1LT0A

Crystal structure of the cn-bound bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lt0A00
2JN7A 2VLGA 2L0WA 3H7WB 3BWLA 5AVEA 1T1CA 1TS0A 4JGQA 1OTDA 3UB6A 2QWSA 2YKFA 1V9YA 1XJ2A 3LIEA 2VEAA 2K7SA 1UWPX 2BASA 5DKLA 1LSVA 5J4EA 3MQOA 3UMDA 2PDRA 2PR5A 2VV6A 1P0ZA 2OWHA 4GW9A 1S4RA 5F68A 1LSXA 3KX0X 2V9AA 1JNUA 4LRYC 5HWTA 3F1NA 3E4QA 5G4YA 1DP9A 2OOLA 1DP8A 4K08A 3LIDA 4LPZA 4H6JA 1MZUA 5HZHA 1LL8A 4EETB 3LYXA 3MFXA 3RH8B 3RTYA 1TS6A 1OT9A 1OTIA 3D72A 4XT2B 2D02A 5F69A 3UB7A 1S1YA 1S4SA 4E04A 3B33A 4HHDA 5TBMB 4GS9B 1DP6A 4HJ6A 5F6AA 3ZQ5A 3NOUC 4HNBA 1XJ4A 3CWFA 4WL9A 4PKYA 1XFNA 4HOIA 4LLOB 2QHKA 4RQ9A 4EERA 3LIAA 1S66L 1P97A 4EQ1A 3FC7A 5HDCA 1VB6A 4WN5A 1EW0A 3LI8A 2PHYA 1N9OA 1WA9A 4HI4A 4I5SA 3H82B 2KX6A 1Y28A 3GDIA 1GSXA 2W27A 3PYPA 3UE6A 3A0RA 4BBVA 4L9GA 4KUKA 3F1PB 3EWKA 1V9ZA 1ODVA 2I9VA 3H9WA 4YWZA 4NXFA 2PYRA 5HD5A 1XJ3A 4I3IA 4HY8A 4WF0A 1S67L 1NWZA 4EXOA 4EEUA 2PR6A 1T18A 1UGUA 1GSWA 1OJ5A 5HDSA 1T1BA 3F1OA 4GCZA 5HWWA 1N9LA 3LI9A 4WLAA 1F9IA 5A8BA 4I39A 4GHIB 4I38A 2L1MA 4KUOA 3GECA 2QJ5A 3NHQA 4MN6A 2QKPA 2Z6DA 3OLOA 4H6JB 3PHYA 1GSVA 3EEHA 1OTBA 4HH3A 4JGOA 1UWNX 2M1CA 4MN5A 4HJ4A 3CLOA 4DJ3A 3NOPC 3CAXA 3MQQA 4HJ3A 2CMNA 2J80A 1TS8A 3P7NA 5F5YA 2WKRA 2V1BA 2A24B 4EESA 4HQAA 2ZOIA 1OTAA 1OJGA 5HDDA 3MXQA 1T1AA 4F3LA 3LUQA 5G4ZA 3E4OA 4I3JA 1XFQA 5J7EA 4B9OA 3FG8A 5HD3A 5HSQA 4L9EA 4HP4A 1LSWA 1KOUA 3HJKA 1F98A 5DKKA 4NXBA 3UMEA 3IS2B 1D06A 3BY9A 5J3WA 1X0OA 2L4RA 5EFWA 5IS1A 3UB8A 4R70A 2PD7A 1LT0A 3H82A 3E4PA 3LIBA 5IU1A 2P7JA 3SW1A 2ZOHA 2WKQA 3H7WA 2V1AA 3F1PA 3C8CA 3MJQA 1G28A 4I3AA 4JGPA 3MR0A 3F1OB 4DJ2A 3HJIA 3F1NB 4WUJA 4NXEA 2YKHA 1D7EA 4JGRA 2Z6CA 4EEPA 3BY8A 1N9NA 4BBTA 3A0VA 3VE3A 3LICA 3LIFA 4HIAA 5KIZA 4GHIA 3A0SA 3ULFA 2VV8A 2GJ3A 2HV1A 3VE4A 2B02A 2D01A 2W0NA 4R6LA 3K3CA 1XJ6A 4KQDA 1TS7A 2INWA 3NOTC 2PD8A 1OT6A 2H28A 2R78A 4F3LB 4XT2A 5AVFA 3C2WA 5DJTA 4R38A 5DJUA 2V0UA 3G6OA 5TBMA 4LRZE 4GS9A 2PYPA 4HH2A 2A24A 4R3AA 2V0WA 1DRMA 2QJ7A 2WKPA 5I5LA 2VV7A 4HP9A 4BBUA 2ZBBA 5HWVA 1OTEA 3K3DA 3UB9A 3ICYA 3NJAA 3T50A 3IBRA 1BYWA 4NXGA 4M4XA 3VOLA 4LRXC 1S1ZA 2JHEA 4L9FA 2EA9A 2OWJA 2KDKA 4EW7A 3IS2A 4PKYG 1T19A
chains in the Genus database with same CATH superfamily
4Y2FA 2JN7A 2WKHA 3FV7A 3H7WB 3BWLA 5AVEA 4NEED 4JXVA 4GNUA 2EX9A 1MPLA 4UHUA 2ZD8A 1HZOA 2QWSA 4EBLA 1I5QA 1GHPA 3MFDA 2R9XA 1PRQA 1XJ2A 2VEAA 4Q8IA 4UEYA 1IKIA 4NG2A 5DKLA 1KE3A 1VETB 4LFUA 3JVUA 3IF6C 3UN7A 3MKFA 5J4EA 3UMDA 3I7JA 3QP6A 1PW8A 4M3KA 1HD8A 2VV6A 1CEGA 3QP8A 1N4OA 1XA7A 4GD6A 1BT5A 4S2IA 1LSXA 3KX0X 4FH2A 5AQAA 3F1NA 2W3EA 5G4YA 4KG6A 1K57C 2OOLA 5HFOA 4MBKA 1LL8A 1YLZA 4OH0A 3LYXA 3PXPA 4OPRA 1VHMA 5FDHA 4OPYA 2XF3A 3HUNA 5KZHA 3A3EA 3RTYA 1TS6A 4KQOA 4WEKA 3SH8A 1FQGA 3D72A 3N4IA 2HDRA 4IVIA 1E4DA 5F69A 4OLGA 1S1YA 1YLWA 1WYBA 3U4LP 2VK3A 1DP6A 4DF6A 2W1TA 5F6AA 3CMZA 4BD0A 4WMCA 2PU2A 4HNBA 3T1XA 1KVMA 2J9OA 4IUKA 1PI4A 3DTMA 4EERA 3LIAA 3FPWA 4CLCC 5L2FA 4N9KA 1S66L 1ALQA 5HX9A 5FASA 4S2OA 5HDCA 1MWSA 3BFFA 3AGDA 2G2UA 3WRZA 5CEDA 2A3UA 4GN2A 1WA9A 5DF7A 3H82B 1FCNA 3B47A 2PT7A 2JKFA 1GSXA 3UE6A 3A0RA 4BBVA 1DJCA 4L9GA 2ZM0A 2ACGA 2GNXA 1V9ZA 4BJPA 4OQGA 5CRFA 2PYRA 4E6WA 1W8YA 3MF0A 2DRWA 2Z2LB 5CHMA 2ZQDA 1M40A 3BFGA 4JBFA 5M18A 1FSYA 3LEQA 3R4KA 3VP0A 4EEUA 1T18A 1GSWA 3S7QA 1NZOA 3F1OA 3OPLA 4GCZA 2Y2JA 4WYYA 5DVAA 3LI9A 2J3TC 4IHQA 2Q9NA 5CGSA 2WZXA 2J3WA 4ESPA 1P9RA 4G3VA 3O86A 4X69A 4OLDA 3NHQA 5EECA 1MC0A 3PHYA 3TRCA 2ZM8A 1GSVA 3IF5A 3NY4A 3RJUA 4HH3A 2M1CA 1J9MA 3PTEA 3W4QA 1O07A 1BLHA 2P9VB 5FQKA 3ZYTA 3M2JA 5F5YA 1BSGA 1ERMA 4OOLA 2V1BA 2OV5A 1OJGA 3N8SA 5HDDA 4DRTA 1J3WA 3NECA 3E4OA 2WUQA 5FI2A 5E43A 5J7EA 4HP4A 2WKIA 4X53A 3T4KA 4C75A 4BQMA 3W2ZA 4O8GA 3UPNA 1YQSA 4KZ8A 5DF8A 4OOMA 1I2WA 4NXBA 1RP5A 2W3FA 4YFMA 2OSUA 3CG5A 5CHJA 5F83A 3BLMA 4CLCD 3EGXC 4DXBA 3P01A 2WYXA 2C6WB 4EBPA 3U2AA 3W4OA 2PD7A 3ITBA 1CK3A 2Y2HA 1Y4OA 5BOHA 4OQ0A 5IU1A 3ZG8B 2EFUA 2Y2LA 2WKQA 3H7WA 2FFYA 4GJ4A 3UDIA 4QWOA 2ZMVA 2M7UA 3VFHA 4JXGA 2Y2IA 2O9AA 3BJNA 3F1NB 3SS3A 2Y4AA 2AVXA 1JWPA 2EX2A 1QMEA 1VETA 3QHYA 1W7FA 4N1HA 4JGRA 1W63Q 2Z6CA 3O3VA 2BLSA 2DMWA 3MBZA 1ONGA 4R4SA 4QY5A 3WRTA 1PZOA 1FOFA 4CQHA 1ES2A 3LICA 5L07A 1F5MA 3VP2A 1WE4A 2J3TD 4GHIA 1LHYA 3A0SA 4EQIA 3C7UA 4N1XA 4FOFA 2GJ3A 4GDNA 3MZDA 2XFTA 1JWVA 2EX8A 2Y2MA 1O7EA 2K31A 2QZ6A 1YLTA 2E8JA 4R4RA 3KYEA 2D01A 1Q2PA 4KQDA 1TS7A 3NOTC 1OPXA 5A91A 2H28A 2WK0A 5AVFA 2XRNA 3BRMA 2PU4A 3C7VA 3CZDA 4HH2A 4EU0A 2A24A 1XP4A 2E8IA 3NDGA 3OC2A 4IBRA 1HLUP 2Y2QA 4WZ4A 3S7PA 5I5LA 3LR3A 4KG5A 2VV7A 3UO9A 1FSWA 2VJWA 3ICYA 1PFLA 1ZG6A 5G18A 3HLGA 1BYWA 1GCEA 1H8YA 3BEBA 4X56A 4L9FA 2EA9A 4X6TA 4OQIA 4Q0HA 2XH9A 1BTLA 2ZJ9A 4EW7A 1GA0A 3HLFA 4GDBA 1K38A 1T19A 3A3FA 2L0WA 4OPZA 2A2LA 3OZHA 4BD1A 1TS0A 5FL3A 1DY6A 3LO7A 4JKTA 5HW3A 4N9LA 1E3UD 4KZ3A 4LENA 1YSQA 3IXHA 3LIEA 1K4EA 1MKMA 3EOIA 1UWPX 4R1GA 2HJEA 1KE4A 2PDRA 2V1ZA 5GLDA 3G30A 4FTXA 5EVEA 4UA9A 2V9AA 2BG1A 1YPRA 3UPOA 3QP5A 4NETA 5CGWA 1IFQA 5EVIB 3HBRA 4K08A 3V5MA 4IEDA 4YOFA 4EETB 1YLYA 1K56A 2Q0OA 1Y54A 3M2KA 2HP6A 4PMAA 1XGIA 4EWFA 3DTIA 4OONA 3UDXA 1OT9A 4ZTKA 5FAPA 4XT2B 4C6YA 4D60A 4HJ6A 1VQQA 1EI5A 3E0YA 3SZTA 3V3SA 5L09A 1XJ4A 2PBYA 1XFNA 4FCFA 4PKYA 5EM1A 3HL9A 1N9BA 4LLOB 5F82A 3BECA 4S2NC 4HEFA 1G6OA 3GVBA 4C3QA 3FC7A 3WWXA 3VSLA 4O01A 1PYYA 1U60A 4KZBA 3CJMA 4P87A 1CI9A 3T1QB 2KX6A 3L7HA 3HLBA 5CHUA 3FZCA 1PWGA 4MBFA 4E3KA 4LGWA 5CECA 1S6RA 3EWKA 1AWIA 2I9VA 5HAQA 4NXFA 4PHTA 2EFXA 1VM1A 1FIKA 4GKUA 4GB7A 5HPFA 3FYZA 5DF9A 3ZG0A 4WZ5A 4MNRA 1RCJA 2OAP1 3ZNTA 4DE2A 1SKOB 2FFFB 4I3IA 3VFFA 2Y2KA 4KENB 4K91A 3Q82A 1JWZA 1S67L 4P85A 2ZQCA 1K0KA 2PR6A 4RA7A 1UGUA 1YMSA 5HDSA 2W3DA 1Z6FA 3UE3A 2X01A 4PAUA 1XXMA 1CJFA 4WLAA 3DW0A 5A8BA 2ZL1B 4I39A 1H8ZA 4GHIB 3VP3A 1ES5A 2FZ0A 4GLQA 4KUOA 2JKGA 1L0FA 1XA1A 2XLNA 5K5BA 3S7OA 4MN6A 5TR7A 3OLOA 3MXSA 5HAIA 2DNSA 3MSHA 1SHVA 1OTBA 4S2NA 3SH9A 1UWNX 2EWWA 4KZ7A 4Z1WA 2WAEA 3CLOA 1K55A 1RGYA 3CAXA 3GSGA 3T12B 3GQZA 4U3TA 1JTDA 3AGFA 2EX6A 3Q07A 1BLSA 4EBNA 1BLPA 3LR5A 3LR0A 2A24B 4OKPA 2ZMFA 2C5WB 3UE0A 2HP5A 3MXQA 1T1AA 3PBRA 4MDZA 3LUQA 1FCMA 3MKEA 4I3JA 1XFQA 5JYOA 4WM9A 4QHCA 4B9OA 3PBSA 5HD3A 3T4QA 4ARZA 5HSQA 3HJKA 3ZGAB 1F98A 4YINA 2ZQ9A 3UB5P 5EE8A 1XGJA 4MCWA 2VKSA 3KO6A 5FI6A 2K2NA 1NZUA 4DE0A 3RFBA 3ZHHA 2L4RA 2OLUA 1NRFA 2WGVA 5EFWA 3B42A 3IXDA 5FEGA 3CHWP 4NKPA 3LR4A 4GD8A 4Q0IA 2P7JA 2IWCA 1MBLA 3SW1A 2ZOHA 4WMCD 2B18A 1IYSA 1G28A 1MWUA 2XSSA 1NY0A 4LCMA 4JGPA 3MR0A 4Y7PA 3GMWA 3LCEA 2W3GA 2YKHA 3MS6A 4NXEA 3D3OA 2ZQ8A 3SH7A 4DE3A 5A92A 3IH9A 1FR1A 1N9NA 1K25A 4BBTA 1JTGA 4X25A 5KIZA 4WEJA 3S7NA 5EVIA 4JF4A 3ZG9B 2VGLS 1C3BA 2VV8A 3HUMA 5EV0A 3VE4A 2ZQ7A 2W0NA 3K3CA 3LY4A 2JC7A 2INWA 2JKRI 2PD8A 1VEUB 3PAEA 4XT2A 3P09A 4DN0A 3UE1A 5DJTA 4R38A 3G6OA 3FPVA 4ZJ1A 2PYPA 4ETZA 1BLCA 3CUEA 4Y0OA 4AFIA 4R3AA 4NK3A 4BMWA 2V0WA 5HL6A 2UV0E 3Q1FA 4Z9QA 3GRJA 3JYIA 2H10A 2H0YA 2W1RA 4BBUA 2ZBBA 1LI9A 3K3DA 2EXBA 1M6KA 2IWDA 4DE1A 3DTKA 1YM1A 3IBRA 3NULA 4M4XA 3DBAA 2GDNA 3TW8A 5FSRA 4FSFA 4LRXC 2JHEA 2OWJA 2B5RA 1KGGA 1LI0A 2OLVA 3VOZA 1G68A 4KZ9A 3RXWA 5GL9A 5GLBA 3T4TA 4PKYG 2VGLM 2WKEA 3Q7VA 4G3WA 4WBGA 2ZQAA 3TJZC 2WZZA 2WGIA 4UA6A 4JGQA 1OTDA 3E2KA 1V9YA 1GHMA 1SKOA 1H3QA 2Y55A 5AQ9A 4UQIS 1GA9A 2EWVA 1H0MA 2ZC7A 1LSVA 4Y17A 5FQIA 2HP9A 2VA0A 3IWOA 2Y59A 1IYOA 3IHBA 3VOYA 1S4RA 3ITAA 1YT4A 5F68A 4E3JA 1SDNA 5I94A 5M1AA 1JNUA 4LRYC 5HWTA 4PM9A 2HDSA 2ZL1A 3E2LA 2A49A 3OBFA 4E3MA 3D9YA 3IX3A 1ZTUA 3LIDA 5HZHA 3S4XA 1IELA 3MFXA 2V2FF 4P6ZS 5GHXA 3WS5A 3ZDJA 1OTIA 2JKRM 3BW6A 3ZG7B 2X02A 1LLBA 3GV9A 1TVFA 3UB7A 4E04A 2JKTI 3B33A 5TBMB 4ZJ3A 2RCXA 4GS9B 1ZKJA 4ETXA 3ZQ5A 4ARZB 3S1YA 3N6IA 4OOYA 3C5AA 4OQHA 1ACFA 3CWFA 3C4PA 3T4LA 4MBHA 3QNBA 1SCWA 4RQ9A 3OCLA 2H0TA 2NUPC 4UQIM 3IBJA 3IT9A 4MMNA 3UPPA 3M6BA 1P97A 5EOOA 1XX2A 1VB6A 4DKIA 4WN5A 5FQJA 1N9OA 2HGVA 5GLCA 3OPHA 4I5SA 2WAFA 1Y28A 2VGKA 4D2OA 1DJAA 3GDIA 4U0TA 5EVLA 4RYEA 2IA2A 3PYPA 1KDSA 4CLCE 2P08A 4E3NA 1L0GA 4IBXA 3FWLA 1ODVA 3H9WA 3BFEA 5E2GA 4P6ZM 2J7VA 5J8XA 4LV0A 3TE8A 1WYCA 1ES4A 4KQQA 5KSCA 5HD5A 1MWRA 3IXGA 4ME4A 1GHIA 3OOVA 3P98A 1OJ5A 3NC8A 2HF6A 5GHYA 1T1BA 2JCHA 5HWWA 5FQQA 1N9LA 5CXWA 3WS1A 2PAVP 2P74A 2XD1A 2ZM2A 4KZ4A 4I38A 2BTFP 4X55A 3A3JA 3FKVA 2QKPA 4H6JB 1TDGA 4WZ5C 2HZ5A 3MZEA 3NI9A 3EEHA 1PI5A 1DJBA 4JGOA 3TSGA 1H8MA 4CLCB 1MXOA 4MN5A 4HJ4A 3KYQA 1NJ4A 1TDLA 3MQQA 4FUWA 2CMNA 2J80A 1Z09A 3N7WA 5E2EA 2Y91A 3NDEA 4JXWA 1TS8A 3PAGA 3MXRA 4DXCA 3P7NA 2DCFA 4IJGA 2WKRA 3T1SA 4HQAA 2ZOIA 4YNRA 3T1RA 1VEUA 4ZAMA 3TG9A 2O9BA 1L0EA 4KQRA 3NBLA 1BUEA 1SZVA 4ZRRA 4B93A 5HAPA 2ZLYA 1K55C 1KOUA 3HUOA 3W8KA 2XFSA 1JVJA 1P9WA 1YKDA 3BQ8A 4OP5A 1K56D 1PWCA 3G2ZA 4O7DA 3GTCA 4B4ZA 3Q7VB 4X1MA 1X0OA 4O0PA 4KZ6A 1A0KA 2XGNA 2O0YA 4R70A 1LT0A 1I2SA 2XD5A 3LIBA 3L9KA 4BENA 1KE0A 3NIAA 3C4OA 2Y2NA 1AXBA 3T4SA 4E3LA 2V1AA 3F1PA 4R23A 4JPMA 4I3AA 5DFXA 2VGJA 1TF1A 5A90A 3HJIA 3HLDA 3PBNA 4Y0TA 1FILA 4PPRA 4WUJA 3ZFZA 2I72A 5TJJA 4RVAA 3HCYA 1FCOA 3BY8A 3G32A 3M6HA 2Q9MA 3O87A 2QPNA 3EGDC 1H5XA 3VE3A 4II7A 5CGXA 3LIFA 4JLFA 4JF6A 4HIAA 4QU3A 3ULFA 3QNCA 5AQ7A 3KYZA 1W79A 3SS4A 3IQAA 4P0MA 2FH5A 2UWXA 3EQUA 2PBDP 1XJ6A 2ZC6B 4BL3A 3BQAA 3VP1A 1YSPA 5IHVA 4KZAA 4EV4A 3VSKA 2WADA 1ES3A 4F3LB 3KSFA 1SDEA 5MC7A 4PM7A 5DJUA 2H5SA 3O5YA 5KSHA 2XK1A 3IXBA 4HESA 5TBMA 4LRZE 1KGEA 4GS9A 2XROA 4MN7A 2CC1A 5DTKA 2VZWA 1W5DA 4X1LA 5IT5A 5EVIC 1DRMA 2QJ7A 2XA7S 2WKPA 3Q81A 4E3OA 1YLJA 5HWVA 3Q7ZA 2XQZA 4CJNA 2GZAA 1KGFA 3KSHA 4LCLA 3NCKA 3VOLA 3VP4A 3E98A 3HREA 1S1ZA 1F2KA 3IWIA 2WGWA 3IF6A 1Q2QA 3PBOA 1NLZA 4DDYA 3IS2A 3A3IA 1K4FA 3CUEC 3BLSA 3MZFA 3EQVA 3SOIA 5F1GA 4S2JA 2VLGA 4QPRA 1PIOA 5CERA 1T1CA 3G2YA 1L3LA 4Y3IA 1K57A 1CF0A 4UA7A 1ESIA 3GR2A 1D1JA 3KSIA 4JF5A 2EXAA 3UB6A 2YKFA 3IX8A 4FD8A 4Y15A 3V50A 5FI7A 4Y13A 2K7SA 2BASA 3LGOA 4HBTA 2QYBA 5TFQA 4XUZA 1G5UA 3MQOA 4DMZA 1EROA 4XUXA 2PR5A 4N92A 1P0ZA 2OWHA 3T4JA 4GW9A 3ISGA 1ZC2A 4XXRA 2XA7M 1W63M 3HVFA 3E4QA 5E2FA 1DP9A 1BULA 1TD5A 5DTTA 1DP8A 1NYYA 1NRJA 4LPZA 4H6JA 1MZUA 5CTMA 1G6AA 3FKWA 1S0WA 4EUZA 2J9PA 1FR6A 3RH8B 4B88A 3CPTA 4X68A 4A5RA 4CLCA 3MMHA 4JXSA 1PNEA 3DWZA 1OMEA 5DFYA 4B4XA 5EOEA 5KMWA 2D02A 3PR6A 4ZDXA 1TEMA 3PBQA 3WS2A 3B3XA 3S22A 4L0LA 1PW1A 1S4SA 4HHDA 1ESUA 1MY8A 5FAOA 4QJGA 1E25A 3NOUC 2B95A 2Y79A 4WL9A 5HARA 4HOIA 1L0DA 2XDMA 2QHKA 1IOUA 3TOIA 2XEPA 5FDSA 2O99A 3V3RA 5HL1A 4BL2A 3QP2A 1YLPA 2O9CA 4EQ1A 4GOGA 5EVID 4WELA 1EW0A 3LI8A 2PHYA 5GHZA 4RX3A 1W8QA 4HI4A 4BLMA 5FATA 3V67A 3IX4A 1YMXA 4UAAA 3BYDA 4CPKA 4MEZA 1MKIA 2W27A 4ID4A 5M19A 1IYPA 4E3IA 4KUKA 3F1PB 3IH8A 3G35A 4OVDA 5FQ9A 4YWZA 3ZVTA 5CTNA 3CITA 1LL9A 1ONHA 2ZC3B 3ZVWA 1SKFA 3R7WA 3RXXA 4QB8A 3VV4A 1STZA 1XJ3A 4HY8A 2OAQ1 3N8LA 2NUTC 3DAVA 4WF0A 1K54C 1NWZA 4EXOA 4S2PA 1YAXA 4PM6A 3LEZA 3O88A 4LV2A 3ZCZA 3QP1A 4R3BA 5CEBA 2ZC5B 2XR0A 5FA7A 1LL5A 1F9IA 1K6RA 1NYMA 3MQ0A 2L1MA 5HPIA 4K0XA 4R3JA 4LV3A 2Y2PA 3G34A 3GECA 2LB5A 3HLCA 2QJ5A 2Z6DA 3C38A 3K2NA 3BFCA 3LFVA 1IYQA 2KLIA 3DTEA 2Y2OA 4DJ3A 5FAQA 2LB9A 1KDWA 3NOPC 4HJ3A 3OPPA 2J8YA 3SS5A 5FQMA 5CX7A 4HBUA 2JE5A 4ZBEA 3IWQA 2W3HA 2W1TB 1XPBA 1IEMA 4KG2A 4EESA 1OTAA 3JVVA 4R0QA 3EEAA 2RL3A 4F3LA 3ZNYA 5G4ZA 2V8FA 4ZJ2A 1E3UA 3OCNA 3FG8A 3DWKA 4L9EA 4Y5FA 2ZC4B 1LSWA 3IHAA 1ZHHB 2Y2GA 1K54A 2HPBA 5DKKA 2WGWB 3C30A 3IF6B 3KSGA 1QMFA 3D4FA 3OPRA 4OPQA 1CEFA 2Y8HA 3UMEA 3IS2B 2R9WA 1D06A 2P04A 3BY9A 4LV1A 5J3WA 3QP4A 4K0WA 1HVBA 4GZBA 3N8RA 2HJ9C 2IWBA 5IS1A 4S2LA 3UB8A 4BWIA 3H82A 1CQAA 3E4PA 2M7VA 4IVKA 1XKZA 3W4PA 4QD4A 1MWTA 4OP8A 3C8CA 1BZAA 3MJQA 4F94A 3VMAA 1RGZA 3F1OB 4DJ2A 3V39A 1IKGA 1PWDA 4KZ5A 2Z2MB 2MJ6A 2PRFA 4H8RA 3BFDA 4S2MA 1CI8A 2V20A 1D7EA 5DTSA 3G4PA 3WS0A 3HLEA 5L10A 4FH4A 4EEPA 2ZMAA 3PBTA 5AQBA 4P6BA 4PM5A 5EM0A 2VX8A 5JYPA 3WS4A 3A0VA 1HTZA 3CPTB 2HDQA 3BM6A 3LY3A 1PZPA 3CI6A 2QMIA 1NXYA 4EUVA 2HV1A 5GLAA 3HLWA 4G3KA 4IUHA 4Y0UA 2GX5A 2B02A 2JKTM 4R6LA 4E6XA 4U0XA 2KOIA 5LBRA 4MLLA 5EUAA 1EWZA 5EPHA 3G31A 1OT6A 3UY6A 1ZG4A 2G2WA 2R78A 5U47A 2P9VA 3C2WA 1K6SA 2JBFA 2V0UA 4S2KA 5E2HA 4QY6A 3UNWA 4DDSA 4Q0JA 1L2SA 5FEFA 1NLYA 3A3DA 3ZG5A 4HP9A 5F1FA 1OTEA 3UB9A 2X71A 3JPUA 3NJAA 1ERQA 3T50A 2G7UA 4NXGA 1KVLA 5D3OA 5A93A 5AJGA 2HDUA 3T4OA 3UDFA 4RX2A 5L8MA 5TGFA 2KDKA 2V8CA 5C5KA 3AGEA 4PM8A 3R7WB
chains in the Genus database with same CATH topology
4Y2FA 2JN7A 2VLGA 2L0WA 3H7WB 4G3WA 3BWLA 4QPRA 5AVEA 4NEED 1T1CA 2A2LA 4Y3IA 3TJZC 1TS0A 5FL3A 3KSIA 4JGQA 1OTDA 3UB6A 2QWSA 2YKFA 1V9YA 1YSQA 1XJ2A 3LIEA 2VEAA 1H3QA 4UEYA 2K7SA 1MKMA 3EOIA 1UWPX 2BASA 2EWVA 4UQIS 5DKLA 2QYBA 2HJEA 1LSVA 3JVUA 5J4EA 4DMZA 3MQOA 2VA0A 3UMDA 2PDRA 2PR5A 2VV6A 1P0ZA 2OWHA 3T4JA 4GW9A 1S4RA 5F68A 1LSXA 3KX0X 2V9AA 2XA7M 1JNUA 1W63M 4LRYC 5HWTA 3F1NA 3E4QA 2W3EA 3OBFA 5G4YA 1DP9A 1IFQA 2OOLA 1TD5A 1DP8A 4K08A 1NRJA 1ZTUA 3LIDA 4LPZA 4H6JA 1MZUA 5HZHA 4YOFA 1LL8A 4EETB 3LYXA 3PXPA 1VHMA 3MFXA 3RH8B 4P6ZS 4CLCA 3MMHA 3RTYA 1TS6A 1OT9A 4KQOA 1OTIA 2JKRM 3BW6A 4WEKA 5DFYA 3D72A 4XT2B 2D02A 5F69A 3PR6A 3PBQA 1S1YA 4L0LA 3UB7A 1S4SA 4E04A 2JKTI 3B33A 4HHDA 5TBMB 4GS9B 1DP6A 4HJ6A 2W1TA 5F6AA 4ETXA 3E0YA 3ZQ5A 4ARZB 3NOUC 4HNBA 1XJ4A 3CWFA 2Y79A 4WL9A 3T4LA 4PKYA 1XFNA 4HOIA 4LLOB 2QHKA 1IOUA 4IUKA 4RQ9A 3OCLA 2NUPC 2O99A 4EERA 4UQIM 3IBJA 3LIAA 3FPWA 4CLCC 1G6OA 1S66L 4MMNA 2O9CA 1P97A 4EQ1A 3FC7A 5HDCA 1VB6A 4O01A 4WELA 4WN5A 1EW0A 3LI8A 2PHYA 1N9OA 2HGVA 1WA9A 4HI4A 4I5SA 3H82B 2KX6A 3V67A 3B47A 1Y28A 3GDIA 2PT7A 2IA2A 1GSXA 2W27A 3PYPA 3UE6A 4CLCE 3A0RA 4BBVA 2P08A 4L9GA 4KUKA 3F1PB 3EWKA 2GNXA 1V9ZA 1ODVA 2I9VA 4BJPA 3H9WA 4YWZA 4NXFA 4PHTA 4P6ZM 2PYRA 3CITA 3TE8A 5HPFA 5DF9A 5HD5A 3MF0A 3R7WA 3VV4A 1STZA 2OAP1 1XJ3A 4I3IA 4HY8A 2OAQ1 2NUTC 4WF0A 1S67L 3R4KA 4ME4A 1NWZA 4EXOA 4EEUA 2PR6A 1T18A 1UGUA 3OOVA 1GSWA 1YAXA 1OJ5A 2HF6A 5HDSA 3S7QA 1T1BA 2W3DA 3F1OA 3UE3A 4GCZA 5HWWA 4PAUA 1N9LA 3LI9A 4WLAA 1F9IA 2J3TC 5A8BA 4IHQA 4I39A 3MQ0A 4GHIB 4I38A 2L1MA 5HPIA 2FZ0A 4GLQA 4KUOA 2J3WA 1P9RA 4G3VA 3GECA 2LB5A 5K5BA 2QJ5A 3NHQA 4MN6A 3S7OA 2QKPA 2Z6DA 3OLOA 4H6JB 3C38A 3K2NA 1MC0A 3PHYA 3TRCA 1GSVA 3EEHA 1OTBA 3LFVA 4HH3A 2KLIA 4JGOA 1UWNX 1H8MA 4CLCB 2EWWA 2M1CA 4Z1WA 4MN5A 4HJ4A 3CLOA 4DJ3A 3KYQA 2LB9A 3NOPC 3CAXA 3MQQA 4HJ3A 2CMNA 2J80A 1TS8A 3ZYTA 5CX7A 3P7NA 4IJGA 5F5YA 2WKRA 2W3HA 3LR0A 3LR5A 4OOLA 2W1TB 2V1BA 2A24B 2ZMFA 4EESA 4HQAA 2ZOIA 1OTAA 1OJGA 3JVVA 4YNRA 5HDDA 3EEAA 3MXQA 2O9BA 1T1AA 3PBRA 4MDZA 3LUQA 4F3LA 5G4ZA 3E4OA 4I3JA 1XFQA 5J7EA 4B9OA 3PBSA 3OCNA 3FG8A 4ZRRA 5HD3A 3T4QA 4B93A 4ARZA 4L9EA 4Y5FA 4HP4A 5HSQA 1LSWA 3T4KA 1KOUA 3HJKA 3W2ZA 4O8GA 1F98A 1ZHHB 4OOMA 1P9WA 4MCWA 2VKSA 5DKKA 1YKDA 4NXBA 3C30A 3KSGA 3BQ8A 2W3FA 2Y8HA 3UMEA 3KO6A 3IS2B 1D06A 2P04A 3BY9A 5J3WA 4CLCD 2K2NA 3EGXC 1X0OA 3RFBA 4O0PA 3P01A 2L4RA 2HJ9C 2O0YA 5EFWA 3UB8A 5IS1A 4R70A 3U2AA 4BWIA 2PD7A 1LT0A 3H82A 3E4PA 3B42A 3LIBA 5IU1A 2M7VA 4NKPA 3LR4A 4Q0IA 2P7JA 3SW1A 2ZOHA 2WKQA 3H7WA 4GJ4A 3T4SA 2V1AA 3F1PA 2B18A 2ZMVA 3C8CA 3MJQA 2M7UA 1G28A 2XSSA 4I3AA 4JGPA 5DFXA 3MR0A 2O9AA 3BJNA 1TF1A 3F1OB 4DJ2A 3HJIA 3PBNA 3F1NB 2W3GA 4WUJA 2MJ6A 2YKHA 4NXEA 5TJJA 3D3OA 3HCYA 1D7EA 4JGRA 1W63Q 2Z6CA 4EEPA 3BY8A 3PBTA 1N9NA 2DMWA 3EGDC 2VX8A 4BBTA 3A0VA 4CQHA 3VE3A 3LICA 1F5MA 4II7A 3LIFA 4HIAA 5KIZA 2J3TD 4GHIA 4WEJA 3S7NA 3A0SA 3ULFA 2VGLS 4FOFA 3CI6A 3KYZA 2VV8A 2GJ3A 4EUVA 2HV1A 3VE4A 2K31A 4G3KA 2FH5A 4IUHA 2GX5A 2B02A 2JKTM 2D01A 2W0NA 3EQUA 4R6LA 3K3CA 1XJ6A 2KOIA 1TS7A 4KQDA 5LBRA 2INWA 2JKRI 3NOTC 1OPXA 3BQAA 2PD8A 1OT6A 1YSPA 2H28A 2R78A 4F3LB 4XT2A 5AVFA 3C2WA 4DN0A 2XRNA 5DJTA 3KSFA 4R38A 5MC7A 2V0UA 5DJUA 3O5YA 3G6OA 5KSHA 3FPVA 5TBMA 2XROA 4LRZE 4GS9A 4MN7A 2PYPA 2VZWA 4HH2A 4EU0A 4ETZA 2A24A 3CUEA 4Q0JA 4AFIA 5IT5A 4R3AA 3OC2A 4BMWA 2V0WA 1DRMA 5HL6A 2QJ7A 2XA7S 1NLYA 2WKPA 3S7PA 5I5LA 3LR3A 2W1RA 2VV7A 4HP9A 4BBUA 2ZBBA 5HWVA 1OTEA 3K3DA 3UB9A 2VJWA 3ICYA 3NJAA 2GZAA 3T50A 3KSHA 2G7UA 3IBRA 1BYWA 4NXGA 4M4XA 5AJGA 3DBAA 3VOLA 3T4OA 3TW8A 4FSFA 4LRXC 3E98A 1S1ZA 2JHEA 4L9FA 2EA9A 2OWJA 5L8MA 2KDKA 4Q0HA 5C5KA 3PBOA 1NLZA 4EW7A 3IS2A 3T4TA 3CUEC 4PKYG 3R7WB 3EQVA 2VGLM 1T19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JN7 A;  2VLG A;  2L0W A;  3H7W B;  3BWL A;  5AVE A;  1T1C A;  1TS0 A;  4JGQ A;  1OTD A;  3UB6 A;  2QWS A;  2YKF A;  1V9Y A;  1XJ2 A;  3LIE A;  2VEA A;  2K7S A;  1UWP X;  2BAS A;  5DKL A;  1LSV A;  5J4E A;  3MQO A;  3UMD A;  2PDR A;  2PR5 A;  2VV6 A;  1P0Z A;  2OWH A;  4GW9 A;  1S4R A;  5F68 A;  1LSX A;  3KX0 X;  2V9A A;  1JNU A;  4LRY C;  5HWT A;  3F1N A;  3E4Q A;  5G4Y A;  1DP9 A;  2OOL A;  1DP8 A;  4K08 A;  3LID A;  4LPZ A;  4H6J A;  1MZU A;  5HZH A;  1LL8 A;  4EET B;  3LYX A;  3MFX A;  3RH8 B;  3RTY A;  1TS6 A;  1OT9 A;  1OTI A;  3D72 A;  4XT2 B;  2D02 A;  5F69 A;  3UB7 A;  1S1Y A;  1S4S A;  4E04 A;  3B33 A;  4HHD A;  5TBM B;  4GS9 B;  1DP6 A;  4HJ6 A;  5F6A A;  3ZQ5 A;  3NOU C;  4HNB A;  1XJ4 A;  3CWF A;  4WL9 A;  4PKY A;  1XFN A;  4HOI A;  4LLO B;  2QHK A;  4RQ9 A;  4EER A;  3LIA A;  1S66 L;  1P97 A;  4EQ1 A;  3FC7 A;  5HDC A;  1VB6 A;  4WN5 A;  1EW0 A;  3LI8 A;  2PHY A;  1N9O A;  1WA9 A;  4HI4 A;  4I5S A;  3H82 B;  2KX6 A;  1Y28 A;  3GDI A;  1GSX A;  2W27 A;  3PYP A;  3UE6 A;  3A0R A;  4BBV A;  4L9G A;  4KUK A;  3F1P B;  3EWK A;  1V9Z A;  1ODV A;  2I9V A;  3H9W A;  4YWZ A;  4NXF A;  2PYR A;  5HD5 A;  1XJ3 A;  4I3I A;  4HY8 A;  4WF0 A;  1S67 L;  1NWZ A;  4EXO A;  4EEU A;  2PR6 A;  1T18 A;  1UGU A;  1GSW A;  1OJ5 A;  5HDS A;  1T1B A;  3F1O A;  4GCZ A;  5HWW A;  1N9L A;  3LI9 A;  4WLA A;  1F9I A;  5A8B A;  4I39 A;  4GHI B;  4I38 A;  2L1M A;  4KUO A;  3GEC A;  2QJ5 A;  3NHQ A;  4MN6 A;  2QKP A;  2Z6D A;  3OLO A;  4H6J B;  3PHY A;  1GSV A;  3EEH A;  1OTB A;  4HH3 A;  4JGO A;  1UWN X;  2M1C A;  4MN5 A;  4HJ4 A;  3CLO A;  4DJ3 A;  3NOP C;  3CAX A;  3MQQ A;  4HJ3 A;  2CMN A;  2J80 A;  1TS8 A;  3P7N A;  5F5Y A;  2WKR A;  2V1B A;  2A24 B;  4EES A;  4HQA A;  2ZOI A;  1OTA A;  1OJG A;  5HDD A;  3MXQ A;  1T1A A;  4F3L A;  3LUQ A;  5G4Z A;  3E4O A;  4I3J A;  1XFQ A;  5J7E A;  4B9O A;  3FG8 A;  5HD3 A;  5HSQ A;  4L9E A;  4HP4 A;  1LSW A;  1KOU A;  3HJK A;  1F98 A;  5DKK A;  4NXB A;  3UME A;  3IS2 B;  1D06 A;  3BY9 A;  5J3W A;  1X0O A;  2L4R A;  5EFW A;  5IS1 A;  3UB8 A;  4R70 A;  2PD7 A;  1LT0 A;  3H82 A;  3E4P A;  3LIB A;  5IU1 A;  2P7J A;  3SW1 A;  2ZOH A;  2WKQ A;  3H7W A;  2V1A A;  3F1P A;  3C8C A;  3MJQ A;  1G28 A;  4I3A A;  4JGP A;  3MR0 A;  3F1O B;  4DJ2 A;  3HJI A;  3F1N B;  4WUJ A;  4NXE A;  2YKH A;  1D7E A;  4JGR A;  2Z6C A;  4EEP A;  3BY8 A;  1N9N A;  4BBT A;  3A0V A;  3VE3 A;  3LIC A;  3LIF A;  4HIA A;  5KIZ A;  4GHI A;  3A0S A;  3ULF A;  2VV8 A;  2GJ3 A;  2HV1 A;  3VE4 A;  2B02 A;  2D01 A;  2W0N A;  4R6L A;  3K3C A;  1XJ6 A;  4KQD A;  1TS7 A;  2INW A;  3NOT C;  2PD8 A;  1OT6 A;  2H28 A;  2R78 A;  4F3L B;  4XT2 A;  5AVF A;  3C2W A;  5DJT A;  4R38 A;  5DJU A;  2V0U A;  3G6O A;  5TBM A;  4LRZ E;  4GS9 A;  2PYP A;  4HH2 A;  2A24 A;  4R3A A;  2V0W A;  1DRM A;  2QJ7 A;  2WKP A;  5I5L A;  2VV7 A;  4HP9 A;  4BBU A;  2ZBB A;  5HWV A;  1OTE A;  3K3D A;  3UB9 A;  3ICY A;  3NJA A;  3T50 A;  3IBR A;  1BYW A;  4NXG A;  4M4X A;  3VOL A;  4LRX C;  1S1Z A;  2JHE A;  4L9F A;  2EA9 A;  2OWJ A;  2KDK A;  4EW7 A;  3IS2 A;  4PKY G;  1T19 A; 
#chains in the Genus database with same CATH topology
 4Y2F A;  2JN7 A;  2WKH A;  3FV7 A;  3H7W B;  3BWL A;  5AVE A;  4NEE D;  4JXV A;  4GNU A;  2EX9 A;  1MPL A;  4UHU A;  2ZD8 A;  1HZO A;  2QWS A;  4EBL A;  1I5Q A;  1GHP A;  3MFD A;  2R9X A;  1PRQ A;  1XJ2 A;  2VEA A;  4Q8I A;  4UEY A;  1IKI A;  4NG2 A;  5DKL A;  1KE3 A;  1VET B;  4LFU A;  3JVU A;  3IF6 C;  3UN7 A;  3MKF A;  5J4E A;  3UMD A;  3I7J A;  3QP6 A;  1PW8 A;  4M3K A;  1HD8 A;  2VV6 A;  1CEG A;  3QP8 A;  1N4O A;  1XA7 A;  4GD6 A;  1BT5 A;  4S2I A;  1LSX A;  3KX0 X;  4FH2 A;  5AQA A;  3F1N A;  2W3E A;  5G4Y A;  4KG6 A;  1K57 C;  2OOL A;  5HFO A;  4MBK A;  1LL8 A;  1YLZ A;  4OH0 A;  3LYX A;  3PXP A;  4OPR A;  1VHM A;  5FDH A;  4OPY A;  2XF3 A;  3HUN A;  5KZH A;  3A3E A;  3RTY A;  1TS6 A;  4KQO A;  4WEK A;  3SH8 A;  1FQG A;  3D72 A;  3N4I A;  2HDR A;  4IVI A;  1E4D A;  5F69 A;  4OLG A;  1S1Y A;  1YLW A;  1WYB A;  3U4L P;  2VK3 A;  1DP6 A;  4DF6 A;  2W1T A;  5F6A A;  3CMZ A;  4BD0 A;  4WMC A;  2PU2 A;  4HNB A;  3T1X A;  1KVM A;  2J9O A;  4IUK A;  1PI4 A;  3DTM A;  4EER A;  3LIA A;  3FPW A;  4CLC C;  5L2F A;  4N9K A;  1S66 L;  1ALQ A;  5HX9 A;  5FAS A;  4S2O A;  5HDC A;  1MWS A;  3BFF A;  3AGD A;  2G2U A;  3WRZ A;  5CED A;  2A3U A;  4GN2 A;  1WA9 A;  5DF7 A;  3H82 B;  1FCN A;  3B47 A;  2PT7 A;  2JKF A;  1GSX A;  3UE6 A;  3A0R A;  4BBV A;  1DJC A;  4L9G A;  2ZM0 A;  2ACG A;  2GNX A;  1V9Z A;  4BJP A;  4OQG A;  5CRF A;  2PYR A;  4E6W A;  1W8Y A;  3MF0 A;  2DRW A;  2Z2L B;  5CHM A;  2ZQD A;  1M40 A;  3BFG A;  4JBF A;  5M18 A;  1FSY A;  3LEQ A;  3R4K A;  3VP0 A;  4EEU A;  1T18 A;  1GSW A;  3S7Q A;  1NZO A;  3F1O A;  3OPL A;  4GCZ A;  2Y2J A;  4WYY A;  5DVA A;  3LI9 A;  2J3T C;  4IHQ A;  2Q9N A;  5CGS A;  2WZX A;  2J3W A;  4ESP A;  1P9R A;  4G3V A;  3O86 A;  4X69 A;  4OLD A;  3NHQ A;  5EEC A;  1MC0 A;  3PHY A;  3TRC A;  2ZM8 A;  1GSV A;  3IF5 A;  3NY4 A;  3RJU A;  4HH3 A;  2M1C A;  1J9M A;  3PTE A;  3W4Q A;  1O07 A;  1BLH A;  2P9V B;  5FQK A;  3ZYT A;  3M2J A;  5F5Y A;  1BSG A;  1ERM A;  4OOL A;  2V1B A;  2OV5 A;  1OJG A;  3N8S A;  5HDD A;  4DRT A;  1J3W A;  3NEC A;  3E4O A;  2WUQ A;  5FI2 A;  5E43 A;  5J7E A;  4HP4 A;  2WKI A;  4X53 A;  3T4K A;  4C75 A;  4BQM A;  3W2Z A;  4O8G A;  3UPN A;  1YQS A;  4KZ8 A;  5DF8 A;  4OOM A;  1I2W A;  4NXB A;  1RP5 A;  2W3F A;  4YFM A;  2OSU A;  3CG5 A;  5CHJ A;  5F83 A;  3BLM A;  4CLC D;  3EGX C;  4DXB A;  3P01 A;  2WYX A;  2C6W B;  4EBP A;  3U2A A;  3W4O A;  2PD7 A;  3ITB A;  1CK3 A;  2Y2H A;  1Y4O A;  5BOH A;  4OQ0 A;  5IU1 A;  3ZG8 B;  2EFU A;  2Y2L A;  2WKQ A;  3H7W A;  2FFY A;  4GJ4 A;  3UDI A;  4QWO A;  2ZMV A;  2M7U A;  3VFH A;  4JXG A;  2Y2I A;  2O9A A;  3BJN A;  3F1N B;  3SS3 A;  2Y4A A;  2AVX A;  1JWP A;  2EX2 A;  1QME A;  1VET A;  3QHY A;  1W7F A;  4N1H A;  4JGR A;  1W63 Q;  2Z6C A;  3O3V A;  2BLS A;  2DMW A;  3MBZ A;  1ONG A;  4R4S A;  4QY5 A;  3WRT A;  1PZO A;  1FOF A;  4CQH A;  1ES2 A;  3LIC A;  5L07 A;  1F5M A;  3VP2 A;  1WE4 A;  2J3T D;  4GHI A;  1LHY A;  3A0S A;  4EQI A;  3C7U A;  4N1X A;  4FOF A;  2GJ3 A;  4GDN A;  3MZD A;  2XFT A;  1JWV A;  2EX8 A;  2Y2M A;  1O7E A;  2K31 A;  2QZ6 A;  1YLT A;  2E8J A;  4R4R A;  3KYE A;  2D01 A;  1Q2P A;  4KQD A;  1TS7 A;  3NOT C;  1OPX A;  5A91 A;  2H28 A;  2WK0 A;  5AVF A;  2XRN A;  3BRM A;  2PU4 A;  3C7V A;  3CZD A;  4HH2 A;  4EU0 A;  2A24 A;  1XP4 A;  2E8I A;  3NDG A;  3OC2 A;  4IBR A;  1HLU P;  2Y2Q A;  4WZ4 A;  3S7P A;  5I5L A;  3LR3 A;  4KG5 A;  2VV7 A;  3UO9 A;  1FSW A;  2VJW A;  3ICY A;  1PFL A;  1ZG6 A;  5G18 A;  3HLG A;  1BYW A;  1GCE A;  1H8Y A;  3BEB A;  4X56 A;  4L9F A;  2EA9 A;  4X6T A;  4OQI A;  4Q0H A;  2XH9 A;  1BTL A;  2ZJ9 A;  4EW7 A;  1GA0 A;  3HLF A;  4GDB A;  1K38 A;  1T19 A;  3A3F A;  2L0W A;  4OPZ A;  2A2L A;  3OZH A;  4BD1 A;  1TS0 A;  5FL3 A;  1DY6 A;  3LO7 A;  4JKT A;  5HW3 A;  4N9L A;  1E3U D;  4KZ3 A;  4LEN A;  1YSQ A;  3IXH A;  3LIE A;  1K4E A;  1MKM A;  3EOI A;  1UWP X;  4R1G A;  2HJE A;  1KE4 A;  2PDR A;  2V1Z A;  5GLD A;  3G30 A;  4FTX A;  5EVE A;  4UA9 A;  2V9A A;  2BG1 A;  1YPR A;  3UPO A;  3QP5 A;  4NET A;  5CGW A;  1IFQ A;  5EVI B;  3HBR A;  4K08 A;  3V5M A;  4IED A;  4YOF A;  4EET B;  1YLY A;  1K56 A;  2Q0O A;  1Y54 A;  3M2K A;  2HP6 A;  4PMA A;  1XGI A;  4EWF A;  3DTI A;  4OON A;  3UDX A;  1OT9 A;  4ZTK A;  5FAP A;  4XT2 B;  4C6Y A;  4D60 A;  4HJ6 A;  1VQQ A;  1EI5 A;  3E0Y A;  3SZT A;  3V3S A;  5L09 A;  1XJ4 A;  2PBY A;  1XFN A;  4FCF A;  4PKY A;  5EM1 A;  3HL9 A;  1N9B A;  4LLO B;  5F82 A;  3BEC A;  4S2N C;  4HEF A;  1G6O A;  3GVB A;  4C3Q A;  3FC7 A;  3WWX A;  3VSL A;  4O01 A;  1PYY A;  1U60 A;  4KZB A;  3CJM A;  4P87 A;  1CI9 A;  3T1Q B;  2KX6 A;  3L7H A;  3HLB A;  5CHU A;  3FZC A;  1PWG A;  4MBF A;  4E3K A;  4LGW A;  5CEC A;  1S6R A;  3EWK A;  1AWI A;  2I9V A;  5HAQ A;  4NXF A;  4PHT A;  2EFX A;  1VM1 A;  1FIK A;  4GKU A;  4GB7 A;  5HPF A;  3FYZ A;  5DF9 A;  3ZG0 A;  4WZ5 A;  4MNR A;  1RCJ A;  2OAP 1;  3ZNT A;  4DE2 A;  1SKO B;  2FFF B;  4I3I A;  3VFF A;  2Y2K A;  4KEN B;  4K91 A;  3Q82 A;  1JWZ A;  1S67 L;  4P85 A;  2ZQC A;  1K0K A;  2PR6 A;  4RA7 A;  1UGU A;  1YMS A;  5HDS A;  2W3D A;  1Z6F A;  3UE3 A;  2X01 A;  4PAU A;  1XXM A;  1CJF A;  4WLA A;  3DW0 A;  5A8B A;  2ZL1 B;  4I39 A;  1H8Z A;  4GHI B;  3VP3 A;  1ES5 A;  2FZ0 A;  4GLQ A;  4KUO A;  2JKG A;  1L0F A;  1XA1 A;  2XLN A;  5K5B A;  3S7O A;  4MN6 A;  5TR7 A;  3OLO A;  3MXS A;  5HAI A;  2DNS A;  3MSH A;  1SHV A;  1OTB A;  4S2N A;  3SH9 A;  1UWN X;  2EWW A;  4KZ7 A;  4Z1W A;  2WAE A;  3CLO A;  1K55 A;  1RGY A;  3CAX A;  3GSG A;  3T12 B;  3GQZ A;  4U3T A;  1JTD A;  3AGF A;  2EX6 A;  3Q07 A;  1BLS A;  4EBN A;  1BLP A;  3LR5 A;  3LR0 A;  2A24 B;  4OKP A;  2ZMF A;  2C5W B;  3UE0 A;  2HP5 A;  3MXQ A;  1T1A A;  3PBR A;  4MDZ A;  3LUQ A;  1FCM A;  3MKE A;  4I3J A;  1XFQ A;  5JYO A;  4WM9 A;  4QHC A;  4B9O A;  3PBS A;  5HD3 A;  3T4Q A;  4ARZ A;  5HSQ A;  3HJK A;  3ZGA B;  1F98 A;  4YIN A;  2ZQ9 A;  3UB5 P;  5EE8 A;  1XGJ A;  4MCW A;  2VKS A;  3KO6 A;  5FI6 A;  2K2N A;  1NZU A;  4DE0 A;  3RFB A;  3ZHH A;  2L4R A;  2OLU A;  1NRF A;  2WGV A;  5EFW A;  3B42 A;  3IXD A;  5FEG A;  3CHW P;  4NKP A;  3LR4 A;  4GD8 A;  4Q0I A;  2P7J A;  2IWC A;  1MBL A;  3SW1 A;  2ZOH A;  4WMC D;  2B18 A;  1IYS A;  1G28 A;  1MWU A;  2XSS A;  1NY0 A;  4LCM A;  4JGP A;  3MR0 A;  4Y7P A;  3GMW A;  3LCE A;  2W3G A;  2YKH A;  3MS6 A;  4NXE A;  3D3O A;  2ZQ8 A;  3SH7 A;  4DE3 A;  5A92 A;  3IH9 A;  1FR1 A;  1N9N A;  1K25 A;  4BBT A;  1JTG A;  4X25 A;  5KIZ A;  4WEJ A;  3S7N A;  5EVI A;  4JF4 A;  3ZG9 B;  2VGL S;  1C3B A;  2VV8 A;  3HUM A;  5EV0 A;  3VE4 A;  2ZQ7 A;  2W0N A;  3K3C A;  3LY4 A;  2JC7 A;  2INW A;  2JKR I;  2PD8 A;  1VEU B;  3PAE A;  4XT2 A;  3P09 A;  4DN0 A;  3UE1 A;  5DJT A;  4R38 A;  3G6O A;  3FPV A;  4ZJ1 A;  2PYP A;  4ETZ A;  1BLC A;  3CUE A;  4Y0O A;  4AFI A;  4R3A A;  4NK3 A;  4BMW A;  2V0W A;  5HL6 A;  2UV0 E;  3Q1F A;  4Z9Q A;  3GRJ A;  3JYI A;  2H10 A;  2H0Y A;  2W1R A;  4BBU A;  2ZBB A;  1LI9 A;  3K3D A;  2EXB A;  1M6K A;  2IWD A;  4DE1 A;  3DTK A;  1YM1 A;  3IBR A;  3NUL A;  4M4X A;  3DBA A;  2GDN A;  3TW8 A;  5FSR A;  4FSF A;  4LRX C;  2JHE A;  2OWJ A;  2B5R A;  1KGG A;  1LI0 A;  2OLV A;  3VOZ A;  1G68 A;  4KZ9 A;  3RXW A;  5GL9 A;  5GLB A;  3T4T A;  4PKY G;  2VGL M;  2WKE A;  3Q7V A;  4G3W A;  4WBG A;  2ZQA A;  3TJZ C;  2WZZ A;  2WGI A;  4UA6 A;  4JGQ A;  1OTD A;  3E2K A;  1V9Y A;  1GHM A;  1SKO A;  1H3Q A;  2Y55 A;  5AQ9 A;  4UQI S;  1GA9 A;  2EWV A;  1H0M A;  2ZC7 A;  1LSV A;  4Y17 A;  5FQI A;  2HP9 A;  2VA0 A;  3IWO A;  2Y59 A;  1IYO A;  3IHB A;  3VOY A;  1S4R A;  3ITA A;  1YT4 A;  5F68 A;  4E3J A;  1SDN A;  5I94 A;  5M1A A;  1JNU A;  4LRY C;  5HWT A;  4PM9 A;  2HDS A;  2ZL1 A;  3E2L A;  2A49 A;  3OBF A;  4E3M A;  3D9Y A;  3IX3 A;  1ZTU A;  3LID A;  5HZH A;  3S4X A;  1IEL A;  3MFX A;  2V2F F;  4P6Z S;  5GHX A;  3WS5 A;  3ZDJ A;  1OTI A;  2JKR M;  3BW6 A;  3ZG7 B;  2X02 A;  1LLB A;  3GV9 A;  1TVF A;  3UB7 A;  4E04 A;  2JKT I;  3B33 A;  5TBM B;  4ZJ3 A;  2RCX A;  4GS9 B;  1ZKJ A;  4ETX A;  3ZQ5 A;  4ARZ B;  3S1Y A;  3N6I A;  4OOY A;  3C5A A;  4OQH A;  1ACF A;  3CWF A;  3C4P A;  3T4L A;  4MBH A;  3QNB A;  1SCW A;  4RQ9 A;  3OCL A;  2H0T A;  2NUP C;  4UQI M;  3IBJ A;  3IT9 A;  4MMN A;  3UPP A;  3M6B A;  1P97 A;  5EOO A;  1XX2 A;  1VB6 A;  4DKI A;  4WN5 A;  5FQJ A;  1N9O A;  2HGV A;  5GLC A;  3OPH A;  4I5S A;  2WAF A;  1Y28 A;  2VGK A;  4D2O A;  1DJA A;  3GDI A;  4U0T A;  5EVL A;  4RYE A;  2IA2 A;  3PYP A;  1KDS A;  4CLC E;  2P08 A;  4E3N A;  1L0G A;  4IBX A;  3FWL A;  1ODV A;  3H9W A;  3BFE A;  5E2G A;  4P6Z M;  2J7V A;  5J8X A;  4LV0 A;  3TE8 A;  1WYC A;  1ES4 A;  4KQQ A;  5KSC A;  5HD5 A;  1MWR A;  3IXG A;  4ME4 A;  1GHI A;  3OOV A;  3P98 A;  1OJ5 A;  3NC8 A;  2HF6 A;  5GHY A;  1T1B A;  2JCH A;  5HWW A;  5FQQ A;  1N9L A;  5CXW A;  3WS1 A;  2PAV P;  2P74 A;  2XD1 A;  2ZM2 A;  4KZ4 A;  4I38 A;  2BTF P;  4X55 A;  3A3J A;  3FKV A;  2QKP A;  4H6J B;  1TDG A;  4WZ5 C;  2HZ5 A;  3MZE A;  3NI9 A;  3EEH A;  1PI5 A;  1DJB A;  4JGO A;  3TSG A;  1H8M A;  4CLC B;  1MXO A;  4MN5 A;  4HJ4 A;  3KYQ A;  1NJ4 A;  1TDL A;  3MQQ A;  4FUW A;  2CMN A;  2J80 A;  1Z09 A;  3N7W A;  5E2E A;  2Y91 A;  3NDE A;  4JXW A;  1TS8 A;  3PAG A;  3MXR A;  4DXC A;  3P7N A;  2DCF A;  4IJG A;  2WKR A;  3T1S A;  4HQA A;  2ZOI A;  4YNR A;  3T1R A;  1VEU A;  4ZAM A;  3TG9 A;  2O9B A;  1L0E A;  4KQR A;  3NBL A;  1BUE A;  1SZV A;  4ZRR A;  4B93 A;  5HAP A;  2ZLY A;  1K55 C;  1KOU A;  3HUO A;  3W8K A;  2XFS A;  1JVJ A;  1P9W A;  1YKD A;  3BQ8 A;  4OP5 A;  1K56 D;  1PWC A;  3G2Z A;  4O7D A;  3GTC A;  4B4Z A;  3Q7V B;  4X1M A;  1X0O A;  4O0P A;  4KZ6 A;  1A0K A;  2XGN A;  2O0Y A;  4R70 A;  1LT0 A;  1I2S A;  2XD5 A;  3LIB A;  3L9K A;  4BEN A;  1KE0 A;  3NIA A;  3C4O A;  2Y2N A;  1AXB A;  3T4S A;  4E3L A;  2V1A A;  3F1P A;  4R23 A;  4JPM A;  4I3A A;  5DFX A;  2VGJ A;  1TF1 A;  5A90 A;  3HJI A;  3HLD A;  3PBN A;  4Y0T A;  1FIL A;  4PPR A;  4WUJ A;  3ZFZ A;  2I72 A;  5TJJ A;  4RVA A;  3HCY A;  1FCO A;  3BY8 A;  3G32 A;  3M6H A;  2Q9M A;  3O87 A;  2QPN A;  3EGD C;  1H5X A;  3VE3 A;  4II7 A;  5CGX A;  3LIF A;  4JLF A;  4JF6 A;  4HIA A;  4QU3 A;  3ULF A;  3QNC A;  5AQ7 A;  3KYZ A;  1W79 A;  3SS4 A;  3IQA A;  4P0M A;  2FH5 A;  2UWX A;  3EQU A;  2PBD P;  1XJ6 A;  2ZC6 B;  4BL3 A;  3BQA A;  3VP1 A;  1YSP A;  5IHV A;  4KZA A;  4EV4 A;  3VSK A;  2WAD A;  1ES3 A;  4F3L B;  3KSF A;  1SDE A;  5MC7 A;  4PM7 A;  5DJU A;  2H5S A;  3O5Y A;  5KSH A;  2XK1 A;  3IXB A;  4HES A;  5TBM A;  4LRZ E;  1KGE A;  4GS9 A;  2XRO A;  4MN7 A;  2CC1 A;  5DTK A;  2VZW A;  1W5D A;  4X1L A;  5IT5 A;  5EVI C;  1DRM A;  2QJ7 A;  2XA7 S;  2WKP A;  3Q81 A;  4E3O A;  1YLJ A;  5HWV A;  3Q7Z A;  2XQZ A;  4CJN A;  2GZA A;  1KGF A;  3KSH A;  4LCL A;  3NCK A;  3VOL A;  3VP4 A;  3E98 A;  3HRE A;  1S1Z A;  1F2K A;  3IWI A;  2WGW A;  3IF6 A;  1Q2Q A;  3PBO A;  1NLZ A;  4DDY A;  3IS2 A;  3A3I A;  1K4F A;  3CUE C;  3BLS A;  3MZF A;  3EQV A;  3SOI A;  5F1G A;  4S2J A;  2VLG A;  4QPR A;  1PIO A;  5CER A;  1T1C A;  3G2Y A;  1L3L A;  4Y3I A;  1K57 A;  1CF0 A;  4UA7 A;  1ESI A;  3GR2 A;  1D1J A;  3KSI A;  4JF5 A;  2EXA A;  3UB6 A;  2YKF A;  3IX8 A;  4FD8 A;  4Y15 A;  3V50 A;  5FI7 A;  4Y13 A;  2K7S A;  2BAS A;  3LGO A;  4HBT A;  2QYB A;  5TFQ A;  4XUZ A;  1G5U A;  3MQO A;  4DMZ A;  1ERO A;  4XUX A;  2PR5 A;  4N92 A;  1P0Z A;  2OWH A;  3T4J A;  4GW9 A;  3ISG A;  1ZC2 A;  4XXR A;  2XA7 M;  1W63 M;  3HVF A;  3E4Q A;  5E2F A;  1DP9 A;  1BUL A;  1TD5 A;  5DTT A;  1DP8 A;  1NYY A;  1NRJ A;  4LPZ A;  4H6J A;  1MZU A;  5CTM A;  1G6A A;  3FKW A;  1S0W A;  4EUZ A;  2J9P A;  1FR6 A;  3RH8 B;  4B88 A;  3CPT A;  4X68 A;  4A5R A;  4CLC A;  3MMH A;  4JXS A;  1PNE A;  3DWZ A;  1OME A;  5DFY A;  4B4X A;  5EOE A;  5KMW A;  2D02 A;  3PR6 A;  4ZDX A;  1TEM A;  3PBQ A;  3WS2 A;  3B3X A;  3S22 A;  4L0L A;  1PW1 A;  1S4S A;  4HHD A;  1ESU A;  1MY8 A;  5FAO A;  4QJG A;  1E25 A;  3NOU C;  2B95 A;  2Y79 A;  4WL9 A;  5HAR A;  4HOI A;  1L0D A;  2XDM A;  2QHK A;  1IOU A;  3TOI A;  2XEP A;  5FDS A;  2O99 A;  3V3R A;  5HL1 A;  4BL2 A;  3QP2 A;  1YLP A;  2O9C A;  4EQ1 A;  4GOG A;  5EVI D;  4WEL A;  1EW0 A;  3LI8 A;  2PHY A;  5GHZ A;  4RX3 A;  1W8Q A;  4HI4 A;  4BLM A;  5FAT A;  3V67 A;  3IX4 A;  1YMX A;  4UAA A;  3BYD A;  4CPK A;  4MEZ A;  1MKI A;  2W27 A;  4ID4 A;  5M19 A;  1IYP A;  4E3I A;  4KUK A;  3F1P B;  3IH8 A;  3G35 A;  4OVD A;  5FQ9 A;  4YWZ A;  3ZVT A;  5CTN A;  3CIT A;  1LL9 A;  1ONH A;  2ZC3 B;  3ZVW A;  1SKF A;  3R7W A;  3RXX A;  4QB8 A;  3VV4 A;  1STZ A;  1XJ3 A;  4HY8 A;  2OAQ 1;  3N8L A;  2NUT C;  3DAV A;  4WF0 A;  1K54 C;  1NWZ A;  4EXO A;  4S2P A;  1YAX A;  4PM6 A;  3LEZ A;  3O88 A;  4LV2 A;  3ZCZ A;  3QP1 A;  4R3B A;  5CEB A;  2ZC5 B;  2XR0 A;  5FA7 A;  1LL5 A;  1F9I A;  1K6R A;  1NYM A;  3MQ0 A;  2L1M A;  5HPI A;  4K0X A;  4R3J A;  4LV3 A;  2Y2P A;  3G34 A;  3GEC A;  2LB5 A;  3HLC A;  2QJ5 A;  2Z6D A;  3C38 A;  3K2N A;  3BFC A;  3LFV A;  1IYQ A;  2KLI A;  3DTE A;  2Y2O A;  4DJ3 A;  5FAQ A;  2LB9 A;  1KDW A;  3NOP C;  4HJ3 A;  3OPP A;  2J8Y A;  3SS5 A;  5FQM A;  5CX7 A;  4HBU A;  2JE5 A;  4ZBE A;  3IWQ A;  2W3H A;  2W1T B;  1XPB A;  1IEM A;  4KG2 A;  4EES A;  1OTA A;  3JVV A;  4R0Q A;  3EEA A;  2RL3 A;  4F3L A;  3ZNY A;  5G4Z A;  2V8F A;  4ZJ2 A;  1E3U A;  3OCN A;  3FG8 A;  3DWK A;  4L9E A;  4Y5F A;  2ZC4 B;  1LSW A;  3IHA A;  1ZHH B;  2Y2G A;  1K54 A;  2HPB A;  5DKK A;  2WGW B;  3C30 A;  3IF6 B;  3KSG A;  1QMF A;  3D4F A;  3OPR A;  4OPQ A;  1CEF A;  2Y8H A;  3UME A;  3IS2 B;  2R9W A;  1D06 A;  2P04 A;  3BY9 A;  4LV1 A;  5J3W A;  3QP4 A;  4K0W A;  1HVB A;  4GZB A;  3N8R A;  2HJ9 C;  2IWB A;  5IS1 A;  4S2L A;  3UB8 A;  4BWI A;  3H82 A;  1CQA A;  3E4P A;  2M7V A;  4IVK A;  1XKZ A;  3W4P A;  4QD4 A;  1MWT A;  4OP8 A;  3C8C A;  1BZA A;  3MJQ A;  4F94 A;  3VMA A;  1RGZ A;  3F1O B;  4DJ2 A;  3V39 A;  1IKG A;  1PWD A;  4KZ5 A;  2Z2M B;  2MJ6 A;  2PRF A;  4H8R A;  3BFD A;  4S2M A;  1CI8 A;  2V20 A;  1D7E A;  5DTS A;  3G4P A;  3WS0 A;  3HLE A;  5L10 A;  4FH4 A;  4EEP A;  2ZMA A;  3PBT A;  5AQB A;  4P6B A;  4PM5 A;  5EM0 A;  2VX8 A;  5JYP A;  3WS4 A;  3A0V A;  1HTZ A;  3CPT B;  2HDQ A;  3BM6 A;  3LY3 A;  1PZP A;  3CI6 A;  2QMI A;  1NXY A;  4EUV A;  2HV1 A;  5GLA A;  3HLW A;  4G3K A;  4IUH A;  4Y0U A;  2GX5 A;  2B02 A;  2JKT M;  4R6L A;  4E6X A;  4U0X A;  2KOI A;  5LBR A;  4MLL A;  5EUA A;  1EWZ A;  5EPH A;  3G31 A;  1OT6 A;  3UY6 A;  1ZG4 A;  2G2W A;  2R78 A;  5U47 A;  2P9V A;  3C2W A;  1K6S A;  2JBF A;  2V0U A;  4S2K A;  5E2H A;  4QY6 A;  3UNW A;  4DDS A;  4Q0J A;  1L2S A;  5FEF A;  1NLY A;  3A3D A;  3ZG5 A;  4HP9 A;  5F1F A;  1OTE A;  3UB9 A;  2X71 A;  3JPU A;  3NJA A;  1ERQ A;  3T50 A;  2G7U A;  4NXG A;  1KVL A;  5D3O A;  5A93 A;  5AJG A;  2HDU A;  3T4O A;  3UDF A;  4RX2 A;  5L8M A;  5TGF A;  2KDK A;  2V8C A;  5C5K A;  3AGE A;  4PM8 A;  3R7W B; 
#chains in the Genus database with same CATH homology
 4Y2F A;  2JN7 A;  2VLG A;  2L0W A;  3H7W B;  4G3W A;  3BWL A;  4QPR A;  5AVE A;  4NEE D;  1T1C A;  2A2L A;  4Y3I A;  3TJZ C;  1TS0 A;  5FL3 A;  3KSI A;  4JGQ A;  1OTD A;  3UB6 A;  2QWS A;  2YKF A;  1V9Y A;  1YSQ A;  1XJ2 A;  3LIE A;  2VEA A;  1H3Q A;  4UEY A;  2K7S A;  1MKM A;  3EOI A;  1UWP X;  2BAS A;  2EWV A;  4UQI S;  5DKL A;  2QYB A;  2HJE A;  1LSV A;  3JVU A;  5J4E A;  4DMZ A;  3MQO A;  2VA0 A;  3UMD A;  2PDR A;  2PR5 A;  2VV6 A;  1P0Z A;  2OWH A;  3T4J A;  4GW9 A;  1S4R A;  5F68 A;  1LSX A;  3KX0 X;  2V9A A;  2XA7 M;  1JNU A;  1W63 M;  4LRY C;  5HWT A;  3F1N A;  3E4Q A;  2W3E A;  3OBF A;  5G4Y A;  1DP9 A;  1IFQ A;  2OOL A;  1TD5 A;  1DP8 A;  4K08 A;  1NRJ A;  1ZTU A;  3LID A;  4LPZ A;  4H6J A;  1MZU A;  5HZH A;  4YOF A;  1LL8 A;  4EET B;  3LYX A;  3PXP A;  1VHM A;  3MFX A;  3RH8 B;  4P6Z S;  4CLC A;  3MMH A;  3RTY A;  1TS6 A;  1OT9 A;  4KQO A;  1OTI A;  2JKR M;  3BW6 A;  4WEK A;  5DFY A;  3D72 A;  4XT2 B;  2D02 A;  5F69 A;  3PR6 A;  3PBQ A;  1S1Y A;  4L0L A;  3UB7 A;  1S4S A;  4E04 A;  2JKT I;  3B33 A;  4HHD A;  5TBM B;  4GS9 B;  1DP6 A;  4HJ6 A;  2W1T A;  5F6A A;  4ETX A;  3E0Y A;  3ZQ5 A;  4ARZ B;  3NOU C;  4HNB A;  1XJ4 A;  3CWF A;  2Y79 A;  4WL9 A;  3T4L A;  4PKY A;  1XFN A;  4HOI A;  4LLO B;  2QHK A;  1IOU A;  4IUK A;  4RQ9 A;  3OCL A;  2NUP C;  2O99 A;  4EER A;  4UQI M;  3IBJ A;  3LIA A;  3FPW A;  4CLC C;  1G6O A;  1S66 L;  4MMN A;  2O9C A;  1P97 A;  4EQ1 A;  3FC7 A;  5HDC A;  1VB6 A;  4O01 A;  4WEL A;  4WN5 A;  1EW0 A;  3LI8 A;  2PHY A;  1N9O A;  2HGV A;  1WA9 A;  4HI4 A;  4I5S A;  3H82 B;  2KX6 A;  3V67 A;  3B47 A;  1Y28 A;  3GDI A;  2PT7 A;  2IA2 A;  1GSX A;  2W27 A;  3PYP A;  3UE6 A;  4CLC E;  3A0R A;  4BBV A;  2P08 A;  4L9G A;  4KUK A;  3F1P B;  3EWK A;  2GNX A;  1V9Z A;  1ODV A;  2I9V A;  4BJP A;  3H9W A;  4YWZ A;  4NXF A;  4PHT A;  4P6Z M;  2PYR A;  3CIT A;  3TE8 A;  5HPF A;  5DF9 A;  5HD5 A;  3MF0 A;  3R7W A;  3VV4 A;  1STZ A;  2OAP 1;  1XJ3 A;  4I3I A;  4HY8 A;  2OAQ 1;  2NUT C;  4WF0 A;  1S67 L;  3R4K A;  4ME4 A;  1NWZ A;  4EXO A;  4EEU A;  2PR6 A;  1T18 A;  1UGU A;  3OOV A;  1GSW A;  1YAX A;  1OJ5 A;  2HF6 A;  5HDS A;  3S7Q A;  1T1B A;  2W3D A;  3F1O A;  3UE3 A;  4GCZ A;  5HWW A;  4PAU A;  1N9L A;  3LI9 A;  4WLA A;  1F9I A;  2J3T C;  5A8B A;  4IHQ A;  4I39 A;  3MQ0 A;  4GHI B;  4I38 A;  2L1M A;  5HPI A;  2FZ0 A;  4GLQ A;  4KUO A;  2J3W A;  1P9R A;  4G3V A;  3GEC A;  2LB5 A;  5K5B A;  2QJ5 A;  3NHQ A;  4MN6 A;  3S7O A;  2QKP A;  2Z6D A;  3OLO A;  4H6J B;  3C38 A;  3K2N A;  1MC0 A;  3PHY A;  3TRC A;  1GSV A;  3EEH A;  1OTB A;  3LFV A;  4HH3 A;  2KLI A;  4JGO A;  1UWN X;  1H8M A;  4CLC B;  2EWW A;  2M1C A;  4Z1W A;  4MN5 A;  4HJ4 A;  3CLO A;  4DJ3 A;  3KYQ A;  2LB9 A;  3NOP C;  3CAX A;  3MQQ A;  4HJ3 A;  2CMN A;  2J80 A;  1TS8 A;  3ZYT A;  5CX7 A;  3P7N A;  4IJG A;  5F5Y A;  2WKR A;  2W3H A;  3LR0 A;  3LR5 A;  4OOL A;  2W1T B;  2V1B A;  2A24 B;  2ZMF A;  4EES A;  4HQA A;  2ZOI A;  1OTA A;  1OJG A;  3JVV A;  4YNR A;  5HDD A;  3EEA A;  3MXQ A;  2O9B A;  1T1A A;  3PBR A;  4MDZ A;  3LUQ A;  4F3L A;  5G4Z A;  3E4O A;  4I3J A;  1XFQ A;  5J7E A;  4B9O A;  3PBS A;  3OCN A;  3FG8 A;  4ZRR A;  5HD3 A;  3T4Q A;  4B93 A;  4ARZ A;  4L9E A;  4Y5F A;  4HP4 A;  5HSQ A;  1LSW A;  3T4K A;  1KOU A;  3HJK A;  3W2Z A;  4O8G A;  1F98 A;  1ZHH B;  4OOM A;  1P9W A;  4MCW A;  2VKS A;  5DKK A;  1YKD A;  4NXB A;  3C30 A;  3KSG A;  3BQ8 A;  2W3F A;  2Y8H A;  3UME A;  3KO6 A;  3IS2 B;  1D06 A;  2P04 A;  3BY9 A;  5J3W A;  4CLC D;  2K2N A;  3EGX C;  1X0O A;  3RFB A;  4O0P A;  3P01 A;  2L4R A;  2HJ9 C;  2O0Y A;  5EFW A;  3UB8 A;  5IS1 A;  4R70 A;  3U2A A;  4BWI A;  2PD7 A;  1LT0 A;  3H82 A;  3E4P A;  3B42 A;  3LIB A;  5IU1 A;  2M7V A;  4NKP A;  3LR4 A;  4Q0I A;  2P7J A;  3SW1 A;  2ZOH A;  2WKQ A;  3H7W A;  4GJ4 A;  3T4S A;  2V1A A;  3F1P A;  2B18 A;  2ZMV A;  3C8C A;  3MJQ A;  2M7U A;  1G28 A;  2XSS A;  4I3A A;  4JGP A;  5DFX A;  3MR0 A;  2O9A A;  3BJN A;  1TF1 A;  3F1O B;  4DJ2 A;  3HJI A;  3PBN A;  3F1N B;  2W3G A;  4WUJ A;  2MJ6 A;  2YKH A;  4NXE A;  5TJJ A;  3D3O A;  3HCY A;  1D7E A;  4JGR A;  1W63 Q;  2Z6C A;  4EEP A;  3BY8 A;  3PBT A;  1N9N A;  2DMW A;  3EGD C;  2VX8 A;  4BBT A;  3A0V A;  4CQH A;  3VE3 A;  3LIC A;  1F5M A;  4II7 A;  3LIF A;  4HIA A;  5KIZ A;  2J3T D;  4GHI A;  4WEJ A;  3S7N A;  3A0S A;  3ULF A;  2VGL S;  4FOF A;  3CI6 A;  3KYZ A;  2VV8 A;  2GJ3 A;  4EUV A;  2HV1 A;  3VE4 A;  2K31 A;  4G3K A;  2FH5 A;  4IUH A;  2GX5 A;  2B02 A;  2JKT M;  2D01 A;  2W0N A;  3EQU A;  4R6L A;  3K3C A;  1XJ6 A;  2KOI A;  1TS7 A;  4KQD A;  5LBR A;  2INW A;  2JKR I;  3NOT C;  1OPX A;  3BQA A;  2PD8 A;  1OT6 A;  1YSP A;  2H28 A;  2R78 A;  4F3L B;  4XT2 A;  5AVF A;  3C2W A;  4DN0 A;  2XRN A;  5DJT A;  3KSF A;  4R38 A;  5MC7 A;  2V0U A;  5DJU A;  3O5Y A;  3G6O A;  5KSH A;  3FPV A;  5TBM A;  2XRO A;  4LRZ E;  4GS9 A;  4MN7 A;  2PYP A;  2VZW A;  4HH2 A;  4EU0 A;  4ETZ A;  2A24 A;  3CUE A;  4Q0J A;  4AFI A;  5IT5 A;  4R3A A;  3OC2 A;  4BMW A;  2V0W A;  1DRM A;  5HL6 A;  2QJ7 A;  2XA7 S;  1NLY A;  2WKP A;  3S7P A;  5I5L A;  3LR3 A;  2W1R A;  2VV7 A;  4HP9 A;  4BBU A;  2ZBB A;  5HWV A;  1OTE A;  3K3D A;  3UB9 A;  2VJW A;  3ICY A;  3NJA A;  2GZA A;  3T50 A;  3KSH A;  2G7U A;  3IBR A;  1BYW A;  4NXG A;  4M4X A;  5AJG A;  3DBA A;  3VOL A;  3T4O A;  3TW8 A;  4FSF A;  4LRX C;  3E98 A;  1S1Z A;  2JHE A;  4L9F A;  2EA9 A;  2OWJ A;  5L8M A;  2KDK A;  4Q0H A;  5C5K A;  3PBO A;  1NLZ A;  4EW7 A;  3IS2 A;  3T4T A;  3CUE C;  4PKY G;  3R7W B;  3EQV A;  2VGL M;  1T19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...