1ESIA

R248l mutant of streptomyces k15 dd-transpeptidase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
KPTIAAVGGYAMNNGTGTTLYTKAADTRRSTGSTTKIMTAKVVLAQSNLNLDAKVTIQKAYSDYVVANNASQAHLIVGDKVTVRQLLYGLMLPSGCDAAYALADKYGSGSTRAARVKSFIGKMNTAATNLGLHNTHFDSFDGIGNGANYSTPRDLTKIASSAMKNSTFRTVVKTKAYTAKTVTKTGSIRTMDTWKNTNGLLSSYSGAIGVKTGSGPEAKYCLVFAATRGGKTVIGTVLASTSIPALESDATKIMNYGFAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DD-TRANSPEPTIDASE
publication title DD-TRANSPEPTIDASE
rcsb
source organism Streptomyces sp.
molecule tags Hydrolase
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2000-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1esiA00
1MWRA 3NCKA 1HTZA 1XA7A 3MBZA 5FQKA 4U3TA 2EXAA 5CTMA 3RJUA 4WZ4A 3ZDJA 3HLGA 3IT9A 1BLCA 2WK0A 2ZLYA 3LEZA 4R4RA 1BUEA 4EWFA 2OV5A 3DWZA 4OPRA 4N92A 1BZAA 1K4EA 3Q81A 1KDSA 1PZOA 4IBRA 4S2KA 5EOEA 4E6XA 3GV9A 1YMSA 2WUQA 1FCNA 4ZTKA 4ZJ2A 2DCFA 3C4OA 3HLWA 4P6BA 3G30A 4DE1A 3QHYA 3BFEA 3VOZA 4Z9QA 4KZ7A 4OONA 2WGWA 3BECA 4QU3A 3ZNYA 4EBLA 3JYIA 1FSWA 5HFOA 1N4OA 2X02A 1Q2QA 3MXRA 4OP8A 4OLGA 2IWDA 3G2YA 3ZNTA 4YFMA 3QNBA 4QY6A 3VP1A 3O86A 1S6RA 4OP5A 1W7FA 2ZQ8A 1JTDA 4KZ4A 4C6YA 2Y55A 3VP0A 3Q7ZA 2WADA 1FOFA 3D4FA 4GDBA 4E3NA 2XR0A 1J9MA 3N6IA 5GHZA 1NY0A 3ZG7B 4KZ6A 1KE4A 1IEMA 3O88A 1XGIA 4X55A 3WRZA 4FH2A 4Y0TA 3MZEA 3NI9A 1ONHA 1U60A 3IF6C 4OLDA 1E3UA 1JWZA 2H0TA 1IYPA 2Y2IA 3LY4A 4LCMA 5DF7A 1K38A 5FDHA 3WWXA 4KQRA 4WMCD 1L0DA 1M40A 4GOGA 1IYQA 1L0GA 3RXXA 3VFHA 1K57A 3ZVWA 5CXWA 5L2FA 1K56D 4DDSA 5G18A 4DDYA 3VFFA 3GSGA 5FAQA 1YLYA 3G35A 4QB8A 1GA0A 3NIAA 4RVAA 3IXBA 4BL2A 3A3IA 4IVKA 5AQ7A 3A3FA 5GHYA 3N7WA 4N9LA 3SH7A 1MWSA 3G2ZA 1CI9A 4YINA 4RX2A 4EUZA 2ZM2A 4MBHA 3GMWA 3W8KA 2R9XA 3ISGA 3BRMA 3E2KA 1HD8A 2UWXA 4Y0UA 4A5RA 5KSHA 4P85A 2JCHA 2Q9MA 5CHJA 3UY6A 4KZ9A 4U0XA 1GHIA 3BFGA 2ZQDA 3ZG5A 5I94A 1PW8A 5E2HA 3M2JA 4UA7A 4OQIA 2R9WA 1JVJA 4GN2A 1KGFA 3HUNA 3LCEA 3VOYA 2C5WB 1BULA 4JXVA 2Y2HA 2JBFA 1SCWA 2A3UA 2ZM8A 4JF5A 3MZFA 3WS0A 3MZDA 3CG5A 4X56A 3GTCA 3WS1A 1NZUA 4E6WA 3B3XA 2ZC3B 1L2SA 4ZJ3A 4WZ5A 5M18A 1OMEA 1BT5A 3G4PA 2XQZA 3DTMA 3N8SA 4HBTA 5KSCA 3CMZA 2ZD8A 2WYXA 1M6KA 1CEGA 2Y59A 3G34A 5EVLA 4FD8A 3C4PA 4BD0A 5HARA 2XFSA 3ITBA 5CERA 3Q1FA 2HDQA 1SDNA 4DRTA 3HUOA 1IELA 4KG2A 1HZOA 4QY5A 4GB7A 3V39A 4ID4A 4LV2A 2OSUA 2Y2LA 1NYYA 3OC2A 2ZJ9A 1FCOA 2WGWB 4F94A 5JYOA 3IWQA 1K55A 1XP4A 1MXOA 2JE5A 4X6TA 2XLNA 4ZBEA 3V3SA 3VSLA 4QD4A 4N9KA 5GLDA 3UE3A 3OCLA 1QMFA 5A91A 5A92A 4EQIA 5EVID 3S1YA 5TR7A 3S4XA 3IF6B 1DY6A 1E25A 2Y2KA 1GA9A 2EX2A 4JF6A 1PZPA 1H5XA 5FI7A 3IHAA 3BLSA 1BTLA 1SHVA 3BFFA 3SOIA 2PU2A 3PBRA 3PBSA 2IWCA 1KE0A 2EX6A 1DJCA 2PBYA 2P9VA 2WAFA 4QJGA 3S22A 2JC7A 3OCNA 4OQHA 4MBFA 5FA7A 2ZM0A 1IYSA 1JWVA 3GQZA 5CHMA 2XGNA 4RX3A 3Q07A 1W79A 4OQ0A 4CPKA 5EE8A 3CZDA 1I2WA 4S2LA 3PBNA 3UPNA 4LV3A 3SH9A 1EI5A 2QPNA 3WRTA 4DKIA 4Q8IA 1IYOA 3FZCA 1AXBA 2VGJA 3PBTA 2BG1A 1Y54A 1MWTA 5AQAA 1I5QA 2XD5A 4WYYA 2P74A 1Z6FA 4KZ5A 4OH0A 1O07A 2ZQ7A 1K54A 1FCMA 4OQGA 1ES4A 5E2EA 5IHVA 1NYMA 4GD8A 3V50A 1H8ZA 3OPHA 3HL9A 1G68A 2EFUA 3MKFA 2J9OA 4ZJ1A 1JTGA 4JKTA 5FSRA 1RP5A 4UA9A 3Q7VA 5KZHA 4Y0OA 3DW0A 5M19A 1CI8A 4S2NA 2ZC4B 5U47A 4OVDA 4L0LA 1YMXA 1YLTA 5AQBA 1K4FA 1ESUA 3IHBA 5EECA 4KG6A 1PWGA 4OOLA 1YLJA 3WS5A 5FATA 1MWUA 5FI6A 4MBKA 4U0TA 5AQ9A 4ZAMA 4WMCA 1K57C 3IXHA 1LHYA 1MY8A 2B5RA 2OLUA 3AGEA 3EQUA 3O87A 3V3RA 2WZZA 5E2FA 5HX9A 3VP3A 4K0XA 1W5DA 1K56A 1LI9A 2Y2OA 2Y2JA 4E3OA 3PBQA 3VP2A 3PAGA 4BENA 4KQOA 3ZFZA 2XF3A 2Y2QA 3W4OA 1W8YA 5FAOA 1PI5A 2XD1A 3N8RA 1I2SA 3FKWA 4LV0A 3UE1A 3FV7A 1VM1A 1CK3A 1LL9A 3BYDA 3UPPA 1YQSA 1S0WA 2WGIA 5BOHA 1FR6A 2OLVA 1G6AA 1ERQA 5EOOA 5F82A 2G2UA 4HBUA 5TGFA 2H0YA 4FSFA 5FI2A 3WS4A 1LI0A 4N1HA 1K6SA 1PWCA 3CJMA 3AGDA 4KENB 3FWLA 4JXGA 4DE3A 1FR1A 4JLFA 2A49A 4WZ5C 3A3EA 5GL9A 3SH8A 3UPOA 5HAIA 3E2LA 3G31A 1ESIA 3IWIA 2Y2GA 3A3DA 3ZG8B 4DE0A 4DXCA 2H5SA 2WKHA 4S2OA 1ZKJA 4OPQA 3HLBA 1K6RA 1XXMA 3ZHHA 4PM6A 4NETA 1XPBA 1W8QA 3A3JA 3IQAA 4XXRA 3IH8A 4DE2A 4HEFA 5DF8A 1MKIA 2FFYA 3ZGAB 3V5MA 4R3BA 3M6BA 3ZG0A 2Y91A 4B4ZA 3WS2A 2GDNA 3HUMA 4X68A 4LV1A 5F83A 1WYCA 2V20A 4GZBA 5DTKA 4BJPA 1K55C 2EXBA 3GVBA 1MBLA 5FQIA 1ES2A 3ITAA 4RYEA 4NK3A 4JF4A 4P0MA 3M6HA 5CTNA 3W4QA 2RL3A 1EROA 1VQQA 4S2IA 2Z2MB 4PM5A 5EVIA 2X71A 1NJ4A 5HAPA 3UDXA 2ZQCA 5F1FA 4PM8A 3Q7VB 5FASA 3PBOA 4GNUA 3IF5A 5J8XA 2QZ6A 4PM7A 1BLPA 1GHPA 4PM9A 1QMEA 4OKPA 2C6WB 2HP6A 4BD1A 3PTEA 3IH9A 3LO7A 1ONGA 1PYYA 2EFXA 2J9PA 3VP4A 1E4DA 2HDSA 4IVIA 5D3OA 4JXSA 3ZVTA 1FSYA 1RGZA 3C7VA 3N8LA 5DTSA 5FQQA 1ZC2A 1NRFA 4PMAA 4OOYA 5GHXA 1WYBA 2WGVA 4UHUA 3G32A 3IXDA 4MNRA 3HLDA 2XDMA 5FQ9A 1TVFA 1XA1A 1XX2A 4JPMA 3UN7A 1EWZA 2I72A 2XFTA 3BFDA 4FH4A 1RGYA 4R4SA 4WELA 5M1AA 4OOMA 4Y7PA 2WZXA 3HLFA 3UO9A 1WE4A 1IKGA 5HL1A 3BLMA 1K54C 4IBXA 4E3JA 4BLMA 4DXBA 2HPBA 4KG5A 3MFDA 4R23A 1GHMA 5EUAA 3SS3A 4E3MA 1BSGA 1E3UD 2ZQ9A 1ZG4A 4EBPA 3N4IA 4E3LA 3Q82A 3IF6A 2HDRA 4KZ3A 3GR2A 3OZHA 3RXWA 3AGFA 3HBRA 5A93A 2EX8A 4S2JA 5DF9A 1KGGA 1IKIA 2PU4A 3HLCA 2Z2LB 3HVFA 3OPPA 4S2NC 4S2PA 1YLPA 1YLWA 3TOIA 5FQMA 1TEMA 2ZC5B 4MEZA 4B4XA 1RCJA 2XK1A 1DJBA 1KDWA 4KZBA 4PPRA 4MLLA 5FAPA 2ZC6B 5CEDA 5GLCA 3GRJA 2FFFB 2HDUA 4K0WA 4KZAA 5GLBA 1KVLA 1SKFA 4BQMA 4FCFA 1TDGA 5GLAA 4WM9A 2DRWA 3NC8A 2HP5A 1XKZA 2V2FF 3QNCA 1ERMA 4KQQA 3NBLA 2HP9A 1NXYA 4M3KA 3W4PA 4RA7A 3MKEA 2XEPA 4OPZA 2WAEA 3FKVA 3ZCZA 1BLHA 1GCEA 4XUZA 3BM6A 5KMWA 4C75A 3VSKA 1XGJA 2H10A 3LY3A 4X53A 1LLBA 4BL3A 4QHCA 3P09A 4WEJA 2J7VA 5A90A 1YT4A 3IXGA 2Q9NA 3VMAA 4GDNA 1PWDA 1SDEA 5DVAA 3UE0A 4N1XA 4R3JA 3P98A 4LCLA 4JBFA 5CEBA 1CEFA 3C7UA 3FYZA 5E2GA 3UNWA 5EVIB 3SS5A 5HAQA 2X01A 4R1GA 1DJAA 2ZMAA 4X69A 2P9VB 3BFCA 1KGEA 4WEKA 5HW3A 5CGXA 4OPYA 4KZ8A 4E3KA 4EV4A 2QMIA 4JXWA 1ES5A 3C5AA 3BEBA 3M2KA 3DWKA 4WBGA 1MPLA 2ZC7A 1ZG6A 4P87A 5CECA 2CC1A 1BLSA 1N9BA 2V1ZA 1YM1A 2ZQAA 3HLEA 5EPHA 5FQJA 1C3BA 2BLSA 2DNSA 4EBNA 2Y4AA 3NDGA 3NY4A 1PI4A 4UA6A 3EQVA 3NDEA 1Q2PA 4HESA 4R0QA 2XH9A 4UAAA 2E8IA 3SS4A 1YLZA 2RCXA 1TDLA 4O7DA 2G2WA 5CRFA 3I7JA 2IWBA 1KE3A 3UDIA 1LL5A 5CGSA 4B88A 3UDFA 1HVBA 4C3QA 1PIOA 1L0EA 3OPRA 1JWPA 3HREA 3TSGA 1L0FA 3IWOA 4CJNA 3OPLA 5TFQA 3MXSA 1KVMA 4E3IA 4ZDXA 4K91A 2J8YA 1FQGA 4IEDA 1K25A 1H8YA 2WKEA 2VGKA 3PAEA 3ZG9B 5JYPA 1O7EA 2Y2NA 5CGWA 1ALQA 4GD6A 1ES3A 5DTTA 1PW1A 5E43A 5F1GA 4D2OA 2Y2MA 1NZOA 3O3VA 2EX9A 4LENA 4GKUA 4H8RA 4S2MA 2WKIA 4XUXA 2Y2PA 3TG9A 4DF6A 5CHUA 5EVIC
chains in the Genus database with same CATH superfamily
4Y17A 3MBZA 4HP9A 2EXAA 4WZ4A 3OBFA 4EWFA 3DWZA 4N92A 1K4EA 2WUQA 2XSSA 3T4TA 3HLWA 4P6BA 3G30A 3IBJA 3QHYA 3VOZA 4DE1A 4EBLA 4Y13A 2X02A 3JPUA 3T1SA 3G2YA 3QNBA 4MN7A 4QY6A 3VP1A 4KZ4A 1F2KA 3T1XA 4HP4A 1KE4A 3WRZA 3T4JA 3CITA 2KX6A 3VV4A 1JWZA 2H0TA 4LCMA 2W0NA 5FDHA 4WMCD 4I38A 1IYQA 3RXXA 3VFHA 1K56D 5EM1A 1J3WA 4KUOA 5FAQA 4GHIB 1YLYA 3G35A 3TE8A 3TJZC 2OAP1 4GCZA 5AQ7A 3A3FA 1N9OA 1W63M 1MWSA 2ZM2A 3GMWA 3ISGA 1OTDA 2UWXA 1TS0A 5CHJA 2ZQDA 4I5SA 1PW8A 4UA7A 4OQIA 2R9WA 3HUNA 3VOYA 2JBFA 3IX8A 2ZM8A 1L2SA 3KYQA 4WZ5A 3DTMA 3MR0A 1CQAA 2Y59A 5EVLA 3NJAA 2VLGA 5CX7A 2VZWA 4LV2A 1D1JA 1NYYA 2ZMVA 2ZJ9A 5AJGA 2WGWB 2IA2A 4F94A 5JYOA 4N9KA 5A91A 2HJ9C 5EVID 3NECA 5HPIA 1P0ZA 1DY6A 1E25A 2KOIA 1W63Q 3BFFA 5LBRA 3PBSA 5MC7A 3F1PA 2EX6A 2PBYA 2PRFA 3TW8A 2XGNA 4RX3A 1W79A 4OQ0A 4CPKA 1WA9A 3CZDA 1EI5A 2B18A 4Q8IA 1AXBA 3G6OA 2BG1A 5AQAA 2XD5A 2P74A 4KZ5A 1K54A 1ES4A 4QPRA 5E2EA 5IHVA 3V50A 1UGUA 2W27A 3P01A 4ZJ1A 1F9IA 4JKTA 3E98A 3BW6A 4UA9A 4Y0OA 4S2NA 4L0LA 2AVXA 4X25A 3C30A 3CI6A 3SW1A 3LI9A 4DN0A 1YLJA 5FATA 5FI6A 1S66L 3QP1A 2HF6A 3V3RA 2B5RA 3O87A 2WZZA 5HX9A 4K0XA 1W5DA 1LI9A 2Y2JA 2VJWA 1S4RA 4FTXA 1PFLA 3VP2A 4CLCA 2QYBA 3IS2A 2XF3A 3W4OA 1W8YA 2GZAA 1PI5A 3N8RA 4H6JB 4HNBA 3UE1A 2Z6CA 4XT2A 3FV7A 1DP9A 1YQSA 1S0WA 1S1ZA 5EOOA 3CAXA 2G2UA 3CJMA 3AGDA 4KENB 5HZHA 2PT7A 4UQIS 1OPXA 3U2AA 3UPOA 3E2LA 4DXCA 3A3DA 3IX4A 1ZKJA 1YSPA 4O0PA 3UMEA 1XPBA 3A3JA 3IQAA 1XJ2A 5IS1A 4R3BA 4MN6A 3ZG0A 5KIZA 3WS2A 4JGPA 5F83A 3MF0A 1VETA 1WYCA 2JKFA 2V20A 1K55C 3GVBA 1MBLA 3DTKA 1YAXA 4JF4A 5DKLA 3O5YA 1VQQA 1NRJA 2Z2MB 4E04A 4PM5A 3UDXA 2ZQCA 4PM8A 1T1CA 5J8XA 2QZ6A 4PM7A 4I3JA 2HP6A 3PTEA 2J9PA 1E4DA 1UWPX 2FZ0A 4FUWA 5D3OA 1RGZA 3C7VA 4GW9A 1ZC2A 5GHXA 1GSVA 4LFUA 4CQHA 3L7HA 3IXDA 2XDMA 5FQ9A 1XA1A 1XX2A 3UN7A 2XFTA 3BFDA 4R4SA 3MJQA 3E4PA 3LFVA 4IBXA 3T1RA 2HPBA 4KG5A 4R23A 4DMZA 3SS3A 1BSGA 2ZQ9A 4E3LA 3IF6A 2HDRA 4WLAA 3GR2A 3ZYTA 5DF9A 2Z2LB 1G6OA 1YLPA 5FQMA 1PNEA 2XK1A 3LIDA 2JKTI 2FFFB 5GLBA 5HPFA 5GLAA 4WM9A 3NC8A 1T1BA 1UWNX 2V2FF 3PHYA 1NXYA 4RA7A 2WAEA 1EW0A 4XUZA 4C75A 1XGJA 4X53A 3P09A 3P98A 4FOFA 3FYZA 1N9LA 3F1PB 4R38A 4HIAA 2JKRM 1OJ5A 2ZMAA 4LPZA 1TS7A 3BFCA 4X69A 5HW3A 4F3LA 1X0OA 2QMIA 3M2KA 3DWKA 4P87A 1BLSA 2V1ZA 4MMNA 4CLCE 1IOUA 3CUEC 4EBNA 3NDGA 3NY4A 1PI4A 3NDEA 2E8IA 4O7DA 3IX3A 4KUKA 3I7JA 4ARZB 1HVBA 1PIOA 3TSGA 4PAUA 4IUHA 4EXOA 1STZA 4ZDXA 1FQGA 4IEDA 1K25A 1H8YA 3LEQA 3ZG9B 5JYPA 1O7EA 2J3TC 2XROA 2EX9A 3MQQA 2V1BA 1MWRA 5FQKA 3ICYA 2WK0A 4R4RA 5DJTA 2PR5A 4ESPA 5HDCA 4IBRA 3LR0A 3R4KA 4E6XA 3UB6A 3IS2B 4Z9QA 4KZ7A 2WGWA 3ZNYA 3JYIA 1Q2QA 2DMWA 4OP8A 4K08A 2IWDA 3ZNTA 1Y4OA 5L07A 3H82A 1JTDA 4C6YA 2Y55A 5TJJA 3VP0A 4O01A 3ZG7B 4KZ6A 1IEMA 4X55A 4FH2A 3MZEA 1KOUA 3BQAA 2NUPC 2J3WA 1E3UA 2Y2IA 3LY4A 5DF7A 1K38A 3WWXA 2I9VA 4GOGA 1K57A 3ZVWA 5CXWA 2K2NA 4UEYA 4DDSA 5L2FA 3CPTB 1K0KA 2XA7M 4BL2A 3A3IA 4IVKA 5GHYA 1JNUA 2PD7A 4YINA 1VETB 3QP4A 4LRZE 3BRMA 2PAVP 1HD8A 3E2KA 4A5RA 4P85A 2JCHA 3H7WA 3BFGA 3MSHA 1TS6A 3B33A 1FIKA 3LCEA 2C5WB 1SCWA 4II7A 2A3UA 4JF5A 4E6WA 3GTCA 1NZUA 5M18A 1BT5A 5J7EA 1MKMA 3G4PA 4HBTA 3N8SA 1OTEA 3UMDA 3K3DA 5DFXA 2HZ5A 4B9OA 4NXFA 3G34A 4FD8A 3C4PA 4MN5A 3HUOA 1IELA 4KG2A 1HZOA 4ID4A 3NOTC 2OSUA 3RFBA 3OC2A 4H6JA 1MXOA 4ETZA 4ZBEA 3V3SA 3VSLA 4HJ6A 5GLDA 3OCLA 4EQIA 3IF6B 2Y2KA 2ZL1B 1PZPA 1H5XA 4EETB 5FI7A 3F1NB 3V67A 3KYEA 2PU2A 2IWCA 4DJ3A 2L4RA 5AVEA 2P9VA 4WL9A 3OCNA 4MBFA 5FA7A 4MDZA 1IYSA 1JWVA 4S2LA 3EEHA 3LUQA 3QP8A 4LV3A 4HY8A 4DKIA 4MCWA 1I5QA 4I39A 3S7NA 2V9AA 3BY8A 1O07A 1FCMA 3MXQA 4OQGA 4GD8A 1H8ZA 3OPHA 4HH3A 3HL9A 2EFUA 1JTGA 2UV0E 1RP5A 2ZC4B 4F3LB 1YMXA 1YLTA 3F1OA 3EGDC 1ESUA 3BY9A 4OOLA 3C2WA 1LHYA 3AGEA 2GJ3A 2Y2OA 3MS6A 4CLCC 3KSHA 3FKWA 4LV0A 3UPPA 3CHWP 5DJUA 1V9YA 2H0YA 4FSFA 2VV6A 1V9ZA 3WS4A 4Z1WA 3TRCA 4DE3A 3OOVA 3A3EA 1LSXA 3HJIA 5GL9A 3IWIA 1YKDA 4QWOA 4OPQA 1K6RA 1NLYA 1TD5A 3ULFA 4PM6A 4P6ZM 4XXRA 3E4QA 1MKIA 2FFYA 3T1QB 3M6BA 4B4ZA 3HUMA 4LV1A 3H82B 4GZBA 4BJPA 2VKSA 1N9NA 1ES2A 1VEUA 2GNXA 1F98A 3ITAA 4RYEA 5CTNA 1YPRA 2RL3A 4Y5FA 3T4KA 2K31A 4R6LA 4P6ZS 4GNUA 4LGWA 2HGVA 1GHPA 4OKPA 2W1TA 1Y28A 4ME4A 2EFXA 1PYYA 1G28A 2G7UA 2HDSA 2QJ7A 2ZMFA 4JXSA 3ZVTA 1FSYA 5DTSA 4PMAA 4ARZA 5FEFA 2WGVA 3G32A 2O99A 4JPMA 3H7WB 1EWZA 2I72A 1RGYA 4BBVA 5M1AA 4OOMA 5HL1A 3KO6A 4E3JA 1DP6A 1GHMA 4E3MA 1E3UD 1F5MA 4EBPA 3Q82A 1OTBA 3AGFA 3BQ8A 5A93A 2EX8A 2PU4A 1IKIA 3OPPA 4S2PA 3LIAA 2KDKA 5K5BA 1TEMA 4EUVA 4B4XA 1RCJA 4PKYG 1DJBA 2A2LA 4UQIM 5GLCA 3GRJA 3W2ZA 3DTIA 4HJ4A 1TDGA 2DRWA 5EVEA 3QNCA 1XKZA 2WKQA 4KQQA 2VA0A 1OJGA 2VGLM 3W4PA 3QP2A 3FKVA 1P9RA 1BLHA 2M7VA 2H10A 3LY3A 3LIBA 4QHCA 1YT4A 3D3OA 1SDEA 5DVAA 4N1XA 4JBFA 5CEBA 1CEFA 2K7SA 3SS5A 2X01A 1DJAA 2PYRA 2P9VB 3PXPA 4X1LA 1MPLA 2VGLS 2ZC7A 3CPTA 5FQJA 4LRYC 3DTEA 1Q2PA 4R0QA 2XH9A 1YLZA 2RCXA 1HLUP 1P97A 2KLIA 4B88A 3LIEA 1S67L 3NOUC 4C3QA 3T12B 1JWPA 3HREA 3IWOA 5L8MA 3BWLA 5TFQA 1KVMA 1ZTUA 4K91A 2J8YA 2VGKA 5CGWA 4G3KA 4LENA 4GKUA 2WKIA 3F1OB 3TG9A 4DF6A 5CHUA 5EVIC 3NCKA 2YKHA 1HTZA 4U3TA 3ZDJA 3GECA 1BLCA 2ZLYA 3LEZA 2Y8HA 1BUEA 2OV5A 3Q81A 1KDSA 1PZOA 4S2KA 3K3CA 3GV9A 2DCFA 3C4OA 4OONA 3NOPC 5HFOA 1N4OA 3MXRA 2W3GA 4OLGA 4NG2A 2PD8A 4NXBA 3O86A 1S6RA 4OP5A 1W7FA 2ZQ8A 3P7NA 2ZL1A 4PKYA 1FOFA 1XJ3A 4GDBA 2XR0A 3N6IA 5GHZA 1DRMA 2JN7A 5G4ZA 1YSQA 3F1NA 4Y0TA 3NI9A 1U60A 4OLDA 3MMHA 2FH5A 4KQRA 3T4OA 4DDYA 3VFFA 4WUJA 4QB8A 3NIAA 3IXBA 4HH2A 3SH7A 1CI9A 4RX2A 4MBHA 3W8KA 1T1AA 4Y0UA 1VEUB 2Q9MA 3D72A 3UY6A 1GHIA 3LR5A 5I94A 5HSQA 5E2HA 2ZOHA 2Y2HA 1PRQA 3MZDA 4X56A 1OMEA 2W1TB 2XQZA 5KSCA 3EOIA 3CMZA 2ZD8A 2WYXA 1LT0A 5AVFA 2QJ5A 2VV7A 3SZTA 5CERA 3Q1FA 3A0SA 4QY5A 1Z09A 2Y2LA 2D02A 5J4EA 1FCOA 1XFNA 3IWQA 1K55A 1XP4A 2XLNA 1QMFA 5TR7A 3S4XA 2A24A 4NEED 4JF6A 5HD5A 3LICA 3BLSA 1SHVA 3EGXC 1LSWA 1DJCA 4BMWA 3D9YA 4QJGA 3S22A 5C5KA 1GSWA 3R7WB 3E0YA 2P7JA 2OAQ1 3Q07A 1I2WA 3PBNA 3UPNA 3WRTA 3SH9A 1IYOA 3PBTA 4EESA 1Y54A 1MWTA 1P9WA 4KQDA 2O9CA 1NYMA 2J9OA 5FSRA 2B02A 4YNRA 5KZHA 5FEGA 3A0RA 2BASA 5EFWA 1CI8A 4OVDA 5AQBA 5IT5A 1K4FA 3QP5A 3IHBA 1PWGA 3WS5A 4U0TA 5AQ9A 4ZAMA 3IXHA 1MY8A 2OLUA 5A8BA 4E3OA 2EWWA 4YOFA 4BENA 3A0VA 3ZFZA 2Y2QA 3C38A 2XD1A 4M4XA 1LL9A 3BYDA 2VX8A 5BOHA 2OLVA 1G6AA 5F82A 1SZVA 5FI2A 1LI0A 1K6SA 1PWCA 4R3AA 2PR6A 4JXGA 1FR1A 4LLOB 4WZ5C 3SH8A 1H8MA 2E8JA 5HAIA 3G31A 1ESIA 4DE0A 2Y2GA 3ZG8B 2H5SA 3EEAA 4S2OA 2QHKA 3CUEA 3HLBA 4NKPA 1XXMA 2V8CA 3ZHHA 2BTFP 1W8QA 3B47A 4DE2A 3IH8A 2JHEA 2O9BA 3ZGAB 4AFIA 5HL6A 2V1AA 5J3WA 4NK3A 1L3LA 3LR3A 3W4QA 4G3WA 4S2IA 5HAPA 4GS9B 3KSIA 5F1FA 3Q7VB 2MJ6A 5FASA 3IF5A 1MZUA 2PHYA 3HCYA 1BLPA 4PM9A 1QMEA 1OTIA 2C6WB 4BD1A 3IH9A 3LO7A 2W3FA 2NUTC 2J80A 3VP4A 2W3HA 2YKFA 3N8LA 4JGOA 3U4LP 4EEPA 2O0YA 4ETXA 4BWIA 4FH4A 4WELA 4NXEA 1D7EA 4Y7PA 2WZXA 3HLFA 1WE4A 1IKGA 4WN5A 3BLMA 1K54C 4DXBA 4BLMA 3N4IA 4KZ3A 3OZHA 3RXWA 4RQ9A 1XJ4A 3HBRA 4I3IA 1KGGA 3HLCA 4S2NC 4O8GA 2ZC5B 4MEZA 2JKTM 3RH8B 3UE6A 4KZBA 5FAPA 4HJ3A 4KZAA 4K0WA 2V8FA 1KVLA 4EU0A 4FCFA 4Y3IA 3H9WA 4HOIA 2HP5A 1ERMA 5F5YA 3MQ0A 2JKGA 4OPZA 3KYZA 1GCEA 3B42A 3VSKA 4BL3A 2A24B 2M1CA 3KX0X 2PDRA 5A90A 2Q9NA 3VMAA 1PWDA 3UE0A 4R3JA 4LCLA 3UNWA 5EVIB 2QKPA 4WEKA 2JKRI 1NLZA 4OPYA 5TBMB 4E3KA 4EV4A 4JXWA 1FILA 1ES5A 3C5AA 3BEBA 2ACGA 5CECA 2ZQAA 3HLEA 3LYXA 2HV1A 2BLSA 2DNSA 4Q0JA 2Y4AA 4UA6A 3EQVA 3SS4A 1OT9A 2INWA 1TDLA 2G2WA 2V0UA 2IWBA 1KE3A 1VHMA 2OOLA 5CGSA 5L09A 2OWHA 2B95A 1L0EA 3OPRA 4CJNA 1XFQA 4IHQA 2WKEA 3PAEA 2Y2NA 4GD6A 1ES3A 5F1GA 4D2OA 3O3VA 4H8RA 5HWVA 2ZOIA 2Y2PA 1XA7A 5CTMA 3RJUA 3HLGA 3IT9A 4HI4A 4GLQA 3PYPA 4DJ2A 4OPRA 4X1MA 1BZAA 2VK3A 1CJFA 4ZRRA 5EOEA 1YMSA 3EWKA 1FCNA 4ZTKA 4ZJ2A 3NHQA 3BFEA 4R70A 3BECA 4QU3A 1FSWA 3T4QA 4YFMA 5HWWA 4B93A 3Q7ZA 2WADA 3D4FA 4E3NA 1J9MA 1NY0A 3O88A 1XGIA 2LB9A 2W1RA 3C8CA 1ONHA 1D06A 1BYWA 3IF6C 1IYPA 3MFXA 1L0DA 3R7WA 1M40A 1L0GA 5G18A 5HWTA 1GSXA 3GSGA 4YWZA 4Y15A 3LI8A 1GA0A 4RVAA 3GDIA 1AWIA 3N7WA 4N9LA 3T4SA 3G2ZA 4EUZA 3VOLA 3FPWA 1LL8A 1H3QA 2R9XA 5KSHA 5HD3A 4KZ9A 4U0XA 4LRXC 3ZG5A 5EM0A 3M2JA 1JVJA 4GN2A 1KGFA 1BULA 3CWFA 4JXVA 1S1YA 3MZFA 3WS0A 3CG5A 3WS1A 2R78A 2XRNA 3B3XA 2ZC3B 4ZJ3A 5FDSA 1M6KA 1CEGA 4BD0A 5HARA 2XFSA 3ITBA 2HDQA 1SDNA 4DRTA 1G5UA 4GB7A 3V39A 2LB5A 1SKOA 4EEUA 2J3TD 2JE5A 4X6TA 4HQAA 2W3EA 4QD4A 3UE3A 5A92A 3IBRA 3RTYA 3S1YA 3LGOA 1GA9A 2EX2A 3KSFA 3IHAA 1BTLA 3SOIA 5EV0A 3PBRA 1KE0A 3BJNA 2L1MA 2WAFA 2JC7A 3FC7A 4G3VA 4OQHA 2ZM0A 1T19A 5DFYA 3GQZA 5CHMA 3K2NA 1CF0A 5F68A 5EE8A 5F6AA 2WKPA 3ZQ5A 3UB8A 2QPNA 4PHTA 4D60A 3FZCA 2VGJA 4WYYA 3DAVA 4HHDA 1Z6FA 4OH0A 2ZQ7A 1XJ6A 4EERA 4GJ4A 1ODVA 2HJEA 2O9AA 1G68A 3MKFA 4JGRA 2P04A 4GS9A 1NWZA 4I3AA 5IU1A 1H0MA 3Q7VA 3DW0A 3QP6A 5M19A 5U47A 5HDSA 5EECA 3VE3A 4KG6A 1S4SA 1MWUA 4MBKA 4WMCA 1K57C 3EQUA 5E2FA 3VP3A 1K56A 3PBQA 3UB5P 3PAGA 4KQOA 5FAOA 1I2SA 1VM1A 1CK3A 2WGIA 1FR6A 1ERQA 2H28A 3FPVA 4HBUA 4WF0A 5TGFA 4NXGA 3UB9A 2W3DA 4N1HA 3FWLA 2VEAA 4JLFA 1TS8A 2A49A 2WKHA 2GX5A 4NETA 1OTAA 4IUKA 4HEFA 3HJKA 5DF8A 4GHIA 3V5MA 3DBAA 2Y91A 2GDNA 4X68A 3UB7A 5DTKA 1ZHHB 2EA9A 2EXBA 4Q0IA 5FQIA 4P0MA 3M6HA 2P08A 3T50A 1EROA 5EVIA 2X71A 1NJ4A 3T4LA 5TBMA 3PBOA 2ZBBA 3S7PA 4EW7A 1ONGA 2V0WA 3PR6A 4IVIA 3JVVA 3MQOA 5G4YA 4Y2FA 5FQQA 1NRFA 4OOYA 1WYBA 4CLCB 4UHUA 1LSVA 4EQ1A 4MNRA 3HLDA 1TVFA 5HDDA 3KSGA 3UO9A 4XT2B 3MFDA 5EUAA 3LIFA 4BBUA 1ZG4A 2Q0OA 4S2JA 3HVFA 1YLWA 3TOIA 3OLOA 2PYPA 1KDWA 3S7OA 3E4OA 4PPRA 4MLLA 4BBTA 2ZC6B 1OT6A 5CEDA 4L9EA 2HDUA 3NULA 1SKFA 4L9FA 4BQMA 1DP8A 5FL3A 1SKOB 3S7QA 3NBLA 4CLCD 2HP9A 5DKKA 2Y79A 4M3KA 3MKEA 2XEPA 3ZCZA 1A0KA 5KMWA 3BM6A 1LLBA 3JVUA 4WEJA 2J7VA 4Q0HA 3IXGA 2WKRA 4GDNA 3FG8A 3CLOA 3C7UA 5E2GA 5HAQA 2VV8A 4R1GA 2D01A 1KGEA 5CGXA 4KZ8A 1MC0A 1VB6A 5L10A 3L9KA 4WBGA 2XA7S 1ZG6A 1TF1A 2CC1A 1N9BA 2Z6DA 5EPHA 1YM1A 4IJGA 1C3BA 2PBDP 4HESA 2QWSA 4UAAA 5I5LA 2L0WA 1T18A 5CRFA 3VE4A 3UDIA 5F69A 1LL5A 3LR4A 2CMNA 3UDFA 1L0FA 2EWVA 2OWJA 3OPLA 1ACFA 3MXSA 4E3IA 4L9GA 1IFQA 1ALQA 5DTTA 1PW1A 5E43A 2Y2MA 1NZOA 4JGQA 4S2MA 4XUXA 2M7UA
chains in the Genus database with same CATH topology
1MWRA 3NCKA 1HTZA 1XA7A 3MBZA 5FQKA 4U3TA 2EXAA 5CTMA 3RJUA 4WZ4A 3ZDJA 3HLGA 3IT9A 1BLCA 2WK0A 2ZLYA 3LEZA 4R4RA 1BUEA 4EWFA 2OV5A 3DWZA 4OPRA 4N92A 1BZAA 1K4EA 3Q81A 1KDSA 1PZOA 4IBRA 4S2KA 5EOEA 4E6XA 3GV9A 1YMSA 2WUQA 1FCNA 4ZTKA 4ZJ2A 2DCFA 3C4OA 3HLWA 4P6BA 3G30A 4DE1A 3QHYA 3BFEA 3VOZA 4Z9QA 4KZ7A 4OONA 2WGWA 3BECA 4QU3A 3ZNYA 4EBLA 3JYIA 1FSWA 5HFOA 1N4OA 2X02A 1Q2QA 3MXRA 4OP8A 4OLGA 2IWDA 3G2YA 3ZNTA 4YFMA 3QNBA 4QY6A 3VP1A 3O86A 1S6RA 4OP5A 1W7FA 2ZQ8A 1JTDA 4KZ4A 4C6YA 2Y55A 3VP0A 3Q7ZA 2WADA 1FOFA 3D4FA 4GDBA 4E3NA 2XR0A 1J9MA 3N6IA 5GHZA 1NY0A 3ZG7B 4KZ6A 1KE4A 1IEMA 3O88A 1XGIA 4X55A 3WRZA 4FH2A 4Y0TA 3MZEA 3NI9A 1ONHA 1U60A 3IF6C 4OLDA 1E3UA 1JWZA 2H0TA 1IYPA 2Y2IA 3LY4A 4LCMA 5DF7A 1K38A 5FDHA 3WWXA 4KQRA 4WMCD 1L0DA 1M40A 4GOGA 1IYQA 1L0GA 3RXXA 3VFHA 1K57A 3ZVWA 5CXWA 5L2FA 1K56D 4DDSA 5G18A 4DDYA 3VFFA 3GSGA 5FAQA 1YLYA 3G35A 4QB8A 1GA0A 3NIAA 4RVAA 3IXBA 4BL2A 3A3IA 4IVKA 5AQ7A 3A3FA 5GHYA 3N7WA 4N9LA 3SH7A 1MWSA 3G2ZA 1CI9A 4YINA 4RX2A 4EUZA 2ZM2A 4MBHA 3GMWA 3W8KA 2R9XA 3ISGA 3BRMA 3E2KA 1HD8A 2UWXA 4Y0UA 4A5RA 5KSHA 4P85A 2JCHA 2Q9MA 5CHJA 3UY6A 4KZ9A 4U0XA 1GHIA 3BFGA 2ZQDA 3ZG5A 5I94A 1PW8A 5E2HA 3M2JA 4UA7A 4OQIA 2R9WA 1JVJA 4GN2A 1KGFA 3HUNA 3LCEA 3VOYA 2C5WB 1BULA 4JXVA 2Y2HA 2JBFA 1SCWA 2A3UA 2ZM8A 4JF5A 3MZFA 3WS0A 3MZDA 3CG5A 4X56A 3GTCA 3WS1A 1NZUA 4E6WA 3B3XA 2ZC3B 1L2SA 4ZJ3A 4WZ5A 5M18A 1OMEA 1BT5A 3G4PA 2XQZA 3DTMA 3N8SA 4HBTA 5KSCA 3CMZA 2ZD8A 2WYXA 1M6KA 1CEGA 2Y59A 3G34A 5EVLA 4FD8A 3C4PA 4BD0A 5HARA 2XFSA 3ITBA 5CERA 3Q1FA 2HDQA 1SDNA 4DRTA 3HUOA 1IELA 4KG2A 1HZOA 4QY5A 4GB7A 3V39A 4ID4A 4LV2A 2OSUA 2Y2LA 1NYYA 3OC2A 2ZJ9A 1FCOA 2WGWB 4F94A 5JYOA 3IWQA 1K55A 1XP4A 1MXOA 2JE5A 4X6TA 2XLNA 4ZBEA 3V3SA 3VSLA 4QD4A 4N9KA 5GLDA 3UE3A 3OCLA 1QMFA 5A91A 5A92A 4EQIA 5EVID 3S1YA 5TR7A 3S4XA 3IF6B 1DY6A 1E25A 2Y2KA 1GA9A 2EX2A 4JF6A 1PZPA 1H5XA 5FI7A 3IHAA 3BLSA 1BTLA 1SHVA 3BFFA 3SOIA 2PU2A 3PBRA 3PBSA 2IWCA 1KE0A 2EX6A 1DJCA 2PBYA 2P9VA 2WAFA 4QJGA 3S22A 2JC7A 3OCNA 4OQHA 4MBFA 5FA7A 2ZM0A 1IYSA 1JWVA 3GQZA 5CHMA 2XGNA 4RX3A 3Q07A 1W79A 4OQ0A 4CPKA 5EE8A 3CZDA 1I2WA 4S2LA 3PBNA 3UPNA 4LV3A 3SH9A 1EI5A 2QPNA 3WRTA 4DKIA 4Q8IA 1IYOA 3FZCA 1AXBA 2VGJA 3PBTA 2BG1A 1Y54A 1MWTA 5AQAA 1I5QA 2XD5A 4WYYA 2P74A 1Z6FA 4KZ5A 4OH0A 1O07A 2ZQ7A 1K54A 1FCMA 4OQGA 1ES4A 5E2EA 5IHVA 1NYMA 4GD8A 3V50A 1H8ZA 3OPHA 3HL9A 1G68A 2EFUA 3MKFA 2J9OA 4ZJ1A 1JTGA 4JKTA 5FSRA 1RP5A 4UA9A 3Q7VA 5KZHA 4Y0OA 3DW0A 5M19A 1CI8A 4S2NA 2ZC4B 5U47A 4OVDA 4L0LA 1YMXA 1YLTA 5AQBA 1K4FA 1ESUA 3IHBA 5EECA 4KG6A 1PWGA 4OOLA 1YLJA 3WS5A 5FATA 1MWUA 5FI6A 4MBKA 4U0TA 5AQ9A 4ZAMA 4WMCA 1K57C 3IXHA 1LHYA 1MY8A 2B5RA 2OLUA 3AGEA 3EQUA 3O87A 3V3RA 2WZZA 5E2FA 5HX9A 3VP3A 4K0XA 1W5DA 1K56A 1LI9A 2Y2OA 2Y2JA 4E3OA 3PBQA 3VP2A 3PAGA 4BENA 4KQOA 3ZFZA 2XF3A 2Y2QA 3W4OA 1W8YA 5FAOA 1PI5A 2XD1A 3N8RA 1I2SA 3FKWA 4LV0A 3UE1A 3FV7A 1VM1A 1CK3A 1LL9A 3BYDA 3UPPA 1YQSA 1S0WA 2WGIA 5BOHA 1FR6A 2OLVA 1G6AA 1ERQA 5EOOA 5F82A 2G2UA 4HBUA 5TGFA 2H0YA 4FSFA 5FI2A 3WS4A 1LI0A 4N1HA 1K6SA 1PWCA 3CJMA 3AGDA 4KENB 3FWLA 4JXGA 4DE3A 1FR1A 4JLFA 2A49A 4WZ5C 3A3EA 5GL9A 3SH8A 3UPOA 5HAIA 3E2LA 3G31A 1ESIA 3IWIA 2Y2GA 3A3DA 3ZG8B 4DE0A 4DXCA 2H5SA 2WKHA 4S2OA 1ZKJA 4OPQA 3HLBA 1K6RA 1XXMA 3ZHHA 4PM6A 4NETA 1XPBA 1W8QA 3A3JA 3IQAA 4XXRA 3IH8A 4DE2A 4HEFA 5DF8A 1MKIA 2FFYA 3ZGAB 3V5MA 4R3BA 3M6BA 3ZG0A 2Y91A 4B4ZA 3WS2A 2GDNA 3HUMA 4X68A 4LV1A 5F83A 1WYCA 2V20A 4GZBA 5DTKA 4BJPA 1K55C 2EXBA 3GVBA 1MBLA 5FQIA 1ES2A 3ITAA 4RYEA 4NK3A 4JF4A 4P0MA 3M6HA 5CTNA 3W4QA 2RL3A 1EROA 1VQQA 4S2IA 2Z2MB 4PM5A 5EVIA 2X71A 1NJ4A 5HAPA 3UDXA 2ZQCA 5F1FA 4PM8A 3Q7VB 5FASA 3PBOA 4GNUA 3IF5A 5J8XA 2QZ6A 4PM7A 1BLPA 1GHPA 4PM9A 1QMEA 4OKPA 2C6WB 2HP6A 4BD1A 3PTEA 3IH9A 3LO7A 1ONGA 1PYYA 2EFXA 2J9PA 3VP4A 1E4DA 2HDSA 4IVIA 5D3OA 4JXSA 3ZVTA 1FSYA 1RGZA 3C7VA 3N8LA 5DTSA 5FQQA 1ZC2A 1NRFA 4PMAA 4OOYA 5GHXA 1WYBA 2WGVA 4UHUA 3G32A 3IXDA 4MNRA 3HLDA 2XDMA 5FQ9A 1TVFA 1XA1A 1XX2A 4JPMA 3UN7A 1EWZA 2I72A 2XFTA 3BFDA 4FH4A 1RGYA 4R4SA 4WELA 5M1AA 4OOMA 4Y7PA 2WZXA 3HLFA 3UO9A 1WE4A 1IKGA 5HL1A 3BLMA 1K54C 4IBXA 4E3JA 4BLMA 4DXBA 2HPBA 4KG5A 3MFDA 4R23A 1GHMA 5EUAA 3SS3A 4E3MA 1BSGA 1E3UD 2ZQ9A 1ZG4A 4EBPA 3N4IA 4E3LA 3Q82A 3IF6A 2HDRA 4KZ3A 3GR2A 3OZHA 3RXWA 3AGFA 3HBRA 5A93A 2EX8A 4S2JA 5DF9A 1KGGA 1IKIA 2PU4A 3HLCA 2Z2LB 3HVFA 3OPPA 4S2NC 4S2PA 1YLPA 1YLWA 3TOIA 5FQMA 1TEMA 2ZC5B 4MEZA 4B4XA 1RCJA 2XK1A 1DJBA 1KDWA 4KZBA 4PPRA 4MLLA 5FAPA 2ZC6B 5CEDA 5GLCA 3GRJA 2FFFB 2HDUA 4K0WA 4KZAA 5GLBA 1KVLA 1SKFA 4BQMA 4FCFA 1TDGA 5GLAA 4WM9A 2DRWA 3NC8A 2HP5A 1XKZA 2V2FF 3QNCA 1ERMA 4KQQA 3NBLA 2HP9A 1NXYA 4M3KA 3W4PA 4RA7A 3MKEA 2XEPA 4OPZA 2WAEA 3FKVA 3ZCZA 1BLHA 1GCEA 4XUZA 3BM6A 5KMWA 4C75A 3VSKA 1XGJA 2H10A 3LY3A 4X53A 1LLBA 4BL3A 4QHCA 3P09A 4WEJA 2J7VA 5A90A 1YT4A 3IXGA 2Q9NA 3VMAA 4GDNA 1PWDA 1SDEA 5DVAA 3UE0A 4N1XA 4R3JA 3P98A 4LCLA 4JBFA 5CEBA 1CEFA 3C7UA 3FYZA 5E2GA 3UNWA 5EVIB 3SS5A 5HAQA 2X01A 4R1GA 1DJAA 2ZMAA 4X69A 2P9VB 3BFCA 1KGEA 4WEKA 5HW3A 5CGXA 4OPYA 4KZ8A 4E3KA 4EV4A 2QMIA 4JXWA 1ES5A 3C5AA 3BEBA 3M2KA 3DWKA 4WBGA 1MPLA 2ZC7A 1ZG6A 4P87A 5CECA 2CC1A 1BLSA 1N9BA 2V1ZA 1YM1A 2ZQAA 3HLEA 5EPHA 5FQJA 1C3BA 2BLSA 2DNSA 4EBNA 2Y4AA 3NDGA 3NY4A 1PI4A 4UA6A 3EQVA 3NDEA 1Q2PA 4HESA 4R0QA 2XH9A 4UAAA 2E8IA 3SS4A 1YLZA 2RCXA 1TDLA 4O7DA 2G2WA 5CRFA 3I7JA 2IWBA 1KE3A 3UDIA 1LL5A 5CGSA 4B88A 3UDFA 1HVBA 4C3QA 1PIOA 1L0EA 3OPRA 1JWPA 3HREA 3TSGA 1L0FA 3IWOA 4CJNA 3OPLA 5TFQA 3MXSA 1KVMA 4E3IA 4ZDXA 4K91A 2J8YA 1FQGA 4IEDA 1K25A 1H8YA 2WKEA 2VGKA 3PAEA 3ZG9B 5JYPA 1O7EA 2Y2NA 5CGWA 1ALQA 4GD6A 1ES3A 5DTTA 1PW1A 5E43A 5F1GA 4D2OA 2Y2MA 1NZOA 3O3VA 2EX9A 4LENA 4GKUA 4H8RA 4S2MA 2WKIA 4XUXA 2Y2PA 3TG9A 4DF6A 5CHUA 5EVIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWR A;  3NCK A;  1HTZ A;  1XA7 A;  3MBZ A;  5FQK A;  4U3T A;  2EXA A;  5CTM A;  3RJU A;  4WZ4 A;  3ZDJ A;  3HLG A;  3IT9 A;  1BLC A;  2WK0 A;  2ZLY A;  3LEZ A;  4R4R A;  1BUE A;  4EWF A;  2OV5 A;  3DWZ A;  4OPR A;  4N92 A;  1BZA A;  1K4E A;  3Q81 A;  1KDS A;  1PZO A;  4IBR A;  4S2K A;  5EOE A;  4E6X A;  3GV9 A;  1YMS A;  2WUQ A;  1FCN A;  4ZTK A;  4ZJ2 A;  2DCF A;  3C4O A;  3HLW A;  4P6B A;  3G30 A;  4DE1 A;  3QHY A;  3BFE A;  3VOZ A;  4Z9Q A;  4KZ7 A;  4OON A;  2WGW A;  3BEC A;  4QU3 A;  3ZNY A;  4EBL A;  3JYI A;  1FSW A;  5HFO A;  1N4O A;  2X02 A;  1Q2Q A;  3MXR A;  4OP8 A;  4OLG A;  2IWD A;  3G2Y A;  3ZNT A;  4YFM A;  3QNB A;  4QY6 A;  3VP1 A;  3O86 A;  1S6R A;  4OP5 A;  1W7F A;  2ZQ8 A;  1JTD A;  4KZ4 A;  4C6Y A;  2Y55 A;  3VP0 A;  3Q7Z A;  2WAD A;  1FOF A;  3D4F A;  4GDB A;  4E3N A;  2XR0 A;  1J9M A;  3N6I A;  5GHZ A;  1NY0 A;  3ZG7 B;  4KZ6 A;  1KE4 A;  1IEM A;  3O88 A;  1XGI A;  4X55 A;  3WRZ A;  4FH2 A;  4Y0T A;  3MZE A;  3NI9 A;  1ONH A;  1U60 A;  3IF6 C;  4OLD A;  1E3U A;  1JWZ A;  2H0T A;  1IYP A;  2Y2I A;  3LY4 A;  4LCM A;  5DF7 A;  1K38 A;  5FDH A;  3WWX A;  4KQR A;  4WMC D;  1L0D A;  1M40 A;  4GOG A;  1IYQ A;  1L0G A;  3RXX A;  3VFH A;  1K57 A;  3ZVW A;  5CXW A;  5L2F A;  1K56 D;  4DDS A;  5G18 A;  4DDY A;  3VFF A;  3GSG A;  5FAQ A;  1YLY A;  3G35 A;  4QB8 A;  1GA0 A;  3NIA A;  4RVA A;  3IXB A;  4BL2 A;  3A3I A;  4IVK A;  5AQ7 A;  3A3F A;  5GHY A;  3N7W A;  4N9L A;  3SH7 A;  1MWS A;  3G2Z A;  1CI9 A;  4YIN A;  4RX2 A;  4EUZ A;  2ZM2 A;  4MBH A;  3GMW A;  3W8K A;  2R9X A;  3ISG A;  3BRM A;  3E2K A;  1HD8 A;  2UWX A;  4Y0U A;  4A5R A;  5KSH A;  4P85 A;  2JCH A;  2Q9M A;  5CHJ A;  3UY6 A;  4KZ9 A;  4U0X A;  1GHI A;  3BFG A;  2ZQD A;  3ZG5 A;  5I94 A;  1PW8 A;  5E2H A;  3M2J A;  4UA7 A;  4OQI A;  2R9W A;  1JVJ A;  4GN2 A;  1KGF A;  3HUN A;  3LCE A;  3VOY A;  2C5W B;  1BUL A;  4JXV A;  2Y2H A;  2JBF A;  1SCW A;  2A3U A;  2ZM8 A;  4JF5 A;  3MZF A;  3WS0 A;  3MZD A;  3CG5 A;  4X56 A;  3GTC A;  3WS1 A;  1NZU A;  4E6W A;  3B3X A;  2ZC3 B;  1L2S A;  4ZJ3 A;  4WZ5 A;  5M18 A;  1OME A;  1BT5 A;  3G4P A;  2XQZ A;  3DTM A;  3N8S A;  4HBT A;  5KSC A;  3CMZ A;  2ZD8 A;  2WYX A;  1M6K A;  1CEG A;  2Y59 A;  3G34 A;  5EVL A;  4FD8 A;  3C4P A;  4BD0 A;  5HAR A;  2XFS A;  3ITB A;  5CER A;  3Q1F A;  2HDQ A;  1SDN A;  4DRT A;  3HUO A;  1IEL A;  4KG2 A;  1HZO A;  4QY5 A;  4GB7 A;  3V39 A;  4ID4 A;  4LV2 A;  2OSU A;  2Y2L A;  1NYY A;  3OC2 A;  2ZJ9 A;  1FCO A;  2WGW B;  4F94 A;  5JYO A;  3IWQ A;  1K55 A;  1XP4 A;  1MXO A;  2JE5 A;  4X6T A;  2XLN A;  4ZBE A;  3V3S A;  3VSL A;  4QD4 A;  4N9K A;  5GLD A;  3UE3 A;  3OCL A;  1QMF A;  5A91 A;  5A92 A;  4EQI A;  5EVI D;  3S1Y A;  5TR7 A;  3S4X A;  3IF6 B;  1DY6 A;  1E25 A;  2Y2K A;  1GA9 A;  2EX2 A;  4JF6 A;  1PZP A;  1H5X A;  5FI7 A;  3IHA A;  3BLS A;  1BTL A;  1SHV A;  3BFF A;  3SOI A;  2PU2 A;  3PBR A;  3PBS A;  2IWC A;  1KE0 A;  2EX6 A;  1DJC A;  2PBY A;  2P9V A;  2WAF A;  4QJG A;  3S22 A;  2JC7 A;  3OCN A;  4OQH A;  4MBF A;  5FA7 A;  2ZM0 A;  1IYS A;  1JWV A;  3GQZ A;  5CHM A;  2XGN A;  4RX3 A;  3Q07 A;  1W79 A;  4OQ0 A;  4CPK A;  5EE8 A;  3CZD A;  1I2W A;  4S2L A;  3PBN A;  3UPN A;  4LV3 A;  3SH9 A;  1EI5 A;  2QPN A;  3WRT A;  4DKI A;  4Q8I A;  1IYO A;  3FZC A;  1AXB A;  2VGJ A;  3PBT A;  2BG1 A;  1Y54 A;  1MWT A;  5AQA A;  1I5Q A;  2XD5 A;  4WYY A;  2P74 A;  1Z6F A;  4KZ5 A;  4OH0 A;  1O07 A;  2ZQ7 A;  1K54 A;  1FCM A;  4OQG A;  1ES4 A;  5E2E A;  5IHV A;  1NYM A;  4GD8 A;  3V50 A;  1H8Z A;  3OPH A;  3HL9 A;  1G68 A;  2EFU A;  3MKF A;  2J9O A;  4ZJ1 A;  1JTG A;  4JKT A;  5FSR A;  1RP5 A;  4UA9 A;  3Q7V A;  5KZH A;  4Y0O A;  3DW0 A;  5M19 A;  1CI8 A;  4S2N A;  2ZC4 B;  5U47 A;  4OVD A;  4L0L A;  1YMX A;  1YLT A;  5AQB A;  1K4F A;  1ESU A;  3IHB A;  5EEC A;  4KG6 A;  1PWG A;  4OOL A;  1YLJ A;  3WS5 A;  5FAT A;  1MWU A;  5FI6 A;  4MBK A;  4U0T A;  5AQ9 A;  4ZAM A;  4WMC A;  1K57 C;  3IXH A;  1LHY A;  1MY8 A;  2B5R A;  2OLU A;  3AGE A;  3EQU A;  3O87 A;  3V3R A;  2WZZ A;  5E2F A;  5HX9 A;  3VP3 A;  4K0X A;  1W5D A;  1K56 A;  1LI9 A;  2Y2O A;  2Y2J A;  4E3O A;  3PBQ A;  3VP2 A;  3PAG A;  4BEN A;  4KQO A;  3ZFZ A;  2XF3 A;  2Y2Q A;  3W4O A;  1W8Y A;  5FAO A;  1PI5 A;  2XD1 A;  3N8R A;  1I2S A;  3FKW A;  4LV0 A;  3UE1 A;  3FV7 A;  1VM1 A;  1CK3 A;  1LL9 A;  3BYD A;  3UPP A;  1YQS A;  1S0W A;  2WGI A;  5BOH A;  1FR6 A;  2OLV A;  1G6A A;  1ERQ A;  5EOO A;  5F82 A;  2G2U A;  4HBU A;  5TGF A;  2H0Y A;  4FSF A;  5FI2 A;  3WS4 A;  1LI0 A;  4N1H A;  1K6S A;  1PWC A;  3CJM A;  3AGD A;  4KEN B;  3FWL A;  4JXG A;  4DE3 A;  1FR1 A;  4JLF A;  2A49 A;  4WZ5 C;  3A3E A;  5GL9 A;  3SH8 A;  3UPO A;  5HAI A;  3E2L A;  3G31 A;  1ESI A;  3IWI A;  2Y2G A;  3A3D A;  3ZG8 B;  4DE0 A;  4DXC A;  2H5S A;  2WKH A;  4S2O A;  1ZKJ A;  4OPQ A;  3HLB A;  1K6R A;  1XXM A;  3ZHH A;  4PM6 A;  4NET A;  1XPB A;  1W8Q A;  3A3J A;  3IQA A;  4XXR A;  3IH8 A;  4DE2 A;  4HEF A;  5DF8 A;  1MKI A;  2FFY A;  3ZGA B;  3V5M A;  4R3B A;  3M6B A;  3ZG0 A;  2Y91 A;  4B4Z A;  3WS2 A;  2GDN A;  3HUM A;  4X68 A;  4LV1 A;  5F83 A;  1WYC A;  2V20 A;  4GZB A;  5DTK A;  4BJP A;  1K55 C;  2EXB A;  3GVB A;  1MBL A;  5FQI A;  1ES2 A;  3ITA A;  4RYE A;  4NK3 A;  4JF4 A;  4P0M A;  3M6H A;  5CTN A;  3W4Q A;  2RL3 A;  1ERO A;  1VQQ A;  4S2I A;  2Z2M B;  4PM5 A;  5EVI A;  2X71 A;  1NJ4 A;  5HAP A;  3UDX A;  2ZQC A;  5F1F A;  4PM8 A;  3Q7V B;  5FAS A;  3PBO A;  4GNU A;  3IF5 A;  5J8X A;  2QZ6 A;  4PM7 A;  1BLP A;  1GHP A;  4PM9 A;  1QME A;  4OKP A;  2C6W B;  2HP6 A;  4BD1 A;  3PTE A;  3IH9 A;  3LO7 A;  1ONG A;  1PYY A;  2EFX A;  2J9P A;  3VP4 A;  1E4D A;  2HDS A;  4IVI A;  5D3O A;  4JXS A;  3ZVT A;  1FSY A;  1RGZ A;  3C7V A;  3N8L A;  5DTS A;  5FQQ A;  1ZC2 A;  1NRF A;  4PMA A;  4OOY A;  5GHX A;  1WYB A;  2WGV A;  4UHU A;  3G32 A;  3IXD A;  4MNR A;  3HLD A;  2XDM A;  5FQ9 A;  1TVF A;  1XA1 A;  1XX2 A;  4JPM A;  3UN7 A;  1EWZ A;  2I72 A;  2XFT A;  3BFD A;  4FH4 A;  1RGY A;  4R4S A;  4WEL A;  5M1A A;  4OOM A;  4Y7P A;  2WZX A;  3HLF A;  3UO9 A;  1WE4 A;  1IKG A;  5HL1 A;  3BLM A;  1K54 C;  4IBX A;  4E3J A;  4BLM A;  4DXB A;  2HPB A;  4KG5 A;  3MFD A;  4R23 A;  1GHM A;  5EUA A;  3SS3 A;  4E3M A;  1BSG A;  1E3U D;  2ZQ9 A;  1ZG4 A;  4EBP A;  3N4I A;  4E3L A;  3Q82 A;  3IF6 A;  2HDR A;  4KZ3 A;  3GR2 A;  3OZH A;  3RXW A;  3AGF A;  3HBR A;  5A93 A;  2EX8 A;  4S2J A;  5DF9 A;  1KGG A;  1IKI A;  2PU4 A;  3HLC A;  2Z2L B;  3HVF A;  3OPP A;  4S2N C;  4S2P A;  1YLP A;  1YLW A;  3TOI A;  5FQM A;  1TEM A;  2ZC5 B;  4MEZ A;  4B4X A;  1RCJ A;  2XK1 A;  1DJB A;  1KDW A;  4KZB A;  4PPR A;  4MLL A;  5FAP A;  2ZC6 B;  5CED A;  5GLC A;  3GRJ A;  2FFF B;  2HDU A;  4K0W A;  4KZA A;  5GLB A;  1KVL A;  1SKF A;  4BQM A;  4FCF A;  1TDG A;  5GLA A;  4WM9 A;  2DRW A;  3NC8 A;  2HP5 A;  1XKZ A;  2V2F F;  3QNC A;  1ERM A;  4KQQ A;  3NBL A;  2HP9 A;  1NXY A;  4M3K A;  3W4P A;  4RA7 A;  3MKE A;  2XEP A;  4OPZ A;  2WAE A;  3FKV A;  3ZCZ A;  1BLH A;  1GCE A;  4XUZ A;  3BM6 A;  5KMW A;  4C75 A;  3VSK A;  1XGJ A;  2H10 A;  3LY3 A;  4X53 A;  1LLB A;  4BL3 A;  4QHC A;  3P09 A;  4WEJ A;  2J7V A;  5A90 A;  1YT4 A;  3IXG A;  2Q9N A;  3VMA A;  4GDN A;  1PWD A;  1SDE A;  5DVA A;  3UE0 A;  4N1X A;  4R3J A;  3P98 A;  4LCL A;  4JBF A;  5CEB A;  1CEF A;  3C7U A;  3FYZ A;  5E2G A;  3UNW A;  5EVI B;  3SS5 A;  5HAQ A;  2X01 A;  4R1G A;  1DJA A;  2ZMA A;  4X69 A;  2P9V B;  3BFC A;  1KGE A;  4WEK A;  5HW3 A;  5CGX A;  4OPY A;  4KZ8 A;  4E3K A;  4EV4 A;  2QMI A;  4JXW A;  1ES5 A;  3C5A A;  3BEB A;  3M2K A;  3DWK A;  4WBG A;  1MPL A;  2ZC7 A;  1ZG6 A;  4P87 A;  5CEC A;  2CC1 A;  1BLS A;  1N9B A;  2V1Z A;  1YM1 A;  2ZQA A;  3HLE A;  5EPH A;  5FQJ A;  1C3B A;  2BLS A;  2DNS A;  4EBN A;  2Y4A A;  3NDG A;  3NY4 A;  1PI4 A;  4UA6 A;  3EQV A;  3NDE A;  1Q2P A;  4HES A;  4R0Q A;  2XH9 A;  4UAA A;  2E8I A;  3SS4 A;  1YLZ A;  2RCX A;  1TDL A;  4O7D A;  2G2W A;  5CRF A;  3I7J A;  2IWB A;  1KE3 A;  3UDI A;  1LL5 A;  5CGS A;  4B88 A;  3UDF A;  1HVB A;  4C3Q A;  1PIO A;  1L0E A;  3OPR A;  1JWP A;  3HRE A;  3TSG A;  1L0F A;  3IWO A;  4CJN A;  3OPL A;  5TFQ A;  3MXS A;  1KVM A;  4E3I A;  4ZDX A;  4K91 A;  2J8Y A;  1FQG A;  4IED A;  1K25 A;  1H8Y A;  2WKE A;  2VGK A;  3PAE A;  3ZG9 B;  5JYP A;  1O7E A;  2Y2N A;  5CGW A;  1ALQ A;  4GD6 A;  1ES3 A;  5DTT A;  1PW1 A;  5E43 A;  5F1G A;  4D2O A;  2Y2M A;  1NZO A;  3O3V A;  2EX9 A;  4LEN A;  4GKU A;  4H8R A;  4S2M A;  2WKI A;  4XUX A;  2Y2P A;  3TG9 A;  4DF6 A;  5CHU A;  5EVI C; 
#chains in the Genus database with same CATH topology
 4Y17 A;  3MBZ A;  4HP9 A;  2EXA A;  4WZ4 A;  3OBF A;  4EWF A;  3DWZ A;  4N92 A;  1K4E A;  2WUQ A;  2XSS A;  3T4T A;  3HLW A;  4P6B A;  3G30 A;  3IBJ A;  3QHY A;  3VOZ A;  4DE1 A;  4EBL A;  4Y13 A;  2X02 A;  3JPU A;  3T1S A;  3G2Y A;  3QNB A;  4MN7 A;  4QY6 A;  3VP1 A;  4KZ4 A;  1F2K A;  3T1X A;  4HP4 A;  1KE4 A;  3WRZ A;  3T4J A;  3CIT A;  2KX6 A;  3VV4 A;  1JWZ A;  2H0T A;  4LCM A;  2W0N A;  5FDH A;  4WMC D;  4I38 A;  1IYQ A;  3RXX A;  3VFH A;  1K56 D;  5EM1 A;  1J3W A;  4KUO A;  5FAQ A;  4GHI B;  1YLY A;  3G35 A;  3TE8 A;  3TJZ C;  2OAP 1;  4GCZ A;  5AQ7 A;  3A3F A;  1N9O A;  1W63 M;  1MWS A;  2ZM2 A;  3GMW A;  3ISG A;  1OTD A;  2UWX A;  1TS0 A;  5CHJ A;  2ZQD A;  4I5S A;  1PW8 A;  4UA7 A;  4OQI A;  2R9W A;  3HUN A;  3VOY A;  2JBF A;  3IX8 A;  2ZM8 A;  1L2S A;  3KYQ A;  4WZ5 A;  3DTM A;  3MR0 A;  1CQA A;  2Y59 A;  5EVL A;  3NJA A;  2VLG A;  5CX7 A;  2VZW A;  4LV2 A;  1D1J A;  1NYY A;  2ZMV A;  2ZJ9 A;  5AJG A;  2WGW B;  2IA2 A;  4F94 A;  5JYO A;  4N9K A;  5A91 A;  2HJ9 C;  5EVI D;  3NEC A;  5HPI A;  1P0Z A;  1DY6 A;  1E25 A;  2KOI A;  1W63 Q;  3BFF A;  5LBR A;  3PBS A;  5MC7 A;  3F1P A;  2EX6 A;  2PBY A;  2PRF A;  3TW8 A;  2XGN A;  4RX3 A;  1W79 A;  4OQ0 A;  4CPK A;  1WA9 A;  3CZD A;  1EI5 A;  2B18 A;  4Q8I A;  1AXB A;  3G6O A;  2BG1 A;  5AQA A;  2XD5 A;  2P74 A;  4KZ5 A;  1K54 A;  1ES4 A;  4QPR A;  5E2E A;  5IHV A;  3V50 A;  1UGU A;  2W27 A;  3P01 A;  4ZJ1 A;  1F9I A;  4JKT A;  3E98 A;  3BW6 A;  4UA9 A;  4Y0O A;  4S2N A;  4L0L A;  2AVX A;  4X25 A;  3C30 A;  3CI6 A;  3SW1 A;  3LI9 A;  4DN0 A;  1YLJ A;  5FAT A;  5FI6 A;  1S66 L;  3QP1 A;  2HF6 A;  3V3R A;  2B5R A;  3O87 A;  2WZZ A;  5HX9 A;  4K0X A;  1W5D A;  1LI9 A;  2Y2J A;  2VJW A;  1S4R A;  4FTX A;  1PFL A;  3VP2 A;  4CLC A;  2QYB A;  3IS2 A;  2XF3 A;  3W4O A;  1W8Y A;  2GZA A;  1PI5 A;  3N8R A;  4H6J B;  4HNB A;  3UE1 A;  2Z6C A;  4XT2 A;  3FV7 A;  1DP9 A;  1YQS A;  1S0W A;  1S1Z A;  5EOO A;  3CAX A;  2G2U A;  3CJM A;  3AGD A;  4KEN B;  5HZH A;  2PT7 A;  4UQI S;  1OPX A;  3U2A A;  3UPO A;  3E2L A;  4DXC A;  3A3D A;  3IX4 A;  1ZKJ A;  1YSP A;  4O0P A;  3UME A;  1XPB A;  3A3J A;  3IQA A;  1XJ2 A;  5IS1 A;  4R3B A;  4MN6 A;  3ZG0 A;  5KIZ A;  3WS2 A;  4JGP A;  5F83 A;  3MF0 A;  1VET A;  1WYC A;  2JKF A;  2V20 A;  1K55 C;  3GVB A;  1MBL A;  3DTK A;  1YAX A;  4JF4 A;  5DKL A;  3O5Y A;  1VQQ A;  1NRJ A;  2Z2M B;  4E04 A;  4PM5 A;  3UDX A;  2ZQC A;  4PM8 A;  1T1C A;  5J8X A;  2QZ6 A;  4PM7 A;  4I3J A;  2HP6 A;  3PTE A;  2J9P A;  1E4D A;  1UWP X;  2FZ0 A;  4FUW A;  5D3O A;  1RGZ A;  3C7V A;  4GW9 A;  1ZC2 A;  5GHX A;  1GSV A;  4LFU A;  4CQH A;  3L7H A;  3IXD A;  2XDM A;  5FQ9 A;  1XA1 A;  1XX2 A;  3UN7 A;  2XFT A;  3BFD A;  4R4S A;  3MJQ A;  3E4P A;  3LFV A;  4IBX A;  3T1R A;  2HPB A;  4KG5 A;  4R23 A;  4DMZ A;  3SS3 A;  1BSG A;  2ZQ9 A;  4E3L A;  3IF6 A;  2HDR A;  4WLA A;  3GR2 A;  3ZYT A;  5DF9 A;  2Z2L B;  1G6O A;  1YLP A;  5FQM A;  1PNE A;  2XK1 A;  3LID A;  2JKT I;  2FFF B;  5GLB A;  5HPF A;  5GLA A;  4WM9 A;  3NC8 A;  1T1B A;  1UWN X;  2V2F F;  3PHY A;  1NXY A;  4RA7 A;  2WAE A;  1EW0 A;  4XUZ A;  4C75 A;  1XGJ A;  4X53 A;  3P09 A;  3P98 A;  4FOF A;  3FYZ A;  1N9L A;  3F1P B;  4R38 A;  4HIA A;  2JKR M;  1OJ5 A;  2ZMA A;  4LPZ A;  1TS7 A;  3BFC A;  4X69 A;  5HW3 A;  4F3L A;  1X0O A;  2QMI A;  3M2K A;  3DWK A;  4P87 A;  1BLS A;  2V1Z A;  4MMN A;  4CLC E;  1IOU A;  3CUE C;  4EBN A;  3NDG A;  3NY4 A;  1PI4 A;  3NDE A;  2E8I A;  4O7D A;  3IX3 A;  4KUK A;  3I7J A;  4ARZ B;  1HVB A;  1PIO A;  3TSG A;  4PAU A;  4IUH A;  4EXO A;  1STZ A;  4ZDX A;  1FQG A;  4IED A;  1K25 A;  1H8Y A;  3LEQ A;  3ZG9 B;  5JYP A;  1O7E A;  2J3T C;  2XRO A;  2EX9 A;  3MQQ A;  2V1B A;  1MWR A;  5FQK A;  3ICY A;  2WK0 A;  4R4R A;  5DJT A;  2PR5 A;  4ESP A;  5HDC A;  4IBR A;  3LR0 A;  3R4K A;  4E6X A;  3UB6 A;  3IS2 B;  4Z9Q A;  4KZ7 A;  2WGW A;  3ZNY A;  3JYI A;  1Q2Q A;  2DMW A;  4OP8 A;  4K08 A;  2IWD A;  3ZNT A;  1Y4O A;  5L07 A;  3H82 A;  1JTD A;  4C6Y A;  2Y55 A;  5TJJ A;  3VP0 A;  4O01 A;  3ZG7 B;  4KZ6 A;  1IEM A;  4X55 A;  4FH2 A;  3MZE A;  1KOU A;  3BQA A;  2NUP C;  2J3W A;  1E3U A;  2Y2I A;  3LY4 A;  5DF7 A;  1K38 A;  3WWX A;  2I9V A;  4GOG A;  1K57 A;  3ZVW A;  5CXW A;  2K2N A;  4UEY A;  4DDS A;  5L2F A;  3CPT B;  1K0K A;  2XA7 M;  4BL2 A;  3A3I A;  4IVK A;  5GHY A;  1JNU A;  2PD7 A;  4YIN A;  1VET B;  3QP4 A;  4LRZ E;  3BRM A;  2PAV P;  1HD8 A;  3E2K A;  4A5R A;  4P85 A;  2JCH A;  3H7W A;  3BFG A;  3MSH A;  1TS6 A;  3B33 A;  1FIK A;  3LCE A;  2C5W B;  1SCW A;  4II7 A;  2A3U A;  4JF5 A;  4E6W A;  3GTC A;  1NZU A;  5M18 A;  1BT5 A;  5J7E A;  1MKM A;  3G4P A;  4HBT A;  3N8S A;  1OTE A;  3UMD A;  3K3D A;  5DFX A;  2HZ5 A;  4B9O A;  4NXF A;  3G34 A;  4FD8 A;  3C4P A;  4MN5 A;  3HUO A;  1IEL A;  4KG2 A;  1HZO A;  4ID4 A;  3NOT C;  2OSU A;  3RFB A;  3OC2 A;  4H6J A;  1MXO A;  4ETZ A;  4ZBE A;  3V3S A;  3VSL A;  4HJ6 A;  5GLD A;  3OCL A;  4EQI A;  3IF6 B;  2Y2K A;  2ZL1 B;  1PZP A;  1H5X A;  4EET B;  5FI7 A;  3F1N B;  3V67 A;  3KYE A;  2PU2 A;  2IWC A;  4DJ3 A;  2L4R A;  5AVE A;  2P9V A;  4WL9 A;  3OCN A;  4MBF A;  5FA7 A;  4MDZ A;  1IYS A;  1JWV A;  4S2L A;  3EEH A;  3LUQ A;  3QP8 A;  4LV3 A;  4HY8 A;  4DKI A;  4MCW A;  1I5Q A;  4I39 A;  3S7N A;  2V9A A;  3BY8 A;  1O07 A;  1FCM A;  3MXQ A;  4OQG A;  4GD8 A;  1H8Z A;  3OPH A;  4HH3 A;  3HL9 A;  2EFU A;  1JTG A;  2UV0 E;  1RP5 A;  2ZC4 B;  4F3L B;  1YMX A;  1YLT A;  3F1O A;  3EGD C;  1ESU A;  3BY9 A;  4OOL A;  3C2W A;  1LHY A;  3AGE A;  2GJ3 A;  2Y2O A;  3MS6 A;  4CLC C;  3KSH A;  3FKW A;  4LV0 A;  3UPP A;  3CHW P;  5DJU A;  1V9Y A;  2H0Y A;  4FSF A;  2VV6 A;  1V9Z A;  3WS4 A;  4Z1W A;  3TRC A;  4DE3 A;  3OOV A;  3A3E A;  1LSX A;  3HJI A;  5GL9 A;  3IWI A;  1YKD A;  4QWO A;  4OPQ A;  1K6R A;  1NLY A;  1TD5 A;  3ULF A;  4PM6 A;  4P6Z M;  4XXR A;  3E4Q A;  1MKI A;  2FFY A;  3T1Q B;  3M6B A;  4B4Z A;  3HUM A;  4LV1 A;  3H82 B;  4GZB A;  4BJP A;  2VKS A;  1N9N A;  1ES2 A;  1VEU A;  2GNX A;  1F98 A;  3ITA A;  4RYE A;  5CTN A;  1YPR A;  2RL3 A;  4Y5F A;  3T4K A;  2K31 A;  4R6L A;  4P6Z S;  4GNU A;  4LGW A;  2HGV A;  1GHP A;  4OKP A;  2W1T A;  1Y28 A;  4ME4 A;  2EFX A;  1PYY A;  1G28 A;  2G7U A;  2HDS A;  2QJ7 A;  2ZMF A;  4JXS A;  3ZVT A;  1FSY A;  5DTS A;  4PMA A;  4ARZ A;  5FEF A;  2WGV A;  3G32 A;  2O99 A;  4JPM A;  3H7W B;  1EWZ A;  2I72 A;  1RGY A;  4BBV A;  5M1A A;  4OOM A;  5HL1 A;  3KO6 A;  4E3J A;  1DP6 A;  1GHM A;  4E3M A;  1E3U D;  1F5M A;  4EBP A;  3Q82 A;  1OTB A;  3AGF A;  3BQ8 A;  5A93 A;  2EX8 A;  2PU4 A;  1IKI A;  3OPP A;  4S2P A;  3LIA A;  2KDK A;  5K5B A;  1TEM A;  4EUV A;  4B4X A;  1RCJ A;  4PKY G;  1DJB A;  2A2L A;  4UQI M;  5GLC A;  3GRJ A;  3W2Z A;  3DTI A;  4HJ4 A;  1TDG A;  2DRW A;  5EVE A;  3QNC A;  1XKZ A;  2WKQ A;  4KQQ A;  2VA0 A;  1OJG A;  2VGL M;  3W4P A;  3QP2 A;  3FKV A;  1P9R A;  1BLH A;  2M7V A;  2H10 A;  3LY3 A;  3LIB A;  4QHC A;  1YT4 A;  3D3O A;  1SDE A;  5DVA A;  4N1X A;  4JBF A;  5CEB A;  1CEF A;  2K7S A;  3SS5 A;  2X01 A;  1DJA A;  2PYR A;  2P9V B;  3PXP A;  4X1L A;  1MPL A;  2VGL S;  2ZC7 A;  3CPT A;  5FQJ A;  4LRY C;  3DTE A;  1Q2P A;  4R0Q A;  2XH9 A;  1YLZ A;  2RCX A;  1HLU P;  1P97 A;  2KLI A;  4B88 A;  3LIE A;  1S67 L;  3NOU C;  4C3Q A;  3T12 B;  1JWP A;  3HRE A;  3IWO A;  5L8M A;  3BWL A;  5TFQ A;  1KVM A;  1ZTU A;  4K91 A;  2J8Y A;  2VGK A;  5CGW A;  4G3K A;  4LEN A;  4GKU A;  2WKI A;  3F1O B;  3TG9 A;  4DF6 A;  5CHU A;  5EVI C;  3NCK A;  2YKH A;  1HTZ A;  4U3T A;  3ZDJ A;  3GEC A;  1BLC A;  2ZLY A;  3LEZ A;  2Y8H A;  1BUE A;  2OV5 A;  3Q81 A;  1KDS A;  1PZO A;  4S2K A;  3K3C A;  3GV9 A;  2DCF A;  3C4O A;  4OON A;  3NOP C;  5HFO A;  1N4O A;  3MXR A;  2W3G A;  4OLG A;  4NG2 A;  2PD8 A;  4NXB A;  3O86 A;  1S6R A;  4OP5 A;  1W7F A;  2ZQ8 A;  3P7N A;  2ZL1 A;  4PKY A;  1FOF A;  1XJ3 A;  4GDB A;  2XR0 A;  3N6I A;  5GHZ A;  1DRM A;  2JN7 A;  5G4Z A;  1YSQ A;  3F1N A;  4Y0T A;  3NI9 A;  1U60 A;  4OLD A;  3MMH A;  2FH5 A;  4KQR A;  3T4O A;  4DDY A;  3VFF A;  4WUJ A;  4QB8 A;  3NIA A;  3IXB A;  4HH2 A;  3SH7 A;  1CI9 A;  4RX2 A;  4MBH A;  3W8K A;  1T1A A;  4Y0U A;  1VEU B;  2Q9M A;  3D72 A;  3UY6 A;  1GHI A;  3LR5 A;  5I94 A;  5HSQ A;  5E2H A;  2ZOH A;  2Y2H A;  1PRQ A;  3MZD A;  4X56 A;  1OME A;  2W1T B;  2XQZ A;  5KSC A;  3EOI A;  3CMZ A;  2ZD8 A;  2WYX A;  1LT0 A;  5AVF A;  2QJ5 A;  2VV7 A;  3SZT A;  5CER A;  3Q1F A;  3A0S A;  4QY5 A;  1Z09 A;  2Y2L A;  2D02 A;  5J4E A;  1FCO A;  1XFN A;  3IWQ A;  1K55 A;  1XP4 A;  2XLN A;  1QMF A;  5TR7 A;  3S4X A;  2A24 A;  4NEE D;  4JF6 A;  5HD5 A;  3LIC A;  3BLS A;  1SHV A;  3EGX C;  1LSW A;  1DJC A;  4BMW A;  3D9Y A;  4QJG A;  3S22 A;  5C5K A;  1GSW A;  3R7W B;  3E0Y A;  2P7J A;  2OAQ 1;  3Q07 A;  1I2W A;  3PBN A;  3UPN A;  3WRT A;  3SH9 A;  1IYO A;  3PBT A;  4EES A;  1Y54 A;  1MWT A;  1P9W A;  4KQD A;  2O9C A;  1NYM A;  2J9O A;  5FSR A;  2B02 A;  4YNR A;  5KZH A;  5FEG A;  3A0R A;  2BAS A;  5EFW A;  1CI8 A;  4OVD A;  5AQB A;  5IT5 A;  1K4F A;  3QP5 A;  3IHB A;  1PWG A;  3WS5 A;  4U0T A;  5AQ9 A;  4ZAM A;  3IXH A;  1MY8 A;  2OLU A;  5A8B A;  4E3O A;  2EWW A;  4YOF A;  4BEN A;  3A0V A;  3ZFZ A;  2Y2Q A;  3C38 A;  2XD1 A;  4M4X A;  1LL9 A;  3BYD A;  2VX8 A;  5BOH A;  2OLV A;  1G6A A;  5F82 A;  1SZV A;  5FI2 A;  1LI0 A;  1K6S A;  1PWC A;  4R3A A;  2PR6 A;  4JXG A;  1FR1 A;  4LLO B;  4WZ5 C;  3SH8 A;  1H8M A;  2E8J A;  5HAI A;  3G31 A;  1ESI A;  4DE0 A;  2Y2G A;  3ZG8 B;  2H5S A;  3EEA A;  4S2O A;  2QHK A;  3CUE A;  3HLB A;  4NKP A;  1XXM A;  2V8C A;  3ZHH A;  2BTF P;  1W8Q A;  3B47 A;  4DE2 A;  3IH8 A;  2JHE A;  2O9B A;  3ZGA B;  4AFI A;  5HL6 A;  2V1A A;  5J3W A;  4NK3 A;  1L3L A;  3LR3 A;  3W4Q A;  4G3W A;  4S2I A;  5HAP A;  4GS9 B;  3KSI A;  5F1F A;  3Q7V B;  2MJ6 A;  5FAS A;  3IF5 A;  1MZU A;  2PHY A;  3HCY A;  1BLP A;  4PM9 A;  1QME A;  1OTI A;  2C6W B;  4BD1 A;  3IH9 A;  3LO7 A;  2W3F A;  2NUT C;  2J80 A;  3VP4 A;  2W3H A;  2YKF A;  3N8L A;  4JGO A;  3U4L P;  4EEP A;  2O0Y A;  4ETX A;  4BWI A;  4FH4 A;  4WEL A;  4NXE A;  1D7E A;  4Y7P A;  2WZX A;  3HLF A;  1WE4 A;  1IKG A;  4WN5 A;  3BLM A;  1K54 C;  4DXB A;  4BLM A;  3N4I A;  4KZ3 A;  3OZH A;  3RXW A;  4RQ9 A;  1XJ4 A;  3HBR A;  4I3I A;  1KGG A;  3HLC A;  4S2N C;  4O8G A;  2ZC5 B;  4MEZ A;  2JKT M;  3RH8 B;  3UE6 A;  4KZB A;  5FAP A;  4HJ3 A;  4KZA A;  4K0W A;  2V8F A;  1KVL A;  4EU0 A;  4FCF A;  4Y3I A;  3H9W A;  4HOI A;  2HP5 A;  1ERM A;  5F5Y A;  3MQ0 A;  2JKG A;  4OPZ A;  3KYZ A;  1GCE A;  3B42 A;  3VSK A;  4BL3 A;  2A24 B;  2M1C A;  3KX0 X;  2PDR A;  5A90 A;  2Q9N A;  3VMA A;  1PWD A;  3UE0 A;  4R3J A;  4LCL A;  3UNW A;  5EVI B;  2QKP A;  4WEK A;  2JKR I;  1NLZ A;  4OPY A;  5TBM B;  4E3K A;  4EV4 A;  4JXW A;  1FIL A;  1ES5 A;  3C5A A;  3BEB A;  2ACG A;  5CEC A;  2ZQA A;  3HLE A;  3LYX A;  2HV1 A;  2BLS A;  2DNS A;  4Q0J A;  2Y4A A;  4UA6 A;  3EQV A;  3SS4 A;  1OT9 A;  2INW A;  1TDL A;  2G2W A;  2V0U A;  2IWB A;  1KE3 A;  1VHM A;  2OOL A;  5CGS A;  5L09 A;  2OWH A;  2B95 A;  1L0E A;  3OPR A;  4CJN A;  1XFQ A;  4IHQ A;  2WKE A;  3PAE A;  2Y2N A;  4GD6 A;  1ES3 A;  5F1G A;  4D2O A;  3O3V A;  4H8R A;  5HWV A;  2ZOI A;  2Y2P A;  1XA7 A;  5CTM A;  3RJU A;  3HLG A;  3IT9 A;  4HI4 A;  4GLQ A;  3PYP A;  4DJ2 A;  4OPR A;  4X1M A;  1BZA A;  2VK3 A;  1CJF A;  4ZRR A;  5EOE A;  1YMS A;  3EWK A;  1FCN A;  4ZTK A;  4ZJ2 A;  3NHQ A;  3BFE A;  4R70 A;  3BEC A;  4QU3 A;  1FSW A;  3T4Q A;  4YFM A;  5HWW A;  4B93 A;  3Q7Z A;  2WAD A;  3D4F A;  4E3N A;  1J9M A;  1NY0 A;  3O88 A;  1XGI A;  2LB9 A;  2W1R A;  3C8C A;  1ONH A;  1D06 A;  1BYW A;  3IF6 C;  1IYP A;  3MFX A;  1L0D A;  3R7W A;  1M40 A;  1L0G A;  5G18 A;  5HWT A;  1GSX A;  3GSG A;  4YWZ A;  4Y15 A;  3LI8 A;  1GA0 A;  4RVA A;  3GDI A;  1AWI A;  3N7W A;  4N9L A;  3T4S A;  3G2Z A;  4EUZ A;  3VOL A;  3FPW A;  1LL8 A;  1H3Q A;  2R9X A;  5KSH A;  5HD3 A;  4KZ9 A;  4U0X A;  4LRX C;  3ZG5 A;  5EM0 A;  3M2J A;  1JVJ A;  4GN2 A;  1KGF A;  1BUL A;  3CWF A;  4JXV A;  1S1Y A;  3MZF A;  3WS0 A;  3CG5 A;  3WS1 A;  2R78 A;  2XRN A;  3B3X A;  2ZC3 B;  4ZJ3 A;  5FDS A;  1M6K A;  1CEG A;  4BD0 A;  5HAR A;  2XFS A;  3ITB A;  2HDQ A;  1SDN A;  4DRT A;  1G5U A;  4GB7 A;  3V39 A;  2LB5 A;  1SKO A;  4EEU A;  2J3T D;  2JE5 A;  4X6T A;  4HQA A;  2W3E A;  4QD4 A;  3UE3 A;  5A92 A;  3IBR A;  3RTY A;  3S1Y A;  3LGO A;  1GA9 A;  2EX2 A;  3KSF A;  3IHA A;  1BTL A;  3SOI A;  5EV0 A;  3PBR A;  1KE0 A;  3BJN A;  2L1M A;  2WAF A;  2JC7 A;  3FC7 A;  4G3V A;  4OQH A;  2ZM0 A;  1T19 A;  5DFY A;  3GQZ A;  5CHM A;  3K2N A;  1CF0 A;  5F68 A;  5EE8 A;  5F6A A;  2WKP A;  3ZQ5 A;  3UB8 A;  2QPN A;  4PHT A;  4D60 A;  3FZC A;  2VGJ A;  4WYY A;  3DAV A;  4HHD A;  1Z6F A;  4OH0 A;  2ZQ7 A;  1XJ6 A;  4EER A;  4GJ4 A;  1ODV A;  2HJE A;  2O9A A;  1G68 A;  3MKF A;  4JGR A;  2P04 A;  4GS9 A;  1NWZ A;  4I3A A;  5IU1 A;  1H0M A;  3Q7V A;  3DW0 A;  3QP6 A;  5M19 A;  5U47 A;  5HDS A;  5EEC A;  3VE3 A;  4KG6 A;  1S4S A;  1MWU A;  4MBK A;  4WMC A;  1K57 C;  3EQU A;  5E2F A;  3VP3 A;  1K56 A;  3PBQ A;  3UB5 P;  3PAG A;  4KQO A;  5FAO A;  1I2S A;  1VM1 A;  1CK3 A;  2WGI A;  1FR6 A;  1ERQ A;  2H28 A;  3FPV A;  4HBU A;  4WF0 A;  5TGF A;  4NXG A;  3UB9 A;  2W3D A;  4N1H A;  3FWL A;  2VEA A;  4JLF A;  1TS8 A;  2A49 A;  2WKH A;  2GX5 A;  4NET A;  1OTA A;  4IUK A;  4HEF A;  3HJK A;  5DF8 A;  4GHI A;  3V5M A;  3DBA A;  2Y91 A;  2GDN A;  4X68 A;  3UB7 A;  5DTK A;  1ZHH B;  2EA9 A;  2EXB A;  4Q0I A;  5FQI A;  4P0M A;  3M6H A;  2P08 A;  3T50 A;  1ERO A;  5EVI A;  2X71 A;  1NJ4 A;  3T4L A;  5TBM A;  3PBO A;  2ZBB A;  3S7P A;  4EW7 A;  1ONG A;  2V0W A;  3PR6 A;  4IVI A;  3JVV A;  3MQO A;  5G4Y A;  4Y2F A;  5FQQ A;  1NRF A;  4OOY A;  1WYB A;  4CLC B;  4UHU A;  1LSV A;  4EQ1 A;  4MNR A;  3HLD A;  1TVF A;  5HDD A;  3KSG A;  3UO9 A;  4XT2 B;  3MFD A;  5EUA A;  3LIF A;  4BBU A;  1ZG4 A;  2Q0O A;  4S2J A;  3HVF A;  1YLW A;  3TOI A;  3OLO A;  2PYP A;  1KDW A;  3S7O A;  3E4O A;  4PPR A;  4MLL A;  4BBT A;  2ZC6 B;  1OT6 A;  5CED A;  4L9E A;  2HDU A;  3NUL A;  1SKF A;  4L9F A;  4BQM A;  1DP8 A;  5FL3 A;  1SKO B;  3S7Q A;  3NBL A;  4CLC D;  2HP9 A;  5DKK A;  2Y79 A;  4M3K A;  3MKE A;  2XEP A;  3ZCZ A;  1A0K A;  5KMW A;  3BM6 A;  1LLB A;  3JVU A;  4WEJ A;  2J7V A;  4Q0H A;  3IXG A;  2WKR A;  4GDN A;  3FG8 A;  3CLO A;  3C7U A;  5E2G A;  5HAQ A;  2VV8 A;  4R1G A;  2D01 A;  1KGE A;  5CGX A;  4KZ8 A;  1MC0 A;  1VB6 A;  5L10 A;  3L9K A;  4WBG A;  2XA7 S;  1ZG6 A;  1TF1 A;  2CC1 A;  1N9B A;  2Z6D A;  5EPH A;  1YM1 A;  4IJG A;  1C3B A;  2PBD P;  4HES A;  2QWS A;  4UAA A;  5I5L A;  2L0W A;  1T18 A;  5CRF A;  3VE4 A;  3UDI A;  5F69 A;  1LL5 A;  3LR4 A;  2CMN A;  3UDF A;  1L0F A;  2EWV A;  2OWJ A;  3OPL A;  1ACF A;  3MXS A;  4E3I A;  4L9G A;  1IFQ A;  1ALQ A;  5DTT A;  1PW1 A;  5E43 A;  2Y2M A;  1NZO A;  4JGQ A;  4S2M A;  4XUX A;  2M7U A; 
#chains in the Genus database with same CATH homology
 1MWR A;  3NCK A;  1HTZ A;  1XA7 A;  3MBZ A;  5FQK A;  4U3T A;  2EXA A;  5CTM A;  3RJU A;  4WZ4 A;  3ZDJ A;  3HLG A;  3IT9 A;  1BLC A;  2WK0 A;  2ZLY A;  3LEZ A;  4R4R A;  1BUE A;  4EWF A;  2OV5 A;  3DWZ A;  4OPR A;  4N92 A;  1BZA A;  1K4E A;  3Q81 A;  1KDS A;  1PZO A;  4IBR A;  4S2K A;  5EOE A;  4E6X A;  3GV9 A;  1YMS A;  2WUQ A;  1FCN A;  4ZTK A;  4ZJ2 A;  2DCF A;  3C4O A;  3HLW A;  4P6B A;  3G30 A;  4DE1 A;  3QHY A;  3BFE A;  3VOZ A;  4Z9Q A;  4KZ7 A;  4OON A;  2WGW A;  3BEC A;  4QU3 A;  3ZNY A;  4EBL A;  3JYI A;  1FSW A;  5HFO A;  1N4O A;  2X02 A;  1Q2Q A;  3MXR A;  4OP8 A;  4OLG A;  2IWD A;  3G2Y A;  3ZNT A;  4YFM A;  3QNB A;  4QY6 A;  3VP1 A;  3O86 A;  1S6R A;  4OP5 A;  1W7F A;  2ZQ8 A;  1JTD A;  4KZ4 A;  4C6Y A;  2Y55 A;  3VP0 A;  3Q7Z A;  2WAD A;  1FOF A;  3D4F A;  4GDB A;  4E3N A;  2XR0 A;  1J9M A;  3N6I A;  5GHZ A;  1NY0 A;  3ZG7 B;  4KZ6 A;  1KE4 A;  1IEM A;  3O88 A;  1XGI A;  4X55 A;  3WRZ A;  4FH2 A;  4Y0T A;  3MZE A;  3NI9 A;  1ONH A;  1U60 A;  3IF6 C;  4OLD A;  1E3U A;  1JWZ A;  2H0T A;  1IYP A;  2Y2I A;  3LY4 A;  4LCM A;  5DF7 A;  1K38 A;  5FDH A;  3WWX A;  4KQR A;  4WMC D;  1L0D A;  1M40 A;  4GOG A;  1IYQ A;  1L0G A;  3RXX A;  3VFH A;  1K57 A;  3ZVW A;  5CXW A;  5L2F A;  1K56 D;  4DDS A;  5G18 A;  4DDY A;  3VFF A;  3GSG A;  5FAQ A;  1YLY A;  3G35 A;  4QB8 A;  1GA0 A;  3NIA A;  4RVA A;  3IXB A;  4BL2 A;  3A3I A;  4IVK A;  5AQ7 A;  3A3F A;  5GHY A;  3N7W A;  4N9L A;  3SH7 A;  1MWS A;  3G2Z A;  1CI9 A;  4YIN A;  4RX2 A;  4EUZ A;  2ZM2 A;  4MBH A;  3GMW A;  3W8K A;  2R9X A;  3ISG A;  3BRM A;  3E2K A;  1HD8 A;  2UWX A;  4Y0U A;  4A5R A;  5KSH A;  4P85 A;  2JCH A;  2Q9M A;  5CHJ A;  3UY6 A;  4KZ9 A;  4U0X A;  1GHI A;  3BFG A;  2ZQD A;  3ZG5 A;  5I94 A;  1PW8 A;  5E2H A;  3M2J A;  4UA7 A;  4OQI A;  2R9W A;  1JVJ A;  4GN2 A;  1KGF A;  3HUN A;  3LCE A;  3VOY A;  2C5W B;  1BUL A;  4JXV A;  2Y2H A;  2JBF A;  1SCW A;  2A3U A;  2ZM8 A;  4JF5 A;  3MZF A;  3WS0 A;  3MZD A;  3CG5 A;  4X56 A;  3GTC A;  3WS1 A;  1NZU A;  4E6W A;  3B3X A;  2ZC3 B;  1L2S A;  4ZJ3 A;  4WZ5 A;  5M18 A;  1OME A;  1BT5 A;  3G4P A;  2XQZ A;  3DTM A;  3N8S A;  4HBT A;  5KSC A;  3CMZ A;  2ZD8 A;  2WYX A;  1M6K A;  1CEG A;  2Y59 A;  3G34 A;  5EVL A;  4FD8 A;  3C4P A;  4BD0 A;  5HAR A;  2XFS A;  3ITB A;  5CER A;  3Q1F A;  2HDQ A;  1SDN A;  4DRT A;  3HUO A;  1IEL A;  4KG2 A;  1HZO A;  4QY5 A;  4GB7 A;  3V39 A;  4ID4 A;  4LV2 A;  2OSU A;  2Y2L A;  1NYY A;  3OC2 A;  2ZJ9 A;  1FCO A;  2WGW B;  4F94 A;  5JYO A;  3IWQ A;  1K55 A;  1XP4 A;  1MXO A;  2JE5 A;  4X6T A;  2XLN A;  4ZBE A;  3V3S A;  3VSL A;  4QD4 A;  4N9K A;  5GLD A;  3UE3 A;  3OCL A;  1QMF A;  5A91 A;  5A92 A;  4EQI A;  5EVI D;  3S1Y A;  5TR7 A;  3S4X A;  3IF6 B;  1DY6 A;  1E25 A;  2Y2K A;  1GA9 A;  2EX2 A;  4JF6 A;  1PZP A;  1H5X A;  5FI7 A;  3IHA A;  3BLS A;  1BTL A;  1SHV A;  3BFF A;  3SOI A;  2PU2 A;  3PBR A;  3PBS A;  2IWC A;  1KE0 A;  2EX6 A;  1DJC A;  2PBY A;  2P9V A;  2WAF A;  4QJG A;  3S22 A;  2JC7 A;  3OCN A;  4OQH A;  4MBF A;  5FA7 A;  2ZM0 A;  1IYS A;  1JWV A;  3GQZ A;  5CHM A;  2XGN A;  4RX3 A;  3Q07 A;  1W79 A;  4OQ0 A;  4CPK A;  5EE8 A;  3CZD A;  1I2W A;  4S2L A;  3PBN A;  3UPN A;  4LV3 A;  3SH9 A;  1EI5 A;  2QPN A;  3WRT A;  4DKI A;  4Q8I A;  1IYO A;  3FZC A;  1AXB A;  2VGJ A;  3PBT A;  2BG1 A;  1Y54 A;  1MWT A;  5AQA A;  1I5Q A;  2XD5 A;  4WYY A;  2P74 A;  1Z6F A;  4KZ5 A;  4OH0 A;  1O07 A;  2ZQ7 A;  1K54 A;  1FCM A;  4OQG A;  1ES4 A;  5E2E A;  5IHV A;  1NYM A;  4GD8 A;  3V50 A;  1H8Z A;  3OPH A;  3HL9 A;  1G68 A;  2EFU A;  3MKF A;  2J9O A;  4ZJ1 A;  1JTG A;  4JKT A;  5FSR A;  1RP5 A;  4UA9 A;  3Q7V A;  5KZH A;  4Y0O A;  3DW0 A;  5M19 A;  1CI8 A;  4S2N A;  2ZC4 B;  5U47 A;  4OVD A;  4L0L A;  1YMX A;  1YLT A;  5AQB A;  1K4F A;  1ESU A;  3IHB A;  5EEC A;  4KG6 A;  1PWG A;  4OOL A;  1YLJ A;  3WS5 A;  5FAT A;  1MWU A;  5FI6 A;  4MBK A;  4U0T A;  5AQ9 A;  4ZAM A;  4WMC A;  1K57 C;  3IXH A;  1LHY A;  1MY8 A;  2B5R A;  2OLU A;  3AGE A;  3EQU A;  3O87 A;  3V3R A;  2WZZ A;  5E2F A;  5HX9 A;  3VP3 A;  4K0X A;  1W5D A;  1K56 A;  1LI9 A;  2Y2O A;  2Y2J A;  4E3O A;  3PBQ A;  3VP2 A;  3PAG A;  4BEN A;  4KQO A;  3ZFZ A;  2XF3 A;  2Y2Q A;  3W4O A;  1W8Y A;  5FAO A;  1PI5 A;  2XD1 A;  3N8R A;  1I2S A;  3FKW A;  4LV0 A;  3UE1 A;  3FV7 A;  1VM1 A;  1CK3 A;  1LL9 A;  3BYD A;  3UPP A;  1YQS A;  1S0W A;  2WGI A;  5BOH A;  1FR6 A;  2OLV A;  1G6A A;  1ERQ A;  5EOO A;  5F82 A;  2G2U A;  4HBU A;  5TGF A;  2H0Y A;  4FSF A;  5FI2 A;  3WS4 A;  1LI0 A;  4N1H A;  1K6S A;  1PWC A;  3CJM A;  3AGD A;  4KEN B;  3FWL A;  4JXG A;  4DE3 A;  1FR1 A;  4JLF A;  2A49 A;  4WZ5 C;  3A3E A;  5GL9 A;  3SH8 A;  3UPO A;  5HAI A;  3E2L A;  3G31 A;  1ESI A;  3IWI A;  2Y2G A;  3A3D A;  3ZG8 B;  4DE0 A;  4DXC A;  2H5S A;  2WKH A;  4S2O A;  1ZKJ A;  4OPQ A;  3HLB A;  1K6R A;  1XXM A;  3ZHH A;  4PM6 A;  4NET A;  1XPB A;  1W8Q A;  3A3J A;  3IQA A;  4XXR A;  3IH8 A;  4DE2 A;  4HEF A;  5DF8 A;  1MKI A;  2FFY A;  3ZGA B;  3V5M A;  4R3B A;  3M6B A;  3ZG0 A;  2Y91 A;  4B4Z A;  3WS2 A;  2GDN A;  3HUM A;  4X68 A;  4LV1 A;  5F83 A;  1WYC A;  2V20 A;  4GZB A;  5DTK A;  4BJP A;  1K55 C;  2EXB A;  3GVB A;  1MBL A;  5FQI A;  1ES2 A;  3ITA A;  4RYE A;  4NK3 A;  4JF4 A;  4P0M A;  3M6H A;  5CTN A;  3W4Q A;  2RL3 A;  1ERO A;  1VQQ A;  4S2I A;  2Z2M B;  4PM5 A;  5EVI A;  2X71 A;  1NJ4 A;  5HAP A;  3UDX A;  2ZQC A;  5F1F A;  4PM8 A;  3Q7V B;  5FAS A;  3PBO A;  4GNU A;  3IF5 A;  5J8X A;  2QZ6 A;  4PM7 A;  1BLP A;  1GHP A;  4PM9 A;  1QME A;  4OKP A;  2C6W B;  2HP6 A;  4BD1 A;  3PTE A;  3IH9 A;  3LO7 A;  1ONG A;  1PYY A;  2EFX A;  2J9P A;  3VP4 A;  1E4D A;  2HDS A;  4IVI A;  5D3O A;  4JXS A;  3ZVT A;  1FSY A;  1RGZ A;  3C7V A;  3N8L A;  5DTS A;  5FQQ A;  1ZC2 A;  1NRF A;  4PMA A;  4OOY A;  5GHX A;  1WYB A;  2WGV A;  4UHU A;  3G32 A;  3IXD A;  4MNR A;  3HLD A;  2XDM A;  5FQ9 A;  1TVF A;  1XA1 A;  1XX2 A;  4JPM A;  3UN7 A;  1EWZ A;  2I72 A;  2XFT A;  3BFD A;  4FH4 A;  1RGY A;  4R4S A;  4WEL A;  5M1A A;  4OOM A;  4Y7P A;  2WZX A;  3HLF A;  3UO9 A;  1WE4 A;  1IKG A;  5HL1 A;  3BLM A;  1K54 C;  4IBX A;  4E3J A;  4BLM A;  4DXB A;  2HPB A;  4KG5 A;  3MFD A;  4R23 A;  1GHM A;  5EUA A;  3SS3 A;  4E3M A;  1BSG A;  1E3U D;  2ZQ9 A;  1ZG4 A;  4EBP A;  3N4I A;  4E3L A;  3Q82 A;  3IF6 A;  2HDR A;  4KZ3 A;  3GR2 A;  3OZH A;  3RXW A;  3AGF A;  3HBR A;  5A93 A;  2EX8 A;  4S2J A;  5DF9 A;  1KGG A;  1IKI A;  2PU4 A;  3HLC A;  2Z2L B;  3HVF A;  3OPP A;  4S2N C;  4S2P A;  1YLP A;  1YLW A;  3TOI A;  5FQM A;  1TEM A;  2ZC5 B;  4MEZ A;  4B4X A;  1RCJ A;  2XK1 A;  1DJB A;  1KDW A;  4KZB A;  4PPR A;  4MLL A;  5FAP A;  2ZC6 B;  5CED A;  5GLC A;  3GRJ A;  2FFF B;  2HDU A;  4K0W A;  4KZA A;  5GLB A;  1KVL A;  1SKF A;  4BQM A;  4FCF A;  1TDG A;  5GLA A;  4WM9 A;  2DRW A;  3NC8 A;  2HP5 A;  1XKZ A;  2V2F F;  3QNC A;  1ERM A;  4KQQ A;  3NBL A;  2HP9 A;  1NXY A;  4M3K A;  3W4P A;  4RA7 A;  3MKE A;  2XEP A;  4OPZ A;  2WAE A;  3FKV A;  3ZCZ A;  1BLH A;  1GCE A;  4XUZ A;  3BM6 A;  5KMW A;  4C75 A;  3VSK A;  1XGJ A;  2H10 A;  3LY3 A;  4X53 A;  1LLB A;  4BL3 A;  4QHC A;  3P09 A;  4WEJ A;  2J7V A;  5A90 A;  1YT4 A;  3IXG A;  2Q9N A;  3VMA A;  4GDN A;  1PWD A;  1SDE A;  5DVA A;  3UE0 A;  4N1X A;  4R3J A;  3P98 A;  4LCL A;  4JBF A;  5CEB A;  1CEF A;  3C7U A;  3FYZ A;  5E2G A;  3UNW A;  5EVI B;  3SS5 A;  5HAQ A;  2X01 A;  4R1G A;  1DJA A;  2ZMA A;  4X69 A;  2P9V B;  3BFC A;  1KGE A;  4WEK A;  5HW3 A;  5CGX A;  4OPY A;  4KZ8 A;  4E3K A;  4EV4 A;  2QMI A;  4JXW A;  1ES5 A;  3C5A A;  3BEB A;  3M2K A;  3DWK A;  4WBG A;  1MPL A;  2ZC7 A;  1ZG6 A;  4P87 A;  5CEC A;  2CC1 A;  1BLS A;  1N9B A;  2V1Z A;  1YM1 A;  2ZQA A;  3HLE A;  5EPH A;  5FQJ A;  1C3B A;  2BLS A;  2DNS A;  4EBN A;  2Y4A A;  3NDG A;  3NY4 A;  1PI4 A;  4UA6 A;  3EQV A;  3NDE A;  1Q2P A;  4HES A;  4R0Q A;  2XH9 A;  4UAA A;  2E8I A;  3SS4 A;  1YLZ A;  2RCX A;  1TDL A;  4O7D A;  2G2W A;  5CRF A;  3I7J A;  2IWB A;  1KE3 A;  3UDI A;  1LL5 A;  5CGS A;  4B88 A;  3UDF A;  1HVB A;  4C3Q A;  1PIO A;  1L0E A;  3OPR A;  1JWP A;  3HRE A;  3TSG A;  1L0F A;  3IWO A;  4CJN A;  3OPL A;  5TFQ A;  3MXS A;  1KVM A;  4E3I A;  4ZDX A;  4K91 A;  2J8Y A;  1FQG A;  4IED A;  1K25 A;  1H8Y A;  2WKE A;  2VGK A;  3PAE A;  3ZG9 B;  5JYP A;  1O7E A;  2Y2N A;  5CGW A;  1ALQ A;  4GD6 A;  1ES3 A;  5DTT A;  1PW1 A;  5E43 A;  5F1G A;  4D2O A;  2Y2M A;  1NZO A;  3O3V A;  2EX9 A;  4LEN A;  4GKU A;  4H8R A;  4S2M A;  2WKI A;  4XUX A;  2Y2P A;  3TG9 A;  4DF6 A;  5CHU A;  5EVI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...