4X69A

Crystal structure of op0595 complexed with ctx-m-44
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase Toho-1
publication title OP0595, a new diazabicyclooctane: mode of action as a serine beta-lactamase inhibitor, antibiotic and beta-lactam 'enhancer'
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x69A00
1GA0A 3O3VA 5GL9A 4MLLA 4E6XA 1PZPA 3A3JA 5KMWA 4E3MA 4FCFA 1K54A 2X02A 3SOIA 4OOYA 1YLWA 1MPLA 2VGJA 4C75A 1FQGA 2WKIA 1BT5A 3HLEA 1BLHA 3QHYA 5EVLA 3VFFA 3MZDA 3ZG0A 4FH2A 5E43A 4P6BA 4N92A 2H5SA 1PWDA 1C3BA 2Z2LB 3GTCA 3UDIA 1Q2QA 3TOIA 2XFTA 2H0TA 2J8YA 3PAEA 4GD6A 2JBFA 2Y4AA 4PMAA 1CK3A 3BFGA 5EUAA 3M2KA 4X6TA 5GLDA 2V1ZA 1SDEA 4BENA 1MWSA 5CHMA 4D2OA 4Y0UA 2A3UA 3CMZA 1RCJA 2P74A 1NZUA 1AXBA 3UE3A 1K38A 3HLBA 1NYMA 4ZDXA 5FQQA 1XPBA 2QZ6A 4HBTA 3ZG9B 5A91A 4E3OA 1I2WA 2P9VA 5D3OA 4IVIA 4Y0OA 4BD0A 1ZC2A 3MXSA 4FD8A 3C4OA 3G30A 4BQMA 1E25A 4GNUA 3ZVWA 3Q07A 4HESA 5HX9A 3NI9A 4X55A 2V20A 1S0WA 4QJGA 3UDXA 1YLYA 2ZM0A 5E2HA 4RYEA 2ZM2A 3OZHA 4R3BA 3Q7ZA 4NK3A 1W7FA 2XEPA 4ZAMA 3FKVA 2EFUA 3IHBA 3WS1A 5E2EA 5HW3A 5FASA 3ZHHA 3ISGA 3W4QA 4WZ5A 1SKFA 2HP9A 3LO7A 1I2SA 3E2KA 5KSCA 3V50A 1BUEA 3VP2A 3VMAA 5AQ7A 1XGIA 1GHPA 4JF4A 4PPRA 2A49A 1LL5A 2EXAA 2XDMA 3C7UA 2QPNA 2ZQ8A 4OPRA 3ZGAB 3HLFA 5HARA 3GQZA 4C3QA 2J9OA 1DJAA 3IHAA 2ZQ9A 1ONGA 4FH4A 4LCLA 3A3IA 3AGEA 4LV1A 5DF8A 5CEDA 4KG2A 1YLZA 3UDFA 1KE3A 3N8LA 3N8RA 1FSWA 4Y7PA 3VSKA 3WS0A 4JKTA 1YMXA 5CHJA 4S2OA 4GD8A 4UAAA 1MY8A 1JTGA 4JPMA 5FQJA 4UHUA 2EX9A 1H5XA 1XA7A 2FFYA 4WELA 1M40A 4QB8A 4UA9A 1L0EA 4L0LA 1FOFA 5FATA 4M3KA 1KGGA 1JTDA 1K57C 1WYBA 4JXSA 2EX2A 2XF3A 1G6AA 1O07A 5M19A 5JYOA 3AGDA 1FR6A 1KDWA 3SS3A 2XQZA 2Y2KA 4KZ5A 3DWKA 4DE0A 1L0FA 4KG6A 1NXYA 3ZNTA 4DDYA 1ES4A 4JXVA 4R1GA 3HLGA 5HAPA 1KVLA 1K57A 5EECA 4EQIA 1ESUA 5GLBA 4S2KA 3I7JA 1ONHA 3PBNA 2WGWA 4KZ7A 3P98A 1VQQA 4LV3A 4OQ0A 3SS4A 3WS2A 3IXDA 1LL9A 2ZQAA 2B5RA 3S1YA 4E3NA 3TSGA 5HFOA 1H8ZA 3UO9A 1XA1A 3C7VA 2IWBA 1DJCA 4H8RA 3OCLA 1MKIA 5AQ9A 1FCMA 5FA7A 2HDRA 3ZCZA 4WZ4A 2ZMAA 3W4OA 4C6YA 2WUQA 2XK1A 4XXRA 3EQVA 1LI9A 4X56A 4Q8IA 2Y2GA 4HEFA 3WS5A 5EVIA 5FAOA 1TDGA 3Q81A 4R3JA 1RGYA 5HL1A 1FR1A 4EBPA 3GV9A 5CECA 3VOZA 4BJPA 4P87A 1L0GA 2X01A 1IEMA 4DXCA 1S6RA 5FAQA 3UPPA 3MFDA 4GDNA 1PW8A 1XGJA 3VSLA 2Y2QA 3AGFA 2BLSA 3ZG5A 4EUZA 3HREA 3IXGA 2WZXA 1BZAA 2FFFB 2RL3A 2WADA 3NY4A 4KZ8A 1K56D 1YLTA 1QMFA 4O7DA 3CJMA 1KVMA 4MNRA 1O7EA 4WMCA 3A3EA 3IF6B 3N7WA 1BULA 4X69A 1W5DA 4R0QA 3W4PA 2XH9A 3IWIA 2ZD8A 1HD8A 3FV7A 2Y2PA 1OMEA 4LENA 2CC1A 4MEZA 5GHXA 1PWCA 1RP5A 3PBSA 4B88A 3MZEA 4N1HA 3FWLA 4WM9A 3S22A 3GRJA 3Q1FA 4U0XA 4QHCA 4LCMA 2XD1A 5E2GA 2C6WB 1RGZA 4JF6A 3V39A 3G2ZA 1ALQA 4RX3A 3B3XA 3HVFA 2OLVA 3ZNYA 2Y55A 1KE0A 4LV2A 3HL9A 5CEBA 2R9XA 3O88A 4DE3A 1EI5A 1IYPA 4GKUA 5A90A 1IELA 3BFEA 1NYYA 5FQ9A 1H8YA 4CPKA 1N9BA 1L2SA 4KQOA 3G4PA 4DXBA 4DE1A 1IKGA 4QY6A 5F1GA 2EX8A 1GHMA 1ES5A 5GLAA 1DJBA 1CEFA 1FSYA 5FQMA 2OSUA 3UNWA 2G2UA 3BYDA 1SCWA 5FI6A 3PBQA 1DY6A 2WAEA 3IXBA 1L0DA 4LV0A 3UY6A 5HAQA 1W8QA 5TGFA 3V5MA 3VP0A 3D4FA 4S2IA 2Y2MA 2DNSA 3ZG8B 5A92A 3UPNA 2ZQCA 3Q82A 1K4FA 4K0WA 4IVKA 3SH9A 2HP5A 5CRFA 4OVDA 3VP3A 3OPHA 3G32A 4KZ4A 5EOEA 1GA9A 1HTZA 5F82A 4E3KA 2WZZA 2HPBA 2XD5A 5U47A 4EWFA 1VM1A 1E3UD 4GDBA 1LLBA 4K0XA 1PZOA 3NDGA 1GCEA 3NIAA 3QNCA 4BLMA 1FCNA 5EE8A 1KGFA 3SH8A 3N6IA 3LY4A 2RCXA 3V3RA 4KZAA 2JCHA 4ZJ1A 3PBTA 1YMSA 4GZBA 4E3IA 1J9MA 4Y0TA 1LI0A 3IH9A 5HAIA 2EFXA 4PM7A 1E4DA 2ZC6B 1ERQA 1XX2A 3O86A 4KZBA 4OP5A 3UE1A 4EV4A 3IF5A 1HZOA 3NCKA 1TVFA 3FYZA 3DTMA 2Y2LA 4OPYA 4ZBEA 3PTEA 1ZKJA 2HP6A 1TDLA 4DKIA 3G31A 4UA7A 2WGIA 3WS4A 1G68A 2ZC7A 2ZQDA 1LHYA 2IWCA 2XGNA 5M1AA 3WRZA 4GN2A 1JWPA 1NRFA 1W8YA 3V3SA 4DE2A 2Q9NA 1YLJA 3OPRA 4MBKA 4S2NC 4P85A 4PM6A 4F94A 4JLFA 4BD1A 4XUXA 2R9WA 4JF5A 4KG5A 1W79A 3HUNA 3O87A 3HLDA 1PI4A 4S2NA 4ZJ2A 3BFFA 2VGKA 1SHVA 5DVAA 3JYIA 1BLCA 5I94A 3A3FA 5DF7A 2V2FF 2WAFA 5EOOA 5JYPA 5FSRA 3VP4A 2C5WB 3MKEA 1BTLA 3M6HA 1YM1A 4RX2A 4UA6A 5TR7A 2H10A 4OONA 4KQRA 3ZG7B 5KSHA 1WE4A 2DCFA 4HBUA 4B4XA 5BOHA 3GSGA 4ZJ3A 1XXMA 4OOLA 3BLSA 4RVAA 4OOMA 1ERMA 4S2JA 1IKIA 5GLCA 1GHIA 4JBFA 2Y2JA 2P9VB 2XLNA 4IEDA 4X68A 3NBLA 3S4XA 1JWVA 3P09A 4N1XA 3RXXA 2ZC3B 1IYOA 3BLMA 4E3JA 4U3TA 5GHYA 3HUOA 3RXWA 1ESIA 1XP4A 1JVJA 1FCOA 3NC8A 5DF9A 1WYCA 4MBHA 2JE5A 1K6SA 3EQUA 3GMWA 2XFSA 4NETA 3ZVTA 1TEMA 5CGSA 3VOYA 1BLPA 4KQQA 4OQHA 3IT9A 1MWUA 1K4EA 1PYYA 5AQBA 2ZC5B 5CTNA 5DTKA 4B4ZA 5F83A 5IHVA 5FQIA 3HLWA 2ZM8A 1YQSA 4OLDA 3FKWA 3IF6C 3RJUA 3SH7A 3VFHA 4YFMA 2WKEA 5CGWA 3IXHA 4DF6A 4BL2A 2Y59A 4QU3A 1Z6FA 3HLCA 2J7VA 3IF6A 2WGVA 3UPOA 2OLUA 4OP8A 1U60A 2X71A 3BM6A 3ZFZA 2GDNA 4R4SA 3HUMA 3C4PA 5CTMA 1YLPA 3QNBA 2BG1A 4GOGA 3MKFA 4K91A 4N9LA 1CEGA 1JWZA 4U0TA 3BRMA 2E8IA 3M2JA 1MWTA 1YT4A 2IWDA 3OPPA 4E3LA 5A93A 2ZLYA 3BECA 3G34A 5M18A 1ZG4A 2Y2HA 3ITBA 4ZTKA 1BLSA 3MBZA 1K56A 3ZDJA 4FSFA 1HVBA 3C5AA 5TFQA 1IYSA 4DDSA 1KE4A 4OQIA 1EWZA 4OLGA 2JC7A 4WZ5C 3CG5A 3MZFA 1I5QA 3BFCA 2Y2NA 5J8XA 2HDSA 3IQAA 3N4IA 5CERA 2EX6A 2DRWA 4IBRA 3GR2A 1Q2PA 1NY0A 1K55C 3BFDA 5DTTA 5FI7A 2I72A 4PM9A 4YINA 2Y91A 2HDQA 3MXRA 3IH8A 4OQGA 2PU4A 2WGWB 4QD4A 3HBRA 1K55A 3ITAA 1BSGA 3LY3A 3N8SA 3WRTA 5GHZA 4OKPA 1MBLA 2Y2IA 5EVID 4JXGA 4OPQA 4IBXA 1CI8A 3OPLA 4KENB 1M6KA 5CXWA 4OH0A 5E2FA 1MWRA 4EBNA 5L2FA 1KDSA 2WYXA 3PBOA 2Q9MA 4WEJA 2HDUA 4ID4A 4BL3A 1ES3A 4OPZA 1PI5A 3VP1A 2UWXA 4P0MA 5FI2A 4PM8A 5FQKA 4KZ9A 1XKZA 3W8KA 1SDNA 5EVIB 4WEKA 3DWZA 4R23A 3Q7VB 2ZC4B 2H0YA 1ZG6A 2ZQ7A 5FDHA 5AQAA 3IWQA 4RA7A 4S2PA 4EBLA 2ZJ9A 4X53A 2QMIA 3OC2A 4WMCD 2EXBA 4KZ6A 4CJNA 1QMEA 1EROA 1MXOA 3DW0A 2OV5A 2WKHA 4Z9QA 4KZ3A 4A5RA 2PBYA 1Y54A 3GVBA 1PW1A 4WBGA 3WWXA 1N4OA 1PWGA 2Z2MB 2Y2OA 1ES2A 4GB7A 5KZHA 3SS5A 3PAGA 4PM5A 3G2YA 4JXWA 4E6WA 1NZOA 3A3DA 3NDEA 5CGXA 5EPHA 2PU2A 5FAPA 2WK0A 3TG9A 3FZCA 5CHUA 4QY5A 4S2MA 3OCNA 4MBFA 2XR0A 3UN7A 1CI9A 4XUZA 5F1FA 2G2WA 4R4RA 1K25A 1IYQA 3LEZA 3LCEA 3PBRA 5EVIC 1KGEA 3UE0A 3G35A 1E3UA 2J9PA 4WYYA 5DTSA 3CZDA 3M6BA 1K6RA 3BEBA 4DRTA 1NJ4A 1PIOA 1K54C 3Q7VA 4N9KA 5G18A 4S2LA 3IWOA 3E2LA
chains in the Genus database with same CATH superfamily
3VOLA 5GL9A 1PZPA 2VGJA 1FQGA 1BT5A 1BLHA 4I39A 2VGLS 3MZDA 3PR6A 3BY9A 2H5SA 4Y17A 3OOVA 3QP2A 3PAEA 1XJ3A 2V1ZA 4KUKA 4Y0UA 2A3UA 2A24B 2L0WA 2P74A 1NZUA 1K38A 1IFQA 3ZG9B 2P9VA 4IVIA 3LIBA 3BWLA 3CLOA 4WUJA 4BQMA 3W2ZA 4GNUA 3ZVWA 3UE6A 4HESA 2XRNA 4WL9A 2VZWA 1W7FA 4ZAMA 2EFUA 5E2EA 1ACFA 4X1MA 5FASA 3W4QA 1SKFA 3LO7A 3E2KA 4O01A 1LL8A 3VP2A 4HI4A 3VMAA 4CQHA 2A49A 1SKOA 4OPRA 3ZGAB 4Y3IA 4C3QA 4LV1A 1ONGA 3UDFA 3G6OA 3GDIA 3VSKA 3NHQA 4JPMA 1NLYA 5FQJA 3T4QA 4UHUA 2J3TD 1D7EA 4F3LB 1XA7A 3C2WA 4EQ1A 4L0LA 4M3KA 1WYBA 5M19A 5HDCA 1FR6A 2PAVP 1TS8A 1G5UA 3DWKA 3B42A 4JXVA 5J4EA 3F1NA 1K57A 5EECA 4I5SA 4KUOA 3S7NA 4S2KA 2P7JA 1VQQA 3SS4A 4OQ0A 2ZQAA 3S1YA 1H8ZA 3UO9A 3C7VA 4LPZA 1DJCA 1FCMA 5FA7A 2HDRA 3CWFA 3A0SA 4GS9A 5EVIA 5FAOA 1TDGA 1RGYA 1FR1A 2W3DA 3NULA 5FAQA 3KO6A 3MMHA 2RL3A 1EW0A 1H0MA 4EESA 1KVMA 3N7WA 5TJJA 4MEZA 4B88A 1S4RA 3TE8A 1ODVA 3FWLA 1ZTUA 5E2GA 2C6WB 1XFNA 3V39A 3G2ZA 3B3XA 2D02A 4WN5A 3T1XA 4GKUA 1IELA 3BFEA 3D72A 2W1RA 4CPKA 4GHIA 3U4LP 4DE1A 2EX8A 1ES5A 5GLAA 3MQOA 2L4RA 1DY6A 3IXBA 5HAQA 5TGFA 3V5MA 4S2IA 2JHEA 4RQ9A 4QPRA 3ZG8B 3UPNA 3Q82A 1K4FA 3C30A 4K0WA 4IVKA 5CRFA 3MFXA 5IS1A 1L3LA 5F82A 2XD5A 5J3WA 4EWFA 1PZOA 5EFWA 1GCEA 3NIAA 1DP6A 2VA0A 1KGFA 3VV4A 2RCXA 4KZAA 2FZ0A 1D1JA 4GZBA 4E3IA 4Y0TA 1LI0A 3IH9A 5HAIA 3O86A 3IF5A 3NCKA 1TS6A 4OPYA 3PTEA 4DKIA 4UA7A 1OJ5A 2ZC7A 2ZQDA 1LHYA 5M1AA 2B18A 2Y8HA 3KSGA 4S2NC 4JLFA 4BD1A 4JF5A 1W79A 3TJZC 2J3TC 2W3FA 2VGKA 3RTYA 1GSXA 2V2FF 3IX4A 5HD5A 4E04A 3HJKA 4Y5FA 3VP4A 2V1BA 3M6HA 1YM1A 4UA6A 3B33A 5KSHA 3GSGA 4ZJ3A 4OOLA 3B47A 1HLUP 3T12B 2Y2JA 4IEDA 3C38A 3P09A 2QYBA 4N1XA 2ZC3B 1IYOA 3BLMA 4E3JA 5GHYA 2MJ6A 1ESIA 4MMNA 5DF9A 4I38A 2HGVA 2JE5A 4ARZA 1AWIA 2KLIA 5HPIA 5AQBA 5FQIA 4NXBA 3DTEA 3VFHA 2WKEA 5CGWA 3V67A 3IXHA 1S66L 4DF6A 1Z6FA 1P9RA 3IX3A 4OP8A 1U60A 2X71A 3BM6A 3ZFZA 3HUMA 5CTMA 1YLPA 4N9LA 1JWZA 1MWTA 2I9VA 3GECA 5A93A 3E98A 3ZDJA 5TFQA 3C5AA 1KE4A 4OLGA 1I5QA 5J8XA 3LIEA 3IQAA 5CERA 2DRWA 2O9CA 3LUQA 4YINA 2Y91A 2HDQA 1LT0A 4HJ6A 4OQGA 4R3AA 3HBRA 3ITAA 4DJ2A 1MBLA 2Y2IA 1CI8A 4OH0A 5E2FA 1MWRA 1KDSA 4BWIA 1OTAA 4OPZA 4EUVA 4P0MA 2XROA 5I5LA 2PR5A 5EM0A 2ZC4B 2H0YA 2YKFA 1ZG6A 2P04A 2ZQ7A 4S2PA 4HQAA 3LI8A 3LIAA 4EBLA 4WMCD 3R4KA 4II7A 4GB7A 5FEGA 2Y2OA 1ES2A 5KZHA 1TS7A 3SS5A 3G2YA 1NZOA 2HZ5A 5CGXA 5FAPA 2PU2A 2WK0A 3TG9A 3FZCA 1Y4OA 4S2MA 5AJGA 2XR0A 5G4YA 2PRFA 2G2WA 3LEZA 3UE0A 3G35A 1E3UA 4CLCD 4M4XA 2J9PA 1YPRA 2A2LA 3M6BA 1K54C 4UQIM 5G18A 3F1OB 3LR5A 2OAQ1 1GA0A 3F1PB 3IX8A 4MLLA 3T4OA 1DP9A 4ETZA 1MKMA 3SOIA 4OOYA 4C75A 1N9LA 3MJQA 3ZG0A 4P6BA 2ZMVA 4LGWA 1PWDA 2KOIA 1C3BA 2GX5A 1Q2QA 3H82B 2XFTA 4LLOB 2H0TA 2QWSA 5HPFA 4PMAA 1CK3A 5EUAA 2M7VA 4WF0A 1SDEA 5F5YA 1NYMA 3F1OA 4HBTA 3F1PA 5A91A 1I2WA 4BD0A 3MXSA 3C4OA 3CI6A 1E25A 1MC0A 3LR3A 2V20A 3JVUA 3UDXA 2W3HA 2OWJA 4NK3A 1XFQA 2JKGA 3EGDC 1J3WA 3WS1A 4QWOA 3H82A 2HP9A 2NUPC 5AQ7A 4JF4A 1G28A 1LL5A 3C7UA 2QPNA 1Z09A 2Q0OA 2JKRI 1DJAA 5DF8A 4KG2A 1KE3A 3N8LA 1FILA 4JKTA 1YMXA 4PKYA 4L9GA 1MY8A 1JTGA 5DKLA 1M40A 4QB8A 4EXOA 1L0EA 1FOFA 5FATA 4LFUA 1KGGA 1JTDA 2LB9A 2G7UA 2EX2A 1G6AA 4LRZE 3AGDA 1NWZA 2Y2KA 4O0PA 3ZNTA 4AFIA 3HLGA 1KVLA 4EQIA 2BTFP 5GLBA 4B9OA 1ONHA 3PBNA 2WGWA 5HL6A 4R38A 3IXDA 2CMNA 1LL9A 1XA1A 2ZBBA 2W27A 3PHYA 1MKIA 5AQ9A 3R7WA 3ZCZA 4D60A 4EEPA 2ZMFA 4Z1WA 4XXRA 4Q8IA 3Q81A 3IBJA 5CECA 4P87A 5AVEA 1IEMA 4DXCA 1S6RA 3T1SA 3QP5A 3MFDA 4GDNA 3D9YA 1TD5A 4Q0HA 4EUZA 3E4OA 2OAP1 3NY4A 2FFFB 1MZUA 4KZ8A 5HWTA 4O8GA 1K56D 4O7DA 3CJMA 3CPTB 2VGLM 3IF6B 1NLZA 2XH9A 2V0WA 2Y2PA 3PYPA 3VE4A 4GLQA 1PWCA 2W1TB 4CLCC 3S22A 3Q1FA 4U0XA 4QHCA 5J7EA 4LCMA 5EVEA 1LSVA 2Y55A 1KE0A 4G3KA 3BY8A 3HL9A 2JKFA 5FL3A 4BBTA 3CPTA 1NYYA 1H8YA 2VEAA 3H7WB 3UB7A 4NXEA 4QY6A 5HSQA 1DJBA 1V9ZA 5FQMA 2J80A 2OSUA 2A24A 3UNWA 2VV7A 1L0DA 2O99A 2K7SA 3UY6A 2WKQA 4JGPA 2DNSA 5A92A 5MC7A 4Y2FA 3MQQA 3LIFA 2HP5A 3VP3A 4KZ4A 1GA9A 2K31A 1VM1A 4K0XA 1LLBA 3DAVA 3CUEC 5CX7A 1FCNA 4G3VA 3H7WA 2JCHA 1J9MA 2EFXA 4PM7A 1E4DA 5G4ZA 1XX2A 3UE1A 4Y15A 2HP6A 3WS4A 2WGIA 2IWCA 3KYZA 4GN2A 2FH5A 4F3LA 5AVFA 1G6OA 3UB5P 5F6AA 4GCZA 3HUNA 4S2NA 1SHVA 2VKSA 5I94A 1NRJA 1GSWA 5DF7A 3HCYA 2WAFA 5JYPA 2C5WB 4RX2A 4OONA 4KQRA 3ZG7B 3KYEA 3PXPA 4HBUA 5BOHA 1XXMA 4RVAA 5DFXA 3NOUC 4OOMA 4S2JA 1F9IA 2QKPA 4BBUA 3EWKA 5HZHA 1UWNX 3K3DA 4X68A 1JWVA 3NJAA 2P08A 3HUOA 3RXWA 1FCOA 3LR4A 4MBHA 1PNEA 3EQUA 2GNXA 1BLPA 4KQQA 4OQHA 4HP9A 1MWUA 1K4EA 5DTKA 2GZAA 3HLWA 3IF6C 5L09A 3RJUA 3SH7A 2Y59A 1CF0A 3QP4A 2PHYA 2WGVA 2GDNA 3QNBA 2BG1A 4U0TA 3KSHA 3MKFA 3ZG5A 2B02A 3M2JA 2LB5A 2Y2HA 4ZTKA 3IS2B 1HVBA 1IYSA 4OQIA 2W0NA 1EWZA 5FDSA 2HDSA 4G3WA 4IBRA 3GR2A 3MXQA 2IA2A 1F98A 1BSGA 5HDSA 3WRTA 5GHZA 4HJ3A 4IBXA 2DMWA 1M6KA 5L2FA 2ZOHA 3PBOA 4HNBA 4WEJA 4B93A 4ID4A 4BL3A 1ES3A 3VP1A 3IS2A 4PM8A 3DTKA 5FQKA 3T4SA 3Q7VB 3RH8B 1P0ZA 2EXBA 1QMEA 1EROA 2OV5A 3L9KA 4A5RA 4WBGA 2VJWA 2Z2MB 4PM5A 4JXWA 3VE3A 3NDEA 2INWA 1CI9A 5EVIC 1KGEA 2Z6DA 4WYYA 5DTSA 3CZDA 1PIOA 3Q7VA 4ZJ1A 3IWOA 5HD3A 3O3VA 5KMWA 4E6XA 1YSQA 2Z6CA 4FCFA 4DMZA 4ESPA 1K54A 3UB9A 1YLWA 1MPLA 3QHYA 5EVLA 3VFFA 3FPVA 1GSVA 4N92A 4FUWA 1OJGA 3TOIA 4GD6A 2JBFA 3BFGA 3M2KA 5GLDA 4BENA 5CHMA 3CMZA 1ZHHB 3UE3A 3HLBA 2L1MA 4ZDXA 5HDDA 5FQQA 4HHDA 2QZ6A 2K2NA 4E3OA 5D3OA 3S7QA 2V9AA 1OTEA 3Q07A 1IOUA 3NI9A 1S0WA 4RYEA 2ZM2A 3OZHA 4FTXA 4R3BA 3EGXC 3T50A 4EETB 4NXFA 5HW3A 3S7PA 3FKVA 3ISGA 4WZ5A 1I2SA 3V50A 2VLGA 4IUHA 4PPRA 3ZQ5A 1UWPX 5L10A 2J9OA 4FH4A 3IHAA 2ZQ9A 3DBAA 3A3IA 5CEDA 1YLZA 3WS0A 4Y7PA 5CHJA 4S2OA 3MR0A 3KX0X 2EA9A 1H5XA 2FFYA 2HJ9C 3UMEA 4JXSA 5LBRA 2XF3A 1KDWA 3SS3A 2XQZA 4KG6A 1NXYA 4DDYA 4R1GA 3FG8A 3UB8A 4LV3A 2PDRA 4MCWA 4BBVA 2B5RA 4E3NA 3E4QA 3OCLA 4WZ4A 2EWWA 3W4OA 4C6YA 2WUQA 3BJNA 4LRYC 1LI9A 4X56A 4HEFA 3WS5A 2R78A 1H3QA 5A8BA 4R3JA 5HL1A 4EBPA 3VOZA 4YWZA 2D01A 2XA7S 3UPPA 3ZYTA 4CLCB 3MQ0A 1PW8A 1XGJA 5HWWA 3HREA 3IXGA 2WZXA 2WADA 3QP8A 3FPWA 1YLTA 2PT7A 1O7EA 4WMCA 3A3EA 1BULA 1S67L 2PBDP 3W4PA 3IWIA 3FV7A 1OMEA 4LENA 1W63Q 2CC1A 5L07A 3S7OA 1RP5A 4DJ3A 4N1HA 2PD7A 2NUTC 1S1ZA 2XD1A 3LI9A 4CLCA 1ALQA 4RX3A 3HVFA 2OLVA 5K5BA 3O88A 1EI5A 1IYPA 4GJ4A 3KYQA 4P6ZS 2XSSA 4JGOA 4DXBA 1IKGA 5F1GA 1CEFA 2W3EA 2G2UA 5FI6A 1SCWA 1OT9A 2WAEA 2W3GA 1W8QA 3KSFA 2ACGA 3D4FA 2Y2MA 4L9EA 3BW6A 2ZQCA 3K3CA 3K2NA 1T1AA 3A0VA 2ZOIA 2PD8A 4OVDA 3OPHA 3G32A 5EOEA 1HTZA 4E3KA 3LGOA 5U47A 4BLMA 1T1CA 3N6IA 1XJ6A 3LY4A 3V3RA 3MS6A 2M1CA 1YMSA 3T4TA 2ZC6B 4KZBA 4OP5A 4EV4A 1HZOA 3FYZA 3DTMA 2Y2LA 4H6JB 2UV0E 4ZBEA 5DJUA 4HY8A 3G31A 1G68A 4MDZA 1NRFA 3V3SA 2Q9NA 1YLJA 4P85A 4PM6A 4F94A 4YOFA 2R9WA 1PRQA 3O87A 3HLDA 1PI4A 3OLOA 1T18A 4PAUA 2WKRA 4KQDA 4X1LA 5DVAA 3JYIA 1VETB 3A3FA 1YAXA 5EOOA 3L7HA 5FSRA 3LIDA 1LSWA 3LEQA 1F5MA 3MKEA 3EEAA 5TR7A 3JPUA 4H6JA 3QP1A 4B4XA 3BLSA 2VK3A 1ERMA 1GHIA 2AVXA 4JBFA 2P9VB 2XLNA 1A0KA 3RXXA 4U3TA 2BASA 1XP4A 1WA9A 3ULFA 1WYCA 1K6SA 3UMDA 3GMWA 4NETA 1VETA 1TEMA 4IJGA 3VOYA 4HP4A 3IT9A 1UGUA 2ZC5B 3UB6A 5F83A 5IHVA 2ZM8A 1YQSA 4OLDA 3FKWA 5TBMB 3TRCA 1SKOB 4BL2A 3HLCA 2J7VA 3IF6A 3UPOA 3T1QB 4BMWA 2OLUA 4K91A 1CEGA 1OT6A 1YT4A 2ZL1B 3G34A 3ITBA 4DN0A 5IT5A 1BLSA 1K56A 2W1TA 4MN5A 2JC7A 4HIAA 3BFCA 4HOIA 1TS0A 3N4IA 1Q2PA 1NY0A 1K55C 3F1NB 3SZTA 4EEUA 5DTTA 2I72A 5TBMA 4Y13A 3IH8A 1YKDA 4QD4A 3LICA 3N8SA 3LY3A 3E0YA 1YSPA 5EVID 4Q0JA 4EBNA 2WYXA 2ZL1A 1K0KA 2HDUA 1F2KA 2UWXA 4CLCE 1XKZA 4GS9B 5EVIB 4WEKA 3DWZA 4R23A 2O0YA 2O9AA 4I3IA 4RA7A 2ZJ9A 4ETXA 2QMIA 5DJTA 4CJNA 1STZA 2WKHA 2V1AA 3GVBA 1PW1A 3WWXA 1PWGA 4EU0A 2KX6A 3A3DA 2QHKA 4NEED 1CJFA 4R70A 3OCNA 5F1FA 4R4RA 1K25A 3LCEA 1K6RA 1LSXA 3SW1A 1TF1A 3LR0A 2M7UA 2Y79A 2X01A 4S2LA 3E2LA 2VV8A 3A3JA 4E3MA 3U2AA 2X02A 4MN6A 2WKIA 3HLEA 4FH2A 5E43A 1S1YA 2Z2LB 3GTCA 3UDIA 5KIZA 2J8YA 4MN7A 2J3WA 2Y4AA 3P01A 4GHIB 4HJ4A 4X6TA 1MWSA 4D2OA 1RCJA 1AXBA 4I3JA 1XJ2A 1XPBA 4Y0OA 1ZC2A 4FD8A 3G30A 2VX8A 2E8JA 5HX9A 4X55A 1P97A 4QJGA 1YLYA 2ZM0A 5E2HA 3Q7ZA 1VB6A 3HJIA 2XEPA 1H8MA 3IHBA 4I3AA 4IHQA 3T4JA 3ZHHA 5KSCA 1BUEA 3T4KA 1XGIA 1GHPA 2EXAA 2XDMA 4JGQA 2ZQ8A 1VEUB 3HLFA 5HARA 2PYRA 3GQZA 3QP6A 3CAXA 4LCLA 3AGEA 3N8RA 1FSWA 1T19A 4LRXC 4GD8A 3LFVA 4UAAA 2GJ3A 2EX9A 4WELA 4UA9A 2OWHA 4HH3A 1K57C 4R6LA 1O07A 2B95A 5JYOA 3MF0A 4KZ5A 4DE0A 1L0FA 2HV1A 1ES4A 5HAPA 2V8FA 2PR6A 1ESUA 3T4LA 1OTIA 1S4SA 1VEUA 3I7JA 4KZ7A 3P98A 3WS2A 2EWVA 4EERA 5HFOA 2IWBA 4H8RA 4WLAA 3C8CA 2ZMAA 4FOFA 2XK1A 3EQVA 2Y2GA 2V0UA 3GV9A 4ARZB 2QJ7A 4BJPA 1L0GA 3RFBA 2H28A 3H9WA 4XT2B 3VSLA 2Y2QA 3AGFA 2BLSA 5L8MA 4GW9A 1KOUA 2VV6A 1BZAA 4K08A 1QMFA 3IBRA 4MNRA 1V9YA 2O9BA 5C5KA 4X69A 1W5DA 4R0QA 2ZD8A 3FC7A 1HD8A 1XJ4A 5GHXA 4EW7A 1PFLA 3PBSA 2WKPA 3MZEA 3NOTC 1X0OA 4WM9A 1JNUA 3GRJA 4XT2A 1BYWA 1RGZA 4JF6A 4ZRRA 3ZNYA 4LV2A 5CEBA 2R9XA 4DE3A 5A90A 1OTDA 5FQ9A 1N9NA 3BQ8A 1N9BA 1L2SA 4KQOA 1OTBA 3G4PA 1GHMA 3E4PA 1FSYA 2HF6A 3BYDA 3PBQA 4LV0A 3VP0A 1DP8A 3SH9A 2WZZA 2HPBA 1E3UD 4GDBA 3NDGA 3QNCA 5EE8A 5F68A 3SH8A 1W63M 3PBTA 3KSIA 1ERQA 3D3OA 4NKPA 1TVFA 3EOIA 1ZKJA 1TDLA 1D06A 5HWVA 2XGNA 3WRZA 1JWPA 1FIKA 1W8YA 4DE2A 3OPRA 4MBKA 2JKRM 5DFYA 4L9FA 4XUXA 3O5YA 4KG5A 4ZJ2A 3BFFA 3ICYA 3OBFA 5EV0A 1BLCA 2JKTM 4NXGA 4UQIS 1BTLA 2H10A 1WE4A 2XA7M 2DCFA 3EEHA 2JN7A 1IKIA 5GLCA 1VHMA 3CHWP 3NBLA 3S4XA 5DKKA 1JVJA 3NC8A 3NOPC 3CITA 3MSHA 3ZVTA 2XFSA 5CGSA 1PYYA 2PYPA 5CTNA 2HJEA 4B4ZA 5IU1A 3A0RA 3NECA 5FEFA 4ME4A 4YFMA 4QU3A 4X25A 1Y28A 4R4SA 3P7NA 3C4PA 3TSGA 4GOGA 3BRMA 2E8IA 4E3LA 1CQAA 3OPPA 2IWDA 2ZLYA 2QJ5A 3BECA 4P6ZM 1ZG4A 5M18A 3MBZA 4DDSA 4FSFA 4PKYG 4WZ5C 1SZVA 3CG5A 3JVVA 3MZFA 2Y2NA 1OPXA 3T1RA 2KDKA 2EX6A 3BFDA 3BQAA 5FI7A 4PM9A 3MXRA 5F69A 1P9WA 2PU4A 2WGWB 4Q0IA 4PHTA 1K55A 4OKPA 4IUKA 3DTIA 4JXGA 4OPQA 3OPLA 4KENB 5CXWA 3CUEA 2Q9MA 3R7WB 2JKTI 1PI5A 2YKHA 5FI2A 4JGRA 3W8KA 4KZ9A 1SDNA 1DRMA 1N9OA 5FDHA 5AQAA 3IWQA 4X53A 3OC2A 4KZ6A 4UEYA 1MXOA 3DW0A 4Z9QA 4KZ3A 3TW8A 2PBYA 1Y54A 1T1BA 4NG2A 2V8CA 1N4OA 3PAGA 5EM1A 4E6WA 4HH2A 5EPHA 5CHUA 4QY5A 4MBFA 3UN7A 4XUZA 1IYQA 3PBRA 2OOLA 3BEBA 4DRTA 1NJ4A 4N9KA 3LYXA 4YNRA
chains in the Genus database with same CATH topology
1GA0A 3O3VA 5GL9A 4MLLA 4E6XA 1PZPA 3A3JA 5KMWA 4E3MA 4FCFA 1K54A 2X02A 3SOIA 4OOYA 1YLWA 1MPLA 2VGJA 4C75A 1FQGA 2WKIA 1BT5A 3HLEA 1BLHA 3QHYA 5EVLA 3VFFA 3MZDA 3ZG0A 4FH2A 5E43A 4P6BA 4N92A 2H5SA 1PWDA 1C3BA 2Z2LB 3GTCA 3UDIA 1Q2QA 3TOIA 2XFTA 2H0TA 2J8YA 3PAEA 4GD6A 2JBFA 2Y4AA 4PMAA 1CK3A 3BFGA 5EUAA 3M2KA 4X6TA 5GLDA 2V1ZA 1SDEA 4BENA 1MWSA 5CHMA 4D2OA 4Y0UA 2A3UA 3CMZA 1RCJA 2P74A 1NZUA 1AXBA 3UE3A 1K38A 3HLBA 1NYMA 4ZDXA 5FQQA 1XPBA 2QZ6A 4HBTA 3ZG9B 5A91A 4E3OA 1I2WA 2P9VA 5D3OA 4IVIA 4Y0OA 4BD0A 1ZC2A 3MXSA 4FD8A 3C4OA 3G30A 4BQMA 1E25A 4GNUA 3ZVWA 3Q07A 4HESA 5HX9A 3NI9A 4X55A 2V20A 1S0WA 4QJGA 3UDXA 1YLYA 2ZM0A 5E2HA 4RYEA 2ZM2A 3OZHA 4R3BA 3Q7ZA 4NK3A 1W7FA 2XEPA 4ZAMA 3FKVA 2EFUA 3IHBA 3WS1A 5E2EA 5HW3A 5FASA 3ZHHA 3ISGA 3W4QA 4WZ5A 1SKFA 2HP9A 3LO7A 1I2SA 3E2KA 5KSCA 3V50A 1BUEA 3VP2A 3VMAA 5AQ7A 1XGIA 1GHPA 4JF4A 4PPRA 2A49A 1LL5A 2EXAA 2XDMA 3C7UA 2QPNA 2ZQ8A 4OPRA 3ZGAB 3HLFA 5HARA 3GQZA 4C3QA 2J9OA 1DJAA 3IHAA 2ZQ9A 1ONGA 4FH4A 4LCLA 3A3IA 3AGEA 4LV1A 5DF8A 5CEDA 4KG2A 1YLZA 3UDFA 1KE3A 3N8LA 3N8RA 1FSWA 4Y7PA 3VSKA 3WS0A 4JKTA 1YMXA 5CHJA 4S2OA 4GD8A 4UAAA 1MY8A 1JTGA 4JPMA 5FQJA 4UHUA 2EX9A 1H5XA 1XA7A 2FFYA 4WELA 1M40A 4QB8A 4UA9A 1L0EA 4L0LA 1FOFA 5FATA 4M3KA 1KGGA 1JTDA 1K57C 1WYBA 4JXSA 2EX2A 2XF3A 1G6AA 1O07A 5M19A 5JYOA 3AGDA 1FR6A 1KDWA 3SS3A 2XQZA 2Y2KA 4KZ5A 3DWKA 4DE0A 1L0FA 4KG6A 1NXYA 3ZNTA 4DDYA 1ES4A 4JXVA 4R1GA 3HLGA 5HAPA 1KVLA 1K57A 5EECA 4EQIA 1ESUA 5GLBA 4S2KA 3I7JA 1ONHA 3PBNA 2WGWA 4KZ7A 3P98A 1VQQA 4LV3A 4OQ0A 3SS4A 3WS2A 3IXDA 1LL9A 2ZQAA 2B5RA 3S1YA 4E3NA 3TSGA 5HFOA 1H8ZA 3UO9A 1XA1A 3C7VA 2IWBA 1DJCA 4H8RA 3OCLA 1MKIA 5AQ9A 1FCMA 5FA7A 2HDRA 3ZCZA 4WZ4A 2ZMAA 3W4OA 4C6YA 2WUQA 2XK1A 4XXRA 3EQVA 1LI9A 4X56A 4Q8IA 2Y2GA 4HEFA 3WS5A 5EVIA 5FAOA 1TDGA 3Q81A 4R3JA 1RGYA 5HL1A 1FR1A 4EBPA 3GV9A 5CECA 3VOZA 4BJPA 4P87A 1L0GA 2X01A 1IEMA 4DXCA 1S6RA 5FAQA 3UPPA 3MFDA 4GDNA 1PW8A 1XGJA 3VSLA 2Y2QA 3AGFA 2BLSA 3ZG5A 4EUZA 3HREA 3IXGA 2WZXA 1BZAA 2FFFB 2RL3A 2WADA 3NY4A 4KZ8A 1K56D 1YLTA 1QMFA 4O7DA 3CJMA 1KVMA 4MNRA 1O7EA 4WMCA 3A3EA 3IF6B 3N7WA 1BULA 4X69A 1W5DA 4R0QA 3W4PA 2XH9A 3IWIA 2ZD8A 1HD8A 3FV7A 2Y2PA 1OMEA 4LENA 2CC1A 4MEZA 5GHXA 1PWCA 1RP5A 3PBSA 4B88A 3MZEA 4N1HA 3FWLA 4WM9A 3S22A 3GRJA 3Q1FA 4U0XA 4QHCA 4LCMA 2XD1A 5E2GA 2C6WB 1RGZA 4JF6A 3V39A 3G2ZA 1ALQA 4RX3A 3B3XA 3HVFA 2OLVA 3ZNYA 2Y55A 1KE0A 4LV2A 3HL9A 5CEBA 2R9XA 3O88A 4DE3A 1EI5A 1IYPA 4GKUA 5A90A 1IELA 3BFEA 1NYYA 5FQ9A 1H8YA 4CPKA 1N9BA 1L2SA 4KQOA 3G4PA 4DXBA 4DE1A 1IKGA 4QY6A 5F1GA 2EX8A 1GHMA 1ES5A 5GLAA 1DJBA 1CEFA 1FSYA 5FQMA 2OSUA 3UNWA 2G2UA 3BYDA 1SCWA 5FI6A 3PBQA 1DY6A 2WAEA 3IXBA 1L0DA 4LV0A 3UY6A 5HAQA 1W8QA 5TGFA 3V5MA 3VP0A 3D4FA 4S2IA 2Y2MA 2DNSA 3ZG8B 5A92A 3UPNA 2ZQCA 3Q82A 1K4FA 4K0WA 4IVKA 3SH9A 2HP5A 5CRFA 4OVDA 3VP3A 3OPHA 3G32A 4KZ4A 5EOEA 1GA9A 1HTZA 5F82A 4E3KA 2WZZA 2HPBA 2XD5A 5U47A 4EWFA 1VM1A 1E3UD 4GDBA 1LLBA 4K0XA 1PZOA 3NDGA 1GCEA 3NIAA 3QNCA 4BLMA 1FCNA 5EE8A 1KGFA 3SH8A 3N6IA 3LY4A 2RCXA 3V3RA 4KZAA 2JCHA 4ZJ1A 3PBTA 1YMSA 4GZBA 4E3IA 1J9MA 4Y0TA 1LI0A 3IH9A 5HAIA 2EFXA 4PM7A 1E4DA 2ZC6B 1ERQA 1XX2A 3O86A 4KZBA 4OP5A 3UE1A 4EV4A 3IF5A 1HZOA 3NCKA 1TVFA 3FYZA 3DTMA 2Y2LA 4OPYA 4ZBEA 3PTEA 1ZKJA 2HP6A 1TDLA 4DKIA 3G31A 4UA7A 2WGIA 3WS4A 1G68A 2ZC7A 2ZQDA 1LHYA 2IWCA 2XGNA 5M1AA 3WRZA 4GN2A 1JWPA 1NRFA 1W8YA 3V3SA 4DE2A 2Q9NA 1YLJA 3OPRA 4MBKA 4S2NC 4P85A 4PM6A 4F94A 4JLFA 4BD1A 4XUXA 2R9WA 4JF5A 4KG5A 1W79A 3HUNA 3O87A 3HLDA 1PI4A 4S2NA 4ZJ2A 3BFFA 2VGKA 1SHVA 5DVAA 3JYIA 1BLCA 5I94A 3A3FA 5DF7A 2V2FF 2WAFA 5EOOA 5JYPA 5FSRA 3VP4A 2C5WB 3MKEA 1BTLA 3M6HA 1YM1A 4RX2A 4UA6A 5TR7A 2H10A 4OONA 4KQRA 3ZG7B 5KSHA 1WE4A 2DCFA 4HBUA 4B4XA 5BOHA 3GSGA 4ZJ3A 1XXMA 4OOLA 3BLSA 4RVAA 4OOMA 1ERMA 4S2JA 1IKIA 5GLCA 1GHIA 4JBFA 2Y2JA 2P9VB 2XLNA 4IEDA 4X68A 3NBLA 3S4XA 1JWVA 3P09A 4N1XA 3RXXA 2ZC3B 1IYOA 3BLMA 4E3JA 4U3TA 5GHYA 3HUOA 3RXWA 1ESIA 1XP4A 1JVJA 1FCOA 3NC8A 5DF9A 1WYCA 4MBHA 2JE5A 1K6SA 3EQUA 3GMWA 2XFSA 4NETA 3ZVTA 1TEMA 5CGSA 3VOYA 1BLPA 4KQQA 4OQHA 3IT9A 1MWUA 1K4EA 1PYYA 5AQBA 2ZC5B 5CTNA 5DTKA 4B4ZA 5F83A 5IHVA 5FQIA 3HLWA 2ZM8A 1YQSA 4OLDA 3FKWA 3IF6C 3RJUA 3SH7A 3VFHA 4YFMA 2WKEA 5CGWA 3IXHA 4DF6A 4BL2A 2Y59A 4QU3A 1Z6FA 3HLCA 2J7VA 3IF6A 2WGVA 3UPOA 2OLUA 4OP8A 1U60A 2X71A 3BM6A 3ZFZA 2GDNA 4R4SA 3HUMA 3C4PA 5CTMA 1YLPA 3QNBA 2BG1A 4GOGA 3MKFA 4K91A 4N9LA 1CEGA 1JWZA 4U0TA 3BRMA 2E8IA 3M2JA 1MWTA 1YT4A 2IWDA 3OPPA 4E3LA 5A93A 2ZLYA 3BECA 3G34A 5M18A 1ZG4A 2Y2HA 3ITBA 4ZTKA 1BLSA 3MBZA 1K56A 3ZDJA 4FSFA 1HVBA 3C5AA 5TFQA 1IYSA 4DDSA 1KE4A 4OQIA 1EWZA 4OLGA 2JC7A 4WZ5C 3CG5A 3MZFA 1I5QA 3BFCA 2Y2NA 5J8XA 2HDSA 3IQAA 3N4IA 5CERA 2EX6A 2DRWA 4IBRA 3GR2A 1Q2PA 1NY0A 1K55C 3BFDA 5DTTA 5FI7A 2I72A 4PM9A 4YINA 2Y91A 2HDQA 3MXRA 3IH8A 4OQGA 2PU4A 2WGWB 4QD4A 3HBRA 1K55A 3ITAA 1BSGA 3LY3A 3N8SA 3WRTA 5GHZA 4OKPA 1MBLA 2Y2IA 5EVID 4JXGA 4OPQA 4IBXA 1CI8A 3OPLA 4KENB 1M6KA 5CXWA 4OH0A 5E2FA 1MWRA 4EBNA 5L2FA 1KDSA 2WYXA 3PBOA 2Q9MA 4WEJA 2HDUA 4ID4A 4BL3A 1ES3A 4OPZA 1PI5A 3VP1A 2UWXA 4P0MA 5FI2A 4PM8A 5FQKA 4KZ9A 1XKZA 3W8KA 1SDNA 5EVIB 4WEKA 3DWZA 4R23A 3Q7VB 2ZC4B 2H0YA 1ZG6A 2ZQ7A 5FDHA 5AQAA 3IWQA 4RA7A 4S2PA 4EBLA 2ZJ9A 4X53A 2QMIA 3OC2A 4WMCD 2EXBA 4KZ6A 4CJNA 1QMEA 1EROA 1MXOA 3DW0A 2OV5A 2WKHA 4Z9QA 4KZ3A 4A5RA 2PBYA 1Y54A 3GVBA 1PW1A 4WBGA 3WWXA 1N4OA 1PWGA 2Z2MB 2Y2OA 1ES2A 4GB7A 5KZHA 3SS5A 3PAGA 4PM5A 3G2YA 4JXWA 4E6WA 1NZOA 3A3DA 3NDEA 5CGXA 5EPHA 2PU2A 5FAPA 2WK0A 3TG9A 3FZCA 5CHUA 4QY5A 4S2MA 3OCNA 4MBFA 2XR0A 3UN7A 1CI9A 4XUZA 5F1FA 2G2WA 4R4RA 1K25A 1IYQA 3LEZA 3LCEA 3PBRA 5EVIC 1KGEA 3UE0A 3G35A 1E3UA 2J9PA 4WYYA 5DTSA 3CZDA 3M6BA 1K6RA 3BEBA 4DRTA 1NJ4A 1PIOA 1K54C 3Q7VA 4N9KA 5G18A 4S2LA 3IWOA 3E2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GA0 A;  3O3V A;  5GL9 A;  4MLL A;  4E6X A;  1PZP A;  3A3J A;  5KMW A;  4E3M A;  4FCF A;  1K54 A;  2X02 A;  3SOI A;  4OOY A;  1YLW A;  1MPL A;  2VGJ A;  4C75 A;  1FQG A;  2WKI A;  1BT5 A;  3HLE A;  1BLH A;  3QHY A;  5EVL A;  3VFF A;  3MZD A;  3ZG0 A;  4FH2 A;  5E43 A;  4P6B A;  4N92 A;  2H5S A;  1PWD A;  1C3B A;  2Z2L B;  3GTC A;  3UDI A;  1Q2Q A;  3TOI A;  2XFT A;  2H0T A;  2J8Y A;  3PAE A;  4GD6 A;  2JBF A;  2Y4A A;  4PMA A;  1CK3 A;  3BFG A;  5EUA A;  3M2K A;  4X6T A;  5GLD A;  2V1Z A;  1SDE A;  4BEN A;  1MWS A;  5CHM A;  4D2O A;  4Y0U A;  2A3U A;  3CMZ A;  1RCJ A;  2P74 A;  1NZU A;  1AXB A;  3UE3 A;  1K38 A;  3HLB A;  1NYM A;  4ZDX A;  5FQQ A;  1XPB A;  2QZ6 A;  4HBT A;  3ZG9 B;  5A91 A;  4E3O A;  1I2W A;  2P9V A;  5D3O A;  4IVI A;  4Y0O A;  4BD0 A;  1ZC2 A;  3MXS A;  4FD8 A;  3C4O A;  3G30 A;  4BQM A;  1E25 A;  4GNU A;  3ZVW A;  3Q07 A;  4HES A;  5HX9 A;  3NI9 A;  4X55 A;  2V20 A;  1S0W A;  4QJG A;  3UDX A;  1YLY A;  2ZM0 A;  5E2H A;  4RYE A;  2ZM2 A;  3OZH A;  4R3B A;  3Q7Z A;  4NK3 A;  1W7F A;  2XEP A;  4ZAM A;  3FKV A;  2EFU A;  3IHB A;  3WS1 A;  5E2E A;  5HW3 A;  5FAS A;  3ZHH A;  3ISG A;  3W4Q A;  4WZ5 A;  1SKF A;  2HP9 A;  3LO7 A;  1I2S A;  3E2K A;  5KSC A;  3V50 A;  1BUE A;  3VP2 A;  3VMA A;  5AQ7 A;  1XGI A;  1GHP A;  4JF4 A;  4PPR A;  2A49 A;  1LL5 A;  2EXA A;  2XDM A;  3C7U A;  2QPN A;  2ZQ8 A;  4OPR A;  3ZGA B;  3HLF A;  5HAR A;  3GQZ A;  4C3Q A;  2J9O A;  1DJA A;  3IHA A;  2ZQ9 A;  1ONG A;  4FH4 A;  4LCL A;  3A3I A;  3AGE A;  4LV1 A;  5DF8 A;  5CED A;  4KG2 A;  1YLZ A;  3UDF A;  1KE3 A;  3N8L A;  3N8R A;  1FSW A;  4Y7P A;  3VSK A;  3WS0 A;  4JKT A;  1YMX A;  5CHJ A;  4S2O A;  4GD8 A;  4UAA A;  1MY8 A;  1JTG A;  4JPM A;  5FQJ A;  4UHU A;  2EX9 A;  1H5X A;  1XA7 A;  2FFY A;  4WEL A;  1M40 A;  4QB8 A;  4UA9 A;  1L0E A;  4L0L A;  1FOF A;  5FAT A;  4M3K A;  1KGG A;  1JTD A;  1K57 C;  1WYB A;  4JXS A;  2EX2 A;  2XF3 A;  1G6A A;  1O07 A;  5M19 A;  5JYO A;  3AGD A;  1FR6 A;  1KDW A;  3SS3 A;  2XQZ A;  2Y2K A;  4KZ5 A;  3DWK A;  4DE0 A;  1L0F A;  4KG6 A;  1NXY A;  3ZNT A;  4DDY A;  1ES4 A;  4JXV A;  4R1G A;  3HLG A;  5HAP A;  1KVL A;  1K57 A;  5EEC A;  4EQI A;  1ESU A;  5GLB A;  4S2K A;  3I7J A;  1ONH A;  3PBN A;  2WGW A;  4KZ7 A;  3P98 A;  1VQQ A;  4LV3 A;  4OQ0 A;  3SS4 A;  3WS2 A;  3IXD A;  1LL9 A;  2ZQA A;  2B5R A;  3S1Y A;  4E3N A;  3TSG A;  5HFO A;  1H8Z A;  3UO9 A;  1XA1 A;  3C7V A;  2IWB A;  1DJC A;  4H8R A;  3OCL A;  1MKI A;  5AQ9 A;  1FCM A;  5FA7 A;  2HDR A;  3ZCZ A;  4WZ4 A;  2ZMA A;  3W4O A;  4C6Y A;  2WUQ A;  2XK1 A;  4XXR A;  3EQV A;  1LI9 A;  4X56 A;  4Q8I A;  2Y2G A;  4HEF A;  3WS5 A;  5EVI A;  5FAO A;  1TDG A;  3Q81 A;  4R3J A;  1RGY A;  5HL1 A;  1FR1 A;  4EBP A;  3GV9 A;  5CEC A;  3VOZ A;  4BJP A;  4P87 A;  1L0G A;  2X01 A;  1IEM A;  4DXC A;  1S6R A;  5FAQ A;  3UPP A;  3MFD A;  4GDN A;  1PW8 A;  1XGJ A;  3VSL A;  2Y2Q A;  3AGF A;  2BLS A;  3ZG5 A;  4EUZ A;  3HRE A;  3IXG A;  2WZX A;  1BZA A;  2FFF B;  2RL3 A;  2WAD A;  3NY4 A;  4KZ8 A;  1K56 D;  1YLT A;  1QMF A;  4O7D A;  3CJM A;  1KVM A;  4MNR A;  1O7E A;  4WMC A;  3A3E A;  3IF6 B;  3N7W A;  1BUL A;  4X69 A;  1W5D A;  4R0Q A;  3W4P A;  2XH9 A;  3IWI A;  2ZD8 A;  1HD8 A;  3FV7 A;  2Y2P A;  1OME A;  4LEN A;  2CC1 A;  4MEZ A;  5GHX A;  1PWC A;  1RP5 A;  3PBS A;  4B88 A;  3MZE A;  4N1H A;  3FWL A;  4WM9 A;  3S22 A;  3GRJ A;  3Q1F A;  4U0X A;  4QHC A;  4LCM A;  2XD1 A;  5E2G A;  2C6W B;  1RGZ A;  4JF6 A;  3V39 A;  3G2Z A;  1ALQ A;  4RX3 A;  3B3X A;  3HVF A;  2OLV A;  3ZNY A;  2Y55 A;  1KE0 A;  4LV2 A;  3HL9 A;  5CEB A;  2R9X A;  3O88 A;  4DE3 A;  1EI5 A;  1IYP A;  4GKU A;  5A90 A;  1IEL A;  3BFE A;  1NYY A;  5FQ9 A;  1H8Y A;  4CPK A;  1N9B A;  1L2S A;  4KQO A;  3G4P A;  4DXB A;  4DE1 A;  1IKG A;  4QY6 A;  5F1G A;  2EX8 A;  1GHM A;  1ES5 A;  5GLA A;  1DJB A;  1CEF A;  1FSY A;  5FQM A;  2OSU A;  3UNW A;  2G2U A;  3BYD A;  1SCW A;  5FI6 A;  3PBQ A;  1DY6 A;  2WAE A;  3IXB A;  1L0D A;  4LV0 A;  3UY6 A;  5HAQ A;  1W8Q A;  5TGF A;  3V5M A;  3VP0 A;  3D4F A;  4S2I A;  2Y2M A;  2DNS A;  3ZG8 B;  5A92 A;  3UPN A;  2ZQC A;  3Q82 A;  1K4F A;  4K0W A;  4IVK A;  3SH9 A;  2HP5 A;  5CRF A;  4OVD A;  3VP3 A;  3OPH A;  3G32 A;  4KZ4 A;  5EOE A;  1GA9 A;  1HTZ A;  5F82 A;  4E3K A;  2WZZ A;  2HPB A;  2XD5 A;  5U47 A;  4EWF A;  1VM1 A;  1E3U D;  4GDB A;  1LLB A;  4K0X A;  1PZO A;  3NDG A;  1GCE A;  3NIA A;  3QNC A;  4BLM A;  1FCN A;  5EE8 A;  1KGF A;  3SH8 A;  3N6I A;  3LY4 A;  2RCX A;  3V3R A;  4KZA A;  2JCH A;  4ZJ1 A;  3PBT A;  1YMS A;  4GZB A;  4E3I A;  1J9M A;  4Y0T A;  1LI0 A;  3IH9 A;  5HAI A;  2EFX A;  4PM7 A;  1E4D A;  2ZC6 B;  1ERQ A;  1XX2 A;  3O86 A;  4KZB A;  4OP5 A;  3UE1 A;  4EV4 A;  3IF5 A;  1HZO A;  3NCK A;  1TVF A;  3FYZ A;  3DTM A;  2Y2L A;  4OPY A;  4ZBE A;  3PTE A;  1ZKJ A;  2HP6 A;  1TDL A;  4DKI A;  3G31 A;  4UA7 A;  2WGI A;  3WS4 A;  1G68 A;  2ZC7 A;  2ZQD A;  1LHY A;  2IWC A;  2XGN A;  5M1A A;  3WRZ A;  4GN2 A;  1JWP A;  1NRF A;  1W8Y A;  3V3S A;  4DE2 A;  2Q9N A;  1YLJ A;  3OPR A;  4MBK A;  4S2N C;  4P85 A;  4PM6 A;  4F94 A;  4JLF A;  4BD1 A;  4XUX A;  2R9W A;  4JF5 A;  4KG5 A;  1W79 A;  3HUN A;  3O87 A;  3HLD A;  1PI4 A;  4S2N A;  4ZJ2 A;  3BFF A;  2VGK A;  1SHV A;  5DVA A;  3JYI A;  1BLC A;  5I94 A;  3A3F A;  5DF7 A;  2V2F F;  2WAF A;  5EOO A;  5JYP A;  5FSR A;  3VP4 A;  2C5W B;  3MKE A;  1BTL A;  3M6H A;  1YM1 A;  4RX2 A;  4UA6 A;  5TR7 A;  2H10 A;  4OON A;  4KQR A;  3ZG7 B;  5KSH A;  1WE4 A;  2DCF A;  4HBU A;  4B4X A;  5BOH A;  3GSG A;  4ZJ3 A;  1XXM A;  4OOL A;  3BLS A;  4RVA A;  4OOM A;  1ERM A;  4S2J A;  1IKI A;  5GLC A;  1GHI A;  4JBF A;  2Y2J A;  2P9V B;  2XLN A;  4IED A;  4X68 A;  3NBL A;  3S4X A;  1JWV A;  3P09 A;  4N1X A;  3RXX A;  2ZC3 B;  1IYO A;  3BLM A;  4E3J A;  4U3T A;  5GHY A;  3HUO A;  3RXW A;  1ESI A;  1XP4 A;  1JVJ A;  1FCO A;  3NC8 A;  5DF9 A;  1WYC A;  4MBH A;  2JE5 A;  1K6S A;  3EQU A;  3GMW A;  2XFS A;  4NET A;  3ZVT A;  1TEM A;  5CGS A;  3VOY A;  1BLP A;  4KQQ A;  4OQH A;  3IT9 A;  1MWU A;  1K4E A;  1PYY A;  5AQB A;  2ZC5 B;  5CTN A;  5DTK A;  4B4Z A;  5F83 A;  5IHV A;  5FQI A;  3HLW A;  2ZM8 A;  1YQS A;  4OLD A;  3FKW A;  3IF6 C;  3RJU A;  3SH7 A;  3VFH A;  4YFM A;  2WKE A;  5CGW A;  3IXH A;  4DF6 A;  4BL2 A;  2Y59 A;  4QU3 A;  1Z6F A;  3HLC A;  2J7V A;  3IF6 A;  2WGV A;  3UPO A;  2OLU A;  4OP8 A;  1U60 A;  2X71 A;  3BM6 A;  3ZFZ A;  2GDN A;  4R4S A;  3HUM A;  3C4P A;  5CTM A;  1YLP A;  3QNB A;  2BG1 A;  4GOG A;  3MKF A;  4K91 A;  4N9L A;  1CEG A;  1JWZ A;  4U0T A;  3BRM A;  2E8I A;  3M2J A;  1MWT A;  1YT4 A;  2IWD A;  3OPP A;  4E3L A;  5A93 A;  2ZLY A;  3BEC A;  3G34 A;  5M18 A;  1ZG4 A;  2Y2H A;  3ITB A;  4ZTK A;  1BLS A;  3MBZ A;  1K56 A;  3ZDJ A;  4FSF A;  1HVB A;  3C5A A;  5TFQ A;  1IYS A;  4DDS A;  1KE4 A;  4OQI A;  1EWZ A;  4OLG A;  2JC7 A;  4WZ5 C;  3CG5 A;  3MZF A;  1I5Q A;  3BFC A;  2Y2N A;  5J8X A;  2HDS A;  3IQA A;  3N4I A;  5CER A;  2EX6 A;  2DRW A;  4IBR A;  3GR2 A;  1Q2P A;  1NY0 A;  1K55 C;  3BFD A;  5DTT A;  5FI7 A;  2I72 A;  4PM9 A;  4YIN A;  2Y91 A;  2HDQ A;  3MXR A;  3IH8 A;  4OQG A;  2PU4 A;  2WGW B;  4QD4 A;  3HBR A;  1K55 A;  3ITA A;  1BSG A;  3LY3 A;  3N8S A;  3WRT A;  5GHZ A;  4OKP A;  1MBL A;  2Y2I A;  5EVI D;  4JXG A;  4OPQ A;  4IBX A;  1CI8 A;  3OPL A;  4KEN B;  1M6K A;  5CXW A;  4OH0 A;  5E2F A;  1MWR A;  4EBN A;  5L2F A;  1KDS A;  2WYX A;  3PBO A;  2Q9M A;  4WEJ A;  2HDU A;  4ID4 A;  4BL3 A;  1ES3 A;  4OPZ A;  1PI5 A;  3VP1 A;  2UWX A;  4P0M A;  5FI2 A;  4PM8 A;  5FQK A;  4KZ9 A;  1XKZ A;  3W8K A;  1SDN A;  5EVI B;  4WEK A;  3DWZ A;  4R23 A;  3Q7V B;  2ZC4 B;  2H0Y A;  1ZG6 A;  2ZQ7 A;  5FDH A;  5AQA A;  3IWQ A;  4RA7 A;  4S2P A;  4EBL A;  2ZJ9 A;  4X53 A;  2QMI A;  3OC2 A;  4WMC D;  2EXB A;  4KZ6 A;  4CJN A;  1QME A;  1ERO A;  1MXO A;  3DW0 A;  2OV5 A;  2WKH A;  4Z9Q A;  4KZ3 A;  4A5R A;  2PBY A;  1Y54 A;  3GVB A;  1PW1 A;  4WBG A;  3WWX A;  1N4O A;  1PWG A;  2Z2M B;  2Y2O A;  1ES2 A;  4GB7 A;  5KZH A;  3SS5 A;  3PAG A;  4PM5 A;  3G2Y A;  4JXW A;  4E6W A;  1NZO A;  3A3D A;  3NDE A;  5CGX A;  5EPH A;  2PU2 A;  5FAP A;  2WK0 A;  3TG9 A;  3FZC A;  5CHU A;  4QY5 A;  4S2M A;  3OCN A;  4MBF A;  2XR0 A;  3UN7 A;  1CI9 A;  4XUZ A;  5F1F A;  2G2W A;  4R4R A;  1K25 A;  1IYQ A;  3LEZ A;  3LCE A;  3PBR A;  5EVI C;  1KGE A;  3UE0 A;  3G35 A;  1E3U A;  2J9P A;  4WYY A;  5DTS A;  3CZD A;  3M6B A;  1K6R A;  3BEB A;  4DRT A;  1NJ4 A;  1PIO A;  1K54 C;  3Q7V A;  4N9K A;  5G18 A;  4S2L A;  3IWO A;  3E2L A; 
#chains in the Genus database with same CATH topology
 3VOL A;  5GL9 A;  1PZP A;  2VGJ A;  1FQG A;  1BT5 A;  1BLH A;  4I39 A;  2VGL S;  3MZD A;  3PR6 A;  3BY9 A;  2H5S A;  4Y17 A;  3OOV A;  3QP2 A;  3PAE A;  1XJ3 A;  2V1Z A;  4KUK A;  4Y0U A;  2A3U A;  2A24 B;  2L0W A;  2P74 A;  1NZU A;  1K38 A;  1IFQ A;  3ZG9 B;  2P9V A;  4IVI A;  3LIB A;  3BWL A;  3CLO A;  4WUJ A;  4BQM A;  3W2Z A;  4GNU A;  3ZVW A;  3UE6 A;  4HES A;  2XRN A;  4WL9 A;  2VZW A;  1W7F A;  4ZAM A;  2EFU A;  5E2E A;  1ACF A;  4X1M A;  5FAS A;  3W4Q A;  1SKF A;  3LO7 A;  3E2K A;  4O01 A;  1LL8 A;  3VP2 A;  4HI4 A;  3VMA A;  4CQH A;  2A49 A;  1SKO A;  4OPR A;  3ZGA B;  4Y3I A;  4C3Q A;  4LV1 A;  1ONG A;  3UDF A;  3G6O A;  3GDI A;  3VSK A;  3NHQ A;  4JPM A;  1NLY A;  5FQJ A;  3T4Q A;  4UHU A;  2J3T D;  1D7E A;  4F3L B;  1XA7 A;  3C2W A;  4EQ1 A;  4L0L A;  4M3K A;  1WYB A;  5M19 A;  5HDC A;  1FR6 A;  2PAV P;  1TS8 A;  1G5U A;  3DWK A;  3B42 A;  4JXV A;  5J4E A;  3F1N A;  1K57 A;  5EEC A;  4I5S A;  4KUO A;  3S7N A;  4S2K A;  2P7J A;  1VQQ A;  3SS4 A;  4OQ0 A;  2ZQA A;  3S1Y A;  1H8Z A;  3UO9 A;  3C7V A;  4LPZ A;  1DJC A;  1FCM A;  5FA7 A;  2HDR A;  3CWF A;  3A0S A;  4GS9 A;  5EVI A;  5FAO A;  1TDG A;  1RGY A;  1FR1 A;  2W3D A;  3NUL A;  5FAQ A;  3KO6 A;  3MMH A;  2RL3 A;  1EW0 A;  1H0M A;  4EES A;  1KVM A;  3N7W A;  5TJJ A;  4MEZ A;  4B88 A;  1S4R A;  3TE8 A;  1ODV A;  3FWL A;  1ZTU A;  5E2G A;  2C6W B;  1XFN A;  3V39 A;  3G2Z A;  3B3X A;  2D02 A;  4WN5 A;  3T1X A;  4GKU A;  1IEL A;  3BFE A;  3D72 A;  2W1R A;  4CPK A;  4GHI A;  3U4L P;  4DE1 A;  2EX8 A;  1ES5 A;  5GLA A;  3MQO A;  2L4R A;  1DY6 A;  3IXB A;  5HAQ A;  5TGF A;  3V5M A;  4S2I A;  2JHE A;  4RQ9 A;  4QPR A;  3ZG8 B;  3UPN A;  3Q82 A;  1K4F A;  3C30 A;  4K0W A;  4IVK A;  5CRF A;  3MFX A;  5IS1 A;  1L3L A;  5F82 A;  2XD5 A;  5J3W A;  4EWF A;  1PZO A;  5EFW A;  1GCE A;  3NIA A;  1DP6 A;  2VA0 A;  1KGF A;  3VV4 A;  2RCX A;  4KZA A;  2FZ0 A;  1D1J A;  4GZB A;  4E3I A;  4Y0T A;  1LI0 A;  3IH9 A;  5HAI A;  3O86 A;  3IF5 A;  3NCK A;  1TS6 A;  4OPY A;  3PTE A;  4DKI A;  4UA7 A;  1OJ5 A;  2ZC7 A;  2ZQD A;  1LHY A;  5M1A A;  2B18 A;  2Y8H A;  3KSG A;  4S2N C;  4JLF A;  4BD1 A;  4JF5 A;  1W79 A;  3TJZ C;  2J3T C;  2W3F A;  2VGK A;  3RTY A;  1GSX A;  2V2F F;  3IX4 A;  5HD5 A;  4E04 A;  3HJK A;  4Y5F A;  3VP4 A;  2V1B A;  3M6H A;  1YM1 A;  4UA6 A;  3B33 A;  5KSH A;  3GSG A;  4ZJ3 A;  4OOL A;  3B47 A;  1HLU P;  3T12 B;  2Y2J A;  4IED A;  3C38 A;  3P09 A;  2QYB A;  4N1X A;  2ZC3 B;  1IYO A;  3BLM A;  4E3J A;  5GHY A;  2MJ6 A;  1ESI A;  4MMN A;  5DF9 A;  4I38 A;  2HGV A;  2JE5 A;  4ARZ A;  1AWI A;  2KLI A;  5HPI A;  5AQB A;  5FQI A;  4NXB A;  3DTE A;  3VFH A;  2WKE A;  5CGW A;  3V67 A;  3IXH A;  1S66 L;  4DF6 A;  1Z6F A;  1P9R A;  3IX3 A;  4OP8 A;  1U60 A;  2X71 A;  3BM6 A;  3ZFZ A;  3HUM A;  5CTM A;  1YLP A;  4N9L A;  1JWZ A;  1MWT A;  2I9V A;  3GEC A;  5A93 A;  3E98 A;  3ZDJ A;  5TFQ A;  3C5A A;  1KE4 A;  4OLG A;  1I5Q A;  5J8X A;  3LIE A;  3IQA A;  5CER A;  2DRW A;  2O9C A;  3LUQ A;  4YIN A;  2Y91 A;  2HDQ A;  1LT0 A;  4HJ6 A;  4OQG A;  4R3A A;  3HBR A;  3ITA A;  4DJ2 A;  1MBL A;  2Y2I A;  1CI8 A;  4OH0 A;  5E2F A;  1MWR A;  1KDS A;  4BWI A;  1OTA A;  4OPZ A;  4EUV A;  4P0M A;  2XRO A;  5I5L A;  2PR5 A;  5EM0 A;  2ZC4 B;  2H0Y A;  2YKF A;  1ZG6 A;  2P04 A;  2ZQ7 A;  4S2P A;  4HQA A;  3LI8 A;  3LIA A;  4EBL A;  4WMC D;  3R4K A;  4II7 A;  4GB7 A;  5FEG A;  2Y2O A;  1ES2 A;  5KZH A;  1TS7 A;  3SS5 A;  3G2Y A;  1NZO A;  2HZ5 A;  5CGX A;  5FAP A;  2PU2 A;  2WK0 A;  3TG9 A;  3FZC A;  1Y4O A;  4S2M A;  5AJG A;  2XR0 A;  5G4Y A;  2PRF A;  2G2W A;  3LEZ A;  3UE0 A;  3G35 A;  1E3U A;  4CLC D;  4M4X A;  2J9P A;  1YPR A;  2A2L A;  3M6B A;  1K54 C;  4UQI M;  5G18 A;  3F1O B;  3LR5 A;  2OAQ 1;  1GA0 A;  3F1P B;  3IX8 A;  4MLL A;  3T4O A;  1DP9 A;  4ETZ A;  1MKM A;  3SOI A;  4OOY A;  4C75 A;  1N9L A;  3MJQ A;  3ZG0 A;  4P6B A;  2ZMV A;  4LGW A;  1PWD A;  2KOI A;  1C3B A;  2GX5 A;  1Q2Q A;  3H82 B;  2XFT A;  4LLO B;  2H0T A;  2QWS A;  5HPF A;  4PMA A;  1CK3 A;  5EUA A;  2M7V A;  4WF0 A;  1SDE A;  5F5Y A;  1NYM A;  3F1O A;  4HBT A;  3F1P A;  5A91 A;  1I2W A;  4BD0 A;  3MXS A;  3C4O A;  3CI6 A;  1E25 A;  1MC0 A;  3LR3 A;  2V20 A;  3JVU A;  3UDX A;  2W3H A;  2OWJ A;  4NK3 A;  1XFQ A;  2JKG A;  3EGD C;  1J3W A;  3WS1 A;  4QWO A;  3H82 A;  2HP9 A;  2NUP C;  5AQ7 A;  4JF4 A;  1G28 A;  1LL5 A;  3C7U A;  2QPN A;  1Z09 A;  2Q0O A;  2JKR I;  1DJA A;  5DF8 A;  4KG2 A;  1KE3 A;  3N8L A;  1FIL A;  4JKT A;  1YMX A;  4PKY A;  4L9G A;  1MY8 A;  1JTG A;  5DKL A;  1M40 A;  4QB8 A;  4EXO A;  1L0E A;  1FOF A;  5FAT A;  4LFU A;  1KGG A;  1JTD A;  2LB9 A;  2G7U A;  2EX2 A;  1G6A A;  4LRZ E;  3AGD A;  1NWZ A;  2Y2K A;  4O0P A;  3ZNT A;  4AFI A;  3HLG A;  1KVL A;  4EQI A;  2BTF P;  5GLB A;  4B9O A;  1ONH A;  3PBN A;  2WGW A;  5HL6 A;  4R38 A;  3IXD A;  2CMN A;  1LL9 A;  1XA1 A;  2ZBB A;  2W27 A;  3PHY A;  1MKI A;  5AQ9 A;  3R7W A;  3ZCZ A;  4D60 A;  4EEP A;  2ZMF A;  4Z1W A;  4XXR A;  4Q8I A;  3Q81 A;  3IBJ A;  5CEC A;  4P87 A;  5AVE A;  1IEM A;  4DXC A;  1S6R A;  3T1S A;  3QP5 A;  3MFD A;  4GDN A;  3D9Y A;  1TD5 A;  4Q0H A;  4EUZ A;  3E4O A;  2OAP 1;  3NY4 A;  2FFF B;  1MZU A;  4KZ8 A;  5HWT A;  4O8G A;  1K56 D;  4O7D A;  3CJM A;  3CPT B;  2VGL M;  3IF6 B;  1NLZ A;  2XH9 A;  2V0W A;  2Y2P A;  3PYP A;  3VE4 A;  4GLQ A;  1PWC A;  2W1T B;  4CLC C;  3S22 A;  3Q1F A;  4U0X A;  4QHC A;  5J7E A;  4LCM A;  5EVE A;  1LSV A;  2Y55 A;  1KE0 A;  4G3K A;  3BY8 A;  3HL9 A;  2JKF A;  5FL3 A;  4BBT A;  3CPT A;  1NYY A;  1H8Y A;  2VEA A;  3H7W B;  3UB7 A;  4NXE A;  4QY6 A;  5HSQ A;  1DJB A;  1V9Z A;  5FQM A;  2J80 A;  2OSU A;  2A24 A;  3UNW A;  2VV7 A;  1L0D A;  2O99 A;  2K7S A;  3UY6 A;  2WKQ A;  4JGP A;  2DNS A;  5A92 A;  5MC7 A;  4Y2F A;  3MQQ A;  3LIF A;  2HP5 A;  3VP3 A;  4KZ4 A;  1GA9 A;  2K31 A;  1VM1 A;  4K0X A;  1LLB A;  3DAV A;  3CUE C;  5CX7 A;  1FCN A;  4G3V A;  3H7W A;  2JCH A;  1J9M A;  2EFX A;  4PM7 A;  1E4D A;  5G4Z A;  1XX2 A;  3UE1 A;  4Y15 A;  2HP6 A;  3WS4 A;  2WGI A;  2IWC A;  3KYZ A;  4GN2 A;  2FH5 A;  4F3L A;  5AVF A;  1G6O A;  3UB5 P;  5F6A A;  4GCZ A;  3HUN A;  4S2N A;  1SHV A;  2VKS A;  5I94 A;  1NRJ A;  1GSW A;  5DF7 A;  3HCY A;  2WAF A;  5JYP A;  2C5W B;  4RX2 A;  4OON A;  4KQR A;  3ZG7 B;  3KYE A;  3PXP A;  4HBU A;  5BOH A;  1XXM A;  4RVA A;  5DFX A;  3NOU C;  4OOM A;  4S2J A;  1F9I A;  2QKP A;  4BBU A;  3EWK A;  5HZH A;  1UWN X;  3K3D A;  4X68 A;  1JWV A;  3NJA A;  2P08 A;  3HUO A;  3RXW A;  1FCO A;  3LR4 A;  4MBH A;  1PNE A;  3EQU A;  2GNX A;  1BLP A;  4KQQ A;  4OQH A;  4HP9 A;  1MWU A;  1K4E A;  5DTK A;  2GZA A;  3HLW A;  3IF6 C;  5L09 A;  3RJU A;  3SH7 A;  2Y59 A;  1CF0 A;  3QP4 A;  2PHY A;  2WGV A;  2GDN A;  3QNB A;  2BG1 A;  4U0T A;  3KSH A;  3MKF A;  3ZG5 A;  2B02 A;  3M2J A;  2LB5 A;  2Y2H A;  4ZTK A;  3IS2 B;  1HVB A;  1IYS A;  4OQI A;  2W0N A;  1EWZ A;  5FDS A;  2HDS A;  4G3W A;  4IBR A;  3GR2 A;  3MXQ A;  2IA2 A;  1F98 A;  1BSG A;  5HDS A;  3WRT A;  5GHZ A;  4HJ3 A;  4IBX A;  2DMW A;  1M6K A;  5L2F A;  2ZOH A;  3PBO A;  4HNB A;  4WEJ A;  4B93 A;  4ID4 A;  4BL3 A;  1ES3 A;  3VP1 A;  3IS2 A;  4PM8 A;  3DTK A;  5FQK A;  3T4S A;  3Q7V B;  3RH8 B;  1P0Z A;  2EXB A;  1QME A;  1ERO A;  2OV5 A;  3L9K A;  4A5R A;  4WBG A;  2VJW A;  2Z2M B;  4PM5 A;  4JXW A;  3VE3 A;  3NDE A;  2INW A;  1CI9 A;  5EVI C;  1KGE A;  2Z6D A;  4WYY A;  5DTS A;  3CZD A;  1PIO A;  3Q7V A;  4ZJ1 A;  3IWO A;  5HD3 A;  3O3V A;  5KMW A;  4E6X A;  1YSQ A;  2Z6C A;  4FCF A;  4DMZ A;  4ESP A;  1K54 A;  3UB9 A;  1YLW A;  1MPL A;  3QHY A;  5EVL A;  3VFF A;  3FPV A;  1GSV A;  4N92 A;  4FUW A;  1OJG A;  3TOI A;  4GD6 A;  2JBF A;  3BFG A;  3M2K A;  5GLD A;  4BEN A;  5CHM A;  3CMZ A;  1ZHH B;  3UE3 A;  3HLB A;  2L1M A;  4ZDX A;  5HDD A;  5FQQ A;  4HHD A;  2QZ6 A;  2K2N A;  4E3O A;  5D3O A;  3S7Q A;  2V9A A;  1OTE A;  3Q07 A;  1IOU A;  3NI9 A;  1S0W A;  4RYE A;  2ZM2 A;  3OZH A;  4FTX A;  4R3B A;  3EGX C;  3T50 A;  4EET B;  4NXF A;  5HW3 A;  3S7P A;  3FKV A;  3ISG A;  4WZ5 A;  1I2S A;  3V50 A;  2VLG A;  4IUH A;  4PPR A;  3ZQ5 A;  1UWP X;  5L10 A;  2J9O A;  4FH4 A;  3IHA A;  2ZQ9 A;  3DBA A;  3A3I A;  5CED A;  1YLZ A;  3WS0 A;  4Y7P A;  5CHJ A;  4S2O A;  3MR0 A;  3KX0 X;  2EA9 A;  1H5X A;  2FFY A;  2HJ9 C;  3UME A;  4JXS A;  5LBR A;  2XF3 A;  1KDW A;  3SS3 A;  2XQZ A;  4KG6 A;  1NXY A;  4DDY A;  4R1G A;  3FG8 A;  3UB8 A;  4LV3 A;  2PDR A;  4MCW A;  4BBV A;  2B5R A;  4E3N A;  3E4Q A;  3OCL A;  4WZ4 A;  2EWW A;  3W4O A;  4C6Y A;  2WUQ A;  3BJN A;  4LRY C;  1LI9 A;  4X56 A;  4HEF A;  3WS5 A;  2R78 A;  1H3Q A;  5A8B A;  4R3J A;  5HL1 A;  4EBP A;  3VOZ A;  4YWZ A;  2D01 A;  2XA7 S;  3UPP A;  3ZYT A;  4CLC B;  3MQ0 A;  1PW8 A;  1XGJ A;  5HWW A;  3HRE A;  3IXG A;  2WZX A;  2WAD A;  3QP8 A;  3FPW A;  1YLT A;  2PT7 A;  1O7E A;  4WMC A;  3A3E A;  1BUL A;  1S67 L;  2PBD P;  3W4P A;  3IWI A;  3FV7 A;  1OME A;  4LEN A;  1W63 Q;  2CC1 A;  5L07 A;  3S7O A;  1RP5 A;  4DJ3 A;  4N1H A;  2PD7 A;  2NUT C;  1S1Z A;  2XD1 A;  3LI9 A;  4CLC A;  1ALQ A;  4RX3 A;  3HVF A;  2OLV A;  5K5B A;  3O88 A;  1EI5 A;  1IYP A;  4GJ4 A;  3KYQ A;  4P6Z S;  2XSS A;  4JGO A;  4DXB A;  1IKG A;  5F1G A;  1CEF A;  2W3E A;  2G2U A;  5FI6 A;  1SCW A;  1OT9 A;  2WAE A;  2W3G A;  1W8Q A;  3KSF A;  2ACG A;  3D4F A;  2Y2M A;  4L9E A;  3BW6 A;  2ZQC A;  3K3C A;  3K2N A;  1T1A A;  3A0V A;  2ZOI A;  2PD8 A;  4OVD A;  3OPH A;  3G32 A;  5EOE A;  1HTZ A;  4E3K A;  3LGO A;  5U47 A;  4BLM A;  1T1C A;  3N6I A;  1XJ6 A;  3LY4 A;  3V3R A;  3MS6 A;  2M1C A;  1YMS A;  3T4T A;  2ZC6 B;  4KZB A;  4OP5 A;  4EV4 A;  1HZO A;  3FYZ A;  3DTM A;  2Y2L A;  4H6J B;  2UV0 E;  4ZBE A;  5DJU A;  4HY8 A;  3G31 A;  1G68 A;  4MDZ A;  1NRF A;  3V3S A;  2Q9N A;  1YLJ A;  4P85 A;  4PM6 A;  4F94 A;  4YOF A;  2R9W A;  1PRQ A;  3O87 A;  3HLD A;  1PI4 A;  3OLO A;  1T18 A;  4PAU A;  2WKR A;  4KQD A;  4X1L A;  5DVA A;  3JYI A;  1VET B;  3A3F A;  1YAX A;  5EOO A;  3L7H A;  5FSR A;  3LID A;  1LSW A;  3LEQ A;  1F5M A;  3MKE A;  3EEA A;  5TR7 A;  3JPU A;  4H6J A;  3QP1 A;  4B4X A;  3BLS A;  2VK3 A;  1ERM A;  1GHI A;  2AVX A;  4JBF A;  2P9V B;  2XLN A;  1A0K A;  3RXX A;  4U3T A;  2BAS A;  1XP4 A;  1WA9 A;  3ULF A;  1WYC A;  1K6S A;  3UMD A;  3GMW A;  4NET A;  1VET A;  1TEM A;  4IJG A;  3VOY A;  4HP4 A;  3IT9 A;  1UGU A;  2ZC5 B;  3UB6 A;  5F83 A;  5IHV A;  2ZM8 A;  1YQS A;  4OLD A;  3FKW A;  5TBM B;  3TRC A;  1SKO B;  4BL2 A;  3HLC A;  2J7V A;  3IF6 A;  3UPO A;  3T1Q B;  4BMW A;  2OLU A;  4K91 A;  1CEG A;  1OT6 A;  1YT4 A;  2ZL1 B;  3G34 A;  3ITB A;  4DN0 A;  5IT5 A;  1BLS A;  1K56 A;  2W1T A;  4MN5 A;  2JC7 A;  4HIA A;  3BFC A;  4HOI A;  1TS0 A;  3N4I A;  1Q2P A;  1NY0 A;  1K55 C;  3F1N B;  3SZT A;  4EEU A;  5DTT A;  2I72 A;  5TBM A;  4Y13 A;  3IH8 A;  1YKD A;  4QD4 A;  3LIC A;  3N8S A;  3LY3 A;  3E0Y A;  1YSP A;  5EVI D;  4Q0J A;  4EBN A;  2WYX A;  2ZL1 A;  1K0K A;  2HDU A;  1F2K A;  2UWX A;  4CLC E;  1XKZ A;  4GS9 B;  5EVI B;  4WEK A;  3DWZ A;  4R23 A;  2O0Y A;  2O9A A;  4I3I A;  4RA7 A;  2ZJ9 A;  4ETX A;  2QMI A;  5DJT A;  4CJN A;  1STZ A;  2WKH A;  2V1A A;  3GVB A;  1PW1 A;  3WWX A;  1PWG A;  4EU0 A;  2KX6 A;  3A3D A;  2QHK A;  4NEE D;  1CJF A;  4R70 A;  3OCN A;  5F1F A;  4R4R A;  1K25 A;  3LCE A;  1K6R A;  1LSX A;  3SW1 A;  1TF1 A;  3LR0 A;  2M7U A;  2Y79 A;  2X01 A;  4S2L A;  3E2L A;  2VV8 A;  3A3J A;  4E3M A;  3U2A A;  2X02 A;  4MN6 A;  2WKI A;  3HLE A;  4FH2 A;  5E43 A;  1S1Y A;  2Z2L B;  3GTC A;  3UDI A;  5KIZ A;  2J8Y A;  4MN7 A;  2J3W A;  2Y4A A;  3P01 A;  4GHI B;  4HJ4 A;  4X6T A;  1MWS A;  4D2O A;  1RCJ A;  1AXB A;  4I3J A;  1XJ2 A;  1XPB A;  4Y0O A;  1ZC2 A;  4FD8 A;  3G30 A;  2VX8 A;  2E8J A;  5HX9 A;  4X55 A;  1P97 A;  4QJG A;  1YLY A;  2ZM0 A;  5E2H A;  3Q7Z A;  1VB6 A;  3HJI A;  2XEP A;  1H8M A;  3IHB A;  4I3A A;  4IHQ A;  3T4J A;  3ZHH A;  5KSC A;  1BUE A;  3T4K A;  1XGI A;  1GHP A;  2EXA A;  2XDM A;  4JGQ A;  2ZQ8 A;  1VEU B;  3HLF A;  5HAR A;  2PYR A;  3GQZ A;  3QP6 A;  3CAX A;  4LCL A;  3AGE A;  3N8R A;  1FSW A;  1T19 A;  4LRX C;  4GD8 A;  3LFV A;  4UAA A;  2GJ3 A;  2EX9 A;  4WEL A;  4UA9 A;  2OWH A;  4HH3 A;  1K57 C;  4R6L A;  1O07 A;  2B95 A;  5JYO A;  3MF0 A;  4KZ5 A;  4DE0 A;  1L0F A;  2HV1 A;  1ES4 A;  5HAP A;  2V8F A;  2PR6 A;  1ESU A;  3T4L A;  1OTI A;  1S4S A;  1VEU A;  3I7J A;  4KZ7 A;  3P98 A;  3WS2 A;  2EWV A;  4EER A;  5HFO A;  2IWB A;  4H8R A;  4WLA A;  3C8C A;  2ZMA A;  4FOF A;  2XK1 A;  3EQV A;  2Y2G A;  2V0U A;  3GV9 A;  4ARZ B;  2QJ7 A;  4BJP A;  1L0G A;  3RFB A;  2H28 A;  3H9W A;  4XT2 B;  3VSL A;  2Y2Q A;  3AGF A;  2BLS A;  5L8M A;  4GW9 A;  1KOU A;  2VV6 A;  1BZA A;  4K08 A;  1QMF A;  3IBR A;  4MNR A;  1V9Y A;  2O9B A;  5C5K A;  4X69 A;  1W5D A;  4R0Q A;  2ZD8 A;  3FC7 A;  1HD8 A;  1XJ4 A;  5GHX A;  4EW7 A;  1PFL A;  3PBS A;  2WKP A;  3MZE A;  3NOT C;  1X0O A;  4WM9 A;  1JNU A;  3GRJ A;  4XT2 A;  1BYW A;  1RGZ A;  4JF6 A;  4ZRR A;  3ZNY A;  4LV2 A;  5CEB A;  2R9X A;  4DE3 A;  5A90 A;  1OTD A;  5FQ9 A;  1N9N A;  3BQ8 A;  1N9B A;  1L2S A;  4KQO A;  1OTB A;  3G4P A;  1GHM A;  3E4P A;  1FSY A;  2HF6 A;  3BYD A;  3PBQ A;  4LV0 A;  3VP0 A;  1DP8 A;  3SH9 A;  2WZZ A;  2HPB A;  1E3U D;  4GDB A;  3NDG A;  3QNC A;  5EE8 A;  5F68 A;  3SH8 A;  1W63 M;  3PBT A;  3KSI A;  1ERQ A;  3D3O A;  4NKP A;  1TVF A;  3EOI A;  1ZKJ A;  1TDL A;  1D06 A;  5HWV A;  2XGN A;  3WRZ A;  1JWP A;  1FIK A;  1W8Y A;  4DE2 A;  3OPR A;  4MBK A;  2JKR M;  5DFY A;  4L9F A;  4XUX A;  3O5Y A;  4KG5 A;  4ZJ2 A;  3BFF A;  3ICY A;  3OBF A;  5EV0 A;  1BLC A;  2JKT M;  4NXG A;  4UQI S;  1BTL A;  2H10 A;  1WE4 A;  2XA7 M;  2DCF A;  3EEH A;  2JN7 A;  1IKI A;  5GLC A;  1VHM A;  3CHW P;  3NBL A;  3S4X A;  5DKK A;  1JVJ A;  3NC8 A;  3NOP C;  3CIT A;  3MSH A;  3ZVT A;  2XFS A;  5CGS A;  1PYY A;  2PYP A;  5CTN A;  2HJE A;  4B4Z A;  5IU1 A;  3A0R A;  3NEC A;  5FEF A;  4ME4 A;  4YFM A;  4QU3 A;  4X25 A;  1Y28 A;  4R4S A;  3P7N A;  3C4P A;  3TSG A;  4GOG A;  3BRM A;  2E8I A;  4E3L A;  1CQA A;  3OPP A;  2IWD A;  2ZLY A;  2QJ5 A;  3BEC A;  4P6Z M;  1ZG4 A;  5M18 A;  3MBZ A;  4DDS A;  4FSF A;  4PKY G;  4WZ5 C;  1SZV A;  3CG5 A;  3JVV A;  3MZF A;  2Y2N A;  1OPX A;  3T1R A;  2KDK A;  2EX6 A;  3BFD A;  3BQA A;  5FI7 A;  4PM9 A;  3MXR A;  5F69 A;  1P9W A;  2PU4 A;  2WGW B;  4Q0I A;  4PHT A;  1K55 A;  4OKP A;  4IUK A;  3DTI A;  4JXG A;  4OPQ A;  3OPL A;  4KEN B;  5CXW A;  3CUE A;  2Q9M A;  3R7W B;  2JKT I;  1PI5 A;  2YKH A;  5FI2 A;  4JGR A;  3W8K A;  4KZ9 A;  1SDN A;  1DRM A;  1N9O A;  5FDH A;  5AQA A;  3IWQ A;  4X53 A;  3OC2 A;  4KZ6 A;  4UEY A;  1MXO A;  3DW0 A;  4Z9Q A;  4KZ3 A;  3TW8 A;  2PBY A;  1Y54 A;  1T1B A;  4NG2 A;  2V8C A;  1N4O A;  3PAG A;  5EM1 A;  4E6W A;  4HH2 A;  5EPH A;  5CHU A;  4QY5 A;  4MBF A;  3UN7 A;  4XUZ A;  1IYQ A;  3PBR A;  2OOL A;  3BEB A;  4DRT A;  1NJ4 A;  4N9K A;  3LYX A;  4YNR A; 
#chains in the Genus database with same CATH homology
 1GA0 A;  3O3V A;  5GL9 A;  4MLL A;  4E6X A;  1PZP A;  3A3J A;  5KMW A;  4E3M A;  4FCF A;  1K54 A;  2X02 A;  3SOI A;  4OOY A;  1YLW A;  1MPL A;  2VGJ A;  4C75 A;  1FQG A;  2WKI A;  1BT5 A;  3HLE A;  1BLH A;  3QHY A;  5EVL A;  3VFF A;  3MZD A;  3ZG0 A;  4FH2 A;  5E43 A;  4P6B A;  4N92 A;  2H5S A;  1PWD A;  1C3B A;  2Z2L B;  3GTC A;  3UDI A;  1Q2Q A;  3TOI A;  2XFT A;  2H0T A;  2J8Y A;  3PAE A;  4GD6 A;  2JBF A;  2Y4A A;  4PMA A;  1CK3 A;  3BFG A;  5EUA A;  3M2K A;  4X6T A;  5GLD A;  2V1Z A;  1SDE A;  4BEN A;  1MWS A;  5CHM A;  4D2O A;  4Y0U A;  2A3U A;  3CMZ A;  1RCJ A;  2P74 A;  1NZU A;  1AXB A;  3UE3 A;  1K38 A;  3HLB A;  1NYM A;  4ZDX A;  5FQQ A;  1XPB A;  2QZ6 A;  4HBT A;  3ZG9 B;  5A91 A;  4E3O A;  1I2W A;  2P9V A;  5D3O A;  4IVI A;  4Y0O A;  4BD0 A;  1ZC2 A;  3MXS A;  4FD8 A;  3C4O A;  3G30 A;  4BQM A;  1E25 A;  4GNU A;  3ZVW A;  3Q07 A;  4HES A;  5HX9 A;  3NI9 A;  4X55 A;  2V20 A;  1S0W A;  4QJG A;  3UDX A;  1YLY A;  2ZM0 A;  5E2H A;  4RYE A;  2ZM2 A;  3OZH A;  4R3B A;  3Q7Z A;  4NK3 A;  1W7F A;  2XEP A;  4ZAM A;  3FKV A;  2EFU A;  3IHB A;  3WS1 A;  5E2E A;  5HW3 A;  5FAS A;  3ZHH A;  3ISG A;  3W4Q A;  4WZ5 A;  1SKF A;  2HP9 A;  3LO7 A;  1I2S A;  3E2K A;  5KSC A;  3V50 A;  1BUE A;  3VP2 A;  3VMA A;  5AQ7 A;  1XGI A;  1GHP A;  4JF4 A;  4PPR A;  2A49 A;  1LL5 A;  2EXA A;  2XDM A;  3C7U A;  2QPN A;  2ZQ8 A;  4OPR A;  3ZGA B;  3HLF A;  5HAR A;  3GQZ A;  4C3Q A;  2J9O A;  1DJA A;  3IHA A;  2ZQ9 A;  1ONG A;  4FH4 A;  4LCL A;  3A3I A;  3AGE A;  4LV1 A;  5DF8 A;  5CED A;  4KG2 A;  1YLZ A;  3UDF A;  1KE3 A;  3N8L A;  3N8R A;  1FSW A;  4Y7P A;  3VSK A;  3WS0 A;  4JKT A;  1YMX A;  5CHJ A;  4S2O A;  4GD8 A;  4UAA A;  1MY8 A;  1JTG A;  4JPM A;  5FQJ A;  4UHU A;  2EX9 A;  1H5X A;  1XA7 A;  2FFY A;  4WEL A;  1M40 A;  4QB8 A;  4UA9 A;  1L0E A;  4L0L A;  1FOF A;  5FAT A;  4M3K A;  1KGG A;  1JTD A;  1K57 C;  1WYB A;  4JXS A;  2EX2 A;  2XF3 A;  1G6A A;  1O07 A;  5M19 A;  5JYO A;  3AGD A;  1FR6 A;  1KDW A;  3SS3 A;  2XQZ A;  2Y2K A;  4KZ5 A;  3DWK A;  4DE0 A;  1L0F A;  4KG6 A;  1NXY A;  3ZNT A;  4DDY A;  1ES4 A;  4JXV A;  4R1G A;  3HLG A;  5HAP A;  1KVL A;  1K57 A;  5EEC A;  4EQI A;  1ESU A;  5GLB A;  4S2K A;  3I7J A;  1ONH A;  3PBN A;  2WGW A;  4KZ7 A;  3P98 A;  1VQQ A;  4LV3 A;  4OQ0 A;  3SS4 A;  3WS2 A;  3IXD A;  1LL9 A;  2ZQA A;  2B5R A;  3S1Y A;  4E3N A;  3TSG A;  5HFO A;  1H8Z A;  3UO9 A;  1XA1 A;  3C7V A;  2IWB A;  1DJC A;  4H8R A;  3OCL A;  1MKI A;  5AQ9 A;  1FCM A;  5FA7 A;  2HDR A;  3ZCZ A;  4WZ4 A;  2ZMA A;  3W4O A;  4C6Y A;  2WUQ A;  2XK1 A;  4XXR A;  3EQV A;  1LI9 A;  4X56 A;  4Q8I A;  2Y2G A;  4HEF A;  3WS5 A;  5EVI A;  5FAO A;  1TDG A;  3Q81 A;  4R3J A;  1RGY A;  5HL1 A;  1FR1 A;  4EBP A;  3GV9 A;  5CEC A;  3VOZ A;  4BJP A;  4P87 A;  1L0G A;  2X01 A;  1IEM A;  4DXC A;  1S6R A;  5FAQ A;  3UPP A;  3MFD A;  4GDN A;  1PW8 A;  1XGJ A;  3VSL A;  2Y2Q A;  3AGF A;  2BLS A;  3ZG5 A;  4EUZ A;  3HRE A;  3IXG A;  2WZX A;  1BZA A;  2FFF B;  2RL3 A;  2WAD A;  3NY4 A;  4KZ8 A;  1K56 D;  1YLT A;  1QMF A;  4O7D A;  3CJM A;  1KVM A;  4MNR A;  1O7E A;  4WMC A;  3A3E A;  3IF6 B;  3N7W A;  1BUL A;  4X69 A;  1W5D A;  4R0Q A;  3W4P A;  2XH9 A;  3IWI A;  2ZD8 A;  1HD8 A;  3FV7 A;  2Y2P A;  1OME A;  4LEN A;  2CC1 A;  4MEZ A;  5GHX A;  1PWC A;  1RP5 A;  3PBS A;  4B88 A;  3MZE A;  4N1H A;  3FWL A;  4WM9 A;  3S22 A;  3GRJ A;  3Q1F A;  4U0X A;  4QHC A;  4LCM A;  2XD1 A;  5E2G A;  2C6W B;  1RGZ A;  4JF6 A;  3V39 A;  3G2Z A;  1ALQ A;  4RX3 A;  3B3X A;  3HVF A;  2OLV A;  3ZNY A;  2Y55 A;  1KE0 A;  4LV2 A;  3HL9 A;  5CEB A;  2R9X A;  3O88 A;  4DE3 A;  1EI5 A;  1IYP A;  4GKU A;  5A90 A;  1IEL A;  3BFE A;  1NYY A;  5FQ9 A;  1H8Y A;  4CPK A;  1N9B A;  1L2S A;  4KQO A;  3G4P A;  4DXB A;  4DE1 A;  1IKG A;  4QY6 A;  5F1G A;  2EX8 A;  1GHM A;  1ES5 A;  5GLA A;  1DJB A;  1CEF A;  1FSY A;  5FQM A;  2OSU A;  3UNW A;  2G2U A;  3BYD A;  1SCW A;  5FI6 A;  3PBQ A;  1DY6 A;  2WAE A;  3IXB A;  1L0D A;  4LV0 A;  3UY6 A;  5HAQ A;  1W8Q A;  5TGF A;  3V5M A;  3VP0 A;  3D4F A;  4S2I A;  2Y2M A;  2DNS A;  3ZG8 B;  5A92 A;  3UPN A;  2ZQC A;  3Q82 A;  1K4F A;  4K0W A;  4IVK A;  3SH9 A;  2HP5 A;  5CRF A;  4OVD A;  3VP3 A;  3OPH A;  3G32 A;  4KZ4 A;  5EOE A;  1GA9 A;  1HTZ A;  5F82 A;  4E3K A;  2WZZ A;  2HPB A;  2XD5 A;  5U47 A;  4EWF A;  1VM1 A;  1E3U D;  4GDB A;  1LLB A;  4K0X A;  1PZO A;  3NDG A;  1GCE A;  3NIA A;  3QNC A;  4BLM A;  1FCN A;  5EE8 A;  1KGF A;  3SH8 A;  3N6I A;  3LY4 A;  2RCX A;  3V3R A;  4KZA A;  2JCH A;  4ZJ1 A;  3PBT A;  1YMS A;  4GZB A;  4E3I A;  1J9M A;  4Y0T A;  1LI0 A;  3IH9 A;  5HAI A;  2EFX A;  4PM7 A;  1E4D A;  2ZC6 B;  1ERQ A;  1XX2 A;  3O86 A;  4KZB A;  4OP5 A;  3UE1 A;  4EV4 A;  3IF5 A;  1HZO A;  3NCK A;  1TVF A;  3FYZ A;  3DTM A;  2Y2L A;  4OPY A;  4ZBE A;  3PTE A;  1ZKJ A;  2HP6 A;  1TDL A;  4DKI A;  3G31 A;  4UA7 A;  2WGI A;  3WS4 A;  1G68 A;  2ZC7 A;  2ZQD A;  1LHY A;  2IWC A;  2XGN A;  5M1A A;  3WRZ A;  4GN2 A;  1JWP A;  1NRF A;  1W8Y A;  3V3S A;  4DE2 A;  2Q9N A;  1YLJ A;  3OPR A;  4MBK A;  4S2N C;  4P85 A;  4PM6 A;  4F94 A;  4JLF A;  4BD1 A;  4XUX A;  2R9W A;  4JF5 A;  4KG5 A;  1W79 A;  3HUN A;  3O87 A;  3HLD A;  1PI4 A;  4S2N A;  4ZJ2 A;  3BFF A;  2VGK A;  1SHV A;  5DVA A;  3JYI A;  1BLC A;  5I94 A;  3A3F A;  5DF7 A;  2V2F F;  2WAF A;  5EOO A;  5JYP A;  5FSR A;  3VP4 A;  2C5W B;  3MKE A;  1BTL A;  3M6H A;  1YM1 A;  4RX2 A;  4UA6 A;  5TR7 A;  2H10 A;  4OON A;  4KQR A;  3ZG7 B;  5KSH A;  1WE4 A;  2DCF A;  4HBU A;  4B4X A;  5BOH A;  3GSG A;  4ZJ3 A;  1XXM A;  4OOL A;  3BLS A;  4RVA A;  4OOM A;  1ERM A;  4S2J A;  1IKI A;  5GLC A;  1GHI A;  4JBF A;  2Y2J A;  2P9V B;  2XLN A;  4IED A;  4X68 A;  3NBL A;  3S4X A;  1JWV A;  3P09 A;  4N1X A;  3RXX A;  2ZC3 B;  1IYO A;  3BLM A;  4E3J A;  4U3T A;  5GHY A;  3HUO A;  3RXW A;  1ESI A;  1XP4 A;  1JVJ A;  1FCO A;  3NC8 A;  5DF9 A;  1WYC A;  4MBH A;  2JE5 A;  1K6S A;  3EQU A;  3GMW A;  2XFS A;  4NET A;  3ZVT A;  1TEM A;  5CGS A;  3VOY A;  1BLP A;  4KQQ A;  4OQH A;  3IT9 A;  1MWU A;  1K4E A;  1PYY A;  5AQB A;  2ZC5 B;  5CTN A;  5DTK A;  4B4Z A;  5F83 A;  5IHV A;  5FQI A;  3HLW A;  2ZM8 A;  1YQS A;  4OLD A;  3FKW A;  3IF6 C;  3RJU A;  3SH7 A;  3VFH A;  4YFM A;  2WKE A;  5CGW A;  3IXH A;  4DF6 A;  4BL2 A;  2Y59 A;  4QU3 A;  1Z6F A;  3HLC A;  2J7V A;  3IF6 A;  2WGV A;  3UPO A;  2OLU A;  4OP8 A;  1U60 A;  2X71 A;  3BM6 A;  3ZFZ A;  2GDN A;  4R4S A;  3HUM A;  3C4P A;  5CTM A;  1YLP A;  3QNB A;  2BG1 A;  4GOG A;  3MKF A;  4K91 A;  4N9L A;  1CEG A;  1JWZ A;  4U0T A;  3BRM A;  2E8I A;  3M2J A;  1MWT A;  1YT4 A;  2IWD A;  3OPP A;  4E3L A;  5A93 A;  2ZLY A;  3BEC A;  3G34 A;  5M18 A;  1ZG4 A;  2Y2H A;  3ITB A;  4ZTK A;  1BLS A;  3MBZ A;  1K56 A;  3ZDJ A;  4FSF A;  1HVB A;  3C5A A;  5TFQ A;  1IYS A;  4DDS A;  1KE4 A;  4OQI A;  1EWZ A;  4OLG A;  2JC7 A;  4WZ5 C;  3CG5 A;  3MZF A;  1I5Q A;  3BFC A;  2Y2N A;  5J8X A;  2HDS A;  3IQA A;  3N4I A;  5CER A;  2EX6 A;  2DRW A;  4IBR A;  3GR2 A;  1Q2P A;  1NY0 A;  1K55 C;  3BFD A;  5DTT A;  5FI7 A;  2I72 A;  4PM9 A;  4YIN A;  2Y91 A;  2HDQ A;  3MXR A;  3IH8 A;  4OQG A;  2PU4 A;  2WGW B;  4QD4 A;  3HBR A;  1K55 A;  3ITA A;  1BSG A;  3LY3 A;  3N8S A;  3WRT A;  5GHZ A;  4OKP A;  1MBL A;  2Y2I A;  5EVI D;  4JXG A;  4OPQ A;  4IBX A;  1CI8 A;  3OPL A;  4KEN B;  1M6K A;  5CXW A;  4OH0 A;  5E2F A;  1MWR A;  4EBN A;  5L2F A;  1KDS A;  2WYX A;  3PBO A;  2Q9M A;  4WEJ A;  2HDU A;  4ID4 A;  4BL3 A;  1ES3 A;  4OPZ A;  1PI5 A;  3VP1 A;  2UWX A;  4P0M A;  5FI2 A;  4PM8 A;  5FQK A;  4KZ9 A;  1XKZ A;  3W8K A;  1SDN A;  5EVI B;  4WEK A;  3DWZ A;  4R23 A;  3Q7V B;  2ZC4 B;  2H0Y A;  1ZG6 A;  2ZQ7 A;  5FDH A;  5AQA A;  3IWQ A;  4RA7 A;  4S2P A;  4EBL A;  2ZJ9 A;  4X53 A;  2QMI A;  3OC2 A;  4WMC D;  2EXB A;  4KZ6 A;  4CJN A;  1QME A;  1ERO A;  1MXO A;  3DW0 A;  2OV5 A;  2WKH A;  4Z9Q A;  4KZ3 A;  4A5R A;  2PBY A;  1Y54 A;  3GVB A;  1PW1 A;  4WBG A;  3WWX A;  1N4O A;  1PWG A;  2Z2M B;  2Y2O A;  1ES2 A;  4GB7 A;  5KZH A;  3SS5 A;  3PAG A;  4PM5 A;  3G2Y A;  4JXW A;  4E6W A;  1NZO A;  3A3D A;  3NDE A;  5CGX A;  5EPH A;  2PU2 A;  5FAP A;  2WK0 A;  3TG9 A;  3FZC A;  5CHU A;  4QY5 A;  4S2M A;  3OCN A;  4MBF A;  2XR0 A;  3UN7 A;  1CI9 A;  4XUZ A;  5F1F A;  2G2W A;  4R4R A;  1K25 A;  1IYQ A;  3LEZ A;  3LCE A;  3PBR A;  5EVI C;  1KGE A;  3UE0 A;  3G35 A;  1E3U A;  2J9P A;  4WYY A;  5DTS A;  3CZD A;  3M6B A;  1K6R A;  3BEB A;  4DRT A;  1NJ4 A;  1PIO A;  1K54 C;  3Q7V A;  4N9K A;  5G18 A;  4S2L A;  3IWO A;  3E2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...