2M7UA

Blue light-absorbing state of tepixj, an active cyanobacteriochrome domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
165
structure length
165
Chain Sequence
MAAVQLSELRDRQAIFETLVAKGRELLACDRVIVYAFDDNYVGTVVAESVAEGWPQARDQVIEDPCFREHWVEAYRQGRIQATTDIFKAGLTECHLNQLRPLKVRANLVVPMVIDDQLFGLLIAHQASEPRQWQEIEIDQFSELASTGSLVLERLHFLEQTIASL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein
publication title Structural and Flexibility Variations Between the Ground and Photoactivated States of a Blue/Green Light-Absorbing Cyanobacteriochrome
rcsb
source organism Thermosynechococcus elongatus
total genus 32
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2013-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2m7uA00
5HL6A 4FOFA 3DBAA 2GX5A 4MCWA 4RQ9A 3NOPC 5HPIA 4R70A 2Y8HA 4ME4A 3CI6A 3NOTC 5AJGA 3C2WA 2O9BA 4PAUA 2QYBA 2VKSA 4CQHA 4ETZA 1YSPA 1F5MA 2XSSA 3ZQ5A 3MQ0A 3R4KA 4LRYC 4EU0A 2XRNA 4E04A 3IBJA 3KSGA 2W1RA 3VV4A 1VHMA 2M7VA 4IJGA 4Y5FA 2HGVA 1TD5A 3W2ZA 2W1TB 3MF0A 3CITA 3LFVA 5C5KA 5K5BA 3KSHA 4G3WA 4GW9A 2W3HA 3G6OA 4QPRA 4ZRRA 3K2NA 4LRXC 2W1TA 4IUKA 4DMZA 4MDZA 3S7PA 2M7UA 2O0YA 2K2NA 4Z1WA 4Y2FA 4GLQA 4R6LA 2O9AA 4DN0A 3TRCA 4G3VA 2W3DA 4MMNA 3KSIA 2XROA 3RFBA 2VEAA 3MMHA 1MKMA 2IA2A 5DFYA 3BJNA 4IUHA 2W3GA 2K31A 2W3FA 2LB5A 4O0PA 3E98A 4Q0IA 3S7OA 1TF1A 3NOUC 5LBRA 4LRZE 4G3KA 3IBRA 4O01A 1STZA 4Q0HA 2W3EA 2O99A 5TJJA 1YKDA 3OOVA 4YNRA 5L8MA 3EEAA 5DFXA 3NHQA 3E0YA 3S7QA 2B18A 2LB9A 3D3OA 4MN7A 4ETXA 3O5YA 4EUVA 2ZMFA 4YOFA 2VJWA 1YSQA 2KOIA 5HSQA 3HCYA 4O8GA 3OBFA 5HPFA 2OOLA 3KSFA 2G7UA 3KO6A 2Y79A 3S7NA 5I5LA 2KLIA 2O9CA 1MC0A 4Y3IA 4BWIA 2VZWA 1ZTUA 4Q0JA
chains in the Genus database with same CATH superfamily
2C5WB 3MFDA 2ZD8A 4MBHA 4KQQA 4N92A 4RQ9A 1WE4A 1VETA 2JKTI 4KENB 1J9MA 3MZFA 1XJ4A 4JLFA 3LR4A 1M6KA 1ZG4A 2QYBA 1NYMA 2VKSA 3F1NA 3GRJA 3PBTA 3W4OA 1YSPA 2B02A 3ZYTA 2HP6A 5AVFA 2Y2OA 5FASA 3OC2A 5A93A 3VFFA 5CTNA 4B4ZA 4Y0TA 5EM1A 5E2GA 1JWPA 2CMNA 4B9OA 3CG5A 3FWLA 5E2EA 3SH7A 4OOYA 2XR0A 4P0MA 4A5RA 2PYRA 2Y2KA 4MNRA 1YLTA 5E2FA 1K0KA 4QY6A 1MKMA 4KZ4A 3A0VA 2WGWB 5HFOA 4K91A 4KG6A 5GLAA 4GNUA 3PR6A 3QNCA 2H0YA 4PM6A 3UE6A 1P97A 2HV1A 1Q2PA 1ES3A 3D3OA 5FATA 1YM1A 3FKWA 3S1YA 2HDSA 1LSVA 4OVDA 1DJBA 1V9ZA 4FUWA 3KSFA 2KX6A 4OQIA 3LCEA 2BG1A 4X53A 2Y2PA 2PR6A 5EVIA 2J9OA 2H28A 4LCLA 5EVIC 3SS5A 1L3LA 1Y28A 2VK3A 3CWFA 1P9WA 2X71A 1FCNA 1J3WA 4NG2A 2ZM0A 4OPRA 4S2LA 1Q2QA 3MQ0A 2EFXA 2PDRA 3WRZA 4Y17A 4X25A 2XFSA 4HH3A 1XJ2A 2ZC4B 4BBUA 3CITA 3ZDJA 3ZGAB 4HJ4A 2WAFA 5CERA 2W3HA 5FQIA 3IF6A 4S2MA 3IF6C 4YWZA 4OH0A 2O0YA 2K2NA 5F5YA 4DN0A 1IELA 1ODVA 1MXOA 2Q9MA 2VEAA 4XT2B 5DFYA 5CHUA 3M2JA 3AGFA 2ZMVA 2ZM2A 3F1PB 3BQAA 3IH8A 4S2PA 4CLCD 1F9IA 1T1BA 3V50A 2VV6A 5TJJA 2JC7A 1KVMA 3GV9A 3MZDA 1CEGA 1YLPA 3HVFA 4MLLA 2INWA 3F1OA 5HPFA 4BBVA 5FQKA 2ZQ9A 4X56A 5GHXA 3OLOA 3BWLA 5FEFA 2A2LA 1T1CA 1ZHHB 4HBUA 1LSXA 2XD5A 3NCKA 2GX5A 3VSKA 4MCWA 4LLOB 4UAAA 3EGDC 4S2KA 4D2OA 4XUZA 1K25A 4WL9A 5A90A 3MQOA 4NKPA 4EERA 1CEFA 4CQHA 4ETZA 2QPNA 4ZJ3A 3LR5A 1H8ZA 2K7SA 2W27A 3CAXA 3IBJA 5EECA 4P6ZS 4PPRA 1NYYA 4UA6A 1TVFA 3IWQA 4KZ3A 3ZFZA 4N1HA 3SH9A 3MBZA 4CPKA 3DWZA 1KGEA 1M40A 3LFVA 1N4OA 3H82A 5A8BA 3D9YA 1C3BA 1YLWA 3C7UA 2Y2HA 3T4LA 3P01A 4WELA 4OQGA 3VMAA 4K0XA 2WK0A 4DDSA 1DJAA 2RL3A 2Y55A 4OONA 4OKPA 4HY8A 5G18A 1EW0A 1ES5A 5GLDA 5KZHA 1CI9A 1D1JA 1RCJA 1FILA 4R3JA 4R4RA 4NETA 3V67A 3MJQA 2Z2LB 3Q82A 2KOIA 1FR1A 2ZMAA 2BLSA 5AVEA 3LI9A 5CXWA 4KQOA 5EPHA 3A3JA 3MQQA 1D06A 3ZG0A 3ZCZA 4BQMA 3B33A 2ZC6B 2EX2A 4II7A 5HWVA 3DTEA 1YT4A 1NLZA 2KDKA 2HJEA 1ERQA 2HPBA 1MPLA 4EEUA 3IHBA 4EQIA 1ZC2A 4L9FA 4IHQA 3NOTC 2QHKA 2Y2QA 1OMEA 1ALQA 5DF9A 4KZ9A 5CGWA 5E2HA 3N8SA 1OT9A 2VGJA 2Y2LA 4JKTA 4HEFA 3SS4A 2M7VA 3WS4A 3W2ZA 4QWOA 2V20A 4JXWA 4JGPA 5HAIA 3IS2B 2J3WA 3KSHA 2V8FA 3T4KA 4PM7A 2IWCA 5HD3A 4L0LA 3IX8A 1XJ6A 1CJFA 4IUKA 2OLVA 2J8YA 3O88A 4LPZA 1DJCA 1K56A 2HDRA 3VE3A 1XGIA 1H3QA 5TR7A 4WF0A 1SCWA 4HQAA 2WGVA 4E3MA 4ZTKA 2J80A 1KE0A 5FEGA 1XP4A 1KE3A 2LB5A 5EVEA 5IU1A 4QB8A 3A3EA 2EXAA 2WZXA 1NJ4A 2V2FF 3FPVA 1FSYA 1YKDA 1L0DA 1E3UA 3EEAA 5L8MA 3PAEA 1YQSA 4L9GA 4NK3A 4GCZA 4E3LA 4HNBA 2JBFA 4L9EA 1L0EA 1T19A 1JWZA 4UQIM 4NEED 1MC0A 1W63M 3UE3A 5EE8A 2P08A 3HREA 2WZZA 3FV7A 3A3IA 2ZC3B 2HP5A 1IYPA 1MWUA 1MWTA 5TBMB 3VP0A 3VE4A 3Q81A 4GHIA 2O9BA 2JKRI 3UNWA 3NY4A 2Z2MB 4Y7PA 3VOLA 3NDEA 1IYSA 4BLMA 2A49A 3RH8B 3IWIA 4P85A 5CRFA 2OAP1 3QP8A 3HJIA 5IS1A 4HBTA 4NXGA 2WYXA 4PHTA 1GHMA 2ZL1B 2H5SA 4WN5A 1H5XA 2W1TB 2W0NA 1SKOB 4HI4A 4WMCA 1U60A 3ZHHA 3ZNYA 1BT5A 1GCEA 4G3WA 2QZ6A 5GHZA 3BY9A 1WYBA 3P7NA 4FTXA 3ZG9B 4Z1WA 4R6LA 1XFQA 4WZ5A 5L09A 3DTIA 2ZBBA 1DP9A 4WZ5C 2V0WA 3RFBA 4EW7A 2W3FA 4C3QA 4DXCA 3LEQA 4KZ6A 4BENA 1NRFA 3BECA 3QP6A 1LLBA 1SHVA 2A24B 2ZOIA 1BLPA 1MWSA 4CJNA 2WADA 5FSRA 1HTZA 4X55A 3HCYA 1K6RA 3IXGA 3EEHA 2P74A 5FAQA 2PD8A 3T1RA 5D3OA 1XFNA 3UB7A 1VM1A 3LYXA 1E25A 1VEUB 3IQAA 4B88A 4LV0A 3FKVA 2ZQ8A 4GOGA 5EUAA 1SZVA 3OZHA 4FCFA 4XUXA 4R70A 4HHDA 5AJGA 3VOZA 3T4TA 3Q7VB 1BLCA 4ZJ1A 5CGXA 2ZJ9A 3C30A 5L07A 1LL8A 1XJ3A 1OTEA 4OQHA 1K54A 4R3BA 1IOUA 3LI8A 1K54C 2QKPA 4X68A 4Y5FA 4XXRA 1XA7A 4LV3A 4WZ4A 2L1MA 4M4XA 4E3JA 4LGWA 4FH4A 3R7WA 3PBSA 4MN6A 1Z09A 3JPUA 2P9VA 5L10A 5F69A 2XF3A 3IXDA 2JKTM 4R1GA 3MXRA 1OTIA 1S1YA 3C7VA 3U2AA 2XA7S 4KZAA 3C4OA 4BL3A 2E8JA 1XGJA 4GS9B 1JVJA 4ZAMA 5JYPA 1CF0A 3G2ZA 4IBXA 1GSXA 5F68A 2HP9A 4OLDA 2P04A 4QY5A 1STZA 3NULA 4QD4A 3BW6A 3OOVA 1KGFA 5EOOA 2ZMFA 5HSQA 4O8GA 4FH2A 1LT0A 3B3XA 1G6AA 3KO6A 1UWPX 5I5LA 4HJ3A 4UEYA 3E2KA 4WEKA 2Q9NA 4BWIA 1E4DA 1L0GA 3KX0X 2Y2JA 3EWKA 1T1AA 3UE1A 3LY3A 4U3TA 5HL1A 4OLGA 2Y4AA 3P98A 2PU4A 4JF5A 2Y2IA 1DP8A 3ISGA 3D4FA 1HLUP 1N9NA 2XRNA 4E04A 4EUZA 2V0UA 2XGNA 1QMFA 3KSGA 1NLYA 1NY0A 3LR0A 5FI2A 1BTLA 1ESIA 4KUKA 3CLOA 3SH8A 3UPOA 3Q1FA 1V9YA 3GECA 4Z9QA 1TS7A 1XX2A 4QPRA 4ZRRA 1YLYA 3DTMA 3V3RA 3IWOA 3IXHA 4DMZA 2XD1A 3LUQA 4EESA 2P7JA 2UWXA 2BTFP 5EV0A 5A92A 3LIAA 5DJTA 4Y13A 4EQ1A 1WA9A 2J7VA 2K31A 4E3NA 1NZOA 1YMXA 3A3DA 1ERMA 4ARZB 1YLJA 5F1GA 5KSHA 4LV1A 4PMAA 3P09A 1IEMA 1CI8A 5GLBA 2WGWA 1CQAA 4MN5A 3UN7A 2XK1A 5AQBA 3QHYA 2WGIA 1K55A 5F82A 1S4RA 1K55C 5HWWA 4B93A 3T12B 2G7UA 1IKIA 1HD8A 4QHCA 2KLIA 3RXXA 4E3OA 3LEZA 3MKFA 2WUQA 3H7WB 4JF6A 2D02A 5DKLA 1K56D 1BZAA 3CPTB 3KYZA 3VP2A 3ZVTA 2R78A 1F5MA 2QMIA 3NIAA 1I5QA 3VP1A 3CMZA 3QP1A 1ES2A 2OLUA 2PR5A 2JCHA 3TJZC 1LI0A 4OPZA 2YKHA 1E3UD 3O87A 2WKIA 3OPHA 3PBRA 3O3VA 3RXWA 4IBRA 2H10A 3HBRA 1YMSA 4ID4A 3T1QB 3NDGA 2ZQDA 4EBNA 1S66L 2B5RA 5FQQA 4P6ZM 1GA0A 2X01A 2ZLYA 1CK3A 2IA2A 3LIFA 3NJAA 2DRWA 1XKZA 3WS5A 4IVKA 2HJ9C 4XT2A 2W3EA 3ITBA 2L0WA 3E0YA 3F1PA 1DP6A 1W8YA 3BFEA 4Y0OA 3T4JA 2CC1A 5J7EA 2FZ0A 3G4PA 3SW1A 4K0WA 3UB8A 4WMCD 1UGUA 3VFHA 2VZWA 1TDLA 4E6WA 1MWRA 4F3LB 4CLCB 2OV5A 1S1ZA 4HJ6A 1DRMA 5HX9A 1O7EA 2NUPC 3CUEC 1O07A 2EA9A 2ZC7A 3HUMA 3N7WA 2WKQA 1BLHA 3WWXA 4WLAA 4LRYC 1VB6A 3ZG7B 5M1AA 2GDNA 2ACGA 3ULFA 1MKIA 4F94A 3BYDA 5CGSA 2XH9A 3UB9A 3JVUA 2I9VA 4O7DA 5CEDA 4GW9A 4CLCE 2DCFA 4JBFA 1EROA 2Y2NA 2EX6A 3MZEA 1BYWA 2G2WA 2W3DA 4YFMA 3KSIA 1EWZA 2EWWA 5FAPA 3UE0A 2QJ5A 4GB7A 1AWIA 5HWTA 3S7OA 1RP5A 3W8KA 3HLGA 4H6JB 3KYEA 1JWVA 3VP4A 3OCNA 1F2KA 4DDYA 3UB6A 2FFYA 3HLFA 3B47A 1XXMA 5FI7A 3GMWA 2HDQA 3LGOA 3S7NA 3ITAA 4DJ3A 2PD7A 5EVLA 4AFIA 4N1XA 3IXBA 3C4PA 1NWZA 3TE8A 1N9BA 5HAPA 2VGLS 2J3TC 1FIKA 3DBAA 1JNUA 3WS0A 1YAXA 4QU3A 1G6OA 4M3KA 4DRTA 5IT5A 3HUOA 5HDSA 4OP5A 1P0ZA 3U4LP 3M2KA 4HESA 1G68A 3LICA 3R4KA 3ZG8B 5G4YA 1XPBA 5DTTA 2C6WB 1FCMA 3E4QA 2WKRA 3MR0A 5CHJA 2OAQ1 5C5KA 2IWDA 5CTMA 2GJ3A 1LI9A 1H8MA 3FYZA 1T18A 4X1MA 3V3SA 1OT6A 4Y2FA 3EQVA 3BLMA 1K4FA 3IS2A 1BSGA 2JKRM 4LV2A 3FPWA 2DMWA 3BJNA 4R4SA 3MXSA 4U0TA 2V9AA 3G31A 5CEBA 4DE2A 4DE0A 3MXQA 4RX3A 2J9PA 2VA0A 5FQJA 2OWJA 5FA7A 3CJMA 4MN7A 3WRTA 3UB5P 2VGKA 1ZKJA 5EOEA 5FDHA 4WYYA 2ZC5B 3K3CA 2R9XA 5EVID 3IX3A 4HIAA 4WBGA 5MC7A 1ONGA 1PWCA 2ZOHA 4I39A 4E3IA 4ESPA 3BFDA 3W4PA 1VETB 2JKFA 1PRQA 2JHEA 5EM0A 4HP9A 3BQ8A 4NXFA 4DE3A 3CZDA 5J4EA 1X0OA 1W7FA 3F1NB 5HZHA 3WS1A 5F83A 3IX4A 3IHAA 3E4PA 1OTDA 3GR2A 3OPRA 5M18A 4ME4A 5HDDA 4BBTA 4GDBA 4DF6A 3N6IA 5TBMA 1PNEA 2I72A 2Y2GA 3KYQA 4EETB 4P87A 4PKYG 3G35A 4IJGA 3BRMA 3UMDA 2HGVA 1TD5A 4ZDXA 1S4SA 3UMEA 1SKFA 4ZBEA 1OTBA 3QP5A 5HW3A 1K6SA 3LR3A 4EV4A 2ZL1A 3K2NA 4LRXC 1I2SA 2W1TA 3L7HA 2GZAA 1SKOA 2VV8A 3PYPA 4OPYA 3TRCA 1NXYA 2XROA 3ZG5A 1KGGA 3TSGA 5L2FA 4O0PA 4GKUA 4H8RA 1PZPA 1W79A 4DXBA 2NUTC 1K57C 3AGDA 4E3KA 3GDIA 4YNRA 3G2YA 4KG2A 2B18A 3GQZA 3MSHA 2Z6CA 1L2SA 1SDEA 2EXBA 1FQGA 1PI5A 2XFTA 2Z6DA 4E6XA 2A24A 3HJKA 3V39A 3DAVA 4ZJ2A 4JXGA 2XA7M 5EVIB 4PM8A 3BLSA 3MFXA 3H9WA 4DKIA 4Q0JA 1MZUA 4DJ2A 4R0QA 3BM6A 2WKHA 5FAOA 3WS2A 1VEUA 4UA7A 5HAQA 3M6BA 4KZ7A 1DY6A 4R23A 3C2WA 3FC7A 3VP3A 3ZQ5A 3GSGA 5CX7A 3G34A 1MY8A 5AQ9A 4BD0A 3Q7VA 1S67L 3VV4A 5CHMA 2ZQAA 2JN7A 3IF6B 1D7EA 3HLCA 2WKPA 5E43A 3MF0A 4EBPA 3BEBA 4BL2A 1HZOA 2PT7A 3HLEA 1F98A 1W63Q 3T50A 3S22A 2B95A 4JXSA 4C6YA 4MDZA 2M7UA 3AGEA 2H0TA 3LIDA 3B42A 3PHYA 3RTYA 4G3VA 2UV0E 1FR6A 3C8CA 3BFGA 4Q0IA 2PHYA 1QMEA 3T4OA 4MEZA 1G28A 1TF1A 3SOIA 1N9LA 3ZNTA 4Q0HA 3F1OB 1FSWA 2Y91A 4GS9A 1VQQA 1OPXA 4C75A 5U47A 3O5YA 3Q07A 2V1AA 1GA9A 5DF7A 3V5MA 5DTSA 3TG9A 2VV7A 2OOLA 3T4SA 5HARA 2O9CA 1PW1A 4FD8A 2WKEA 3HUNA 3GTCA 2D01A 5HL6A 3EQUA 4X6TA 1PI4A 2R9WA 2EX8A 2PU2A 4EEPA 1PFLA 5FQMA 4PKYA 1GHPA 1KDWA 3S4XA 3A3FA 5A91A 4OOMA 2XSSA 1L0FA 4BD1A 2XEPA 4JXVA 2W1RA 3JYIA 3LIEA 1ESUA 4GN2A 3H82B 1YLZA 1Z6FA 1YPRA 3C5AA 3G32A 3N8RA 4GZBA 1XA1A 5EFWA 1OTAA 4I38A 4MBFA 5FDSA 4JF4A 1ACFA 3QP2A 2PBYA 1W5DA 3ICYA 4OP8A 4GD6A 1LSWA 3LIBA 4JPMA 3L9KA 4GLQA 2J3TD 3N4IA 1OJGA 1RGZA 2V1BA 4LFUA 3UPNA 3NI9A 4MMNA 4DE1A 2E8IA 3EOIA 2W3GA 1SDNA 1PWGA 2Q0OA 3E98A 4LRZE 2RCXA 3LO7A 2JKGA 1TS8A 5J3WA 4ARZA 5DFXA 1GSVA 1K4EA 3IF5A 1GSWA 2EX9A 4HOIA 5DVAA 4EUVA 2VJWA 4S2OA 3UPPA 1GHIA 1PIOA 1TS0A 4KZ8A 5J8XA 1IFQA 1PW8A 2EWVA 5IHVA 1OJ5A 1ZG6A 3D72A 4NXEA 1KE4A 3IT9A 2ZM8A 1H0MA 2HF6A 4GDNA 3NOPC 5HPIA 1LHYA 3CI6A 4I3JA 3H7WA 1Y4OA 3UDFA 1LL5A 4OPQA 2ZQCA 4S2NA 3CPTA 3VOYA 4S2NC 1NRJA 4R38A 3CUEA 1VHMA 5TGFA 3UDIA 3QP4A 4BJPA 1BLSA 1LL9A 4FSFA 4RVAA 4GD8A 4S2IA 5K5BA 3G6OA 3DTKA 1S0WA 5DJUA 2PRFA 4EXOA 1ONHA 3NBLA 3T1SA 1PZOA 3E2LA 4IEDA 4S2JA 1EI5A 2V8CA 5F1FA 1KOUA 4YINA 2PAVP 3SZTA 3N8LA 5DF8A 5CECA 1KVLA 4EBLA 3A0SA 3IBRA 2DNSA 1Y54A 2O99A 1N9OA 3NHQA 4U0XA 4Y15A 3O86A 1FOFA 1MBLA 1JTGA 3FG8A 1HVBA 4GJ4A 2VX8A 1G5UA 5HDCA 4LENA 3TOIA 3W4QA 3E4OA 5AQAA 4HP4A 4K08A 4GHIB 5GLCA 2GNXA 5AQ7A 4RA7A 4KZBA 1NZUA 2Y59A 4F3LA 2QWSA 4CLCA 3T1XA 1FCOA 2FH5A 4I3AA 3MS6A 4CLCC 2Y2MA 4RX2A 3IH9A 3I7JA 3RJUA 1UWNX 3M6HA 1JTDA 5DTKA 4EWFA 4Q8IA 2IWBA 1ES4A 2VGLM 3ZVWA 1BULA 4D60A 3PBNA 3QNBA 4BMWA 4B4XA 5HD5A 1WYCA 1K38A 3T4QA 3UO9A 4N9KA 3PAGA 4JGRA 5TFQA 2M1CA 3OCLA 2XQZA 5GL9A 3K3DA 3C38A 4KG5A 3PBQA 3Q7ZA 1W8QA 3HLWA 4UQIS 3TW8A 4IVIA 3MMHA 5JYOA 4IUHA 3BFCA 5KSCA 4LCMA 3A0RA 3OPPA 4UA9A 4P6BA 5FQ9A 5LBRA 1TEMA 3PXPA 2JE5A 4O01A 5I94A 2BASA 3MKEA 4R3AA 3JVVA 3S7QA 5FI6A 4X1LA 3FZCA 1BUEA 1S6RA 1KDSA 1YSQA 4I3IA 1H8YA 4UHUA 4H6JA 4QJGA 1PWDA 2V1ZA 5M19A 4I5SA 2OSUA 3VSLA 3NC8A 3PTEA 2VLGA 3DW0A 3EGXC 1IYOA 4Y3IA 2EFUA 5KMWA 3G30A 4FOFA 3UDXA 2OWHA 4OOLA 2ZQ7A 4OQ0A 2YKFA 3OPLA 1AXBA 4JGOA 4PM5A 3PBOA 2Y8HA 1I2WA 5G4ZA 1IKGA 4PAUA 2FFFB 2WAEA 3DWKA 2MJ6A 3UY6A 5BOHA 2QJ7A 1A0KA 4EU0A 3BY8A 2XDMA 2G2UA 5F6AA 1P9RA 3R7WB 4KQDA 1PYYA 2P9VB 1TS6A 4PM9A 4NXBA 3HLDA 5GHYA 4KUOA 5FL3A 2L4RA 3S7PA 4WM9A 2O9AA 5DKKA 3HLBA 2HDUA 2A3UA 2PYPA 2PBDP 4KZ5A 1IYQA 4JGQA 4MBKA 4HH2A 3NOUC 4G3KA 4N9LA 3LY4A 2AVXA 5KIZA 3BFFA 1RGYA 1TDGA 2X02A 2LB9A 3HL9A 2XLNA 4X69A 3SS3A 4ETXA 4WEJA 4YOFA 3OBFA 3GVBA 2Y79A 4Y0UA 3NECA 4RYEA 3CHWP 4WUJA 2HZ5A 1ZTUA 1K57A 4KQRA
chains in the Genus database with same CATH topology
5HL6A 3EQUA 4F3LB 4CLCB 1S1ZA 4HJ6A 4RQ9A 1DRMA 2JKTI 2NUPC 3CUEC 5TBMB 1XJ4A 4EEPA 2EA9A 3VE4A 3LR4A 4PKYA 4GHIA 2O9BA 2JKRI 2QYBA 3VOLA 2VKSA 3F1NA 3PBTA 1YSPA 2B02A 4OOMA 2WKQA 3ZYTA 2XSSA 3RH8B 4WLAA 4LRYC 1VB6A 5AVFA 2OAP1 2W1RA 3HJIA 3LIEA 5IS1A 3H82B 3ULFA 4NXGA 3OC2A 4PHTA 4WN5A 5EFWA 1OTAA 2W1TB 4I38A 2W0NA 3UB9A 3JVUA 4HI4A 2CMNA 2I9VA 4B9OA 4G3WA 4GW9A 4CLCE 3ICYA 3BY9A 3P7NA 1LSWA 3LIBA 4Z1WA 4GLQA 4R6LA 1XFQA 2J3TD 1OJGA 2V1BA 2PYRA 1BYWA 2ZBBA 2W3DA 1DP9A 4MMNA 3KSIA 2V0WA 3RFBA 2EWWA 1MKMA 3A0VA 4EW7A 3EOIA 2W3GA 2W3FA 2QJ5A 3E98A 5HWTA 3S7OA 4LRZE 2A24B 2ZOIA 3PR6A 3UE6A 4H6JB 1TS8A 5J3WA 1P97A 4ARZA 2HV1A 1GSVA 5DFXA 1GSWA 4HOIA 3D3OA 4EUVA 1LSVA 3OCNA 2VJWA 1TS0A 3UB6A 1IFQA 3HCYA 2EWVA 1V9ZA 3B47A 3EEHA 1OJ5A 3D72A 2PD8A 3KSFA 2KX6A 4NXEA 3S7NA 1XFNA 3UB7A 4DJ3A 3LYXA 2PD7A 4AFIA 1NWZA 3TE8A 2VGLS 2J3TC 3DBAA 1JNUA 2PR6A 2HF6A 1YAXA 2H28A 3NOPC 5HPIA 1G6OA 1Y28A 4R70A 4HHDA 3CWFA 1P9WA 3CI6A 4I3JA 5AJGA 5HDSA 5IT5A 1P0ZA 3H7WA 3T4TA 3LICA 3C30A 3MQ0A 3R4KA 1LL8A 1XJ3A 2PDRA 1OTEA 5G4YA 1NRJA 4R38A 1IOUA 3CUEA 3LI8A 4HH3A 1XJ2A 1VHMA 2QKPA 4Y5FA 3E4QA 4BJPA 2L1MA 2WKRA 3MR0A 4BBUA 3CITA 4M4XA 2OAQ1 3R7WA 5C5KA 4FSFA 4HJ4A 3PBSA 5K5BA 4MN6A 2W3HA 3G6OA 2GJ3A 5F69A 5DJUA 1H8MA 1T18A 2JKTM 4EXOA 4YWZA 2O0YA 2K2NA 1OT6A 4Y2FA 5F5YA 3EQVA 1OTIA 1S1YA 3IS2A 4DN0A 3U2AA 1ODVA 2JKRM 2XA7S 2VEAA 4XT2B 3FPWA 2DMWA 5DFYA 3BJNA 1KOUA 4GS9B 2V9AA 2ZMVA 3F1PB 3BQAA 4CLCD 3MXQA 1GSXA 5F68A 3A0SA 1F9IA 1T1BA 3IBRA 2P04A 2VV6A 1STZA 2O99A 5TJJA 2VA0A 3BW6A 3OOVA 2OWJA 1N9OA 3NHQA 4MN7A 2ZMFA 3K3CA 5HSQA 3FG8A 2INWA 3F1OA 4O8GA 1LT0A 4HIAA 5HPFA 5MC7A 4GJ4A 3KO6A 2VX8A 1UWPX 4BBVA 5I5LA 2ZOHA 4I39A 4HJ3A 4UEYA 4WEKA 4BWIA 5HDCA 3KX0X 3E4OA 2JHEA 3OLOA 3BWLA 4HP9A 3EWKA 2A2LA 1T1AA 3BQ8A 1T1CA 1ZHHB 4HP4A 4K08A 4NXFA 4GHIB 1LSXA 5J4EA 1X0OA 2GX5A 3F1NB 4MCWA 5HZHA 4LLOB 2GNXA 3EGDC 3E4PA 1OTDA 4WL9A 4ME4A 5HDDA 3MQOA 4NKPA 4EERA 4BBTA 4F3LA 2QWSA 4CLCA 2FH5A 4CQHA 1DP8A 4ETZA 3LR5A 4I3AA 2K7SA 2W27A 4CLCC 5TBMA 1N9NA 1UWNX 2XRNA 4E04A 3CAXA 2V0UA 3IBJA 3KYQA 4EETB 4P6ZS 3KSGA 1NLYA 3LR0A 4PKYG 2VGLM 4IJGA 3UMDA 2HGVA 1TD5A 1S4SA 4KUKA 3PBNA 3CLOA 3UMEA 1OTBA 4BMWA 5HD5A 3LFVA 3T4QA 1V9YA 3H82A 3GECA 5A8BA 3LR3A 1TS7A 4QPRA 4ZRRA 3K2NA 4LRXC 2W1TA 4JGRA 4DMZA 2M1CA 2GZAA 3OCLA 3T4LA 3LUQA 3P01A 3K3DA 2VV8A 3C38A 4EESA 2P7JA 3PYPA 4WELA 3LIAA 5DJTA 3TRCA 3PBQA 4EQ1A 2XROA 1WA9A 4UQIS 3TW8A 3MMHA 4IUHA 2K31A 4ARZB 4O0PA 3A0RA 5KSHA 5LBRA 4HY8A 1EW0A 3PXPA 2NUTC 4O01A 2BASA 4R3AA 3JVVA 3GDIA 4MN5A 4YNRA 3S7QA 2B18A 2Z6CA 3V67A 1S4RA 3MJQA 2Z6DA 2A24A 1YSQA 4I3IA 2KOIA 3HJKA 4H6JA 5HWWA 4B93A 2G7UA 2XA7M 2KLIA 4I5SA 3MFXA 5AVEA 3LI9A 4KQOA 3H9WA 3MQQA 1D06A 2VLGA 3B33A 3EGXC 4Q0JA 4Y3IA 4II7A 5HWVA 1MZUA 4FOFA 2OWHA 4OOLA 3H7WB 4DJ2A 2D02A 1NLZA 2KDKA 5DKLA 2HJEA 2YKFA 4JGOA 4EEUA 3PBOA 2Y8HA 5G4ZA 4L9FA 4IHQA 3NOTC 3C2WA 2QHKA 4PAUA 3KYZA 3FC7A 5DF9A 2R78A 2MJ6A 1F5MA 3ZQ5A 5CX7A 2QJ7A 4EU0A 3BY8A 1OT9A 5F6AA 1P9RA 3R7WB 1S67L 3VV4A 4KQDA 2PR5A 2JN7A 3TJZC 2M7VA 2YKHA 1D7EA 2WKPA 1TS6A 3PBRA 3W2ZA 3MF0A 4NXBA 4JGPA 3IS2B 2PT7A 2J3WA 4KUOA 1F98A 3KSHA 1W63Q 3T4KA 3T50A 5FL3A 5HD3A 1S66L 4L0LA 4IUKA 1XJ6A 2L4RA 4MDZA 2M7UA 3S7PA 4LPZA 3LIDA 2O9AA 3VE3A 1H3QA 5DKKA 4WF0A 3B42A 3PHYA 4HQAA 3RTYA 4G3VA 2J80A 4P6ZM 2PYPA 3C8CA 2IA2A 3LIFA 3NJAA 4JGQA 2LB5A 4Q0IA 5IU1A 2PHYA 3T4OA 1G28A 4HH2A 1TF1A 3NOUC 1N9LA 4G3KA 2HJ9C 4XT2A 4Q0HA 3F1OB 2W3EA 3FPVA 5KIZA 1YKDA 4GS9A 1OPXA 2L0WA 3EEAA 5L8MA 3E0YA 3F1PA 1DP6A 2LB9A 4L9GA 4ETXA 3O5YA 2V1AA 4GCZA 4HNBA 4WEJA 4YOFA 4L9EA 2VV7A 3T4JA 3OBFA 5J7EA 2OOLA 3T4SA 2FZ0A 1T19A 3SW1A 2Y79A 4UQIM 2O9CA 4NEED 1MC0A 3UB8A 1W63M 1UGUA 4WUJA 3UE3A 2VZWA 1ZTUA 2P08A 2D01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL6 A;  4FOF A;  3DBA A;  2GX5 A;  4MCW A;  4RQ9 A;  3NOP C;  5HPI A;  4R70 A;  2Y8H A;  4ME4 A;  3CI6 A;  3NOT C;  5AJG A;  3C2W A;  2O9B A;  4PAU A;  2QYB A;  2VKS A;  4CQH A;  4ETZ A;  1YSP A;  1F5M A;  2XSS A;  3ZQ5 A;  3MQ0 A;  3R4K A;  4LRY C;  4EU0 A;  2XRN A;  4E04 A;  3IBJ A;  3KSG A;  2W1R A;  3VV4 A;  1VHM A;  2M7V A;  4IJG A;  4Y5F A;  2HGV A;  1TD5 A;  3W2Z A;  2W1T B;  3MF0 A;  3CIT A;  3LFV A;  5C5K A;  5K5B A;  3KSH A;  4G3W A;  4GW9 A;  2W3H A;  3G6O A;  4QPR A;  4ZRR A;  3K2N A;  4LRX C;  2W1T A;  4IUK A;  4DMZ A;  4MDZ A;  3S7P A;  2M7U A;  2O0Y A;  2K2N A;  4Z1W A;  4Y2F A;  4GLQ A;  4R6L A;  2O9A A;  4DN0 A;  3TRC A;  4G3V A;  2W3D A;  4MMN A;  3KSI A;  2XRO A;  3RFB A;  2VEA A;  3MMH A;  1MKM A;  2IA2 A;  5DFY A;  3BJN A;  4IUH A;  2W3G A;  2K31 A;  2W3F A;  2LB5 A;  4O0P A;  3E98 A;  4Q0I A;  3S7O A;  1TF1 A;  3NOU C;  5LBR A;  4LRZ E;  4G3K A;  3IBR A;  4O01 A;  1STZ A;  4Q0H A;  2W3E A;  2O99 A;  5TJJ A;  1YKD A;  3OOV A;  4YNR A;  5L8M A;  3EEA A;  5DFX A;  3NHQ A;  3E0Y A;  3S7Q A;  2B18 A;  2LB9 A;  3D3O A;  4MN7 A;  4ETX A;  3O5Y A;  4EUV A;  2ZMF A;  4YOF A;  2VJW A;  1YSQ A;  2KOI A;  5HSQ A;  3HCY A;  4O8G A;  3OBF A;  5HPF A;  2OOL A;  3KSF A;  2G7U A;  3KO6 A;  2Y79 A;  3S7N A;  5I5L A;  2KLI A;  2O9C A;  1MC0 A;  4Y3I A;  4BWI A;  2VZW A;  1ZTU A;  4Q0J A; 
#chains in the Genus database with same CATH topology
 2C5W B;  3MFD A;  2ZD8 A;  4MBH A;  4KQQ A;  4N92 A;  4RQ9 A;  1WE4 A;  1VET A;  2JKT I;  4KEN B;  1J9M A;  3MZF A;  1XJ4 A;  4JLF A;  3LR4 A;  1M6K A;  1ZG4 A;  2QYB A;  1NYM A;  2VKS A;  3F1N A;  3GRJ A;  3PBT A;  3W4O A;  1YSP A;  2B02 A;  3ZYT A;  2HP6 A;  5AVF A;  2Y2O A;  5FAS A;  3OC2 A;  5A93 A;  3VFF A;  5CTN A;  4B4Z A;  4Y0T A;  5EM1 A;  5E2G A;  1JWP A;  2CMN A;  4B9O A;  3CG5 A;  3FWL A;  5E2E A;  3SH7 A;  4OOY A;  2XR0 A;  4P0M A;  4A5R A;  2PYR A;  2Y2K A;  4MNR A;  1YLT A;  5E2F A;  1K0K A;  4QY6 A;  1MKM A;  4KZ4 A;  3A0V A;  2WGW B;  5HFO A;  4K91 A;  4KG6 A;  5GLA A;  4GNU A;  3PR6 A;  3QNC A;  2H0Y A;  4PM6 A;  3UE6 A;  1P97 A;  2HV1 A;  1Q2P A;  1ES3 A;  3D3O A;  5FAT A;  1YM1 A;  3FKW A;  3S1Y A;  2HDS A;  1LSV A;  4OVD A;  1DJB A;  1V9Z A;  4FUW A;  3KSF A;  2KX6 A;  4OQI A;  3LCE A;  2BG1 A;  4X53 A;  2Y2P A;  2PR6 A;  5EVI A;  2J9O A;  2H28 A;  4LCL A;  5EVI C;  3SS5 A;  1L3L A;  1Y28 A;  2VK3 A;  3CWF A;  1P9W A;  2X71 A;  1FCN A;  1J3W A;  4NG2 A;  2ZM0 A;  4OPR A;  4S2L A;  1Q2Q A;  3MQ0 A;  2EFX A;  2PDR A;  3WRZ A;  4Y17 A;  4X25 A;  2XFS A;  4HH3 A;  1XJ2 A;  2ZC4 B;  4BBU A;  3CIT A;  3ZDJ A;  3ZGA B;  4HJ4 A;  2WAF A;  5CER A;  2W3H A;  5FQI A;  3IF6 A;  4S2M A;  3IF6 C;  4YWZ A;  4OH0 A;  2O0Y A;  2K2N A;  5F5Y A;  4DN0 A;  1IEL A;  1ODV A;  1MXO A;  2Q9M A;  2VEA A;  4XT2 B;  5DFY A;  5CHU A;  3M2J A;  3AGF A;  2ZMV A;  2ZM2 A;  3F1P B;  3BQA A;  3IH8 A;  4S2P A;  4CLC D;  1F9I A;  1T1B A;  3V50 A;  2VV6 A;  5TJJ A;  2JC7 A;  1KVM A;  3GV9 A;  3MZD A;  1CEG A;  1YLP A;  3HVF A;  4MLL A;  2INW A;  3F1O A;  5HPF A;  4BBV A;  5FQK A;  2ZQ9 A;  4X56 A;  5GHX A;  3OLO A;  3BWL A;  5FEF A;  2A2L A;  1T1C A;  1ZHH B;  4HBU A;  1LSX A;  2XD5 A;  3NCK A;  2GX5 A;  3VSK A;  4MCW A;  4LLO B;  4UAA A;  3EGD C;  4S2K A;  4D2O A;  4XUZ A;  1K25 A;  4WL9 A;  5A90 A;  3MQO A;  4NKP A;  4EER A;  1CEF A;  4CQH A;  4ETZ A;  2QPN A;  4ZJ3 A;  3LR5 A;  1H8Z A;  2K7S A;  2W27 A;  3CAX A;  3IBJ A;  5EEC A;  4P6Z S;  4PPR A;  1NYY A;  4UA6 A;  1TVF A;  3IWQ A;  4KZ3 A;  3ZFZ A;  4N1H A;  3SH9 A;  3MBZ A;  4CPK A;  3DWZ A;  1KGE A;  1M40 A;  3LFV A;  1N4O A;  3H82 A;  5A8B A;  3D9Y A;  1C3B A;  1YLW A;  3C7U A;  2Y2H A;  3T4L A;  3P01 A;  4WEL A;  4OQG A;  3VMA A;  4K0X A;  2WK0 A;  4DDS A;  1DJA A;  2RL3 A;  2Y55 A;  4OON A;  4OKP A;  4HY8 A;  5G18 A;  1EW0 A;  1ES5 A;  5GLD A;  5KZH A;  1CI9 A;  1D1J A;  1RCJ A;  1FIL A;  4R3J A;  4R4R A;  4NET A;  3V67 A;  3MJQ A;  2Z2L B;  3Q82 A;  2KOI A;  1FR1 A;  2ZMA A;  2BLS A;  5AVE A;  3LI9 A;  5CXW A;  4KQO A;  5EPH A;  3A3J A;  3MQQ A;  1D06 A;  3ZG0 A;  3ZCZ A;  4BQM A;  3B33 A;  2ZC6 B;  2EX2 A;  4II7 A;  5HWV A;  3DTE A;  1YT4 A;  1NLZ A;  2KDK A;  2HJE A;  1ERQ A;  2HPB A;  1MPL A;  4EEU A;  3IHB A;  4EQI A;  1ZC2 A;  4L9F A;  4IHQ A;  3NOT C;  2QHK A;  2Y2Q A;  1OME A;  1ALQ A;  5DF9 A;  4KZ9 A;  5CGW A;  5E2H A;  3N8S A;  1OT9 A;  2VGJ A;  2Y2L A;  4JKT A;  4HEF A;  3SS4 A;  2M7V A;  3WS4 A;  3W2Z A;  4QWO A;  2V20 A;  4JXW A;  4JGP A;  5HAI A;  3IS2 B;  2J3W A;  3KSH A;  2V8F A;  3T4K A;  4PM7 A;  2IWC A;  5HD3 A;  4L0L A;  3IX8 A;  1XJ6 A;  1CJF A;  4IUK A;  2OLV A;  2J8Y A;  3O88 A;  4LPZ A;  1DJC A;  1K56 A;  2HDR A;  3VE3 A;  1XGI A;  1H3Q A;  5TR7 A;  4WF0 A;  1SCW A;  4HQA A;  2WGV A;  4E3M A;  4ZTK A;  2J80 A;  1KE0 A;  5FEG A;  1XP4 A;  1KE3 A;  2LB5 A;  5EVE A;  5IU1 A;  4QB8 A;  3A3E A;  2EXA A;  2WZX A;  1NJ4 A;  2V2F F;  3FPV A;  1FSY A;  1YKD A;  1L0D A;  1E3U A;  3EEA A;  5L8M A;  3PAE A;  1YQS A;  4L9G A;  4NK3 A;  4GCZ A;  4E3L A;  4HNB A;  2JBF A;  4L9E A;  1L0E A;  1T19 A;  1JWZ A;  4UQI M;  4NEE D;  1MC0 A;  1W63 M;  3UE3 A;  5EE8 A;  2P08 A;  3HRE A;  2WZZ A;  3FV7 A;  3A3I A;  2ZC3 B;  2HP5 A;  1IYP A;  1MWU A;  1MWT A;  5TBM B;  3VP0 A;  3VE4 A;  3Q81 A;  4GHI A;  2O9B A;  2JKR I;  3UNW A;  3NY4 A;  2Z2M B;  4Y7P A;  3VOL A;  3NDE A;  1IYS A;  4BLM A;  2A49 A;  3RH8 B;  3IWI A;  4P85 A;  5CRF A;  2OAP 1;  3QP8 A;  3HJI A;  5IS1 A;  4HBT A;  4NXG A;  2WYX A;  4PHT A;  1GHM A;  2ZL1 B;  2H5S A;  4WN5 A;  1H5X A;  2W1T B;  2W0N A;  1SKO B;  4HI4 A;  4WMC A;  1U60 A;  3ZHH A;  3ZNY A;  1BT5 A;  1GCE A;  4G3W A;  2QZ6 A;  5GHZ A;  3BY9 A;  1WYB A;  3P7N A;  4FTX A;  3ZG9 B;  4Z1W A;  4R6L A;  1XFQ A;  4WZ5 A;  5L09 A;  3DTI A;  2ZBB A;  1DP9 A;  4WZ5 C;  2V0W A;  3RFB A;  4EW7 A;  2W3F A;  4C3Q A;  4DXC A;  3LEQ A;  4KZ6 A;  4BEN A;  1NRF A;  3BEC A;  3QP6 A;  1LLB A;  1SHV A;  2A24 B;  2ZOI A;  1BLP A;  1MWS A;  4CJN A;  2WAD A;  5FSR A;  1HTZ A;  4X55 A;  3HCY A;  1K6R A;  3IXG A;  3EEH A;  2P74 A;  5FAQ A;  2PD8 A;  3T1R A;  5D3O A;  1XFN A;  3UB7 A;  1VM1 A;  3LYX A;  1E25 A;  1VEU B;  3IQA A;  4B88 A;  4LV0 A;  3FKV A;  2ZQ8 A;  4GOG A;  5EUA A;  1SZV A;  3OZH A;  4FCF A;  4XUX A;  4R70 A;  4HHD A;  5AJG A;  3VOZ A;  3T4T A;  3Q7V B;  1BLC A;  4ZJ1 A;  5CGX A;  2ZJ9 A;  3C30 A;  5L07 A;  1LL8 A;  1XJ3 A;  1OTE A;  4OQH A;  1K54 A;  4R3B A;  1IOU A;  3LI8 A;  1K54 C;  2QKP A;  4X68 A;  4Y5F A;  4XXR A;  1XA7 A;  4LV3 A;  4WZ4 A;  2L1M A;  4M4X A;  4E3J A;  4LGW A;  4FH4 A;  3R7W A;  3PBS A;  4MN6 A;  1Z09 A;  3JPU A;  2P9V A;  5L10 A;  5F69 A;  2XF3 A;  3IXD A;  2JKT M;  4R1G A;  3MXR A;  1OTI A;  1S1Y A;  3C7V A;  3U2A A;  2XA7 S;  4KZA A;  3C4O A;  4BL3 A;  2E8J A;  1XGJ A;  4GS9 B;  1JVJ A;  4ZAM A;  5JYP A;  1CF0 A;  3G2Z A;  4IBX A;  1GSX A;  5F68 A;  2HP9 A;  4OLD A;  2P04 A;  4QY5 A;  1STZ A;  3NUL A;  4QD4 A;  3BW6 A;  3OOV A;  1KGF A;  5EOO A;  2ZMF A;  5HSQ A;  4O8G A;  4FH2 A;  1LT0 A;  3B3X A;  1G6A A;  3KO6 A;  1UWP X;  5I5L A;  4HJ3 A;  4UEY A;  3E2K A;  4WEK A;  2Q9N A;  4BWI A;  1E4D A;  1L0G A;  3KX0 X;  2Y2J A;  3EWK A;  1T1A A;  3UE1 A;  3LY3 A;  4U3T A;  5HL1 A;  4OLG A;  2Y4A A;  3P98 A;  2PU4 A;  4JF5 A;  2Y2I A;  1DP8 A;  3ISG A;  3D4F A;  1HLU P;  1N9N A;  2XRN A;  4E04 A;  4EUZ A;  2V0U A;  2XGN A;  1QMF A;  3KSG A;  1NLY A;  1NY0 A;  3LR0 A;  5FI2 A;  1BTL A;  1ESI A;  4KUK A;  3CLO A;  3SH8 A;  3UPO A;  3Q1F A;  1V9Y A;  3GEC A;  4Z9Q A;  1TS7 A;  1XX2 A;  4QPR A;  4ZRR A;  1YLY A;  3DTM A;  3V3R A;  3IWO A;  3IXH A;  4DMZ A;  2XD1 A;  3LUQ A;  4EES A;  2P7J A;  2UWX A;  2BTF P;  5EV0 A;  5A92 A;  3LIA A;  5DJT A;  4Y13 A;  4EQ1 A;  1WA9 A;  2J7V A;  2K31 A;  4E3N A;  1NZO A;  1YMX A;  3A3D A;  1ERM A;  4ARZ B;  1YLJ A;  5F1G A;  5KSH A;  4LV1 A;  4PMA A;  3P09 A;  1IEM A;  1CI8 A;  5GLB A;  2WGW A;  1CQA A;  4MN5 A;  3UN7 A;  2XK1 A;  5AQB A;  3QHY A;  2WGI A;  1K55 A;  5F82 A;  1S4R A;  1K55 C;  5HWW A;  4B93 A;  3T12 B;  2G7U A;  1IKI A;  1HD8 A;  4QHC A;  2KLI A;  3RXX A;  4E3O A;  3LEZ A;  3MKF A;  2WUQ A;  3H7W B;  4JF6 A;  2D02 A;  5DKL A;  1K56 D;  1BZA A;  3CPT B;  3KYZ A;  3VP2 A;  3ZVT A;  2R78 A;  1F5M A;  2QMI A;  3NIA A;  1I5Q A;  3VP1 A;  3CMZ A;  3QP1 A;  1ES2 A;  2OLU A;  2PR5 A;  2JCH A;  3TJZ C;  1LI0 A;  4OPZ A;  2YKH A;  1E3U D;  3O87 A;  2WKI A;  3OPH A;  3PBR A;  3O3V A;  3RXW A;  4IBR A;  2H10 A;  3HBR A;  1YMS A;  4ID4 A;  3T1Q B;  3NDG A;  2ZQD A;  4EBN A;  1S66 L;  2B5R A;  5FQQ A;  4P6Z M;  1GA0 A;  2X01 A;  2ZLY A;  1CK3 A;  2IA2 A;  3LIF A;  3NJA A;  2DRW A;  1XKZ A;  3WS5 A;  4IVK A;  2HJ9 C;  4XT2 A;  2W3E A;  3ITB A;  2L0W A;  3E0Y A;  3F1P A;  1DP6 A;  1W8Y A;  3BFE A;  4Y0O A;  3T4J A;  2CC1 A;  5J7E A;  2FZ0 A;  3G4P A;  3SW1 A;  4K0W A;  3UB8 A;  4WMC D;  1UGU A;  3VFH A;  2VZW A;  1TDL A;  4E6W A;  1MWR A;  4F3L B;  4CLC B;  2OV5 A;  1S1Z A;  4HJ6 A;  1DRM A;  5HX9 A;  1O7E A;  2NUP C;  3CUE C;  1O07 A;  2EA9 A;  2ZC7 A;  3HUM A;  3N7W A;  2WKQ A;  1BLH A;  3WWX A;  4WLA A;  4LRY C;  1VB6 A;  3ZG7 B;  5M1A A;  2GDN A;  2ACG A;  3ULF A;  1MKI A;  4F94 A;  3BYD A;  5CGS A;  2XH9 A;  3UB9 A;  3JVU A;  2I9V A;  4O7D A;  5CED A;  4GW9 A;  4CLC E;  2DCF A;  4JBF A;  1ERO A;  2Y2N A;  2EX6 A;  3MZE A;  1BYW A;  2G2W A;  2W3D A;  4YFM A;  3KSI A;  1EWZ A;  2EWW A;  5FAP A;  3UE0 A;  2QJ5 A;  4GB7 A;  1AWI A;  5HWT A;  3S7O A;  1RP5 A;  3W8K A;  3HLG A;  4H6J B;  3KYE A;  1JWV A;  3VP4 A;  3OCN A;  1F2K A;  4DDY A;  3UB6 A;  2FFY A;  3HLF A;  3B47 A;  1XXM A;  5FI7 A;  3GMW A;  2HDQ A;  3LGO A;  3S7N A;  3ITA A;  4DJ3 A;  2PD7 A;  5EVL A;  4AFI A;  4N1X A;  3IXB A;  3C4P A;  1NWZ A;  3TE8 A;  1N9B A;  5HAP A;  2VGL S;  2J3T C;  1FIK A;  3DBA A;  1JNU A;  3WS0 A;  1YAX A;  4QU3 A;  1G6O A;  4M3K A;  4DRT A;  5IT5 A;  3HUO A;  5HDS A;  4OP5 A;  1P0Z A;  3U4L P;  3M2K A;  4HES A;  1G68 A;  3LIC A;  3R4K A;  3ZG8 B;  5G4Y A;  1XPB A;  5DTT A;  2C6W B;  1FCM A;  3E4Q A;  2WKR A;  3MR0 A;  5CHJ A;  2OAQ 1;  5C5K A;  2IWD A;  5CTM A;  2GJ3 A;  1LI9 A;  1H8M A;  3FYZ A;  1T18 A;  4X1M A;  3V3S A;  1OT6 A;  4Y2F A;  3EQV A;  3BLM A;  1K4F A;  3IS2 A;  1BSG A;  2JKR M;  4LV2 A;  3FPW A;  2DMW A;  3BJN A;  4R4S A;  3MXS A;  4U0T A;  2V9A A;  3G31 A;  5CEB A;  4DE2 A;  4DE0 A;  3MXQ A;  4RX3 A;  2J9P A;  2VA0 A;  5FQJ A;  2OWJ A;  5FA7 A;  3CJM A;  4MN7 A;  3WRT A;  3UB5 P;  2VGK A;  1ZKJ A;  5EOE A;  5FDH A;  4WYY A;  2ZC5 B;  3K3C A;  2R9X A;  5EVI D;  3IX3 A;  4HIA A;  4WBG A;  5MC7 A;  1ONG A;  1PWC A;  2ZOH A;  4I39 A;  4E3I A;  4ESP A;  3BFD A;  3W4P A;  1VET B;  2JKF A;  1PRQ A;  2JHE A;  5EM0 A;  4HP9 A;  3BQ8 A;  4NXF A;  4DE3 A;  3CZD A;  5J4E A;  1X0O A;  1W7F A;  3F1N B;  5HZH A;  3WS1 A;  5F83 A;  3IX4 A;  3IHA A;  3E4P A;  1OTD A;  3GR2 A;  3OPR A;  5M18 A;  4ME4 A;  5HDD A;  4BBT A;  4GDB A;  4DF6 A;  3N6I A;  5TBM A;  1PNE A;  2I72 A;  2Y2G A;  3KYQ A;  4EET B;  4P87 A;  4PKY G;  3G35 A;  4IJG A;  3BRM A;  3UMD A;  2HGV A;  1TD5 A;  4ZDX A;  1S4S A;  3UME A;  1SKF A;  4ZBE A;  1OTB A;  3QP5 A;  5HW3 A;  1K6S A;  3LR3 A;  4EV4 A;  2ZL1 A;  3K2N A;  4LRX C;  1I2S A;  2W1T A;  3L7H A;  2GZA A;  1SKO A;  2VV8 A;  3PYP A;  4OPY A;  3TRC A;  1NXY A;  2XRO A;  3ZG5 A;  1KGG A;  3TSG A;  5L2F A;  4O0P A;  4GKU A;  4H8R A;  1PZP A;  1W79 A;  4DXB A;  2NUT C;  1K57 C;  3AGD A;  4E3K A;  3GDI A;  4YNR A;  3G2Y A;  4KG2 A;  2B18 A;  3GQZ A;  3MSH A;  2Z6C A;  1L2S A;  1SDE A;  2EXB A;  1FQG A;  1PI5 A;  2XFT A;  2Z6D A;  4E6X A;  2A24 A;  3HJK A;  3V39 A;  3DAV A;  4ZJ2 A;  4JXG A;  2XA7 M;  5EVI B;  4PM8 A;  3BLS A;  3MFX A;  3H9W A;  4DKI A;  4Q0J A;  1MZU A;  4DJ2 A;  4R0Q A;  3BM6 A;  2WKH A;  5FAO A;  3WS2 A;  1VEU A;  4UA7 A;  5HAQ A;  3M6B A;  4KZ7 A;  1DY6 A;  4R23 A;  3C2W A;  3FC7 A;  3VP3 A;  3ZQ5 A;  3GSG A;  5CX7 A;  3G34 A;  1MY8 A;  5AQ9 A;  4BD0 A;  3Q7V A;  1S67 L;  3VV4 A;  5CHM A;  2ZQA A;  2JN7 A;  3IF6 B;  1D7E A;  3HLC A;  2WKP A;  5E43 A;  3MF0 A;  4EBP A;  3BEB A;  4BL2 A;  1HZO A;  2PT7 A;  3HLE A;  1F98 A;  1W63 Q;  3T50 A;  3S22 A;  2B95 A;  4JXS A;  4C6Y A;  4MDZ A;  2M7U A;  3AGE A;  2H0T A;  3LID A;  3B42 A;  3PHY A;  3RTY A;  4G3V A;  2UV0 E;  1FR6 A;  3C8C A;  3BFG A;  4Q0I A;  2PHY A;  1QME A;  3T4O A;  4MEZ A;  1G28 A;  1TF1 A;  3SOI A;  1N9L A;  3ZNT A;  4Q0H A;  3F1O B;  1FSW A;  2Y91 A;  4GS9 A;  1VQQ A;  1OPX A;  4C75 A;  5U47 A;  3O5Y A;  3Q07 A;  2V1A A;  1GA9 A;  5DF7 A;  3V5M A;  5DTS A;  3TG9 A;  2VV7 A;  2OOL A;  3T4S A;  5HAR A;  2O9C A;  1PW1 A;  4FD8 A;  2WKE A;  3HUN A;  3GTC A;  2D01 A;  5HL6 A;  3EQU A;  4X6T A;  1PI4 A;  2R9W A;  2EX8 A;  2PU2 A;  4EEP A;  1PFL A;  5FQM A;  4PKY A;  1GHP A;  1KDW A;  3S4X A;  3A3F A;  5A91 A;  4OOM A;  2XSS A;  1L0F A;  4BD1 A;  2XEP A;  4JXV A;  2W1R A;  3JYI A;  3LIE A;  1ESU A;  4GN2 A;  3H82 B;  1YLZ A;  1Z6F A;  1YPR A;  3C5A A;  3G32 A;  3N8R A;  4GZB A;  1XA1 A;  5EFW A;  1OTA A;  4I38 A;  4MBF A;  5FDS A;  4JF4 A;  1ACF A;  3QP2 A;  2PBY A;  1W5D A;  3ICY A;  4OP8 A;  4GD6 A;  1LSW A;  3LIB A;  4JPM A;  3L9K A;  4GLQ A;  2J3T D;  3N4I A;  1OJG A;  1RGZ A;  2V1B A;  4LFU A;  3UPN A;  3NI9 A;  4MMN A;  4DE1 A;  2E8I A;  3EOI A;  2W3G A;  1SDN A;  1PWG A;  2Q0O A;  3E98 A;  4LRZ E;  2RCX A;  3LO7 A;  2JKG A;  1TS8 A;  5J3W A;  4ARZ A;  5DFX A;  1GSV A;  1K4E A;  3IF5 A;  1GSW A;  2EX9 A;  4HOI A;  5DVA A;  4EUV A;  2VJW A;  4S2O A;  3UPP A;  1GHI A;  1PIO A;  1TS0 A;  4KZ8 A;  5J8X A;  1IFQ A;  1PW8 A;  2EWV A;  5IHV A;  1OJ5 A;  1ZG6 A;  3D72 A;  4NXE A;  1KE4 A;  3IT9 A;  2ZM8 A;  1H0M A;  2HF6 A;  4GDN A;  3NOP C;  5HPI A;  1LHY A;  3CI6 A;  4I3J A;  3H7W A;  1Y4O A;  3UDF A;  1LL5 A;  4OPQ A;  2ZQC A;  4S2N A;  3CPT A;  3VOY A;  4S2N C;  1NRJ A;  4R38 A;  3CUE A;  1VHM A;  5TGF A;  3UDI A;  3QP4 A;  4BJP A;  1BLS A;  1LL9 A;  4FSF A;  4RVA A;  4GD8 A;  4S2I A;  5K5B A;  3G6O A;  3DTK A;  1S0W A;  5DJU A;  2PRF A;  4EXO A;  1ONH A;  3NBL A;  3T1S A;  1PZO A;  3E2L A;  4IED A;  4S2J A;  1EI5 A;  2V8C A;  5F1F A;  1KOU A;  4YIN A;  2PAV P;  3SZT A;  3N8L A;  5DF8 A;  5CEC A;  1KVL A;  4EBL A;  3A0S A;  3IBR A;  2DNS A;  1Y54 A;  2O99 A;  1N9O A;  3NHQ A;  4U0X A;  4Y15 A;  3O86 A;  1FOF A;  1MBL A;  1JTG A;  3FG8 A;  1HVB A;  4GJ4 A;  2VX8 A;  1G5U A;  5HDC A;  4LEN A;  3TOI A;  3W4Q A;  3E4O A;  5AQA A;  4HP4 A;  4K08 A;  4GHI B;  5GLC A;  2GNX A;  5AQ7 A;  4RA7 A;  4KZB A;  1NZU A;  2Y59 A;  4F3L A;  2QWS A;  4CLC A;  3T1X A;  1FCO A;  2FH5 A;  4I3A A;  3MS6 A;  4CLC C;  2Y2M A;  4RX2 A;  3IH9 A;  3I7J A;  3RJU A;  1UWN X;  3M6H A;  1JTD A;  5DTK A;  4EWF A;  4Q8I A;  2IWB A;  1ES4 A;  2VGL M;  3ZVW A;  1BUL A;  4D60 A;  3PBN A;  3QNB A;  4BMW A;  4B4X A;  5HD5 A;  1WYC A;  1K38 A;  3T4Q A;  3UO9 A;  4N9K A;  3PAG A;  4JGR A;  5TFQ A;  2M1C A;  3OCL A;  2XQZ A;  5GL9 A;  3K3D A;  3C38 A;  4KG5 A;  3PBQ A;  3Q7Z A;  1W8Q A;  3HLW A;  4UQI S;  3TW8 A;  4IVI A;  3MMH A;  5JYO A;  4IUH A;  3BFC A;  5KSC A;  4LCM A;  3A0R A;  3OPP A;  4UA9 A;  4P6B A;  5FQ9 A;  5LBR A;  1TEM A;  3PXP A;  2JE5 A;  4O01 A;  5I94 A;  2BAS A;  3MKE A;  4R3A A;  3JVV A;  3S7Q A;  5FI6 A;  4X1L A;  3FZC A;  1BUE A;  1S6R A;  1KDS A;  1YSQ A;  4I3I A;  1H8Y A;  4UHU A;  4H6J A;  4QJG A;  1PWD A;  2V1Z A;  5M19 A;  4I5S A;  2OSU A;  3VSL A;  3NC8 A;  3PTE A;  2VLG A;  3DW0 A;  3EGX C;  1IYO A;  4Y3I A;  2EFU A;  5KMW A;  3G30 A;  4FOF A;  3UDX A;  2OWH A;  4OOL A;  2ZQ7 A;  4OQ0 A;  2YKF A;  3OPL A;  1AXB A;  4JGO A;  4PM5 A;  3PBO A;  2Y8H A;  1I2W A;  5G4Z A;  1IKG A;  4PAU A;  2FFF B;  2WAE A;  3DWK A;  2MJ6 A;  3UY6 A;  5BOH A;  2QJ7 A;  1A0K A;  4EU0 A;  3BY8 A;  2XDM A;  2G2U A;  5F6A A;  1P9R A;  3R7W B;  4KQD A;  1PYY A;  2P9V B;  1TS6 A;  4PM9 A;  4NXB A;  3HLD A;  5GHY A;  4KUO A;  5FL3 A;  2L4R A;  3S7P A;  4WM9 A;  2O9A A;  5DKK A;  3HLB A;  2HDU A;  2A3U A;  2PYP A;  2PBD P;  4KZ5 A;  1IYQ A;  4JGQ A;  4MBK A;  4HH2 A;  3NOU C;  4G3K A;  4N9L A;  3LY4 A;  2AVX A;  5KIZ A;  3BFF A;  1RGY A;  1TDG A;  2X02 A;  2LB9 A;  3HL9 A;  2XLN A;  4X69 A;  3SS3 A;  4ETX A;  4WEJ A;  4YOF A;  3OBF A;  3GVB A;  2Y79 A;  4Y0U A;  3NEC A;  4RYE A;  3CHW P;  4WUJ A;  2HZ5 A;  1ZTU A;  1K57 A;  4KQR A; 
#chains in the Genus database with same CATH homology
 5HL6 A;  3EQU A;  4F3L B;  4CLC B;  1S1Z A;  4HJ6 A;  4RQ9 A;  1DRM A;  2JKT I;  2NUP C;  3CUE C;  5TBM B;  1XJ4 A;  4EEP A;  2EA9 A;  3VE4 A;  3LR4 A;  4PKY A;  4GHI A;  2O9B A;  2JKR I;  2QYB A;  3VOL A;  2VKS A;  3F1N A;  3PBT A;  1YSP A;  2B02 A;  4OOM A;  2WKQ A;  3ZYT A;  2XSS A;  3RH8 B;  4WLA A;  4LRY C;  1VB6 A;  5AVF A;  2OAP 1;  2W1R A;  3HJI A;  3LIE A;  5IS1 A;  3H82 B;  3ULF A;  4NXG A;  3OC2 A;  4PHT A;  4WN5 A;  5EFW A;  1OTA A;  2W1T B;  4I38 A;  2W0N A;  3UB9 A;  3JVU A;  4HI4 A;  2CMN A;  2I9V A;  4B9O A;  4G3W A;  4GW9 A;  4CLC E;  3ICY A;  3BY9 A;  3P7N A;  1LSW A;  3LIB A;  4Z1W A;  4GLQ A;  4R6L A;  1XFQ A;  2J3T D;  1OJG A;  2V1B A;  2PYR A;  1BYW A;  2ZBB A;  2W3D A;  1DP9 A;  4MMN A;  3KSI A;  2V0W A;  3RFB A;  2EWW A;  1MKM A;  3A0V A;  4EW7 A;  3EOI A;  2W3G A;  2W3F A;  2QJ5 A;  3E98 A;  5HWT A;  3S7O A;  4LRZ E;  2A24 B;  2ZOI A;  3PR6 A;  3UE6 A;  4H6J B;  1TS8 A;  5J3W A;  1P97 A;  4ARZ A;  2HV1 A;  1GSV A;  5DFX A;  1GSW A;  4HOI A;  3D3O A;  4EUV A;  1LSV A;  3OCN A;  2VJW A;  1TS0 A;  3UB6 A;  1IFQ A;  3HCY A;  2EWV A;  1V9Z A;  3B47 A;  3EEH A;  1OJ5 A;  3D72 A;  2PD8 A;  3KSF A;  2KX6 A;  4NXE A;  3S7N A;  1XFN A;  3UB7 A;  4DJ3 A;  3LYX A;  2PD7 A;  4AFI A;  1NWZ A;  3TE8 A;  2VGL S;  2J3T C;  3DBA A;  1JNU A;  2PR6 A;  2HF6 A;  1YAX A;  2H28 A;  3NOP C;  5HPI A;  1G6O A;  1Y28 A;  4R70 A;  4HHD A;  3CWF A;  1P9W A;  3CI6 A;  4I3J A;  5AJG A;  5HDS A;  5IT5 A;  1P0Z A;  3H7W A;  3T4T A;  3LIC A;  3C30 A;  3MQ0 A;  3R4K A;  1LL8 A;  1XJ3 A;  2PDR A;  1OTE A;  5G4Y A;  1NRJ A;  4R38 A;  1IOU A;  3CUE A;  3LI8 A;  4HH3 A;  1XJ2 A;  1VHM A;  2QKP A;  4Y5F A;  3E4Q A;  4BJP A;  2L1M A;  2WKR A;  3MR0 A;  4BBU A;  3CIT A;  4M4X A;  2OAQ 1;  3R7W A;  5C5K A;  4FSF A;  4HJ4 A;  3PBS A;  5K5B A;  4MN6 A;  2W3H A;  3G6O A;  2GJ3 A;  5F69 A;  5DJU A;  1H8M A;  1T18 A;  2JKT M;  4EXO A;  4YWZ A;  2O0Y A;  2K2N A;  1OT6 A;  4Y2F A;  5F5Y A;  3EQV A;  1OTI A;  1S1Y A;  3IS2 A;  4DN0 A;  3U2A A;  1ODV A;  2JKR M;  2XA7 S;  2VEA A;  4XT2 B;  3FPW A;  2DMW A;  5DFY A;  3BJN A;  1KOU A;  4GS9 B;  2V9A A;  2ZMV A;  3F1P B;  3BQA A;  4CLC D;  3MXQ A;  1GSX A;  5F68 A;  3A0S A;  1F9I A;  1T1B A;  3IBR A;  2P04 A;  2VV6 A;  1STZ A;  2O99 A;  5TJJ A;  2VA0 A;  3BW6 A;  3OOV A;  2OWJ A;  1N9O A;  3NHQ A;  4MN7 A;  2ZMF A;  3K3C A;  5HSQ A;  3FG8 A;  2INW A;  3F1O A;  4O8G A;  1LT0 A;  4HIA A;  5HPF A;  5MC7 A;  4GJ4 A;  3KO6 A;  2VX8 A;  1UWP X;  4BBV A;  5I5L A;  2ZOH A;  4I39 A;  4HJ3 A;  4UEY A;  4WEK A;  4BWI A;  5HDC A;  3KX0 X;  3E4O A;  2JHE A;  3OLO A;  3BWL A;  4HP9 A;  3EWK A;  2A2L A;  1T1A A;  3BQ8 A;  1T1C A;  1ZHH B;  4HP4 A;  4K08 A;  4NXF A;  4GHI B;  1LSX A;  5J4E A;  1X0O A;  2GX5 A;  3F1N B;  4MCW A;  5HZH A;  4LLO B;  2GNX A;  3EGD C;  3E4P A;  1OTD A;  4WL9 A;  4ME4 A;  5HDD A;  3MQO A;  4NKP A;  4EER A;  4BBT A;  4F3L A;  2QWS A;  4CLC A;  2FH5 A;  4CQH A;  1DP8 A;  4ETZ A;  3LR5 A;  4I3A A;  2K7S A;  2W27 A;  4CLC C;  5TBM A;  1N9N A;  1UWN X;  2XRN A;  4E04 A;  3CAX A;  2V0U A;  3IBJ A;  3KYQ A;  4EET B;  4P6Z S;  3KSG A;  1NLY A;  3LR0 A;  4PKY G;  2VGL M;  4IJG A;  3UMD A;  2HGV A;  1TD5 A;  1S4S A;  4KUK A;  3PBN A;  3CLO A;  3UME A;  1OTB A;  4BMW A;  5HD5 A;  3LFV A;  3T4Q A;  1V9Y A;  3H82 A;  3GEC A;  5A8B A;  3LR3 A;  1TS7 A;  4QPR A;  4ZRR A;  3K2N A;  4LRX C;  2W1T A;  4JGR A;  4DMZ A;  2M1C A;  2GZA A;  3OCL A;  3T4L A;  3LUQ A;  3P01 A;  3K3D A;  2VV8 A;  3C38 A;  4EES A;  2P7J A;  3PYP A;  4WEL A;  3LIA A;  5DJT A;  3TRC A;  3PBQ A;  4EQ1 A;  2XRO A;  1WA9 A;  4UQI S;  3TW8 A;  3MMH A;  4IUH A;  2K31 A;  4ARZ B;  4O0P A;  3A0R A;  5KSH A;  5LBR A;  4HY8 A;  1EW0 A;  3PXP A;  2NUT C;  4O01 A;  2BAS A;  4R3A A;  3JVV A;  3GDI A;  4MN5 A;  4YNR A;  3S7Q A;  2B18 A;  2Z6C A;  3V67 A;  1S4R A;  3MJQ A;  2Z6D A;  2A24 A;  1YSQ A;  4I3I A;  2KOI A;  3HJK A;  4H6J A;  5HWW A;  4B93 A;  2G7U A;  2XA7 M;  2KLI A;  4I5S A;  3MFX A;  5AVE A;  3LI9 A;  4KQO A;  3H9W A;  3MQQ A;  1D06 A;  2VLG A;  3B33 A;  3EGX C;  4Q0J A;  4Y3I A;  4II7 A;  5HWV A;  1MZU A;  4FOF A;  2OWH A;  4OOL A;  3H7W B;  4DJ2 A;  2D02 A;  1NLZ A;  2KDK A;  5DKL A;  2HJE A;  2YKF A;  4JGO A;  4EEU A;  3PBO A;  2Y8H A;  5G4Z A;  4L9F A;  4IHQ A;  3NOT C;  3C2W A;  2QHK A;  4PAU A;  3KYZ A;  3FC7 A;  5DF9 A;  2R78 A;  2MJ6 A;  1F5M A;  3ZQ5 A;  5CX7 A;  2QJ7 A;  4EU0 A;  3BY8 A;  1OT9 A;  5F6A A;  1P9R A;  3R7W B;  1S67 L;  3VV4 A;  4KQD A;  2PR5 A;  2JN7 A;  3TJZ C;  2M7V A;  2YKH A;  1D7E A;  2WKP A;  1TS6 A;  3PBR A;  3W2Z A;  3MF0 A;  4NXB A;  4JGP A;  3IS2 B;  2PT7 A;  2J3W A;  4KUO A;  1F98 A;  3KSH A;  1W63 Q;  3T4K A;  3T50 A;  5FL3 A;  5HD3 A;  1S66 L;  4L0L A;  4IUK A;  1XJ6 A;  2L4R A;  4MDZ A;  2M7U A;  3S7P A;  4LPZ A;  3LID A;  2O9A A;  3VE3 A;  1H3Q A;  5DKK A;  4WF0 A;  3B42 A;  3PHY A;  4HQA A;  3RTY A;  4G3V A;  2J80 A;  4P6Z M;  2PYP A;  3C8C A;  2IA2 A;  3LIF A;  3NJA A;  4JGQ A;  2LB5 A;  4Q0I A;  5IU1 A;  2PHY A;  3T4O A;  1G28 A;  4HH2 A;  1TF1 A;  3NOU C;  1N9L A;  4G3K A;  2HJ9 C;  4XT2 A;  4Q0H A;  3F1O B;  2W3E A;  3FPV A;  5KIZ A;  1YKD A;  4GS9 A;  1OPX A;  2L0W A;  3EEA A;  5L8M A;  3E0Y A;  3F1P A;  1DP6 A;  2LB9 A;  4L9G A;  4ETX A;  3O5Y A;  2V1A A;  4GCZ A;  4HNB A;  4WEJ A;  4YOF A;  4L9E A;  2VV7 A;  3T4J A;  3OBF A;  5J7E A;  2OOL A;  3T4S A;  2FZ0 A;  1T19 A;  3SW1 A;  2Y79 A;  4UQI M;  2O9C A;  4NEE D;  1MC0 A;  3UB8 A;  1W63 M;  1UGU A;  4WUJ A;  3UE3 A;  2VZW A;  1ZTU A;  2P08 A;  2D01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...