LL9 A;  1IFQ A;  3CWF A;  1N4O A;  1T18 A;  3HUM A;  3VP0 A;  3RH8 B;  3S1Y A;  1S4R A;  2ZC3 B;  4S2N C;  5EVI A;  4PM9 A;  2IWD A;  3VOL A;  1DP8 A;  2ZC7 A;  2WKE A;  4DE3 A;  1H8M A;  5FAP A;  4B93 A;  3O88 A;  4E3O A;  3PAE A;  3BWL A;  4RX2 A;  1K55 A;  1YSP A;  4GHI B;  5DTS A;  4JXG A;  1SDN A;  2HP6 A;  5M1A A;  3TSG A;  1EI5 A;  3HRE A;  3C8C A;  3BJN A;  3IH9 A;  4OH0 A;  4R0Q A;  1YM1 A;  3VSL A;  2OLU A;  3GVB A;  3D72 A;  1K4F A;  5DVA A;  3W4Q A;  5MC7 A;  2WKQ A;  5DKL A;  2XA7 M;  4WEL A;  1BLS A;  4OPZ A;  3VSK A;  2B5R A;  3MF0 A;  1RGZ A;  1OTA A;  1VB6 A;  5CHM A;  3V3R A;  2Q9N A;  4FUW A;  2G7U A;  3GSG A;  1LL8 A;  3WS0 A;  4PHT A;  1L0F A;  4DMZ A;  3IHA A;  5EVI B;  3ZCZ A;  3WWX A;  4PM7 A;  4H8R A;  5D3O A;  4MCW A;  2G2W A;  4P6Z M;  3VV4 A;  5EOO A;  4QPR A;  5HFO A;  5HPI A;  2Z6D A;  3PAG A;  2PU4 A;  5HW3 A;  3IXG A;  4U0T A;  1OJ5 A;  2Q0O A;  4Y0O A;  3W8K A;  2XDM A;  2VV8 A;  3NIA A;  1ACF A;  2HV1 A;  3QNC A;  2WGI A;  1IOU A;  4MBF A;  3WRT A;  2JE5 A;  1CJF A;  4NKP A;  2RCX A;  4YFM A;  3IXD A;  4MBK A;  3MZD A;  3VP4 A;  1DP9 A;  2WK0 A;  2JBF A;  3IXH A;  3DWZ A;  1NLZ A;  2QKP A;  2WZZ A;  1S4S A;  4OPY A;  3PYP A;  5L2F A;  1NJ4 A;  2VEA A;  4LLO B;  4ARZ B;  1ONG A;  3SZT A;  2ZL1 B;  4GNU A;  2VX8 A;  1F98 A;  1LI9 A;  5DJU A;  4M3K A;  2Y2I A;  1ZKJ A;  3KYZ A;  4LV1 A;  1G6O A;  5DJT A;  2DRW A;  3IHB A;  3T50 A;  4IUH A;  2XD1 A;  1KGE A;  2R9X A;  1TS6 A;  4K08 A;  1FR6 A;  2V0U A;  3MKE A;  3GV9 A;  3DWK A;  3C38 A;  4BD1 A;  1MBL A;  1W8Q A;  3K3D A;  3VMA A;  5A93 A;  1K57 A;  5HDS A;  1ZG6 A;  4U0X A;  2V9A A;  2Y2L A;  3UPP A;  3OCN A;  4BBV A;  2EWV A;  5F69 A;  3UDI A;  4EER A;  3LO7 A;  3IF5 A;  3IQA A;  3SS4 A;  3HVF A;  1BLP A;  4GOG A;  2O9A A;  5EPH A;  2PU2 A;  1K6R A;  4YNR A;  3IWI A;  3F1N A;  5CXW A;  1T19 A;  3QP5 A;  4KQQ A;  3NI9 A;  1XP4 A;  1CI9 A;  5E2G A;  3T4S A;  2QJ7 A;  1ERQ A;  2BTF P;  2VGK A;  4DJ3 A;  1P97 A;  5F1G A;  4EQ1 A;  3E4P A;  4Q0J A;  2Z6C A;  2H0T A;  3NOT C;  4OOY A;  4S2N A;  1DJB A;  1TDL A;  3AGD A;  3LY4 A;  2B02 A;  3VOZ A;  4K0W A;  5HAR A;  4S2J A;  4HI4 A;  3G32 A;  2WKI A;  3IX3 A;  5L10 A;  1K54 C;  3T4Q A;  2WKP A;  3S7P A;  4S2M A;  1XFN A;  2Y2N A;  2KOI A;  5F5Y A;  2WAF A;  2WAD A;  4F3L A;  2PRF A;  3DW0 A;  2VJW A;  1I2S A;  3UPO A;  1MWS A;  2PR6 A;  2O99 A;  3N4I A;  4OPQ A;  1MXO A;  4X68 A;  4Y0U A;  5IT5 A;  4C3Q A;  4UA6 A;  1SHV A;  4PKY G;  3UN7 A;  3MXQ A;  4NG2 A;  3E4O A;  1H8Y A;  1C3B A;  3PBR A;  3S4X A;  4HP9 A;  3LIF A;  3IXB A;  2HPB A;  3GRJ A;  1NYY A;  2H0Y A;  4JXS A;  3C5A A;  4E6X A;  3P7N A;  1XXM A;  3ZFZ A;  3HUO A;  3EQV A;  4WF0 A;  4YWZ A;  2CMN A;  3ZG7 B;  3T4J A;  4GKU A;  4RVA A;  4PM6 A;  1K0K A;  3JPU A;  3PHY A;  2Z2L B;  1Q2Q A;  1H3Q A;  4R4R A;  2EWW A;  2VLG A;  1FSY A;  4KZ7 A;  4JF5 A;  2XA7 S;  3B3X A;  4MEZ A;  3C30 A;  4X25 A;  4LEN A;  1H5X A;  4F3L B;  3LR4 A;  1FIK A;  1STZ A;  2W3D A;  3UE3 A;  4CPK A;  2W3F A;  1YLW A;  4LRY C;  4KZ9 A;  4EBL A;  4S2K A;  3D4F A;  5IU1 A;  3BLM A;  1GSW A;  1UGU A;  3MKF A;  4DXC A;  2WZX A;  1L2S A;  4DKI A;  4DDS A;  2KLI A;  1YMX A;  2WGV A;  1E4D A;  3S22 A;  5TBM B;  4KZ8 A;  4R4S A;  1LSX A;  2ZLY A;  3L7H A;  5G18 A;  2W3H A;  4Y2F A;  1ZG4 A;  5GHZ A;  5KIZ A;  5L07 A;  5CEB A;  5AQB A;  5EVE A;  5EM0 A;  4H6J A;  4GD8 A;  3FPV A;  2H5S A;  4K0X A;  3V3S A;  2X01 A;  2XRN A;  2JCH A;  4WEJ A;  3A0R A;  1YPR A;  1IYQ A;  5KSC A;  3GTC A;  2XSS A;  5G4Y A;  4RQ9 A;  1IEL A;  1K56 D;  1DY6 A;  3G4P A;  1LI0 A;  1TF1 A;  4NK3 A;  5GHX A;  2L1M A;  3LR3 A;  5L09 A;  3ZYT A;  4F94 A;  4N1X A;  3JVV A;  5GHY A;  1W63 Q;  2VZW A;  3LGO A;  1UWP X;  3ZDJ A;  3N8L A;  3GQZ A;  4OKP A;  4LCM A;  4Y15 A;  3H82 A;  4Q0H A;  4P87 A;  5HZH A;  1NXY A;  3G31 A;  2Y2Q A;  3SH9 A;  4EET B;  1I5Q A;  2E8I A;  2V0W A;  3T1R A;  2W27 A;  2O9C A;  1W79 A;  2XR0 A;  5K5B A;  3UB9 A;  1LSV A;  4GB7 A;  4GDB A;  2ZC4 B;  2C6W B;  1VM1 A;  1JWV A;  3V5M A;  2JKF A;  1YLP A;  4EEU A;  4IBR A;  1CEG A;  2BG1 A;  5FAT A;  2ZQC A;  4H6J B;  4CLC C;  4LCL A;  5M19 A;  5FI2 A;  5TGF A;  4HH2 A;  1JWZ A;  2P04 A;  2PD7 A;  5CRF A;  1S1Z A;  3C4O A;  5CGX A;  5GLC A;  3ZNT A;  3CI6 A;  3MJQ A;  1SZV A;  3M6H A;  3KSG A;  4HP4 A;  4HIA A;  4LV0 A;  1T1C A;  3MZE A;  1K56 A;  1YQS A;  1JNU A;  4I38 A;  1ZC2 A;  4IJG A;  4CLC E;  4KZ5 A;  4I3J A;  4ID4 A;  3MXR A;  2K2N A;  4E3I A;  3I7J A;  4L0L A;  4II7 A;  1TS7 A;  3W2Z A;  2PYP A;  4PKY A;  3H82 B;  1GA9 A;  5EFW A;  1PW1 A;  5FI7 A;  4IBX A;  3NUL A;  1G68 A;  5FQK A;  4Q0I A;  5F68 A;  5HDD A;  4OLG A;  3KYQ A;  5AVF A;  5G4Z A;  3BY8 A;  1YMS A;  1P0Z A;  3LI9 A;  1YT4 A;  1OT9 A;  1QMF A;  2CC1 A;  1ERO A;  5E2E A;  1VQQ A;  4KEN B;  4MBH A;  4LPZ A;  5HAP A;  4B88 A;  2O0Y A;  3MS6 A;  4WZ5 C;  1E3U D;  5DFX A;  5HDC A;  3S7N A;  4EBP A;  4Y13 A;  4R70 A;  3QNB A;  1MKM A;  2J9P A;  1YLY A;  2X71 A;  1F9I A;  4GW9 A;  5F83 A;  4MDZ A;  2X02 A;  4IUK A;  1NRF A;  3BFF A;  4JGO A;  2QPN A;  3R4K A;  5EM1 A;  2GX5 A;  5GLB A;  3H7W A;  2EXB A;  1MZU A;  1OPX A;  2XGN A;  1BZA A;  1OTE A;  3BLS A;  3QP1 A;  1PYY A;  3SH7 A;  4KG6 A;  4HEF A;  5FAO A;  4NET A;  4JXW A;  3A3J A;  2D01 A;  3LIC A;  5KMW A;  3LIE A;  3B33 A;  1JTG A;  3F1O A;  3IH8 A;  1BLC A;  1NYM A;  3W4O A;  4WLA A;  2HZ5 A;  1Y54 A;  5FEF A;  4CLC D;  5A92 A;  3IF6 A;  3UB6 A;  4O7D A;  2HDQ A;  3IX4 A;  3NDE A;  1PWC A;  1CF0 A;  3A0S A;  2MJ6 A;  5DFY A;  1N9N A;  2Y2M A;  1ALQ A;  4ARZ A;  5TJJ A;  2W3G A;  2ZL1 A;  3CPT A;  1E3U A;  3ITA A;  4QY6 A;  3ZHH A;  3D9Y A;  3RTY A;  3QP6 A;  1IEM A;  2IA2 A;  2NUP C;  4UQI S;  2GNX A;  2OOL A;  4FSF A;  4N1H A;  2HP5 A;  2FZ0 A;  2PDR A;  5CGW A;  5BOH A;  3CIT A;  1YAX A;  5HPF A;  1S6R A;  3LCE A;  5HWV A;  3MXS A;  3T4K A;  1MY8 A;  1IYP A;  2XFT A;  3BM6 A;  4HJ4 A;  3RFB A;  2C5W B;  3H7W B;  1HD8 A;  4FTX A;  4PMA A;  2INW A;  3U4L P;  2BLS A;  5FAS A;  2P9V A;  2P08 A;  3IWO A;  1GHM A;  4MNR A;  3VP2 A;  3T4O A;  4R38 A;  2QMI A;  4QWO A;  3OLO A;  3T4L A;  2JHE A;  3VP3 A;  3DTK A;  5AQA A;  3F1O B;  4HES A;  4JGQ A;  3IF6 B;  1N9B A;  5CGS A;  1DJA A;  1E25 A;  3HLW A;  3T1X A;  5DTT A;  4HQA A;  1XJ4 A;  3T12 B;  5FQI A;  3CPT B;  1BUL A;  2XF3 A;  1ESI A;  1PRQ A;  4WN5 A;  5FDH A;  1ZHH B;  4AFI A;  2A3U A;  2O9B A;  1GHI A;  2JKT M;  5DF8 A;  1XX2 A;  3LYX A;  3B47 A;  2VK3 A;  3O5Y A;  4YOF A;  5TR7 A;  5FAQ A;  4X56 A;  1O7E A;  4JGR A;  1JVJ A;  3KSH A;  2W1R A;  4KZ4 A;  1KDW A;  3MFX A;  3HCY A;  4Y0T A;  2P9V B;  1WYB A;  5LBR A;  2BAS A;  1Y4O A;  1OTI A;  3F1P A;  4WBG A;  5HWW A;  2ZQA A;  3UE1 A;  3PBS A;  3Q1F A;  2EFX A;  3SS3 A;  3FWL A;  4E3N A;  2EXA A;  4I3I A;  2G2U A;  2M7U A;  3OPH A;  3UPN A;  4CLC B;  1KOU A;  5GL9 A;  4MLL A;  2XD5 A;  5IHV A;  4OON A;  2WAE A;  4DF6 A;  5JYP A;  4RYE A;  3GDI A;  3UB8 A;  5EVL A;  3UB5 P;  5CTN A;  4DDY A;  3NOU C;  2HDR A;  4UAA A;  2ZM2 A;  3D3O A;  2I9V A;  4KUO A;  1ZTU A;  4LRZ E;  4ME4 A;  4ZBE A;  5GLA A;  3BQA A;  5FI6 A;  3DTM A;  3CJM A;  2ZOI A;  2NUT C;  1K4E A;  3LIA A;  4QHC A;  2J3T C;  1PWD A;  3A0V A;  4R3B A;  5EV0 A;  4HBU A;  1ESU A;  4P6B A;  2V8F A;  3M2K A;  2XRO A;  4MN6 A;  2A49 A;  3BFE A;  3IT9 A;  3CG5 A;  2B18 A;  2PBY A;  4HJ6 A;  4EV4 A;  3CHW P;  4R6L A;  5E2H A;  3B42 A;  4S2O A;  3GR2 A;  3F1P B;  1M6K A;  3LEQ A;  4LRX C;  2Z2M B;  1PI4 A;  2JC7 A;  1FSW A;  1N9O A;  2GJ3 A;  3EOI A;  1GSV A;  2ZQ8 A;  4B4Z A;  5TBM A;  1VHM A;  3WS1 A;  1A0K A;  3UE6 A;  3MQ0 A;  3NBL A;  1XKZ A;  4GS9 B;  4Z1W A;  2VA0 A;  3DTE A;  2D02 A;  1PZO A;  1NLY A;  5J8X A;  4IHQ A;  2ZQD A;  4OQH A;  3ZG5 A;  3CUE C;  4XUX A;  4DJ2 A;  4IVI A;  4GJ4 A;  3MFD A;  4A5R A;  4LGW A;  3OZH A;  1KE0 A;  3ZGA B;  4C6Y A;  1G28 A;  2PBD P;  2JKR M;  3C4P A;  2QZ6 A;  3QP8 A;  4RA7 A;  5L8M A;  4QJG A;  3M6B A;  4X1M A;  4L9F A;  1N9L A;  1NZU A;  2I72 A;  3RXW A;  2P74 A;  5FQQ A;  1G6A A;  1ES2 A;  1Z6F A;  3WS4 A;  3UDF A;  2W3E A;  3A3I A;  3LI8 A;  4JF6 A;  3SW1 A;  4JF4 A;  5GLD A;  2AVX A;  2VKS A;  3DTI A;  2H10 A;  3TOI A;  1FOF A;  2B95 A;  3VE3 A;  3E98 A;  1HVB A;  3PTE A;  3RXX A;  5EVI C;  3IBJ A;  2FFY A;  2XH9 A;  2JKT I;  1LL5 A;  3FG8 A;  2Y2O A;  4LV3 A;  4UQI M;  3ITB A;  1YLZ A;  5CED A;  4C75 A;  3P01 A;  3ZVW A;  4NXE A;  3TG9 A;  2Y2H A;  1BYW A;  3IS2 A;  2DCF A;  4OOL A;  3C2W A;  1PW8 A;  4NXG A;  1D1J A;  4R23 A;  1F2K A;  3NHQ A;  2J3T D;  1BTL A;  5FQM A;  3MMH A;  5HAI A;  1L3L A;  4FOF A;  5M18 A;  5HD3 A;  3U2A A;  1L0D A;  2Y2J A;  5FQJ A;  1PI5 A;  4ZRR A;  5TFQ A;  1W5D A;  4N9L A;  1ODV A;  2GZA A;  3QHY A;  2V20 A;  3IWQ A;  4JXV A;  4BBT A;  4BQM A;  3TRC A;  5A8B A;  2XFS A;  3E2K A;  4ETZ A;  4EUZ A;  1MC0 A;  1V9Z A;  3HLB A;  5HAQ A;  4CQH A;  2Q9M A;  4X69 A;  4UHU A;  4ZJ2 A;  1CQA A;  4Y7P A;  5E43 A;  3A3E A;  5EOE A;  3UNW A;  3BFD A;  1HZO A;  4OLD A;  4WL9 A;  1NWZ A;  3VFF A;  1S67 L;  4O8G A;  1OJG A;  2ZMA A;  3QP2 A;  2PAV P;  3BYD A;  2IWC A;  1DP6 A;  4WEK A;  2V1A A;  2OLV A;  1YLJ A;  3IS2 B;  4FCF A;  3CAX A;  2QHK A;  4HNB A;  5HD5 A;  4PM5 A;  5KZH A;  2J80 A;  2DMW A;  1AWI A;  1K54 A;  1W8Y A;  1V9Y A;  4I3A A;  5F1F A;  5HX9 A;  1ERM A;  5FEG A;  3NOP C;  5FL3 A;  5IS1 A;  2LB9 A;  1EWZ A;  4DE1 A;  3G30 A;  4ZAM A;  1FQG A;  3LID A;  3QP4 A;  2M1C A;  3HBR A;  5A91 A;  2E8J A;  3NEC A;  4GN2 A;  1H8Z A;  1IYO A;  1Y28 A;  1KGF A;  3ZG8 B;  1S0W A;  1P9R A;  3NDG A;  1X0O A;  3PBT A;  2XLN A;  4FH2 A;  1GSX A;  2J9O A;  2IWB A;  1DRM A;  4DRT A;  3CLO A;  4E3L A;  4EBN A;  4KZA A;  2EX6 A;  2WUQ A;  4UEY A;  5EE8 A;  2EX8 A;  5J7E A;  2JKR I;  1U60 A;  3HLE A;  1GA0 A;  1TVF A;  4BJP A;  4NXF A;  2QWS A;  1T1B A;  2FH5 A;  4OOM A;  3UE0 A;  3CUE A;  1J9M A;  3VFH A;  4S2I A;  4P0M A;  4ESP A;  4GD6 A;  4ZJ3 A;  1VEU B;  3RJU A;  2K7S A;  2V1B A;  1MWR A;  5DF9 A;  3A3D A;  4HHD A;  3BEC A;  3PBQ A;  3UDX A;  3MR0 A;  5FDS A;  4U3T A;  1JWP A;  1T1A A;  3NC8 A;  4BL2 A;  1I2W A;  2HF6 A;  4NXB A;  1RP5 A;  2QJ5 A;  4HJ3 A;  3OPR A;  4HOI A;  4DN0 A;  4XUZ A;  1IKG A;  4G3K A;  4OVD A;  3UMD A;  3FKW A;  3G2Z A;  5HL1 A;  2ZOH A;  5J3W A;  3O3V A;  1BT5 A;  1FR1 A;  4ETX A;  4EQI A;  1K38 A;  4R1G A;  2ZC6 B;  3OCL A;  4WZ4 A;  1HTZ A;  5CTM A;  2PD8 A;  4GLQ A;  4O01 A;  1XJ2 A;  3OOV A;  1YLT A;  3JYI A;  2EFU A;  1SDE A;  3KO6 A;  1L0E A;  1SCW A;  4KQO A;  2Y2G A;  2OAP 1;  4EW7 A;  4BEN A;  3S7O A;  1TS0 A;  3P98 A;  3G35 A;  4ZJ1 A;  3NJA A;  4JBF A;  3HUN A;  1RCJ A;  3LEZ A;  3ICY A;  1LSW A;  4Y17 A;  4WM9 A;  1UWN X;  1OTD A;  2QYB A;  3PXP A;  5JYO A;  3VOY A;  5A90 A;  3LIB A;  4ZDX A;  3EQU A;  3FPW A;  4X53 A;  5F6A A;  4R3J A;  2ZM0 A;  3ISG A;  5FQ9 A;  2PHY A;  3BEB A;  3WS2 A;  3ZVT A;  2HP9 A;  4XT2 A;  1TEM A;  1AXB A;  4QB8 A;  1LT0 A;  1MWU A;  3KSI A;  2J8Y A;  2Y91 A;  1WA9 A;  1XFQ A;  2ZMV A;  4D2O A;  4CLC A;  4L9E A;  3ZQ5 A;  2OWJ A;  4QY5 A;  2A2L A;  1FCO A;  3O87 A;  3GEC A;  3MQQ A;  3UY6 A;  1ES5 A;  3HLD A;  4B4X A;  3LR0 A;  2EA9 A;  3IX8 A;  1KVM A;  3ZG0 A;  3BFG A;  5F82 A;  1FCN A;  4HY8 A;  2WGW A;  1NY0 A;  5CX7 A;  1K6S A;  3BQ8 A;  3KSF A;  2K31 A;  4NEE D;  1DJC A;  3MBZ A;  4DXB A;  3PBN A;  2JKG A;  1KDS A;  2YKH A;  2HJ9 C;  4X55 A;  2ZQ9 A;  4G3W A;  1S66 L;  1MPL A;  1BUE A;  1ES3 A;  4BL3 A;  1GHP A;  1M40 A;  1G5U A;  2PT7 A;  4KZB A;  3WRZ A;  2GDN A;  4XT2 B;  4JLF A;  3Q7Z A;  1BLH A;  4DE0 A;  1FCM A;  2ACG A;  4UA9 A;  1XJ6 A;  2WKR A;  3K2N A;  2ZM8 A;  4PAU A;  3CZD A;  2ZD8 A;  4FD8 A;  4E04 A;  3HLC A;  4WZ5 A;  5J4E A;  4PPR A;  5E2F A;  3T1Q B;  2HGV A;  4N92 A;  3AGF A;  4IVK A;  3UO9 A;  4GS9 A; 
#chains in the Genus database with same CATH homology
 4I38 A;  4IJG A;  3IBJ A;  4CLC E;  2JKT I;  3FG8 A;  1TD5 A;  4I3J A;  2G7U A;  1TS8 A;  2K2N A;  4UQI M;  1LL8 A;  1VB6 A;  4L0L A;  4II7 A;  4PHT A;  1TS7 A;  3PBO A;  3P01 A;  4DMZ A;  3W2Z A;  4NXE A;  2PYP A;  4PKY A;  4MCW A;  1BYW A;  3H82 B;  3IS2 A;  4P6Z M;  5EFW A;  3EEH A;  2JN7 A;  4OOL A;  3VV4 A;  4QPR A;  3C2W A;  4NXG A;  3V67 A;  4GCZ A;  3R7W A;  3JVU A;  3NHQ A;  5HPI A;  4JGP A;  2Z6D A;  4Q0I A;  5F68 A;  5HDD A;  2J3T D;  1OJ5 A;  3KYQ A;  5AVF A;  3MMH A;  5G4Z A;  4FOF A;  3BY8 A;  2VV8 A;  5HD3 A;  3U2A A;  2HV1 A;  4MN7 A;  1P0Z A;  3LI9 A;  4ZRR A;  4MMN A;  1IOU A;  1OT9 A;  1ODV A;  2GZA A;  5HSQ A;  4LPZ A;  4NKP A;  2O0Y A;  2OWH A;  3H9W A;  5DFX A;  2VGL S;  4BBT A;  5HDC A;  4L9G A;  3S7N A;  3TRC A;  1DP9 A;  3BW6 A;  5A8B A;  2KDK A;  1NLZ A;  2QKP A;  4O0P A;  1S4S A;  3PYP A;  4R70 A;  4ETZ A;  1MC0 A;  4I5S A;  1MKM A;  1V9Z A;  4Y5F A;  3S7Q A;  4CQH A;  2VV6 A;  1EW0 A;  2VEA A;  1F9I A;  4GW9 A;  4LLO B;  1D06 A;  2VV7 A;  2W1T A;  4ARZ B;  4MDZ A;  2Y8H A;  4IUK A;  2VX8 A;  1F98 A;  2KX6 A;  5DJU A;  5KSH A;  4JGO A;  4WL9 A;  1NWZ A;  1S67 L;  3E0Y A;  4O8G A;  3R4K A;  2GX5 A;  3TJZ C;  3H7W A;  3KYZ A;  1OJG A;  1G6O A;  5DJT A;  3F1N B;  1XJ3 A;  5C5K A;  1MZU A;  4WEK A;  1DP6 A;  4WUJ A;  3T50 A;  1OPX A;  2V1A A;  4IUH A;  1OTE A;  3DBA A;  3IS2 B;  1TS6 A;  3CAX A;  2QHK A;  4K08 A;  2V0U A;  3R7W B;  3TE8 A;  4HNB A;  5HD5 A;  1S1Y A;  2D01 A;  3LIC A;  3C38 A;  2J80 A;  3LIE A;  3B33 A;  2DMW A;  3F1O A;  5HWT A;  4WLA A;  1V9Y A;  3K3D A;  4I3A A;  4CLC D;  3UB6 A;  3TW8 A;  5HDS A;  4EXO A;  2W0N A;  2V9A A;  2LB5 A;  2OAQ 1;  3NOP C;  5FL3 A;  5IS1 A;  3A0S A;  3OCN A;  2LB9 A;  2MJ6 A;  5DFY A;  1N9N A;  4BBV A;  2EWV A;  3FC7 A;  5F69 A;  2M7V A;  4EER A;  4ARZ A;  5TJJ A;  2W3G A;  3UB7 A;  2L4R A;  4EES A;  3EGD C;  5DKK A;  2O9A A;  4EUV A;  3RTY A;  3LID A;  5HL6 A;  4YNR A;  2M1C A;  2IA2 A;  2NUP C;  3F1N A;  4UQI S;  1T19 A;  2GNX A;  2OOL A;  4FSF A;  1Y28 A;  3T4S A;  2QJ7 A;  2FZ0 A;  2PDR A;  2W1T B;  3CIT A;  4DJ3 A;  1P9R A;  1P97 A;  1YAX A;  1D7E A;  4BMW A;  5HPF A;  3LFV A;  1X0O A;  3EEA A;  4P6Z S;  1OT6 A;  4EQ1 A;  3E4P A;  5HWV A;  3PBT A;  5AVE A;  3MQO A;  4Q0J A;  2Z6C A;  3T4K A;  1GSX A;  1NRJ A;  1DRM A;  3NOT C;  3CLO A;  4G3V A;  4HJ4 A;  3RFB A;  4EU0 A;  2H28 A;  3H7W B;  2B02 A;  4UEY A;  2HJE A;  2INW A;  2P7J A;  2PYR A;  3E4Q A;  4HI4 A;  5J7E A;  2JKR I;  3T4Q A;  2P08 A;  2WKP A;  4BJP A;  4NXF A;  2QWS A;  1T1B A;  2FH5 A;  3S7P A;  3VE4 A;  3T4O A;  1XFN A;  4R38 A;  2KOI A;  4OOM A;  3OLO A;  5F5Y A;  2JHE A;  3T4L A;  3CUE A;  4F3L A;  3HJI A;  3F1O B;  2VJW A;  2K7S A;  4JGQ A;  2V1B A;  2PR6 A;  2O99 A;  5DF9 A;  3T4T A;  4KQD A;  5IT5 A;  4HHD A;  3PBQ A;  4HQA A;  1XJ4 A;  4PKY G;  3MXQ A;  3MR0 A;  3E4O A;  3PBR A;  4WN5 A;  1T1A A;  3KX0 X;  1ZHH B;  4HP9 A;  4AFI A;  3LIF A;  2HF6 A;  2O9B A;  2ZBB A;  4NXB A;  2QJ5 A;  4HJ3 A;  4BWI A;  2JKT M;  3LYX A;  4HOI A;  4DN0 A;  3P7N A;  3B47 A;  3O5Y A;  4G3K A;  3UMD A;  4YOF A;  1YKD A;  3K3C A;  3PR6 A;  2ZOH A;  5J3W A;  3EQV A;  3OC2 A;  4WF0 A;  2A24 A;  3HJK A;  4YWZ A;  2CMN A;  3T4J A;  4B9O A;  4ETX A;  3LUQ A;  4JGR A;  1OTB A;  3PHY A;  3BY9 A;  3KSH A;  3UME A;  2W1R A;  3MFX A;  1H3Q A;  3HCY A;  2EWW A;  2VLG A;  3OCL A;  2PD8 A;  4GLQ A;  4O01 A;  5LBR A;  2BAS A;  2XA7 S;  1XJ2 A;  1OTI A;  2ZMF A;  3OOV A;  3F1P A;  2YKF A;  3EWK A;  5HWW A;  3KO6 A;  3C30 A;  2R78 A;  3PBS A;  4KQO A;  2L0W A;  4EW7 A;  2OAP 1;  4F3L B;  3S7O A;  3EGX C;  1TS0 A;  3LR4 A;  1STZ A;  3G6O A;  2W3D A;  4I3I A;  5AJG A;  3NJA A;  2M7U A;  2PR5 A;  1OTA A;  3UE3 A;  4CLC B;  1KOU A;  2W3F A;  4I39 A;  4LRY C;  4BBU A;  3ICY A;  3GDI A;  5IU1 A;  3UB8 A;  1LSW A;  3NOU C;  1GSW A;  1UGU A;  1F5M A;  1UWN X;  1OTD A;  3D3O A;  2QYB A;  4M4X A;  3PXP A;  2I9V A;  4KUK A;  4KUO A;  5I5L A;  1ZTU A;  4HH3 A;  4LRZ E;  4ME4 A;  4EEP A;  2KLI A;  3LIB A;  4R3A A;  3BQA A;  3EQU A;  3FPW A;  1W63 M;  5F6A A;  2ZOI A;  5TBM B;  2NUT C;  1LSX A;  2W3H A;  3OBF A;  4GHI A;  2PHY A;  2Y79 A;  3LIA A;  4Y2F A;  2J3T C;  3A0V A;  5KIZ A;  4XT2 A;  2A24 B;  4H6J A;  3FPV A;  2XRO A;  1LT0 A;  4MN6 A;  2XRN A;  3KSI A;  2B18 A;  3IBR A;  4Y3I A;  3ULF A;  1YSQ A;  4HJ6 A;  1WA9 A;  1XFQ A;  2ZMV A;  4WEJ A;  3A0R A;  4MN5 A;  4R6L A;  4L9E A;  4CLC A;  3ZQ5 A;  2OWJ A;  3LR5 A;  3B42 A;  2XSS A;  2A2L A;  5G4Y A;  3F1P B;  4RQ9 A;  3GEC A;  3MQQ A;  4LRX C;  2VGL M;  1TF1 A;  3LR0 A;  2J3W A;  2L1M A;  3LR3 A;  2EA9 A;  3ZYT A;  1P9W A;  1N9O A;  3JVV A;  2GJ3 A;  1W63 Q;  3EOI A;  1GSV A;  2VZW A;  1IFQ A;  3CWF A;  1T18 A;  1UWP X;  5TBM A;  3RH8 B;  1S4R A;  1VHM A;  4HY8 A;  3UE6 A;  3MQ0 A;  3H82 A;  4Q0H A;  5CX7 A;  3VOL A;  1DP8 A;  3BQ8 A;  3KSF A;  2K31 A;  4GS9 B;  4NEE D;  5HZH A;  1H8M A;  4Z1W A;  2VA0 A;  4B93 A;  4EET B;  3PBN A;  2D02 A;  2YKH A;  2V0W A;  1NLY A;  2W27 A;  2HJ9 C;  2O9C A;  3BWL A;  5K5B A;  4G3W A;  1S66 L;  4IHQ A;  3UB9 A;  1LSV A;  1YSP A;  3CUE C;  4GHI B;  4DJ2 A;  4GJ4 A;  2PT7 A;  4EEU A;  3C8C A;  3BJN A;  4XT2 B;  1G28 A;  4H6J B;  4CLC C;  2JKR M;  5L8M A;  4HH2 A;  2P04 A;  4L9F A;  1N9L A;  1XJ6 A;  2WKR A;  2PD7 A;  3D72 A;  3K2N A;  1S1Z A;  5MC7 A;  4PAU A;  2WKQ A;  4E04 A;  3CI6 A;  5DKL A;  2W3E A;  3MJQ A;  2XA7 M;  4WEL A;  3KSG A;  4HP4 A;  5J4E A;  2HGV A;  3LI8 A;  4HIA A;  3SW1 A;  1T1C A;  2VKS A;  3MF0 A;  3VE3 A;  1JNU A;  4GS9 A;  3E98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...