4X69A

Crystal structure of op0595 complexed with ctx-m-44
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title OP0595, a new diazabicyclooctane: mode of action as a serine beta-lactamase inhibitor, antibiotic and beta-lactam 'enhancer'
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 92
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x69A00
4ID4A 4CJNA 3UPPA 4BL2A 1KE3A 3BLSA 3UPOA 4LCMA 2VGJA 1WYBA 3IXHA 1YLWA 1I5QA 3IF5A 4OP8A 2Y2LA 3BM6A 3IT9A 1EI5A 2GDNA 3WS5A 5EVLA 4JXVA 4OQHA 4QB8A 5EVID 2E8IA 3MKFA 2HP6A 4GB7A 4DRTA 4E3KA 4OH0A 1FCMA 5HARA 1MY8A 2EFXA 3IH9A 3NCKA 1IELA 2H5SA 3A3JA 1SCWA 5DTSA 2ZC7A 1PWCA 1ZG6A 3M2JA 5TFQA 2ZQCA 4LV3A 3BFFA 3HBRA 2Y2QA 3WS1A 3ZGAB 3BEBA 4EBNA 2C5WB 1TVFA 4DF6A 1OMEA 4FSFA 2P9VB 4RVAA 4WEKA 1PZOA 1ES5A 3OPRA 4NK3A 3HLEA 4BJPA 2WKHA 5FQIA 2IWCA 5JYPA 5FQKA 1LHYA 3UN7A 3ZG7B 3W4OA 2Y2IA 4N1XA 5CHJA 5A90A 3NBLA 1FR6A 2EFUA 2XEPA 3ITAA 5FSRA 4ZJ3A 1Q2PA 2IWBA 3VP2A 1BSGA 1EROA 5CRFA 3FKWA 4JXWA 3VOYA 5TGFA 4DE1A 1IEMA 1PI4A 3HLWA 2WUQA 4JF5A 4OLDA 4EV4A 1FOFA 1O7EA 1SDNA 5EECA 2Y2PA 1IYSA 5AQBA 3GV9A 1JTDA 3UE3A 4DE2A 3MZFA 4IEDA 4K91A 2ZD8A 5FA7A 1VQQA 3ZG5A 2Y2NA 3V39A 3HLGA 1XA1A 2EXAA 3LEZA 1GHMA 5EVIA 3G34A 2ZM0A 1W8YA 3TG9A 2OLVA 5BOHA 3HREA 3GTCA 5FAQA 3GVBA 1K55A 2Q9NA 1ESUA 1YMXA 3O87A 4KZ8A 4WM9A 1K38A 3E2KA 1CI8A 4X68A 3C4OA 5FI6A 3ZG8B 3N7WA 3VMAA 1LL9A 4WZ5A 3G32A 4PM6A 2WYXA 4QD4A 3ZVWA 4S2NA 5F82A 3WS0A 4GZBA 2XD1A 2ZC3B 5A91A 2EX9A 5CTNA 1KVMA 2V2FF 4OQ0A 4QY5A 1LLBA 3NIAA 1IYQA 3PBNA 3DW0A 1NXYA 4KQRA 1TEMA 3G2YA 5FAOA 1EWZA 1K6RA 1TDLA 3B3XA 3PBOA 3SH9A 1YLPA 5CGWA 3M6HA 2R9XA 3BFGA 3A3FA 3RXXA 5CEBA 1ES3A 1I2SA 2WZXA 4E3MA 3BFDA 3HLDA 1BLCA 4PM5A 1DJCA 5HW3A 4OOMA 1PZPA 1M40A 2ZLYA 1WE4A 1FSWA 5EE8A 1MWUA 3BFEA 1W7FA 3VP3A 4U0TA 1N4OA 4E3LA 3PBSA 4OPRA 3WWXA 1PIOA 1JWZA 4PM8A 1FCNA 4KZ5A 4UA6A 3PAEA 3QNBA 4UHUA 3IHBA 5M18A 4JF6A 1SDEA 4Y7PA 4KENB 3ZG9B 3CG5A 3V3RA 2HP9A 1BTLA 4MBKA 3VFFA 1HVBA 1XKZA 1ZKJA 4EWFA 4BLMA 5E2HA 4EBPA 3Q81A 1K57A 3Q07A 4XUXA 4DDYA 3CZDA 4UA7A 4C75A 1QMEA 3VP1A 1XXMA 2EX2A 2XK1A 4JF4A 4PM7A 1E3UA 5HAIA 2HDSA 2HDUA 1L0GA 2PBYA 3SH7A 3OZHA 3TOIA 3MZDA 1YM1A 3M6BA 1HZOA 1NZOA 2CC1A 3PBTA 4ZBEA 4E6WA 3IF6B 5L2FA 4UA9A 5KZHA 5DF8A 4R4SA 4HBUA 1GA0A 2XQZA 2WGWA 4OQGA 2XFSA 2XFTA 5KMWA 3S4XA 2WGIA 1SHVA 2G2WA 3BLMA 4N9LA 5GHZA 4JPMA 2XLNA 4R3BA 3V50A 3S1YA 5CXWA 1ES4A 3FYZA 1DJBA 4GD6A 4YFMA 1QMFA 4FH2A 3IXBA 1K54A 5GLBA 3ZDJA 1BLSA 2JE5A 1BLPA 5DTTA 3A3DA 4S2OA 4UAAA 4N9KA 4P85A 3SH8A 1S0WA 1YT4A 4OOLA 4DE0A 4GDNA 1ERMA 2ZQ7A 1RGZA 1DY6A 4WMCD 5F1GA 1L2SA 1NYMA 1KDSA 3N6IA 3IQAA 3CJMA 3G4PA 4FH4A 4MNRA 4S2PA 3IXDA 5CTMA 4OVDA 3V5MA 4GNUA 5FATA 1NZUA 1Z6FA 5F83A 1KGFA 1Y54A 3O86A 1E25A 3E2LA 3W4PA 2QPNA 3N8SA 1FSYA 1I2WA 3AGEA 3A3IA 2FFYA 1W79A 4R4RA 4X6TA 3PTEA 1TDGA 5KSHA 3UDFA 4D2OA 1NYYA 4ZDXA 4R23A 5EUAA 3A3EA 2QZ6A 4GD8A 4KZ9A 3NDEA 4C6YA 4HEFA 4LV1A 3G35A 5CHMA 2JC7A 4KG2A 5FI2A 2WKIA 1H5XA 1DJAA 4OKPA 4DDSA 1O07A 4QHCA 4EBLA 1H8YA 1K4EA 3UPNA 1E4DA 3G2ZA 1XGJA 2Y4AA 1PW8A 4S2MA 1JTGA 1GHIA 1RCJA 2Y55A 4WELA 4NETA 3ZNYA 1J9MA 1ONGA 3Q1FA 2C6WB 1H8ZA 1HTZA 1MPLA 4BENA 1PWGA 2ZJ9A 3DWZA 4OONA 4S2JA 5GLCA 3UDIA 5KSCA 4Y0OA 1ALQA 4X53A 5GL9A 1ESIA 4WMCA 3N4IA 3C7VA 4OLGA 5GLAA 2XD5A 3PAGA 4QY6A 2Y2GA 3EQVA 3PBRA 2G2UA 4JBFA 5EVIB 3BECA 4X56A 3IF6C 5FQMA 1U60A 1GHPA 4B88A 2XR0A 2HP5A 4S2KA 1ERQA 5DF7A 4DXBA 2PU2A 4FD8A 2WK0A 1LI9A 5E43A 3OPPA 3Q82A 1BZAA 5HFOA 1YMSA 3ZVTA 4X55A 2J8YA 2P74A 2XF3A 3OCLA 3IH8A 1PWDA 1IKGA 2Y2KA 4L0LA 1W5DA 5FQJA 1SKFA 5FDHA 2WGVA 3RXWA 4BD1A 2X02A 4OP5A 5A93A 4E6XA 4OOYA 3MFDA 2Y59A 3MXRA 3HLCA 2Y2HA 4LCLA 5CEDA 3GQZA 2H0TA 4XUZA 4KG5A 2XH9A 4QJGA 1NY0A 4RYEA 1XPBA 3SS5A 2ZMAA 2WAEA 3ZG0A 4ZAMA 4HESA 1AXBA 1PI5A 3ZCZA 5HX9A 5EOOA 4M3KA 3NDGA 3RJUA 5JYOA 2ZQ8A 4MEZA 4GKUA 2OSUA 1GCEA 5D3OA 1MBLA 4OPQA 1HD8A 1K4FA 4HBTA 4E3JA 3ISGA 1W8QA 3HUOA 4MBHA 5CERA 4F94A 1YLYA 5IHVA 1ZC2A 1KGEA 3GR2A 2V20A 1BUEA 3N8LA 3NC8A 4OPZA 2UWXA 4DKIA 2BLSA 1XX2A 1K54C 4P6BA 1L0FA 2WZZA 4IVIA 1BLHA 3BRMA 4WEJA 5GHXA 5M1AA 4E3OA 4B4XA 5AQ9A 4KZ4A 4WZ4A 4LENA 3AGFA 3P98A 3LY4A 2V1ZA 4OQIA 5EOEA 3QNCA 2P9VA 4JKTA 3Q7ZA 1IYOA 3C4PA 3OPHA 3UNWA 5FAPA 3SS4A 1NRFA 3IXGA 4N92A 2ZQDA 1FQGA 4K0XA 4S2LA 1K56D 3GMWA 3W8KA 1YLZA 3IWOA 1BT5A 1ES2A 1XA7A 2WADA 4RA7A 4MLLA 4R1GA 3V3SA 3HUMA 1JVJA 3LO7A 1RP5A 2HDQA 3MZEA 3IHAA 4Z9QA 1CI9A 4GOGA 4GN2A 1XP4A 5A92A 5AQAA 2XDMA 3EQUA 3VP0A 5CGXA 4U0XA 2QMIA 4BD0A 2WGWB 1MKIA 4EUZA 3ZFZA 1FCOA 2EX8A 4KZAA 5J8XA 3HLFA 2A3UA 3MKEA 4N1HA 2H0YA 1FR1A 2FFFB 1MWRA 5EVIC 3UY6A 1PYYA 5DVAA 4IBXA 5G18A 3QHYA 1JWPA 1BULA 1K55C 3TSGA 4B4ZA 3M2KA 4GDBA 4E3IA 3VP4A 1M6KA 5FI7A 1ZG4A 1YLTA 2ZM8A 3NY4A 5CECA 3LCEA 4WZ5C 2IWDA 5GHYA 4S2IA 3Q7VA 4DXCA 1MXOA 4S2NC 3MBZA 4RX3A 5HAQA 3FKVA 4PM9A 4MBFA 1PW1A 1CK3A 4KZ7A 2JBFA 1N9BA 3G30A 5U47A 4P0MA 3ZHHA 1GA9A 4R3JA 3BYDA 3GRJA 3JYIA 4FCFA 1K6SA 3AGDA 5I94A 3W4QA 5F1FA 5CGSA 1K56A 1NJ4A 1RGYA 4BL3A 4XXRA 3IWIA 2Q9MA 5DTKA 2ZC5B 5FQQA 1ONHA 1KE0A 4ZJ2A 3ITBA 5EPHA 5GLDA 1KE4A 1VM1A 3BFCA 3VOZA 1CEGA 2XGNA 1Q2QA 1MWTA 1G68A 5FASA 4C3QA 2ZQAA 2B5RA 3SS3A 4DE3A 5HL1A 5AQ7A 4BQMA 4KQOA 2RL3A 5E2FA 1WYCA 4JXGA 3UO9A 2OLUA 2PU4A 3NI9A 2RCXA 2H10A 3FZCA 3IWQA 2EXBA 3Q7VB 1L0DA 2ZC4B 3LY3A 4JLFA 1LI0A 2DCFA 2HPBA 4KG6A 2R9WA 3VSLA 3WRTA 5TR7A 2ZM2A 2A49A 1E3UD 4K0WA 4KZBA 3S22A 3CMZA 5E2GA 2Y91A 3DTMA 3FV7A 4YINA 1K25A 3OCNA 4LV0A 3UDXA 4IVKA 4WYYA 2I72A 3WS4A 1JWVA 1G6AA 3UE0A 1K57C 1CEFA 5M19A 2X01A 2BG1A 2WAFA 3O3VA 3C7UA 3WRZA 4X69A 2J9OA 3HVFA 5CHUA 1S6RA 1YQSA 3HL9A 3HLBA 2EX6A 4U3TA 4Y0UA 3SOIA 3G31A 4WBGA 4A5RA 4CPKA 3OPLA 3I7JA 2Y2JA 4LV2A 4ZTKA 3P09A 2Y2MA 3VSKA 4KZ6A 5DF9A 2OV5A 2VGKA 3MXSA 3HUNA 4H8RA 1YLJA 3IF6A 2X71A 4PMAA 1IKIA 3UE1A 2ZC6B 1C3BA 3C5AA 5E2EA 4ZJ1A 3FWLA 1KDWA 1KGGA 4O7DA 4R0QA 5FQ9A 3ZNTA 4KQQA 3N8RA 5HAPA 1KVLA 4IBRA 4EQIA 4Y0TA 2JCHA 2WKEA 4E3NA 3DWKA 4PPRA 2ZQ9A 1IYPA 2HDRA 3PBQA 1MWSA 2J7VA 4JXSA 4P87A 4QU3A 1XGIA 2J9PA 2DNSA 2Y2OA 3VFHA 3GSGA 3OC2A 4RX2A 2DRWA 2Z2LB 3D4FA 2Z2MB 4Q8IA 4KZ3A 1LL5A 4OPYA 1L0EA 3WS2A 3O88A
chains in the Genus database with same CATH superfamily
5AVFA 4EERA 1YLWA 3IT9A 4OQHA 4QB8A 2E8IA 2HP6A 4HOIA 4E3KA 4I39A 1FCMA 1MY8A 4H6JA 1YKDA 3NCKA 2H5SA 1SCWA 2ZC7A 1PWCA 1VHMA 3NHQA 2ZQCA 3WS1A 3ZGAB 3BEBA 4EBNA 1OMEA 2P9VB 4NK3A 3HLEA 4UQIM 1PFLA 2L0WA 2YKFA 3V67A 2Y2IA 4LRXC 2XEPA 2KOIA 3FKWA 4DE1A 4EV4A 2Y79A 5EECA 2Y2PA 4HJ4A 1VQQA 3HLGA 3UB8A 2EXAA 5EVIA 3HREA 1K55A 1ESUA 3BY9A 1YMXA 4KZ8A 1K38A 4ETXA 3VMAA 2WYXA 5F5YA 4LFUA 3EOIA 1J3WA 2XD1A 2EX9A 5HSQA 3PBNA 3G2YA 5FAOA 4GCZA 3PBOA 3LR5A 1YLPA 2WKPA 2R9XA 3RXXA 3KSGA 1CJFA 2I9VA 2W1TB 4E3MA 1XJ4A 2LB9A 1W63Q 1PZPA 1WE4A 4U0TA 5IS1A 3PBSA 3T12B 1JWZA 4UQIS 3IBJA 3VE3A 4I5SA 4BBVA 3F1PB 5M18A 1F98A 4Y7PA 3CG5A 3V3RA 1BTLA 1XKZA 4DDYA 2L1MA 4R70A 3UB7A 2XK1A 5HAIA 1L0GA 2CMNA 3OZHA 3MQQA 3MZDA 3M6BA 1NZOA 4ZBEA 4WL9A 3EGDC 5DF8A 3LUQA 4BBUA 3MS6A 1T1BA 1D7EA 2XFTA 5HWTA 1SHVA 1S4SA 2J3WA 2XLNA 3V50A 2XROA 1TS8A 2EA9A 3FYZA 4GD6A 2PHYA 1K54A 2QYBA 1ZTUA 3L9KA 5DTTA 4DN0A 4S2OA 4OOLA 4GDNA 2ZQ7A 3NJAA 2W3EA 4WMCD 3F1OB 3G4PA 2M1CA 4S2PA 3IXDA 4HH2A 3TJZC 3BWLA 3W4PA 3N8SA 3U4LP 3A3IA 1TDGA 3JPUA 2QZ6A 4GD8A 4HEFA 2A2LA 4LV1A 5CHMA 4KG2A 5FI2A 2VGLM 2Y8HA 2QWSA 4S2MA 4BMWA 3CHWP 4ETZA 2M7VA 1PWGA 3LR4A 4OONA 5GLCA 5KSCA 4ESPA 1ESIA 3C7VA 3H82B 2Y2GA 2G2UA 3IF6C 1XJ2A 4I3IA 4B88A 4S2KA 4FD8A 2EWVA 3Q82A 1BZAA 2J8YA 2XF3A 4EU0A 4L0LA 1W5DA 5FDHA 2WGVA 2X02A 4OP5A 5A93A 4E6XA 4OOYA 2Y2HA 4LCLA 3GQZA 4KG5A 1XPBA 2W3DA 3ZCZA 2ZOIA 4EXOA 3F1NA 1HD8A 4F94A 4E3JA 4O8GA 4OPZA 3NC8A 3B47A 1XX2A 2VGLS 1L0FA 2WZZA 3GDIA 4IVIA 2ZMVA 1BLHA 4B4XA 1XFQA 3C2WA 3P98A 2V1ZA 1OTIA 3Q7ZA 1NLYA 2ZQDA 1FQGA 1YLZA 1XJ6A 1ES2A 4R1GA 4F3LA 3LO7A 1RP5A 2HDQA 2ZL1A 3MZEA 3IHAA 1CI9A 4GOGA 3EQUA 3VP0A 4L9FA 3IS2B 4U0XA 1FCOA 2EX8A 5J8XA 2H0YA 2D01A 4GS9A 5EVIC 5HDCA 1K55C 1M6KA 5FI7A 1YLTA 3NY4A 3KYQA 2P04A 1PW1A 4II7A 2JBFA 3G30A 3ZHHA 3BYDA 3T1SA 2XSSA 3BW6A 5CGSA 1NJ4A 1RGYA 4BL3A 4IUHA 3IWIA 4XXRA 1KE0A 4NXEA 5GLDA 1KE4A 1VM1A 5HD5A 3VOZA 1G68A 3L7HA 3JVUA 4Y13A 5HL1A 2RL3A 1WYCA 4JXGA 3LR0A 5F6AA 2OLUA 4QWOA 4GHIB 1VB6A 5TR7A 3LIFA 4KZBA 3S22A 1K25A 4LV0A 3UDXA 1JWVA 3GECA 3LICA 4R38A 2A24B 4X69A 2J9OA 4NXFA 4Y0UA 4RQ9A 3DTKA 4CPKA 3D3OA 2Y2JA 4ZTKA 3P09A 5DF9A 2OV5A 4H8RA 3UE1A 3C30A 4ZJ1A 3S7QA 4O7DA 4R0QA 3ZNTA 5FQ9A 5HPFA 3LR3A 4EQIA 4Y0TA 2V8FA 4E3NA 1IYPA 1MWSA 4JXSA 4P87A 2DNSA 1T1AA 1LSXA 2ZMFA 3OC2A 4KQDA 2Z2MB 4NEED 5G4ZA 4EQ1A 4ID4A 5EFWA 3UPPA 4BL2A 2VGJA 4B9OA 1I5QA 3IF5A 5EVLA 5KIZA 4HH3A 5EVID 1BYWA 4DJ3A 2W3HA 4PKYG 1PRQA 4ARZA 1TS6A 4LV3A 3H7WA 4G3VA 3HBRA 5F69A 1TVFA 4DF6A 4FSFA 3OPRA 2PT7A 2WKHA 2W0NA 1LHYA 3T1XA 3NBLA 1FR6A 2EFUA 1Q2PA 2IWBA 1S1ZA 1EROA 5TGFA 4OLDA 5TBMB 4H6JB 1FOFA 1O7EA 2JKRI 5AQBA 3GV9A 4DE2A 4IEDA 4K91A 2J80A 3LEZA 3G34A 2QJ5A 4QPRA 3GTCA 5BOHA 5EVEA 2K31A 3E2KA 5FEFA 1OJGA 5FI6A 3ZG8B 3CUEA 4QD4A 4NXGA 3WS0A 2ZC3B 1MC0A 4EESA 3MF0A 2ZBBA 3SZTA 1NXYA 1TEMA 4R6LA 1K6RA 3B3XA 1ZHHB 5CGWA 1ES3A 2WZXA 4PM5A 1DJCA 4IHQA 4OOMA 1DP6A 1N9LA 1FSWA 3BFEA 5EE8A 3WWXA 3IX8A 2Z6CA 1FCNA 3QNBA 3S7NA 3T50A 2PAVP 4MBKA 3T4JA 4AFIA 4FUWA 3HJIA 4XUXA 2O9CA 3CZDA 2LB5A 5K5BA 4HHDA 4C75A 3P7NA 1QMEA 2V8CA 3VP1A 2OAQ1 1XXMA 4PM7A 3MMHA 4NKPA 4NG2A 3VV4A 2Q0OA 2XFSA 4M4XA 3S4XA 2WGIA 3LGOA 5CXWA 4I3JA 1N9OA 1GSXA 3R4KA 4HIAA 4CQHA 3ZDJA 4JGQA 1VEUA 1BLPA 4N9KA 4ZRRA 3HJKA 1DY6A 1L2SA 1NYMA 1XJ3A 1YSQA 4XT2A 4MNRA 3K3CA 5FATA 1NZUA 3B33A 2VLGA 5F83A 1G5UA 2V1AA 3OBFA 2QPNA 1IOUA 4R4RA 1I2WA 4X6TA 3PTEA 1OTEA 5HZHA 3UDFA 1NYYA 4L9EA 2O9BA 3E98A 5EUAA 4KZ9A 2PYRA 1H5XA 1K4EA 3T1RA 3UPNA 3G2ZA 4MCWA 3H9WA 1RCJA 2Y55A 4NETA 3ZNYA 3A0SA 2C6WB 2Z6DA 5L10A 1HLUP 3UDIA 4X53A 4EEPA 3DTEA 2VJWA 4Y5FA 3N4IA 1YPRA 4FOFA 4OLGA 3PBRA 3BECA 1GHPA 3NECA 2XR0A 2HP5A 2INWA 1H8MA 5DF7A 4DXBA 2WK0A 3IX3A 3OPPA 5E43A 3ZVTA 2VK3A 2P74A 1IKGA 2Y2KA 5A8BA 1SKFA 3LI8A 3RXWA 4BD1A 3LFVA 1AWIA 3MXRA 1F9IA 5HDDA 2JKTM 3CI6A 2XH9A 4QJGA 1NY0A 2ZMAA 3NOPC 3ZG0A 4HESA 5HX9A 5EOOA 1OTDA 4M3KA 3NDGA 2ZQ8A 4MEZA 2V9AA 4LRYC 3ISGA 3HUOA 4Y3IA 1KGEA 3GR2A 1BUEA 4CLCC 4P6BA 2VV6A 4GW9A 3BRMA 5GHXA 3LIEA 4KZ4A 2OWJA 4LENA 2V1BA 3QNCA 2P9VA 3MFXA 1IYOA 3C4PA 3OPHA 3UNWA 5FAPA 3SS4A 1NRFA 3IXGA 2BTFP 3GMWA 3W8KA 3HUMA 1JVJA 1SKOA 4Z9QA 4GN2A 1XP4A 2XDMA 1YSPA 5CGXA 4BD0A 2VV7A 2WGWB 3RTYA 3HLFA 3KX0X 3MKEA 1FR1A 2FFFB 1MWRA 1NRJA 3UB5P 5G18A 3QHYA 1JWPA 3T4LA 4GDBA 2L4RA 4E3IA 2ZM8A 1W63M 3CUEC 1MXOA 3FKVA 4PM9A 4MBFA 4KZ7A 2XA7M 5U47A 1NLZA 5I5LA 3JYIA 3AGDA 2FH5A 2KLIA 1ONHA 1Y4OA 3ITBA 3BFCA 1Q2QA 5FASA 2W1TA 5AQ7A 4BQMA 5E2FA 2VEAA 4MN5A 2PRFA 4X25A 3FZCA 3BQ8A 2ZC4B 4JLFA 2DCFA 3WRTA 3F1PA 1XFNA 5EM0A 2Y91A 3FV7A 4YINA 3E4PA 4K08A 3WS4A 1G6AA 5M19A 3QP6A 2WAFA 3HVFA 1YQSA 3SOIA 2EX6A 1SZVA 3G31A 4LV2A 2P7JA 3VSKA 4CLCD 4HP9A 1C3BA 5LBRA 3FWLA 1KDWA 2JKRM 4KQQA 3N8RA 1KVLA 4WLAA 2PD7A 2WKEA 4I38A 2ZQ9A 3PBQA 3BQAA 2J7VA 2XA7S 5CX7A 2J9PA 2Y2OA 5F68A 4KZ3A 4L9GA 3WS2A 4CJNA 3BLSA 3UPOA 1WYBA 4BWIA 4OP8A 3BM6A 4MDZA 1EI5A 2GDNA 3WS5A 3MSHA 4GB7A 3BJNA 4DRTA 4P6ZM 5HARA 1TS0A 3DTIA 3M2JA 5TFQA 3LIAA 2C5WB 4WEKA 1PZOA 1ES5A 1UGUA 3C38A 2JKTI 2IWCA 3UN7A 5EV0A 5J3WA 3KYEA 4N1XA 5CHJA 5A90A 3T4QA 1G28A 5FSRA 3OLOA 1T1CA 4ZJ3A 2D02A 5DKKA 2R78A 1BSGA 2KDKA 5MC7A 3VOYA 4WN5A 1IEMA 3HLWA 3MXQA 4JF5A 1IYSA 3KSIA 4X1MA 3ZG5A 3H82A 3V39A 4Q0HA 2VZWA 5AVEA 1W8YA 3CPTB 2OLVA 4EETB 3GVBA 2Q9NA 3O87A 2H28A 4EEUA 1CI8A 3C4OA 1LL9A 3G32A 4IUKA 3MQ0A 4S2NA 2NUTC 4GZBA 2HGVA 4QY5A 5IU1A 3KYZA 4P6ZS 1UWPX 1EWZA 1TDLA 3LIDA 3M6HA 5CEBA 3A3FA 1I2SA 3P01A 3BFDA 3HLDA 1BLCA 4LGWA 3IBRA 5HW3A 2UV0E 2ZLYA 1MWUA 1W7FA 1N4OA 4E3LA 4OPRA 4PM8A 4KZ5A 4UHUA 3CLOA 2DMWA 3IHBA 3TW8A 2YKHA 3CITA 2HP9A 3R7WB 3VFFA 4EWFA 5E2HA 1K57A 3Q07A 3T4TA 3UMDA 1VETB 1LL8A 4JGPA 2HDSA 3FG8A 3SH7A 3TOIA 4HP4A 1YM1A 2CC1A 3PBTA 4MN7A 4E6WA 3IF6B 5L2FA 4UA9A 4ME4A 3IS2A 5KZHA 1GA0A 4OQGA 2K2NA 3BLMA 3UB6A 3S1YA 1ES4A 1DJBA 1IFQA 4CLCA 3D72A 1QMFA 4FH2A 2V0UA 2J3TC 2JE5A 4UAAA 3QP1A 4P85A 3SH8A 3FPWA 1RGZA 3N6IA 3CJMA 4FH4A 4B93A 1STZA 4GNUA 2VX8A 1Y54A 3O86A 1E25A 3E2LA 1FSYA 3AGEA 1W79A 3G6OA 4I3AA 4D2OA 5AJGA 4R3AA 4ZDXA 4R23A 4Q0JA 1VEUB 3A3EA 4GHIA 1OTBA 4C6YA 1P97A 3G35A 2JC7A 1DJAA 4OKPA 1O07A 3IX4A 3EGXC 1E4DA 4E04A 2PDRA 3EEHA 4XT2B 2Y4AA 1PW8A 1JTGA 1GHIA 4WELA 2A24A 3Q1FA 3MQOA 3VOLA 2ZJ9A 3DWZA 4S2JA 1ALQA 5GLAA 3EQVA 1LT0A 4JBFA 5EVIB 3QP4A 4X56A 1OT6A 1DP9A 1U60A 5FQMA 3PHYA 4YOFA 4EUVA 3MJQA 1LI9A 1YMSA 4X55A 2PR6A 3IH8A 1PWDA 1Y28A 3U2AA 3HCYA 3E0YA 1TF1A 3MFDA 2B02A 4DMZA 3HLCA 5CEDA 2H0TA 4XUZA 4G3KA 4RYEA 5IT5A 4ZAMA 1AXBA 1PI5A 5JYOA 5C5KA 5D3OA 4OPQA 4MBHA 5CERA 1N9NA 2V20A 2UWXA 2BLSA 2J3TD 3KO6A 5M1AA 4E3OA 4WZ4A 3AGFA 3JVVA 4EW7A 3FPVA 3O5YA 5G4YA 4K0XA 3IWOA 4RA7A 4MLLA 2HV1A 3FC7A 3KSFA 5HPIA 5TBMA 4PAUA 4EUZA 3ZFZA 1CF0A 5DJUA 1V9ZA 4N1HA 2VV8A 3UY6A 1F5MA 5DVAA 5HWVA 5EM1A 4WUJA 1PNEA 3EWKA 3CAXA 4Y17A 4B4ZA 2ACGA 3OOVA 5CECA 3LCEA 4O0PA 1SKOB 5GHYA 4FTXA 3Q7VA 3PR6A 4DXCA 4S2NC 3MBZA 4RX3A 1CK3A 4HJ6A 4G3WA 4P0MA 1GA9A 2E8JA 4FCFA 1K6SA 3W4QA 1K56A 3S7OA 5DTKA 2VA0A 5FQQA 4ZJ2A 3W2ZA 4UEYA 1MWTA 1S66L 4C3QA 2ZQAA 3SS3A 4LRZE 2PU4A 3NI9A 2G7UA 2RCXA 2W27A 3IWQA 1L0DA 2HPBA 3VSLA 4KG6A 3T4SA 2ZM2A 2A49A 1E3UD 2QJ7A 3OCNA 2K7SA 4WYYA 2I72A 2OOLA 2O9AA 3UE0A 1K57C 1CEFA 2NUPC 3O3VA 5J4EA 3CWFA 3LIBA 1CQAA 3HL9A 3HLBA 4WBGA 2BASA 5L07A 4GJ4A 2HZ5A 3OPLA 2M7UA 2Y2MA 4KZ6A 5L09A 2VGKA 3MXSA 3HUNA 1YLJA 5L8MA 2WKRA 2X71A 4PMAA 1H3QA 5E2EA 4X1LA 5HAPA 1MZUA 3E4OA 4PPRA 2P08A 1S1YA 1XGIA 3GSGA 4RX2A 4Q8IA 5DFXA 1KE3A 4WF0A 4LCMA 3IXHA 2Y2LA 4JXVA 3SW1A 3F1NB 3MKFA 1S4RA 1K0KA 4OH0A 1MKMA 2EFXA 3IH9A 3PXPA 1IELA 3A3JA 3S7PA 5DTSA 1ZG6A 3E4QA 3BFFA 2Y2QA 3NOTC 1V9YA 4RVAA 4BJPA 5FQIA 5JYPA 5FQKA 3ZG7B 2HJEA 2JKGA 4F3LB 3W4OA 1YAXA 2PR5A 2ZL1B 1EW0A 1KOUA 3ITAA 3TE8A 3VP2A 5CRFA 3T4OA 4JXWA 1PI4A 3NULA 1OPXA 2WUQA 1SDNA 1S67L 4Z1WA 1JTDA 3UE3A 3MZFA 5FA7A 2ZD8A 4PKYA 2Y2NA 4GS9B 1XA1A 1GHMA 2ZM0A 3C8CA 3TG9A 5FAQA 4HNBA 4WM9A 4X68A 2W3GA 1T18A 3N7WA 2FZ0A 4O01A 4WZ5A 4PM6A 1LSWA 3ZVWA 5F82A 5A91A 3VE4A 5CTNA 1KVMA 3EEAA 2OAP1 2V2FF 3DAVA 2OWHA 4OQ0A 1LLBA 1P0ZA 3NIAA 1IYQA 3DW0A 4KQRA 1ACFA 1P9RA 3SH9A 3BFGA 3K2NA 2QKPA 1M40A 4CLCE 3VP3A 1PIOA 2EWWA 4UA6A 3PAEA 5DKLA 4JF6A 1X0OA 1SDEA 5HL6A 4KENB 3ZG9B 1TS7A 4JGOA 2JN7A 2PBDP 1HVBA 1ZKJA 4BLMA 4EBPA 3Q81A 4UA7A 5FDSA 3BY8A 2EX2A 4JF4A 1E3UA 2HDUA 2PBYA 2MJ6A 4HY8A 4GLQA 2VKSA 1HZOA 3F1OA 4R4SA 4HBUA 2XQZA 2WGWA 5KMWA 4N9LA 2G2WA 5GHZA 4LLOB 4JPMA 4R3BA 1OT9A 2GX5A 3RH8B 4IJGA 4YFMA 1DP8A 1G6OA 3IXBA 5GLBA 1BLSA 5DJTA 4JGRA 3A3DA 5DFYA 1S0WA 1YT4A 3QP8A 4DE0A 1ERMA 2W3FA 2HF6A 2JHEA 5F1GA 1KDSA 3K3DA 3IQAA 5CTMA 4OVDA 3V5MA 1Z6FA 1KGFA 3UB9A 1WA9A 2FFYA 4ARZB 2WKQA 5KSHA 4CLCB 3H7WB 3NDEA 4YWZA 2WKIA 4MMNA 4DDSA 4QHCA 2B18A 1LSVA 2QHKA 1H8YA 4EBLA 1L3LA 4Q0IA 1XGJA 2KX6A 3QP5A 1OTAA 4MN6A 1J9MA 1DRMA 1ONGA 3UE6A 1H8ZA 1HTZA 1MPLA 4BENA 1F2KA 4Y0OA 3LI9A 5GL9A 4WMCA 1ODVA 2XD5A 3PAGA 4QY6A 2PYPA 1D1JA 1ERQA 2PU2A 1FIKA 5HFOA 4NXBA 1H0MA 3OCLA 5J7EA 2O99A 5FQJA 3A0VA 2Y59A 2JKFA 3QP2A 3SS5A 2WAEA 3RJUA 5FL3A 4GKUA 2OSUA 1GCEA 1MBLA 1K4FA 4HBTA 2V0WA 1W8QA 1YLYA 3A0RA 5IHVA 1ZC2A 3N8LA 3RFBA 4KUKA 2GZAA 4DKIA 4KUOA 1OJ5A 3PYPA 1K54C 4WEJA 3ULFA 5AQ9A 3LEQA 1Z09A 3LY4A 4OQIA 1NWZA 5EOEA 4JKTA 4N92A 3KSHA 4S2LA 3ZQ5A 1K56D 1BT5A 2WADA 1XA7A 3V3SA 3ICYA 5TJJA 4BBTA 4HJ3A 3NOUC 5HDSA 2PD8A 3LYXA 5A92A 5AQAA 1UWNX 2IA2A 1A0KA 5FEGA 2QMIA 1MKIA 3T1QB 4KZAA 4DJ2A 2A3UA 4YNRA 1PYYA 4IBXA 3CPTA 3DBAA 1BULA 1JNUA 3TSGA 3B42A 3M2KA 1GSWA 3VP4A 1ZG4A 3T4KA 4WZ5C 1TD5A 2IWDA 4S2IA 2W1RA 2GNXA 3ZYTA 5HAQA 1N9BA 1FILA 4R3JA 3GRJA 1T19A 5I94A 5F1FA 2Q9MA 2ZC5B 4HI4A 5HD3A 4Y2FA 5EPHA 1CEGA 2XGNA 2HJ9C 2B5RA 4DE3A 4KQOA 1P9WA 3UO9A 1D06A 2H10A 2EXBA 3Q7VB 3LY3A 2XRNA 1LI0A 3D9YA 2R9WA 4K0WA 3MR0A 5HWWA 3CMZA 5E2GA 3DTMA 2O0YA 4IVKA 3R7WA 2X01A 4PHTA 3UMEA 2BG1A 3C7UA 4HQAA 3WRZA 4LPZA 1VETA 5CHUA 1S6RA 4U3TA 4A5RA 3I7JA 2B95A 3TRCA 3IF6A 2AVXA 2ZOHA 1IKIA 4Y15A 2ZC6B 3C5AA 1KGGA 2GJ3A 4IBRA 2JCHA 1GSVA 3DWKA 2HDRA 4QU3A 3VFHA 4D60A 2DRWA 2Z2LB 3D4FA 1LL5A 4OPYA 1L0EA 3O88A
chains in the Genus database with same CATH topology
4ID4A 4CJNA 3UPPA 4BL2A 1KE3A 3BLSA 3UPOA 4LCMA 2VGJA 1WYBA 3IXHA 1YLWA 1I5QA 3IF5A 4OP8A 2Y2LA 3BM6A 3IT9A 1EI5A 2GDNA 3WS5A 5EVLA 4JXVA 4OQHA 4QB8A 5EVID 2E8IA 3MKFA 2HP6A 4GB7A 4DRTA 4E3KA 4OH0A 1FCMA 5HARA 1MY8A 2EFXA 3IH9A 3NCKA 1IELA 2H5SA 3A3JA 1SCWA 5DTSA 2ZC7A 1PWCA 1ZG6A 3M2JA 5TFQA 2ZQCA 4LV3A 3BFFA 3HBRA 2Y2QA 3WS1A 3ZGAB 3BEBA 4EBNA 2C5WB 1TVFA 4DF6A 1OMEA 4FSFA 2P9VB 4RVAA 4WEKA 1PZOA 1ES5A 3OPRA 4NK3A 3HLEA 4BJPA 2WKHA 5FQIA 2IWCA 5JYPA 5FQKA 1LHYA 3UN7A 3ZG7B 3W4OA 2Y2IA 4N1XA 5CHJA 5A90A 3NBLA 1FR6A 2EFUA 2XEPA 3ITAA 5FSRA 4ZJ3A 1Q2PA 2IWBA 3VP2A 1BSGA 1EROA 5CRFA 3FKWA 4JXWA 3VOYA 5TGFA 4DE1A 1IEMA 1PI4A 3HLWA 2WUQA 4JF5A 4OLDA 4EV4A 1FOFA 1O7EA 1SDNA 5EECA 2Y2PA 1IYSA 5AQBA 3GV9A 1JTDA 3UE3A 4DE2A 3MZFA 4IEDA 4K91A 2ZD8A 5FA7A 1VQQA 3ZG5A 2Y2NA 3V39A 3HLGA 1XA1A 2EXAA 3LEZA 1GHMA 5EVIA 3G34A 2ZM0A 1W8YA 3TG9A 2OLVA 5BOHA 3HREA 3GTCA 5FAQA 3GVBA 1K55A 2Q9NA 1ESUA 1YMXA 3O87A 4KZ8A 4WM9A 1K38A 3E2KA 1CI8A 4X68A 3C4OA 5FI6A 3ZG8B 3N7WA 3VMAA 1LL9A 4WZ5A 3G32A 4PM6A 2WYXA 4QD4A 3ZVWA 4S2NA 5F82A 3WS0A 4GZBA 2XD1A 2ZC3B 5A91A 2EX9A 5CTNA 1KVMA 2V2FF 4OQ0A 4QY5A 1LLBA 3NIAA 1IYQA 3PBNA 3DW0A 1NXYA 4KQRA 1TEMA 3G2YA 5FAOA 1EWZA 1K6RA 1TDLA 3B3XA 3PBOA 3SH9A 1YLPA 5CGWA 3M6HA 2R9XA 3BFGA 3A3FA 3RXXA 5CEBA 1ES3A 1I2SA 2WZXA 4E3MA 3BFDA 3HLDA 1BLCA 4PM5A 1DJCA 5HW3A 4OOMA 1PZPA 1M40A 2ZLYA 1WE4A 1FSWA 5EE8A 1MWUA 3BFEA 1W7FA 3VP3A 4U0TA 1N4OA 4E3LA 3PBSA 4OPRA 3WWXA 1PIOA 1JWZA 4PM8A 1FCNA 4KZ5A 4UA6A 3PAEA 3QNBA 4UHUA 3IHBA 5M18A 4JF6A 1SDEA 4Y7PA 4KENB 3ZG9B 3CG5A 3V3RA 2HP9A 1BTLA 4MBKA 3VFFA 1HVBA 1XKZA 1ZKJA 4EWFA 4BLMA 5E2HA 4EBPA 3Q81A 1K57A 3Q07A 4XUXA 4DDYA 3CZDA 4UA7A 4C75A 1QMEA 3VP1A 1XXMA 2EX2A 2XK1A 4JF4A 4PM7A 1E3UA 5HAIA 2HDSA 2HDUA 1L0GA 2PBYA 3SH7A 3OZHA 3TOIA 3MZDA 1YM1A 3M6BA 1HZOA 1NZOA 2CC1A 3PBTA 4ZBEA 4E6WA 3IF6B 5L2FA 4UA9A 5KZHA 5DF8A 4R4SA 4HBUA 1GA0A 2XQZA 2WGWA 4OQGA 2XFSA 2XFTA 5KMWA 3S4XA 2WGIA 1SHVA 2G2WA 3BLMA 4N9LA 5GHZA 4JPMA 2XLNA 4R3BA 3V50A 3S1YA 5CXWA 1ES4A 3FYZA 1DJBA 4GD6A 4YFMA 1QMFA 4FH2A 3IXBA 1K54A 5GLBA 3ZDJA 1BLSA 2JE5A 1BLPA 5DTTA 3A3DA 4S2OA 4UAAA 4N9KA 4P85A 3SH8A 1S0WA 1YT4A 4OOLA 4DE0A 4GDNA 1ERMA 2ZQ7A 1RGZA 1DY6A 4WMCD 5F1GA 1L2SA 1NYMA 1KDSA 3N6IA 3IQAA 3CJMA 3G4PA 4FH4A 4MNRA 4S2PA 3IXDA 5CTMA 4OVDA 3V5MA 4GNUA 5FATA 1NZUA 1Z6FA 5F83A 1KGFA 1Y54A 3O86A 1E25A 3E2LA 3W4PA 2QPNA 3N8SA 1FSYA 1I2WA 3AGEA 3A3IA 2FFYA 1W79A 4R4RA 4X6TA 3PTEA 1TDGA 5KSHA 3UDFA 4D2OA 1NYYA 4ZDXA 4R23A 5EUAA 3A3EA 2QZ6A 4GD8A 4KZ9A 3NDEA 4C6YA 4HEFA 4LV1A 3G35A 5CHMA 2JC7A 4KG2A 5FI2A 2WKIA 1H5XA 1DJAA 4OKPA 4DDSA 1O07A 4QHCA 4EBLA 1H8YA 1K4EA 3UPNA 1E4DA 3G2ZA 1XGJA 2Y4AA 1PW8A 4S2MA 1JTGA 1GHIA 1RCJA 2Y55A 4WELA 4NETA 3ZNYA 1J9MA 1ONGA 3Q1FA 2C6WB 1H8ZA 1HTZA 1MPLA 4BENA 1PWGA 2ZJ9A 3DWZA 4OONA 4S2JA 5GLCA 3UDIA 5KSCA 4Y0OA 1ALQA 4X53A 5GL9A 1ESIA 4WMCA 3N4IA 3C7VA 4OLGA 5GLAA 2XD5A 3PAGA 4QY6A 2Y2GA 3EQVA 3PBRA 2G2UA 4JBFA 5EVIB 3BECA 4X56A 3IF6C 5FQMA 1U60A 1GHPA 4B88A 2XR0A 2HP5A 4S2KA 1ERQA 5DF7A 4DXBA 2PU2A 4FD8A 2WK0A 1LI9A 5E43A 3OPPA 3Q82A 1BZAA 5HFOA 1YMSA 3ZVTA 4X55A 2J8YA 2P74A 2XF3A 3OCLA 3IH8A 1PWDA 1IKGA 2Y2KA 4L0LA 1W5DA 5FQJA 1SKFA 5FDHA 2WGVA 3RXWA 4BD1A 2X02A 4OP5A 5A93A 4E6XA 4OOYA 3MFDA 2Y59A 3MXRA 3HLCA 2Y2HA 4LCLA 5CEDA 3GQZA 2H0TA 4XUZA 4KG5A 2XH9A 4QJGA 1NY0A 4RYEA 1XPBA 3SS5A 2ZMAA 2WAEA 3ZG0A 4ZAMA 4HESA 1AXBA 1PI5A 3ZCZA 5HX9A 5EOOA 4M3KA 3NDGA 3RJUA 5JYOA 2ZQ8A 4MEZA 4GKUA 2OSUA 1GCEA 5D3OA 1MBLA 4OPQA 1HD8A 1K4FA 4HBTA 4E3JA 3ISGA 1W8QA 3HUOA 4MBHA 5CERA 4F94A 1YLYA 5IHVA 1ZC2A 1KGEA 3GR2A 2V20A 1BUEA 3N8LA 3NC8A 4OPZA 2UWXA 4DKIA 2BLSA 1XX2A 1K54C 4P6BA 1L0FA 2WZZA 4IVIA 1BLHA 3BRMA 4WEJA 5GHXA 5M1AA 4E3OA 4B4XA 5AQ9A 4KZ4A 4WZ4A 4LENA 3AGFA 3P98A 3LY4A 2V1ZA 4OQIA 5EOEA 3QNCA 2P9VA 4JKTA 3Q7ZA 1IYOA 3C4PA 3OPHA 3UNWA 5FAPA 3SS4A 1NRFA 3IXGA 4N92A 2ZQDA 1FQGA 4K0XA 4S2LA 1K56D 3GMWA 3W8KA 1YLZA 3IWOA 1BT5A 1ES2A 1XA7A 2WADA 4RA7A 4MLLA 4R1GA 3V3SA 3HUMA 1JVJA 3LO7A 1RP5A 2HDQA 3MZEA 3IHAA 4Z9QA 1CI9A 4GOGA 4GN2A 1XP4A 5A92A 5AQAA 2XDMA 3EQUA 3VP0A 5CGXA 4U0XA 2QMIA 4BD0A 2WGWB 1MKIA 4EUZA 3ZFZA 1FCOA 2EX8A 4KZAA 5J8XA 3HLFA 2A3UA 3MKEA 4N1HA 2H0YA 1FR1A 2FFFB 1MWRA 5EVIC 3UY6A 1PYYA 5DVAA 4IBXA 5G18A 3QHYA 1JWPA 1BULA 1K55C 3TSGA 4B4ZA 3M2KA 4GDBA 4E3IA 3VP4A 1M6KA 5FI7A 1ZG4A 1YLTA 2ZM8A 3NY4A 5CECA 3LCEA 4WZ5C 2IWDA 5GHYA 4S2IA 3Q7VA 4DXCA 1MXOA 4S2NC 3MBZA 4RX3A 5HAQA 3FKVA 4PM9A 4MBFA 1PW1A 1CK3A 4KZ7A 2JBFA 1N9BA 3G30A 5U47A 4P0MA 3ZHHA 1GA9A 4R3JA 3BYDA 3GRJA 3JYIA 4FCFA 1K6SA 3AGDA 5I94A 3W4QA 5F1FA 5CGSA 1K56A 1NJ4A 1RGYA 4BL3A 4XXRA 3IWIA 2Q9MA 5DTKA 2ZC5B 5FQQA 1ONHA 1KE0A 4ZJ2A 3ITBA 5EPHA 5GLDA 1KE4A 1VM1A 3BFCA 3VOZA 1CEGA 2XGNA 1Q2QA 1MWTA 1G68A 5FASA 4C3QA 2ZQAA 2B5RA 3SS3A 4DE3A 5HL1A 5AQ7A 4BQMA 4KQOA 2RL3A 5E2FA 1WYCA 4JXGA 3UO9A 2OLUA 2PU4A 3NI9A 2RCXA 2H10A 3FZCA 3IWQA 2EXBA 3Q7VB 1L0DA 2ZC4B 3LY3A 4JLFA 1LI0A 2DCFA 2HPBA 4KG6A 2R9WA 3VSLA 3WRTA 5TR7A 2ZM2A 2A49A 1E3UD 4K0WA 4KZBA 3S22A 3CMZA 5E2GA 2Y91A 3DTMA 3FV7A 4YINA 1K25A 3OCNA 4LV0A 3UDXA 4IVKA 4WYYA 2I72A 3WS4A 1JWVA 1G6AA 3UE0A 1K57C 1CEFA 5M19A 2X01A 2BG1A 2WAFA 3O3VA 3C7UA 3WRZA 4X69A 2J9OA 3HVFA 5CHUA 1S6RA 1YQSA 3HL9A 3HLBA 2EX6A 4U3TA 4Y0UA 3SOIA 3G31A 4WBGA 4A5RA 4CPKA 3OPLA 3I7JA 2Y2JA 4LV2A 4ZTKA 3P09A 2Y2MA 3VSKA 4KZ6A 5DF9A 2OV5A 2VGKA 3MXSA 3HUNA 4H8RA 1YLJA 3IF6A 2X71A 4PMAA 1IKIA 3UE1A 2ZC6B 1C3BA 3C5AA 5E2EA 4ZJ1A 3FWLA 1KDWA 1KGGA 4O7DA 4R0QA 5FQ9A 3ZNTA 4KQQA 3N8RA 5HAPA 1KVLA 4IBRA 4EQIA 4Y0TA 2JCHA 2WKEA 4E3NA 3DWKA 4PPRA 2ZQ9A 1IYPA 2HDRA 3PBQA 1MWSA 2J7VA 4JXSA 4P87A 4QU3A 1XGIA 2J9PA 2DNSA 2Y2OA 3VFHA 3GSGA 3OC2A 4RX2A 2DRWA 2Z2LB 3D4FA 2Z2MB 4Q8IA 4KZ3A 1LL5A 4OPYA 1L0EA 3WS2A 3O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ID4 A;  4CJN A;  3UPP A;  4BL2 A;  1KE3 A;  3BLS A;  3UPO A;  4LCM A;  2VGJ A;  1WYB A;  3IXH A;  1YLW A;  1I5Q A;  3IF5 A;  4OP8 A;  2Y2L A;  3BM6 A;  3IT9 A;  1EI5 A;  2GDN A;  3WS5 A;  5EVL A;  4JXV A;  4OQH A;  4QB8 A;  5EVI D;  2E8I A;  3MKF A;  2HP6 A;  4GB7 A;  4DRT A;  4E3K A;  4OH0 A;  1FCM A;  5HAR A;  1MY8 A;  2EFX A;  3IH9 A;  3NCK A;  1IEL A;  2H5S A;  3A3J A;  1SCW A;  5DTS A;  2ZC7 A;  1PWC A;  1ZG6 A;  3M2J A;  5TFQ A;  2ZQC A;  4LV3 A;  3BFF A;  3HBR A;  2Y2Q A;  3WS1 A;  3ZGA B;  3BEB A;  4EBN A;  2C5W B;  1TVF A;  4DF6 A;  1OME A;  4FSF A;  2P9V B;  4RVA A;  4WEK A;  1PZO A;  1ES5 A;  3OPR A;  4NK3 A;  3HLE A;  4BJP A;  2WKH A;  5FQI A;  2IWC A;  5JYP A;  5FQK A;  1LHY A;  3UN7 A;  3ZG7 B;  3W4O A;  2Y2I A;  4N1X A;  5CHJ A;  5A90 A;  3NBL A;  1FR6 A;  2EFU A;  2XEP A;  3ITA A;  5FSR A;  4ZJ3 A;  1Q2P A;  2IWB A;  3VP2 A;  1BSG A;  1ERO A;  5CRF A;  3FKW A;  4JXW A;  3VOY A;  5TGF A;  4DE1 A;  1IEM A;  1PI4 A;  3HLW A;  2WUQ A;  4JF5 A;  4OLD A;  4EV4 A;  1FOF A;  1O7E A;  1SDN A;  5EEC A;  2Y2P A;  1IYS A;  5AQB A;  3GV9 A;  1JTD A;  3UE3 A;  4DE2 A;  3MZF A;  4IED A;  4K91 A;  2ZD8 A;  5FA7 A;  1VQQ A;  3ZG5 A;  2Y2N A;  3V39 A;  3HLG A;  1XA1 A;  2EXA A;  3LEZ A;  1GHM A;  5EVI A;  3G34 A;  2ZM0 A;  1W8Y A;  3TG9 A;  2OLV A;  5BOH A;  3HRE A;  3GTC A;  5FAQ A;  3GVB A;  1K55 A;  2Q9N A;  1ESU A;  1YMX A;  3O87 A;  4KZ8 A;  4WM9 A;  1K38 A;  3E2K A;  1CI8 A;  4X68 A;  3C4O A;  5FI6 A;  3ZG8 B;  3N7W A;  3VMA A;  1LL9 A;  4WZ5 A;  3G32 A;  4PM6 A;  2WYX A;  4QD4 A;  3ZVW A;  4S2N A;  5F82 A;  3WS0 A;  4GZB A;  2XD1 A;  2ZC3 B;  5A91 A;  2EX9 A;  5CTN A;  1KVM A;  2V2F F;  4OQ0 A;  4QY5 A;  1LLB A;  3NIA A;  1IYQ A;  3PBN A;  3DW0 A;  1NXY A;  4KQR A;  1TEM A;  3G2Y A;  5FAO A;  1EWZ A;  1K6R A;  1TDL A;  3B3X A;  3PBO A;  3SH9 A;  1YLP A;  5CGW A;  3M6H A;  2R9X A;  3BFG A;  3A3F A;  3RXX A;  5CEB A;  1ES3 A;  1I2S A;  2WZX A;  4E3M A;  3BFD A;  3HLD A;  1BLC A;  4PM5 A;  1DJC A;  5HW3 A;  4OOM A;  1PZP A;  1M40 A;  2ZLY A;  1WE4 A;  1FSW A;  5EE8 A;  1MWU A;  3BFE A;  1W7F A;  3VP3 A;  4U0T A;  1N4O A;  4E3L A;  3PBS A;  4OPR A;  3WWX A;  1PIO A;  1JWZ A;  4PM8 A;  1FCN A;  4KZ5 A;  4UA6 A;  3PAE A;  3QNB A;  4UHU A;  3IHB A;  5M18 A;  4JF6 A;  1SDE A;  4Y7P A;  4KEN B;  3ZG9 B;  3CG5 A;  3V3R A;  2HP9 A;  1BTL A;  4MBK A;  3VFF A;  1HVB A;  1XKZ A;  1ZKJ A;  4EWF A;  4BLM A;  5E2H A;  4EBP A;  3Q81 A;  1K57 A;  3Q07 A;  4XUX A;  4DDY A;  3CZD A;  4UA7 A;  4C75 A;  1QME A;  3VP1 A;  1XXM A;  2EX2 A;  2XK1 A;  4JF4 A;  4PM7 A;  1E3U A;  5HAI A;  2HDS A;  2HDU A;  1L0G A;  2PBY A;  3SH7 A;  3OZH A;  3TOI A;  3MZD A;  1YM1 A;  3M6B A;  1HZO A;  1NZO A;  2CC1 A;  3PBT A;  4ZBE A;  4E6W A;  3IF6 B;  5L2F A;  4UA9 A;  5KZH A;  5DF8 A;  4R4S A;  4HBU A;  1GA0 A;  2XQZ A;  2WGW A;  4OQG A;  2XFS A;  2XFT A;  5KMW A;  3S4X A;  2WGI A;  1SHV A;  2G2W A;  3BLM A;  4N9L A;  5GHZ A;  4JPM A;  2XLN A;  4R3B A;  3V50 A;  3S1Y A;  5CXW A;  1ES4 A;  3FYZ A;  1DJB A;  4GD6 A;  4YFM A;  1QMF A;  4FH2 A;  3IXB A;  1K54 A;  5GLB A;  3ZDJ A;  1BLS A;  2JE5 A;  1BLP A;  5DTT A;  3A3D A;  4S2O A;  4UAA A;  4N9K A;  4P85 A;  3SH8 A;  1S0W A;  1YT4 A;  4OOL A;  4DE0 A;  4GDN A;  1ERM A;  2ZQ7 A;  1RGZ A;  1DY6 A;  4WMC D;  5F1G A;  1L2S A;  1NYM A;  1KDS A;  3N6I A;  3IQA A;  3CJM A;  3G4P A;  4FH4 A;  4MNR A;  4S2P A;  3IXD A;  5CTM A;  4OVD A;  3V5M A;  4GNU A;  5FAT A;  1NZU A;  1Z6F A;  5F83 A;  1KGF A;  1Y54 A;  3O86 A;  1E25 A;  3E2L A;  3W4P A;  2QPN A;  3N8S A;  1FSY A;  1I2W A;  3AGE A;  3A3I A;  2FFY A;  1W79 A;  4R4R A;  4X6T A;  3PTE A;  1TDG A;  5KSH A;  3UDF A;  4D2O A;  1NYY A;  4ZDX A;  4R23 A;  5EUA A;  3A3E A;  2QZ6 A;  4GD8 A;  4KZ9 A;  3NDE A;  4C6Y A;  4HEF A;  4LV1 A;  3G35 A;  5CHM A;  2JC7 A;  4KG2 A;  5FI2 A;  2WKI A;  1H5X A;  1DJA A;  4OKP A;  4DDS A;  1O07 A;  4QHC A;  4EBL A;  1H8Y A;  1K4E A;  3UPN A;  1E4D A;  3G2Z A;  1XGJ A;  2Y4A A;  1PW8 A;  4S2M A;  1JTG A;  1GHI A;  1RCJ A;  2Y55 A;  4WEL A;  4NET A;  3ZNY A;  1J9M A;  1ONG A;  3Q1F A;  2C6W B;  1H8Z A;  1HTZ A;  1MPL A;  4BEN A;  1PWG A;  2ZJ9 A;  3DWZ A;  4OON A;  4S2J A;  5GLC A;  3UDI A;  5KSC A;  4Y0O A;  1ALQ A;  4X53 A;  5GL9 A;  1ESI A;  4WMC A;  3N4I A;  3C7V A;  4OLG A;  5GLA A;  2XD5 A;  3PAG A;  4QY6 A;  2Y2G A;  3EQV A;  3PBR A;  2G2U A;  4JBF A;  5EVI B;  3BEC A;  4X56 A;  3IF6 C;  5FQM A;  1U60 A;  1GHP A;  4B88 A;  2XR0 A;  2HP5 A;  4S2K A;  1ERQ A;  5DF7 A;  4DXB A;  2PU2 A;  4FD8 A;  2WK0 A;  1LI9 A;  5E43 A;  3OPP A;  3Q82 A;  1BZA A;  5HFO A;  1YMS A;  3ZVT A;  4X55 A;  2J8Y A;  2P74 A;  2XF3 A;  3OCL A;  3IH8 A;  1PWD A;  1IKG A;  2Y2K A;  4L0L A;  1W5D A;  5FQJ A;  1SKF A;  5FDH A;  2WGV A;  3RXW A;  4BD1 A;  2X02 A;  4OP5 A;  5A93 A;  4E6X A;  4OOY A;  3MFD A;  2Y59 A;  3MXR A;  3HLC A;  2Y2H A;  4LCL A;  5CED A;  3GQZ A;  2H0T A;  4XUZ A;  4KG5 A;  2XH9 A;  4QJG A;  1NY0 A;  4RYE A;  1XPB A;  3SS5 A;  2ZMA A;  2WAE A;  3ZG0 A;  4ZAM A;  4HES A;  1AXB A;  1PI5 A;  3ZCZ A;  5HX9 A;  5EOO A;  4M3K A;  3NDG A;  3RJU A;  5JYO A;  2ZQ8 A;  4MEZ A;  4GKU A;  2OSU A;  1GCE A;  5D3O A;  1MBL A;  4OPQ A;  1HD8 A;  1K4F A;  4HBT A;  4E3J A;  3ISG A;  1W8Q A;  3HUO A;  4MBH A;  5CER A;  4F94 A;  1YLY A;  5IHV A;  1ZC2 A;  1KGE A;  3GR2 A;  2V20 A;  1BUE A;  3N8L A;  3NC8 A;  4OPZ A;  2UWX A;  4DKI A;  2BLS A;  1XX2 A;  1K54 C;  4P6B A;  1L0F A;  2WZZ A;  4IVI A;  1BLH A;  3BRM A;  4WEJ A;  5GHX A;  5M1A A;  4E3O A;  4B4X A;  5AQ9 A;  4KZ4 A;  4WZ4 A;  4LEN A;  3AGF A;  3P98 A;  3LY4 A;  2V1Z A;  4OQI A;  5EOE A;  3QNC A;  2P9V A;  4JKT A;  3Q7Z A;  1IYO A;  3C4P A;  3OPH A;  3UNW A;  5FAP A;  3SS4 A;  1NRF A;  3IXG A;  4N92 A;  2ZQD A;  1FQG A;  4K0X A;  4S2L A;  1K56 D;  3GMW A;  3W8K A;  1YLZ A;  3IWO A;  1BT5 A;  1ES2 A;  1XA7 A;  2WAD A;  4RA7 A;  4MLL A;  4R1G A;  3V3S A;  3HUM A;  1JVJ A;  3LO7 A;  1RP5 A;  2HDQ A;  3MZE A;  3IHA A;  4Z9Q A;  1CI9 A;  4GOG A;  4GN2 A;  1XP4 A;  5A92 A;  5AQA A;  2XDM A;  3EQU A;  3VP0 A;  5CGX A;  4U0X A;  2QMI A;  4BD0 A;  2WGW B;  1MKI A;  4EUZ A;  3ZFZ A;  1FCO A;  2EX8 A;  4KZA A;  5J8X A;  3HLF A;  2A3U A;  3MKE A;  4N1H A;  2H0Y A;  1FR1 A;  2FFF B;  1MWR A;  5EVI C;  3UY6 A;  1PYY A;  5DVA A;  4IBX A;  5G18 A;  3QHY A;  1JWP A;  1BUL A;  1K55 C;  3TSG A;  4B4Z A;  3M2K A;  4GDB A;  4E3I A;  3VP4 A;  1M6K A;  5FI7 A;  1ZG4 A;  1YLT A;  2ZM8 A;  3NY4 A;  5CEC A;  3LCE A;  4WZ5 C;  2IWD A;  5GHY A;  4S2I A;  3Q7V A;  4DXC A;  1MXO A;  4S2N C;  3MBZ A;  4RX3 A;  5HAQ A;  3FKV A;  4PM9 A;  4MBF A;  1PW1 A;  1CK3 A;  4KZ7 A;  2JBF A;  1N9B A;  3G30 A;  5U47 A;  4P0M A;  3ZHH A;  1GA9 A;  4R3J A;  3BYD A;  3GRJ A;  3JYI A;  4FCF A;  1K6S A;  3AGD A;  5I94 A;  3W4Q A;  5F1F A;  5CGS A;  1K56 A;  1NJ4 A;  1RGY A;  4BL3 A;  4XXR A;  3IWI A;  2Q9M A;  5DTK A;  2ZC5 B;  5FQQ A;  1ONH A;  1KE0 A;  4ZJ2 A;  3ITB A;  5EPH A;  5GLD A;  1KE4 A;  1VM1 A;  3BFC A;  3VOZ A;  1CEG A;  2XGN A;  1Q2Q A;  1MWT A;  1G68 A;  5FAS A;  4C3Q A;  2ZQA A;  2B5R A;  3SS3 A;  4DE3 A;  5HL1 A;  5AQ7 A;  4BQM A;  4KQO A;  2RL3 A;  5E2F A;  1WYC A;  4JXG A;  3UO9 A;  2OLU A;  2PU4 A;  3NI9 A;  2RCX A;  2H10 A;  3FZC A;  3IWQ A;  2EXB A;  3Q7V B;  1L0D A;  2ZC4 B;  3LY3 A;  4JLF A;  1LI0 A;  2DCF A;  2HPB A;  4KG6 A;  2R9W A;  3VSL A;  3WRT A;  5TR7 A;  2ZM2 A;  2A49 A;  1E3U D;  4K0W A;  4KZB A;  3S22 A;  3CMZ A;  5E2G A;  2Y91 A;  3DTM A;  3FV7 A;  4YIN A;  1K25 A;  3OCN A;  4LV0 A;  3UDX A;  4IVK A;  4WYY A;  2I72 A;  3WS4 A;  1JWV A;  1G6A A;  3UE0 A;  1K57 C;  1CEF A;  5M19 A;  2X01 A;  2BG1 A;  2WAF A;  3O3V A;  3C7U A;  3WRZ A;  4X69 A;  2J9O A;  3HVF A;  5CHU A;  1S6R A;  1YQS A;  3HL9 A;  3HLB A;  2EX6 A;  4U3T A;  4Y0U A;  3SOI A;  3G31 A;  4WBG A;  4A5R A;  4CPK A;  3OPL A;  3I7J A;  2Y2J A;  4LV2 A;  4ZTK A;  3P09 A;  2Y2M A;  3VSK A;  4KZ6 A;  5DF9 A;  2OV5 A;  2VGK A;  3MXS A;  3HUN A;  4H8R A;  1YLJ A;  3IF6 A;  2X71 A;  4PMA A;  1IKI A;  3UE1 A;  2ZC6 B;  1C3B A;  3C5A A;  5E2E A;  4ZJ1 A;  3FWL A;  1KDW A;  1KGG A;  4O7D A;  4R0Q A;  5FQ9 A;  3ZNT A;  4KQQ A;  3N8R A;  5HAP A;  1KVL A;  4IBR A;  4EQI A;  4Y0T A;  2JCH A;  2WKE A;  4E3N A;  3DWK A;  4PPR A;  2ZQ9 A;  1IYP A;  2HDR A;  3PBQ A;  1MWS A;  2J7V A;  4JXS A;  4P87 A;  4QU3 A;  1XGI A;  2J9P A;  2DNS A;  2Y2O A;  3VFH A;  3GSG A;  3OC2 A;  4RX2 A;  2DRW A;  2Z2L B;  3D4F A;  2Z2M B;  4Q8I A;  4KZ3 A;  1LL5 A;  4OPY A;  1L0E A;  3WS2 A;  3O88 A; 
#chains in the Genus database with same CATH topology
 5AVF A;  4EER A;  1YLW A;  3IT9 A;  4OQH A;  4QB8 A;  2E8I A;  2HP6 A;  4HOI A;  4E3K A;  4I39 A;  1FCM A;  1MY8 A;  4H6J A;  1YKD A;  3NCK A;  2H5S A;  1SCW A;  2ZC7 A;  1PWC A;  1VHM A;  3NHQ A;  2ZQC A;  3WS1 A;  3ZGA B;  3BEB A;  4EBN A;  1OME A;  2P9V B;  4NK3 A;  3HLE A;  4UQI M;  1PFL A;  2L0W A;  2YKF A;  3V67 A;  2Y2I A;  4LRX C;  2XEP A;  2KOI A;  3FKW A;  4DE1 A;  4EV4 A;  2Y79 A;  5EEC A;  2Y2P A;  4HJ4 A;  1VQQ A;  3HLG A;  3UB8 A;  2EXA A;  5EVI A;  3HRE A;  1K55 A;  1ESU A;  3BY9 A;  1YMX A;  4KZ8 A;  1K38 A;  4ETX A;  3VMA A;  2WYX A;  5F5Y A;  4LFU A;  3EOI A;  1J3W A;  2XD1 A;  2EX9 A;  5HSQ A;  3PBN A;  3G2Y A;  5FAO A;  4GCZ A;  3PBO A;  3LR5 A;  1YLP A;  2WKP A;  2R9X A;  3RXX A;  3KSG A;  1CJF A;  2I9V A;  2W1T B;  4E3M A;  1XJ4 A;  2LB9 A;  1W63 Q;  1PZP A;  1WE4 A;  4U0T A;  5IS1 A;  3PBS A;  3T12 B;  1JWZ A;  4UQI S;  3IBJ A;  3VE3 A;  4I5S A;  4BBV A;  3F1P B;  5M18 A;  1F98 A;  4Y7P A;  3CG5 A;  3V3R A;  1BTL A;  1XKZ A;  4DDY A;  2L1M A;  4R70 A;  3UB7 A;  2XK1 A;  5HAI A;  1L0G A;  2CMN A;  3OZH A;  3MQQ A;  3MZD A;  3M6B A;  1NZO A;  4ZBE A;  4WL9 A;  3EGD C;  5DF8 A;  3LUQ A;  4BBU A;  3MS6 A;  1T1B A;  1D7E A;  2XFT A;  5HWT A;  1SHV A;  1S4S A;  2J3W A;  2XLN A;  3V50 A;  2XRO A;  1TS8 A;  2EA9 A;  3FYZ A;  4GD6 A;  2PHY A;  1K54 A;  2QYB A;  1ZTU A;  3L9K A;  5DTT A;  4DN0 A;  4S2O A;  4OOL A;  4GDN A;  2ZQ7 A;  3NJA A;  2W3E A;  4WMC D;  3F1O B;  3G4P A;  2M1C A;  4S2P A;  3IXD A;  4HH2 A;  3TJZ C;  3BWL A;  3W4P A;  3N8S A;  3U4L P;  3A3I A;  1TDG A;  3JPU A;  2QZ6 A;  4GD8 A;  4HEF A;  2A2L A;  4LV1 A;  5CHM A;  4KG2 A;  5FI2 A;  2VGL M;  2Y8H A;  2QWS A;  4S2M A;  4BMW A;  3CHW P;  4ETZ A;  2M7V A;  1PWG A;  3LR4 A;  4OON A;  5GLC A;  5KSC A;  4ESP A;  1ESI A;  3C7V A;  3H82 B;  2Y2G A;  2G2U A;  3IF6 C;  1XJ2 A;  4I3I A;  4B88 A;  4S2K A;  4FD8 A;  2EWV A;  3Q82 A;  1BZA A;  2J8Y A;  2XF3 A;  4EU0 A;  4L0L A;  1W5D A;  5FDH A;  2WGV A;  2X02 A;  4OP5 A;  5A93 A;  4E6X A;  4OOY A;  2Y2H A;  4LCL A;  3GQZ A;  4KG5 A;  1XPB A;  2W3D A;  3ZCZ A;  2ZOI A;  4EXO A;  3F1N A;  1HD8 A;  4F94 A;  4E3J A;  4O8G A;  4OPZ A;  3NC8 A;  3B47 A;  1XX2 A;  2VGL S;  1L0F A;  2WZZ A;  3GDI A;  4IVI A;  2ZMV A;  1BLH A;  4B4X A;  1XFQ A;  3C2W A;  3P98 A;  2V1Z A;  1OTI A;  3Q7Z A;  1NLY A;  2ZQD A;  1FQG A;  1YLZ A;  1XJ6 A;  1ES2 A;  4R1G A;  4F3L A;  3LO7 A;  1RP5 A;  2HDQ A;  2ZL1 A;  3MZE A;  3IHA A;  1CI9 A;  4GOG A;  3EQU A;  3VP0 A;  4L9F A;  3IS2 B;  4U0X A;  1FCO A;  2EX8 A;  5J8X A;  2H0Y A;  2D01 A;  4GS9 A;  5EVI C;  5HDC A;  1K55 C;  1M6K A;  5FI7 A;  1YLT A;  3NY4 A;  3KYQ A;  2P04 A;  1PW1 A;  4II7 A;  2JBF A;  3G30 A;  3ZHH A;  3BYD A;  3T1S A;  2XSS A;  3BW6 A;  5CGS A;  1NJ4 A;  1RGY A;  4BL3 A;  4IUH A;  3IWI A;  4XXR A;  1KE0 A;  4NXE A;  5GLD A;  1KE4 A;  1VM1 A;  5HD5 A;  3VOZ A;  1G68 A;  3L7H A;  3JVU A;  4Y13 A;  5HL1 A;  2RL3 A;  1WYC A;  4JXG A;  3LR0 A;  5F6A A;  2OLU A;  4QWO A;  4GHI B;  1VB6 A;  5TR7 A;  3LIF A;  4KZB A;  3S22 A;  1K25 A;  4LV0 A;  3UDX A;  1JWV A;  3GEC A;  3LIC A;  4R38 A;  2A24 B;  4X69 A;  2J9O A;  4NXF A;  4Y0U A;  4RQ9 A;  3DTK A;  4CPK A;  3D3O A;  2Y2J A;  4ZTK A;  3P09 A;  5DF9 A;  2OV5 A;  4H8R A;  3UE1 A;  3C30 A;  4ZJ1 A;  3S7Q A;  4O7D A;  4R0Q A;  3ZNT A;  5FQ9 A;  5HPF A;  3LR3 A;  4EQI A;  4Y0T A;  2V8F A;  4E3N A;  1IYP A;  1MWS A;  4JXS A;  4P87 A;  2DNS A;  1T1A A;  1LSX A;  2ZMF A;  3OC2 A;  4KQD A;  2Z2M B;  4NEE D;  5G4Z A;  4EQ1 A;  4ID4 A;  5EFW A;  3UPP A;  4BL2 A;  2VGJ A;  4B9O A;  1I5Q A;  3IF5 A;  5EVL A;  5KIZ A;  4HH3 A;  5EVI D;  1BYW A;  4DJ3 A;  2W3H A;  4PKY G;  1PRQ A;  4ARZ A;  1TS6 A;  4LV3 A;  3H7W A;  4G3V A;  3HBR A;  5F69 A;  1TVF A;  4DF6 A;  4FSF A;  3OPR A;  2PT7 A;  2WKH A;  2W0N A;  1LHY A;  3T1X A;  3NBL A;  1FR6 A;  2EFU A;  1Q2P A;  2IWB A;  1S1Z A;  1ERO A;  5TGF A;  4OLD A;  5TBM B;  4H6J B;  1FOF A;  1O7E A;  2JKR I;  5AQB A;  3GV9 A;  4DE2 A;  4IED A;  4K91 A;  2J80 A;  3LEZ A;  3G34 A;  2QJ5 A;  4QPR A;  3GTC A;  5BOH A;  5EVE A;  2K31 A;  3E2K A;  5FEF A;  1OJG A;  5FI6 A;  3ZG8 B;  3CUE A;  4QD4 A;  4NXG A;  3WS0 A;  2ZC3 B;  1MC0 A;  4EES A;  3MF0 A;  2ZBB A;  3SZT A;  1NXY A;  1TEM A;  4R6L A;  1K6R A;  3B3X A;  1ZHH B;  5CGW A;  1ES3 A;  2WZX A;  4PM5 A;  1DJC A;  4IHQ A;  4OOM A;  1DP6 A;  1N9L A;  1FSW A;  3BFE A;  5EE8 A;  3WWX A;  3IX8 A;  2Z6C A;  1FCN A;  3QNB A;  3S7N A;  3T50 A;  2PAV P;  4MBK A;  3T4J A;  4AFI A;  4FUW A;  3HJI A;  4XUX A;  2O9C A;  3CZD A;  2LB5 A;  5K5B A;  4HHD A;  4C75 A;  3P7N A;  1QME A;  2V8C A;  3VP1 A;  2OAQ 1;  1XXM A;  4PM7 A;  3MMH A;  4NKP A;  4NG2 A;  3VV4 A;  2Q0O A;  2XFS A;  4M4X A;  3S4X A;  2WGI A;  3LGO A;  5CXW A;  4I3J A;  1N9O A;  1GSX A;  3R4K A;  4HIA A;  4CQH A;  3ZDJ A;  4JGQ A;  1VEU A;  1BLP A;  4N9K A;  4ZRR A;  3HJK A;  1DY6 A;  1L2S A;  1NYM A;  1XJ3 A;  1YSQ A;  4XT2 A;  4MNR A;  3K3C A;  5FAT A;  1NZU A;  3B33 A;  2VLG A;  5F83 A;  1G5U A;  2V1A A;  3OBF A;  2QPN A;  1IOU A;  4R4R A;  1I2W A;  4X6T A;  3PTE A;  1OTE A;  5HZH A;  3UDF A;  1NYY A;  4L9E A;  2O9B A;  3E98 A;  5EUA A;  4KZ9 A;  2PYR A;  1H5X A;  1K4E A;  3T1R A;  3UPN A;  3G2Z A;  4MCW A;  3H9W A;  1RCJ A;  2Y55 A;  4NET A;  3ZNY A;  3A0S A;  2C6W B;  2Z6D A;  5L10 A;  1HLU P;  3UDI A;  4X53 A;  4EEP A;  3DTE A;  2VJW A;  4Y5F A;  3N4I A;  1YPR A;  4FOF A;  4OLG A;  3PBR A;  3BEC A;  1GHP A;  3NEC A;  2XR0 A;  2HP5 A;  2INW A;  1H8M A;  5DF7 A;  4DXB A;  2WK0 A;  3IX3 A;  3OPP A;  5E43 A;  3ZVT A;  2VK3 A;  2P74 A;  1IKG A;  2Y2K A;  5A8B A;  1SKF A;  3LI8 A;  3RXW A;  4BD1 A;  3LFV A;  1AWI A;  3MXR A;  1F9I A;  5HDD A;  2JKT M;  3CI6 A;  2XH9 A;  4QJG A;  1NY0 A;  2ZMA A;  3NOP C;  3ZG0 A;  4HES A;  5HX9 A;  5EOO A;  1OTD A;  4M3K A;  3NDG A;  2ZQ8 A;  4MEZ A;  2V9A A;  4LRY C;  3ISG A;  3HUO A;  4Y3I A;  1KGE A;  3GR2 A;  1BUE A;  4CLC C;  4P6B A;  2VV6 A;  4GW9 A;  3BRM A;  5GHX A;  3LIE A;  4KZ4 A;  2OWJ A;  4LEN A;  2V1B A;  3QNC A;  2P9V A;  3MFX A;  1IYO A;  3C4P A;  3OPH A;  3UNW A;  5FAP A;  3SS4 A;  1NRF A;  3IXG A;  2BTF P;  3GMW A;  3W8K A;  3HUM A;  1JVJ A;  1SKO A;  4Z9Q A;  4GN2 A;  1XP4 A;  2XDM A;  1YSP A;  5CGX A;  4BD0 A;  2VV7 A;  2WGW B;  3RTY A;  3HLF A;  3KX0 X;  3MKE A;  1FR1 A;  2FFF B;  1MWR A;  1NRJ A;  3UB5 P;  5G18 A;  3QHY A;  1JWP A;  3T4L A;  4GDB A;  2L4R A;  4E3I A;  2ZM8 A;  1W63 M;  3CUE C;  1MXO A;  3FKV A;  4PM9 A;  4MBF A;  4KZ7 A;  2XA7 M;  5U47 A;  1NLZ A;  5I5L A;  3JYI A;  3AGD A;  2FH5 A;  2KLI A;  1ONH A;  1Y4O A;  3ITB A;  3BFC A;  1Q2Q A;  5FAS A;  2W1T A;  5AQ7 A;  4BQM A;  5E2F A;  2VEA A;  4MN5 A;  2PRF A;  4X25 A;  3FZC A;  3BQ8 A;  2ZC4 B;  4JLF A;  2DCF A;  3WRT A;  3F1P A;  1XFN A;  5EM0 A;  2Y91 A;  3FV7 A;  4YIN A;  3E4P A;  4K08 A;  3WS4 A;  1G6A A;  5M19 A;  3QP6 A;  2WAF A;  3HVF A;  1YQS A;  3SOI A;  2EX6 A;  1SZV A;  3G31 A;  4LV2 A;  2P7J A;  3VSK A;  4CLC D;  4HP9 A;  1C3B A;  5LBR A;  3FWL A;  1KDW A;  2JKR M;  4KQQ A;  3N8R A;  1KVL A;  4WLA A;  2PD7 A;  2WKE A;  4I38 A;  2ZQ9 A;  3PBQ A;  3BQA A;  2J7V A;  2XA7 S;  5CX7 A;  2J9P A;  2Y2O A;  5F68 A;  4KZ3 A;  4L9G A;  3WS2 A;  4CJN A;  3BLS A;  3UPO A;  1WYB A;  4BWI A;  4OP8 A;  3BM6 A;  4MDZ A;  1EI5 A;  2GDN A;  3WS5 A;  3MSH A;  4GB7 A;  3BJN A;  4DRT A;  4P6Z M;  5HAR A;  1TS0 A;  3DTI A;  3M2J A;  5TFQ A;  3LIA A;  2C5W B;  4WEK A;  1PZO A;  1ES5 A;  1UGU A;  3C38 A;  2JKT I;  2IWC A;  3UN7 A;  5EV0 A;  5J3W A;  3KYE A;  4N1X A;  5CHJ A;  5A90 A;  3T4Q A;  1G28 A;  5FSR A;  3OLO A;  1T1C A;  4ZJ3 A;  2D02 A;  5DKK A;  2R78 A;  1BSG A;  2KDK A;  5MC7 A;  3VOY A;  4WN5 A;  1IEM A;  3HLW A;  3MXQ A;  4JF5 A;  1IYS A;  3KSI A;  4X1M A;  3ZG5 A;  3H82 A;  3V39 A;  4Q0H A;  2VZW A;  5AVE A;  1W8Y A;  3CPT B;  2OLV A;  4EET B;  3GVB A;  2Q9N A;  3O87 A;  2H28 A;  4EEU A;  1CI8 A;  3C4O A;  1LL9 A;  3G32 A;  4IUK A;  3MQ0 A;  4S2N A;  2NUT C;  4GZB A;  2HGV A;  4QY5 A;  5IU1 A;  3KYZ A;  4P6Z S;  1UWP X;  1EWZ A;  1TDL A;  3LID A;  3M6H A;  5CEB A;  3A3F A;  1I2S A;  3P01 A;  3BFD A;  3HLD A;  1BLC A;  4LGW A;  3IBR A;  5HW3 A;  2UV0 E;  2ZLY A;  1MWU A;  1W7F A;  1N4O A;  4E3L A;  4OPR A;  4PM8 A;  4KZ5 A;  4UHU A;  3CLO A;  2DMW A;  3IHB A;  3TW8 A;  2YKH A;  3CIT A;  2HP9 A;  3R7W B;  3VFF A;  4EWF A;  5E2H A;  1K57 A;  3Q07 A;  3T4T A;  3UMD A;  1VET B;  1LL8 A;  4JGP A;  2HDS A;  3FG8 A;  3SH7 A;  3TOI A;  4HP4 A;  1YM1 A;  2CC1 A;  3PBT A;  4MN7 A;  4E6W A;  3IF6 B;  5L2F A;  4UA9 A;  4ME4 A;  3IS2 A;  5KZH A;  1GA0 A;  4OQG A;  2K2N A;  3BLM A;  3UB6 A;  3S1Y A;  1ES4 A;  1DJB A;  1IFQ A;  4CLC A;  3D72 A;  1QMF A;  4FH2 A;  2V0U A;  2J3T C;  2JE5 A;  4UAA A;  3QP1 A;  4P85 A;  3SH8 A;  3FPW A;  1RGZ A;  3N6I A;  3CJM A;  4FH4 A;  4B93 A;  1STZ A;  4GNU A;  2VX8 A;  1Y54 A;  3O86 A;  1E25 A;  3E2L A;  1FSY A;  3AGE A;  1W79 A;  3G6O A;  4I3A A;  4D2O A;  5AJG A;  4R3A A;  4ZDX A;  4R23 A;  4Q0J A;  1VEU B;  3A3E A;  4GHI A;  1OTB A;  4C6Y A;  1P97 A;  3G35 A;  2JC7 A;  1DJA A;  4OKP A;  1O07 A;  3IX4 A;  3EGX C;  1E4D A;  4E04 A;  2PDR A;  3EEH A;  4XT2 B;  2Y4A A;  1PW8 A;  1JTG A;  1GHI A;  4WEL A;  2A24 A;  3Q1F A;  3MQO A;  3VOL A;  2ZJ9 A;  3DWZ A;  4S2J A;  1ALQ A;  5GLA A;  3EQV A;  1LT0 A;  4JBF A;  5EVI B;  3QP4 A;  4X56 A;  1OT6 A;  1DP9 A;  1U60 A;  5FQM A;  3PHY A;  4YOF A;  4EUV A;  3MJQ A;  1LI9 A;  1YMS A;  4X55 A;  2PR6 A;  3IH8 A;  1PWD A;  1Y28 A;  3U2A A;  3HCY A;  3E0Y A;  1TF1 A;  3MFD A;  2B02 A;  4DMZ A;  3HLC A;  5CED A;  2H0T A;  4XUZ A;  4G3K A;  4RYE A;  5IT5 A;  4ZAM A;  1AXB A;  1PI5 A;  5JYO A;  5C5K A;  5D3O A;  4OPQ A;  4MBH A;  5CER A;  1N9N A;  2V20 A;  2UWX A;  2BLS A;  2J3T D;  3KO6 A;  5M1A A;  4E3O A;  4WZ4 A;  3AGF A;  3JVV A;  4EW7 A;  3FPV A;  3O5Y A;  5G4Y A;  4K0X A;  3IWO A;  4RA7 A;  4MLL A;  2HV1 A;  3FC7 A;  3KSF A;  5HPI A;  5TBM A;  4PAU A;  4EUZ A;  3ZFZ A;  1CF0 A;  5DJU A;  1V9Z A;  4N1H A;  2VV8 A;  3UY6 A;  1F5M A;  5DVA A;  5HWV A;  5EM1 A;  4WUJ A;  1PNE A;  3EWK A;  3CAX A;  4Y17 A;  4B4Z A;  2ACG A;  3OOV A;  5CEC A;  3LCE A;  4O0P A;  1SKO B;  5GHY A;  4FTX A;  3Q7V A;  3PR6 A;  4DXC A;  4S2N C;  3MBZ A;  4RX3 A;  1CK3 A;  4HJ6 A;  4G3W A;  4P0M A;  1GA9 A;  2E8J A;  4FCF A;  1K6S A;  3W4Q A;  1K56 A;  3S7O A;  5DTK A;  2VA0 A;  5FQQ A;  4ZJ2 A;  3W2Z A;  4UEY A;  1MWT A;  1S66 L;  4C3Q A;  2ZQA A;  3SS3 A;  4LRZ E;  2PU4 A;  3NI9 A;  2G7U A;  2RCX A;  2W27 A;  3IWQ A;  1L0D A;  2HPB A;  3VSL A;  4KG6 A;  3T4S A;  2ZM2 A;  2A49 A;  1E3U D;  2QJ7 A;  3OCN A;  2K7S A;  4WYY A;  2I72 A;  2OOL A;  2O9A A;  3UE0 A;  1K57 C;  1CEF A;  2NUP C;  3O3V A;  5J4E A;  3CWF A;  3LIB A;  1CQA A;  3HL9 A;  3HLB A;  4WBG A;  2BAS A;  5L07 A;  4GJ4 A;  2HZ5 A;  3OPL A;  2M7U A;  2Y2M A;  4KZ6 A;  5L09 A;  2VGK A;  3MXS A;  3HUN A;  1YLJ A;  5L8M A;  2WKR A;  2X71 A;  4PMA A;  1H3Q A;  5E2E A;  4X1L A;  5HAP A;  1MZU A;  3E4O A;  4PPR A;  2P08 A;  1S1Y A;  1XGI A;  3GSG A;  4RX2 A;  4Q8I A;  5DFX A;  1KE3 A;  4WF0 A;  4LCM A;  3IXH A;  2Y2L A;  4JXV A;  3SW1 A;  3F1N B;  3MKF A;  1S4R A;  1K0K A;  4OH0 A;  1MKM A;  2EFX A;  3IH9 A;  3PXP A;  1IEL A;  3A3J A;  3S7P A;  5DTS A;  1ZG6 A;  3E4Q A;  3BFF A;  2Y2Q A;  3NOT C;  1V9Y A;  4RVA A;  4BJP A;  5FQI A;  5JYP A;  5FQK A;  3ZG7 B;  2HJE A;  2JKG A;  4F3L B;  3W4O A;  1YAX A;  2PR5 A;  2ZL1 B;  1EW0 A;  1KOU A;  3ITA A;  3TE8 A;  3VP2 A;  5CRF A;  3T4O A;  4JXW A;  1PI4 A;  3NUL A;  1OPX A;  2WUQ A;  1SDN A;  1S67 L;  4Z1W A;  1JTD A;  3UE3 A;  3MZF A;  5FA7 A;  2ZD8 A;  4PKY A;  2Y2N A;  4GS9 B;  1XA1 A;  1GHM A;  2ZM0 A;  3C8C A;  3TG9 A;  5FAQ A;  4HNB A;  4WM9 A;  4X68 A;  2W3G A;  1T18 A;  3N7W A;  2FZ0 A;  4O01 A;  4WZ5 A;  4PM6 A;  1LSW A;  3ZVW A;  5F82 A;  5A91 A;  3VE4 A;  5CTN A;  1KVM A;  3EEA A;  2OAP 1;  2V2F F;  3DAV A;  2OWH A;  4OQ0 A;  1LLB A;  1P0Z A;  3NIA A;  1IYQ A;  3DW0 A;  4KQR A;  1ACF A;  1P9R A;  3SH9 A;  3BFG A;  3K2N A;  2QKP A;  1M40 A;  4CLC E;  3VP3 A;  1PIO A;  2EWW A;  4UA6 A;  3PAE A;  5DKL A;  4JF6 A;  1X0O A;  1SDE A;  5HL6 A;  4KEN B;  3ZG9 B;  1TS7 A;  4JGO A;  2JN7 A;  2PBD P;  1HVB A;  1ZKJ A;  4BLM A;  4EBP A;  3Q81 A;  4UA7 A;  5FDS A;  3BY8 A;  2EX2 A;  4JF4 A;  1E3U A;  2HDU A;  2PBY A;  2MJ6 A;  4HY8 A;  4GLQ A;  2VKS A;  1HZO A;  3F1O A;  4R4S A;  4HBU A;  2XQZ A;  2WGW A;  5KMW A;  4N9L A;  2G2W A;  5GHZ A;  4LLO B;  4JPM A;  4R3B A;  1OT9 A;  2GX5 A;  3RH8 B;  4IJG A;  4YFM A;  1DP8 A;  1G6O A;  3IXB A;  5GLB A;  1BLS A;  5DJT A;  4JGR A;  3A3D A;  5DFY A;  1S0W A;  1YT4 A;  3QP8 A;  4DE0 A;  1ERM A;  2W3F A;  2HF6 A;  2JHE A;  5F1G A;  1KDS A;  3K3D A;  3IQA A;  5CTM A;  4OVD A;  3V5M A;  1Z6F A;  1KGF A;  3UB9 A;  1WA9 A;  2FFY A;  4ARZ B;  2WKQ A;  5KSH A;  4CLC B;  3H7W B;  3NDE A;  4YWZ A;  2WKI A;  4MMN A;  4DDS A;  4QHC A;  2B18 A;  1LSV A;  2QHK A;  1H8Y A;  4EBL A;  1L3L A;  4Q0I A;  1XGJ A;  2KX6 A;  3QP5 A;  1OTA A;  4MN6 A;  1J9M A;  1DRM A;  1ONG A;  3UE6 A;  1H8Z A;  1HTZ A;  1MPL A;  4BEN A;  1F2K A;  4Y0O A;  3LI9 A;  5GL9 A;  4WMC A;  1ODV A;  2XD5 A;  3PAG A;  4QY6 A;  2PYP A;  1D1J A;  1ERQ A;  2PU2 A;  1FIK A;  5HFO A;  4NXB A;  1H0M A;  3OCL A;  5J7E A;  2O99 A;  5FQJ A;  3A0V A;  2Y59 A;  2JKF A;  3QP2 A;  3SS5 A;  2WAE A;  3RJU A;  5FL3 A;  4GKU A;  2OSU A;  1GCE A;  1MBL A;  1K4F A;  4HBT A;  2V0W A;  1W8Q A;  1YLY A;  3A0R A;  5IHV A;  1ZC2 A;  3N8L A;  3RFB A;  4KUK A;  2GZA A;  4DKI A;  4KUO A;  1OJ5 A;  3PYP A;  1K54 C;  4WEJ A;  3ULF A;  5AQ9 A;  3LEQ A;  1Z09 A;  3LY4 A;  4OQI A;  1NWZ A;  5EOE A;  4JKT A;  4N92 A;  3KSH A;  4S2L A;  3ZQ5 A;  1K56 D;  1BT5 A;  2WAD A;  1XA7 A;  3V3S A;  3ICY A;  5TJJ A;  4BBT A;  4HJ3 A;  3NOU C;  5HDS A;  2PD8 A;  3LYX A;  5A92 A;  5AQA A;  1UWN X;  2IA2 A;  1A0K A;  5FEG A;  2QMI A;  1MKI A;  3T1Q B;  4KZA A;  4DJ2 A;  2A3U A;  4YNR A;  1PYY A;  4IBX A;  3CPT A;  3DBA A;  1BUL A;  1JNU A;  3TSG A;  3B42 A;  3M2K A;  1GSW A;  3VP4 A;  1ZG4 A;  3T4K A;  4WZ5 C;  1TD5 A;  2IWD A;  4S2I A;  2W1R A;  2GNX A;  3ZYT A;  5HAQ A;  1N9B A;  1FIL A;  4R3J A;  3GRJ A;  1T19 A;  5I94 A;  5F1F A;  2Q9M A;  2ZC5 B;  4HI4 A;  5HD3 A;  4Y2F A;  5EPH A;  1CEG A;  2XGN A;  2HJ9 C;  2B5R A;  4DE3 A;  4KQO A;  1P9W A;  3UO9 A;  1D06 A;  2H10 A;  2EXB A;  3Q7V B;  3LY3 A;  2XRN A;  1LI0 A;  3D9Y A;  2R9W A;  4K0W A;  3MR0 A;  5HWW A;  3CMZ A;  5E2G A;  3DTM A;  2O0Y A;  4IVK A;  3R7W A;  2X01 A;  4PHT A;  3UME A;  2BG1 A;  3C7U A;  4HQA A;  3WRZ A;  4LPZ A;  1VET A;  5CHU A;  1S6R A;  4U3T A;  4A5R A;  3I7J A;  2B95 A;  3TRC A;  3IF6 A;  2AVX A;  2ZOH A;  1IKI A;  4Y15 A;  2ZC6 B;  3C5A A;  1KGG A;  2GJ3 A;  4IBR A;  2JCH A;  1GSV A;  3DWK A;  2HDR A;  4QU3 A;  3VFH A;  4D60 A;  2DRW A;  2Z2L B;  3D4F A;  1LL5 A;  4OPY A;  1L0E A;  3O88 A; 
#chains in the Genus database with same CATH homology
 4ID4 A;  4CJN A;  3UPP A;  4BL2 A;  1KE3 A;  3BLS A;  3UPO A;  4LCM A;  2VGJ A;  1WYB A;  3IXH A;  1YLW A;  1I5Q A;  3IF5 A;  4OP8 A;  2Y2L A;  3BM6 A;  3IT9 A;  1EI5 A;  2GDN A;  3WS5 A;  5EVL A;  4JXV A;  4OQH A;  4QB8 A;  5EVI D;  2E8I A;  3MKF A;  2HP6 A;  4GB7 A;  4DRT A;  4E3K A;  4OH0 A;  1FCM A;  5HAR A;  1MY8 A;  2EFX A;  3IH9 A;  3NCK A;  1IEL A;  2H5S A;  3A3J A;  1SCW A;  5DTS A;  2ZC7 A;  1PWC A;  1ZG6 A;  3M2J A;  5TFQ A;  2ZQC A;  4LV3 A;  3BFF A;  3HBR A;  2Y2Q A;  3WS1 A;  3ZGA B;  3BEB A;  4EBN A;  2C5W B;  1TVF A;  4DF6 A;  1OME A;  4FSF A;  2P9V B;  4RVA A;  4WEK A;  1PZO A;  1ES5 A;  3OPR A;  4NK3 A;  3HLE A;  4BJP A;  2WKH A;  5FQI A;  2IWC A;  5JYP A;  5FQK A;  1LHY A;  3UN7 A;  3ZG7 B;  3W4O A;  2Y2I A;  4N1X A;  5CHJ A;  5A90 A;  3NBL A;  1FR6 A;  2EFU A;  2XEP A;  3ITA A;  5FSR A;  4ZJ3 A;  1Q2P A;  2IWB A;  3VP2 A;  1BSG A;  1ERO A;  5CRF A;  3FKW A;  4JXW A;  3VOY A;  5TGF A;  4DE1 A;  1IEM A;  1PI4 A;  3HLW A;  2WUQ A;  4JF5 A;  4OLD A;  4EV4 A;  1FOF A;  1O7E A;  1SDN A;  5EEC A;  2Y2P A;  1IYS A;  5AQB A;  3GV9 A;  1JTD A;  3UE3 A;  4DE2 A;  3MZF A;  4IED A;  4K91 A;  2ZD8 A;  5FA7 A;  1VQQ A;  3ZG5 A;  2Y2N A;  3V39 A;  3HLG A;  1XA1 A;  2EXA A;  3LEZ A;  1GHM A;  5EVI A;  3G34 A;  2ZM0 A;  1W8Y A;  3TG9 A;  2OLV A;  5BOH A;  3HRE A;  3GTC A;  5FAQ A;  3GVB A;  1K55 A;  2Q9N A;  1ESU A;  1YMX A;  3O87 A;  4KZ8 A;  4WM9 A;  1K38 A;  3E2K A;  1CI8 A;  4X68 A;  3C4O A;  5FI6 A;  3ZG8 B;  3N7W A;  3VMA A;  1LL9 A;  4WZ5 A;  3G32 A;  4PM6 A;  2WYX A;  4QD4 A;  3ZVW A;  4S2N A;  5F82 A;  3WS0 A;  4GZB A;  2XD1 A;  2ZC3 B;  5A91 A;  2EX9 A;  5CTN A;  1KVM A;  2V2F F;  4OQ0 A;  4QY5 A;  1LLB A;  3NIA A;  1IYQ A;  3PBN A;  3DW0 A;  1NXY A;  4KQR A;  1TEM A;  3G2Y A;  5FAO A;  1EWZ A;  1K6R A;  1TDL A;  3B3X A;  3PBO A;  3SH9 A;  1YLP A;  5CGW A;  3M6H A;  2R9X A;  3BFG A;  3A3F A;  3RXX A;  5CEB A;  1ES3 A;  1I2S A;  2WZX A;  4E3M A;  3BFD A;  3HLD A;  1BLC A;  4PM5 A;  1DJC A;  5HW3 A;  4OOM A;  1PZP A;  1M40 A;  2ZLY A;  1WE4 A;  1FSW A;  5EE8 A;  1MWU A;  3BFE A;  1W7F A;  3VP3 A;  4U0T A;  1N4O A;  4E3L A;  3PBS A;  4OPR A;  3WWX A;  1PIO A;  1JWZ A;  4PM8 A;  1FCN A;  4KZ5 A;  4UA6 A;  3PAE A;  3QNB A;  4UHU A;  3IHB A;  5M18 A;  4JF6 A;  1SDE A;  4Y7P A;  4KEN B;  3ZG9 B;  3CG5 A;  3V3R A;  2HP9 A;  1BTL A;  4MBK A;  3VFF A;  1HVB A;  1XKZ A;  1ZKJ A;  4EWF A;  4BLM A;  5E2H A;  4EBP A;  3Q81 A;  1K57 A;  3Q07 A;  4XUX A;  4DDY A;  3CZD A;  4UA7 A;  4C75 A;  1QME A;  3VP1 A;  1XXM A;  2EX2 A;  2XK1 A;  4JF4 A;  4PM7 A;  1E3U A;  5HAI A;  2HDS A;  2HDU A;  1L0G A;  2PBY A;  3SH7 A;  3OZH A;  3TOI A;  3MZD A;  1YM1 A;  3M6B A;  1HZO A;  1NZO A;  2CC1 A;  3PBT A;  4ZBE A;  4E6W A;  3IF6 B;  5L2F A;  4UA9 A;  5KZH A;  5DF8 A;  4R4S A;  4HBU A;  1GA0 A;  2XQZ A;  2WGW A;  4OQG A;  2XFS A;  2XFT A;  5KMW A;  3S4X A;  2WGI A;  1SHV A;  2G2W A;  3BLM A;  4N9L A;  5GHZ A;  4JPM A;  2XLN A;  4R3B A;  3V50 A;  3S1Y A;  5CXW A;  1ES4 A;  3FYZ A;  1DJB A;  4GD6 A;  4YFM A;  1QMF A;  4FH2 A;  3IXB A;  1K54 A;  5GLB A;  3ZDJ A;  1BLS A;  2JE5 A;  1BLP A;  5DTT A;  3A3D A;  4S2O A;  4UAA A;  4N9K A;  4P85 A;  3SH8 A;  1S0W A;  1YT4 A;  4OOL A;  4DE0 A;  4GDN A;  1ERM A;  2ZQ7 A;  1RGZ A;  1DY6 A;  4WMC D;  5F1G A;  1L2S A;  1NYM A;  1KDS A;  3N6I A;  3IQA A;  3CJM A;  3G4P A;  4FH4 A;  4MNR A;  4S2P A;  3IXD A;  5CTM A;  4OVD A;  3V5M A;  4GNU A;  5FAT A;  1NZU A;  1Z6F A;  5F83 A;  1KGF A;  1Y54 A;  3O86 A;  1E25 A;  3E2L A;  3W4P A;  2QPN A;  3N8S A;  1FSY A;  1I2W A;  3AGE A;  3A3I A;  2FFY A;  1W79 A;  4R4R A;  4X6T A;  3PTE A;  1TDG A;  5KSH A;  3UDF A;  4D2O A;  1NYY A;  4ZDX A;  4R23 A;  5EUA A;  3A3E A;  2QZ6 A;  4GD8 A;  4KZ9 A;  3NDE A;  4C6Y A;  4HEF A;  4LV1 A;  3G35 A;  5CHM A;  2JC7 A;  4KG2 A;  5FI2 A;  2WKI A;  1H5X A;  1DJA A;  4OKP A;  4DDS A;  1O07 A;  4QHC A;  4EBL A;  1H8Y A;  1K4E A;  3UPN A;  1E4D A;  3G2Z A;  1XGJ A;  2Y4A A;  1PW8 A;  4S2M A;  1JTG A;  1GHI A;  1RCJ A;  2Y55 A;  4WEL A;  4NET A;  3ZNY A;  1J9M A;  1ONG A;  3Q1F A;  2C6W B;  1H8Z A;  1HTZ A;  1MPL A;  4BEN A;  1PWG A;  2ZJ9 A;  3DWZ A;  4OON A;  4S2J A;  5GLC A;  3UDI A;  5KSC A;  4Y0O A;  1ALQ A;  4X53 A;  5GL9 A;  1ESI A;  4WMC A;  3N4I A;  3C7V A;  4OLG A;  5GLA A;  2XD5 A;  3PAG A;  4QY6 A;  2Y2G A;  3EQV A;  3PBR A;  2G2U A;  4JBF A;  5EVI B;  3BEC A;  4X56 A;  3IF6 C;  5FQM A;  1U60 A;  1GHP A;  4B88 A;  2XR0 A;  2HP5 A;  4S2K A;  1ERQ A;  5DF7 A;  4DXB A;  2PU2 A;  4FD8 A;  2WK0 A;  1LI9 A;  5E43 A;  3OPP A;  3Q82 A;  1BZA A;  5HFO A;  1YMS A;  3ZVT A;  4X55 A;  2J8Y A;  2P74 A;  2XF3 A;  3OCL A;  3IH8 A;  1PWD A;  1IKG A;  2Y2K A;  4L0L A;  1W5D A;  5FQJ A;  1SKF A;  5FDH A;  2WGV A;  3RXW A;  4BD1 A;  2X02 A;  4OP5 A;  5A93 A;  4E6X A;  4OOY A;  3MFD A;  2Y59 A;  3MXR A;  3HLC A;  2Y2H A;  4LCL A;  5CED A;  3GQZ A;  2H0T A;  4XUZ A;  4KG5 A;  2XH9 A;  4QJG A;  1NY0 A;  4RYE A;  1XPB A;  3SS5 A;  2ZMA A;  2WAE A;  3ZG0 A;  4ZAM A;  4HES A;  1AXB A;  1PI5 A;  3ZCZ A;  5HX9 A;  5EOO A;  4M3K A;  3NDG A;  3RJU A;  5JYO A;  2ZQ8 A;  4MEZ A;  4GKU A;  2OSU A;  1GCE A;  5D3O A;  1MBL A;  4OPQ A;  1HD8 A;  1K4F A;  4HBT A;  4E3J A;  3ISG A;  1W8Q A;  3HUO A;  4MBH A;  5CER A;  4F94 A;  1YLY A;  5IHV A;  1ZC2 A;  1KGE A;  3GR2 A;  2V20 A;  1BUE A;  3N8L A;  3NC8 A;  4OPZ A;  2UWX A;  4DKI A;  2BLS A;  1XX2 A;  1K54 C;  4P6B A;  1L0F A;  2WZZ A;  4IVI A;  1BLH A;  3BRM A;  4WEJ A;  5GHX A;  5M1A A;  4E3O A;  4B4X A;  5AQ9 A;  4KZ4 A;  4WZ4 A;  4LEN A;  3AGF A;  3P98 A;  3LY4 A;  2V1Z A;  4OQI A;  5EOE A;  3QNC A;  2P9V A;  4JKT A;  3Q7Z A;  1IYO A;  3C4P A;  3OPH A;  3UNW A;  5FAP A;  3SS4 A;  1NRF A;  3IXG A;  4N92 A;  2ZQD A;  1FQG A;  4K0X A;  4S2L A;  1K56 D;  3GMW A;  3W8K A;  1YLZ A;  3IWO A;  1BT5 A;  1ES2 A;  1XA7 A;  2WAD A;  4RA7 A;  4MLL A;  4R1G A;  3V3S A;  3HUM A;  1JVJ A;  3LO7 A;  1RP5 A;  2HDQ A;  3MZE A;  3IHA A;  4Z9Q A;  1CI9 A;  4GOG A;  4GN2 A;  1XP4 A;  5A92 A;  5AQA A;  2XDM A;  3EQU A;  3VP0 A;  5CGX A;  4U0X A;  2QMI A;  4BD0 A;  2WGW B;  1MKI A;  4EUZ A;  3ZFZ A;  1FCO A;  2EX8 A;  4KZA A;  5J8X A;  3HLF A;  2A3U A;  3MKE A;  4N1H A;  2H0Y A;  1FR1 A;  2FFF B;  1MWR A;  5EVI C;  3UY6 A;  1PYY A;  5DVA A;  4IBX A;  5G18 A;  3QHY A;  1JWP A;  1BUL A;  1K55 C;  3TSG A;  4B4Z A;  3M2K A;  4GDB A;  4E3I A;  3VP4 A;  1M6K A;  5FI7 A;  1ZG4 A;  1YLT A;  2ZM8 A;  3NY4 A;  5CEC A;  3LCE A;  4WZ5 C;  2IWD A;  5GHY A;  4S2I A;  3Q7V A;  4DXC A;  1MXO A;  4S2N C;  3MBZ A;  4RX3 A;  5HAQ A;  3FKV A;  4PM9 A;  4MBF A;  1PW1 A;  1CK3 A;  4KZ7 A;  2JBF A;  1N9B A;  3G30 A;  5U47 A;  4P0M A;  3ZHH A;  1GA9 A;  4R3J A;  3BYD A;  3GRJ A;  3JYI A;  4FCF A;  1K6S A;  3AGD A;  5I94 A;  3W4Q A;  5F1F A;  5CGS A;  1K56 A;  1NJ4 A;  1RGY A;  4BL3 A;  4XXR A;  3IWI A;  2Q9M A;  5DTK A;  2ZC5 B;  5FQQ A;  1ONH A;  1KE0 A;  4ZJ2 A;  3ITB A;  5EPH A;  5GLD A;  1KE4 A;  1VM1 A;  3BFC A;  3VOZ A;  1CEG A;  2XGN A;  1Q2Q A;  1MWT A;  1G68 A;  5FAS A;  4C3Q A;  2ZQA A;  2B5R A;  3SS3 A;  4DE3 A;  5HL1 A;  5AQ7 A;  4BQM A;  4KQO A;  2RL3 A;  5E2F A;  1WYC A;  4JXG A;  3UO9 A;  2OLU A;  2PU4 A;  3NI9 A;  2RCX A;  2H10 A;  3FZC A;  3IWQ A;  2EXB A;  3Q7V B;  1L0D A;  2ZC4 B;  3LY3 A;  4JLF A;  1LI0 A;  2DCF A;  2HPB A;  4KG6 A;  2R9W A;  3VSL A;  3WRT A;  5TR7 A;  2ZM2 A;  2A49 A;  1E3U D;  4K0W A;  4KZB A;  3S22 A;  3CMZ A;  5E2G A;  2Y91 A;  3DTM A;  3FV7 A;  4YIN A;  1K25 A;  3OCN A;  4LV0 A;  3UDX A;  4IVK A;  4WYY A;  2I72 A;  3WS4 A;  1JWV A;  1G6A A;  3UE0 A;  1K57 C;  1CEF A;  5M19 A;  2X01 A;  2BG1 A;  2WAF A;  3O3V A;  3C7U A;  3WRZ A;  4X69 A;  2J9O A;  3HVF A;  5CHU A;  1S6R A;  1YQS A;  3HL9 A;  3HLB A;  2EX6 A;  4U3T A;  4Y0U A;  3SOI A;  3G31 A;  4WBG A;  4A5R A;  4CPK A;  3OPL A;  3I7J A;  2Y2J A;  4LV2 A;  4ZTK A;  3P09 A;  2Y2M A;  3VSK A;  4KZ6 A;  5DF9 A;  2OV5 A;  2VGK A;  3MXS A;  3HUN A;  4H8R A;  1YLJ A;  3IF6 A;  2X71 A;  4PMA A;  1IKI A;  3UE1 A;  2ZC6 B;  1C3B A;  3C5A A;  5E2E A;  4ZJ1 A;  3FWL A;  1KDW A;  1KGG A;  4O7D A;  4R0Q A;  5FQ9 A;  3ZNT A;  4KQQ A;  3N8R A;  5HAP A;  1KVL A;  4IBR A;  4EQI A;  4Y0T A;  2JCH A;  2WKE A;  4E3N A;  3DWK A;  4PPR A;  2ZQ9 A;  1IYP A;  2HDR A;  3PBQ A;  1MWS A;  2J7V A;  4JXS A;  4P87 A;  4QU3 A;  1XGI A;  2J9P A;  2DNS A;  2Y2O A;  3VFH A;  3GSG A;  3OC2 A;  4RX2 A;  2DRW A;  2Z2L B;  3D4F A;  2Z2M B;  4Q8I A;  4KZ3 A;  1LL5 A;  4OPY A;  1L0E A;  3WS2 A;  3O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...