1XA1A

Crystal structure of the sensor domain of blar1 from staphylococcus aureus in its apo form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
246
structure length
244
Chain Sequence
NYKKPLHNDYQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMENHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Regulatory protein blaR1
publication title Crystal structures of the Apo and penicillin-acylated forms of the BlaR1 beta-lactam sensor of Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 82
structure length 244
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xa1A00
1NZUA 5HX9A 3NIAA 4HEFA 3ZNTA 3P09A 3OCLA 1KE3A 3V3SA 4P0MA 3UDFA 1WE4A 1KGEA 1KGFA 4XUXA 4ZTKA 3BECA 2XFTA 1EI5A 3CJMA 4BL2A 4S2JA 3UO9A 5DF8A 4B4ZA 1HD8A 4RYEA 5CRFA 3HLCA 4LV3A 4MLLA 2Y2IA 4R3BA 3HLEA 2WADA 4O7DA 4OQGA 4E3KA 1TDLA 5DTKA 4OPYA 3WS1A 2B5RA 3HUOA 3HVFA 5EVID 1GA0A 3UPNA 2Y2JA 5FAOA 3WS0A 5AQBA 1ES4A 5CHUA 1Q2QA 5EE8A 4OQ0A 3GR2A 5KSHA 1K4FA 1YMSA 4UHUA 2HDRA 3E2LA 2Z2MB 2WGWA 5EECA 3MFDA 1SCWA 4WELA 3LY3A 3SS3A 5DVAA 3WS5A 5M19A 1FCMA 5CHJA 4JXSA 4DE1A 3I7JA 2WKHA 1K38A 3BLSA 3E2KA 4QJGA 2WAEA 4R3JA 4U0XA 1ESUA 4KQRA 2EX9A 2J9OA 3HLDA 4BJPA 1FQGA 2EFUA 1MKIA 1CI9A 1GHIA 4UA9A 4B88A 4KQQA 2JBFA 4PM6A 5F83A 3FYZA 4OH0A 4N9LA 5GHYA 4FH2A 4K91A 4N1XA 3A3EA 1G6AA 2VGJA 1FSWA 3W4PA 3CZDA 3OPPA 2WUQA 3ZHHA 5HAIA 1ONHA 1YLJA 4XXRA 1K6SA 4KZBA 1DJAA 3NCKA 1MY8A 3PBTA 3FWLA 3FKVA 3O88A 4PM9A 5M18A 1K55C 3N7WA 2Y2KA 1RGZA 2ZD8A 3LO7A 3G4PA 2GDNA 3G31A 4R4SA 2QPNA 5EVIC 4WYYA 3PBRA 3W4OA 2ZC6B 5FDHA 3OC2A 3B3XA 3VFFA 4ZAMA 4Y0TA 1PI4A 5F1FA 1DJBA 3A3JA 4R4RA 1PZOA 3C4PA 4WEJA 1BLSA 1XGJA 3DWKA 5CHMA 3BFEA 4WZ4A 5FQJA 4GB7A 3S22A 1YLWA 3P98A 1L0DA 1CK3A 1XP4A 2Q9MA 3HLBA 1E25A 4OP8A 4KZ4A 3V50A 1ZC2A 1O07A 3M6HA 5HAQA 5JYOA 3BFFA 3IXDA 1LI0A 1ESIA 4HBTA 1PZPA 2EXAA 5FQKA 1C3BA 3ZG0A 1PW8A 1W7FA 2WYXA 3HLFA 5E2EA 3LEZA 1Y54A 4GDBA 4OPZA 2ZM8A 4ZJ2A 5FATA 5GHZA 4QY5A 2OSUA 2H10A 2HPBA 3VFHA 1XXMA 4QB8A 4B4XA 5G18A 2A49A 4GNUA 1XA7A 2XK1A 2J7VA 4E3NA 2R9WA 2X71A 3Q82A 4NK3A 3HBRA 4GKUA 1FR1A 1G68A 4KZAA 5AQAA 4OLDA 1NYMA 1LHYA 3BLMA 3SOIA 5CGWA 3ITBA 1KDSA 2HDUA 5EVIB 4KG6A 5BOHA 1IELA 3IXGA 4IEDA 2EX8A 3ZVWA 3NY4A 4EQIA 4LCMA 2E8IA 2ZC7A 5F1GA 1NRFA 3IWOA 1I2WA 3GV9A 2WK0A 3IHAA 2HP6A 4U3TA 3HUNA 5FQIA 4ID4A 5FI6A 1JTGA 2XQZA 3GTCA 4BL3A 3FZCA 3OCNA 2PU2A 1CI8A 5M1AA 1K55A 2WZXA 1BZAA 1Q2PA 2Y2OA 5D3OA 3G35A 3IQAA 3OPHA 5EVIA 3Q7VB 3W4QA 3ZCZA 1JWPA 2Q9NA 4K0XA 3CMZA 4KZ7A 3EQUA 4S2KA 5E2HA 1IYOA 5EOEA 2XFSA 1J9MA 1LL5A 3N8SA 3PAEA 3PBOA 3TSGA 4S2IA 2EFXA 3VSLA 5L2FA 2ZQCA 1XGIA 1U60A 5EVLA 4E3OA 1RP5A 4R1GA 2Y4AA 4LV0A 3WRTA 4WMCD 5GLCA 5HAPA 1GHPA 1K4EA 3N4IA 4WEKA 3V5MA 5I94A 1VM1A 3DW0A 1OMEA 1SDNA 5HFOA 1HVBA 1WYBA 1YLPA 1YLYA 2ZLYA 4JLFA 4DE2A 1NZOA 2HDSA 2Y2GA 3S1YA 4PMAA 3Q7VA 5CGXA 4MBFA 4GN2A 4R0QA 5KSCA 3GRJA 4DE0A 1PWDA 5CXWA 1GCEA 4JXVA 3IXHA 3G32A 4C75A 5GLDA 3UN7A 3BFDA 4PM7A 3Q1FA 3UNWA 4X53A 2J8YA 4CJNA 3UE1A 4P6BA 4BENA 3PTEA 3S4XA 1NXYA 2ZM2A 3MKEA 3ZG7B 5F82A 4DXBA 5EPHA 5GLAA 4PM5A 2HDQA 2XF3A 4N9KA 4X69A 1CEFA 1WYCA 5DF9A 3A3DA 2XLNA 2Y91A 3CG5A 4KQOA 4ZDXA 2PU4A 5KZHA 1BLPA 1RGYA 2ZJ9A 3NBLA 1XPBA 4PPRA 4PM8A 2HP5A 3IF6B 1GHMA 1XX2A 1BLHA 1M40A 4S2OA 1K54C 4R23A 3PBSA 2HP9A 4P87A 3AGDA 3O86A 1MPLA 3ISGA 3MXRA 2P9VB 3PBNA 4JF5A 3ZDJA 3VP3A 4BD0A 4YINA 2DNSA 5CTNA 3MZDA 3IT9A 1SKFA 4A5RA 1W79A 4OONA 3UDXA 1LL9A 3TG9A 1YMXA 4MNRA 4OPQA 3IWQA 4EBNA 4FCFA 1FCNA 1S0WA 1E3UD 3C4OA 5A92A 2H5SA 1K25A 2ZC5B 1YQSA 4E6XA 4EUZA 3VOZA 2Y55A 4KG5A 1W8YA 4RX2A 4EV4A 3BFGA 3RXXA 2P9VA 4MEZA 4H8RA 1KE0A 2EX2A 3AGFA 3IWIA 3G30A 4BQMA 4EWFA 1Z6FA 4NETA 3Q7ZA 4UA7A 2DRWA 1HZOA 3SH8A 4Y0OA 3QNBA 4EBLA 4OQIA 4F94A 1IYSA 4L0LA 1JWZA 1DJCA 3NDGA 4S2NC 1SHVA 1L2SA 3M6BA 3VOYA 2XR0A 2G2WA 3DTMA 1BLCA 2H0YA 1MWSA 4S2MA 5KMWA 3O3VA 5TFQA 2X01A 5A91A 1L0EA 3G34A 4GD6A 3N6IA 3VP2A 1K56D 3FKWA 4Y0UA 4UAAA 4ZJ1A 1AXBA 1M6KA 2ZQ8A 1QMFA 4JF6A 2WGVA 4IBXA 2ZQ7A 4X6TA 3GMWA 5FI7A 2Y59A 4QU3A 4LENA 4FH4A 3JYIA 2IWBA 5A90A 2V2FF 4IVIA 4RA7A 4OPRA 5FQMA 4OP5A 1LLBA 1KVMA 1O7EA 4OKPA 1N9BA 4EBPA 4GOGA 3M2KA 5EOOA 4ZBEA 4Z9QA 3ZGAB 4DKIA 1CEGA 3OZHA 1JVJA 3WS4A 1K54A 2WKEA 3BM6A 3UDIA 3IF5A 2XGNA 2JCHA 5E2FA 4X68A 1PWGA 2ZQDA 3UE3A 4KZ6A 1W5DA 4E3JA 3IHBA 3MZFA 4N92A 1ZKJA 2H0TA 2WZZA 3MZEA 1DY6A 1VQQA 1BULA 3PAGA 4GZBA 4JKTA 2VGKA 4WZ5C 5AQ9A 3D4FA 3SS5A 1XKZA 1TDGA 2C5WB 3IF6C 1KE4A 2ZMAA 4XUZA 1YM1A 4QD4A 4RX3A 3FV7A 3V3RA 2IWCA 4P85A 5FAQA 1K57C 1BTLA 5EUAA 4C6YA 2V20A 3ZVTA 1NJ4A 1ES2A 2QMIA 3BRMA 2ZQAA 5FI2A 2XH9A 4BLMA 3WS2A 3BEBA 1MWRA 4LV2A 4JPMA 3HL9A 4OOYA 4C3QA 4E6WA 3HREA 2WAFA 2WGWB 1ZG4A 1ZG6A 4KZ5A 3WRZA 1ES5A 4UA6A 4GDNA 4MBKA 4N1HA 3Q81A 5E43A 2Y2QA 3GQZA 2RCXA 2P74A 2DCFA 4MBHA 1JWVA 1LI9A 1TVFA 3VP0A 4FD8A 3AGEA 2WKIA 4KZ3A 3MBZA 4S2NA 4KZ9A 5GL9A 5HARA 1L0GA 4DF6A 4Q8IA 2G2UA 4JXGA 3OPLA 5TGFA 5FQ9A 4OLGA 4WBGA 4KENB 1YLZA 2C6WB 3IH8A 3VMAA 4QY6A 3HLGA 3A3FA 4IBRA 4OQHA 5E2GA 1MXOA 2Y2HA 5GHXA 4X56A 3G2YA 5FAPA 3VP4A 5HL1A 4DE3A 3ZG5A 4E3LA 3UE0A 3C7UA 3SH9A 1S6RA 5DTTA 1QMEA 1IYQA 1EWZA 2V1ZA 2ZM0A 1NYYA 3RXWA 3SH7A 3LY4A 2J9PA 4U0TA 1MBLA 1IKIA 2BLSA 4LV1A 4JBFA 4S2LA 3LCEA 5A93A 3TOIA 1IYPA 2XDMA 2ZQ9A 3NC8A 3EQVA 1TEMA 3QNCA 1XA1A 2IWDA 1ONGA 1E3UA 2PBYA 2WGIA 3BYDA 1PYYA 5GLBA 3VSKA 3ZG9B 2FFYA 4OOLA 2ZC3B 4BD1A 5CGSA 3A3IA 1H8ZA 2Y2PA 1FOFA 2QZ6A 5CERA 4ZJ3A 1EROA 4M3KA 3V39A 3W8KA 3GVBA 2I72A 4HESA 4X55A 5FA7A 4E3MA 4WZ5A 1FR6A 1MWTA 3O87A 1YLTA 2Y2LA 2RL3A 3IF6A 4OOMA 1ERQA 4S2PA 2OLUA 3ITAA 5FASA 1ES3A 2XD5A 4IVKA 1IEMA 1KGGA 1FSYA 1I5QA 1K57A 2XD1A 3C5AA 3G2ZA 1W8QA 4JXWA 5FQQA 4DRTA 2R9XA 5CEDA 2EX6A 5DTSA 1H8YA 1N4OA 1BSGA 4D2OA 3UPOA 2XEPA 2OV5A 3RJUA 4Y7PA 2BG1A 3VP1A 1K56A 1HTZA 3N8RA 3PBQA 3IH9A 2JC7A 4LCLA 5DF7A 5HW3A 1IKGA 1KVLA 2JE5A 1PWCA 1FCOA 2Y2MA 3M2JA 5CTMA 2CC1A 4FSFA 3ZNYA 5CECA 4DXCA 3SS4A 2EXBA 2Z2LB 5IHVA 5TR7A 4OVDA 3UPPA 4E3IA 3GSGA 4RVAA 2FFFB 4KG2A 1K6RA 1L0FA 1KDWA 2ZC4B 3N8LA 4CPKA 4WM9A 3C7VA 1ALQA 1SDEA 3MXSA 5CEBA 1ERMA 3DWZA 3HUMA 3UY6A 3MKFA 1PW1A 4KZ8A 4GD8A 5JYPA 1MWUA 3Q07A 1H5XA 2OLVA 5J8XA 1RCJA 3ZG8B 1GA9A 3OPRA 1BUEA 5AQ7A 4YFMA 1NY0A 1E4DA 4JF4A 1PIOA 2UWXA 3HLWA 3WWXA 1YT4A 1JTDA 4DDSA 1I2SA 5U47A 4QHCA 4WMCA 3NDEA 3BFCA 4DDYA 1BT5A 2Y2NA 2A3UA 3IXBA 3ZFZA 5FSRA 4HBUA 1PI5A 2X02A 3QHYA 3NI9A 4K0WA
chains in the Genus database with same CATH superfamily
4L9EA 5HX9A 2G7UA 3P09A 4MCWA 4YNRA 3UDFA 2XFTA 3CJMA 3SW1A 4S2JA 3VV4A 5DF8A 1OTAA 3NECA 4LV3A 2Y2IA 4R3BA 2WADA 4GCZA 5LBRA 4O7DA 3NULA 4E3KA 5DTKA 4JGRA 3HVFA 2PD7A 5EVID 3S7OA 5FAOA 5AQBA 4B93A 4ARZA 5CHUA 2JHEA 3GR2A 1K4FA 1YMSA 2MJ6A 4UHUA 4WELA 1FCMA 3O5YA 4DE1A 2H28A 3BLSA 3KO6A 4U0XA 2J9OA 5HDDA 4WL9A 4HIAA 1MKIA 3S7QA 1F2KA 3P7NA 5F83A 4N9LA 4FH2A 3A3EA 4HI4A 1VETB 1FSWA 3T4TA 3T4LA 2WUQA 1ONHA 1MY8A 3FKVA 4PM9A 1K55C 2ZD8A 1RGZA 1NWZA 2ZC6B 2NUTC 4Y0TA 3NOPC 2R78A 3UB9A 5FQJA 3A0VA 3P98A 1XP4A 4UQIM 4LGWA 4KZ4A 2D01A 1O07A 3M6HA 1ESIA 3ZG0A 5DJTA 5IT5A 3LEZA 4OPZA 4ZJ2A 2A49A 4GNUA 1XA7A 4MMNA 2X71A 4KZAA 1LSXA 3C2WA 5CGWA 3ITBA 4Z1WA 4LCMA 1NRFA 2L4RA 2W1TB 2HP6A 5HD5A 3FZCA 1G28A 1BZAA 3NHQA 3IQAA 2QYBA 4EXOA 1JWPA 4K0XA 3EWKA 4WN5A 4S2KA 5EOEA 3PBOA 3L7HA 2ZQCA 3F1OB 3BQAA 2Y4AA 5HAPA 1K4EA 4WEKA 3VOLA 1OMEA 4MN7A 4JLFA 3S1YA 5CGXA 1GCEA 3UMEA 4C75A 4PM7A 2J8YA 3UE1A 3HJIA 4BENA 3S4XA 2JKFA 2B02A 3MKEA 5HPFA 5F82A 3OOVA 2XF3A 1WYCA 1W63M 2JKTM 1TS6A 4ZDXA 2PU4A 2XA7S 3CI6A 5AVFA 2HP5A 3IF6B 3L9KA 4F3LB 1GHMA 1XX2A 4S2OA 4R23A 1Z09A 2P9VB 3VP3A 2PDRA 2YKHA 1SKFA 4EUVA 3SZTA 1YMXA 1S1ZA 3UMDA 4FCFA 5AJGA 1E3UD 1LL8A 5A92A 2H5SA 1K25A 3LGOA 2PAVP 3E98A 4E6XA 5EM1A 5FL3A 4RX2A 4EV4A 3T12B 4H8RA 2EX2A 3IWIA 4BQMA 4EWFA 5HPIA 4UA7A 2DRWA 4Y17A 1IYSA 3F1PA 4II7A 4S2NC 1L2SA 3M6BA 2H0YA 4O01A 1MWSA 3N6IA 2EWWA 2K2NA 2VV8A 1AXBA 2WGVA 2ZQ7A 5FI7A 4LENA 2IWBA 1ODVA 4RA7A 1P9WA 2Q0OA 4OKPA 1G5UA 1N9BA 2J3TC 3A0SA 2O9BA 1PNEA 4Z9QA 1OJ5A 3GECA 1SKOB 5AVEA 4CLCD 4X68A 1PWGA 2ZQDA 4B9OA 4KZ6A 2O9CA 3MZFA 2H0TA 2WZZA 5FATA 3PAGA 3MZEA 1BULA 1V9YA 1OTEA 1F9IA 1XJ4A 4WZ5C 3LFVA 3D4FA 2HF6A 3ULFA 4G3WA 4UEYA 3S7PA 5EUAA 5HWVA 1NJ4A 3BRMA 4KUOA 1VB6A 1V9ZA 3HL9A 1TS0A 3HREA 2WGWB 1ZG6A 3WRZA 1ES5A 3T1RA 4N1HA 4IUHA 3DTIA 1SZVA 2PBDP 5GL9A 3TJZC 1L0GA 1XFNA 4EU0A 2G2UA 5TGFA 4KENB 1KOUA 2C6WB 3IH8A 3PYPA 3IX8A 4QWOA 5E2GA 1MXOA 3CPTB 3H82B 5HL1A 4DE3A 3ZG5A 5CX7A 1S6RA 4EERA 3SH7A 3PHYA 4U0TA 4RQ9A 2HV1A 4R70A 1MBLA 4JBFA 2XDMA 5CERA 3QNCA 1YSQA 5GLBA 3ZG9B 3KSFA 1DP8A 4OOLA 2ZC3B 4BD1A 3A3IA 2QZ6A 4HH3A 4ZJ3A 1HLUP 4HESA 4O0PA 4E3MA 5KIZA 1YLTA 2GNXA 2OLUA 3ITAA 1KGGA 4JXWA 1K57A 2XD1A 3C5AA 1W8QA 5TBMA 3MS6A 2EX6A 1BSGA 3K3CA 3B42A 2XEPA 2OV5A 2BG1A 1K56A 3MR0A 1KVLA 4DJ2A 1PWCA 2CMNA 3D72A 2CC1A 4FSFA 5CECA 3SS4A 3R7WA 2EXBA 4OVDA 3MQOA 2L1MA 1L0FA 3LI8A 5CEBA 3MXSA 3MKFA 4KZ8A 1S67L 5JYPA 3G6OA 2OLVA 1TS8A 1RCJA 1STZA 4Q0IA 3ZG8B 1GA9A 1W63Q 4YFMA 1NY0A 3T50A 1YT4A 4DDSA 4DMZA 3BFCA 4DDYA 3ZFZA 2W3GA 3MJQA 2IA2A 5HWTA 2J3WA 3ZNTA 4HEFA 4DN0A 1KE3A 4P0MA 4XUXA 4ZTKA 2VV7A 3UO9A 4B4ZA 4MLLA 3LIDA 1TDLA 4MN6A 4HP9A 3HUOA 2W3DA 3UPNA 4WUJA 3WS0A 3CUEC 5EE8A 1OTDA 2HDRA 3E2LA 2Z2MB 4GJ4A 3MFDA 4X25A 3WS5A 5M19A 4JXSA 2ZMVA 5K5BA 1K38A 2WAEA 4R3JA 2PD8A 3LIEA 4UA9A 2M7UA 2QHKA 2JBFA 4OH0A 4K91A 2VGJA 2VX8A 3W4PA 3OPPA 4GLQA 5HAIA 4XXRA 1YLJA 3LR0A 1K6SA 4KZBA 4WF0A 5M18A 4HJ3A 3TW8A 2GDNA 4R4SA 4WYYA 3W4OA 5HWWA 1J3WA 2L0WA 3LIBA 4ZAMA 1VETA 5F1FA 3ICYA 4P6ZS 4WEJA 4R4RA 3C4PA 1BLSA 5CHMA 4WZ4A 3V67A 3S22A 1YLWA 1L0DA 3HLBA 2QWSA 4HH2A 4OP8A 4LRXC 1S4SA 1LI0A 5FQKA 3U4LP 1C3BA 3HLFA 3JPUA 1DRMA 3K2NA 4QY5A 2H10A 2HPBA 1XXMA 2VEAA 3F1NB 3H7WB 2R9WA 5L07A 4I38A 3HBRA 3D9YA 4NG2A 5AQAA 3BQ8A 5F6AA 1NYMA 1LHYA 1KDSA 4KG6A 5BOHA 3PR6A 2EX8A 4EQIA 3FPVA 2VGLM 5F1GA 3IWOA 1I2WA 3GV9A 3IHAA 3HUNA 3BY8A 2PR5A 1JTGA 4D60A 4H6JB 1CI8A 5M1AA 1K55A 2Y2OA 1Q2PA 3QP8A 3R4KA 3Q7VB 3ZCZA 2EWVA 3EQUA 3N8SA 2EFXA 4EEUA 4E3OA 4LV0A 2W1TA 4WMCD 3V5MA 5I94A 1VM1A 4YWZA 1WYBA 1YLPA 2ZLYA 1N9OA 4DE2A 1NZOA 2Y2GA 4PMAA 3B47A 2V0UA 3BY9A 3GRJA 1PWDA 5CXWA 3QP1A 3G32A 3UN7A 3Q1FA 3UNWA 3F1OA 4X53A 4CJNA 4K08A 4GHIB 4P6BA 2GX5A 2JKGA 3ZG7B 3DTEA 2I9VA 2HDQA 4X69A 1CEFA 2O0YA 4NXFA 3B33A 3CG5A 4Q0JA 5KZHA 1BLPA 1RGYA 1D1JA 1XPBA 4PM8A 4HY8A 2HP9A 2VV6A 2ZL1B 1MPLA 3MXRA 4YINA 5CTNA 3T4OA 5DFYA 1W79A 3MMHA 2PRFA 1H8MA 2ZC5B 1YQSA 2DMWA 3HCYA 1W8YA 3RXXA 2P9VA 4MEZA 4E04A 4HP4A 3Q7ZA 3QNBA 1JWZA 1DJCA 1SHVA 2NUPC 2G2WA 3DTMA 5G4YA 5TFQA 5A91A 3VP2A 1K56D 3FKWA 1CJFA 3MFXA 2V2FF 5FQMA 4OP5A 3UE6A 4DKIA 1CEGA 1JVJA 3WS4A 2OOLA 5E2FA 3UE3A 5G4ZA 3SS5A 1XKZA 1TDGA 3IF6C 1KE4A 4L9FA 5HSQA 1DP9A 3TE8A 3IS2B 3ZVTA 4HNBA 2KDKA 4ARZB 4BLMA 1ZHHB 3BEBA 3EGDC 4E6WA 4ME4A 1ZG4A 3C8CA 3Q81A 2Y2QA 3GQZA 1JWVA 3D3OA 1TVFA 3VP0A 3AGEA 4KZ3A 4DF6A 4S2NA 4NXBA 4Q8IA 5FQ9A 4OLGA 4WBGA 4WLAA 3HLGA 4OQHA 2WKRA 5GHXA 5F69A 3FPWA 2PR6A 1N9NA 3UE0A 2ZBBA 1EW0A 5DTTA 2OWHA 2V1ZA 2ZM0A 1NYYA 2P04A 3KSHA 2J9PA 2M1CA 1IKIA 2BLSA 4LV1A 3LR5A 5A93A 3NC8A 3EQVA 1XA1A 2PBYA 2FFYA 2XSSA 3CPTA 2XRNA 5IS1A 2Z6DA 3W8KA 4FUWA 4WZ5A 3O87A 1ERQA 1S1YA 3CITA 4UQIS 5FASA 2W0NA 1IEMA 4MDZA 1OPXA 2R9XA 3KYZA 5DTSA 2O9AA 3KYEA 4IJGA 4BBTA 3RJUA 3LIAA 4LCLA 3IH9A 4Q0HA 4PAUA 4HJ6A 1FCOA 2Y2MA 3PXPA 5J4EA 5DKLA 4ETXA 2Z2LB 5TR7A 1UWPX 4E3IA 2FFFB 3VE3A 3N8LA 4CPKA 3UY6A 3HUMA 1PW1A 4GD8A 5J8XA 1BYWA 1MC0A 1H3QA 2P08A 4BBVA 5MC7A 4JF4A 2OAQ1 3HLWA 1JTDA 4WMCA 3NDEA 2Y2NA 2ZOHA 2A3UA 3IXBA 4NKPA 2A24B 5FSRA 4HBUA 3T4QA 1H0MA 3NI9A 4K0WA 3TRCA 3OCLA 3V3SA 1KGFA 2VK3A 3BECA 1IOUA 1EI5A 4BL2A 1HD8A 5CRFA 4BBUA 3KSIA 1LT0A 3HLEA 4OQGA 2JN7A 3WS1A 2B5RA 2XROA 1GA0A 4EESA 2QJ7A 2Y2JA 2YKFA 2EA9A 1ES4A 3MSHA 4CLCE 1CQAA 2KOIA 5HL6A 3LY3A 3SS3A 4LPZA 4IHQA 4QJGA 3BWLA 4BJPA 3OBFA 1GHIA 4B88A 4Y3IA 4N1XA 1G6AA 4ETZA 2PYRA 3ZHHA 1LSWA 1CF0A 4IUKA 1DJAA 3PBTA 1X0OA 2M7VA 3UB8A 1GSWA 2Y2KA 3G31A 5EVIC 2QPNA 3EGXC 1YSPA 5L10A 3RFBA 5EVEA 4PKYG 5FDHA 3OC2A 5HDSA 1DJBA 3BJNA 1T18A 2LB9A 3LIFA 1T1BA 1CK3A 3T4SA 3W2ZA 1ZC2A 2ZMFA 5HAQA 3IXDA 1PZPA 3CUEA 2KX6A 1PW8A 1GSVA 1FIKA 5E2EA 1Y54A 4GDBA 2ZM8A 5GHZA 2OSUA 1Y4OA 3A0RA 4QB8A 3Q82A 4NK3A 5L8MA 1FR1A 4OLDA 3BLMA 4L9GA 5EVIB 1IELA 3IXGA 4IEDA 4XT2B 2E8IA 1MKMA 3UB7A 2Z6CA 2WK0A 3LI9A 4U3TA 3F1NA 4ID4A 5FI6A 2XQZA 4BL3A 2WZXA 3G35A 3CAXA 3JVVA 3LR4A 2Q9NA 4KZ7A 3CMZA 3E4QA 2B95A 5E2HA 1IYOA 1LL5A 3TSGA 5L09A 1K0KA 4S2IA 3VSLA 5L2FA 1LSVA 1XGIA 3WRTA 4PKYA 5GLCA 1GHPA 3N4IA 1SDNA 4H6JA 5HFOA 1WA9A 3Q7VA 4GN2A 4LLOB 2AVXA 3IXHA 4LRZE 5GLDA 3BFDA 2INWA 2V1AA 4GS9B 1NXYA 4M4XA 4DXBA 5EPHA 5GLAA 1XFQA 3QP4A 5DF9A 2A2LA 3A3DA 3GDIA 2XLNA 4KQOA 2FH5A 3QP6A 3NBLA 4PPRA 1MZUA 1M40A 1K54C 2GJ3A 4P87A 3AGDA 4GHIA 4X1LA 3ISGA 4NXGA 4JF5A 3PBNA 2FZ0A 3ZDJA 2V1BA 2GZAA 5TBMB 3T1SA 4JGQA 3IT9A 4A5RA 4OONA 3UDXA 4OPQA 3IWQA 1P0ZA 3DAVA 4G3VA 2J3TD 3LUQA 2JKRI 4EUZA 2Y55A 4KG5A 2W3HA 2ZL1A 3BFGA 2HGVA 1KE0A 3AGFA 4EETB 4HJ4A 1Z6FA 4R3AA 1HZOA 4EBLA 2WKPA 4ESPA 5F5YA 2W1RA 3O3VA 3FG8A 1L0EA 3G34A 4GD6A 3K3DA 4Y0UA 4UAAA 1VEUB 2Y79A 3MQ0A 3GMWA 4FH4A 3JYIA 5A90A 4IVIA 1PRQA 2QJ5A 1KVMA 4EBPA 1VHMA 3M2KA 5EOOA 3OZHA 4QPRA 4I3AA 2WKEA 3IF5A 2XGNA 2JCHA 1W5DA 3IHBA 3LYXA 1ZKJA 4O8GA 4JKTA 1DY6A 4R6LA 2C5WB 2ZMAA 1YM1A 5EFWA 4QD4A 3FV7A 3V3RA 4P85A 5FAQA 1BTLA 2QMIA 1ES2A 2ZQAA 5FI2A 4FTXA 3P01A 4LV2A 4JPMA 4C3QA 2WAFA 4KZ5A 3IX4A 4UA6A 4GDNA 4MBKA 2P74A 2DCFA 2RCXA 4FD8A 2WKIA 5HARA 3IS2A 1YLZA 2O99A 4QY6A 4IBRA 2Y2HA 4CLCC 3G2YA 3VP4A 3C7UA 3SH9A 1QMEA 1IFQA 4HOIA 1IYQA 1YKDA 3LCEA 1IYPA 2ZQ9A 5DKKA 1TEMA 2WGIA 3VSKA 1PYYA 2Y2PA 1FOFA 2XA7M 1EROA 4M3KA 1OT9A 2V8CA 3V39A 3GVBA 2I72A 4X55A 5I5LA 2Y2LA 2RL3A 3IF6A 4OOMA 4F3LA 5FEGA 2XD5A 4IVKA 1N9LA 3G2ZA 1N4OA 5TJJA 3UPOA 3ZYTA 2OAP1 4BMWA 3VP1A 4CLCB 3PBQA 2W3EA 1XJ6A 5HW3A 1IKGA 1Y28A 4DXCA 5IHVA 3UPPA 4KG2A 2J80A 1K6RA 2ZC4B 1KDWA 4NXEA 4WM9A 3C7VA 4Y2FA 1ALQA 2VGLS 1G6OA 3Q07A 2VA0A 1H5XA 4I3IA 1UWNX 3OPRA 1BUEA 5AQ7A 3QP2A 2UWXA 1I2SA 3KYQA 3MF0A 1PI5A 2X02A 3QHYA 1NZUA 3UB6A 3NIAA 1F5MA 2BASA 2KLIA 5C5KA 3IBJA 4HQAA 1WE4A 1KGEA 1SKOA 3RTYA 5J3WA 4RYEA 3HLCA 3MXQA 4LRYC 2A24A 1NRJA 1ZTUA 4OPYA 4KUKA 1GSXA 2K31A 2WKQA 3E4OA 1Q2QA 4OQ0A 1DP6A 5KSHA 2WGWA 5EECA 1SCWA 5DVAA 5CHJA 3I7JA 5HD3A 3UB5P 2WKHA 1FILA 3E2KA 4HHDA 1ESUA 4KQRA 2EX9A 3HLDA 1OTBA 1FQGA 5HZHA 2EFUA 1CI9A 4KQQA 4PM6A 3FYZA 2V9AA 5GHYA 3H82A 3CZDA 3NCKA 3FWLA 3O88A 5FEFA 3N7WA 3LO7A 3G4PA 3PBRA 3U2AA 4I39A 2ZOIA 3E0YA 3B3XA 3VFFA 1PI4A 3A3JA 1PZOA 2V8FA 3EEAA 1XGJA 3DWKA 3BFEA 4GB7A 4ZRRA 2Q9MA 1OT6A 1E25A 3V50A 5JYOA 3BFFA 2BTFP 4HBTA 2EXAA 1D7EA 1W7FA 2WYXA 2V0WA 2HZ5A 4FOFA 1S4RA 1P97A 3VFHA 4B4XA 5EM0A 5G18A 2UV0E 2XK1A 2J7VA 2W3FA 4JGPA 4E3NA 4GKUA 4DJ3A 1G68A 3SOIA 2HDUA 2ACGA 3ZVWA 3NY4A 3T1XA 1XJ3A 2ZC7A 2HJEA 2QKPA 3CWFA 3H9WA 5FQIA 3T1QB 3GTCA 3OCNA 2PU2A 5D3OA 3OPHA 3E4PA 5EVIA 4PHTA 5FDSA 3W4QA 4E3JA 1J9MA 2XFSA 3HJKA 3PAEA 4XT2A 3NJAA 1U60A 5EVLA 2VJWA 1RP5A 4R1GA 3DBAA 4GW9A 3OLOA 3DW0A 3C30A 1HVBA 1YLYA 2HDSA 3IX3A 3VE4A 5J7EA 4MBFA 4R0QA 5KSCA 4DE0A 4JXVA 2W27A 2JKTI 3PTEA 2ZM2A 5IU1A 4I3JA 4PM5A 1T1CA 4N9KA 3KX0X 2Y91A 2VZWA 2VKSA 2ZJ9A 2D02A 5DJUA 1BLHA 3PBSA 1NLYA 3O86A 4GS9A 4BD0A 2DNSA 1T19A 3MZDA 1LL9A 3TG9A 4MNRA 3F1PB 4EBNA 1FCNA 1OTIA 1S0WA 1TD5A 3MQQA 3C4OA 5F68A 1F98A 3S7NA 3VOZA 4EEPA 5HDCA 3T4KA 3G30A 2JKRM 4NETA 3BW6A 3SH8A 4Y0OA 4OQIA 5DFXA 4L0LA 3NDGA 3LEQA 4P6ZM 3VOYA 2XR0A 1TS7A 1BLCA 2VLGA 4S2MA 5KMWA 2X01A 1L3LA 4ZJ1A 4AFIA 1M6KA 2ZQ8A 1QMFA 4JF6A 4IBXA 4X6TA 5A8BA 2Y59A 4QU3A 3IBRA 3NOUC 1XJ2A 1AWIA 4OPRA 1LLBA 1O7EA 4GOGA 1PFLA 4ZBEA 3ZGAB 3H7WA 1K54A 3BM6A 3UDIA 5EV0A 1YPRA 3FC7A 1VEUA 3C38A 4N92A 4Y5FA 5E43A 1VQQA 4GZBA 2VGKA 5AQ9A 3NOTC 4BWIA 4XUZA 4RX3A 2IWCA 1JNUA 1K57C 4C6YA 2V20A 3DTKA 3CHWP 2XH9A 3WS2A 1MWRA 4OOYA 3QP5A 3RH8B 4EW7A 3LICA 4NEED 2P7JA 2E8JA 4MBHA 1OJGA 1LI9A 2B18A 1ACFA 3MBZA 4KZ9A 2HJ9C 4JXGA 3OPLA 3EEHA 3VMAA 3T4JA 4KQDA 3A3FA 1UGUA 4X56A 5FAPA 4I5SA 4E3LA 3LR3A 1EWZA 3RXWA 3LY4A 1A0KA 4S2LA 3TOIA 3JVUA 2IWDA 3BYDA 1ONGA 1E3UA 4R38A 4F94A 1P9RA 3KSGA 5CGSA 1H8ZA 4YOFA 2OWJA 4LFUA 5FA7A 1FR6A 1MWTA 3CLOA 4S2PA 1ES3A 1FSYA 1I5QA 5FQQA 4X1MA 3R7WB 4DRTA 4Y13A 5CEDA 1H8YA 4CQHA 1T1AA 4D2OA 2PHYA 4Y7PA 2LB5A 1HTZA 3N8RA 4G3KA 5DF7A 1YAXA 2JC7A 2JE5A 3M2JA 5CTMA 3ZNYA 3EOIA 4Y15A 3GSGA 4RVAA 4JGOA 1SDEA 4CLCA 1ERMA 1TF1A 3DWZA 2PT7A 4EQ1A 2PYPA 1MWUA 3ZQ5A 2K7SA 2Y8HA 1S66L 1E4DA 1PIOA 4MN5A 3WWXA 5U47A 4QHCA 1D06A 1BT5A 1NLZA
chains in the Genus database with same CATH topology
1NZUA 5HX9A 3NIAA 4HEFA 3ZNTA 3P09A 3OCLA 1KE3A 3V3SA 4P0MA 3UDFA 1WE4A 1KGEA 1KGFA 4XUXA 4ZTKA 3BECA 2XFTA 1EI5A 3CJMA 4BL2A 4S2JA 3UO9A 5DF8A 4B4ZA 1HD8A 4RYEA 5CRFA 3HLCA 4LV3A 4MLLA 2Y2IA 4R3BA 3HLEA 2WADA 4O7DA 4OQGA 4E3KA 1TDLA 5DTKA 4OPYA 3WS1A 2B5RA 3HUOA 3HVFA 5EVID 1GA0A 3UPNA 2Y2JA 5FAOA 3WS0A 5AQBA 1ES4A 5CHUA 1Q2QA 5EE8A 4OQ0A 3GR2A 5KSHA 1K4FA 1YMSA 4UHUA 2HDRA 3E2LA 2Z2MB 2WGWA 5EECA 3MFDA 1SCWA 4WELA 3LY3A 3SS3A 5DVAA 3WS5A 5M19A 1FCMA 5CHJA 4JXSA 4DE1A 3I7JA 2WKHA 1K38A 3BLSA 3E2KA 4QJGA 2WAEA 4R3JA 4U0XA 1ESUA 4KQRA 2EX9A 2J9OA 3HLDA 4BJPA 1FQGA 2EFUA 1MKIA 1CI9A 1GHIA 4UA9A 4B88A 4KQQA 2JBFA 4PM6A 5F83A 3FYZA 4OH0A 4N9LA 5GHYA 4FH2A 4K91A 4N1XA 3A3EA 1G6AA 2VGJA 1FSWA 3W4PA 3CZDA 3OPPA 2WUQA 3ZHHA 5HAIA 1ONHA 1YLJA 4XXRA 1K6SA 4KZBA 1DJAA 3NCKA 1MY8A 3PBTA 3FWLA 3FKVA 3O88A 4PM9A 5M18A 1K55C 3N7WA 2Y2KA 1RGZA 2ZD8A 3LO7A 3G4PA 2GDNA 3G31A 4R4SA 2QPNA 5EVIC 4WYYA 3PBRA 3W4OA 2ZC6B 5FDHA 3OC2A 3B3XA 3VFFA 4ZAMA 4Y0TA 1PI4A 5F1FA 1DJBA 3A3JA 4R4RA 1PZOA 3C4PA 4WEJA 1BLSA 1XGJA 3DWKA 5CHMA 3BFEA 4WZ4A 5FQJA 4GB7A 3S22A 1YLWA 3P98A 1L0DA 1CK3A 1XP4A 2Q9MA 3HLBA 1E25A 4OP8A 4KZ4A 3V50A 1ZC2A 1O07A 3M6HA 5HAQA 5JYOA 3BFFA 3IXDA 1LI0A 1ESIA 4HBTA 1PZPA 2EXAA 5FQKA 1C3BA 3ZG0A 1PW8A 1W7FA 2WYXA 3HLFA 5E2EA 3LEZA 1Y54A 4GDBA 4OPZA 2ZM8A 4ZJ2A 5FATA 5GHZA 4QY5A 2OSUA 2H10A 2HPBA 3VFHA 1XXMA 4QB8A 4B4XA 5G18A 2A49A 4GNUA 1XA7A 2XK1A 2J7VA 4E3NA 2R9WA 2X71A 3Q82A 4NK3A 3HBRA 4GKUA 1FR1A 1G68A 4KZAA 5AQAA 4OLDA 1NYMA 1LHYA 3BLMA 3SOIA 5CGWA 3ITBA 1KDSA 2HDUA 5EVIB 4KG6A 5BOHA 1IELA 3IXGA 4IEDA 2EX8A 3ZVWA 3NY4A 4EQIA 4LCMA 2E8IA 2ZC7A 5F1GA 1NRFA 3IWOA 1I2WA 3GV9A 2WK0A 3IHAA 2HP6A 4U3TA 3HUNA 5FQIA 4ID4A 5FI6A 1JTGA 2XQZA 3GTCA 4BL3A 3FZCA 3OCNA 2PU2A 1CI8A 5M1AA 1K55A 2WZXA 1BZAA 1Q2PA 2Y2OA 5D3OA 3G35A 3IQAA 3OPHA 5EVIA 3Q7VB 3W4QA 3ZCZA 1JWPA 2Q9NA 4K0XA 3CMZA 4KZ7A 3EQUA 4S2KA 5E2HA 1IYOA 5EOEA 2XFSA 1J9MA 1LL5A 3N8SA 3PAEA 3PBOA 3TSGA 4S2IA 2EFXA 3VSLA 5L2FA 2ZQCA 1XGIA 1U60A 5EVLA 4E3OA 1RP5A 4R1GA 2Y4AA 4LV0A 3WRTA 4WMCD 5GLCA 5HAPA 1GHPA 1K4EA 3N4IA 4WEKA 3V5MA 5I94A 1VM1A 3DW0A 1OMEA 1SDNA 5HFOA 1HVBA 1WYBA 1YLPA 1YLYA 2ZLYA 4JLFA 4DE2A 1NZOA 2HDSA 2Y2GA 3S1YA 4PMAA 3Q7VA 5CGXA 4MBFA 4GN2A 4R0QA 5KSCA 3GRJA 4DE0A 1PWDA 5CXWA 1GCEA 4JXVA 3IXHA 3G32A 4C75A 5GLDA 3UN7A 3BFDA 4PM7A 3Q1FA 3UNWA 4X53A 2J8YA 4CJNA 3UE1A 4P6BA 4BENA 3PTEA 3S4XA 1NXYA 2ZM2A 3MKEA 3ZG7B 5F82A 4DXBA 5EPHA 5GLAA 4PM5A 2HDQA 2XF3A 4N9KA 4X69A 1CEFA 1WYCA 5DF9A 3A3DA 2XLNA 2Y91A 3CG5A 4KQOA 4ZDXA 2PU4A 5KZHA 1BLPA 1RGYA 2ZJ9A 3NBLA 1XPBA 4PPRA 4PM8A 2HP5A 3IF6B 1GHMA 1XX2A 1BLHA 1M40A 4S2OA 1K54C 4R23A 3PBSA 2HP9A 4P87A 3AGDA 3O86A 1MPLA 3ISGA 3MXRA 2P9VB 3PBNA 4JF5A 3ZDJA 3VP3A 4BD0A 4YINA 2DNSA 5CTNA 3MZDA 3IT9A 1SKFA 4A5RA 1W79A 4OONA 3UDXA 1LL9A 3TG9A 1YMXA 4MNRA 4OPQA 3IWQA 4EBNA 4FCFA 1FCNA 1S0WA 1E3UD 3C4OA 5A92A 2H5SA 1K25A 2ZC5B 1YQSA 4E6XA 4EUZA 3VOZA 2Y55A 4KG5A 1W8YA 4RX2A 4EV4A 3BFGA 3RXXA 2P9VA 4MEZA 4H8RA 1KE0A 2EX2A 3AGFA 3IWIA 3G30A 4BQMA 4EWFA 1Z6FA 4NETA 3Q7ZA 4UA7A 2DRWA 1HZOA 3SH8A 4Y0OA 3QNBA 4EBLA 4OQIA 4F94A 1IYSA 4L0LA 1JWZA 1DJCA 3NDGA 4S2NC 1SHVA 1L2SA 3M6BA 3VOYA 2XR0A 2G2WA 3DTMA 1BLCA 2H0YA 1MWSA 4S2MA 5KMWA 3O3VA 5TFQA 2X01A 5A91A 1L0EA 3G34A 4GD6A 3N6IA 3VP2A 1K56D 3FKWA 4Y0UA 4UAAA 4ZJ1A 1AXBA 1M6KA 2ZQ8A 1QMFA 4JF6A 2WGVA 4IBXA 2ZQ7A 4X6TA 3GMWA 5FI7A 2Y59A 4QU3A 4LENA 4FH4A 3JYIA 2IWBA 5A90A 2V2FF 4IVIA 4RA7A 4OPRA 5FQMA 4OP5A 1LLBA 1KVMA 1O7EA 4OKPA 1N9BA 4EBPA 4GOGA 3M2KA 5EOOA 4ZBEA 4Z9QA 3ZGAB 4DKIA 1CEGA 3OZHA 1JVJA 3WS4A 1K54A 2WKEA 3BM6A 3UDIA 3IF5A 2XGNA 2JCHA 5E2FA 4X68A 1PWGA 2ZQDA 3UE3A 4KZ6A 1W5DA 4E3JA 3IHBA 3MZFA 4N92A 1ZKJA 2H0TA 2WZZA 3MZEA 1DY6A 1VQQA 1BULA 3PAGA 4GZBA 4JKTA 2VGKA 4WZ5C 5AQ9A 3D4FA 3SS5A 1XKZA 1TDGA 2C5WB 3IF6C 1KE4A 2ZMAA 4XUZA 1YM1A 4QD4A 4RX3A 3FV7A 3V3RA 2IWCA 4P85A 5FAQA 1K57C 1BTLA 5EUAA 4C6YA 2V20A 3ZVTA 1NJ4A 1ES2A 2QMIA 3BRMA 2ZQAA 5FI2A 2XH9A 4BLMA 3WS2A 3BEBA 1MWRA 4LV2A 4JPMA 3HL9A 4OOYA 4C3QA 4E6WA 3HREA 2WAFA 2WGWB 1ZG4A 1ZG6A 4KZ5A 3WRZA 1ES5A 4UA6A 4GDNA 4MBKA 4N1HA 3Q81A 5E43A 2Y2QA 3GQZA 2RCXA 2P74A 2DCFA 4MBHA 1JWVA 1LI9A 1TVFA 3VP0A 4FD8A 3AGEA 2WKIA 4KZ3A 3MBZA 4S2NA 4KZ9A 5GL9A 5HARA 1L0GA 4DF6A 4Q8IA 2G2UA 4JXGA 3OPLA 5TGFA 5FQ9A 4OLGA 4WBGA 4KENB 1YLZA 2C6WB 3IH8A 3VMAA 4QY6A 3HLGA 3A3FA 4IBRA 4OQHA 5E2GA 1MXOA 2Y2HA 5GHXA 4X56A 3G2YA 5FAPA 3VP4A 5HL1A 4DE3A 3ZG5A 4E3LA 3UE0A 3C7UA 3SH9A 1S6RA 5DTTA 1QMEA 1IYQA 1EWZA 2V1ZA 2ZM0A 1NYYA 3RXWA 3SH7A 3LY4A 2J9PA 4U0TA 1MBLA 1IKIA 2BLSA 4LV1A 4JBFA 4S2LA 3LCEA 5A93A 3TOIA 1IYPA 2XDMA 2ZQ9A 3NC8A 3EQVA 1TEMA 3QNCA 1XA1A 2IWDA 1ONGA 1E3UA 2PBYA 2WGIA 3BYDA 1PYYA 5GLBA 3VSKA 3ZG9B 2FFYA 4OOLA 2ZC3B 4BD1A 5CGSA 3A3IA 1H8ZA 2Y2PA 1FOFA 2QZ6A 5CERA 4ZJ3A 1EROA 4M3KA 3V39A 3W8KA 3GVBA 2I72A 4HESA 4X55A 5FA7A 4E3MA 4WZ5A 1FR6A 1MWTA 3O87A 1YLTA 2Y2LA 2RL3A 3IF6A 4OOMA 1ERQA 4S2PA 2OLUA 3ITAA 5FASA 1ES3A 2XD5A 4IVKA 1IEMA 1KGGA 1FSYA 1I5QA 1K57A 2XD1A 3C5AA 3G2ZA 1W8QA 4JXWA 5FQQA 4DRTA 2R9XA 5CEDA 2EX6A 5DTSA 1H8YA 1N4OA 1BSGA 4D2OA 3UPOA 2XEPA 2OV5A 3RJUA 4Y7PA 2BG1A 3VP1A 1K56A 1HTZA 3N8RA 3PBQA 3IH9A 2JC7A 4LCLA 5DF7A 5HW3A 1IKGA 1KVLA 2JE5A 1PWCA 1FCOA 2Y2MA 3M2JA 5CTMA 2CC1A 4FSFA 3ZNYA 5CECA 4DXCA 3SS4A 2EXBA 2Z2LB 5IHVA 5TR7A 4OVDA 3UPPA 4E3IA 3GSGA 4RVAA 2FFFB 4KG2A 1K6RA 1L0FA 1KDWA 2ZC4B 3N8LA 4CPKA 4WM9A 3C7VA 1ALQA 1SDEA 3MXSA 5CEBA 1ERMA 3DWZA 3HUMA 3UY6A 3MKFA 1PW1A 4KZ8A 4GD8A 5JYPA 1MWUA 3Q07A 1H5XA 2OLVA 5J8XA 1RCJA 3ZG8B 1GA9A 3OPRA 1BUEA 5AQ7A 4YFMA 1NY0A 1E4DA 4JF4A 1PIOA 2UWXA 3HLWA 3WWXA 1YT4A 1JTDA 4DDSA 1I2SA 5U47A 4QHCA 4WMCA 3NDEA 3BFCA 4DDYA 1BT5A 2Y2NA 2A3UA 3IXBA 3ZFZA 5FSRA 4HBUA 1PI5A 2X02A 3QHYA 3NI9A 4K0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZU A;  5HX9 A;  3NIA A;  4HEF A;  3ZNT A;  3P09 A;  3OCL A;  1KE3 A;  3V3S A;  4P0M A;  3UDF A;  1WE4 A;  1KGE A;  1KGF A;  4XUX A;  4ZTK A;  3BEC A;  2XFT A;  1EI5 A;  3CJM A;  4BL2 A;  4S2J A;  3UO9 A;  5DF8 A;  4B4Z A;  1HD8 A;  4RYE A;  5CRF A;  3HLC A;  4LV3 A;  4MLL A;  2Y2I A;  4R3B A;  3HLE A;  2WAD A;  4O7D A;  4OQG A;  4E3K A;  1TDL A;  5DTK A;  4OPY A;  3WS1 A;  2B5R A;  3HUO A;  3HVF A;  5EVI D;  1GA0 A;  3UPN A;  2Y2J A;  5FAO A;  3WS0 A;  5AQB A;  1ES4 A;  5CHU A;  1Q2Q A;  5EE8 A;  4OQ0 A;  3GR2 A;  5KSH A;  1K4F A;  1YMS A;  4UHU A;  2HDR A;  3E2L A;  2Z2M B;  2WGW A;  5EEC A;  3MFD A;  1SCW A;  4WEL A;  3LY3 A;  3SS3 A;  5DVA A;  3WS5 A;  5M19 A;  1FCM A;  5CHJ A;  4JXS A;  4DE1 A;  3I7J A;  2WKH A;  1K38 A;  3BLS A;  3E2K A;  4QJG A;  2WAE A;  4R3J A;  4U0X A;  1ESU A;  4KQR A;  2EX9 A;  2J9O A;  3HLD A;  4BJP A;  1FQG A;  2EFU A;  1MKI A;  1CI9 A;  1GHI A;  4UA9 A;  4B88 A;  4KQQ A;  2JBF A;  4PM6 A;  5F83 A;  3FYZ A;  4OH0 A;  4N9L A;  5GHY A;  4FH2 A;  4K91 A;  4N1X A;  3A3E A;  1G6A A;  2VGJ A;  1FSW A;  3W4P A;  3CZD A;  3OPP A;  2WUQ A;  3ZHH A;  5HAI A;  1ONH A;  1YLJ A;  4XXR A;  1K6S A;  4KZB A;  1DJA A;  3NCK A;  1MY8 A;  3PBT A;  3FWL A;  3FKV A;  3O88 A;  4PM9 A;  5M18 A;  1K55 C;  3N7W A;  2Y2K A;  1RGZ A;  2ZD8 A;  3LO7 A;  3G4P A;  2GDN A;  3G31 A;  4R4S A;  2QPN A;  5EVI C;  4WYY A;  3PBR A;  3W4O A;  2ZC6 B;  5FDH A;  3OC2 A;  3B3X A;  3VFF A;  4ZAM A;  4Y0T A;  1PI4 A;  5F1F A;  1DJB A;  3A3J A;  4R4R A;  1PZO A;  3C4P A;  4WEJ A;  1BLS A;  1XGJ A;  3DWK A;  5CHM A;  3BFE A;  4WZ4 A;  5FQJ A;  4GB7 A;  3S22 A;  1YLW A;  3P98 A;  1L0D A;  1CK3 A;  1XP4 A;  2Q9M A;  3HLB A;  1E25 A;  4OP8 A;  4KZ4 A;  3V50 A;  1ZC2 A;  1O07 A;  3M6H A;  5HAQ A;  5JYO A;  3BFF A;  3IXD A;  1LI0 A;  1ESI A;  4HBT A;  1PZP A;  2EXA A;  5FQK A;  1C3B A;  3ZG0 A;  1PW8 A;  1W7F A;  2WYX A;  3HLF A;  5E2E A;  3LEZ A;  1Y54 A;  4GDB A;  4OPZ A;  2ZM8 A;  4ZJ2 A;  5FAT A;  5GHZ A;  4QY5 A;  2OSU A;  2H10 A;  2HPB A;  3VFH A;  1XXM A;  4QB8 A;  4B4X A;  5G18 A;  2A49 A;  4GNU A;  1XA7 A;  2XK1 A;  2J7V A;  4E3N A;  2R9W A;  2X71 A;  3Q82 A;  4NK3 A;  3HBR A;  4GKU A;  1FR1 A;  1G68 A;  4KZA A;  5AQA A;  4OLD A;  1NYM A;  1LHY A;  3BLM A;  3SOI A;  5CGW A;  3ITB A;  1KDS A;  2HDU A;  5EVI B;  4KG6 A;  5BOH A;  1IEL A;  3IXG A;  4IED A;  2EX8 A;  3ZVW A;  3NY4 A;  4EQI A;  4LCM A;  2E8I A;  2ZC7 A;  5F1G A;  1NRF A;  3IWO A;  1I2W A;  3GV9 A;  2WK0 A;  3IHA A;  2HP6 A;  4U3T A;  3HUN A;  5FQI A;  4ID4 A;  5FI6 A;  1JTG A;  2XQZ A;  3GTC A;  4BL3 A;  3FZC A;  3OCN A;  2PU2 A;  1CI8 A;  5M1A A;  1K55 A;  2WZX A;  1BZA A;  1Q2P A;  2Y2O A;  5D3O A;  3G35 A;  3IQA A;  3OPH A;  5EVI A;  3Q7V B;  3W4Q A;  3ZCZ A;  1JWP A;  2Q9N A;  4K0X A;  3CMZ A;  4KZ7 A;  3EQU A;  4S2K A;  5E2H A;  1IYO A;  5EOE A;  2XFS A;  1J9M A;  1LL5 A;  3N8S A;  3PAE A;  3PBO A;  3TSG A;  4S2I A;  2EFX A;  3VSL A;  5L2F A;  2ZQC A;  1XGI A;  1U60 A;  5EVL A;  4E3O A;  1RP5 A;  4R1G A;  2Y4A A;  4LV0 A;  3WRT A;  4WMC D;  5GLC A;  5HAP A;  1GHP A;  1K4E A;  3N4I A;  4WEK A;  3V5M A;  5I94 A;  1VM1 A;  3DW0 A;  1OME A;  1SDN A;  5HFO A;  1HVB A;  1WYB A;  1YLP A;  1YLY A;  2ZLY A;  4JLF A;  4DE2 A;  1NZO A;  2HDS A;  2Y2G A;  3S1Y A;  4PMA A;  3Q7V A;  5CGX A;  4MBF A;  4GN2 A;  4R0Q A;  5KSC A;  3GRJ A;  4DE0 A;  1PWD A;  5CXW A;  1GCE A;  4JXV A;  3IXH A;  3G32 A;  4C75 A;  5GLD A;  3UN7 A;  3BFD A;  4PM7 A;  3Q1F A;  3UNW A;  4X53 A;  2J8Y A;  4CJN A;  3UE1 A;  4P6B A;  4BEN A;  3PTE A;  3S4X A;  1NXY A;  2ZM2 A;  3MKE A;  3ZG7 B;  5F82 A;  4DXB A;  5EPH A;  5GLA A;  4PM5 A;  2HDQ A;  2XF3 A;  4N9K A;  4X69 A;  1CEF A;  1WYC A;  5DF9 A;  3A3D A;  2XLN A;  2Y91 A;  3CG5 A;  4KQO A;  4ZDX A;  2PU4 A;  5KZH A;  1BLP A;  1RGY A;  2ZJ9 A;  3NBL A;  1XPB A;  4PPR A;  4PM8 A;  2HP5 A;  3IF6 B;  1GHM A;  1XX2 A;  1BLH A;  1M40 A;  4S2O A;  1K54 C;  4R23 A;  3PBS A;  2HP9 A;  4P87 A;  3AGD A;  3O86 A;  1MPL A;  3ISG A;  3MXR A;  2P9V B;  3PBN A;  4JF5 A;  3ZDJ A;  3VP3 A;  4BD0 A;  4YIN A;  2DNS A;  5CTN A;  3MZD A;  3IT9 A;  1SKF A;  4A5R A;  1W79 A;  4OON A;  3UDX A;  1LL9 A;  3TG9 A;  1YMX A;  4MNR A;  4OPQ A;  3IWQ A;  4EBN A;  4FCF A;  1FCN A;  1S0W A;  1E3U D;  3C4O A;  5A92 A;  2H5S A;  1K25 A;  2ZC5 B;  1YQS A;  4E6X A;  4EUZ A;  3VOZ A;  2Y55 A;  4KG5 A;  1W8Y A;  4RX2 A;  4EV4 A;  3BFG A;  3RXX A;  2P9V A;  4MEZ A;  4H8R A;  1KE0 A;  2EX2 A;  3AGF A;  3IWI A;  3G30 A;  4BQM A;  4EWF A;  1Z6F A;  4NET A;  3Q7Z A;  4UA7 A;  2DRW A;  1HZO A;  3SH8 A;  4Y0O A;  3QNB A;  4EBL A;  4OQI A;  4F94 A;  1IYS A;  4L0L A;  1JWZ A;  1DJC A;  3NDG A;  4S2N C;  1SHV A;  1L2S A;  3M6B A;  3VOY A;  2XR0 A;  2G2W A;  3DTM A;  1BLC A;  2H0Y A;  1MWS A;  4S2M A;  5KMW A;  3O3V A;  5TFQ A;  2X01 A;  5A91 A;  1L0E A;  3G34 A;  4GD6 A;  3N6I A;  3VP2 A;  1K56 D;  3FKW A;  4Y0U A;  4UAA A;  4ZJ1 A;  1AXB A;  1M6K A;  2ZQ8 A;  1QMF A;  4JF6 A;  2WGV A;  4IBX A;  2ZQ7 A;  4X6T A;  3GMW A;  5FI7 A;  2Y59 A;  4QU3 A;  4LEN A;  4FH4 A;  3JYI A;  2IWB A;  5A90 A;  2V2F F;  4IVI A;  4RA7 A;  4OPR A;  5FQM A;  4OP5 A;  1LLB A;  1KVM A;  1O7E A;  4OKP A;  1N9B A;  4EBP A;  4GOG A;  3M2K A;  5EOO A;  4ZBE A;  4Z9Q A;  3ZGA B;  4DKI A;  1CEG A;  3OZH A;  1JVJ A;  3WS4 A;  1K54 A;  2WKE A;  3BM6 A;  3UDI A;  3IF5 A;  2XGN A;  2JCH A;  5E2F A;  4X68 A;  1PWG A;  2ZQD A;  3UE3 A;  4KZ6 A;  1W5D A;  4E3J A;  3IHB A;  3MZF A;  4N92 A;  1ZKJ A;  2H0T A;  2WZZ A;  3MZE A;  1DY6 A;  1VQQ A;  1BUL A;  3PAG A;  4GZB A;  4JKT A;  2VGK A;  4WZ5 C;  5AQ9 A;  3D4F A;  3SS5 A;  1XKZ A;  1TDG A;  2C5W B;  3IF6 C;  1KE4 A;  2ZMA A;  4XUZ A;  1YM1 A;  4QD4 A;  4RX3 A;  3FV7 A;  3V3R A;  2IWC A;  4P85 A;  5FAQ A;  1K57 C;  1BTL A;  5EUA A;  4C6Y A;  2V20 A;  3ZVT A;  1NJ4 A;  1ES2 A;  2QMI A;  3BRM A;  2ZQA A;  5FI2 A;  2XH9 A;  4BLM A;  3WS2 A;  3BEB A;  1MWR A;  4LV2 A;  4JPM A;  3HL9 A;  4OOY A;  4C3Q A;  4E6W A;  3HRE A;  2WAF A;  2WGW B;  1ZG4 A;  1ZG6 A;  4KZ5 A;  3WRZ A;  1ES5 A;  4UA6 A;  4GDN A;  4MBK A;  4N1H A;  3Q81 A;  5E43 A;  2Y2Q A;  3GQZ A;  2RCX A;  2P74 A;  2DCF A;  4MBH A;  1JWV A;  1LI9 A;  1TVF A;  3VP0 A;  4FD8 A;  3AGE A;  2WKI A;  4KZ3 A;  3MBZ A;  4S2N A;  4KZ9 A;  5GL9 A;  5HAR A;  1L0G A;  4DF6 A;  4Q8I A;  2G2U A;  4JXG A;  3OPL A;  5TGF A;  5FQ9 A;  4OLG A;  4WBG A;  4KEN B;  1YLZ A;  2C6W B;  3IH8 A;  3VMA A;  4QY6 A;  3HLG A;  3A3F A;  4IBR A;  4OQH A;  5E2G A;  1MXO A;  2Y2H A;  5GHX A;  4X56 A;  3G2Y A;  5FAP A;  3VP4 A;  5HL1 A;  4DE3 A;  3ZG5 A;  4E3L A;  3UE0 A;  3C7U A;  3SH9 A;  1S6R A;  5DTT A;  1QME A;  1IYQ A;  1EWZ A;  2V1Z A;  2ZM0 A;  1NYY A;  3RXW A;  3SH7 A;  3LY4 A;  2J9P A;  4U0T A;  1MBL A;  1IKI A;  2BLS A;  4LV1 A;  4JBF A;  4S2L A;  3LCE A;  5A93 A;  3TOI A;  1IYP A;  2XDM A;  2ZQ9 A;  3NC8 A;  3EQV A;  1TEM A;  3QNC A;  1XA1 A;  2IWD A;  1ONG A;  1E3U A;  2PBY A;  2WGI A;  3BYD A;  1PYY A;  5GLB A;  3VSK A;  3ZG9 B;  2FFY A;  4OOL A;  2ZC3 B;  4BD1 A;  5CGS A;  3A3I A;  1H8Z A;  2Y2P A;  1FOF A;  2QZ6 A;  5CER A;  4ZJ3 A;  1ERO A;  4M3K A;  3V39 A;  3W8K A;  3GVB A;  2I72 A;  4HES A;  4X55 A;  5FA7 A;  4E3M A;  4WZ5 A;  1FR6 A;  1MWT A;  3O87 A;  1YLT A;  2Y2L A;  2RL3 A;  3IF6 A;  4OOM A;  1ERQ A;  4S2P A;  2OLU A;  3ITA A;  5FAS A;  1ES3 A;  2XD5 A;  4IVK A;  1IEM A;  1KGG A;  1FSY A;  1I5Q A;  1K57 A;  2XD1 A;  3C5A A;  3G2Z A;  1W8Q A;  4JXW A;  5FQQ A;  4DRT A;  2R9X A;  5CED A;  2EX6 A;  5DTS A;  1H8Y A;  1N4O A;  1BSG A;  4D2O A;  3UPO A;  2XEP A;  2OV5 A;  3RJU A;  4Y7P A;  2BG1 A;  3VP1 A;  1K56 A;  1HTZ A;  3N8R A;  3PBQ A;  3IH9 A;  2JC7 A;  4LCL A;  5DF7 A;  5HW3 A;  1IKG A;  1KVL A;  2JE5 A;  1PWC A;  1FCO A;  2Y2M A;  3M2J A;  5CTM A;  2CC1 A;  4FSF A;  3ZNY A;  5CEC A;  4DXC A;  3SS4 A;  2EXB A;  2Z2L B;  5IHV A;  5TR7 A;  4OVD A;  3UPP A;  4E3I A;  3GSG A;  4RVA A;  2FFF B;  4KG2 A;  1K6R A;  1L0F A;  1KDW A;  2ZC4 B;  3N8L A;  4CPK A;  4WM9 A;  3C7V A;  1ALQ A;  1SDE A;  3MXS A;  5CEB A;  1ERM A;  3DWZ A;  3HUM A;  3UY6 A;  3MKF A;  1PW1 A;  4KZ8 A;  4GD8 A;  5JYP A;  1MWU A;  3Q07 A;  1H5X A;  2OLV A;  5J8X A;  1RCJ A;  3ZG8 B;  1GA9 A;  3OPR A;  1BUE A;  5AQ7 A;  4YFM A;  1NY0 A;  1E4D A;  4JF4 A;  1PIO A;  2UWX A;  3HLW A;  3WWX A;  1YT4 A;  1JTD A;  4DDS A;  1I2S A;  5U47 A;  4QHC A;  4WMC A;  3NDE A;  3BFC A;  4DDY A;  1BT5 A;  2Y2N A;  2A3U A;  3IXB A;  3ZFZ A;  5FSR A;  4HBU A;  1PI5 A;  2X02 A;  3QHY A;  3NI9 A;  4K0W A; 
#chains in the Genus database with same CATH topology
 4L9E A;  5HX9 A;  2G7U A;  3P09 A;  4MCW A;  4YNR A;  3UDF A;  2XFT A;  3CJM A;  3SW1 A;  4S2J A;  3VV4 A;  5DF8 A;  1OTA A;  3NEC A;  4LV3 A;  2Y2I A;  4R3B A;  2WAD A;  4GCZ A;  5LBR A;  4O7D A;  3NUL A;  4E3K A;  5DTK A;  4JGR A;  3HVF A;  2PD7 A;  5EVI D;  3S7O A;  5FAO A;  5AQB A;  4B93 A;  4ARZ A;  5CHU A;  2JHE A;  3GR2 A;  1K4F A;  1YMS A;  2MJ6 A;  4UHU A;  4WEL A;  1FCM A;  3O5Y A;  4DE1 A;  2H28 A;  3BLS A;  3KO6 A;  4U0X A;  2J9O A;  5HDD A;  4WL9 A;  4HIA A;  1MKI A;  3S7Q A;  1F2K A;  3P7N A;  5F83 A;  4N9L A;  4FH2 A;  3A3E A;  4HI4 A;  1VET B;  1FSW A;  3T4T A;  3T4L A;  2WUQ A;  1ONH A;  1MY8 A;  3FKV A;  4PM9 A;  1K55 C;  2ZD8 A;  1RGZ A;  1NWZ A;  2ZC6 B;  2NUT C;  4Y0T A;  3NOP C;  2R78 A;  3UB9 A;  5FQJ A;  3A0V A;  3P98 A;  1XP4 A;  4UQI M;  4LGW A;  4KZ4 A;  2D01 A;  1O07 A;  3M6H A;  1ESI A;  3ZG0 A;  5DJT A;  5IT5 A;  3LEZ A;  4OPZ A;  4ZJ2 A;  2A49 A;  4GNU A;  1XA7 A;  4MMN A;  2X71 A;  4KZA A;  1LSX A;  3C2W A;  5CGW A;  3ITB A;  4Z1W A;  4LCM A;  1NRF A;  2L4R A;  2W1T B;  2HP6 A;  5HD5 A;  3FZC A;  1G28 A;  1BZA A;  3NHQ A;  3IQA A;  2QYB A;  4EXO A;  1JWP A;  4K0X A;  3EWK A;  4WN5 A;  4S2K A;  5EOE A;  3PBO A;  3L7H A;  2ZQC A;  3F1O B;  3BQA A;  2Y4A A;  5HAP A;  1K4E A;  4WEK A;  3VOL A;  1OME A;  4MN7 A;  4JLF A;  3S1Y A;  5CGX A;  1GCE A;  3UME A;  4C75 A;  4PM7 A;  2J8Y A;  3UE1 A;  3HJI A;  4BEN A;  3S4X A;  2JKF A;  2B02 A;  3MKE A;  5HPF A;  5F82 A;  3OOV A;  2XF3 A;  1WYC A;  1W63 M;  2JKT M;  1TS6 A;  4ZDX A;  2PU4 A;  2XA7 S;  3CI6 A;  5AVF A;  2HP5 A;  3IF6 B;  3L9K A;  4F3L B;  1GHM A;  1XX2 A;  4S2O A;  4R23 A;  1Z09 A;  2P9V B;  3VP3 A;  2PDR A;  2YKH A;  1SKF A;  4EUV A;  3SZT A;  1YMX A;  1S1Z A;  3UMD A;  4FCF A;  5AJG A;  1E3U D;  1LL8 A;  5A92 A;  2H5S A;  1K25 A;  3LGO A;  2PAV P;  3E98 A;  4E6X A;  5EM1 A;  5FL3 A;  4RX2 A;  4EV4 A;  3T12 B;  4H8R A;  2EX2 A;  3IWI A;  4BQM A;  4EWF A;  5HPI A;  4UA7 A;  2DRW A;  4Y17 A;  1IYS A;  3F1P A;  4II7 A;  4S2N C;  1L2S A;  3M6B A;  2H0Y A;  4O01 A;  1MWS A;  3N6I A;  2EWW A;  2K2N A;  2VV8 A;  1AXB A;  2WGV A;  2ZQ7 A;  5FI7 A;  4LEN A;  2IWB A;  1ODV A;  4RA7 A;  1P9W A;  2Q0O A;  4OKP A;  1G5U A;  1N9B A;  2J3T C;  3A0S A;  2O9B A;  1PNE A;  4Z9Q A;  1OJ5 A;  3GEC A;  1SKO B;  5AVE A;  4CLC D;  4X68 A;  1PWG A;  2ZQD A;  4B9O A;  4KZ6 A;  2O9C A;  3MZF A;  2H0T A;  2WZZ A;  5FAT A;  3PAG A;  3MZE A;  1BUL A;  1V9Y A;  1OTE A;  1F9I A;  1XJ4 A;  4WZ5 C;  3LFV A;  3D4F A;  2HF6 A;  3ULF A;  4G3W A;  4UEY A;  3S7P A;  5EUA A;  5HWV A;  1NJ4 A;  3BRM A;  4KUO A;  1VB6 A;  1V9Z A;  3HL9 A;  1TS0 A;  3HRE A;  2WGW B;  1ZG6 A;  3WRZ A;  1ES5 A;  3T1R A;  4N1H A;  4IUH A;  3DTI A;  1SZV A;  2PBD P;  5GL9 A;  3TJZ C;  1L0G A;  1XFN A;  4EU0 A;  2G2U A;  5TGF A;  4KEN B;  1KOU A;  2C6W B;  3IH8 A;  3PYP A;  3IX8 A;  4QWO A;  5E2G A;  1MXO A;  3CPT B;  3H82 B;  5HL1 A;  4DE3 A;  3ZG5 A;  5CX7 A;  1S6R A;  4EER A;  3SH7 A;  3PHY A;  4U0T A;  4RQ9 A;  2HV1 A;  4R70 A;  1MBL A;  4JBF A;  2XDM A;  5CER A;  3QNC A;  1YSQ A;  5GLB A;  3ZG9 B;  3KSF A;  1DP8 A;  4OOL A;  2ZC3 B;  4BD1 A;  3A3I A;  2QZ6 A;  4HH3 A;  4ZJ3 A;  1HLU P;  4HES A;  4O0P A;  4E3M A;  5KIZ A;  1YLT A;  2GNX A;  2OLU A;  3ITA A;  1KGG A;  4JXW A;  1K57 A;  2XD1 A;  3C5A A;  1W8Q A;  5TBM A;  3MS6 A;  2EX6 A;  1BSG A;  3K3C A;  3B42 A;  2XEP A;  2OV5 A;  2BG1 A;  1K56 A;  3MR0 A;  1KVL A;  4DJ2 A;  1PWC A;  2CMN A;  3D72 A;  2CC1 A;  4FSF A;  5CEC A;  3SS4 A;  3R7W A;  2EXB A;  4OVD A;  3MQO A;  2L1M A;  1L0F A;  3LI8 A;  5CEB A;  3MXS A;  3MKF A;  4KZ8 A;  1S67 L;  5JYP A;  3G6O A;  2OLV A;  1TS8 A;  1RCJ A;  1STZ A;  4Q0I A;  3ZG8 B;  1GA9 A;  1W63 Q;  4YFM A;  1NY0 A;  3T50 A;  1YT4 A;  4DDS A;  4DMZ A;  3BFC A;  4DDY A;  3ZFZ A;  2W3G A;  3MJQ A;  2IA2 A;  5HWT A;  2J3W A;  3ZNT A;  4HEF A;  4DN0 A;  1KE3 A;  4P0M A;  4XUX A;  4ZTK A;  2VV7 A;  3UO9 A;  4B4Z A;  4MLL A;  3LID A;  1TDL A;  4MN6 A;  4HP9 A;  3HUO A;  2W3D A;  3UPN A;  4WUJ A;  3WS0 A;  3CUE C;  5EE8 A;  1OTD A;  2HDR A;  3E2L A;  2Z2M B;  4GJ4 A;  3MFD A;  4X25 A;  3WS5 A;  5M19 A;  4JXS A;  2ZMV A;  5K5B A;  1K38 A;  2WAE A;  4R3J A;  2PD8 A;  3LIE A;  4UA9 A;  2M7U A;  2QHK A;  2JBF A;  4OH0 A;  4K91 A;  2VGJ A;  2VX8 A;  3W4P A;  3OPP A;  4GLQ A;  5HAI A;  4XXR A;  1YLJ A;  3LR0 A;  1K6S A;  4KZB A;  4WF0 A;  5M18 A;  4HJ3 A;  3TW8 A;  2GDN A;  4R4S A;  4WYY A;  3W4O A;  5HWW A;  1J3W A;  2L0W A;  3LIB A;  4ZAM A;  1VET A;  5F1F A;  3ICY A;  4P6Z S;  4WEJ A;  4R4R A;  3C4P A;  1BLS A;  5CHM A;  4WZ4 A;  3V67 A;  3S22 A;  1YLW A;  1L0D A;  3HLB A;  2QWS A;  4HH2 A;  4OP8 A;  4LRX C;  1S4S A;  1LI0 A;  5FQK A;  3U4L P;  1C3B A;  3HLF A;  3JPU A;  1DRM A;  3K2N A;  4QY5 A;  2H10 A;  2HPB A;  1XXM A;  2VEA A;  3F1N B;  3H7W B;  2R9W A;  5L07 A;  4I38 A;  3HBR A;  3D9Y A;  4NG2 A;  5AQA A;  3BQ8 A;  5F6A A;  1NYM A;  1LHY A;  1KDS A;  4KG6 A;  5BOH A;  3PR6 A;  2EX8 A;  4EQI A;  3FPV A;  2VGL M;  5F1G A;  3IWO A;  1I2W A;  3GV9 A;  3IHA A;  3HUN A;  3BY8 A;  2PR5 A;  1JTG A;  4D60 A;  4H6J B;  1CI8 A;  5M1A A;  1K55 A;  2Y2O A;  1Q2P A;  3QP8 A;  3R4K A;  3Q7V B;  3ZCZ A;  2EWV A;  3EQU A;  3N8S A;  2EFX A;  4EEU A;  4E3O A;  4LV0 A;  2W1T A;  4WMC D;  3V5M A;  5I94 A;  1VM1 A;  4YWZ A;  1WYB A;  1YLP A;  2ZLY A;  1N9O A;  4DE2 A;  1NZO A;  2Y2G A;  4PMA A;  3B47 A;  2V0U A;  3BY9 A;  3GRJ A;  1PWD A;  5CXW A;  3QP1 A;  3G32 A;  3UN7 A;  3Q1F A;  3UNW A;  3F1O A;  4X53 A;  4CJN A;  4K08 A;  4GHI B;  4P6B A;  2GX5 A;  2JKG A;  3ZG7 B;  3DTE A;  2I9V A;  2HDQ A;  4X69 A;  1CEF A;  2O0Y A;  4NXF A;  3B33 A;  3CG5 A;  4Q0J A;  5KZH A;  1BLP A;  1RGY A;  1D1J A;  1XPB A;  4PM8 A;  4HY8 A;  2HP9 A;  2VV6 A;  2ZL1 B;  1MPL A;  3MXR A;  4YIN A;  5CTN A;  3T4O A;  5DFY A;  1W79 A;  3MMH A;  2PRF A;  1H8M A;  2ZC5 B;  1YQS A;  2DMW A;  3HCY A;  1W8Y A;  3RXX A;  2P9V A;  4MEZ A;  4E04 A;  4HP4 A;  3Q7Z A;  3QNB A;  1JWZ A;  1DJC A;  1SHV A;  2NUP C;  2G2W A;  3DTM A;  5G4Y A;  5TFQ A;  5A91 A;  3VP2 A;  1K56 D;  3FKW A;  1CJF A;  3MFX A;  2V2F F;  5FQM A;  4OP5 A;  3UE6 A;  4DKI A;  1CEG A;  1JVJ A;  3WS4 A;  2OOL A;  5E2F A;  3UE3 A;  5G4Z A;  3SS5 A;  1XKZ A;  1TDG A;  3IF6 C;  1KE4 A;  4L9F A;  5HSQ A;  1DP9 A;  3TE8 A;  3IS2 B;  3ZVT A;  4HNB A;  2KDK A;  4ARZ B;  4BLM A;  1ZHH B;  3BEB A;  3EGD C;  4E6W A;  4ME4 A;  1ZG4 A;  3C8C A;  3Q81 A;  2Y2Q A;  3GQZ A;  1JWV A;  3D3O A;  1TVF A;  3VP0 A;  3AGE A;  4KZ3 A;  4DF6 A;  4S2N A;  4NXB A;  4Q8I A;  5FQ9 A;  4OLG A;  4WBG A;  4WLA A;  3HLG A;  4OQH A;  2WKR A;  5GHX A;  5F69 A;  3FPW A;  2PR6 A;  1N9N A;  3UE0 A;  2ZBB A;  1EW0 A;  5DTT A;  2OWH A;  2V1Z A;  2ZM0 A;  1NYY A;  2P04 A;  3KSH A;  2J9P A;  2M1C A;  1IKI A;  2BLS A;  4LV1 A;  3LR5 A;  5A93 A;  3NC8 A;  3EQV A;  1XA1 A;  2PBY A;  2FFY A;  2XSS A;  3CPT A;  2XRN A;  5IS1 A;  2Z6D A;  3W8K A;  4FUW A;  4WZ5 A;  3O87 A;  1ERQ A;  1S1Y A;  3CIT A;  4UQI S;  5FAS A;  2W0N A;  1IEM A;  4MDZ A;  1OPX A;  2R9X A;  3KYZ A;  5DTS A;  2O9A A;  3KYE A;  4IJG A;  4BBT A;  3RJU A;  3LIA A;  4LCL A;  3IH9 A;  4Q0H A;  4PAU A;  4HJ6 A;  1FCO A;  2Y2M A;  3PXP A;  5J4E A;  5DKL A;  4ETX A;  2Z2L B;  5TR7 A;  1UWP X;  4E3I A;  2FFF B;  3VE3 A;  3N8L A;  4CPK A;  3UY6 A;  3HUM A;  1PW1 A;  4GD8 A;  5J8X A;  1BYW A;  1MC0 A;  1H3Q A;  2P08 A;  4BBV A;  5MC7 A;  4JF4 A;  2OAQ 1;  3HLW A;  1JTD A;  4WMC A;  3NDE A;  2Y2N A;  2ZOH A;  2A3U A;  3IXB A;  4NKP A;  2A24 B;  5FSR A;  4HBU A;  3T4Q A;  1H0M A;  3NI9 A;  4K0W A;  3TRC A;  3OCL A;  3V3S A;  1KGF A;  2VK3 A;  3BEC A;  1IOU A;  1EI5 A;  4BL2 A;  1HD8 A;  5CRF A;  4BBU A;  3KSI A;  1LT0 A;  3HLE A;  4OQG A;  2JN7 A;  3WS1 A;  2B5R A;  2XRO A;  1GA0 A;  4EES A;  2QJ7 A;  2Y2J A;  2YKF A;  2EA9 A;  1ES4 A;  3MSH A;  4CLC E;  1CQA A;  2KOI A;  5HL6 A;  3LY3 A;  3SS3 A;  4LPZ A;  4IHQ A;  4QJG A;  3BWL A;  4BJP A;  3OBF A;  1GHI A;  4B88 A;  4Y3I A;  4N1X A;  1G6A A;  4ETZ A;  2PYR A;  3ZHH A;  1LSW A;  1CF0 A;  4IUK A;  1DJA A;  3PBT A;  1X0O A;  2M7V A;  3UB8 A;  1GSW A;  2Y2K A;  3G31 A;  5EVI C;  2QPN A;  3EGX C;  1YSP A;  5L10 A;  3RFB A;  5EVE A;  4PKY G;  5FDH A;  3OC2 A;  5HDS A;  1DJB A;  3BJN A;  1T18 A;  2LB9 A;  3LIF A;  1T1B A;  1CK3 A;  3T4S A;  3W2Z A;  1ZC2 A;  2ZMF A;  5HAQ A;  3IXD A;  1PZP A;  3CUE A;  2KX6 A;  1PW8 A;  1GSV A;  1FIK A;  5E2E A;  1Y54 A;  4GDB A;  2ZM8 A;  5GHZ A;  2OSU A;  1Y4O A;  3A0R A;  4QB8 A;  3Q82 A;  4NK3 A;  5L8M A;  1FR1 A;  4OLD A;  3BLM A;  4L9G A;  5EVI B;  1IEL A;  3IXG A;  4IED A;  4XT2 B;  2E8I A;  1MKM A;  3UB7 A;  2Z6C A;  2WK0 A;  3LI9 A;  4U3T A;  3F1N A;  4ID4 A;  5FI6 A;  2XQZ A;  4BL3 A;  2WZX A;  3G35 A;  3CAX A;  3JVV A;  3LR4 A;  2Q9N A;  4KZ7 A;  3CMZ A;  3E4Q A;  2B95 A;  5E2H A;  1IYO A;  1LL5 A;  3TSG A;  5L09 A;  1K0K A;  4S2I A;  3VSL A;  5L2F A;  1LSV A;  1XGI A;  3WRT A;  4PKY A;  5GLC A;  1GHP A;  3N4I A;  1SDN A;  4H6J A;  5HFO A;  1WA9 A;  3Q7V A;  4GN2 A;  4LLO B;  2AVX A;  3IXH A;  4LRZ E;  5GLD A;  3BFD A;  2INW A;  2V1A A;  4GS9 B;  1NXY A;  4M4X A;  4DXB A;  5EPH A;  5GLA A;  1XFQ A;  3QP4 A;  5DF9 A;  2A2L A;  3A3D A;  3GDI A;  2XLN A;  4KQO A;  2FH5 A;  3QP6 A;  3NBL A;  4PPR A;  1MZU A;  1M40 A;  1K54 C;  2GJ3 A;  4P87 A;  3AGD A;  4GHI A;  4X1L A;  3ISG A;  4NXG A;  4JF5 A;  3PBN A;  2FZ0 A;  3ZDJ A;  2V1B A;  2GZA A;  5TBM B;  3T1S A;  4JGQ A;  3IT9 A;  4A5R A;  4OON A;  3UDX A;  4OPQ A;  3IWQ A;  1P0Z A;  3DAV A;  4G3V A;  2J3T D;  3LUQ A;  2JKR I;  4EUZ A;  2Y55 A;  4KG5 A;  2W3H A;  2ZL1 A;  3BFG A;  2HGV A;  1KE0 A;  3AGF A;  4EET B;  4HJ4 A;  1Z6F A;  4R3A A;  1HZO A;  4EBL A;  2WKP A;  4ESP A;  5F5Y A;  2W1R A;  3O3V A;  3FG8 A;  1L0E A;  3G34 A;  4GD6 A;  3K3D A;  4Y0U A;  4UAA A;  1VEU B;  2Y79 A;  3MQ0 A;  3GMW A;  4FH4 A;  3JYI A;  5A90 A;  4IVI A;  1PRQ A;  2QJ5 A;  1KVM A;  4EBP A;  1VHM A;  3M2K A;  5EOO A;  3OZH A;  4QPR A;  4I3A A;  2WKE A;  3IF5 A;  2XGN A;  2JCH A;  1W5D A;  3IHB A;  3LYX A;  1ZKJ A;  4O8G A;  4JKT A;  1DY6 A;  4R6L A;  2C5W B;  2ZMA A;  1YM1 A;  5EFW A;  4QD4 A;  3FV7 A;  3V3R A;  4P85 A;  5FAQ A;  1BTL A;  2QMI A;  1ES2 A;  2ZQA A;  5FI2 A;  4FTX A;  3P01 A;  4LV2 A;  4JPM A;  4C3Q A;  2WAF A;  4KZ5 A;  3IX4 A;  4UA6 A;  4GDN A;  4MBK A;  2P74 A;  2DCF A;  2RCX A;  4FD8 A;  2WKI A;  5HAR A;  3IS2 A;  1YLZ A;  2O99 A;  4QY6 A;  4IBR A;  2Y2H A;  4CLC C;  3G2Y A;  3VP4 A;  3C7U A;  3SH9 A;  1QME A;  1IFQ A;  4HOI A;  1IYQ A;  1YKD A;  3LCE A;  1IYP A;  2ZQ9 A;  5DKK A;  1TEM A;  2WGI A;  3VSK A;  1PYY A;  2Y2P A;  1FOF A;  2XA7 M;  1ERO A;  4M3K A;  1OT9 A;  2V8C A;  3V39 A;  3GVB A;  2I72 A;  4X55 A;  5I5L A;  2Y2L A;  2RL3 A;  3IF6 A;  4OOM A;  4F3L A;  5FEG A;  2XD5 A;  4IVK A;  1N9L A;  3G2Z A;  1N4O A;  5TJJ A;  3UPO A;  3ZYT A;  2OAP 1;  4BMW A;  3VP1 A;  4CLC B;  3PBQ A;  2W3E A;  1XJ6 A;  5HW3 A;  1IKG A;  1Y28 A;  4DXC A;  5IHV A;  3UPP A;  4KG2 A;  2J80 A;  1K6R A;  2ZC4 B;  1KDW A;  4NXE A;  4WM9 A;  3C7V A;  4Y2F A;  1ALQ A;  2VGL S;  1G6O A;  3Q07 A;  2VA0 A;  1H5X A;  4I3I A;  1UWN X;  3OPR A;  1BUE A;  5AQ7 A;  3QP2 A;  2UWX A;  1I2S A;  3KYQ A;  3MF0 A;  1PI5 A;  2X02 A;  3QHY A;  1NZU A;  3UB6 A;  3NIA A;  1F5M A;  2BAS A;  2KLI A;  5C5K A;  3IBJ A;  4HQA A;  1WE4 A;  1KGE A;  1SKO A;  3RTY A;  5J3W A;  4RYE A;  3HLC A;  3MXQ A;  4LRY C;  2A24 A;  1NRJ A;  1ZTU A;  4OPY A;  4KUK A;  1GSX A;  2K31 A;  2WKQ A;  3E4O A;  1Q2Q A;  4OQ0 A;  1DP6 A;  5KSH A;  2WGW A;  5EEC A;  1SCW A;  5DVA A;  5CHJ A;  3I7J A;  5HD3 A;  3UB5 P;  2WKH A;  1FIL A;  3E2K A;  4HHD A;  1ESU A;  4KQR A;  2EX9 A;  3HLD A;  1OTB A;  1FQG A;  5HZH A;  2EFU A;  1CI9 A;  4KQQ A;  4PM6 A;  3FYZ A;  2V9A A;  5GHY A;  3H82 A;  3CZD A;  3NCK A;  3FWL A;  3O88 A;  5FEF A;  3N7W A;  3LO7 A;  3G4P A;  3PBR A;  3U2A A;  4I39 A;  2ZOI A;  3E0Y A;  3B3X A;  3VFF A;  1PI4 A;  3A3J A;  1PZO A;  2V8F A;  3EEA A;  1XGJ A;  3DWK A;  3BFE A;  4GB7 A;  4ZRR A;  2Q9M A;  1OT6 A;  1E25 A;  3V50 A;  5JYO A;  3BFF A;  2BTF P;  4HBT A;  2EXA A;  1D7E A;  1W7F A;  2WYX A;  2V0W A;  2HZ5 A;  4FOF A;  1S4R A;  1P97 A;  3VFH A;  4B4X A;  5EM0 A;  5G18 A;  2UV0 E;  2XK1 A;  2J7V A;  2W3F A;  4JGP A;  4E3N A;  4GKU A;  4DJ3 A;  1G68 A;  3SOI A;  2HDU A;  2ACG A;  3ZVW A;  3NY4 A;  3T1X A;  1XJ3 A;  2ZC7 A;  2HJE A;  2QKP A;  3CWF A;  3H9W A;  5FQI A;  3T1Q B;  3GTC A;  3OCN A;  2PU2 A;  5D3O A;  3OPH A;  3E4P A;  5EVI A;  4PHT A;  5FDS A;  3W4Q A;  4E3J A;  1J9M A;  2XFS A;  3HJK A;  3PAE A;  4XT2 A;  3NJA A;  1U60 A;  5EVL A;  2VJW A;  1RP5 A;  4R1G A;  3DBA A;  4GW9 A;  3OLO A;  3DW0 A;  3C30 A;  1HVB A;  1YLY A;  2HDS A;  3IX3 A;  3VE4 A;  5J7E A;  4MBF A;  4R0Q A;  5KSC A;  4DE0 A;  4JXV A;  2W27 A;  2JKT I;  3PTE A;  2ZM2 A;  5IU1 A;  4I3J A;  4PM5 A;  1T1C A;  4N9K A;  3KX0 X;  2Y91 A;  2VZW A;  2VKS A;  2ZJ9 A;  2D02 A;  5DJU A;  1BLH A;  3PBS A;  1NLY A;  3O86 A;  4GS9 A;  4BD0 A;  2DNS A;  1T19 A;  3MZD A;  1LL9 A;  3TG9 A;  4MNR A;  3F1P B;  4EBN A;  1FCN A;  1OTI A;  1S0W A;  1TD5 A;  3MQQ A;  3C4O A;  5F68 A;  1F98 A;  3S7N A;  3VOZ A;  4EEP A;  5HDC A;  3T4K A;  3G30 A;  2JKR M;  4NET A;  3BW6 A;  3SH8 A;  4Y0O A;  4OQI A;  5DFX A;  4L0L A;  3NDG A;  3LEQ A;  4P6Z M;  3VOY A;  2XR0 A;  1TS7 A;  1BLC A;  2VLG A;  4S2M A;  5KMW A;  2X01 A;  1L3L A;  4ZJ1 A;  4AFI A;  1M6K A;  2ZQ8 A;  1QMF A;  4JF6 A;  4IBX A;  4X6T A;  5A8B A;  2Y59 A;  4QU3 A;  3IBR A;  3NOU C;  1XJ2 A;  1AWI A;  4OPR A;  1LLB A;  1O7E A;  4GOG A;  1PFL A;  4ZBE A;  3ZGA B;  3H7W A;  1K54 A;  3BM6 A;  3UDI A;  5EV0 A;  1YPR A;  3FC7 A;  1VEU A;  3C38 A;  4N92 A;  4Y5F A;  5E43 A;  1VQQ A;  4GZB A;  2VGK A;  5AQ9 A;  3NOT C;  4BWI A;  4XUZ A;  4RX3 A;  2IWC A;  1JNU A;  1K57 C;  4C6Y A;  2V20 A;  3DTK A;  3CHW P;  2XH9 A;  3WS2 A;  1MWR A;  4OOY A;  3QP5 A;  3RH8 B;  4EW7 A;  3LIC A;  4NEE D;  2P7J A;  2E8J A;  4MBH A;  1OJG A;  1LI9 A;  2B18 A;  1ACF A;  3MBZ A;  4KZ9 A;  2HJ9 C;  4JXG A;  3OPL A;  3EEH A;  3VMA A;  3T4J A;  4KQD A;  3A3F A;  1UGU A;  4X56 A;  5FAP A;  4I5S A;  4E3L A;  3LR3 A;  1EWZ A;  3RXW A;  3LY4 A;  1A0K A;  4S2L A;  3TOI A;  3JVU A;  2IWD A;  3BYD A;  1ONG A;  1E3U A;  4R38 A;  4F94 A;  1P9R A;  3KSG A;  5CGS A;  1H8Z A;  4YOF A;  2OWJ A;  4LFU A;  5FA7 A;  1FR6 A;  1MWT A;  3CLO A;  4S2P A;  1ES3 A;  1FSY A;  1I5Q A;  5FQQ A;  4X1M A;  3R7W B;  4DRT A;  4Y13 A;  5CED A;  1H8Y A;  4CQH A;  1T1A A;  4D2O A;  2PHY A;  4Y7P A;  2LB5 A;  1HTZ A;  3N8R A;  4G3K A;  5DF7 A;  1YAX A;  2JC7 A;  2JE5 A;  3M2J A;  5CTM A;  3ZNY A;  3EOI A;  4Y15 A;  3GSG A;  4RVA A;  4JGO A;  1SDE A;  4CLC A;  1ERM A;  1TF1 A;  3DWZ A;  2PT7 A;  4EQ1 A;  2PYP A;  1MWU A;  3ZQ5 A;  2K7S A;  2Y8H A;  1S66 L;  1E4D A;  1PIO A;  4MN5 A;  3WWX A;  5U47 A;  4QHC A;  1D06 A;  1BT5 A;  1NLZ A; 
#chains in the Genus database with same CATH homology
 1NZU A;  5HX9 A;  3NIA A;  4HEF A;  3ZNT A;  3P09 A;  3OCL A;  1KE3 A;  3V3S A;  4P0M A;  3UDF A;  1WE4 A;  1KGE A;  1KGF A;  4XUX A;  4ZTK A;  3BEC A;  2XFT A;  1EI5 A;  3CJM A;  4BL2 A;  4S2J A;  3UO9 A;  5DF8 A;  4B4Z A;  1HD8 A;  4RYE A;  5CRF A;  3HLC A;  4LV3 A;  4MLL A;  2Y2I A;  4R3B A;  3HLE A;  2WAD A;  4O7D A;  4OQG A;  4E3K A;  1TDL A;  5DTK A;  4OPY A;  3WS1 A;  2B5R A;  3HUO A;  3HVF A;  5EVI D;  1GA0 A;  3UPN A;  2Y2J A;  5FAO A;  3WS0 A;  5AQB A;  1ES4 A;  5CHU A;  1Q2Q A;  5EE8 A;  4OQ0 A;  3GR2 A;  5KSH A;  1K4F A;  1YMS A;  4UHU A;  2HDR A;  3E2L A;  2Z2M B;  2WGW A;  5EEC A;  3MFD A;  1SCW A;  4WEL A;  3LY3 A;  3SS3 A;  5DVA A;  3WS5 A;  5M19 A;  1FCM A;  5CHJ A;  4JXS A;  4DE1 A;  3I7J A;  2WKH A;  1K38 A;  3BLS A;  3E2K A;  4QJG A;  2WAE A;  4R3J A;  4U0X A;  1ESU A;  4KQR A;  2EX9 A;  2J9O A;  3HLD A;  4BJP A;  1FQG A;  2EFU A;  1MKI A;  1CI9 A;  1GHI A;  4UA9 A;  4B88 A;  4KQQ A;  2JBF A;  4PM6 A;  5F83 A;  3FYZ A;  4OH0 A;  4N9L A;  5GHY A;  4FH2 A;  4K91 A;  4N1X A;  3A3E A;  1G6A A;  2VGJ A;  1FSW A;  3W4P A;  3CZD A;  3OPP A;  2WUQ A;  3ZHH A;  5HAI A;  1ONH A;  1YLJ A;  4XXR A;  1K6S A;  4KZB A;  1DJA A;  3NCK A;  1MY8 A;  3PBT A;  3FWL A;  3FKV A;  3O88 A;  4PM9 A;  5M18 A;  1K55 C;  3N7W A;  2Y2K A;  1RGZ A;  2ZD8 A;  3LO7 A;  3G4P A;  2GDN A;  3G31 A;  4R4S A;  2QPN A;  5EVI C;  4WYY A;  3PBR A;  3W4O A;  2ZC6 B;  5FDH A;  3OC2 A;  3B3X A;  3VFF A;  4ZAM A;  4Y0T A;  1PI4 A;  5F1F A;  1DJB A;  3A3J A;  4R4R A;  1PZO A;  3C4P A;  4WEJ A;  1BLS A;  1XGJ A;  3DWK A;  5CHM A;  3BFE A;  4WZ4 A;  5FQJ A;  4GB7 A;  3S22 A;  1YLW A;  3P98 A;  1L0D A;  1CK3 A;  1XP4 A;  2Q9M A;  3HLB A;  1E25 A;  4OP8 A;  4KZ4 A;  3V50 A;  1ZC2 A;  1O07 A;  3M6H A;  5HAQ A;  5JYO A;  3BFF A;  3IXD A;  1LI0 A;  1ESI A;  4HBT A;  1PZP A;  2EXA A;  5FQK A;  1C3B A;  3ZG0 A;  1PW8 A;  1W7F A;  2WYX A;  3HLF A;  5E2E A;  3LEZ A;  1Y54 A;  4GDB A;  4OPZ A;  2ZM8 A;  4ZJ2 A;  5FAT A;  5GHZ A;  4QY5 A;  2OSU A;  2H10 A;  2HPB A;  3VFH A;  1XXM A;  4QB8 A;  4B4X A;  5G18 A;  2A49 A;  4GNU A;  1XA7 A;  2XK1 A;  2J7V A;  4E3N A;  2R9W A;  2X71 A;  3Q82 A;  4NK3 A;  3HBR A;  4GKU A;  1FR1 A;  1G68 A;  4KZA A;  5AQA A;  4OLD A;  1NYM A;  1LHY A;  3BLM A;  3SOI A;  5CGW A;  3ITB A;  1KDS A;  2HDU A;  5EVI B;  4KG6 A;  5BOH A;  1IEL A;  3IXG A;  4IED A;  2EX8 A;  3ZVW A;  3NY4 A;  4EQI A;  4LCM A;  2E8I A;  2ZC7 A;  5F1G A;  1NRF A;  3IWO A;  1I2W A;  3GV9 A;  2WK0 A;  3IHA A;  2HP6 A;  4U3T A;  3HUN A;  5FQI A;  4ID4 A;  5FI6 A;  1JTG A;  2XQZ A;  3GTC A;  4BL3 A;  3FZC A;  3OCN A;  2PU2 A;  1CI8 A;  5M1A A;  1K55 A;  2WZX A;  1BZA A;  1Q2P A;  2Y2O A;  5D3O A;  3G35 A;  3IQA A;  3OPH A;  5EVI A;  3Q7V B;  3W4Q A;  3ZCZ A;  1JWP A;  2Q9N A;  4K0X A;  3CMZ A;  4KZ7 A;  3EQU A;  4S2K A;  5E2H A;  1IYO A;  5EOE A;  2XFS A;  1J9M A;  1LL5 A;  3N8S A;  3PAE A;  3PBO A;  3TSG A;  4S2I A;  2EFX A;  3VSL A;  5L2F A;  2ZQC A;  1XGI A;  1U60 A;  5EVL A;  4E3O A;  1RP5 A;  4R1G A;  2Y4A A;  4LV0 A;  3WRT A;  4WMC D;  5GLC A;  5HAP A;  1GHP A;  1K4E A;  3N4I A;  4WEK A;  3V5M A;  5I94 A;  1VM1 A;  3DW0 A;  1OME A;  1SDN A;  5HFO A;  1HVB A;  1WYB A;  1YLP A;  1YLY A;  2ZLY A;  4JLF A;  4DE2 A;  1NZO A;  2HDS A;  2Y2G A;  3S1Y A;  4PMA A;  3Q7V A;  5CGX A;  4MBF A;  4GN2 A;  4R0Q A;  5KSC A;  3GRJ A;  4DE0 A;  1PWD A;  5CXW A;  1GCE A;  4JXV A;  3IXH A;  3G32 A;  4C75 A;  5GLD A;  3UN7 A;  3BFD A;  4PM7 A;  3Q1F A;  3UNW A;  4X53 A;  2J8Y A;  4CJN A;  3UE1 A;  4P6B A;  4BEN A;  3PTE A;  3S4X A;  1NXY A;  2ZM2 A;  3MKE A;  3ZG7 B;  5F82 A;  4DXB A;  5EPH A;  5GLA A;  4PM5 A;  2HDQ A;  2XF3 A;  4N9K A;  4X69 A;  1CEF A;  1WYC A;  5DF9 A;  3A3D A;  2XLN A;  2Y91 A;  3CG5 A;  4KQO A;  4ZDX A;  2PU4 A;  5KZH A;  1BLP A;  1RGY A;  2ZJ9 A;  3NBL A;  1XPB A;  4PPR A;  4PM8 A;  2HP5 A;  3IF6 B;  1GHM A;  1XX2 A;  1BLH A;  1M40 A;  4S2O A;  1K54 C;  4R23 A;  3PBS A;  2HP9 A;  4P87 A;  3AGD A;  3O86 A;  1MPL A;  3ISG A;  3MXR A;  2P9V B;  3PBN A;  4JF5 A;  3ZDJ A;  3VP3 A;  4BD0 A;  4YIN A;  2DNS A;  5CTN A;  3MZD A;  3IT9 A;  1SKF A;  4A5R A;  1W79 A;  4OON A;  3UDX A;  1LL9 A;  3TG9 A;  1YMX A;  4MNR A;  4OPQ A;  3IWQ A;  4EBN A;  4FCF A;  1FCN A;  1S0W A;  1E3U D;  3C4O A;  5A92 A;  2H5S A;  1K25 A;  2ZC5 B;  1YQS A;  4E6X A;  4EUZ A;  3VOZ A;  2Y55 A;  4KG5 A;  1W8Y A;  4RX2 A;  4EV4 A;  3BFG A;  3RXX A;  2P9V A;  4MEZ A;  4H8R A;  1KE0 A;  2EX2 A;  3AGF A;  3IWI A;  3G30 A;  4BQM A;  4EWF A;  1Z6F A;  4NET A;  3Q7Z A;  4UA7 A;  2DRW A;  1HZO A;  3SH8 A;  4Y0O A;  3QNB A;  4EBL A;  4OQI A;  4F94 A;  1IYS A;  4L0L A;  1JWZ A;  1DJC A;  3NDG A;  4S2N C;  1SHV A;  1L2S A;  3M6B A;  3VOY A;  2XR0 A;  2G2W A;  3DTM A;  1BLC A;  2H0Y A;  1MWS A;  4S2M A;  5KMW A;  3O3V A;  5TFQ A;  2X01 A;  5A91 A;  1L0E A;  3G34 A;  4GD6 A;  3N6I A;  3VP2 A;  1K56 D;  3FKW A;  4Y0U A;  4UAA A;  4ZJ1 A;  1AXB A;  1M6K A;  2ZQ8 A;  1QMF A;  4JF6 A;  2WGV A;  4IBX A;  2ZQ7 A;  4X6T A;  3GMW A;  5FI7 A;  2Y59 A;  4QU3 A;  4LEN A;  4FH4 A;  3JYI A;  2IWB A;  5A90 A;  2V2F F;  4IVI A;  4RA7 A;  4OPR A;  5FQM A;  4OP5 A;  1LLB A;  1KVM A;  1O7E A;  4OKP A;  1N9B A;  4EBP A;  4GOG A;  3M2K A;  5EOO A;  4ZBE A;  4Z9Q A;  3ZGA B;  4DKI A;  1CEG A;  3OZH A;  1JVJ A;  3WS4 A;  1K54 A;  2WKE A;  3BM6 A;  3UDI A;  3IF5 A;  2XGN A;  2JCH A;  5E2F A;  4X68 A;  1PWG A;  2ZQD A;  3UE3 A;  4KZ6 A;  1W5D A;  4E3J A;  3IHB A;  3MZF A;  4N92 A;  1ZKJ A;  2H0T A;  2WZZ A;  3MZE A;  1DY6 A;  1VQQ A;  1BUL A;  3PAG A;  4GZB A;  4JKT A;  2VGK A;  4WZ5 C;  5AQ9 A;  3D4F A;  3SS5 A;  1XKZ A;  1TDG A;  2C5W B;  3IF6 C;  1KE4 A;  2ZMA A;  4XUZ A;  1YM1 A;  4QD4 A;  4RX3 A;  3FV7 A;  3V3R A;  2IWC A;  4P85 A;  5FAQ A;  1K57 C;  1BTL A;  5EUA A;  4C6Y A;  2V20 A;  3ZVT A;  1NJ4 A;  1ES2 A;  2QMI A;  3BRM A;  2ZQA A;  5FI2 A;  2XH9 A;  4BLM A;  3WS2 A;  3BEB A;  1MWR A;  4LV2 A;  4JPM A;  3HL9 A;  4OOY A;  4C3Q A;  4E6W A;  3HRE A;  2WAF A;  2WGW B;  1ZG4 A;  1ZG6 A;  4KZ5 A;  3WRZ A;  1ES5 A;  4UA6 A;  4GDN A;  4MBK A;  4N1H A;  3Q81 A;  5E43 A;  2Y2Q A;  3GQZ A;  2RCX A;  2P74 A;  2DCF A;  4MBH A;  1JWV A;  1LI9 A;  1TVF A;  3VP0 A;  4FD8 A;  3AGE A;  2WKI A;  4KZ3 A;  3MBZ A;  4S2N A;  4KZ9 A;  5GL9 A;  5HAR A;  1L0G A;  4DF6 A;  4Q8I A;  2G2U A;  4JXG A;  3OPL A;  5TGF A;  5FQ9 A;  4OLG A;  4WBG A;  4KEN B;  1YLZ A;  2C6W B;  3IH8 A;  3VMA A;  4QY6 A;  3HLG A;  3A3F A;  4IBR A;  4OQH A;  5E2G A;  1MXO A;  2Y2H A;  5GHX A;  4X56 A;  3G2Y A;  5FAP A;  3VP4 A;  5HL1 A;  4DE3 A;  3ZG5 A;  4E3L A;  3UE0 A;  3C7U A;  3SH9 A;  1S6R A;  5DTT A;  1QME A;  1IYQ A;  1EWZ A;  2V1Z A;  2ZM0 A;  1NYY A;  3RXW A;  3SH7 A;  3LY4 A;  2J9P A;  4U0T A;  1MBL A;  1IKI A;  2BLS A;  4LV1 A;  4JBF A;  4S2L A;  3LCE A;  5A93 A;  3TOI A;  1IYP A;  2XDM A;  2ZQ9 A;  3NC8 A;  3EQV A;  1TEM A;  3QNC A;  1XA1 A;  2IWD A;  1ONG A;  1E3U A;  2PBY A;  2WGI A;  3BYD A;  1PYY A;  5GLB A;  3VSK A;  3ZG9 B;  2FFY A;  4OOL A;  2ZC3 B;  4BD1 A;  5CGS A;  3A3I A;  1H8Z A;  2Y2P A;  1FOF A;  2QZ6 A;  5CER A;  4ZJ3 A;  1ERO A;  4M3K A;  3V39 A;  3W8K A;  3GVB A;  2I72 A;  4HES A;  4X55 A;  5FA7 A;  4E3M A;  4WZ5 A;  1FR6 A;  1MWT A;  3O87 A;  1YLT A;  2Y2L A;  2RL3 A;  3IF6 A;  4OOM A;  1ERQ A;  4S2P A;  2OLU A;  3ITA A;  5FAS A;  1ES3 A;  2XD5 A;  4IVK A;  1IEM A;  1KGG A;  1FSY A;  1I5Q A;  1K57 A;  2XD1 A;  3C5A A;  3G2Z A;  1W8Q A;  4JXW A;  5FQQ A;  4DRT A;  2R9X A;  5CED A;  2EX6 A;  5DTS A;  1H8Y A;  1N4O A;  1BSG A;  4D2O A;  3UPO A;  2XEP A;  2OV5 A;  3RJU A;  4Y7P A;  2BG1 A;  3VP1 A;  1K56 A;  1HTZ A;  3N8R A;  3PBQ A;  3IH9 A;  2JC7 A;  4LCL A;  5DF7 A;  5HW3 A;  1IKG A;  1KVL A;  2JE5 A;  1PWC A;  1FCO A;  2Y2M A;  3M2J A;  5CTM A;  2CC1 A;  4FSF A;  3ZNY A;  5CEC A;  4DXC A;  3SS4 A;  2EXB A;  2Z2L B;  5IHV A;  5TR7 A;  4OVD A;  3UPP A;  4E3I A;  3GSG A;  4RVA A;  2FFF B;  4KG2 A;  1K6R A;  1L0F A;  1KDW A;  2ZC4 B;  3N8L A;  4CPK A;  4WM9 A;  3C7V A;  1ALQ A;  1SDE A;  3MXS A;  5CEB A;  1ERM A;  3DWZ A;  3HUM A;  3UY6 A;  3MKF A;  1PW1 A;  4KZ8 A;  4GD8 A;  5JYP A;  1MWU A;  3Q07 A;  1H5X A;  2OLV A;  5J8X A;  1RCJ A;  3ZG8 B;  1GA9 A;  3OPR A;  1BUE A;  5AQ7 A;  4YFM A;  1NY0 A;  1E4D A;  4JF4 A;  1PIO A;  2UWX A;  3HLW A;  3WWX A;  1YT4 A;  1JTD A;  4DDS A;  1I2S A;  5U47 A;  4QHC A;  4WMC A;  3NDE A;  3BFC A;  4DDY A;  1BT5 A;  2Y2N A;  2A3U A;  3IXB A;  3ZFZ A;  5FSR A;  4HBU A;  1PI5 A;  2X02 A;  3QHY A;  3NI9 A;  4K0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...