2M7UA

Blue light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
total genus 32
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7uA00
3BJNA 2O9BA 2W1RA 4MMNA 2KLIA 2W3EA 2W3HA 3OBFA 3S7NA 1VHMA 4ETZA 3KO6A 2W3GA 3O5YA 3HCYA 2W1TB 3LFVA 3C2WA 3KSFA 3CITA 2LB5A 3IBJA 4G3KA 4IJGA 4Z1WA 2B18A 3S7OA 3TRCA 4EU0A 5LBRA 3KSIA 4DMZA 4O01A 4RQ9A 3NOTC 3RFBA 1MC0A 3E0YA 1ZTUA 4EUVA 1STZA 3G6OA 2IA2A 4ETXA 4YNRA 3NOUC 4Y3IA 5HSQA 4GLQA 3MF0A 3K2NA 3S7PA 4PAUA 4Y5FA 2OOLA 1TF1A 2ZMFA 5L8MA 2M7UA 3S7QA 1TD5A 3KSGA 4Q0JA 4Q0IA 2M7VA 4MCWA 2G7UA 4E04A 2W3DA 3MMHA 3EEAA 4MDZA 4IUHA 3ZQ5A 3IBRA 2LB9A 4QPRA 3W2ZA 2VZWA 5I5LA 3R4KA 5AJGA 3MQ0A 3NOPC 4G3VA 4GW9A 3DBAA 2K31A 1YSPA 5HL6A 4O0PA 2VJWA 3E98A 4LRZE 4CQHA 2O0YA 4O8GA 4Y2FA 3OOVA 1MKMA 2XSSA 2W1TA 5TJJA 2K2NA 3NHQA 5DFYA 4YOFA 2XRNA 2HGVA 4BWIA 4G3WA 4ZRRA 2VEAA 1YKDA 3KSHA 2W3FA 3VV4A 5HPIA 1YSQA 4LRYC 2O9AA 1F5MA 2Y79A 2QYBA 4LRXC 2O99A 4R6LA 5DFXA 2GX5A 4DN0A 5C5KA 4Q0HA 3D3OA 5K5BA 3CI6A 4FOFA 4ME4A 2Y8HA 5HPFA 4R70A 2VKSA 2XROA 4IUKA 2KOIA 2O9CA 4MN7A
chains in the Genus database with same CATH superfamily
4NKPA 3M6BA 3O5YA 4OKPA 3LIAA 4OP5A 3C2WA 4P87A 3UPPA 4RVAA 3UMEA 1H8ZA 5AQ9A 1L0DA 4DMZA 4Y0UA 1F9IA 4HI4A 3T12B 1XJ6A 3E2LA 4OP8A 3SOIA 5GHXA 5GLBA 3EWKA 4WF0A 4X55A 5E2EA 1PYYA 1DP9A 3NOUC 4ID4A 4S2OA 3T4OA 3T1QB 3QP5A 5EM0A 1PWGA 2WAEA 2M7UA 3TE8A 1K4FA 3QNBA 1K54C 4I3IA 2G7UA 3VSLA 1PZPA 1D1JA 3MMHA 4H6JB 5E2HA 1TS6A 3ZG8B 1XJ2A 2LB9A 1BUEA 3R4KA 1XA7A 1YPRA 2BTFP 1Y28A 4DXBA 3IS2B 1G6AA 1FILA 4R4SA 3C8CA 1K6RA 2CMNA 4Y15A 1V9YA 2ZQCA 4B93A 2EXBA 3FG8A 4OQHA 4PKYA 4EW7A 1W7FA 3PXPA 4U0XA 3A3IA 2ZQ8A 4DN0A 3IWOA 5K5BA 2HPBA 1NYYA 4FCFA 4N1HA 2ZC5B 1PW8A 1T19A 5M19A 1H5XA 2PU2A 2VKSA 4MN7A 4S2NA 3WS5A 4E3IA 2WZXA 3MZEA 3A0VA 3KSFA 1MWRA 3IH8A 4OVDA 2PBDP 3Q07A 3SZTA 5GHYA 3LIEA 2H10A 1N4OA 4KQDA 1ONGA 3G2ZA 4KUKA 3SS4A 2DNSA 2PAVP 3G4PA 2XQZA 4Q8IA 4FH4A 3BEBA 4KUOA 5A8BA 1RGYA 1IKGA 3MBZA 3EGDC 4P6ZS 2C5WB 3FPWA 2HZ5A 4X1LA 3P98A 4GKUA 2I72A 2JKFA 4HY8A 2R9XA 1TS7A 1OTDA 4JKTA 1KGGA 1CI9A 2V0WA 3UB5P 1E4DA 4BBTA 3B47A 2JCHA 5IHVA 3UO9A 1O7EA 4MBFA 3RXWA 5L10A 2XSSA 4N1XA 1H3QA 5DFYA 5EVLA 1LI0A 3SW1A 5FDSA 2ZMAA 5FASA 3A3JA 3LICA 1NYMA 1P0ZA 2Y2NA 3CAXA 2D02A 2XF3A 4GB7A 4WLAA 1YKDA 4HHDA 4GDBA 2A49A 3VV4A 1XJ3A 4WM9A 3T4QA 4UA9A 1K6SA 5HAPA 4NK3A 2V8CA 3UE1A 1T1CA 4R70A 3R7WB 3ZVWA 3LY3A 1HVBA 3MS6A 3IWIA 4K91A 3IWQA 2HV1A 3IX3A 4BBUA 1W63Q 1EW0A 5CHUA 5U47A 3BECA 3PBTA 4UQIS 3LI9A 4NEED 2WYXA 1FR1A 3S7OA 3PAGA 1LLBA 4DE0A 3QP8A 4CJNA 3MJQA 1SKFA 3A0SA 4WELA 2WGIA 4II7A 3OPRA 4X1MA 2PD8A 3MKEA 3CUEA 1MY8A 1FR6A 5HARA 1ZG6A 1E3UD 1Y54A 4UA7A 3DAVA 2EWWA 1TD5A 1DJBA 3O87A 4EQIA 5CEBA 3WS0A 2OAQ1 1WYBA 4KZ5A 1L2SA 2PDRA 2YKHA 4WEKA 1GHMA 4B4XA 1NRJA 4KQQA 3MQOA 2NUTC 4YFMA 2ACGA 3DBAA 2K31A 4N92A 2Y2GA 1S6RA 2XA7M 4O0PA 2NUPC 3JVVA 3RXXA 4X6TA 2WKPA 2JN7A 2Z2MB 4O7DA 2EA9A 4OLDA 1MZUA 1FSWA 3HLEA 5E43A 3M2JA 1SHVA 1CEFA 1KVMA 1IELA 5HDSA 1PWDA 4OOMA 2VGLM 3H82B 2Y8HA 4PM5A 4KENB 1M40A 2X02A 2Y55A 1HD8A 3HUOA 1NZOA 1IEMA 3MR0A 4I39A 4KZ7A 1PI4A 5GLCA 4NXFA 3W8KA 3FYZA 4ZTKA 3Q7ZA 3MQQA 2OSUA 5DVAA 2WKRA 3BQ8A 2JKGA 3RFBA 1MWSA 3LEZA 1PRQA 4EUZA 2VV6A 4ESPA 2R78A 1H0MA 3WS4A 2JKTM 2WGVA 2VX8A 4Y3IA 3S7PA 4OOLA 5HD5A 2QMIA 2I9VA 4Y5FA 2OOLA 3IHBA 2HDSA 3AGDA 3V50A 5TBMB 4LV2A 3H7WA 3UE6A 3QP4A 1F98A 3E4PA 4HEFA 2B02A 1IOUA 3IF6C 2PRFA 3D4FA 5I5LA 5FAQA 3BY9A 3G30A 1TDLA 1YSPA 2EX2A 3D72A 1GA9A 3E98A 2JBFA 2VK3A 4Y2FA 3EOIA 1OTAA 4AFIA 4DE1A 1NRFA 3LI8A 4PHTA 5GL9A 2HGVA 1KOUA 3VOZA 1LI9A 1PIOA 4RX2A 4JXVA 1F5MA 4I3JA 2WKIA 4OH0A 3ZDJA 2ZOIA 3QHYA 2P74A 3UB8A 1SZVA 1YAXA 5F69A 4KG6A 3NIAA 1BT5A 3LR3A 1I5QA 3NI9A 4L9EA 1JWPA 1G68A 4N9KA 1XPBA 3HREA 3CWFA 1ZC2A 2JHEA 4QY5A 3TRCA 3HLGA 3E0YA 3NCKA 4ZDXA 2AVXA 2V1BA 5J4EA 3IH9A 2EX9A 2QZ6A 3GDIA 4DXCA 1K55C 3CZDA 2ZMVA 1T1BA 4EWFA 5HSQA 2Y4AA 4GLQA 1ACFA 3M2KA 5F68A 3C4PA 2Y2PA 4FSFA 3VFFA 1YT4A 1T18A 1X0OA 1NJ4A 1KE3A 1YLWA 4JXWA 5M1AA 1NLZA 2Y2JA 3BQAA 2VLGA 4S2IA 5DF7A 2Y2KA 2H28A 1S1YA 1W5DA 2EX6A 4KZ9A 4GS9A 2C6WB 5AVFA 4G3WA 5CEDA 3NULA 3G2YA 4HJ3A 1VETB 4PMAA 5DFXA 2Y79A 1U60A 4OQGA 4DRTA 4FD8A 2J3TD 4X69A 3N8LA 3VFHA 1BLSA 1Q2QA 4ZJ2A 1HLUP 2ZLYA 4IUKA 1QMEA 2XFTA 4CLCC 2G2UA 4M3KA 5HWTA 3VP0A 3LR0A 1K0KA 2R9WA 4MN5A 2W3GA 1Z09A 4KZ4A 4HBUA 5DTTA 5IT5A 1JVJA 4EETB 4HBTA 4Z1WA 4EU0A 5TFQA 1PI5A 1ALQA 5CHJA 4P85A 1H8YA 5BOHA 1GSWA 5F1GA 4WL9A 3KYQA 3ZYTA 4UEYA 3NBLA 4E6WA 5CECA 5GLAA 4GHIB 1W8YA 1UWNX 2OLVA 3ZNYA 1OPXA 2W27A 4GD8A 4QU3A 3BYDA 1K25A 5L8MA 1P9WA 3BM6A 1W8QA 1TVFA 3C4OA 3OZHA 2JKRM 4R3BA 5J3WA 4OPQA 3IBRA 2Z6CA 4PM6A 3UE0A 3H82A 2A24B 4LCLA 4E3LA 1SDEA 3G35A 3IHAA 3HLFA 4ARZB 1WYCA 3LR4A 5FQJA 2XR0A 4R3JA 4I38A 4PM7A 3PBOA 4PM9A 4KZBA 2ZBBA 4YOFA 3MSHA 1G28A 2IWBA 4NETA 1TS0A 3NDEA 3IF6A 4GS9B 3VP2A 4EEUA 2ZC6B 3IXDA 5F82A 3F1NB 2FFFB 3Q1FA 4N9LA 3IXGA 4XT2B 3PBNA 3T4JA 4O01A 4JLFA 3PTEA 1L0FA 3LIDA 1S66L 4JF4A 3GV9A 4YINA 3CLOA 5KIZA 1LHYA 3FPVA 1ODVA 1ZG4A 4R23A 2OV5A 4IHQA 1MC0A 4OONA 3ZCZA 1ZTUA 3C5AA 4EUVA 2L4RA 2X01A 2HF6A 4OPZA 2Y2HA 3T4TA 2VGLS 4EBPA 2WKQA 1UGUA 1DP8A 4F3LB 3N7WA 3HLBA 1CI8A 1BSGA 2ZMFA 3M6HA 5DF8A 4BL3A 4R3AA 2M7VA 3GSGA 4DJ2A 4E04A 2QWSA 4X56A 4HQAA 4BLMA 2V8FA 5FAPA 1J3WA 2P9VA 3W4OA 1MXOA 5HWWA 2ZC4B 2KX6A 2J8YA 2XD1A 3N8RA 2QKPA 1K56D 4WMCD 4O8GA 4UQIM 1CQAA 2V1ZA 1O07A 3OC2A 5CGWA 2EX8A 4E3JA 1JTDA 4BWIA 4OQIA 3KX0X 5J7EA 1V9ZA 2VEAA 5HDDA 3OCNA 4RA7A 2JKRI 1FQGA 4R38A 1YSQA 3BFEA 2FH5A 4PKYG 5F6AA 3VSKA 4JF5A 1N9OA 1BLHA 4B4ZA 4BD0A 1W79A 2O9CA 3HJIA 1KE4A 4MMNA 2RCXA 3S7NA 3F1PA 3GVBA 4L9GA 1RCJA 2W1TB 2E8JA 4JF6A 2EWVA 1FSYA 2PD7A 3IBJA 4G3KA 3B42A 4LENA 3FKWA 4OQ0A 1BYWA 5AVEA 2J9OA 4BJPA 2J7VA 3F1OA 4X25A 3UDFA 2ZQDA 4HP9A 4OLGA 1TS8A 1CEGA 5FQ9A 1LL5A 3S7QA 3HUMA 4FTXA 1MWTA 2VGKA 4JGRA 2WADA 2QJ7A 3DTIA 1PNEA 5KSCA 1DY6A 5AJGA 3ZG5A 3GECA 4NXBA 1G5UA 1DJCA 4GZBA 4LRZE 2ZL1A 5TGFA 1XA1A 3UMDA 2PR6A 1OTIA 3GTCA 1PFLA 2VV7A 5AQ7A 3IS2A 4ZRRA 1IFQA 3UB6A 4KZ6A 3VP4A 4BBVA 5L2FA 4R6LA 2O9AA 3I7JA 3MXQA 3UN7A 4FOFA 1JTGA 1GHIA 1GSXA 2HP6A 5CX7A 2XROA 2PHYA 5FI7A 4P6BA 4EXOA 3KO6A 3NC8A 1KE0A 3P01A 3ITBA 1NLYA 2V0UA 5FL3A 1C3BA 1I2SA 2GDNA 5EV0A 5LBRA 1Y4OA 3A3DA 3FV7A 4ZBEA 4RX3A 3VE4A 3N8SA 4UA6A 3NJAA 2BASA 2EXAA 1SCWA 4ARZA 1GSVA 2ZM2A 3EGXC 4B88A 3DWKA 2Y2IA 1KDWA 3FC7A 3MZFA 1W63M 5CXWA 4CPKA 3ZGAB 2ZJ9A 1K57A 5EPHA 3HL9A 1LSVA 2G2WA 2OWJA 4WYYA 4QPRA 2XD5A 1VB6A 4DKIA 3MQ0A 3NOPC 4GW9A 5D3OA 4KQOA 4L0LA 4ZJ3A 5KMWA 4D60A 5A92A 1BLPA 3VMAA 2V1AA 3UB7A 2YKFA 1MKMA 2K2NA 5IU1A 1LT0A 3O3VA 4MBKA 2XRNA 5EVIC 4LGWA 3Q81A 3G34A 4Z9QA 5DJUA 4DF6A 1XJ4A 2DCFA 4R1GA 4DE3A 2P04A 2ZM0A 2O99A 3SS3A 1RGZA 1FCMA 3DTMA 4GOGA 2KDKA 5FSRA 5J8XA 3E4OA 4P0MA 3BRMA 1UWPX 4HESA 1VHMA 2FZ0A 3PBQA 4WN5A 3Q7VB 1QMFA 2ZQAA 3PR6A 3DWZA 3MFXA 4I5SA 3LIBA 3R7WA 4IJGA 5EOOA 3C30A 3ITAA 1NWZA 3BW6A 4H6JA 2Q9NA 5F5YA 4HP4A 1STZA 2Q9MA 1YQSA 4Y17A 4ETXA 2OLUA 5DKKA 3EQUA 3UPOA 1G6OA 2PU4A 5A90A 3OPPA 4PPRA 3KSGA 1ZKJA 4EV4A 3B3XA 4S2KA 5HW3A 1Q2PA 3W4QA 4U3TA 1YLYA 2VZWA 5G4YA 5DTSA 5DKLA 2XDMA 5HL6A 2HJEA 3UB9A 2XEPA 3IT9A 5FQKA 3GRJA 1YM1A 3CG5A 3LO7A 3HVFA 4EESA 3EQVA 5HDCA 3KSHA 4WBGA 5CTNA 3AGFA 2ZD8A 1P9RA 2L0WA 4IBRA 2E8IA 2ZC3B 5HPFA 1K55A 3QP6A 4KZ3A 4MNRA 5KZHA 3F1OB 5EOEA 3TJZC 4NXEA 2W1RA 3WWXA 2IWDA 5CGSA 1TEMA 2X71A 3HCYA 3LFVA 4OOYA 3GMWA 4QHCA 1AWIA 1RP5A 2B5RA 3DW0A 2B18A 3OLOA 3O86A 2K7SA 4QY6A 3E4QA 3VP1A 3Q7VA 3JVUA 3AGEA 3U4LP 4CLCD 1YLPA 3O88A 4DDYA 3DTKA 3RTYA 2A2LA 3HUNA 2Z2LB 5HL1A 2J9PA 3BFGA 4JBFA 4QWOA 4HIAA 3T4LA 2PBYA 5HX9A 1VM1A 4HJ6A 2Q0OA 1BTLA 5FEFA 4Q0IA 2V9AA 3BLMA 1KGEA 3ZG7B 4EERA 3K3CA 2W3DA 4NXGA 3EEAA 3CPTA 4WZ4A 1DP6A 1ES4A 4IUHA 4WZ5A 5EECA 3WS2A 5FA7A 3V3SA 3IXHA 3T4KA 4GCZA 4LCMA 1IKIA 3BFDA 3H7WB 1CK3A 2Y91A 3EEHA 4CQHA 4QD4A 5G4ZA 1GCEA 5CHMA 2W0NA 1S4RA 1OT6A 1IYOA 4QJGA 1TDGA 2DRWA 1N9BA 5HD3A 5JYOA 2Y2OA 3QP1A 1S0WA 3TOIA 3L7HA 4ZAMA 4P6ZM 4HH3A 4LPZA 4DJ3A 4BQMA 3BFFA 3OCLA 2GNXA 2Y2MA 3PBRA 2JE5A 2W3HA 3OBFA 3PAEA 4MBHA 3NDGA 2D01A 5EVIA 4CLCE 3WRZA 3G32A 4WEJA 3FZCA 1MKIA 4BENA 2VV8A 3C7UA 2WAFA 2V2FF 5M18A 3IF5A 3NY4A 2GZAA 2XGNA 5FEGA 3G6OA 3V39A 1EROA 3KYEA 4LV1A 3NECA 2IWCA 3LUQA 4Y0TA 4K0XA 2Z6DA 3T50A 3TG9A 4Q0JA 2EFUA 3CUEC 2HDQA 4WMCA 1MWUA 5FQQA 3UDIA 5EM1A 1K56A 3ZQ5A 2HP5A 3Q82A 4JPMA 2A3UA 3A0RA 3C38A 3N6IA 3UPNA 3N4IA 2Y2QA 2ZQ7A 4NG2A 1L0GA 1FIKA 1K54A 1GHPA 1K57C 1OJ5A 1LL8A 5FDHA 4EBLA 2BG1A 4GN2A 1VEUA 4OPYA 5HPIA 4MLLA 4Y0OA 2GX5A 3D3OA 3CI6A 3B33A 1SKOA 1KDSA 2V20A 1YLZA 3QP2A 3T4SA 4R0QA 4A5RA 1ERQA 1VETA 1OTBA 2KLIA 3PYPA 4ETZA 4JGOA 2WGWB 4E3NA 2LB5A 4L9FA 2QHKA 5TBMA 3CJMA 4GJ4A 4C6YA 3WS1A 5FAOA 2XLNA 3VP3A 3ZG9B 1KGFA 3LR5A 4Y7PA 5EVIB 4LFUA 2MJ6A 2RL3A 4IEDA 5HAQA 1XGIA 3UE3A 4M4XA 4E6XA 1S67L 3MF0A 1HZOA 2FFYA 3HLCA 5EVEA 1WA9A 1ZHHB 4XXRA 5EUAA 4K0WA 3BWLA 2B95A 3HBRA 4U0TA 4D2OA 4MDZA 4BL2A 1Z6FA 4BD1A 1IYSA 3IXBA 1LSXA 1XGJA 5DJTA 3UNWA 1K4EA 3SH7A 1HTZA 1VQQA 4E3OA 4Y13A 3MFDA 1K38A 3ZG0A 3V3RA 2P08A 3T1RA 1FOFA 1P97A 2M1CA 5L09A 1CJFA 2VGJA 1WE4A 1OT9A 4LRYC 2QYBA 4S2NC 4EBNA 1YLTA 3RH8B 2ZC7A 1IYQA 2PR5A 2GJ3A 5CTMA 3ZFZA 4CLCB 5AQAA 2XH9A 1S1ZA 3TW8A 4S2JA 1BLCA 4HJ4A 3ISGA 4UAAA 3LY4A 2H0YA 1DJAA 2J3TC 5GLDA 5L07A 3HLWA 5FI6A 3MKFA 1EWZA 2WKHA 2INWA 4PM8A 3HJKA 3DTEA 4RQ9A 3CPTB 2J80A 2WGWA 3A3EA 4R4RA 3PBSA 4FUWA 3W4PA 3F1NA 1A0KA 2WKEA 3CMZA 3GQZA 1BULA 4XT2A 2PYPA 4LV3A 5HZHA 1M6KA 3HLDA 4KQRA 3MXRA 3BLSA 1OMEA 2OWHA 2PYRA 5FQMA 1YMSA 2VA0A 2WZZA 3LYXA 4EEPA 1LL9A 3ICYA 1CF0A 1IYPA 4F3LA 1PW1A 4WUJA 3S1YA 1ESUA 1N9NA 3W2ZA 4KG5A 3V67A 3TSGA 5CRFA 1ES5A 2UWXA 1AXBA 4S2LA 3KYZA 2O0YA 1OJGA 5TJJA 3SS5A 1FCNA 4JXGA 4GD6A 4FH2A 1ES3A 3MXSA 3S22A 2EFXA 4GNUA 2PT7A 1MBLA 1MPLA 5FQIA 4IBXA 2JC7A 2DMWA 1XFQA 4GHIA 4S2MA 1DRMA 3IX4A 1ONHA 1OTEA 1NZUA 2W3EA 5DTKA 1ERMA 3ULFA 4I3AA 1GA0A 5E2FA 3CITA 3A3FA 1F2KA 4DE2A 4CLCA 5FATA 3BY8A 3ZHHA 3KSIA 5IS1A 1YMXA 3C7VA 3NOTC 1XP4A 3BFCA 3K3DA 5EVID 4XUXA 2A24A 3LEQA 2QPNA 4IVIA 1XFNA 1NXYA 4HOIA 4UHUA 3H9WA 4MEZA 3ZNTA 3FWLA 4GDNA 2J3WA 5AQBA 3S4XA 5MC7A 4WZ5C 1H8MA 4RYEA 1XKZA 2CC1A 3V5MA 4MCWA 1VEUB 5TR7A 1N9LA 2H0TA 1PZOA 3P7NA 1SKOB 5I94A 1BZAA 4ZJ1A 3IX8A 2QJ5A 4JGQA 4G3VA 3SH8A 5KSHA 2XK1A 4LV0A 2OAP1 5CGXA 5HWVA 1J9MA 1D7EA 4KZAA 2L1MA 3UY6A 1XXMA 3IF6B 3E2KA 5HFOA 2HJ9C 1KVLA 1FCOA 3NHQA 5A93A 2ZM8A 1YLJA 3GR2A 5HAIA 1ES2A 2XFSA 1JWZA 4X53A 3RJUA 5FI2A 5C5KA 2HDUA 4E3MA 4BMWA 3VE3A 4ME4A 1JNUA 2ZQ9A 4IVKA 3LCEA 3IQAA 2KOIA 4KG2A 3LIFA 4B9OA 3BJNA 2O9BA 1D06A 2H5SA 4QB8A 2ZL1B 1JWVA 5EE8A 1E25A 4EQ1A 1NY0A 1ESIA 2WK0A 2HP9A 5GHZA 1T1AA 5F1FA 2Y2LA 2BLSA 3OPLA 3SH9A 3MZDA 2P7JA 5A91A 5G18A 3WRTA 5JYPA 4C3QA 1E3UA 4LLOB 2XA7S 3UDXA 2Y59A 2IA2A 4C75A 4YNRA 4OPRA 3K2NA 4E3KA 3VOYA 3PHYA 4PAUA 1TF1A 4YWZA 2P9VB 2UV0E 4X68A 5EFWA 3QNCA 4JGPA 4KZ8A 3T1SA 3OPHA 3LGOA 2JKTI 1EI5A 3CHWP 3VOLA 1SDNA 2ZOHA 5CERA 3P09A 1L3LA 3FKVA 1PWCA 2VJWA 4K08A 3U2AA 1XX2A 3L9KA 3OOVA 2W1TA 1LSWA 1S4SA 5E2GA 4S2PA 1L0EA 2WUQA 4DDSA 3D9YA 3JYIA 3G31A 4H8RA 2W3FA 4F94A 2HDRA 3JPUA 5DF9A 4XUZA 4JXSA 3F1PB 4HH2A 4LRXC 4Q0HA 4MN6A 3ZVTA 4HNBA 3T1XA 5F83A 1I2WA
chains in the Genus database with same CATH topology
4NKPA 1OTBA 3LR3A 2KLIA 3PYPA 4EXOA 4ETZA 4L9EA 3KO6A 4JGOA 3O5YA 3LIAA 3P01A 3C2WA 1NLYA 2V0UA 2LB5A 4L9FA 2QHKA 5FL3A 3CWFA 5TBMA 3UMEA 2JHEA 4GJ4A 3TRCA 5LBRA 4DMZA 1F9IA 3E0YA 3LR5A 3VE4A 2V1BA 4HI4A 5J4EA 1XJ6A 2MJ6A 3GDIA 3NJAA 2BASA 3EWKA 4WF0A 2ZMVA 3UE3A 1DP9A 4M4XA 3NOUC 1T1BA 4ARZA 5HSQA 1GSVA 3T4OA 1S67L 4GLQA 3MF0A 3EGXC 5F68A 4FSFA 1WA9A 2M7UA 3FC7A 3TE8A 1ZHHB 1W63M 4I3IA 1T18A 3BWLA 2G7UA 1X0OA 3MMHA 1LSVA 4H6JB 4MDZA 1TS6A 2OWJA 1XJ2A 2LB9A 4QPRA 1VB6A 3R4KA 3MQ0A 3NOPC 4GW9A 1NLZA 1LSXA 5DJTA 1Y28A 3BQAA 3IS2B 4KQOA 4L0LA 2VLGA 3C8CA 2H28A 1S1YA 2CMNA 2V1AA 3UB7A 1V9YA 1MKMA 2YKFA 4GS9A 2K2NA 4B93A 3FG8A 1LT0A 2P08A 5IU1A 1P97A 4PKYA 2M1CA 2XRNA 5AVFA 4EW7A 4G3WA 3PXPA 5DJUA 1XJ4A 2P04A 4HJ3A 1OT9A 4LRYC 5DFXA 2Y79A 4DN0A 2QYBA 2O99A 5K5BA 2J3TD 2KDKA 3RH8B 2PR5A 1T19A 2GJ3A 3E4OA 2VKSA 4CLCB 4IUKA 1S1ZA 4MN7A 3TW8A 4CLCC 5HWTA 4HJ4A 1UWPX 3LR0A 1VHMA 4MN5A 2W3GA 2FZ0A 3PBQA 4WN5A 3A0VA 2J3TC 3KSFA 5IT5A 3PR6A 4EETB 3MFXA 4I5SA 3LIBA 3R7WA 4IJGA 4Z1WA 2INWA 3C30A 4EU0A 3HJKA 3LIEA 1NWZA 4RQ9A 1GSWA 3BW6A 2J80A 4H6JA 4KQDA 4KUKA 4WL9A 5F5YA 3KYQA 3PBSA 3ZYTA 4UEYA 4HP4A 4KUOA 1STZA 3F1NA 4GHIB 4ETXA 5A8BA 4XT2A 2PYPA 1UWNX 3EGDC 5HZHA 4P6ZS 1OPXA 5DKKA 2W27A 3FPWA 3EQUA 1G6OA 2PYRA 2OWHA 5L8MA 1P9WA 2VA0A 3KSGA 2JKRM 4HY8A 3LYXA 4EEPA 1TS7A 3ICYA 5J3WA 4F3LA 1OTDA 4WUJA 3IBRA 2Z6CA 1N9NA 3W2ZA 5G4YA 2VZWA 3H82A 2A24B 3V67A 5DKLA 2V0WA 4BBTA 5HL6A 3B47A 2HJEA 4ARZB 3LR4A 3KYZA 2O0YA 3UB9A 2XSSA 1OJGA 5TJJA 4I38A 3PBOA 1H3QA 5DFYA 3SW1A 2ZBBA 4YOFA 4EESA 3EQVA 3LICA 3CAXA 1P0ZA 5HDCA 1G28A 2D02A 4WLAA 1YKDA 2PT7A 3KSHA 4HHDA 3VV4A 1XJ3A 1TS0A 4GS9B 2DMWA 3T4QA 4EEUA 1XFQA 1P9RA 2L0WA 3F1NB 4GHIA 1T1CA 5HPFA 4R70A 1DRMA 4XT2B 3PBNA 3F1OB 3R7WB 3T4JA 4O01A 3TJZC 4NXEA 2W1RA 1OTEA 2W3EA 3ULFA 3LIDA 2HV1A 1S66L 4BBUA 4I3AA 1W63Q 1EW0A 3HCYA 3LFVA 3CITA 3PBTA 3CLOA 4UQIS 5KIZA 3LI9A 3FPVA 4CLCA 4NEED 1ODVA 2B18A 3BY8A 3OLOA 3S7OA 3KSIA 5IS1A 2K7SA 3E4QA 3NOTC 4IHQA 3MJQA 1MC0A 3K3DA 1ZTUA 3JVUA 2A24A 4EUVA 3A0SA 2L4RA 4WELA 4CLCD 2HF6A 3RTYA 4II7A 2A2LA 1XFNA 2VGLS 3T4TA 2WKQA 4HOIA 3H9WA 1UGUA 2PD8A 4HIAA 3T4LA 1DP8A 3CUEA 2J3WA 4F3LB 4HJ6A 5MC7A 2ZMFA 1H8MA 2EWWA 1TD5A 4R3AA 4Q0IA 2V9AA 4MCWA 2M7VA 2OAQ1 4EERA 4DJ2A 4E04A 1N9LA 3K3CA 2PDRA 2W3DA 4NXGA 3EEAA 2YKHA 4WEKA 2QWSA 1DP6A 4IUHA 3P7NA 4HQAA 1NRJA 3MQOA 2NUTC 3T4KA 5HWWA 4GCZA 2QJ5A 4JGQA 4G3VA 3DBAA 2K31A 2KX6A 3H7WB 5KSHA 2QKPA 2OAP1 2XA7M 4O0PA 2NUPC 5HWVA 3JVVA 1D7EA 3EEHA 2L1MA 4CQHA 2WKPA 4O8GA 5G4ZA 4UQIM 2JN7A 2HJ9C 2W0NA 1S4RA 3OC2A 3NHQA 2EA9A 1OT6A 1MZUA 4BWIA 5HD3A 3KX0X 5J7EA 1V9ZA 2VEAA 5HDDA 3OCNA 2JKRI 4R38A 4P6ZM 4HH3A 4LPZA 1YSQA 5HDSA 4DJ3A 5C5KA 4OOMA 4BMWA 2FH5A 4PKYG 5F6AA 3VE3A 2VGLM 4ME4A 3H82B 1JNUA 3OCLA 1N9OA 2Y8HA 2GNXA 2KOIA 2O9CA 3HJIA 3PBRA 3LIFA 4B9OA 3BJNA 2O9BA 4MMNA 2W3HA 3OBFA 1D06A 3S7NA 3F1PA 3MR0A 4L9GA 4I39A 4NXFA 2W1TB 4EQ1A 2D01A 4CLCE 2EWVA 1T1AA 2PD7A 3IBJA 4WEJA 4G3KA 3MQQA 3B42A 2VV8A 2WKRA 3BQ8A 2P7JA 3RFBA 2GZAA 4LLOB 2VV6A 2XA7S 3G6OA 2R78A 1BYWA 5AVEA 4BJPA 2IA2A 2JKTM 4YNRA 3F1OA 2VX8A 3LUQA 4Y3IA 3S7PA 3K2NA 4OOLA 5HD5A 4HP9A 3PHYA 4PAUA 2I9VA 4Y5FA 1TS8A 2OOLA 1TF1A 4YWZA 5EFWA 4JGPA 3S7QA 2Z6DA 3T50A 5TBMB 3H7WA 4Q0JA 2JKTI 3UE6A 3CUEC 3VOLA 4JGRA 2QJ7A 1F98A 3E4PA 3ZQ5A 2B02A 1IOUA 5I5LA 2ZOHA 5AJGA 3BY9A 3GECA 4NXBA 1YSPA 3D72A 3A0RA 3C38A 2VJWA 4K08A 3E98A 4LRZE 3U2AA 4Y2FA 3OOVA 3EOIA 1OTAA 2W1TA 3UMDA 4AFIA 1OJ5A 1LSWA 3LI8A 1S4SA 1OTIA 2PR6A 4PHTA 1LL8A 2HGVA 1KOUA 2VV7A 3IS2A 4ZRRA 1IFQA 3UB6A 2W3FA 4BBVA 5DF9A 5HPIA 4R6LA 2O9AA 1F5MA 3F1PB 4HH2A 4LRXC 2GX5A 4I3JA 4Q0HA 3D3OA 3MXQA 3CI6A 3B33A 4FOFA 2ZOIA 4MN6A 4HNBA 1GSXA 3UB8A 5CX7A 1YAXA 5F69A 3T4SA 2XROA 2PHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJN A;  2O9B A;  2W1R A;  4MMN A;  2KLI A;  2W3E A;  2W3H A;  3OBF A;  3S7N A;  1VHM A;  4ETZ A;  3KO6 A;  2W3G A;  3O5Y A;  3HCY A;  2W1T B;  3LFV A;  3C2W A;  3KSF A;  3CIT A;  2LB5 A;  3IBJ A;  4G3K A;  4IJG A;  4Z1W A;  2B18 A;  3S7O A;  3TRC A;  4EU0 A;  5LBR A;  3KSI A;  4DMZ A;  4O01 A;  4RQ9 A;  3NOT C;  3RFB A;  1MC0 A;  3E0Y A;  1ZTU A;  4EUV A;  1STZ A;  3G6O A;  2IA2 A;  4ETX A;  4YNR A;  3NOU C;  4Y3I A;  5HSQ A;  4GLQ A;  3MF0 A;  3K2N A;  3S7P A;  4PAU A;  4Y5F A;  2OOL A;  1TF1 A;  2ZMF A;  5L8M A;  2M7U A;  3S7Q A;  1TD5 A;  3KSG A;  4Q0J A;  4Q0I A;  2M7V A;  4MCW A;  2G7U A;  4E04 A;  2W3D A;  3MMH A;  3EEA A;  4MDZ A;  4IUH A;  3ZQ5 A;  3IBR A;  2LB9 A;  4QPR A;  3W2Z A;  2VZW A;  5I5L A;  3R4K A;  5AJG A;  3MQ0 A;  3NOP C;  4G3V A;  4GW9 A;  3DBA A;  2K31 A;  1YSP A;  5HL6 A;  4O0P A;  2VJW A;  3E98 A;  4LRZ E;  4CQH A;  2O0Y A;  4O8G A;  4Y2F A;  3OOV A;  1MKM A;  2XSS A;  2W1T A;  5TJJ A;  2K2N A;  3NHQ A;  5DFY A;  4YOF A;  2XRN A;  2HGV A;  4BWI A;  4G3W A;  4ZRR A;  2VEA A;  1YKD A;  3KSH A;  2W3F A;  3VV4 A;  5HPI A;  1YSQ A;  4LRY C;  2O9A A;  1F5M A;  2Y79 A;  2QYB A;  4LRX C;  2O99 A;  4R6L A;  5DFX A;  2GX5 A;  4DN0 A;  5C5K A;  4Q0H A;  3D3O A;  5K5B A;  3CI6 A;  4FOF A;  4ME4 A;  2Y8H A;  5HPF A;  4R70 A;  2VKS A;  2XRO A;  4IUK A;  2KOI A;  2O9C A;  4MN7 A; 
#chains in the Genus database with same CATH topology
 4NKP A;  3M6B A;  3O5Y A;  4OKP A;  3LIA A;  4OP5 A;  3C2W A;  4P87 A;  3UPP A;  4RVA A;  3UME A;  1H8Z A;  5AQ9 A;  1L0D A;  4DMZ A;  4Y0U A;  1F9I A;  4HI4 A;  3T12 B;  1XJ6 A;  3E2L A;  4OP8 A;  3SOI A;  5GHX A;  5GLB A;  3EWK A;  4WF0 A;  4X55 A;  5E2E A;  1PYY A;  1DP9 A;  3NOU C;  4ID4 A;  4S2O A;  3T4O A;  3T1Q B;  3QP5 A;  5EM0 A;  1PWG A;  2WAE A;  2M7U A;  3TE8 A;  1K4F A;  3QNB A;  1K54 C;  4I3I A;  2G7U A;  3VSL A;  1PZP A;  1D1J A;  3MMH A;  4H6J B;  5E2H A;  1TS6 A;  3ZG8 B;  1XJ2 A;  2LB9 A;  1BUE A;  3R4K A;  1XA7 A;  1YPR A;  2BTF P;  1Y28 A;  4DXB A;  3IS2 B;  1G6A A;  1FIL A;  4R4S A;  3C8C A;  1K6R A;  2CMN A;  4Y15 A;  1V9Y A;  2ZQC A;  4B93 A;  2EXB A;  3FG8 A;  4OQH A;  4PKY A;  4EW7 A;  1W7F A;  3PXP A;  4U0X A;  3A3I A;  2ZQ8 A;  4DN0 A;  3IWO A;  5K5B A;  2HPB A;  1NYY A;  4FCF A;  4N1H A;  2ZC5 B;  1PW8 A;  1T19 A;  5M19 A;  1H5X A;  2PU2 A;  2VKS A;  4MN7 A;  4S2N A;  3WS5 A;  4E3I A;  2WZX A;  3MZE A;  3A0V A;  3KSF A;  1MWR A;  3IH8 A;  4OVD A;  2PBD P;  3Q07 A;  3SZT A;  5GHY A;  3LIE A;  2H10 A;  1N4O A;  4KQD A;  1ONG A;  3G2Z A;  4KUK A;  3SS4 A;  2DNS A;  2PAV P;  3G4P A;  2XQZ A;  4Q8I A;  4FH4 A;  3BEB A;  4KUO A;  5A8B A;  1RGY A;  1IKG A;  3MBZ A;  3EGD C;  4P6Z S;  2C5W B;  3FPW A;  2HZ5 A;  4X1L A;  3P98 A;  4GKU A;  2I72 A;  2JKF A;  4HY8 A;  2R9X A;  1TS7 A;  1OTD A;  4JKT A;  1KGG A;  1CI9 A;  2V0W A;  3UB5 P;  1E4D A;  4BBT A;  3B47 A;  2JCH A;  5IHV A;  3UO9 A;  1O7E A;  4MBF A;  3RXW A;  5L10 A;  2XSS A;  4N1X A;  1H3Q A;  5DFY A;  5EVL A;  1LI0 A;  3SW1 A;  5FDS A;  2ZMA A;  5FAS A;  3A3J A;  3LIC A;  1NYM A;  1P0Z A;  2Y2N A;  3CAX A;  2D02 A;  2XF3 A;  4GB7 A;  4WLA A;  1YKD A;  4HHD A;  4GDB A;  2A49 A;  3VV4 A;  1XJ3 A;  4WM9 A;  3T4Q A;  4UA9 A;  1K6S A;  5HAP A;  4NK3 A;  2V8C A;  3UE1 A;  1T1C A;  4R70 A;  3R7W B;  3ZVW A;  3LY3 A;  1HVB A;  3MS6 A;  3IWI A;  4K91 A;  3IWQ A;  2HV1 A;  3IX3 A;  4BBU A;  1W63 Q;  1EW0 A;  5CHU A;  5U47 A;  3BEC A;  3PBT A;  4UQI S;  3LI9 A;  4NEE D;  2WYX A;  1FR1 A;  3S7O A;  3PAG A;  1LLB A;  4DE0 A;  3QP8 A;  4CJN A;  3MJQ A;  1SKF A;  3A0S A;  4WEL A;  2WGI A;  4II7 A;  3OPR A;  4X1M A;  2PD8 A;  3MKE A;  3CUE A;  1MY8 A;  1FR6 A;  5HAR A;  1ZG6 A;  1E3U D;  1Y54 A;  4UA7 A;  3DAV A;  2EWW A;  1TD5 A;  1DJB A;  3O87 A;  4EQI A;  5CEB A;  3WS0 A;  2OAQ 1;  1WYB A;  4KZ5 A;  1L2S A;  2PDR A;  2YKH A;  4WEK A;  1GHM A;  4B4X A;  1NRJ A;  4KQQ A;  3MQO A;  2NUT C;  4YFM A;  2ACG A;  3DBA A;  2K31 A;  4N92 A;  2Y2G A;  1S6R A;  2XA7 M;  4O0P A;  2NUP C;  3JVV A;  3RXX A;  4X6T A;  2WKP A;  2JN7 A;  2Z2M B;  4O7D A;  2EA9 A;  4OLD A;  1MZU A;  1FSW A;  3HLE A;  5E43 A;  3M2J A;  1SHV A;  1CEF A;  1KVM A;  1IEL A;  5HDS A;  1PWD A;  4OOM A;  2VGL M;  3H82 B;  2Y8H A;  4PM5 A;  4KEN B;  1M40 A;  2X02 A;  2Y55 A;  1HD8 A;  3HUO A;  1NZO A;  1IEM A;  3MR0 A;  4I39 A;  4KZ7 A;  1PI4 A;  5GLC A;  4NXF A;  3W8K A;  3FYZ A;  4ZTK A;  3Q7Z A;  3MQQ A;  2OSU A;  5DVA A;  2WKR A;  3BQ8 A;  2JKG A;  3RFB A;  1MWS A;  3LEZ A;  1PRQ A;  4EUZ A;  2VV6 A;  4ESP A;  2R78 A;  1H0M A;  3WS4 A;  2JKT M;  2WGV A;  2VX8 A;  4Y3I A;  3S7P A;  4OOL A;  5HD5 A;  2QMI A;  2I9V A;  4Y5F A;  2OOL A;  3IHB A;  2HDS A;  3AGD A;  3V50 A;  5TBM B;  4LV2 A;  3H7W A;  3UE6 A;  3QP4 A;  1F98 A;  3E4P A;  4HEF A;  2B02 A;  1IOU A;  3IF6 C;  2PRF A;  3D4F A;  5I5L A;  5FAQ A;  3BY9 A;  3G30 A;  1TDL A;  1YSP A;  2EX2 A;  3D72 A;  1GA9 A;  3E98 A;  2JBF A;  2VK3 A;  4Y2F A;  3EOI A;  1OTA A;  4AFI A;  4DE1 A;  1NRF A;  3LI8 A;  4PHT A;  5GL9 A;  2HGV A;  1KOU A;  3VOZ A;  1LI9 A;  1PIO A;  4RX2 A;  4JXV A;  1F5M A;  4I3J A;  2WKI A;  4OH0 A;  3ZDJ A;  2ZOI A;  3QHY A;  2P74 A;  3UB8 A;  1SZV A;  1YAX A;  5F69 A;  4KG6 A;  3NIA A;  1BT5 A;  3LR3 A;  1I5Q A;  3NI9 A;  4L9E A;  1JWP A;  1G68 A;  4N9K A;  1XPB A;  3HRE A;  3CWF A;  1ZC2 A;  2JHE A;  4QY5 A;  3TRC A;  3HLG A;  3E0Y A;  3NCK A;  4ZDX A;  2AVX A;  2V1B A;  5J4E A;  3IH9 A;  2EX9 A;  2QZ6 A;  3GDI A;  4DXC A;  1K55 C;  3CZD A;  2ZMV A;  1T1B A;  4EWF A;  5HSQ A;  2Y4A A;  4GLQ A;  1ACF A;  3M2K A;  5F68 A;  3C4P A;  2Y2P A;  4FSF A;  3VFF A;  1YT4 A;  1T18 A;  1X0O A;  1NJ4 A;  1KE3 A;  1YLW A;  4JXW A;  5M1A A;  1NLZ A;  2Y2J A;  3BQA A;  2VLG A;  4S2I A;  5DF7 A;  2Y2K A;  2H28 A;  1S1Y A;  1W5D A;  2EX6 A;  4KZ9 A;  4GS9 A;  2C6W B;  5AVF A;  4G3W A;  5CED A;  3NUL A;  3G2Y A;  4HJ3 A;  1VET B;  4PMA A;  5DFX A;  2Y79 A;  1U60 A;  4OQG A;  4DRT A;  4FD8 A;  2J3T D;  4X69 A;  3N8L A;  3VFH A;  1BLS A;  1Q2Q A;  4ZJ2 A;  1HLU P;  2ZLY A;  4IUK A;  1QME A;  2XFT A;  4CLC C;  2G2U A;  4M3K A;  5HWT A;  3VP0 A;  3LR0 A;  1K0K A;  2R9W A;  4MN5 A;  2W3G A;  1Z09 A;  4KZ4 A;  4HBU A;  5DTT A;  5IT5 A;  1JVJ A;  4EET B;  4HBT A;  4Z1W A;  4EU0 A;  5TFQ A;  1PI5 A;  1ALQ A;  5CHJ A;  4P85 A;  1H8Y A;  5BOH A;  1GSW A;  5F1G A;  4WL9 A;  3KYQ A;  3ZYT A;  4UEY A;  3NBL A;  4E6W A;  5CEC A;  5GLA A;  4GHI B;  1W8Y A;  1UWN X;  2OLV A;  3ZNY A;  1OPX A;  2W27 A;  4GD8 A;  4QU3 A;  3BYD A;  1K25 A;  5L8M A;  1P9W A;  3BM6 A;  1W8Q A;  1TVF A;  3C4O A;  3OZH A;  2JKR M;  4R3B A;  5J3W A;  4OPQ A;  3IBR A;  2Z6C A;  4PM6 A;  3UE0 A;  3H82 A;  2A24 B;  4LCL A;  4E3L A;  1SDE A;  3G35 A;  3IHA A;  3HLF A;  4ARZ B;  1WYC A;  3LR4 A;  5FQJ A;  2XR0 A;  4R3J A;  4I38 A;  4PM7 A;  3PBO A;  4PM9 A;  4KZB A;  2ZBB A;  4YOF A;  3MSH A;  1G28 A;  2IWB A;  4NET A;  1TS0 A;  3NDE A;  3IF6 A;  4GS9 B;  3VP2 A;  4EEU A;  2ZC6 B;  3IXD A;  5F82 A;  3F1N B;  2FFF B;  3Q1F A;  4N9L A;  3IXG A;  4XT2 B;  3PBN A;  3T4J A;  4O01 A;  4JLF A;  3PTE A;  1L0F A;  3LID A;  1S66 L;  4JF4 A;  3GV9 A;  4YIN A;  3CLO A;  5KIZ A;  1LHY A;  3FPV A;  1ODV A;  1ZG4 A;  4R23 A;  2OV5 A;  4IHQ A;  1MC0 A;  4OON A;  3ZCZ A;  1ZTU A;  3C5A A;  4EUV A;  2L4R A;  2X01 A;  2HF6 A;  4OPZ A;  2Y2H A;  3T4T A;  2VGL S;  4EBP A;  2WKQ A;  1UGU A;  1DP8 A;  4F3L B;  3N7W A;  3HLB A;  1CI8 A;  1BSG A;  2ZMF A;  3M6H A;  5DF8 A;  4BL3 A;  4R3A A;  2M7V A;  3GSG A;  4DJ2 A;  4E04 A;  2QWS A;  4X56 A;  4HQA A;  4BLM A;  2V8F A;  5FAP A;  1J3W A;  2P9V A;  3W4O A;  1MXO A;  5HWW A;  2ZC4 B;  2KX6 A;  2J8Y A;  2XD1 A;  3N8R A;  2QKP A;  1K56 D;  4WMC D;  4O8G A;  4UQI M;  1CQA A;  2V1Z A;  1O07 A;  3OC2 A;  5CGW A;  2EX8 A;  4E3J A;  1JTD A;  4BWI A;  4OQI A;  3KX0 X;  5J7E A;  1V9Z A;  2VEA A;  5HDD A;  3OCN A;  4RA7 A;  2JKR I;  1FQG A;  4R38 A;  1YSQ A;  3BFE A;  2FH5 A;  4PKY G;  5F6A A;  3VSK A;  4JF5 A;  1N9O A;  1BLH A;  4B4Z A;  4BD0 A;  1W79 A;  2O9C A;  3HJI A;  1KE4 A;  4MMN A;  2RCX A;  3S7N A;  3F1P A;  3GVB A;  4L9G A;  1RCJ A;  2W1T B;  2E8J A;  4JF6 A;  2EWV A;  1FSY A;  2PD7 A;  3IBJ A;  4G3K A;  3B42 A;  4LEN A;  3FKW A;  4OQ0 A;  1BYW A;  5AVE A;  2J9O A;  4BJP A;  2J7V A;  3F1O A;  4X25 A;  3UDF A;  2ZQD A;  4HP9 A;  4OLG A;  1TS8 A;  1CEG A;  5FQ9 A;  1LL5 A;  3S7Q A;  3HUM A;  4FTX A;  1MWT A;  2VGK A;  4JGR A;  2WAD A;  2QJ7 A;  3DTI A;  1PNE A;  5KSC A;  1DY6 A;  5AJG A;  3ZG5 A;  3GEC A;  4NXB A;  1G5U A;  1DJC A;  4GZB A;  4LRZ E;  2ZL1 A;  5TGF A;  1XA1 A;  3UMD A;  2PR6 A;  1OTI A;  3GTC A;  1PFL A;  2VV7 A;  5AQ7 A;  3IS2 A;  4ZRR A;  1IFQ A;  3UB6 A;  4KZ6 A;  3VP4 A;  4BBV A;  5L2F A;  4R6L A;  2O9A A;  3I7J A;  3MXQ A;  3UN7 A;  4FOF A;  1JTG A;  1GHI A;  1GSX A;  2HP6 A;  5CX7 A;  2XRO A;  2PHY A;  5FI7 A;  4P6B A;  4EXO A;  3KO6 A;  3NC8 A;  1KE0 A;  3P01 A;  3ITB A;  1NLY A;  2V0U A;  5FL3 A;  1C3B A;  1I2S A;  2GDN A;  5EV0 A;  5LBR A;  1Y4O A;  3A3D A;  3FV7 A;  4ZBE A;  4RX3 A;  3VE4 A;  3N8S A;  4UA6 A;  3NJA A;  2BAS A;  2EXA A;  1SCW A;  4ARZ A;  1GSV A;  2ZM2 A;  3EGX C;  4B88 A;  3DWK A;  2Y2I A;  1KDW A;  3FC7 A;  3MZF A;  1W63 M;  5CXW A;  4CPK A;  3ZGA B;  2ZJ9 A;  1K57 A;  5EPH A;  3HL9 A;  1LSV A;  2G2W A;  2OWJ A;  4WYY A;  4QPR A;  2XD5 A;  1VB6 A;  4DKI A;  3MQ0 A;  3NOP C;  4GW9 A;  5D3O A;  4KQO A;  4L0L A;  4ZJ3 A;  5KMW A;  4D60 A;  5A92 A;  1BLP A;  3VMA A;  2V1A A;  3UB7 A;  2YKF A;  1MKM A;  2K2N A;  5IU1 A;  1LT0 A;  3O3V A;  4MBK A;  2XRN A;  5EVI C;  4LGW A;  3Q81 A;  3G34 A;  4Z9Q A;  5DJU A;  4DF6 A;  1XJ4 A;  2DCF A;  4R1G A;  4DE3 A;  2P04 A;  2ZM0 A;  2O99 A;  3SS3 A;  1RGZ A;  1FCM A;  3DTM A;  4GOG A;  2KDK A;  5FSR A;  5J8X A;  3E4O A;  4P0M A;  3BRM A;  1UWP X;  4HES A;  1VHM A;  2FZ0 A;  3PBQ A;  4WN5 A;  3Q7V B;  1QMF A;  2ZQA A;  3PR6 A;  3DWZ A;  3MFX A;  4I5S A;  3LIB A;  3R7W A;  4IJG A;  5EOO A;  3C30 A;  3ITA A;  1NWZ A;  3BW6 A;  4H6J A;  2Q9N A;  5F5Y A;  4HP4 A;  1STZ A;  2Q9M A;  1YQS A;  4Y17 A;  4ETX A;  2OLU A;  5DKK A;  3EQU A;  3UPO A;  1G6O A;  2PU4 A;  5A90 A;  3OPP A;  4PPR A;  3KSG A;  1ZKJ A;  4EV4 A;  3B3X A;  4S2K A;  5HW3 A;  1Q2P A;  3W4Q A;  4U3T A;  1YLY A;  2VZW A;  5G4Y A;  5DTS A;  5DKL A;  2XDM A;  5HL6 A;  2HJE A;  3UB9 A;  2XEP A;  3IT9 A;  5FQK A;  3GRJ A;  1YM1 A;  3CG5 A;  3LO7 A;  3HVF A;  4EES A;  3EQV A;  5HDC A;  3KSH A;  4WBG A;  5CTN A;  3AGF A;  2ZD8 A;  1P9R A;  2L0W A;  4IBR A;  2E8I A;  2ZC3 B;  5HPF A;  1K55 A;  3QP6 A;  4KZ3 A;  4MNR A;  5KZH A;  3F1O B;  5EOE A;  3TJZ C;  4NXE A;  2W1R A;  3WWX A;  2IWD A;  5CGS A;  1TEM A;  2X71 A;  3HCY A;  3LFV A;  4OOY A;  3GMW A;  4QHC A;  1AWI A;  1RP5 A;  2B5R A;  3DW0 A;  2B18 A;  3OLO A;  3O86 A;  2K7S A;  4QY6 A;  3E4Q A;  3VP1 A;  3Q7V A;  3JVU A;  3AGE A;  3U4L P;  4CLC D;  1YLP A;  3O88 A;  4DDY A;  3DTK A;  3RTY A;  2A2L A;  3HUN A;  2Z2L B;  5HL1 A;  2J9P A;  3BFG A;  4JBF A;  4QWO A;  4HIA A;  3T4L A;  2PBY A;  5HX9 A;  1VM1 A;  4HJ6 A;  2Q0O A;  1BTL A;  5FEF A;  4Q0I A;  2V9A A;  3BLM A;  1KGE A;  3ZG7 B;  4EER A;  3K3C A;  2W3D A;  4NXG A;  3EEA A;  3CPT A;  4WZ4 A;  1DP6 A;  1ES4 A;  4IUH A;  4WZ5 A;  5EEC A;  3WS2 A;  5FA7 A;  3V3S A;  3IXH A;  3T4K A;  4GCZ A;  4LCM A;  1IKI A;  3BFD A;  3H7W B;  1CK3 A;  2Y91 A;  3EEH A;  4CQH A;  4QD4 A;  5G4Z A;  1GCE A;  5CHM A;  2W0N A;  1S4R A;  1OT6 A;  1IYO A;  4QJG A;  1TDG A;  2DRW A;  1N9B A;  5HD3 A;  5JYO A;  2Y2O A;  3QP1 A;  1S0W A;  3TOI A;  3L7H A;  4ZAM A;  4P6Z M;  4HH3 A;  4LPZ A;  4DJ3 A;  4BQM A;  3BFF A;  3OCL A;  2GNX A;  2Y2M A;  3PBR A;  2JE5 A;  2W3H A;  3OBF A;  3PAE A;  4MBH A;  3NDG A;  2D01 A;  5EVI A;  4CLC E;  3WRZ A;  3G32 A;  4WEJ A;  3FZC A;  1MKI A;  4BEN A;  2VV8 A;  3C7U A;  2WAF A;  2V2F F;  5M18 A;  3IF5 A;  3NY4 A;  2GZA A;  2XGN A;  5FEG A;  3G6O A;  3V39 A;  1ERO A;  3KYE A;  4LV1 A;  3NEC A;  2IWC A;  3LUQ A;  4Y0T A;  4K0X A;  2Z6D A;  3T50 A;  3TG9 A;  4Q0J A;  2EFU A;  3CUE C;  2HDQ A;  4WMC A;  1MWU A;  5FQQ A;  3UDI A;  5EM1 A;  1K56 A;  3ZQ5 A;  2HP5 A;  3Q82 A;  4JPM A;  2A3U A;  3A0R A;  3C38 A;  3N6I A;  3UPN A;  3N4I A;  2Y2Q A;  2ZQ7 A;  4NG2 A;  1L0G A;  1FIK A;  1K54 A;  1GHP A;  1K57 C;  1OJ5 A;  1LL8 A;  5FDH A;  4EBL A;  2BG1 A;  4GN2 A;  1VEU A;  4OPY A;  5HPI A;  4MLL A;  4Y0O A;  2GX5 A;  3D3O A;  3CI6 A;  3B33 A;  1SKO A;  1KDS A;  2V20 A;  1YLZ A;  3QP2 A;  3T4S A;  4R0Q A;  4A5R A;  1ERQ A;  1VET A;  1OTB A;  2KLI A;  3PYP A;  4ETZ A;  4JGO A;  2WGW B;  4E3N A;  2LB5 A;  4L9F A;  2QHK A;  5TBM A;  3CJM A;  4GJ4 A;  4C6Y A;  3WS1 A;  5FAO A;  2XLN A;  3VP3 A;  3ZG9 B;  1KGF A;  3LR5 A;  4Y7P A;  5EVI B;  4LFU A;  2MJ6 A;  2RL3 A;  4IED A;  5HAQ A;  1XGI A;  3UE3 A;  4M4X A;  4E6X A;  1S67 L;  3MF0 A;  1HZO A;  2FFY A;  3HLC A;  5EVE A;  1WA9 A;  1ZHH B;  4XXR A;  5EUA A;  4K0W A;  3BWL A;  2B95 A;  3HBR A;  4U0T A;  4D2O A;  4MDZ A;  4BL2 A;  1Z6F A;  4BD1 A;  1IYS A;  3IXB A;  1LSX A;  1XGJ A;  5DJT A;  3UNW A;  1K4E A;  3SH7 A;  1HTZ A;  1VQQ A;  4E3O A;  4Y13 A;  3MFD A;  1K38 A;  3ZG0 A;  3V3R A;  2P08 A;  3T1R A;  1FOF A;  1P97 A;  2M1C A;  5L09 A;  1CJF A;  2VGJ A;  1WE4 A;  1OT9 A;  4LRY C;  2QYB A;  4S2N C;  4EBN A;  1YLT A;  3RH8 B;  2ZC7 A;  1IYQ A;  2PR5 A;  2GJ3 A;  5CTM A;  3ZFZ A;  4CLC B;  5AQA A;  2XH9 A;  1S1Z A;  3TW8 A;  4S2J A;  1BLC A;  4HJ4 A;  3ISG A;  4UAA A;  3LY4 A;  2H0Y A;  1DJA A;  2J3T C;  5GLD A;  5L07 A;  3HLW A;  5FI6 A;  3MKF A;  1EWZ A;  2WKH A;  2INW A;  4PM8 A;  3HJK A;  3DTE A;  4RQ9 A;  3CPT B;  2J80 A;  2WGW A;  3A3E A;  4R4R A;  3PBS A;  4FUW A;  3W4P A;  3F1N A;  1A0K A;  2WKE A;  3CMZ A;  3GQZ A;  1BUL A;  4XT2 A;  2PYP A;  4LV3 A;  5HZH A;  1M6K A;  3HLD A;  4KQR A;  3MXR A;  3BLS A;  1OME A;  2OWH A;  2PYR A;  5FQM A;  1YMS A;  2VA0 A;  2WZZ A;  3LYX A;  4EEP A;  1LL9 A;  3ICY A;  1CF0 A;  1IYP A;  4F3L A;  1PW1 A;  4WUJ A;  3S1Y A;  1ESU A;  1N9N A;  3W2Z A;  4KG5 A;  3V67 A;  3TSG A;  5CRF A;  1ES5 A;  2UWX A;  1AXB A;  4S2L A;  3KYZ A;  2O0Y A;  1OJG A;  5TJJ A;  3SS5 A;  1FCN A;  4JXG A;  4GD6 A;  4FH2 A;  1ES3 A;  3MXS A;  3S22 A;  2EFX A;  4GNU A;  2PT7 A;  1MBL A;  1MPL A;  5FQI A;  4IBX A;  2JC7 A;  2DMW A;  1XFQ A;  4GHI A;  4S2M A;  1DRM A;  3IX4 A;  1ONH A;  1OTE A;  1NZU A;  2W3E A;  5DTK A;  1ERM A;  3ULF A;  4I3A A;  1GA0 A;  5E2F A;  3CIT A;  3A3F A;  1F2K A;  4DE2 A;  4CLC A;  5FAT A;  3BY8 A;  3ZHH A;  3KSI A;  5IS1 A;  1YMX A;  3C7V A;  3NOT C;  1XP4 A;  3BFC A;  3K3D A;  5EVI D;  4XUX A;  2A24 A;  3LEQ A;  2QPN A;  4IVI A;  1XFN A;  1NXY A;  4HOI A;  4UHU A;  3H9W A;  4MEZ A;  3ZNT A;  3FWL A;  4GDN A;  2J3W A;  5AQB A;  3S4X A;  5MC7 A;  4WZ5 C;  1H8M A;  4RYE A;  1XKZ A;  2CC1 A;  3V5M A;  4MCW A;  1VEU B;  5TR7 A;  1N9L A;  2H0T A;  1PZO A;  3P7N A;  1SKO B;  5I94 A;  1BZA A;  4ZJ1 A;  3IX8 A;  2QJ5 A;  4JGQ A;  4G3V A;  3SH8 A;  5KSH A;  2XK1 A;  4LV0 A;  2OAP 1;  5CGX A;  5HWV A;  1J9M A;  1D7E A;  4KZA A;  2L1M A;  3UY6 A;  1XXM A;  3IF6 B;  3E2K A;  5HFO A;  2HJ9 C;  1KVL A;  1FCO A;  3NHQ A;  5A93 A;  2ZM8 A;  1YLJ A;  3GR2 A;  5HAI A;  1ES2 A;  2XFS A;  1JWZ A;  4X53 A;  3RJU A;  5FI2 A;  5C5K A;  2HDU A;  4E3M A;  4BMW A;  3VE3 A;  4ME4 A;  1JNU A;  2ZQ9 A;  4IVK A;  3LCE A;  3IQA A;  2KOI A;  4KG2 A;  3LIF A;  4B9O A;  3BJN A;  2O9B A;  1D06 A;  2H5S A;  4QB8 A;  2ZL1 B;  1JWV A;  5EE8 A;  1E25 A;  4EQ1 A;  1NY0 A;  1ESI A;  2WK0 A;  2HP9 A;  5GHZ A;  1T1A A;  5F1F A;  2Y2L A;  2BLS A;  3OPL A;  3SH9 A;  3MZD A;  2P7J A;  5A91 A;  5G18 A;  3WRT A;  5JYP A;  4C3Q A;  1E3U A;  4LLO B;  2XA7 S;  3UDX A;  2Y59 A;  2IA2 A;  4C75 A;  4YNR A;  4OPR A;  3K2N A;  4E3K A;  3VOY A;  3PHY A;  4PAU A;  1TF1 A;  4YWZ A;  2P9V B;  2UV0 E;  4X68 A;  5EFW A;  3QNC A;  4JGP A;  4KZ8 A;  3T1S A;  3OPH A;  3LGO A;  2JKT I;  1EI5 A;  3CHW P;  3VOL A;  1SDN A;  2ZOH A;  5CER A;  3P09 A;  1L3L A;  3FKV A;  1PWC A;  2VJW A;  4K08 A;  3U2A A;  1XX2 A;  3L9K A;  3OOV A;  2W1T A;  1LSW A;  1S4S A;  5E2G A;  4S2P A;  1L0E A;  2WUQ A;  4DDS A;  3D9Y A;  3JYI A;  3G31 A;  4H8R A;  2W3F A;  4F94 A;  2HDR A;  3JPU A;  5DF9 A;  4XUZ A;  4JXS A;  3F1P B;  4HH2 A;  4LRX C;  4Q0H A;  4MN6 A;  3ZVT A;  4HNB A;  3T1X A;  5F83 A;  1I2W A; 
#chains in the Genus database with same CATH homology
 4NKP A;  1OTB A;  3LR3 A;  2KLI A;  3PYP A;  4EXO A;  4ETZ A;  4L9E A;  3KO6 A;  4JGO A;  3O5Y A;  3LIA A;  3P01 A;  3C2W A;  1NLY A;  2V0U A;  2LB5 A;  4L9F A;  2QHK A;  5FL3 A;  3CWF A;  5TBM A;  3UME A;  2JHE A;  4GJ4 A;  3TRC A;  5LBR A;  4DMZ A;  1F9I A;  3E0Y A;  3LR5 A;  3VE4 A;  2V1B A;  4HI4 A;  5J4E A;  1XJ6 A;  2MJ6 A;  3GDI A;  3NJA A;  2BAS A;  3EWK A;  4WF0 A;  2ZMV A;  3UE3 A;  1DP9 A;  4M4X A;  3NOU C;  1T1B A;  4ARZ A;  5HSQ A;  1GSV A;  3T4O A;  1S67 L;  4GLQ A;  3MF0 A;  3EGX C;  5F68 A;  4FSF A;  1WA9 A;  2M7U A;  3FC7 A;  3TE8 A;  1ZHH B;  1W63 M;  4I3I A;  1T18 A;  3BWL A;  2G7U A;  1X0O A;  3MMH A;  1LSV A;  4H6J B;  4MDZ A;  1TS6 A;  2OWJ A;  1XJ2 A;  2LB9 A;  4QPR A;  1VB6 A;  3R4K A;  3MQ0 A;  3NOP C;  4GW9 A;  1NLZ A;  1LSX A;  5DJT A;  1Y28 A;  3BQA A;  3IS2 B;  4KQO A;  4L0L A;  2VLG A;  3C8C A;  2H28 A;  1S1Y A;  2CMN A;  2V1A A;  3UB7 A;  1V9Y A;  1MKM A;  2YKF A;  4GS9 A;  2K2N A;  4B93 A;  3FG8 A;  1LT0 A;  2P08 A;  5IU1 A;  1P97 A;  4PKY A;  2M1C A;  2XRN A;  5AVF A;  4EW7 A;  4G3W A;  3PXP A;  5DJU A;  1XJ4 A;  2P04 A;  4HJ3 A;  1OT9 A;  4LRY C;  5DFX A;  2Y79 A;  4DN0 A;  2QYB A;  2O99 A;  5K5B A;  2J3T D;  2KDK A;  3RH8 B;  2PR5 A;  1T19 A;  2GJ3 A;  3E4O A;  2VKS A;  4CLC B;  4IUK A;  1S1Z A;  4MN7 A;  3TW8 A;  4CLC C;  5HWT A;  4HJ4 A;  1UWP X;  3LR0 A;  1VHM A;  4MN5 A;  2W3G A;  2FZ0 A;  3PBQ A;  4WN5 A;  3A0V A;  2J3T C;  3KSF A;  5IT5 A;  3PR6 A;  4EET B;  3MFX A;  4I5S A;  3LIB A;  3R7W A;  4IJG A;  4Z1W A;  2INW A;  3C30 A;  4EU0 A;  3HJK A;  3LIE A;  1NWZ A;  4RQ9 A;  1GSW A;  3BW6 A;  2J80 A;  4H6J A;  4KQD A;  4KUK A;  4WL9 A;  5F5Y A;  3KYQ A;  3PBS A;  3ZYT A;  4UEY A;  4HP4 A;  4KUO A;  1STZ A;  3F1N A;  4GHI B;  4ETX A;  5A8B A;  4XT2 A;  2PYP A;  1UWN X;  3EGD C;  5HZH A;  4P6Z S;  1OPX A;  5DKK A;  2W27 A;  3FPW A;  3EQU A;  1G6O A;  2PYR A;  2OWH A;  5L8M A;  1P9W A;  2VA0 A;  3KSG A;  2JKR M;  4HY8 A;  3LYX A;  4EEP A;  1TS7 A;  3ICY A;  5J3W A;  4F3L A;  1OTD A;  4WUJ A;  3IBR A;  2Z6C A;  1N9N A;  3W2Z A;  5G4Y A;  2VZW A;  3H82 A;  2A24 B;  3V67 A;  5DKL A;  2V0W A;  4BBT A;  5HL6 A;  3B47 A;  2HJE A;  4ARZ B;  3LR4 A;  3KYZ A;  2O0Y A;  3UB9 A;  2XSS A;  1OJG A;  5TJJ A;  4I38 A;  3PBO A;  1H3Q A;  5DFY A;  3SW1 A;  2ZBB A;  4YOF A;  4EES A;  3EQV A;  3LIC A;  3CAX A;  1P0Z A;  5HDC A;  1G28 A;  2D02 A;  4WLA A;  1YKD A;  2PT7 A;  3KSH A;  4HHD A;  3VV4 A;  1XJ3 A;  1TS0 A;  4GS9 B;  2DMW A;  3T4Q A;  4EEU A;  1XFQ A;  1P9R A;  2L0W A;  3F1N B;  4GHI A;  1T1C A;  5HPF A;  4R70 A;  1DRM A;  4XT2 B;  3PBN A;  3F1O B;  3R7W B;  3T4J A;  4O01 A;  3TJZ C;  4NXE A;  2W1R A;  1OTE A;  2W3E A;  3ULF A;  3LID A;  2HV1 A;  1S66 L;  4BBU A;  4I3A A;  1W63 Q;  1EW0 A;  3HCY A;  3LFV A;  3CIT A;  3PBT A;  3CLO A;  4UQI S;  5KIZ A;  3LI9 A;  3FPV A;  4CLC A;  4NEE D;  1ODV A;  2B18 A;  3BY8 A;  3OLO A;  3S7O A;  3KSI A;  5IS1 A;  2K7S A;  3E4Q A;  3NOT C;  4IHQ A;  3MJQ A;  1MC0 A;  3K3D A;  1ZTU A;  3JVU A;  2A24 A;  4EUV A;  3A0S A;  2L4R A;  4WEL A;  4CLC D;  2HF6 A;  3RTY A;  4II7 A;  2A2L A;  1XFN A;  2VGL S;  3T4T A;  2WKQ A;  4HOI A;  3H9W A;  1UGU A;  2PD8 A;  4HIA A;  3T4L A;  1DP8 A;  3CUE A;  2J3W A;  4F3L B;  4HJ6 A;  5MC7 A;  2ZMF A;  1H8M A;  2EWW A;  1TD5 A;  4R3A A;  4Q0I A;  2V9A A;  4MCW A;  2M7V A;  2OAQ 1;  4EER A;  4DJ2 A;  4E04 A;  1N9L A;  3K3C A;  2PDR A;  2W3D A;  4NXG A;  3EEA A;  2YKH A;  4WEK A;  2QWS A;  1DP6 A;  4IUH A;  3P7N A;  4HQA A;  1NRJ A;  3MQO A;  2NUT C;  3T4K A;  5HWW A;  4GCZ A;  2QJ5 A;  4JGQ A;  4G3V A;  3DBA A;  2K31 A;  2KX6 A;  3H7W B;  5KSH A;  2QKP A;  2OAP 1;  2XA7 M;  4O0P A;  2NUP C;  5HWV A;  3JVV A;  1D7E A;  3EEH A;  2L1M A;  4CQH A;  2WKP A;  4O8G A;  5G4Z A;  4UQI M;  2JN7 A;  2HJ9 C;  2W0N A;  1S4R A;  3OC2 A;  3NHQ A;  2EA9 A;  1OT6 A;  1MZU A;  4BWI A;  5HD3 A;  3KX0 X;  5J7E A;  1V9Z A;  2VEA A;  5HDD A;  3OCN A;  2JKR I;  4R38 A;  4P6Z M;  4HH3 A;  4LPZ A;  1YSQ A;  5HDS A;  4DJ3 A;  5C5K A;  4OOM A;  4BMW A;  2FH5 A;  4PKY G;  5F6A A;  3VE3 A;  2VGL M;  4ME4 A;  3H82 B;  1JNU A;  3OCL A;  1N9O A;  2Y8H A;  2GNX A;  2KOI A;  2O9C A;  3HJI A;  3PBR A;  3LIF A;  4B9O A;  3BJN A;  2O9B A;  4MMN A;  2W3H A;  3OBF A;  1D06 A;  3S7N A;  3F1P A;  3MR0 A;  4L9G A;  4I39 A;  4NXF A;  2W1T B;  4EQ1 A;  2D01 A;  4CLC E;  2EWV A;  1T1A A;  2PD7 A;  3IBJ A;  4WEJ A;  4G3K A;  3MQQ A;  3B42 A;  2VV8 A;  2WKR A;  3BQ8 A;  2P7J A;  3RFB A;  2GZA A;  4LLO B;  2VV6 A;  2XA7 S;  3G6O A;  2R78 A;  1BYW A;  5AVE A;  4BJP A;  2IA2 A;  2JKT M;  4YNR A;  3F1O A;  2VX8 A;  3LUQ A;  4Y3I A;  3S7P A;  3K2N A;  4OOL A;  5HD5 A;  4HP9 A;  3PHY A;  4PAU A;  2I9V A;  4Y5F A;  1TS8 A;  2OOL A;  1TF1 A;  4YWZ A;  5EFW A;  4JGP A;  3S7Q A;  2Z6D A;  3T50 A;  5TBM B;  3H7W A;  4Q0J A;  2JKT I;  3UE6 A;  3CUE C;  3VOL A;  4JGR A;  2QJ7 A;  1F98 A;  3E4P A;  3ZQ5 A;  2B02 A;  1IOU A;  5I5L A;  2ZOH A;  5AJG A;  3BY9 A;  3GEC A;  4NXB A;  1YSP A;  3D72 A;  3A0R A;  3C38 A;  2VJW A;  4K08 A;  3E98 A;  4LRZ E;  3U2A A;  4Y2F A;  3OOV A;  3EOI A;  1OTA A;  2W1T A;  3UMD A;  4AFI A;  1OJ5 A;  1LSW A;  3LI8 A;  1S4S A;  1OTI A;  2PR6 A;  4PHT A;  1LL8 A;  2HGV A;  1KOU A;  2VV7 A;  3IS2 A;  4ZRR A;  1IFQ A;  3UB6 A;  2W3F A;  4BBV A;  5DF9 A;  5HPI A;  4R6L A;  2O9A A;  1F5M A;  3F1P B;  4HH2 A;  4LRX C;  2GX5 A;  4I3J A;  4Q0H A;  3D3O A;  3MXQ A;  3CI6 A;  3B33 A;  4FOF A;  2ZOI A;  4MN6 A;  4HNB A;  1GSX A;  3UB8 A;  5CX7 A;  1YAX A;  5F69 A;  3T4S A;  2XRO A;  2PHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...