1ESIA

R248l mutant of streptomyces k15 dd-transpeptidase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
260
structure length
260
Chain Sequence
KPTIAAVGGYAMNNGTGTTLYTKAADTRRSTGSTTKIMTAKVVLAQSNLNLDAKVTIQKAYSDYVVANNASQAHLIVGDKVTVRQLLYGLMLPSGCDAAYALADKYGSGSTRAARVKSFIGKMNTAATNLGLHNTHFDSFDGIGNGANYSTPRDLTKIASSAMKNSTFRTVVKTKAYTAKTVTKTGSIRTMDTWKNTNGLLSSYSGAIGVKTGSGPEAKYCLVFAATRGGKTVIGTVLASTSIPALESDATKIMNYGFAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DD-TRANSPEPTIDASE
publication title DD-TRANSPEPTIDASE
rcsb
source organism Streptomyces sp.
total genus 92
structure length 260
sequence length 260
ec nomenclature ec 3.4.16.4: Serine-type D-Ala-D-Ala carboxypeptidase.
pdb deposition date 2000-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1esiA00
2HDRA 3BYDA 1FR6A 1S6RA 2C6WB 2WYXA 3NIAA 4OKPA 3VMAA 4FCFA 5CHMA 4QJGA 4OQ0A 3RXWA 1TDLA 4MLLA 4K0WA 2ZMAA 5KSCA 5FAOA 4HBUA 1Q2QA 2ZC5B 5CERA 3PBNA 2X02A 1PZOA 2ZM8A 2HPBA 5GHZA 4B4ZA 1PI4A 5TGFA 3IHAA 3C4PA 2Y2PA 4JF6A 3MKEA 4EBPA 4NETA 4PM5A 2QZ6A 2DCFA 1LLBA 3JYIA 5CRFA 4DF6A 4B88A 5CTNA 3MZEA 1LI0A 4PM7A 2DRWA 4MBKA 4JXVA 1NJ4A 1M40A 4S2KA 4S2NC 5JYPA 2WAEA 2EX2A 1ERMA 3Q7VA 4FH4A 1YLPA 2Y2MA 4IBXA 2XK1A 2ZQAA 3OPRA 5FQMA 4N1XA 2Z2MB 1LL5A 5DF9A 3VP0A 4DE1A 5E2FA 4R1GA 5F82A 1GHPA 3N7WA 4OPQA 3UE3A 4BENA 4BQMA 2Y2QA 3G30A 1KVLA 2X01A 4EV4A 5FSRA 2BG1A 4JKTA 3M2JA 3P09A 5M1AA 5GLCA 5I94A 4X6TA 4Z9QA 4ZJ2A 1LI9A 2WGVA 3HREA 4ZTKA 3FWLA 4OOMA 2XF3A 5GLAA 5EOOA 3ZVTA 5FQKA 3ZNYA 1S0WA 1IELA 2XEPA 2E8IA 1RGZA 5A93A 4WMCA 4OQIA 1YLYA 4PPRA 4RX2A 4RA7A 5A90A 1OMEA 3IF6C 4WMCD 5CHUA 3UO9A 4HEFA 1GA0A 1ES5A 1O7EA 1DJCA 1CEFA 1ESUA 1K6SA 3GQZA 4IBRA 5EVIB 3GVBA 3N8LA 3IF5A 5AQ9A 4Y0UA 4X55A 5CHJA 1NZUA 3Q81A 5GLBA 1PI5A 1BUEA 3SH9A 4BL3A 3DTMA 3TOIA 4MNRA 4S2MA 2Y2KA 4KZ9A 1MXOA 2JE5A 5AQ7A 1M6KA 1BLCA 3BEBA 3C5AA 5M18A 3UDFA 4BJPA 2WGWA 4OH0A 5GL9A 5A92A 5FI2A 3M6BA 4L0LA 4N9KA 2Y2OA 4WBGA 2CC1A 1KE0A 4GZBA 1YT4A 3ZCZA 1PW8A 1YLTA 2EX6A 1W5DA 2R9WA 3VP4A 1I2SA 1JVJA 1W79A 3VSLA 3V3RA 3LEZA 4E3MA 3SS5A 1ES4A 2DNSA 1KE3A 4U3TA 1TEMA 1KGFA 1K57C 1PW1A 1YM1A 4GD6A 4OQGA 5E2HA 5M19A 1K57A 3AGFA 4JXWA 5HW3A 2J7VA 1JTDA 4EUZA 3M2KA 1N4OA 1K54A 3OC2A 1ES2A 1TVFA 2ZQDA 3S22A 2R9XA 4KG6A 3VP2A 2H5SA 1PIOA 1FOFA 2VGKA 3MXSA 3Q7ZA 2Y59A 2ZD8A 2WKEA 3V5MA 1K38A 3FV7A 4OPRA 1JWPA 5E2GA 4M3KA 4S2OA 4RX3A 1XGJA 1PYYA 3N4IA 3N8RA 3IWQA 2Y2JA 3NDEA 1MPLA 2Y2LA 5KSHA 4YINA 1L0DA 3P98A 1KE4A 4PMAA 5EECA 1MY8A 1SDEA 3EQUA 4UA7A 4ZAMA 3CJMA 2JCHA 3A3IA 3MFDA 2Y2NA 5CEBA 1W8YA 1FSWA 3Q07A 4GB7A 3HLDA 2HP5A 3DWKA 1ZG4A 1FCOA 2XH9A 4UA6A 3UE0A 5TR7A 2A3UA 2ZQ9A 4IEDA 5EE8A 5BOHA 1CEGA 4O7DA 4DE2A 1ERQA 2P9VA 4N9LA 4R4SA 1IKGA 4ID4A 4C3QA 1PWCA 3M6HA 1WE4A 3G34A 2P9VB 5U47A 1KVMA 4MEZA 5EPHA 5GHYA 4XXRA 4C6YA 3S4XA 2Q9NA 1K4FA 2XFTA 3Q82A 3ZNTA 4WYYA 1SKFA 4U0TA 4LV1A 4OOYA 3HL9A 4S2NA 3VSKA 3ZVWA 5DTSA 1BLHA 3VP1A 5F1FA 5CECA 1L0EA 1O07A 3NCKA 1BTLA 1EI5A 1NY0A 3C7UA 2Y4AA 4QY6A 3Q7VB 5IHVA 5CGWA 1FCMA 3SS3A 2XFSA 5FQQA 4S2PA 5E43A 4B4XA 1BULA 3OCNA 2JBFA 1ONHA 2UWXA 2I72A 3IXGA 2ZC6B 4X68A 5FATA 3WWXA 3ZG0A 3EQVA 5CXWA 3GV9A 4KQQA 3G2ZA 4LV0A 3FYZA 2WKHA 1SCWA 3O88A 1YLZA 5KZHA 2WAFA 1K56A 3W4OA 4OLDA 4EBNA 4DKIA 1YLJA 2Y2GA 5GHXA 1RP5A 3GSGA 1ESIA 1K56D 1YQSA 4KQRA 5CTMA 2ZLYA 1CI8A 1CI9A 3N6IA 3GRJA 1K55C 3WRZA 4R3JA 2XGNA 1ALQA 1HD8A 5CGSA 3WS4A 2WK0A 1IYPA 3BFCA 1K25A 4E6WA 3BRMA 4E3NA 3QNCA 3VOYA 4E3OA 3OPHA 5EUAA 1NYMA 1KDWA 4GD8A 3ITAA 2Z2LB 3IF6A 4P85A 3PBRA 3NY4A 3N8SA 3UN7A 3HVFA 3ZDJA 3LY3A 3OPLA 4GKUA 4QB8A 1Q2PA 2ZQ8A 3A3EA 3IF6B 3IXDA 4N1HA 4R3BA 1I2WA 1RCJA 4RYEA 3UPPA 1GHIA 3UPOA 2ZJ9A 3O87A 4FD8A 3PBSA 2A49A 4JBFA 3PAGA 2JC7A 1YMSA 2WZXA 4K91A 3AGEA 5CEDA 3HLFA 2XD1A 2ZM0A 4HBTA 5FAQA 4LCLA 4OP5A 1XA1A 1K4EA 3PBTA 3Q1FA 1MWSA 2WGWB 3W8KA 1MBLA 5TFQA 4FSFA 2Y55A 5CGXA 3ITBA 4LENA 5JYOA 4QHCA 1NRFA 5FQJA 4E3JA 2ZQ7A 1VQQA 3HBRA 1L0FA 3OPPA 4YFMA 5E2EA 1WYCA 1FCNA 3RJUA 3WS0A 1YMXA 2H0TA 4DE0A 4PM6A 3MXRA 1E4DA 1BLSA 4E3KA 3LO7A 2EFXA 4WZ4A 3O3VA 3ZG8B 4OQHA 4JF4A 2PU4A 4WELA 1BSGA 4KENB 3ZFZA 4E3LA 2J9PA 4S2LA 5DF7A 1NXYA 2P74A 2H10A 3MKFA 1SDNA 3NI9A 4PM9A 1HTZA 4KZ6A 1MWUA 1MWRA 1XKZA 1IKIA 2FFFB 1I5QA 3GTCA 1KGGA 3GMWA 1Z6FA 3UY6A 1NZOA 2XQZA 1IEMA 1XPBA 4R4RA 4DRTA 1DJBA 1XP4A 1E25A 2EXBA 2WKIA 4QD4A 4LCMA 5HAQA 1XGIA 3ZGAB 4U0XA 5F1GA 1FSYA 3G2YA 3IWIA 3UPNA 2J8YA 4GDBA 5DTTA 4E6XA 3ZG7B 1G6AA 3FKVA 4ZJ3A 3DWZA 3AGDA 4X53A 5FQIA 4OPZA 3ZHHA 1H5XA 3G32A 3BFGA 2XDMA 3SH8A 1QMEA 2V1ZA 2Y2IA 5DTKA 3A3DA 2EFUA 3LCEA 4UHUA 1JTGA 4KZ8A 1RGYA 1SHVA 3UNWA 5J8XA 5FQ9A 2Y91A 1W8QA 4D2OA 4GN2A 3PBQA 2OSUA 4Y7PA 3WS1A 3A3FA 3CZDA 3UDIA 3HLEA 3HLBA 3IH9A 4R0QA 3HLWA 5AQAA 3V50A 5F83A 1H8ZA 4KZ7A 4MBHA 2OLVA 4A5RA 2XLNA 2IWCA 5D3OA 4R23A 4KQOA 4WM9A 4FH2A 4LV2A 2HDQA 2WZZA 5AQBA 3VFFA 5FI7A 1PWDA 5HARA 2RL3A 4ZBEA 2Y2HA 5HX9A 3NBLA 4ZJ1A 2FFYA 3NC8A 3MBZA 3SS4A 4IVIA 3WS5A 4GNUA 3O86A 3SOIA 2BLSA 3I7JA 3IHBA 1IYOA 2G2UA 1ZKJA 4JXGA 5EVLA 1C3BA 5HAIA 4N92A 3RXXA 4CPKA 1KDSA 1JWZA 3BECA 4OONA 1XX2A 3BM6A 4MBFA 1J9MA 3FKWA 5FASA 1E3UA 4OP8A 1NYYA 2EX9A 4P6BA 2ZC3B 5DF8A 1E3UD 5FI6A 1K55A 2XD5A 3DW0A 3B3XA 1YLWA 1BLPA 3LY4A 4JLFA 1MKIA 5GLDA 3UDXA 3PAEA 4BD0A 4P0MA 2ZM2A 1ONGA 1HZOA 3V3SA 3BLSA 3GR2A 3HUMA 4JPMA 4F94A 5DVAA 4DXBA 3HLCA 4XUZA 2OLUA 1PWGA 3IXBA 2RCXA 4Y0OA 5KMWA 3IH8A 1TDGA 4Q8IA 5G18A 4CJNA 3PBOA 3W4QA 2EX8A 3A3JA 3V39A 1WYBA 3C4OA 3HLGA 3SH7A 3C7VA 3OCLA 4OOLA 4KG5A 4OVDA 1KGEA 5EVIC 1QMFA 3QHYA 4WEJA 1MWTA 2IWBA 4UA9A 4NK3A 1JWVA 5EVIA 5FA7A 3W4PA 4C75A 3VP3A 2PU2A 2GDNA 1W7FA 3IQAA 4P87A 5EVID 1XA7A 4KZ5A 4BL2A 2OV5A 2VGJA 4KZBA 4EBLA 3BFDA 1PZPA 4OPYA 4ZDXA 3ZG9B 3VFHA 1K6RA 4KZ3A 2Q9MA 4WEKA 4EWFA 3HUNA 1ZC2A 3D4FA 3E2KA 2XR0A 3NDGA 2PBYA 4GDNA 2G2WA 2WADA 2IWDA 3UE1A 1FR1A 1EROA 4BD1A 3BFFA 4PM8A 2QPNA 1LL9A 3ISGA 4DE3A 1H8YA 4JXSA 2HDUA 2WUQA 3QNBA 3BFEA 4QY5A 1VM1A 2H0YA 4EQIA 1L0GA 3MZFA 3CG5A 1AXBA 2B5RA 2V2FF 4KZAA 1GCEA 3OZHA 4JF5A 2V20A 4S2IA 4X56A 2ZC7A 2WGIA 5FDHA 4KG2A 2HP9A 4HESA 4X69A 4OLGA 5A91A 3G35A 1GHMA 2ZC4B 3BLMA 4E3IA 4S2JA 5HAPA 4H8RA 1K54C 4LV3A 2ZQCA 1BT5A 4DDSA 3HUOA 5HFOA 1HVBA 2HDSA 4Y0TA 4IVKA 1IYSA 3IXHA 4RVAA 1DJAA 3G31A 3TG9A 2QMIA 3ZG5A 3IT9A 1ZG6A 2X71A 5FAPA 1IYQA 3TSGA 4UAAA 3FZCA 1GA9A 2C5WB 3S1YA 3PTEA 4GOGA 1N9BA 1EWZA 3MZDA 3VOZA 1DY6A 1LHYA 4K0XA 2J9OA 3WS2A 1FQGA 4DDYA 1U60A 3E2LA 1Y54A 1BZAA 3CMZA 5L2FA 4QU3A 1CK3A 5HL1A 5EOEA 1L2SA 4BLMA 3IWOA 4DXCA 4KZ4A 1ES3A 2EXAA 1G68A 4WZ5C 3WRTA 1XXMA 3G4PA 4XUXA 4WZ5A 2HP6A
chains in the Genus database with same CATH superfamily
3ZQ5A 4D60A 2C6WB 2WYXA 3NIAA 4OKPA 3VMAA 4OQ0A 5FEGA 3UMDA 1TS0A 4WN5A 4Y15A 2HPBA 3IHAA 4LFUA 3MKEA 2DCFA 1LLBA 5CRFA 4DF6A 4BBTA 1UGUA 3MZEA 1LI0A 4MBKA 4LRXC 4S2KA 1M40A 4S2NC 5JYPA 2WAEA 2YKFA 1ERMA 4GHIB 4GW9A 2Z2MB 5DF9A 3UMEA 4OPQA 4BENA 3G30A 1KVLA 3M2JA 1G5UA 4LRZE 3LIDA 5FQKA 4XT2B 1IELA 2XEPA 3ICYA 1P9RA 2FH5A 4RA7A 1OMEA 3E4QA 1GA0A 1O7EA 1CEFA 3MQQA 1K6SA 3GQZA 5KIZA 2O9AA 1T18A 3JVVA 3T4OA 4JGOA 4ARZA 4X55A 3Q81A 5GLBA 1PI5A 1GSWA 1OJGA 3TOIA 4MNRA 4S2MA 2ZL1B 1M6KA 3CAXA 4QPRA 1BLCA 2R78A 2VJWA 3E4PA 4WBGA 5L10A 5C5KA 1KE0A 4CQHA 1PW8A 1JVJA 4E3MA 4U3TA 3C2WA 5L07A 3U2AA 1N4OA 1K54A 3OC2A 2ZQDA 4KG6A 3G6OA 5HDDA 2WKEA 3CPTA 3DTIA 5E2GA 4S2OA 3A0VA 4RX3A 1PYYA 2Y2JA 4DN0A 3NDEA 4P6ZS 2AVXA 1SDEA 4UA7A 3SZTA 4ZAMA 2JCHA 4UQIM 1W8YA 3P7NA 3Q07A 3LR4A 4GB7A 3FC7A 3DWKA 3UE0A 1LSWA 2INWA 4IEDA 3T12B 3T4JA 2JKTM 4G3VA 4DE2A 1PWCA 3FPVA 5U47A 1KVMA 5GHYA 3S4XA 2XFTA 3Q82A 3ZNTA 2L4RA 3LICA 4CLCE 3HL9A 5DTSA 3VP1A 5F1FA 1NY0A 4F3LB 5IHVA 3F1PB 5CGWA 3P01A 4S2PA 1BULA 3OCNA 3IXGA 3WWXA 4EETB 1TS7A 4OLDA 4EBNA 1YLJA 1S1YA 1TD5A 3GSGA 2M7UA 3R7WA 5AJGA 1CI9A 1K55C 4R3JA 2XGNA 1HD8A 3CUEC 3WS4A 4R70A 2GNXA 1K25A 3BRMA 4E3NA 3QNCA 3VOYA 4E3OA 3DTKA 4P85A 3PBRA 3HVFA 3ZDJA 1OJ5A 3LY3A 3OPLA 4QB8A 3IXDA 3UPOA 4B9OA 3CHWP 2JC7A 2WZXA 3LIFA 2QYBA 3AGEA 5CEDA 5FAQA 4WL9A 1MBLA 2Y55A 4LENA 1NRFA 5FQJA 4YFMA 3RJUA 1FCNA 4PM6A 1E4DA 2EFXA 2JKRI 3O3VA 4R6LA 4KENB 3ZFZA 4S2LA 3K2NA 1PFLA 5TBMA 4P6ZM 5AVEA 1KGGA 3GMWA 4DRTA 3S7OA 5EFWA 1XGIA 3W2ZA 1G6OA 3T1XA 4E6XA 3HJIA 2WKRA 3AGDA 4X53A 4OPZA 4LGWA 3G32A 4H6JB 3VV4A 1S4SA 3E0YA 3IBRA 3UNWA 2QJ5A 2Y91A 5IT5A 4GN2A 3PBQA 5AQAA 3HLBA 3HLWA 3V50A 4DJ3A 5HWWA 1MC0A 4KZ7A 3LEQA 3KX0X 1T1CA 4R23A 4KQOA 2HDQA 1GSVA 2WZZA 3QP8A 4Y3IA 4ZBEA 4ZJ1A 3NC8A 4Q0HA 4ESPA 1D06A 3I7JA 1ZKJA 4JXGA 5G4YA 2HJ9C 4GCZA 3RXXA 4OONA 4MBFA 2LB9A 2EX9A 4P6BA 2OWJA 1YLWA 3LY4A 1OTEA 3T4SA 3SW1A 4P0MA 4CLCA 4HQAA 3BLSA 3HUMA 4JPMA 4CLCD 2OLUA 1PWGA 2JKFA 1SZVA 2NUPC 3HLGA 4KG5A 3E4OA 1QMFA 4WEJA 1MWTA 5FA7A 4C75A 3VP3A 4P87A 1XA7A 5HSQA 2PAVP 1LL8A 4GS9A 4KZ3A 4WEKA 2XR0A 3KSFA 4NEED 3UE1A 4DE3A 1H8YA 4JXSA 1VM1A 5HD5A 4KZAA 3EEAA 3OZHA 2GJ3A 3K3DA 4X56A 4KG2A 2HP9A 3JPUA 4HH2A 4HP4A 2ZC4B 4PKYG 4S2JA 3TW8A 2O9BA 1K54C 3ZYTA 5HFOA 2PD8A 1DJAA 3TG9A 4BWIA 5J3WA 3IT9A 4UAAA 1N9BA 3FG8A 1W63Q 3MMHA 3WS2A 3IS2A 2VV7A 2VGLS 3DTEA 2P08A 4AFIA 3IWOA 4KZ4A 1G68A 1OPXA 3WRTA 1XXMA 3G4PA 4WZ5A 4KUKA 3D72A 5CHMA 4QJGA 3RXWA 4K0WA 2VA0A 5CERA 3FPWA 2X02A 4B4ZA 1CQAA 3H82B 1ACFA 2PR6A 4PM5A 3PHYA 5CTNA 5EVEA 3OOVA 1IFQA 4JXVA 5EM0A 5DJTA 1DP6A 2EX2A 5HL6A 3Q7VA 1T19A 1K0KA 5FQMA 2XK1A 2ZQAA 3OPRA 4N1XA 1NRJA 5E2FA 5F82A 3UE3A 3NJAA 2X01A 3T1QB 4EESA 5GLCA 5I94A 1YKDA 2HV1A 4Y2FA 1V9ZA 1LI9A 4OOMA 5EOOA 4B93A 3NULA 5HWTA 2EWVA 4EXOA 4E04A 4OQIA 4ZRRA 4PPRA 1T1AA 3UO9A 4HEFA 2JKGA 4IBRA 4Y0UA 5CHJA 1NZUA 2JKTI 1PNEA 2PYRA 1BUEA 3EGDC 2Y2KA 5FEFA 2Q0OA 3UDFA 4L0LA 4N9KA 2CC1A 4GZBA 3MJQA 3VSLA 3SS5A 1ES4A 1KGFA 1K57C 1YM1A 4GD6A 4MN7A 3BQ8A 3MS6A 2R9XA 2ZBBA 3VP2A 2H5SA 1ZHHB 1PIOA 3MXSA 3V5MA 4WUJA 4M3KA 3N4IA 3L9KA 3IWQA 4Q0JA 1MPLA 3P98A 3DAVA 1MY8A 3EQUA 1PRQA 3CJMA 3MFDA 3MR0A 4HHDA 1FCOA 4UA6A 5TR7A 1S4RA 4HY8A 1VEUA 2QWSA 2ZQ9A 5EE8A 2P9VA 4ID4A 3M6HA 1WE4A 2KOIA 5EPHA 4XXRA 2H28A 4WYYA 2O0YA 4OOYA 2JHEA 3ZVWA 3NCKA 4QY6A 3DBAA 5A8BA 2XFSA 5FQQA 2JBFA 2UWXA 3ZG0A 2L1MA 5CXWA 4LV0A 2VZWA 4I39A 2Y2GA 1DP8A 1ESIA 5CTMA 2ZLYA 1VB6A 2DMWA 1H8MA 5CGSA 1IYPA 4E6WA 4I38A 5EUAA 1KDWA 3ITAA 2Z2LB 2D02A 3NY4A 3N8SA 2VKSA 1Q2PA 3BY9A 4LPZA 4R3BA 1RCJA 3UPPA 4FD8A 2PDRA 1ZTUA 2A24B 4EEPA 3F1OB 4JGRA 2W1RA 4HBTA 4KUOA 4LCLA 3KSHA 2WGWB 3W8KA 2ACGA 4FTXA 5CGXA 2IA2A 3ITBA 5JYOA 4I3JA 2OAQ1 4E3JA 3HBRA 1L0FA 3LIEA 3KSGA 1WYCA 3T50A 2OOLA 4JF4A 4WELA 1NXYA 3NI9A 1SDNA 1MWRA 3MF0A 5L8MA 1NZOA 4R4RA 1E25A 2L0WA 4HIAA 4LCMA 3EEHA 3UPNA 3IWIA 4GDBA 1G6AA 3FKVA 4ZJ3A 5FQIA 4L9EA 3BFGA 2V1ZA 2XA7M 4KZ8A 1RGYA 1SHVA 5AVFA 5FQ9A 1W8QA 1TS6A 4Y7PA 3T4KA 1H8ZA 4MBHA 5J7EA 1XJ3A 3NOPC 4IJGA 4QWOA 3PR6A 4HH3A 3S7NA 3A0SA 5FI7A 2Y2HA 4Y17A 1GSXA 3SS4A 5MC7A 4IVIA 3WS5A 3MQOA 3SOIA 2XRNA 2BLSA 2G2UA 5EVLA 4CPKA 1KDSA 3BECA 1F2KA 3F1NB 1F9IA 4R3AA 4BMWA 4OP8A 3NHQA 2ZC3B 5HDCA 4EUVA 2XD5A 4JLFA 5GLDA 3V67A 3QP5A 3CITA 2ZM2A 1HZOA 1J3WA 3V3SA 3IBJA 4II7A 3GR2A 4XT2A 4DXBA 4XUZA 3IXBA 2RCXA 4Y0OA 3VE4A 5KMWA 3IH8A 3LYXA 1OT6A 3PBOA 1N9NA 3PXPA 2EX8A 3A3JA 1WYBA 4Z1WA 4OOLA 5DFXA 4O0PA 4MN6A 5EVIC 1SKOB 3QHYA 2LB5A 2IWBA 1JWVA 1W7FA 4YWZA 2OV5A 2VGJA 4KZBA 2K2NA 4EBLA 3NECA 1NLYA 1PZPA 4OPYA 2ZL1A 3HUNA 3D4FA 4GS9B 2PBYA 4X1LA 4GDNA 1FR1A 1EROA 3A0RA 4PM8A 3ISGA 2PYPA 5G4ZA 2HDUA 3BFEA 4HP9A 3H7WA 2W3DA 2ZMFA 4EQIA 1L0GA 3CG5A 5D3OA 1GCEA 4JF5A 1NLZA 1S67L 5A91A 2EWWA 2Z6CA 1GHMA 4ETXA 4H8RA 1BT5A 1V9YA 3HUOA 5J4EA 5F68A 3B33A 2HDSA 3KSIA 1IYSA 4RVAA 3G31A 1A0KA 2X71A 5FAPA 3FZCA 1GA9A 3PTEA 3JVUA 4DDYA 5L2FA 2KLIA 5HWVA 2I9VA 1L2SA 4BLMA 3IS2B 4XUXA 2O9CA 3BYDA 4FCFA 3T4TA 4MLLA 4PHTA 4HOIA 4HBUA 2V0UA 2ZC5B 3R4KA 3PBNA 4NXEA 2ZM8A 3C4PA 3UB7A 2V9AA 4JF6A 2G7UA 4EBPA 2QZ6A 3JYIA 3BWLA 4B88A 4PM7A 1NJ4A 4F3LA 1YLPA 3F1PA 3VP0A 4R1GA 3N7WA 4BQMA 2Y2QA 5FSRA 1OTIA 2BG1A 3P09A 4O01A 2EA9A 4X6TA 5TJJA 4Z9QA 4MCWA 4EU0A 3HREA 4ZTKA 5GLAA 5FL3A 3ZNYA 1S0WA 2QJ7A 1RGZA 4WMCA 1YSPA 1YLYA 4WMCD 2QHKA 5CX7A 5EVIB 2PHYA 3GVBA 3IF5A 5AQ9A 3SH9A 5FDSA 2J3TD 4KZ9A 1MXOA 5AQ7A 2V1BA 2A2LA 3C5AA 5GL9A 5FI2A 3M6BA 2W3FA 3TJZC 1VHMA 2GX5A 3ZCZA 2K31A 1YLTA 4NKPA 1W5DA 2R9WA 3LEZA 2FZ0A 1KE3A 2HJEA 1TEMA 5E2HA 5M19A 3C30A 5HW3A 1JTDA 3BJNA 1ES2A 3S22A 1VETB 3LIAA 1FOFA 4HJ6A 3Q7ZA 2Y59A 2ZD8A 3LUQA 4JGQA 1K38A 3FV7A 1JWPA 4X1MA 1XGJA 3N8RA 3LI9A 4BBVA 4YINA 1L0DA 3LR5A 1KE4A 4PMAA 5EECA 4EQ1A 4LRYC 3A3IA 4HNBA 2Y2NA 1FSWA 4H6JA 3HLDA 4HJ4A 1ZG4A 2XH9A 2B95A 3BW6A 3LR0A 5BOHA 1CEGA 4O7DA 4N9LA 1VEUB 3TE8A 2M1CA 2P9VB 2D01A 1HLUP 2Q9NA 1K4FA 4LV1A 3VSKA 2NUTC 1BLHA 5CECA 1O07A 1EI5A 3C7UA 2Y4AA 1YPRA 1FCMA 5IS1A 3ULFA 3BY8A 5E43A 4B4XA 3B42A 5HDSA 2ZC6B 4X68A 3EWKA 4NXGA 3EQVA 3G2ZA 3FYZA 1SCWA 5KZHA 1YLZA 2WAFA 3W4OA 4DKIA 4WLAA 4KQRA 1YQSA 1CI8A 1P97A 2YKHA 3GRJA 2K7SA 1ALQA 1BYWA 2VV6A 3CUEA 3OPHA 2MJ6A 1NYMA 1LSXA 4GD8A 1OTAA 3IF6A 3UN7A 2ZQ8A 3A3EA 4FOFA 2V8CA 1I2WA 3T1SA 2ZJ9A 3O87A 4ARZB 2W1TA 4JBFA 3PAGA 5L09A 1NWZA 1YMSA 4K91A 4I3AA 3LI8A 1Z09A 3PBTA 3Q1FA 5TFQA 3O5YA 2ZOHA 2HGVA 3L7HA 4IUHA 1Y28A 2ZQ7A 1VQQA 3WS0A 3OPPA 2H0TA 1LSVA 4DE0A 1BLSA 3ZG8B 4WZ4A 1KOUA 4OQHA 2PU4A 2P04A 2BASA 4E3LA 2J9PA 3MKFA 1HTZA 4YOFA 4KZ6A 1MWUA 2FFFB 3GTCA 3CPTB 1F98A 3NOTC 3UY6A 2XQZA 1IEMA 2OAP1 1XP4A 2EXBA 4QD4A 2WKIA 5HAQA 1XFNA 3QP4A 3ZGAB 4EERA 5F1GA 3G2YA 2J8YA 3ZG7B 3ZHHA 3SH8A 2XDMA 2Y2IA 2EFUA 3LCEA 1JTGA 5J8XA 2XA7S 2GZAA 2OSUA 3RH8B 3A3FA 2V0WA 3CZDA 3HLEA 4GJ4A 4BBUA 2XLNA 4LV2A 1DRMA 4YNRA 3C8CA 4HJ3A 5AQBA 3H82A 1PWDA 2RL3A 5HX9A 4GNUA 3O86A 2PT7A 1FILA 3IHBA 5HAIA 4N92A 1STZA 1XX2A 3BM6A 3C38A 3FKWA 5HPFA 3KYQA 1OTBA 3R7WB 3DW0A 1BLPA 1MKIA 3UDXA 3IX8A 4CLCC 1ONGA 4WF0A 3IX3A 4EEUA 1TDGA 1CF0A 2W3HA 5G18A 2J80A 3W4QA 4CJNA 3V39A 3C7VA 4K08A 1F5MA 1KGEA 4UA9A 3KYZA 3W4PA 2P7JA 4IUKA 2PU2A 3U4LP 4KZ5A 4BL2A 2KX6A 4HI4A 2J3TC 4Q0IA 4ZDXA 1K6RA 2Q9MA 4EWFA 3NDGA 1LT0A 2M7VA 2G2WA 2IWDA 2KDKA 4BD1A 2QPNA 1LL9A 4UEYA 3QNBA 2WUQA 4QY5A 3UB6A 2B5RA 4S2IA 5FDHA 2ZC7A 3H7WB 4OLGA 3G35A 5TBMB 4I3IA 3BLMA 3T4QA 3OLOA 4E3IA 5HAPA 2VX8A 4DDSA 5HPIA 1P9WA 1HVBA 4LLOB 3VOLA 3D9YA 1IYQA 3TSGA 3KO6A 4KQDA 3S1YA 2C5WB 4GOGA 1EWZA 1DY6A 1FQGA 1U60A 1Y54A 1BZAA 2W3EA 3CMZA 3GECA 4QU3A 5EM1A 3RTYA 4WZ5C 3VE3A 2W0NA 2HP6A 5F69A 2HDRA 1FR6A 1OTDA 1S6RA 3UB9A 1TDLA 2ZMAA 5KSCA 5FAOA 2UV0E 1Q2QA 5GHZA 1PZOA 1G28A 1PI4A 5TGFA 2Y2PA 4NETA 1FIKA 2DRWA 2Y8HA 4GHIA 3UB5P 4FH4A 2Y2MA 4IBXA 1H0MA 1LL5A 4DE1A 1D7EA 1JNUA 1EW0A 1GHPA 1XJ2A 4EV4A 4JKTA 4R38A 5M1AA 2B02A 2ZMVA 4ZJ2A 4G3WA 3CWFA 3RFBA 4CLCB 4JGPA 2WGVA 3FWLA 1W63M 2XF3A 3ZVTA 2QKPA 2E8IA 2Y79A 1L3LA 5A93A 2Z6DA 4RX2A 4IHQA 5A90A 3IF6C 5CHUA 1ES5A 1DJCA 1ESUA 3B47A 3N8LA 2A24A 2XROA 3F1OA 4GLQA 2B18A 4BL3A 3DTMA 3QP2A 1WA9A 3KYEA 2JE5A 3BEBA 5M18A 4BJPA 2WGWA 4OH0A 5A92A 2PR5A 3EGXC 5DKLA 1ODVA 2Y2OA 1YT4A 2EX6A 1N9OA 3VP4A 1I2SA 1W79A 3V3RA 2DNSA 2VK3A 1PW1A 2WKPA 2HF6A 1K57A 3AGFA 4X25A 4JXWA 2J7VA 4EUZA 3M2KA 1TVFA 5EV0A 3LGOA 1TS8A 2VGKA 4EW7A 4I5SA 4OPRA 4RQ9A 3HCYA 2Y2LA 3S7PA 5KSHA 2JN7A 5CEBA 4DMZA 3OBFA 5I5LA 2HP5A 3CLOA 3LR3A 2A3UA 1AWIA 1ERQA 5DFYA 4R4SA 1IKGA 4C3QA 3LIBA 3K3CA 1UWPX 3G34A 4MEZA 4C6YA 5HZHA 3IX4A 1SKFA 4NG2A 4U0TA 3EOIA 4S2NA 2V8FA 1L0EA 1BTLA 3Q7VB 3SS3A 4L9GA 1XJ6A 3H9WA 1ONHA 4NXFA 2I72A 5FATA 2W27A 3GV9A 4KQQA 3F1NA 2WKHA 3O88A 1K56A 2O99A 5HD3A 5GHXA 1RP5A 1K56D 3CI6A 3N6IA 3WRZA 1CJFA 2WK0A 2WKQA 3BFCA 1MKMA 4MMNA 1IOUA 1YSQA 4G3KA 1D1JA 4GKUA 3IF6B 4N1HA 4RYEA 1GHIA 3E98A 3PBSA 1YAXA 2A49A 1SKOA 4PKYA 4ME4A 4NXBA 3HLFA 2W1TB 2XD1A 2ZM0A 4OP5A 1XA1A 2PBDP 1K4EA 1MWSA 2OWHA 4FSFA 3T1RA 4QHCA 5E2EA 3UB8A 1YMXA 3MXRA 4E3KA 3LO7A 1BSGA 3GDIA 5DF7A 2P74A 2H10A 2PRFA 3PYPA 4PM9A 1XKZA 1IKIA 1Y4OA 2VLGA 1I5QA 1OT9A 1Z6FA 1XPBA 1DJBA 4U0XA 1MZUA 1FSYA 3MFXA 5DTTA 1T1BA 3DWZA 1H5XA 1QMEA 5DTKA 3A3DA 1X0OA 4UHUA 4D2OA 3WS1A 3UDIA 3MSHA 3IH9A 4R0QA 5F83A 2OLVA 4A5RA 4O8GA 2BTFP 4Y13A 2IWCA 3TRCA 3BQAA 1UWNX 4WM9A 4FH2A 3VFFA 5HARA 3UE6A 2VEAA 3NBLA 2FFYA 3MBZA 1XFQA 1IYOA 1C3BA 2JKRM 3S7QA 1JWZA 1DP9A 1J9MA 1E3UA 1NYYA 3NOUC 5DF8A 1E3UD 2J3WA 5FI6A 1K55A 3B3XA 4L9FA 2CMNA 1XJ4A 2E8JA 3PAEA 4BD0A 4F94A 5DVAA 3HLCA 2VV8A 4Q8IA 3D3OA 5LBRA 3C4OA 3SH7A 3OCLA 1H3QA 4OVDA 3MXQA 1S1ZA 4MDZA 4NK3A 5EVIA 2W3GA 1N9LA 4Y5FA 3MQ0A 2GDNA 3IQAA 5EVID 5F6AA 2V1AA 3BFDA 1S66L 3ZG9B 3VFHA 2HZ5A 5DJUA 2XSSA 1ZC2A 3E2KA 5DKKA 2WADA 1P0ZA 3BFFA 3QP1A 5F5YA 2H0YA 3LFVA 3MZFA 1AXBA 2ZOIA 2V2FF 5FASA 2V20A 4FUWA 2WGIA 4HESA 4X69A 5IU1A 4ETZA 5K5BA 1TF1A 1VETA 4LV3A 2ZQCA 4Y0TA 4IVKA 3IXHA 3T4LA 2QMIA 4MN5A 3ZG5A 1ZG6A 3QP6A 2PD7A 4PAUA 3MZDA 4M4XA 1LHYA 3VOZA 2VGLM 4K0XA 4DJ2A 2J9OA 3E2LA 1CK3A 5HL1A 5EOEA 3HJKA 4DXCA 1ES3A 2EXAA 4OQGA 4UQIS
chains in the Genus database with same CATH topology
2HDRA 3BYDA 1FR6A 1S6RA 2C6WB 2WYXA 3NIAA 4OKPA 3VMAA 4FCFA 5CHMA 4QJGA 4OQ0A 3RXWA 1TDLA 4MLLA 4K0WA 2ZMAA 5KSCA 5FAOA 4HBUA 1Q2QA 2ZC5B 5CERA 3PBNA 2X02A 1PZOA 2ZM8A 2HPBA 5GHZA 4B4ZA 1PI4A 5TGFA 3IHAA 3C4PA 2Y2PA 4JF6A 3MKEA 4EBPA 4NETA 4PM5A 2QZ6A 2DCFA 1LLBA 3JYIA 5CRFA 4DF6A 4B88A 5CTNA 3MZEA 1LI0A 4PM7A 2DRWA 4MBKA 4JXVA 1NJ4A 1M40A 4S2KA 4S2NC 5JYPA 2WAEA 2EX2A 1ERMA 3Q7VA 4FH4A 1YLPA 2Y2MA 4IBXA 2XK1A 2ZQAA 3OPRA 5FQMA 4N1XA 2Z2MB 1LL5A 5DF9A 3VP0A 4DE1A 5E2FA 4R1GA 5F82A 1GHPA 3N7WA 4OPQA 3UE3A 4BENA 4BQMA 2Y2QA 3G30A 1KVLA 2X01A 4EV4A 5FSRA 2BG1A 4JKTA 3M2JA 3P09A 5M1AA 5GLCA 5I94A 4X6TA 4Z9QA 4ZJ2A 1LI9A 2WGVA 3HREA 4ZTKA 3FWLA 4OOMA 2XF3A 5GLAA 5EOOA 3ZVTA 5FQKA 3ZNYA 1S0WA 1IELA 2XEPA 2E8IA 1RGZA 5A93A 4WMCA 4OQIA 1YLYA 4PPRA 4RX2A 4RA7A 5A90A 1OMEA 3IF6C 4WMCD 5CHUA 3UO9A 4HEFA 1GA0A 1ES5A 1O7EA 1DJCA 1CEFA 1ESUA 1K6SA 3GQZA 4IBRA 5EVIB 3GVBA 3N8LA 3IF5A 5AQ9A 4Y0UA 4X55A 5CHJA 1NZUA 3Q81A 5GLBA 1PI5A 1BUEA 3SH9A 4BL3A 3DTMA 3TOIA 4MNRA 4S2MA 2Y2KA 4KZ9A 1MXOA 2JE5A 5AQ7A 1M6KA 1BLCA 3BEBA 3C5AA 5M18A 3UDFA 4BJPA 2WGWA 4OH0A 5GL9A 5A92A 5FI2A 3M6BA 4L0LA 4N9KA 2Y2OA 4WBGA 2CC1A 1KE0A 4GZBA 1YT4A 3ZCZA 1PW8A 1YLTA 2EX6A 1W5DA 2R9WA 3VP4A 1I2SA 1JVJA 1W79A 3VSLA 3V3RA 3LEZA 4E3MA 3SS5A 1ES4A 2DNSA 1KE3A 4U3TA 1TEMA 1KGFA 1K57C 1PW1A 1YM1A 4GD6A 4OQGA 5E2HA 5M19A 1K57A 3AGFA 4JXWA 5HW3A 2J7VA 1JTDA 4EUZA 3M2KA 1N4OA 1K54A 3OC2A 1ES2A 1TVFA 2ZQDA 3S22A 2R9XA 4KG6A 3VP2A 2H5SA 1PIOA 1FOFA 2VGKA 3MXSA 3Q7ZA 2Y59A 2ZD8A 2WKEA 3V5MA 1K38A 3FV7A 4OPRA 1JWPA 5E2GA 4M3KA 4S2OA 4RX3A 1XGJA 1PYYA 3N4IA 3N8RA 3IWQA 2Y2JA 3NDEA 1MPLA 2Y2LA 5KSHA 4YINA 1L0DA 3P98A 1KE4A 4PMAA 5EECA 1MY8A 1SDEA 3EQUA 4UA7A 4ZAMA 3CJMA 2JCHA 3A3IA 3MFDA 2Y2NA 5CEBA 1W8YA 1FSWA 3Q07A 4GB7A 3HLDA 2HP5A 3DWKA 1ZG4A 1FCOA 2XH9A 4UA6A 3UE0A 5TR7A 2A3UA 2ZQ9A 4IEDA 5EE8A 5BOHA 1CEGA 4O7DA 4DE2A 1ERQA 2P9VA 4N9LA 4R4SA 1IKGA 4ID4A 4C3QA 1PWCA 3M6HA 1WE4A 3G34A 2P9VB 5U47A 1KVMA 4MEZA 5EPHA 5GHYA 4XXRA 4C6YA 3S4XA 2Q9NA 1K4FA 2XFTA 3Q82A 3ZNTA 4WYYA 1SKFA 4U0TA 4LV1A 4OOYA 3HL9A 4S2NA 3VSKA 3ZVWA 5DTSA 1BLHA 3VP1A 5F1FA 5CECA 1L0EA 1O07A 3NCKA 1BTLA 1EI5A 1NY0A 3C7UA 2Y4AA 4QY6A 3Q7VB 5IHVA 5CGWA 1FCMA 3SS3A 2XFSA 5FQQA 4S2PA 5E43A 4B4XA 1BULA 3OCNA 2JBFA 1ONHA 2UWXA 2I72A 3IXGA 2ZC6B 4X68A 5FATA 3WWXA 3ZG0A 3EQVA 5CXWA 3GV9A 4KQQA 3G2ZA 4LV0A 3FYZA 2WKHA 1SCWA 3O88A 1YLZA 5KZHA 2WAFA 1K56A 3W4OA 4OLDA 4EBNA 4DKIA 1YLJA 2Y2GA 5GHXA 1RP5A 3GSGA 1ESIA 1K56D 1YQSA 4KQRA 5CTMA 2ZLYA 1CI8A 1CI9A 3N6IA 3GRJA 1K55C 3WRZA 4R3JA 2XGNA 1ALQA 1HD8A 5CGSA 3WS4A 2WK0A 1IYPA 3BFCA 1K25A 4E6WA 3BRMA 4E3NA 3QNCA 3VOYA 4E3OA 3OPHA 5EUAA 1NYMA 1KDWA 4GD8A 3ITAA 2Z2LB 3IF6A 4P85A 3PBRA 3NY4A 3N8SA 3UN7A 3HVFA 3ZDJA 3LY3A 3OPLA 4GKUA 4QB8A 1Q2PA 2ZQ8A 3A3EA 3IF6B 3IXDA 4N1HA 4R3BA 1I2WA 1RCJA 4RYEA 3UPPA 1GHIA 3UPOA 2ZJ9A 3O87A 4FD8A 3PBSA 2A49A 4JBFA 3PAGA 2JC7A 1YMSA 2WZXA 4K91A 3AGEA 5CEDA 3HLFA 2XD1A 2ZM0A 4HBTA 5FAQA 4LCLA 4OP5A 1XA1A 1K4EA 3PBTA 3Q1FA 1MWSA 2WGWB 3W8KA 1MBLA 5TFQA 4FSFA 2Y55A 5CGXA 3ITBA 4LENA 5JYOA 4QHCA 1NRFA 5FQJA 4E3JA 2ZQ7A 1VQQA 3HBRA 1L0FA 3OPPA 4YFMA 5E2EA 1WYCA 1FCNA 3RJUA 3WS0A 1YMXA 2H0TA 4DE0A 4PM6A 3MXRA 1E4DA 1BLSA 4E3KA 3LO7A 2EFXA 4WZ4A 3O3VA 3ZG8B 4OQHA 4JF4A 2PU4A 4WELA 1BSGA 4KENB 3ZFZA 4E3LA 2J9PA 4S2LA 5DF7A 1NXYA 2P74A 2H10A 3MKFA 1SDNA 3NI9A 4PM9A 1HTZA 4KZ6A 1MWUA 1MWRA 1XKZA 1IKIA 2FFFB 1I5QA 3GTCA 1KGGA 3GMWA 1Z6FA 3UY6A 1NZOA 2XQZA 1IEMA 1XPBA 4R4RA 4DRTA 1DJBA 1XP4A 1E25A 2EXBA 2WKIA 4QD4A 4LCMA 5HAQA 1XGIA 3ZGAB 4U0XA 5F1GA 1FSYA 3G2YA 3IWIA 3UPNA 2J8YA 4GDBA 5DTTA 4E6XA 3ZG7B 1G6AA 3FKVA 4ZJ3A 3DWZA 3AGDA 4X53A 5FQIA 4OPZA 3ZHHA 1H5XA 3G32A 3BFGA 2XDMA 3SH8A 1QMEA 2V1ZA 2Y2IA 5DTKA 3A3DA 2EFUA 3LCEA 4UHUA 1JTGA 4KZ8A 1RGYA 1SHVA 3UNWA 5J8XA 5FQ9A 2Y91A 1W8QA 4D2OA 4GN2A 3PBQA 2OSUA 4Y7PA 3WS1A 3A3FA 3CZDA 3UDIA 3HLEA 3HLBA 3IH9A 4R0QA 3HLWA 5AQAA 3V50A 5F83A 1H8ZA 4KZ7A 4MBHA 2OLVA 4A5RA 2XLNA 2IWCA 5D3OA 4R23A 4KQOA 4WM9A 4FH2A 4LV2A 2HDQA 2WZZA 5AQBA 3VFFA 5FI7A 1PWDA 5HARA 2RL3A 4ZBEA 2Y2HA 5HX9A 3NBLA 4ZJ1A 2FFYA 3NC8A 3MBZA 3SS4A 4IVIA 3WS5A 4GNUA 3O86A 3SOIA 2BLSA 3I7JA 3IHBA 1IYOA 2G2UA 1ZKJA 4JXGA 5EVLA 1C3BA 5HAIA 4N92A 3RXXA 4CPKA 1KDSA 1JWZA 3BECA 4OONA 1XX2A 3BM6A 4MBFA 1J9MA 3FKWA 5FASA 1E3UA 4OP8A 1NYYA 2EX9A 4P6BA 2ZC3B 5DF8A 1E3UD 5FI6A 1K55A 2XD5A 3DW0A 3B3XA 1YLWA 1BLPA 3LY4A 4JLFA 1MKIA 5GLDA 3UDXA 3PAEA 4BD0A 4P0MA 2ZM2A 1ONGA 1HZOA 3V3SA 3BLSA 3GR2A 3HUMA 4JPMA 4F94A 5DVAA 4DXBA 3HLCA 4XUZA 2OLUA 1PWGA 3IXBA 2RCXA 4Y0OA 5KMWA 3IH8A 1TDGA 4Q8IA 5G18A 4CJNA 3PBOA 3W4QA 2EX8A 3A3JA 3V39A 1WYBA 3C4OA 3HLGA 3SH7A 3C7VA 3OCLA 4OOLA 4KG5A 4OVDA 1KGEA 5EVIC 1QMFA 3QHYA 4WEJA 1MWTA 2IWBA 4UA9A 4NK3A 1JWVA 5EVIA 5FA7A 3W4PA 4C75A 3VP3A 2PU2A 2GDNA 1W7FA 3IQAA 4P87A 5EVID 1XA7A 4KZ5A 4BL2A 2OV5A 2VGJA 4KZBA 4EBLA 3BFDA 1PZPA 4OPYA 4ZDXA 3ZG9B 3VFHA 1K6RA 4KZ3A 2Q9MA 4WEKA 4EWFA 3HUNA 1ZC2A 3D4FA 3E2KA 2XR0A 3NDGA 2PBYA 4GDNA 2G2WA 2WADA 2IWDA 3UE1A 1FR1A 1EROA 4BD1A 3BFFA 4PM8A 2QPNA 1LL9A 3ISGA 4DE3A 1H8YA 4JXSA 2HDUA 2WUQA 3QNBA 3BFEA 4QY5A 1VM1A 2H0YA 4EQIA 1L0GA 3MZFA 3CG5A 1AXBA 2B5RA 2V2FF 4KZAA 1GCEA 3OZHA 4JF5A 2V20A 4S2IA 4X56A 2ZC7A 2WGIA 5FDHA 4KG2A 2HP9A 4HESA 4X69A 4OLGA 5A91A 3G35A 1GHMA 2ZC4B 3BLMA 4E3IA 4S2JA 5HAPA 4H8RA 1K54C 4LV3A 2ZQCA 1BT5A 4DDSA 3HUOA 5HFOA 1HVBA 2HDSA 4Y0TA 4IVKA 1IYSA 3IXHA 4RVAA 1DJAA 3G31A 3TG9A 2QMIA 3ZG5A 3IT9A 1ZG6A 2X71A 5FAPA 1IYQA 3TSGA 4UAAA 3FZCA 1GA9A 2C5WB 3S1YA 3PTEA 4GOGA 1N9BA 1EWZA 3MZDA 3VOZA 1DY6A 1LHYA 4K0XA 2J9OA 3WS2A 1FQGA 4DDYA 1U60A 3E2LA 1Y54A 1BZAA 3CMZA 5L2FA 4QU3A 1CK3A 5HL1A 5EOEA 1L2SA 4BLMA 3IWOA 4DXCA 4KZ4A 1ES3A 2EXAA 1G68A 4WZ5C 3WRTA 1XXMA 3G4PA 4XUXA 4WZ5A 2HP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDR A;  3BYD A;  1FR6 A;  1S6R A;  2C6W B;  2WYX A;  3NIA A;  4OKP A;  3VMA A;  4FCF A;  5CHM A;  4QJG A;  4OQ0 A;  3RXW A;  1TDL A;  4MLL A;  4K0W A;  2ZMA A;  5KSC A;  5FAO A;  4HBU A;  1Q2Q A;  2ZC5 B;  5CER A;  3PBN A;  2X02 A;  1PZO A;  2ZM8 A;  2HPB A;  5GHZ A;  4B4Z A;  1PI4 A;  5TGF A;  3IHA A;  3C4P A;  2Y2P A;  4JF6 A;  3MKE A;  4EBP A;  4NET A;  4PM5 A;  2QZ6 A;  2DCF A;  1LLB A;  3JYI A;  5CRF A;  4DF6 A;  4B88 A;  5CTN A;  3MZE A;  1LI0 A;  4PM7 A;  2DRW A;  4MBK A;  4JXV A;  1NJ4 A;  1M40 A;  4S2K A;  4S2N C;  5JYP A;  2WAE A;  2EX2 A;  1ERM A;  3Q7V A;  4FH4 A;  1YLP A;  2Y2M A;  4IBX A;  2XK1 A;  2ZQA A;  3OPR A;  5FQM A;  4N1X A;  2Z2M B;  1LL5 A;  5DF9 A;  3VP0 A;  4DE1 A;  5E2F A;  4R1G A;  5F82 A;  1GHP A;  3N7W A;  4OPQ A;  3UE3 A;  4BEN A;  4BQM A;  2Y2Q A;  3G30 A;  1KVL A;  2X01 A;  4EV4 A;  5FSR A;  2BG1 A;  4JKT A;  3M2J A;  3P09 A;  5M1A A;  5GLC A;  5I94 A;  4X6T A;  4Z9Q A;  4ZJ2 A;  1LI9 A;  2WGV A;  3HRE A;  4ZTK A;  3FWL A;  4OOM A;  2XF3 A;  5GLA A;  5EOO A;  3ZVT A;  5FQK A;  3ZNY A;  1S0W A;  1IEL A;  2XEP A;  2E8I A;  1RGZ A;  5A93 A;  4WMC A;  4OQI A;  1YLY A;  4PPR A;  4RX2 A;  4RA7 A;  5A90 A;  1OME A;  3IF6 C;  4WMC D;  5CHU A;  3UO9 A;  4HEF A;  1GA0 A;  1ES5 A;  1O7E A;  1DJC A;  1CEF A;  1ESU A;  1K6S A;  3GQZ A;  4IBR A;  5EVI B;  3GVB A;  3N8L A;  3IF5 A;  5AQ9 A;  4Y0U A;  4X55 A;  5CHJ A;  1NZU A;  3Q81 A;  5GLB A;  1PI5 A;  1BUE A;  3SH9 A;  4BL3 A;  3DTM A;  3TOI A;  4MNR A;  4S2M A;  2Y2K A;  4KZ9 A;  1MXO A;  2JE5 A;  5AQ7 A;  1M6K A;  1BLC A;  3BEB A;  3C5A A;  5M18 A;  3UDF A;  4BJP A;  2WGW A;  4OH0 A;  5GL9 A;  5A92 A;  5FI2 A;  3M6B A;  4L0L A;  4N9K A;  2Y2O A;  4WBG A;  2CC1 A;  1KE0 A;  4GZB A;  1YT4 A;  3ZCZ A;  1PW8 A;  1YLT A;  2EX6 A;  1W5D A;  2R9W A;  3VP4 A;  1I2S A;  1JVJ A;  1W79 A;  3VSL A;  3V3R A;  3LEZ A;  4E3M A;  3SS5 A;  1ES4 A;  2DNS A;  1KE3 A;  4U3T A;  1TEM A;  1KGF A;  1K57 C;  1PW1 A;  1YM1 A;  4GD6 A;  4OQG A;  5E2H A;  5M19 A;  1K57 A;  3AGF A;  4JXW A;  5HW3 A;  2J7V A;  1JTD A;  4EUZ A;  3M2K A;  1N4O A;  1K54 A;  3OC2 A;  1ES2 A;  1TVF A;  2ZQD A;  3S22 A;  2R9X A;  4KG6 A;  3VP2 A;  2H5S A;  1PIO A;  1FOF A;  2VGK A;  3MXS A;  3Q7Z A;  2Y59 A;  2ZD8 A;  2WKE A;  3V5M A;  1K38 A;  3FV7 A;  4OPR A;  1JWP A;  5E2G A;  4M3K A;  4S2O A;  4RX3 A;  1XGJ A;  1PYY A;  3N4I A;  3N8R A;  3IWQ A;  2Y2J A;  3NDE A;  1MPL A;  2Y2L A;  5KSH A;  4YIN A;  1L0D A;  3P98 A;  1KE4 A;  4PMA A;  5EEC A;  1MY8 A;  1SDE A;  3EQU A;  4UA7 A;  4ZAM A;  3CJM A;  2JCH A;  3A3I A;  3MFD A;  2Y2N A;  5CEB A;  1W8Y A;  1FSW A;  3Q07 A;  4GB7 A;  3HLD A;  2HP5 A;  3DWK A;  1ZG4 A;  1FCO A;  2XH9 A;  4UA6 A;  3UE0 A;  5TR7 A;  2A3U A;  2ZQ9 A;  4IED A;  5EE8 A;  5BOH A;  1CEG A;  4O7D A;  4DE2 A;  1ERQ A;  2P9V A;  4N9L A;  4R4S A;  1IKG A;  4ID4 A;  4C3Q A;  1PWC A;  3M6H A;  1WE4 A;  3G34 A;  2P9V B;  5U47 A;  1KVM A;  4MEZ A;  5EPH A;  5GHY A;  4XXR A;  4C6Y A;  3S4X A;  2Q9N A;  1K4F A;  2XFT A;  3Q82 A;  3ZNT A;  4WYY A;  1SKF A;  4U0T A;  4LV1 A;  4OOY A;  3HL9 A;  4S2N A;  3VSK A;  3ZVW A;  5DTS A;  1BLH A;  3VP1 A;  5F1F A;  5CEC A;  1L0E A;  1O07 A;  3NCK A;  1BTL A;  1EI5 A;  1NY0 A;  3C7U A;  2Y4A A;  4QY6 A;  3Q7V B;  5IHV A;  5CGW A;  1FCM A;  3SS3 A;  2XFS A;  5FQQ A;  4S2P A;  5E43 A;  4B4X A;  1BUL A;  3OCN A;  2JBF A;  1ONH A;  2UWX A;  2I72 A;  3IXG A;  2ZC6 B;  4X68 A;  5FAT A;  3WWX A;  3ZG0 A;  3EQV A;  5CXW A;  3GV9 A;  4KQQ A;  3G2Z A;  4LV0 A;  3FYZ A;  2WKH A;  1SCW A;  3O88 A;  1YLZ A;  5KZH A;  2WAF A;  1K56 A;  3W4O A;  4OLD A;  4EBN A;  4DKI A;  1YLJ A;  2Y2G A;  5GHX A;  1RP5 A;  3GSG A;  1ESI A;  1K56 D;  1YQS A;  4KQR A;  5CTM A;  2ZLY A;  1CI8 A;  1CI9 A;  3N6I A;  3GRJ A;  1K55 C;  3WRZ A;  4R3J A;  2XGN A;  1ALQ A;  1HD8 A;  5CGS A;  3WS4 A;  2WK0 A;  1IYP A;  3BFC A;  1K25 A;  4E6W A;  3BRM A;  4E3N A;  3QNC A;  3VOY A;  4E3O A;  3OPH A;  5EUA A;  1NYM A;  1KDW A;  4GD8 A;  3ITA A;  2Z2L B;  3IF6 A;  4P85 A;  3PBR A;  3NY4 A;  3N8S A;  3UN7 A;  3HVF A;  3ZDJ A;  3LY3 A;  3OPL A;  4GKU A;  4QB8 A;  1Q2P A;  2ZQ8 A;  3A3E A;  3IF6 B;  3IXD A;  4N1H A;  4R3B A;  1I2W A;  1RCJ A;  4RYE A;  3UPP A;  1GHI A;  3UPO A;  2ZJ9 A;  3O87 A;  4FD8 A;  3PBS A;  2A49 A;  4JBF A;  3PAG A;  2JC7 A;  1YMS A;  2WZX A;  4K91 A;  3AGE A;  5CED A;  3HLF A;  2XD1 A;  2ZM0 A;  4HBT A;  5FAQ A;  4LCL A;  4OP5 A;  1XA1 A;  1K4E A;  3PBT A;  3Q1F A;  1MWS A;  2WGW B;  3W8K A;  1MBL A;  5TFQ A;  4FSF A;  2Y55 A;  5CGX A;  3ITB A;  4LEN A;  5JYO A;  4QHC A;  1NRF A;  5FQJ A;  4E3J A;  2ZQ7 A;  1VQQ A;  3HBR A;  1L0F A;  3OPP A;  4YFM A;  5E2E A;  1WYC A;  1FCN A;  3RJU A;  3WS0 A;  1YMX A;  2H0T A;  4DE0 A;  4PM6 A;  3MXR A;  1E4D A;  1BLS A;  4E3K A;  3LO7 A;  2EFX A;  4WZ4 A;  3O3V A;  3ZG8 B;  4OQH A;  4JF4 A;  2PU4 A;  4WEL A;  1BSG A;  4KEN B;  3ZFZ A;  4E3L A;  2J9P A;  4S2L A;  5DF7 A;  1NXY A;  2P74 A;  2H10 A;  3MKF A;  1SDN A;  3NI9 A;  4PM9 A;  1HTZ A;  4KZ6 A;  1MWU A;  1MWR A;  1XKZ A;  1IKI A;  2FFF B;  1I5Q A;  3GTC A;  1KGG A;  3GMW A;  1Z6F A;  3UY6 A;  1NZO A;  2XQZ A;  1IEM A;  1XPB A;  4R4R A;  4DRT A;  1DJB A;  1XP4 A;  1E25 A;  2EXB A;  2WKI A;  4QD4 A;  4LCM A;  5HAQ A;  1XGI A;  3ZGA B;  4U0X A;  5F1G A;  1FSY A;  3G2Y A;  3IWI A;  3UPN A;  2J8Y A;  4GDB A;  5DTT A;  4E6X A;  3ZG7 B;  1G6A A;  3FKV A;  4ZJ3 A;  3DWZ A;  3AGD A;  4X53 A;  5FQI A;  4OPZ A;  3ZHH A;  1H5X A;  3G32 A;  3BFG A;  2XDM A;  3SH8 A;  1QME A;  2V1Z A;  2Y2I A;  5DTK A;  3A3D A;  2EFU A;  3LCE A;  4UHU A;  1JTG A;  4KZ8 A;  1RGY A;  1SHV A;  3UNW A;  5J8X A;  5FQ9 A;  2Y91 A;  1W8Q A;  4D2O A;  4GN2 A;  3PBQ A;  2OSU A;  4Y7P A;  3WS1 A;  3A3F A;  3CZD A;  3UDI A;  3HLE A;  3HLB A;  3IH9 A;  4R0Q A;  3HLW A;  5AQA A;  3V50 A;  5F83 A;  1H8Z A;  4KZ7 A;  4MBH A;  2OLV A;  4A5R A;  2XLN A;  2IWC A;  5D3O A;  4R23 A;  4KQO A;  4WM9 A;  4FH2 A;  4LV2 A;  2HDQ A;  2WZZ A;  5AQB A;  3VFF A;  5FI7 A;  1PWD A;  5HAR A;  2RL3 A;  4ZBE A;  2Y2H A;  5HX9 A;  3NBL A;  4ZJ1 A;  2FFY A;  3NC8 A;  3MBZ A;  3SS4 A;  4IVI A;  3WS5 A;  4GNU A;  3O86 A;  3SOI A;  2BLS A;  3I7J A;  3IHB A;  1IYO A;  2G2U A;  1ZKJ A;  4JXG A;  5EVL A;  1C3B A;  5HAI A;  4N92 A;  3RXX A;  4CPK A;  1KDS A;  1JWZ A;  3BEC A;  4OON A;  1XX2 A;  3BM6 A;  4MBF A;  1J9M A;  3FKW A;  5FAS A;  1E3U A;  4OP8 A;  1NYY A;  2EX9 A;  4P6B A;  2ZC3 B;  5DF8 A;  1E3U D;  5FI6 A;  1K55 A;  2XD5 A;  3DW0 A;  3B3X A;  1YLW A;  1BLP A;  3LY4 A;  4JLF A;  1MKI A;  5GLD A;  3UDX A;  3PAE A;  4BD0 A;  4P0M A;  2ZM2 A;  1ONG A;  1HZO A;  3V3S A;  3BLS A;  3GR2 A;  3HUM A;  4JPM A;  4F94 A;  5DVA A;  4DXB A;  3HLC A;  4XUZ A;  2OLU A;  1PWG A;  3IXB A;  2RCX A;  4Y0O A;  5KMW A;  3IH8 A;  1TDG A;  4Q8I A;  5G18 A;  4CJN A;  3PBO A;  3W4Q A;  2EX8 A;  3A3J A;  3V39 A;  1WYB A;  3C4O A;  3HLG A;  3SH7 A;  3C7V A;  3OCL A;  4OOL A;  4KG5 A;  4OVD A;  1KGE A;  5EVI C;  1QMF A;  3QHY A;  4WEJ A;  1MWT A;  2IWB A;  4UA9 A;  4NK3 A;  1JWV A;  5EVI A;  5FA7 A;  3W4P A;  4C75 A;  3VP3 A;  2PU2 A;  2GDN A;  1W7F A;  3IQA A;  4P87 A;  5EVI D;  1XA7 A;  4KZ5 A;  4BL2 A;  2OV5 A;  2VGJ A;  4KZB A;  4EBL A;  3BFD A;  1PZP A;  4OPY A;  4ZDX A;  3ZG9 B;  3VFH A;  1K6R A;  4KZ3 A;  2Q9M A;  4WEK A;  4EWF A;  3HUN A;  1ZC2 A;  3D4F A;  3E2K A;  2XR0 A;  3NDG A;  2PBY A;  4GDN A;  2G2W A;  2WAD A;  2IWD A;  3UE1 A;  1FR1 A;  1ERO A;  4BD1 A;  3BFF A;  4PM8 A;  2QPN A;  1LL9 A;  3ISG A;  4DE3 A;  1H8Y A;  4JXS A;  2HDU A;  2WUQ A;  3QNB A;  3BFE A;  4QY5 A;  1VM1 A;  2H0Y A;  4EQI A;  1L0G A;  3MZF A;  3CG5 A;  1AXB A;  2B5R A;  2V2F F;  4KZA A;  1GCE A;  3OZH A;  4JF5 A;  2V20 A;  4S2I A;  4X56 A;  2ZC7 A;  2WGI A;  5FDH A;  4KG2 A;  2HP9 A;  4HES A;  4X69 A;  4OLG A;  5A91 A;  3G35 A;  1GHM A;  2ZC4 B;  3BLM A;  4E3I A;  4S2J A;  5HAP A;  4H8R A;  1K54 C;  4LV3 A;  2ZQC A;  1BT5 A;  4DDS A;  3HUO A;  5HFO A;  1HVB A;  2HDS A;  4Y0T A;  4IVK A;  1IYS A;  3IXH A;  4RVA A;  1DJA A;  3G31 A;  3TG9 A;  2QMI A;  3ZG5 A;  3IT9 A;  1ZG6 A;  2X71 A;  5FAP A;  1IYQ A;  3TSG A;  4UAA A;  3FZC A;  1GA9 A;  2C5W B;  3S1Y A;  3PTE A;  4GOG A;  1N9B A;  1EWZ A;  3MZD A;  3VOZ A;  1DY6 A;  1LHY A;  4K0X A;  2J9O A;  3WS2 A;  1FQG A;  4DDY A;  1U60 A;  3E2L A;  1Y54 A;  1BZA A;  3CMZ A;  5L2F A;  4QU3 A;  1CK3 A;  5HL1 A;  5EOE A;  1L2S A;  4BLM A;  3IWO A;  4DXC A;  4KZ4 A;  1ES3 A;  2EXA A;  1G68 A;  4WZ5 C;  3WRT A;  1XXM A;  3G4P A;  4XUX A;  4WZ5 A;  2HP6 A; 
#chains in the Genus database with same CATH topology
 3ZQ5 A;  4D60 A;  2C6W B;  2WYX A;  3NIA A;  4OKP A;  3VMA A;  4OQ0 A;  5FEG A;  3UMD A;  1TS0 A;  4WN5 A;  4Y15 A;  2HPB A;  3IHA A;  4LFU A;  3MKE A;  2DCF A;  1LLB A;  5CRF A;  4DF6 A;  4BBT A;  1UGU A;  3MZE A;  1LI0 A;  4MBK A;  4LRX C;  4S2K A;  1M40 A;  4S2N C;  5JYP A;  2WAE A;  2YKF A;  1ERM A;  4GHI B;  4GW9 A;  2Z2M B;  5DF9 A;  3UME A;  4OPQ A;  4BEN A;  3G30 A;  1KVL A;  3M2J A;  1G5U A;  4LRZ E;  3LID A;  5FQK A;  4XT2 B;  1IEL A;  2XEP A;  3ICY A;  1P9R A;  2FH5 A;  4RA7 A;  1OME A;  3E4Q A;  1GA0 A;  1O7E A;  1CEF A;  3MQQ A;  1K6S A;  3GQZ A;  5KIZ A;  2O9A A;  1T18 A;  3JVV A;  3T4O A;  4JGO A;  4ARZ A;  4X55 A;  3Q81 A;  5GLB A;  1PI5 A;  1GSW A;  1OJG A;  3TOI A;  4MNR A;  4S2M A;  2ZL1 B;  1M6K A;  3CAX A;  4QPR A;  1BLC A;  2R78 A;  2VJW A;  3E4P A;  4WBG A;  5L10 A;  5C5K A;  1KE0 A;  4CQH A;  1PW8 A;  1JVJ A;  4E3M A;  4U3T A;  3C2W A;  5L07 A;  3U2A A;  1N4O A;  1K54 A;  3OC2 A;  2ZQD A;  4KG6 A;  3G6O A;  5HDD A;  2WKE A;  3CPT A;  3DTI A;  5E2G A;  4S2O A;  3A0V A;  4RX3 A;  1PYY A;  2Y2J A;  4DN0 A;  3NDE A;  4P6Z S;  2AVX A;  1SDE A;  4UA7 A;  3SZT A;  4ZAM A;  2JCH A;  4UQI M;  1W8Y A;  3P7N A;  3Q07 A;  3LR4 A;  4GB7 A;  3FC7 A;  3DWK A;  3UE0 A;  1LSW A;  2INW A;  4IED A;  3T12 B;  3T4J A;  2JKT M;  4G3V A;  4DE2 A;  1PWC A;  3FPV A;  5U47 A;  1KVM A;  5GHY A;  3S4X A;  2XFT A;  3Q82 A;  3ZNT A;  2L4R A;  3LIC A;  4CLC E;  3HL9 A;  5DTS A;  3VP1 A;  5F1F A;  1NY0 A;  4F3L B;  5IHV A;  3F1P B;  5CGW A;  3P01 A;  4S2P A;  1BUL A;  3OCN A;  3IXG A;  3WWX A;  4EET B;  1TS7 A;  4OLD A;  4EBN A;  1YLJ A;  1S1Y A;  1TD5 A;  3GSG A;  2M7U A;  3R7W A;  5AJG A;  1CI9 A;  1K55 C;  4R3J A;  2XGN A;  1HD8 A;  3CUE C;  3WS4 A;  4R70 A;  2GNX A;  1K25 A;  3BRM A;  4E3N A;  3QNC A;  3VOY A;  4E3O A;  3DTK A;  4P85 A;  3PBR A;  3HVF A;  3ZDJ A;  1OJ5 A;  3LY3 A;  3OPL A;  4QB8 A;  3IXD A;  3UPO A;  4B9O A;  3CHW P;  2JC7 A;  2WZX A;  3LIF A;  2QYB A;  3AGE A;  5CED A;  5FAQ A;  4WL9 A;  1MBL A;  2Y55 A;  4LEN A;  1NRF A;  5FQJ A;  4YFM A;  3RJU A;  1FCN A;  4PM6 A;  1E4D A;  2EFX A;  2JKR I;  3O3V A;  4R6L A;  4KEN B;  3ZFZ A;  4S2L A;  3K2N A;  1PFL A;  5TBM A;  4P6Z M;  5AVE A;  1KGG A;  3GMW A;  4DRT A;  3S7O A;  5EFW A;  1XGI A;  3W2Z A;  1G6O A;  3T1X A;  4E6X A;  3HJI A;  2WKR A;  3AGD A;  4X53 A;  4OPZ A;  4LGW A;  3G32 A;  4H6J B;  3VV4 A;  1S4S A;  3E0Y A;  3IBR A;  3UNW A;  2QJ5 A;  2Y91 A;  5IT5 A;  4GN2 A;  3PBQ A;  5AQA A;  3HLB A;  3HLW A;  3V50 A;  4DJ3 A;  5HWW A;  1MC0 A;  4KZ7 A;  3LEQ A;  3KX0 X;  1T1C A;  4R23 A;  4KQO A;  2HDQ A;  1GSV A;  2WZZ A;  3QP8 A;  4Y3I A;  4ZBE A;  4ZJ1 A;  3NC8 A;  4Q0H A;  4ESP A;  1D06 A;  3I7J A;  1ZKJ A;  4JXG A;  5G4Y A;  2HJ9 C;  4GCZ A;  3RXX A;  4OON A;  4MBF A;  2LB9 A;  2EX9 A;  4P6B A;  2OWJ A;  1YLW A;  3LY4 A;  1OTE A;  3T4S A;  3SW1 A;  4P0M A;  4CLC A;  4HQA A;  3BLS A;  3HUM A;  4JPM A;  4CLC D;  2OLU A;  1PWG A;  2JKF A;  1SZV A;  2NUP C;  3HLG A;  4KG5 A;  3E4O A;  1QMF A;  4WEJ A;  1MWT A;  5FA7 A;  4C75 A;  3VP3 A;  4P87 A;  1XA7 A;  5HSQ A;  2PAV P;  1LL8 A;  4GS9 A;  4KZ3 A;  4WEK A;  2XR0 A;  3KSF A;  4NEE D;  3UE1 A;  4DE3 A;  1H8Y A;  4JXS A;  1VM1 A;  5HD5 A;  4KZA A;  3EEA A;  3OZH A;  2GJ3 A;  3K3D A;  4X56 A;  4KG2 A;  2HP9 A;  3JPU A;  4HH2 A;  4HP4 A;  2ZC4 B;  4PKY G;  4S2J A;  3TW8 A;  2O9B A;  1K54 C;  3ZYT A;  5HFO A;  2PD8 A;  1DJA A;  3TG9 A;  4BWI A;  5J3W A;  3IT9 A;  4UAA A;  1N9B A;  3FG8 A;  1W63 Q;  3MMH A;  3WS2 A;  3IS2 A;  2VV7 A;  2VGL S;  3DTE A;  2P08 A;  4AFI A;  3IWO A;  4KZ4 A;  1G68 A;  1OPX A;  3WRT A;  1XXM A;  3G4P A;  4WZ5 A;  4KUK A;  3D72 A;  5CHM A;  4QJG A;  3RXW A;  4K0W A;  2VA0 A;  5CER A;  3FPW A;  2X02 A;  4B4Z A;  1CQA A;  3H82 B;  1ACF A;  2PR6 A;  4PM5 A;  3PHY A;  5CTN A;  5EVE A;  3OOV A;  1IFQ A;  4JXV A;  5EM0 A;  5DJT A;  1DP6 A;  2EX2 A;  5HL6 A;  3Q7V A;  1T19 A;  1K0K A;  5FQM A;  2XK1 A;  2ZQA A;  3OPR A;  4N1X A;  1NRJ A;  5E2F A;  5F82 A;  3UE3 A;  3NJA A;  2X01 A;  3T1Q B;  4EES A;  5GLC A;  5I94 A;  1YKD A;  2HV1 A;  4Y2F A;  1V9Z A;  1LI9 A;  4OOM A;  5EOO A;  4B93 A;  3NUL A;  5HWT A;  2EWV A;  4EXO A;  4E04 A;  4OQI A;  4ZRR A;  4PPR A;  1T1A A;  3UO9 A;  4HEF A;  2JKG A;  4IBR A;  4Y0U A;  5CHJ A;  1NZU A;  2JKT I;  1PNE A;  2PYR A;  1BUE A;  3EGD C;  2Y2K A;  5FEF A;  2Q0O A;  3UDF A;  4L0L A;  4N9K A;  2CC1 A;  4GZB A;  3MJQ A;  3VSL A;  3SS5 A;  1ES4 A;  1KGF A;  1K57 C;  1YM1 A;  4GD6 A;  4MN7 A;  3BQ8 A;  3MS6 A;  2R9X A;  2ZBB A;  3VP2 A;  2H5S A;  1ZHH B;  1PIO A;  3MXS A;  3V5M A;  4WUJ A;  4M3K A;  3N4I A;  3L9K A;  3IWQ A;  4Q0J A;  1MPL A;  3P98 A;  3DAV A;  1MY8 A;  3EQU A;  1PRQ A;  3CJM A;  3MFD A;  3MR0 A;  4HHD A;  1FCO A;  4UA6 A;  5TR7 A;  1S4R A;  4HY8 A;  1VEU A;  2QWS A;  2ZQ9 A;  5EE8 A;  2P9V A;  4ID4 A;  3M6H A;  1WE4 A;  2KOI A;  5EPH A;  4XXR A;  2H28 A;  4WYY A;  2O0Y A;  4OOY A;  2JHE A;  3ZVW A;  3NCK A;  4QY6 A;  3DBA A;  5A8B A;  2XFS A;  5FQQ A;  2JBF A;  2UWX A;  3ZG0 A;  2L1M A;  5CXW A;  4LV0 A;  2VZW A;  4I39 A;  2Y2G A;  1DP8 A;  1ESI A;  5CTM A;  2ZLY A;  1VB6 A;  2DMW A;  1H8M A;  5CGS A;  1IYP A;  4E6W A;  4I38 A;  5EUA A;  1KDW A;  3ITA A;  2Z2L B;  2D02 A;  3NY4 A;  3N8S A;  2VKS A;  1Q2P A;  3BY9 A;  4LPZ A;  4R3B A;  1RCJ A;  3UPP A;  4FD8 A;  2PDR A;  1ZTU A;  2A24 B;  4EEP A;  3F1O B;  4JGR A;  2W1R A;  4HBT A;  4KUO A;  4LCL A;  3KSH A;  2WGW B;  3W8K A;  2ACG A;  4FTX A;  5CGX A;  2IA2 A;  3ITB A;  5JYO A;  4I3J A;  2OAQ 1;  4E3J A;  3HBR A;  1L0F A;  3LIE A;  3KSG A;  1WYC A;  3T50 A;  2OOL A;  4JF4 A;  4WEL A;  1NXY A;  3NI9 A;  1SDN A;  1MWR A;  3MF0 A;  5L8M A;  1NZO A;  4R4R A;  1E25 A;  2L0W A;  4HIA A;  4LCM A;  3EEH A;  3UPN A;  3IWI A;  4GDB A;  1G6A A;  3FKV A;  4ZJ3 A;  5FQI A;  4L9E A;  3BFG A;  2V1Z A;  2XA7 M;  4KZ8 A;  1RGY A;  1SHV A;  5AVF A;  5FQ9 A;  1W8Q A;  1TS6 A;  4Y7P A;  3T4K A;  1H8Z A;  4MBH A;  5J7E A;  1XJ3 A;  3NOP C;  4IJG A;  4QWO A;  3PR6 A;  4HH3 A;  3S7N A;  3A0S A;  5FI7 A;  2Y2H A;  4Y17 A;  1GSX A;  3SS4 A;  5MC7 A;  4IVI A;  3WS5 A;  3MQO A;  3SOI A;  2XRN A;  2BLS A;  2G2U A;  5EVL A;  4CPK A;  1KDS A;  3BEC A;  1F2K A;  3F1N B;  1F9I A;  4R3A A;  4BMW A;  4OP8 A;  3NHQ A;  2ZC3 B;  5HDC A;  4EUV A;  2XD5 A;  4JLF A;  5GLD A;  3V67 A;  3QP5 A;  3CIT A;  2ZM2 A;  1HZO A;  1J3W A;  3V3S A;  3IBJ A;  4II7 A;  3GR2 A;  4XT2 A;  4DXB A;  4XUZ A;  3IXB A;  2RCX A;  4Y0O A;  3VE4 A;  5KMW A;  3IH8 A;  3LYX A;  1OT6 A;  3PBO A;  1N9N A;  3PXP A;  2EX8 A;  3A3J A;  1WYB A;  4Z1W A;  4OOL A;  5DFX A;  4O0P A;  4MN6 A;  5EVI C;  1SKO B;  3QHY A;  2LB5 A;  2IWB A;  1JWV A;  1W7F A;  4YWZ A;  2OV5 A;  2VGJ A;  4KZB A;  2K2N A;  4EBL A;  3NEC A;  1NLY A;  1PZP A;  4OPY A;  2ZL1 A;  3HUN A;  3D4F A;  4GS9 B;  2PBY A;  4X1L A;  4GDN A;  1FR1 A;  1ERO A;  3A0R A;  4PM8 A;  3ISG A;  2PYP A;  5G4Z A;  2HDU A;  3BFE A;  4HP9 A;  3H7W A;  2W3D A;  2ZMF A;  4EQI A;  1L0G A;  3CG5 A;  5D3O A;  1GCE A;  4JF5 A;  1NLZ A;  1S67 L;  5A91 A;  2EWW A;  2Z6C A;  1GHM A;  4ETX A;  4H8R A;  1BT5 A;  1V9Y A;  3HUO A;  5J4E A;  5F68 A;  3B33 A;  2HDS A;  3KSI A;  1IYS A;  4RVA A;  3G31 A;  1A0K A;  2X71 A;  5FAP A;  3FZC A;  1GA9 A;  3PTE A;  3JVU A;  4DDY A;  5L2F A;  2KLI A;  5HWV A;  2I9V A;  1L2S A;  4BLM A;  3IS2 B;  4XUX A;  2O9C A;  3BYD A;  4FCF A;  3T4T A;  4MLL A;  4PHT A;  4HOI A;  4HBU A;  2V0U A;  2ZC5 B;  3R4K A;  3PBN A;  4NXE A;  2ZM8 A;  3C4P A;  3UB7 A;  2V9A A;  4JF6 A;  2G7U A;  4EBP A;  2QZ6 A;  3JYI A;  3BWL A;  4B88 A;  4PM7 A;  1NJ4 A;  4F3L A;  1YLP A;  3F1P A;  3VP0 A;  4R1G A;  3N7W A;  4BQM A;  2Y2Q A;  5FSR A;  1OTI A;  2BG1 A;  3P09 A;  4O01 A;  2EA9 A;  4X6T A;  5TJJ A;  4Z9Q A;  4MCW A;  4EU0 A;  3HRE A;  4ZTK A;  5GLA A;  5FL3 A;  3ZNY A;  1S0W A;  2QJ7 A;  1RGZ A;  4WMC A;  1YSP A;  1YLY A;  4WMC D;  2QHK A;  5CX7 A;  5EVI B;  2PHY A;  3GVB A;  3IF5 A;  5AQ9 A;  3SH9 A;  5FDS A;  2J3T D;  4KZ9 A;  1MXO A;  5AQ7 A;  2V1B A;  2A2L A;  3C5A A;  5GL9 A;  5FI2 A;  3M6B A;  2W3F A;  3TJZ C;  1VHM A;  2GX5 A;  3ZCZ A;  2K31 A;  1YLT A;  4NKP A;  1W5D A;  2R9W A;  3LEZ A;  2FZ0 A;  1KE3 A;  2HJE A;  1TEM A;  5E2H A;  5M19 A;  3C30 A;  5HW3 A;  1JTD A;  3BJN A;  1ES2 A;  3S22 A;  1VET B;  3LIA A;  1FOF A;  4HJ6 A;  3Q7Z A;  2Y59 A;  2ZD8 A;  3LUQ A;  4JGQ A;  1K38 A;  3FV7 A;  1JWP A;  4X1M A;  1XGJ A;  3N8R A;  3LI9 A;  4BBV A;  4YIN A;  1L0D A;  3LR5 A;  1KE4 A;  4PMA A;  5EEC A;  4EQ1 A;  4LRY C;  3A3I A;  4HNB A;  2Y2N A;  1FSW A;  4H6J A;  3HLD A;  4HJ4 A;  1ZG4 A;  2XH9 A;  2B95 A;  3BW6 A;  3LR0 A;  5BOH A;  1CEG A;  4O7D A;  4N9L A;  1VEU B;  3TE8 A;  2M1C A;  2P9V B;  2D01 A;  1HLU P;  2Q9N A;  1K4F A;  4LV1 A;  3VSK A;  2NUT C;  1BLH A;  5CEC A;  1O07 A;  1EI5 A;  3C7U A;  2Y4A A;  1YPR A;  1FCM A;  5IS1 A;  3ULF A;  3BY8 A;  5E43 A;  4B4X A;  3B42 A;  5HDS A;  2ZC6 B;  4X68 A;  3EWK A;  4NXG A;  3EQV A;  3G2Z A;  3FYZ A;  1SCW A;  5KZH A;  1YLZ A;  2WAF A;  3W4O A;  4DKI A;  4WLA A;  4KQR A;  1YQS A;  1CI8 A;  1P97 A;  2YKH A;  3GRJ A;  2K7S A;  1ALQ A;  1BYW A;  2VV6 A;  3CUE A;  3OPH A;  2MJ6 A;  1NYM A;  1LSX A;  4GD8 A;  1OTA A;  3IF6 A;  3UN7 A;  2ZQ8 A;  3A3E A;  4FOF A;  2V8C A;  1I2W A;  3T1S A;  2ZJ9 A;  3O87 A;  4ARZ B;  2W1T A;  4JBF A;  3PAG A;  5L09 A;  1NWZ A;  1YMS A;  4K91 A;  4I3A A;  3LI8 A;  1Z09 A;  3PBT A;  3Q1F A;  5TFQ A;  3O5Y A;  2ZOH A;  2HGV A;  3L7H A;  4IUH A;  1Y28 A;  2ZQ7 A;  1VQQ A;  3WS0 A;  3OPP A;  2H0T A;  1LSV A;  4DE0 A;  1BLS A;  3ZG8 B;  4WZ4 A;  1KOU A;  4OQH A;  2PU4 A;  2P04 A;  2BAS A;  4E3L A;  2J9P A;  3MKF A;  1HTZ A;  4YOF A;  4KZ6 A;  1MWU A;  2FFF B;  3GTC A;  3CPT B;  1F98 A;  3NOT C;  3UY6 A;  2XQZ A;  1IEM A;  2OAP 1;  1XP4 A;  2EXB A;  4QD4 A;  2WKI A;  5HAQ A;  1XFN A;  3QP4 A;  3ZGA B;  4EER A;  5F1G A;  3G2Y A;  2J8Y A;  3ZG7 B;  3ZHH A;  3SH8 A;  2XDM A;  2Y2I A;  2EFU A;  3LCE A;  1JTG A;  5J8X A;  2XA7 S;  2GZA A;  2OSU A;  3RH8 B;  3A3F A;  2V0W A;  3CZD A;  3HLE A;  4GJ4 A;  4BBU A;  2XLN A;  4LV2 A;  1DRM A;  4YNR A;  3C8C A;  4HJ3 A;  5AQB A;  3H82 A;  1PWD A;  2RL3 A;  5HX9 A;  4GNU A;  3O86 A;  2PT7 A;  1FIL A;  3IHB A;  5HAI A;  4N92 A;  1STZ A;  1XX2 A;  3BM6 A;  3C38 A;  3FKW A;  5HPF A;  3KYQ A;  1OTB A;  3R7W B;  3DW0 A;  1BLP A;  1MKI A;  3UDX A;  3IX8 A;  4CLC C;  1ONG A;  4WF0 A;  3IX3 A;  4EEU A;  1TDG A;  1CF0 A;  2W3H A;  5G18 A;  2J80 A;  3W4Q A;  4CJN A;  3V39 A;  3C7V A;  4K08 A;  1F5M A;  1KGE A;  4UA9 A;  3KYZ A;  3W4P A;  2P7J A;  4IUK A;  2PU2 A;  3U4L P;  4KZ5 A;  4BL2 A;  2KX6 A;  4HI4 A;  2J3T C;  4Q0I A;  4ZDX A;  1K6R A;  2Q9M A;  4EWF A;  3NDG A;  1LT0 A;  2M7V A;  2G2W A;  2IWD A;  2KDK A;  4BD1 A;  2QPN A;  1LL9 A;  4UEY A;  3QNB A;  2WUQ A;  4QY5 A;  3UB6 A;  2B5R A;  4S2I A;  5FDH A;  2ZC7 A;  3H7W B;  4OLG A;  3G35 A;  5TBM B;  4I3I A;  3BLM A;  3T4Q A;  3OLO A;  4E3I A;  5HAP A;  2VX8 A;  4DDS A;  5HPI A;  1P9W A;  1HVB A;  4LLO B;  3VOL A;  3D9Y A;  1IYQ A;  3TSG A;  3KO6 A;  4KQD A;  3S1Y A;  2C5W B;  4GOG A;  1EWZ A;  1DY6 A;  1FQG A;  1U60 A;  1Y54 A;  1BZA A;  2W3E A;  3CMZ A;  3GEC A;  4QU3 A;  5EM1 A;  3RTY A;  4WZ5 C;  3VE3 A;  2W0N A;  2HP6 A;  5F69 A;  2HDR A;  1FR6 A;  1OTD A;  1S6R A;  3UB9 A;  1TDL A;  2ZMA A;  5KSC A;  5FAO A;  2UV0 E;  1Q2Q A;  5GHZ A;  1PZO A;  1G28 A;  1PI4 A;  5TGF A;  2Y2P A;  4NET A;  1FIK A;  2DRW A;  2Y8H A;  4GHI A;  3UB5 P;  4FH4 A;  2Y2M A;  4IBX A;  1H0M A;  1LL5 A;  4DE1 A;  1D7E A;  1JNU A;  1EW0 A;  1GHP A;  1XJ2 A;  4EV4 A;  4JKT A;  4R38 A;  5M1A A;  2B02 A;  2ZMV A;  4ZJ2 A;  4G3W A;  3CWF A;  3RFB A;  4CLC B;  4JGP A;  2WGV A;  3FWL A;  1W63 M;  2XF3 A;  3ZVT A;  2QKP A;  2E8I A;  2Y79 A;  1L3L A;  5A93 A;  2Z6D A;  4RX2 A;  4IHQ A;  5A90 A;  3IF6 C;  5CHU A;  1ES5 A;  1DJC A;  1ESU A;  3B47 A;  3N8L A;  2A24 A;  2XRO A;  3F1O A;  4GLQ A;  2B18 A;  4BL3 A;  3DTM A;  3QP2 A;  1WA9 A;  3KYE A;  2JE5 A;  3BEB A;  5M18 A;  4BJP A;  2WGW A;  4OH0 A;  5A92 A;  2PR5 A;  3EGX C;  5DKL A;  1ODV A;  2Y2O A;  1YT4 A;  2EX6 A;  1N9O A;  3VP4 A;  1I2S A;  1W79 A;  3V3R A;  2DNS A;  2VK3 A;  1PW1 A;  2WKP A;  2HF6 A;  1K57 A;  3AGF A;  4X25 A;  4JXW A;  2J7V A;  4EUZ A;  3M2K A;  1TVF A;  5EV0 A;  3LGO A;  1TS8 A;  2VGK A;  4EW7 A;  4I5S A;  4OPR A;  4RQ9 A;  3HCY A;  2Y2L A;  3S7P A;  5KSH A;  2JN7 A;  5CEB A;  4DMZ A;  3OBF A;  5I5L A;  2HP5 A;  3CLO A;  3LR3 A;  2A3U A;  1AWI A;  1ERQ A;  5DFY A;  4R4S A;  1IKG A;  4C3Q A;  3LIB A;  3K3C A;  1UWP X;  3G34 A;  4MEZ A;  4C6Y A;  5HZH A;  3IX4 A;  1SKF A;  4NG2 A;  4U0T A;  3EOI A;  4S2N A;  2V8F A;  1L0E A;  1BTL A;  3Q7V B;  3SS3 A;  4L9G A;  1XJ6 A;  3H9W A;  1ONH A;  4NXF A;  2I72 A;  5FAT A;  2W27 A;  3GV9 A;  4KQQ A;  3F1N A;  2WKH A;  3O88 A;  1K56 A;  2O99 A;  5HD3 A;  5GHX A;  1RP5 A;  1K56 D;  3CI6 A;  3N6I A;  3WRZ A;  1CJF A;  2WK0 A;  2WKQ A;  3BFC A;  1MKM A;  4MMN A;  1IOU A;  1YSQ A;  4G3K A;  1D1J A;  4GKU A;  3IF6 B;  4N1H A;  4RYE A;  1GHI A;  3E98 A;  3PBS A;  1YAX A;  2A49 A;  1SKO A;  4PKY A;  4ME4 A;  4NXB A;  3HLF A;  2W1T B;  2XD1 A;  2ZM0 A;  4OP5 A;  1XA1 A;  2PBD P;  1K4E A;  1MWS A;  2OWH A;  4FSF A;  3T1R A;  4QHC A;  5E2E A;  3UB8 A;  1YMX A;  3MXR A;  4E3K A;  3LO7 A;  1BSG A;  3GDI A;  5DF7 A;  2P74 A;  2H10 A;  2PRF A;  3PYP A;  4PM9 A;  1XKZ A;  1IKI A;  1Y4O A;  2VLG A;  1I5Q A;  1OT9 A;  1Z6F A;  1XPB A;  1DJB A;  4U0X A;  1MZU A;  1FSY A;  3MFX A;  5DTT A;  1T1B A;  3DWZ A;  1H5X A;  1QME A;  5DTK A;  3A3D A;  1X0O A;  4UHU A;  4D2O A;  3WS1 A;  3UDI A;  3MSH A;  3IH9 A;  4R0Q A;  5F83 A;  2OLV A;  4A5R A;  4O8G A;  2BTF P;  4Y13 A;  2IWC A;  3TRC A;  3BQA A;  1UWN X;  4WM9 A;  4FH2 A;  3VFF A;  5HAR A;  3UE6 A;  2VEA A;  3NBL A;  2FFY A;  3MBZ A;  1XFQ A;  1IYO A;  1C3B A;  2JKR M;  3S7Q A;  1JWZ A;  1DP9 A;  1J9M A;  1E3U A;  1NYY A;  3NOU C;  5DF8 A;  1E3U D;  2J3W A;  5FI6 A;  1K55 A;  3B3X A;  4L9F A;  2CMN A;  1XJ4 A;  2E8J A;  3PAE A;  4BD0 A;  4F94 A;  5DVA A;  3HLC A;  2VV8 A;  4Q8I A;  3D3O A;  5LBR A;  3C4O A;  3SH7 A;  3OCL A;  1H3Q A;  4OVD A;  3MXQ A;  1S1Z A;  4MDZ A;  4NK3 A;  5EVI A;  2W3G A;  1N9L A;  4Y5F A;  3MQ0 A;  2GDN A;  3IQA A;  5EVI D;  5F6A A;  2V1A A;  3BFD A;  1S66 L;  3ZG9 B;  3VFH A;  2HZ5 A;  5DJU A;  2XSS A;  1ZC2 A;  3E2K A;  5DKK A;  2WAD A;  1P0Z A;  3BFF A;  3QP1 A;  5F5Y A;  2H0Y A;  3LFV A;  3MZF A;  1AXB A;  2ZOI A;  2V2F F;  5FAS A;  2V20 A;  4FUW A;  2WGI A;  4HES A;  4X69 A;  5IU1 A;  4ETZ A;  5K5B A;  1TF1 A;  1VET A;  4LV3 A;  2ZQC A;  4Y0T A;  4IVK A;  3IXH A;  3T4L A;  2QMI A;  4MN5 A;  3ZG5 A;  1ZG6 A;  3QP6 A;  2PD7 A;  4PAU A;  3MZD A;  4M4X A;  1LHY A;  3VOZ A;  2VGL M;  4K0X A;  4DJ2 A;  2J9O A;  3E2L A;  1CK3 A;  5HL1 A;  5EOE A;  3HJK A;  4DXC A;  1ES3 A;  2EXA A;  4OQG A;  4UQI S; 
#chains in the Genus database with same CATH homology
 2HDR A;  3BYD A;  1FR6 A;  1S6R A;  2C6W B;  2WYX A;  3NIA A;  4OKP A;  3VMA A;  4FCF A;  5CHM A;  4QJG A;  4OQ0 A;  3RXW A;  1TDL A;  4MLL A;  4K0W A;  2ZMA A;  5KSC A;  5FAO A;  4HBU A;  1Q2Q A;  2ZC5 B;  5CER A;  3PBN A;  2X02 A;  1PZO A;  2ZM8 A;  2HPB A;  5GHZ A;  4B4Z A;  1PI4 A;  5TGF A;  3IHA A;  3C4P A;  2Y2P A;  4JF6 A;  3MKE A;  4EBP A;  4NET A;  4PM5 A;  2QZ6 A;  2DCF A;  1LLB A;  3JYI A;  5CRF A;  4DF6 A;  4B88 A;  5CTN A;  3MZE A;  1LI0 A;  4PM7 A;  2DRW A;  4MBK A;  4JXV A;  1NJ4 A;  1M40 A;  4S2K A;  4S2N C;  5JYP A;  2WAE A;  2EX2 A;  1ERM A;  3Q7V A;  4FH4 A;  1YLP A;  2Y2M A;  4IBX A;  2XK1 A;  2ZQA A;  3OPR A;  5FQM A;  4N1X A;  2Z2M B;  1LL5 A;  5DF9 A;  3VP0 A;  4DE1 A;  5E2F A;  4R1G A;  5F82 A;  1GHP A;  3N7W A;  4OPQ A;  3UE3 A;  4BEN A;  4BQM A;  2Y2Q A;  3G30 A;  1KVL A;  2X01 A;  4EV4 A;  5FSR A;  2BG1 A;  4JKT A;  3M2J A;  3P09 A;  5M1A A;  5GLC A;  5I94 A;  4X6T A;  4Z9Q A;  4ZJ2 A;  1LI9 A;  2WGV A;  3HRE A;  4ZTK A;  3FWL A;  4OOM A;  2XF3 A;  5GLA A;  5EOO A;  3ZVT A;  5FQK A;  3ZNY A;  1S0W A;  1IEL A;  2XEP A;  2E8I A;  1RGZ A;  5A93 A;  4WMC A;  4OQI A;  1YLY A;  4PPR A;  4RX2 A;  4RA7 A;  5A90 A;  1OME A;  3IF6 C;  4WMC D;  5CHU A;  3UO9 A;  4HEF A;  1GA0 A;  1ES5 A;  1O7E A;  1DJC A;  1CEF A;  1ESU A;  1K6S A;  3GQZ A;  4IBR A;  5EVI B;  3GVB A;  3N8L A;  3IF5 A;  5AQ9 A;  4Y0U A;  4X55 A;  5CHJ A;  1NZU A;  3Q81 A;  5GLB A;  1PI5 A;  1BUE A;  3SH9 A;  4BL3 A;  3DTM A;  3TOI A;  4MNR A;  4S2M A;  2Y2K A;  4KZ9 A;  1MXO A;  2JE5 A;  5AQ7 A;  1M6K A;  1BLC A;  3BEB A;  3C5A A;  5M18 A;  3UDF A;  4BJP A;  2WGW A;  4OH0 A;  5GL9 A;  5A92 A;  5FI2 A;  3M6B A;  4L0L A;  4N9K A;  2Y2O A;  4WBG A;  2CC1 A;  1KE0 A;  4GZB A;  1YT4 A;  3ZCZ A;  1PW8 A;  1YLT A;  2EX6 A;  1W5D A;  2R9W A;  3VP4 A;  1I2S A;  1JVJ A;  1W79 A;  3VSL A;  3V3R A;  3LEZ A;  4E3M A;  3SS5 A;  1ES4 A;  2DNS A;  1KE3 A;  4U3T A;  1TEM A;  1KGF A;  1K57 C;  1PW1 A;  1YM1 A;  4GD6 A;  4OQG A;  5E2H A;  5M19 A;  1K57 A;  3AGF A;  4JXW A;  5HW3 A;  2J7V A;  1JTD A;  4EUZ A;  3M2K A;  1N4O A;  1K54 A;  3OC2 A;  1ES2 A;  1TVF A;  2ZQD A;  3S22 A;  2R9X A;  4KG6 A;  3VP2 A;  2H5S A;  1PIO A;  1FOF A;  2VGK A;  3MXS A;  3Q7Z A;  2Y59 A;  2ZD8 A;  2WKE A;  3V5M A;  1K38 A;  3FV7 A;  4OPR A;  1JWP A;  5E2G A;  4M3K A;  4S2O A;  4RX3 A;  1XGJ A;  1PYY A;  3N4I A;  3N8R A;  3IWQ A;  2Y2J A;  3NDE A;  1MPL A;  2Y2L A;  5KSH A;  4YIN A;  1L0D A;  3P98 A;  1KE4 A;  4PMA A;  5EEC A;  1MY8 A;  1SDE A;  3EQU A;  4UA7 A;  4ZAM A;  3CJM A;  2JCH A;  3A3I A;  3MFD A;  2Y2N A;  5CEB A;  1W8Y A;  1FSW A;  3Q07 A;  4GB7 A;  3HLD A;  2HP5 A;  3DWK A;  1ZG4 A;  1FCO A;  2XH9 A;  4UA6 A;  3UE0 A;  5TR7 A;  2A3U A;  2ZQ9 A;  4IED A;  5EE8 A;  5BOH A;  1CEG A;  4O7D A;  4DE2 A;  1ERQ A;  2P9V A;  4N9L A;  4R4S A;  1IKG A;  4ID4 A;  4C3Q A;  1PWC A;  3M6H A;  1WE4 A;  3G34 A;  2P9V B;  5U47 A;  1KVM A;  4MEZ A;  5EPH A;  5GHY A;  4XXR A;  4C6Y A;  3S4X A;  2Q9N A;  1K4F A;  2XFT A;  3Q82 A;  3ZNT A;  4WYY A;  1SKF A;  4U0T A;  4LV1 A;  4OOY A;  3HL9 A;  4S2N A;  3VSK A;  3ZVW A;  5DTS A;  1BLH A;  3VP1 A;  5F1F A;  5CEC A;  1L0E A;  1O07 A;  3NCK A;  1BTL A;  1EI5 A;  1NY0 A;  3C7U A;  2Y4A A;  4QY6 A;  3Q7V B;  5IHV A;  5CGW A;  1FCM A;  3SS3 A;  2XFS A;  5FQQ A;  4S2P A;  5E43 A;  4B4X A;  1BUL A;  3OCN A;  2JBF A;  1ONH A;  2UWX A;  2I72 A;  3IXG A;  2ZC6 B;  4X68 A;  5FAT A;  3WWX A;  3ZG0 A;  3EQV A;  5CXW A;  3GV9 A;  4KQQ A;  3G2Z A;  4LV0 A;  3FYZ A;  2WKH A;  1SCW A;  3O88 A;  1YLZ A;  5KZH A;  2WAF A;  1K56 A;  3W4O A;  4OLD A;  4EBN A;  4DKI A;  1YLJ A;  2Y2G A;  5GHX A;  1RP5 A;  3GSG A;  1ESI A;  1K56 D;  1YQS A;  4KQR A;  5CTM A;  2ZLY A;  1CI8 A;  1CI9 A;  3N6I A;  3GRJ A;  1K55 C;  3WRZ A;  4R3J A;  2XGN A;  1ALQ A;  1HD8 A;  5CGS A;  3WS4 A;  2WK0 A;  1IYP A;  3BFC A;  1K25 A;  4E6W A;  3BRM A;  4E3N A;  3QNC A;  3VOY A;  4E3O A;  3OPH A;  5EUA A;  1NYM A;  1KDW A;  4GD8 A;  3ITA A;  2Z2L B;  3IF6 A;  4P85 A;  3PBR A;  3NY4 A;  3N8S A;  3UN7 A;  3HVF A;  3ZDJ A;  3LY3 A;  3OPL A;  4GKU A;  4QB8 A;  1Q2P A;  2ZQ8 A;  3A3E A;  3IF6 B;  3IXD A;  4N1H A;  4R3B A;  1I2W A;  1RCJ A;  4RYE A;  3UPP A;  1GHI A;  3UPO A;  2ZJ9 A;  3O87 A;  4FD8 A;  3PBS A;  2A49 A;  4JBF A;  3PAG A;  2JC7 A;  1YMS A;  2WZX A;  4K91 A;  3AGE A;  5CED A;  3HLF A;  2XD1 A;  2ZM0 A;  4HBT A;  5FAQ A;  4LCL A;  4OP5 A;  1XA1 A;  1K4E A;  3PBT A;  3Q1F A;  1MWS A;  2WGW B;  3W8K A;  1MBL A;  5TFQ A;  4FSF A;  2Y55 A;  5CGX A;  3ITB A;  4LEN A;  5JYO A;  4QHC A;  1NRF A;  5FQJ A;  4E3J A;  2ZQ7 A;  1VQQ A;  3HBR A;  1L0F A;  3OPP A;  4YFM A;  5E2E A;  1WYC A;  1FCN A;  3RJU A;  3WS0 A;  1YMX A;  2H0T A;  4DE0 A;  4PM6 A;  3MXR A;  1E4D A;  1BLS A;  4E3K A;  3LO7 A;  2EFX A;  4WZ4 A;  3O3V A;  3ZG8 B;  4OQH A;  4JF4 A;  2PU4 A;  4WEL A;  1BSG A;  4KEN B;  3ZFZ A;  4E3L A;  2J9P A;  4S2L A;  5DF7 A;  1NXY A;  2P74 A;  2H10 A;  3MKF A;  1SDN A;  3NI9 A;  4PM9 A;  1HTZ A;  4KZ6 A;  1MWU A;  1MWR A;  1XKZ A;  1IKI A;  2FFF B;  1I5Q A;  3GTC A;  1KGG A;  3GMW A;  1Z6F A;  3UY6 A;  1NZO A;  2XQZ A;  1IEM A;  1XPB A;  4R4R A;  4DRT A;  1DJB A;  1XP4 A;  1E25 A;  2EXB A;  2WKI A;  4QD4 A;  4LCM A;  5HAQ A;  1XGI A;  3ZGA B;  4U0X A;  5F1G A;  1FSY A;  3G2Y A;  3IWI A;  3UPN A;  2J8Y A;  4GDB A;  5DTT A;  4E6X A;  3ZG7 B;  1G6A A;  3FKV A;  4ZJ3 A;  3DWZ A;  3AGD A;  4X53 A;  5FQI A;  4OPZ A;  3ZHH A;  1H5X A;  3G32 A;  3BFG A;  2XDM A;  3SH8 A;  1QME A;  2V1Z A;  2Y2I A;  5DTK A;  3A3D A;  2EFU A;  3LCE A;  4UHU A;  1JTG A;  4KZ8 A;  1RGY A;  1SHV A;  3UNW A;  5J8X A;  5FQ9 A;  2Y91 A;  1W8Q A;  4D2O A;  4GN2 A;  3PBQ A;  2OSU A;  4Y7P A;  3WS1 A;  3A3F A;  3CZD A;  3UDI A;  3HLE A;  3HLB A;  3IH9 A;  4R0Q A;  3HLW A;  5AQA A;  3V50 A;  5F83 A;  1H8Z A;  4KZ7 A;  4MBH A;  2OLV A;  4A5R A;  2XLN A;  2IWC A;  5D3O A;  4R23 A;  4KQO A;  4WM9 A;  4FH2 A;  4LV2 A;  2HDQ A;  2WZZ A;  5AQB A;  3VFF A;  5FI7 A;  1PWD A;  5HAR A;  2RL3 A;  4ZBE A;  2Y2H A;  5HX9 A;  3NBL A;  4ZJ1 A;  2FFY A;  3NC8 A;  3MBZ A;  3SS4 A;  4IVI A;  3WS5 A;  4GNU A;  3O86 A;  3SOI A;  2BLS A;  3I7J A;  3IHB A;  1IYO A;  2G2U A;  1ZKJ A;  4JXG A;  5EVL A;  1C3B A;  5HAI A;  4N92 A;  3RXX A;  4CPK A;  1KDS A;  1JWZ A;  3BEC A;  4OON A;  1XX2 A;  3BM6 A;  4MBF A;  1J9M A;  3FKW A;  5FAS A;  1E3U A;  4OP8 A;  1NYY A;  2EX9 A;  4P6B A;  2ZC3 B;  5DF8 A;  1E3U D;  5FI6 A;  1K55 A;  2XD5 A;  3DW0 A;  3B3X A;  1YLW A;  1BLP A;  3LY4 A;  4JLF A;  1MKI A;  5GLD A;  3UDX A;  3PAE A;  4BD0 A;  4P0M A;  2ZM2 A;  1ONG A;  1HZO A;  3V3S A;  3BLS A;  3GR2 A;  3HUM A;  4JPM A;  4F94 A;  5DVA A;  4DXB A;  3HLC A;  4XUZ A;  2OLU A;  1PWG A;  3IXB A;  2RCX A;  4Y0O A;  5KMW A;  3IH8 A;  1TDG A;  4Q8I A;  5G18 A;  4CJN A;  3PBO A;  3W4Q A;  2EX8 A;  3A3J A;  3V39 A;  1WYB A;  3C4O A;  3HLG A;  3SH7 A;  3C7V A;  3OCL A;  4OOL A;  4KG5 A;  4OVD A;  1KGE A;  5EVI C;  1QMF A;  3QHY A;  4WEJ A;  1MWT A;  2IWB A;  4UA9 A;  4NK3 A;  1JWV A;  5EVI A;  5FA7 A;  3W4P A;  4C75 A;  3VP3 A;  2PU2 A;  2GDN A;  1W7F A;  3IQA A;  4P87 A;  5EVI D;  1XA7 A;  4KZ5 A;  4BL2 A;  2OV5 A;  2VGJ A;  4KZB A;  4EBL A;  3BFD A;  1PZP A;  4OPY A;  4ZDX A;  3ZG9 B;  3VFH A;  1K6R A;  4KZ3 A;  2Q9M A;  4WEK A;  4EWF A;  3HUN A;  1ZC2 A;  3D4F A;  3E2K A;  2XR0 A;  3NDG A;  2PBY A;  4GDN A;  2G2W A;  2WAD A;  2IWD A;  3UE1 A;  1FR1 A;  1ERO A;  4BD1 A;  3BFF A;  4PM8 A;  2QPN A;  1LL9 A;  3ISG A;  4DE3 A;  1H8Y A;  4JXS A;  2HDU A;  2WUQ A;  3QNB A;  3BFE A;  4QY5 A;  1VM1 A;  2H0Y A;  4EQI A;  1L0G A;  3MZF A;  3CG5 A;  1AXB A;  2B5R A;  2V2F F;  4KZA A;  1GCE A;  3OZH A;  4JF5 A;  2V20 A;  4S2I A;  4X56 A;  2ZC7 A;  2WGI A;  5FDH A;  4KG2 A;  2HP9 A;  4HES A;  4X69 A;  4OLG A;  5A91 A;  3G35 A;  1GHM A;  2ZC4 B;  3BLM A;  4E3I A;  4S2J A;  5HAP A;  4H8R A;  1K54 C;  4LV3 A;  2ZQC A;  1BT5 A;  4DDS A;  3HUO A;  5HFO A;  1HVB A;  2HDS A;  4Y0T A;  4IVK A;  1IYS A;  3IXH A;  4RVA A;  1DJA A;  3G31 A;  3TG9 A;  2QMI A;  3ZG5 A;  3IT9 A;  1ZG6 A;  2X71 A;  5FAP A;  1IYQ A;  3TSG A;  4UAA A;  3FZC A;  1GA9 A;  2C5W B;  3S1Y A;  3PTE A;  4GOG A;  1N9B A;  1EWZ A;  3MZD A;  3VOZ A;  1DY6 A;  1LHY A;  4K0X A;  2J9O A;  3WS2 A;  1FQG A;  4DDY A;  1U60 A;  3E2L A;  1Y54 A;  1BZA A;  3CMZ A;  5L2F A;  4QU3 A;  1CK3 A;  5HL1 A;  5EOE A;  1L2S A;  4BLM A;  3IWO A;  4DXC A;  4KZ4 A;  1ES3 A;  2EXA A;  1G68 A;  4WZ5 C;  3WRT A;  1XXM A;  3G4P A;  4XUX A;  4WZ5 A;  2HP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...