1LT0A

Crystal structure of the cn-bound bjfixl heme domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
117
structure length
117
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein FixL
publication title Structure-based mechanism of O2 sensing and ligand discrimination by the FixL heme domain of Bradyrhizobium japonicum
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 31
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1lt0A00
1F98A 4WL9A 5DKKA 3F1NB 4YWZA 3LIFA 3IS2B 2JN7A 2ZOIA 4HI4A 1T1BA 2Z6DA 2ZBBA 3LYXA 3GDIA 3VE4A 3NOUC 4F3LB 5HWVA 2QWSA 4BBUA 4R38A 4I38A 4MN6A 4HIAA 3RH8B 1G28A 2KX6A 3T50A 1WA9A 2V9AA 5J7EA 2A24A 1TS7A 2QKPA 2YKFA 4I3IA 3BWLA 3EEHA 1XFQA 1GSVA 4DJ3A 3MQOA 1DP8A 2PD7A 1UWNX 3UMDA 3A0VA 4LRXC 3P7NA 2EA9A 2BASA 4EERA 1GSXA 3LI8A 4EESA 1V9YA 2J80A 2W0NA 1T1CA 4L9FA 3HJKA 4K08A 4GS9B 1DP9A 1XJ4A 4JGRA 2OWJA 4MN5A 5DJTA 4EXOA 4I3JA 5A8BA 3E4OA 3F1OA 1OTBA 5HWTA 3G6OA 2VEAA 1T19A 4HNBA 1D7EA 1BYWA 1OJ5A 5F68A 3RTYA 5I5LA 1TS0A 1N9NA 5HD3A 5AVEA 4KUKA 4M4XA 3VE3A 1ODVA 4HHDA 5G4ZA 4I39A 3MR0A 3C2WA 1KOUA 4RQ9A 4WLAA 4XT2A 2PDRA 4HQAA 3NJAA 4L9EA 4LPZA 3HJIA 4H6JA 4GHIA 5HWWA 3OLOA 2PYPA 3MFXA 2VV7A 4BBVA 3MJQA 5TBMA 3GECA 3VOLA 4PKYG 1S1ZA 4EEUA 3LICA 3H82A 1XJ6A 4HY8A 3UB8A 2GJ3A 4LRYC 4R6LA 2L0WA 4E04A 5HDDA 4R70A 2QJ5A 3F1OB 4EQ1A 2D02A 4WF0A 4WN5A 4LRZE 5KIZA 4HP9A 1T1AA 4B9OA 3LIBA 3LUQA 1T18A 5G4YA 5F5YA 3F1PB 1TS8A 4NXBA 2V1AA 1LSXA 1LT0A 5IU1A 1OJGA 2VV6A 4NXEA 4EEPA 1DRMA 2INWA 2R78A 3F1NA 3ZQ5A 3E4QA 3IS2A 3ULFA 3NHQA 3FG8A 1S4SA 5HDCA 2K7SA 4HP4A 5HZHA 5F69A 3C8CA 2WKQA 4F3LA 1LL8A 3A0SA 4HJ3A 4I5SA 3EWKA 3PYPA 4I3AA 4L9GA 5IS1A 3NOTC 4PKYA 3CLOA 2CMNA 4GW9A 1UGUA 2A24B 3A0RA 1LSWA 3UE6A 2WKPA 4EETB 2I9VA 2B02A 3ICYA 2V0UA 4JGPA 2H28A 1Y28A 3FC7A 3BY8A 2OWHA 1OT9A 3LIAA 2V0WA 4HOIA 1N9LA 2VV8A 2PD8A 1UWPX 2PR5A 1MZUA 4GS9A 2VLGA 3KX0X 5F6AA 5DKLA 5HD5A 2QJ7A 1LSVA 5J3WA 4HH3A 4JGOA 4JGQA 3UMEA 5J4EA 1F9IA 4NXFA 2L1MA 4LLOB 3E4PA 3H7WA 1EW0A 3CAXA 3K3DA 4EW7A 2V1BA 2YKHA 4WUJA 2P7JA 2PR6A 1TS6A 3MQQA 1X0OA 1GSWA 5HDSA 3UB9A 1OTAA 2W27A 2L4RA 1DP6A 1NWZA 1V9ZA 1P0ZA 1JNUA 4HH2A 3K3CA 3LIEA 4R3AA 5AVFA 2PHYA 3LIDA 4XT2B 1N9OA 4NXGA 5DJUA 5EFWA 1D06A 4H6JB 4GHIB 2JHEA 2ZOHA 2HV1A 3D72A 3PHYA 1S66L 5TBMB 4HJ6A 1XJ2A 1OT6A 4KUOA 4BBTA 1OTDA 3SW1A 2D01A 5HSQA 3IBRA 3H82B 4HJ4A 3H7WB 1S4RA 3MXQA 1P97A 3UB7A 3NOPC 2QHKA 3B33A 1S1YA 2OOLA 1XFNA 1S67L 2KDKA 4GCZA 1OTEA 1OTIA 3F1PA 3LI9A 2Z6CA 2M1CA 3BY9A 4DJ2A 1XJ3A 3H9WA 2PYRA 4KQDA 1VB6A 3CWFA 3UB6A 2WKRA
chains in the Genus database with same CATH superfamily
1F98A 3G4PA 5GL9A 5FDSA 4ZRRA 1FCMA 3QHYA 3ITBA 4DN0A 2VGLS 2ZC6B 2JC7A 4LCLA 2Z6DA 2ZBBA 2W3DA 1LI9A 3ZFZA 3NOUC 2VGJA 4K91A 1J3WA 3PAGA 1K38A 3V67A 3D3OA 4ZJ2A 4X55A 4EQIA 3A3EA 3QP6A 3RH8B 3A3IA 5CRFA 2P9VA 1HD8A 2A24A 5K5BA 1TS7A 4I3IA 3BWLA 4CLCB 1IFQA 2OSUA 2GDNA 3MQOA 2VJWA 3A0VA 2XD1A 1YLTA 3P7NA 1H8MA 2BASA 4GJ4A 1GSXA 4Y0TA 3UE1A 2W0NA 4OP8A 4OKPA 3IHBA 1J9MA 3GSGA 1T1CA 4L9FA 3HJKA 3QNCA 2HGVA 3EGXC 2EWWA 1H8YA 2PU4A 5DJTA 4UA9A 3MMHA 4B88A 4Z1WA 4EXOA 4P6ZS 2JKTI 4MBHA 4QHCA 2UWXA 4BMWA 1G6AA 2FFYA 3PBOA 5A8BA 1OTBA 2XH9A 3G34A 2ZQ7A 2VEAA 3T4KA 3Q7VB 1BLHA 5I94A 3CPTA 5GLCA 3TOIA 1VEUA 3Q7ZA 3GMWA 1D1JA 3WS4A 1IYSA 1BUEA 5AVEA 2P9VB 5EVIC 5CERA 1NYMA 4HHDA 5G4ZA 3ZGAB 2HF6A 5DFYA 5CX7A 3MR0A 2Q9MA 3GV9A 4WLAA 4WZ4A 1KDSA 3G2ZA 3UDFA 1NZOA 2DMWA 1MBLA 4GHIA 3SS3A 5AQBA 3C4PA 4BBVA 2QPNA 5TBMA 1NXYA 4DE2A 4RA7A 2EX8A 4AFIA 4LRYC 3HLBA 5FQQA 4WYYA 1ZC2A 2L0WA 4K0WA 4E04A 4R70A 2QJ5A 1CQAA 4EQ1A 3EQVA 1FILA 5EVLA 4B9OA 3CPTB 3LUQA 4BJPA 5F1FA 1K55A 3BFGA 3G32A 5G4YA 1TS8A 1DJCA 1VEUB 3SS5A 1YSPA 2JKRM 1O7EA 5FAOA 3HVFA 5IHVA 3PTEA 1FCOA 2HDRA 4D60A 1EWZA 1IELA 2XQZA 2J7VA 2HJEA 1MWRA 1OJGA 2WKIA 4BD1A 2O0YA 4BLMA 3PAEA 1HLUP 4EV4A 1H0MA 5CHUA 4R1GA 5MC7A 3IXHA 4Y2FA 5A93A 4DE0A 2XDMA 4HP4A 1CEGA 3Q81A 4P6BA 2PBYA 1W63Q 5CEDA 3SH7A 3UNWA 3VP3A 3D9YA 3EWKA 5DFXA 2J8YA 2JCHA 3CHWP 4JPMA 1MWTA 2CMNA 4GW9A 2AVXA 3A0RA 4EBNA 5LBRA 2WKPA 4GD6A 3DWKA 2RL3A 3MKFA 4BENA 4PM8A 3M6BA 4EBPA 3WRTA 4HOIA 3B47A 2XA7S 3KX0X 5DKLA 1K56A 2QJ7A 1F5MA 5J3WA 4HH3A 4Y13A 3V3RA 3R4KA 4WZ5A 3H7WA 4KZ3A 2Y59A 3U4LP 1MY8A 3K3DA 4EW7A 1IKGA 3CITA 5FASA 2V1BA 2Z2LB 2K2NA 4FSFA 4EU0A 2YKHA 4R3JA 4WUJA 2P7JA 4X53A 3PBTA 3NCKA 4P85A 3A3DA 3T1QB 5FL3A 2GNXA 1ALQA 4QU3A 3T4JA 4GNUA 3OBFA 2Y2PA 4QWOA 1K55C 2OAP1 5HDSA 3FPWA 1OTAA 3BLMA 5FA7A 5FAPA 1NWZA 3ZG0A 3QP8A 3K3CA 2WKHA 1DY6A 5AVFA 2XROA 3FKVA 1HZOA 2ZL1B 4XT2B 4KQQA 2EWVA 4Y15A 3C7UA 4IBRA 3WS5A 1YM1A 3ITAA 2ZOHA 2Q0OA 4ZDXA 1NLZA 2HV1A 3RXXA 2J9PA 3FPVA 2HP9A 1NLYA 4E6WA 4HJ6A 1FOFA 1XJ2A 3S7PA 1OT6A 4KUOA 1YLYA 5KSHA 3IBRA 2ZM2A 4S2NA 4HJ4A 3L7HA 3H7WB 3AGEA 4K0XA 5TR7A 2QHKA 3B33A 1S1YA 2OOLA 5AJGA 4D2OA 1CF0A 2KDKA 3MZEA 3G2YA 4WM9A 4IUKA 3ZNYA 4JXGA 1FR6A 4JF4A 3F1PA 3PBSA 1PZPA 3C5AA 3O87A 2K31A 3BY9A 3OOVA 1SCWA 2B5RA 3BECA 3S7OA 4RX3A 2WGWA 1RCJA 3M6HA 1W8QA 3IX8A 3IHAA 2PYRA 2ZM8A 4OQHA 2DNSA 1NZUA 3F1NB 2V2FF 2XR0A 4CPKA 4GDBA 5HPFA 2A2LA 2JN7A 2JBFA 1WYCA 2Y2NA 2ZOIA 3N4IA 5L10A 4JXVA 2HDQA 3LYXA 5L2FA 4OQIA 3VE4A 4IUHA 4OOLA 4OOMA 4BBUA 3ISGA 4NEED 3BLSA 4LV1A 1STZA 4OQGA 1LLBA 3FV7A 1PIOA 1YMXA 5DF8A 1WA9A 2V9AA 5FQKA 1Y4OA 3SH9A 1LL5A 2VX8A 1K0KA 5GHZA 3E0YA 4E3JA 3WS2A 3ZYTA 2Y2HA 3JPUA 2PD7A 1QMFA 4NETA 1BULA 4LRXC 1SKFA 2EA9A 5GLBA 5M18A 3NIAA 4KZ8A 4EERA 2WGWB 4EESA 5D3OA 2HJ9C 3DBAA 4MN7A 3IF6B 4GS9B 1FCNA 3NULA 1Q2PA 1XJ4A 4WMCD 4EUVA 4IEDA 3S22A 1ONHA 1G5UA 4ARZB 5BOHA 2ZQDA 2IA2A 2J3TD 2Y91A 5HL1A 3E2KA 3IWQA 3VP4A 2G2WA 4YINA 3RFBA 5EVIA 4WEKA 1D7EA 3VSKA 3RTYA 3IXDA 5I5LA 3ZCZA 2X01A 5FATA 5L09A 1VETA 2HZ5A 2XSSA 5EVID 1BSGA 1ODVA 3CJMA 1IYPA 5L07A 2JKGA 2EX9A 5FQ9A 2HPBA 5HFOA 3C2WA 3OCNA 4RQ9A 2Y2MA 3GVBA 1W8YA 3BEBA 3ZHHA 5AQ9A 4FH4A 3NJAA 4L9EA 4LPZA 1SKOB 2Q9NA 4MBFA 4S2LA 2Y55A 3T4QA 2OV5A 1KVLA 4Q0IA 3VSLA 4IHQA 3UPNA 2V20A 5EUAA 3G35A 3E2LA 3GECA 4OOYA 3LICA 3T4LA 1XJ6A 4HY8A 3UDIA 3N8RA 2XF3A 4HBTA 3FKWA 1SHVA 4YOFA 3GR2A 4R6LA 5F1GA 3QP1A 5CGXA 4E3MA 4JLFA 4WF0A 1XKZA 1PWGA 5FI2A 1VQQA 4DXCA 3NDEA 3S4XA 3LIBA 3MF0A 1T18A 3S1YA 4E3KA 4NXBA 2Y2OA 2I72A 2IWBA 2V1AA 4ZJ1A 5TJJA 4NKPA 1LT0A 4R3BA 5IU1A 2VV6A 3LR0A 1MPLA 2R78A 1K54C 3OC2A 4KENB 3ZQ5A 3HREA 3IS2A 3NHQA 3FG8A 1PW1A 4UQIM 5HDCA 2P08A 1ESIA 1OPXA 2XEPA 4F3LA 1LL8A 3A0SA 2J3TC 3UE0A 4I5SA 4G3WA 5C5KA 4II7A 1PWDA 5AQ7A 3NI9A 1PZOA 1I2WA 5IS1A 2W3FA 2A49A 4KG2A 3IH9A 4FOFA 4C6YA 4LGWA 2M7UA 4B93A 2HP5A 4GD8A 3CLOA 4S2PA 1UGUA 2A24B 1LSWA 1PWCA 3AGDA 1TVFA 4BL2A 3O86A 5DTKA 2PU2A 4XUXA 1JWVA 4JBFA 4LFUA 4Y3IA 2J9OA 2V0UA 2XD5A 3BRMA 3D4FA 4JGPA 3IQAA 3HLGA 2DRWA 4NG2A 3PXPA 4ZJ3A 2XLNA 2Y2QA 2PR5A 4B4XA 4KZ9A 1I5QA 4JGQA 4MDZA 1P9WA 3Q1FA 3CAXA 1PW8A 1U60A 4R0QA 4ZBEA 1XA7A 2ZMFA 4N1HA 3CG5A 4BD0A 1FR1A 1TEMA 2JKTM 2ZC5B 2DCFA 3KSGA 3W2ZA 5CHMA 5GHYA 1IEMA 2XK1A 1IKIA 1RGYA 3OZHA 2CC1A 2P04A 3OPPA 3HBRA 1FSWA 4X1LA 2XFTA 5AQAA 2W3HA 5EV0A 4RVAA 1V9ZA 3HLFA 1P0ZA 3M2KA 4HH2A 3UPPA 2PHYA 4WELA 2W1RA 3S7NA 1TDLA 4WBGA 1S0WA 4QB8A 3DWZA 5HL6A 4QY5A 1D06A 2IWDA 4GHIB 2JHEA 5DVAA 3D72A 3PHYA 3FWLA 2ZQAA 5DF7A 5TBMB 5F83A 3CZDA 3SW1A 4NK3A 5EE8A 3NY4A 4C3QA 3TG9A 1L0GA 1VM1A 1YKDA 4BL3A 4OLGA 4O01A 1XFNA 1YSQA 3E98A 2ZC7A 1JWPA 3NECA 5E2EA 3M2JA 1IYQA 3LO7A 3LY4A 4X68A 1OTIA 3VOYA 3UN7A 2FZ0A 2VZWA 4QD4A 2OLVA 2RCXA 3P09A 4KZ4A 3CUEC 3G31A 2JKFA 4DJ2A 1IYOA 1XJ3A 3LGOA 3LCEA 1CJFA 4B4ZA 4CJNA 5FI6A 3PBQA 3NBLA 3CWFA 1K6SA 2WKRA 4WL9A 4OH0A 4X69A 4YWZA 1YQSA 3T1RA 3LIFA 2W1TA 1CEFA 2EXAA 2J3WA 4HI4A 1L0EA 2WGIA 2G2UA 3GDIA 3JYIA 5HWVA 3QP5A 4L0LA 3OPHA 4I38A 3AGFA 2W3GA 3NDGA 2G7UA 2PBDP 1YLWA 2Y8HA 2JE5A 2NUTC 4HIAA 3SS4A 2B95A 1G28A 1S6RA 4R23A 5KSCA 1HTZA 1FSYA 1XGIA 4XXRA 3O3VA 1ACFA 2QKPA 2YKFA 3MKEA 4UHUA 4ID4A 1GSVA 4HEFA 2QMIA 4DJ3A 4N92A 3UMDA 2EX6A 1K4FA 3EEAA 3BYDA 3IT9A 1ES5A 3MS6A 3LI8A 3LR5A 4X6TA 3IH8A 4F94A 1GHIA 1QMEA 1H8ZA 1V9YA 3QP4A 3HLWA 1PFLA 1Z6FA 3N8SA 4FD8A 3C4OA 1ZHHB 3W8KA 5F82A 2X02A 3BFEA 4E3OA 5FEFA 1SZVA 1DP9A 1H3QA 3BFDA 1JVJA 2V8FA 1BLPA 4YFMA 3MXSA 3VFFA 4I3JA 5HW3A 3G6OA 1LL9A 5KZHA 1T19A 4ZTKA 3KSIA 3N7WA 4DMZA 3EOIA 5CEBA 1BYWA 1PYYA 5F68A 3PBRA 2MJ6A 1TS0A 2HDUA 2H5SA 5FDHA 4PHTA 5HD3A 4O8GA 3BW6A 3CMZA 1RGZA 4ZAMA 3HLEA 2E8JA 3WRZA 4DE3A 4LV0A 1DJBA 3B42A 3R7WA 1KOUA 1K57C 1BZAA 5A91A 3FYZA 2XRNA 3G30A 2PDRA 4OLDA 2Y79A 4PM7A 2LB9A 4H6JA 4LV2A 5HWWA 2PYPA 3MFXA 5EECA 1XPBA 4JF6A 4UQIS 3MBZA 1ES3A 3VOLA 4MCWA 1GA9A 3H82A 2B18A 3MSHA 4RX2A 5HARA 2BG1A 2WK0A 3HL9A 3JVVA 2FH5A 5HDDA 2IWCA 2WYXA 3C7VA 5M19A 4X25A 4WN5A 4DRTA 4LRZE 2NUPC 1T1AA 1MKMA 3TRCA 5FQMA 3F1PB 5G18A 3CI6A 2O9CA 3HLCA 4KZAA 1BLSA 1XP4A 1F2KA 1AWIA 3IXGA 3ZVWA 1E3UD 1K54A 1E4DA 4QPRA 1LSXA 2ZJ9A 4IJGA 4UAAA 4EEPA 4PM6A 4WMCA 1DRMA 4S2IA 3HCYA 4UA6A 4N1XA 5A90A 1KE3A 3UB5P 4OQ0A 1M6KA 4X56A 1MC0A 4N9KA 1S4SA 5EPHA 2Y2IA 2GX5A 3VP1A 1MWSA 4MEZA 2EFXA 3QP2A 1KDWA 1N4OA 5F69A 3C8CA 1RP5A 4MNRA 2XFSA 4HJ3A 4N9LA 3KO6A 1ZG4A 5CECA 3PYPA 1K6RA 2EFUA 4C75A 2C5WB 3I7JA 1GA0A 3T4TA 3NOTC 3QNBA 3W4QA 4PKYA 3T12B 4UA7A 2QYBA 2WAFA 4OPYA 1Z09A 3UE6A 2ZLYA 4EETB 3UPOA 5EOOA 2I9VA 4KZ7A 3ICYA 4Z9QA 1L3LA 1ERMA 5GHXA 3DW0A 1Y28A 2V1ZA 3B3XA 3MFDA 3FC7A 2EX2A 4E3LA 1IOUA 1N9LA 3VP0A 3UO9A 3N6IA 5FQJA 2ZQ9A 1W5DA 4XUZA 5EOEA 2VLGA 3LY3A 5F6AA 4S2JA 1LSVA 4OVDA 1O07A 1F9IA 4LLOB 3VOZA 3IF6C 4MLLA 1EW0A 4DDYA 1GHMA 3DTIA 5U47A 5GLAA 1MWUA 1WYBA 1LI0A 2O9BA 1DJAA 1SDEA 2A3UA 4P0MA 4Y17A 3ZG7B 2VA0A 3Q7VA 2KOIA 1Y54A 3SOIA 4Y0UA 2PR6A 2O9AA 5EVIB 3PR6A 4PM9A 1BT5A 1PI5A 1VETB 3ZG9B 3T1XA 1GSWA 5HX9A 1L0DA 3P98A 4GB7A 2ZM0A 3UB9A 1SDNA 5GLDA 1DP6A 2QZ6A 1JNUA 3HUNA 4KG6A 3LIEA 4R3AA 1MKIA 3IXBA 5J8XA 5CGSA 1LHYA 4GLQA 1N9OA 4NXGA 2Y2GA 1CK3A 2WZXA 1K25A 4BQMA 2KLIA 1S66L 2WZZA 2BLSA 1KE4A 1XGJA 1OTDA 2R9XA 3C30A 4LV3A 3OPLA 2ZMAA 4FUWA 1S4RA 2Z2MB 3MXQA 4X1MA 1CI8A 3NOPC 5JYPA 2FFFB 2JKRI 1ZKJA 4GDNA 1KVMA 1OTEA 3BQAA 3MZDA 3CUEA 2WAEA 3RXWA 4DKIA 1ZG6A 2PRFA 3LI9A 2Z6CA 1H5XA 4R4SA 5A92A 4CLCC 5E2HA 2WUQA 4S2OA 2ZMVA 2Y2LA 4KZ6A 3Q07A 4E3NA 3H9WA 1EI5A 1VB6A 5KMWA 3GTCA 2EXBA 3UB6A 4FTXA 3T4OA 3LEZA 5DKKA 1G68A 3JVUA 2WADA 2O99A 4A5RA 3LFVA 3IS2B 1XA1A 2H0TA 5EM0A 1T1BA 1KGEA 4F3LB 2QWSA 3FZCA 1YLZA 1XX2A 4R38A 3UDXA 4MN6A 3DTMA 3BFCA 5CHJA 2KX6A 3T50A 2LB5A 5FAQA 1BTLA 5J7EA 5HAPA 3Q82A 3IWOA 4ME4A 2BTFP 3EEHA 3PBNA 1XFQA 1PI4A 2ZC4B 3LR4A 3O5YA 4PM5A 2HP6A 1DP8A 3TSGA 1YT4A 4UEYA 1UWNX 3T4SA 1KGGA 4EWFA 3ZDJA 3L9KA 2J80A 1JWZA 2PT7A 4FCFA 4Q0JA 4HESA 1FIKA 3BQ8A 2ACGA 3VP2A 2VGLM 4K08A 4S2KA 4JGRA 3TW8A 2OWJA 3SH8A 4MN5A 3HUMA 1OMEA 4BWIA 2WKEA 3P01A 4DF6A 4DDSA 1ONGA 5FI7A 4HBUA 3LR3A 5E2FA 3DAVA 3E4OA 3F1OA 4Y7PA 4O7DA 5EM1A 5HWTA 1A0KA 4OONA 3IWIA 4HNBA 5HAQA 1OJ5A 2Y2KA 1NJ4A 2ZC3B 2VGKA 4S2MA 5HAIA 2WGVA 1N9NA 1YAXA 4QJGA 5M1AA 4KUKA 4M4XA 3VE3A 1K57A 4I39A 1Q2QA 3V5MA 1JTDA 3N8LA 2OLUA 1NRJA 3RJUA 2ZL1A 4XT2A 4HQAA 4IBXA 3HJIA 3MQ0A 2Y2JA 1VHMA 3OLOA 4GKUA 2VV7A 2X71A 2E8IA 1I2SA 4JXWA 3VMAA 4E6XA 1ZTUA 3MJQA 3GQZA 3WWXA 4P6ZM 1NRFA 1S1ZA 4PKYG 4EEUA 4MBKA 4O0PA 3V50A 4GZBA 4U0XA 1ESUA 5IT5A 3ZG8B 1K56D 3UB8A 2GJ3A 3KYEA 4OPZA 1NY0A 3OPRA 3EGDC 4FH2A 4U3TA 4Y5FA 3F1OB 4QY6A 2D02A 4RYEA 5FEGA 1CI9A 1ERQA 4OPRA 1L0FA 5KIZA 4JXSA 4HP9A 3K2NA 4P87A 3V3SA 5FSRA 5F5YA 3IF5A 3WS1A 3IBJA 1MXOA 1W7FA 4U0TA 1JTGA 4ESPA 3VV4A 4NXEA 4IVIA 2INWA 3F1NA 3A3JA 2H10A 3E4QA 3OCLA 3HLDA 1TF1A 3ULFA 3UE3A 4G3VA 2W1TB 1ES4A 2K7SA 1YMSA 3IX3A 4YNRA 5HZHA 3BM6A 4PPRA 4KQOA 2WKQA 2ZQ8A 2XGNA 1AXBA 3TE8A 4OP5A 3ZVTA 3LEQA 1XXMA 1M40A 4I3AA 4L9GA 2ZQCA 2ZD8A 4DXBA 4PMAA 1TDGA 2R9WA 4GN2A 4CQHA 4JF5A 5CGWA 4G3KA 5L8MA 3V39A 4DE1A 5FQIA 5E43A 1WE4A 1K4EA 2B02A 5TFQA 3DTEA 1YLJA 2UV0E 2H28A 3TJZC 3BY8A 2OWHA 3MXRA 1OT9A 3LIAA 5E2GA 2V0WA 4ETZA 1L2SA 2VV8A 1N9BA 5HPIA 3KYQA 2PD8A 1UWPX 1GCEA 1MZUA 3IF6A 2HDSA 4GS9A 5HD5A 4KZ5A 4KZBA 4JGOA 3UMEA 5J4EA 3C38A 4NXFA 2L1MA 5DF9A 1TD5A 3W4OA 3E4PA 4ARZA 1NYYA 2C6WB 4E3IA 1ES2A 2M7VA 4M3KA 4WZ5C 1E25A 3WS0A 3DTKA 3UY6A 1HVBA 1P9RA 5TGFA 3IX4A 1KGFA 3O88A 2GZAA 4EBLA 3KSFA 4KG5A 1TS6A 5CTNA 4Q8IA 1G6OA 1PNEA 4ETXA 1W63M 3MQQA 1E3UA 1FQGA 1X0OA 2W3EA 4CLCE 2W27A 2L4RA 3KSHA 4KQRA 2V8CA 3R7WB 4H8RA 4PAUA 3BFFA 3VFHA 3NC8A 3LIDA 3S7QA 1SKOA 3U2AA 4LCMA 2XA7M 5DJUA 3EQUA 3HUOA 5EFWA 4H6JB 4R4RA 5DTTA 3GRJA 2H0YA 4Q0HA 4BBTA 2VKSA 1YPRA 2D01A 5HSQA 2P74A 3H82B 5CTMA 2OAQ1 1YLPA 1P97A 3UB7A 4Y0OA 4S2NC 4EUZA 4LENA 5EVEA 1S67L 3W4PA 3ZNTA 3T1SA 2Y4AA 3SZTA 1BLCA 4WEJA 4CLCA 4GCZA 1W79A 4JKTA 4IVKA 1PRQA 3A3FA 4GOGA 1C3BA 5JYOA 3KYZA 4CLCD 2M1CA 1GHPA 4OPQA 3ZG5A 1EROA 3MZFA 2VK3A 2PAVP 4KQDA 3BJNA 5DTSA 1KE0A 4MMNA 5CXWA
chains in the Genus database with same CATH topology
1F98A 4WL9A 5DKKA 3F1NB 3JVUA 4YWZA 4ZRRA 2O99A 3LFVA 3LIFA 5HPFA 3IS2B 2A2LA 4DN0A 2JN7A 2W1TA 2VGLS 2ZOIA 2J3WA 4HI4A 1T1BA 2Z6DA 2ZBBA 3LYXA 2W3DA 3GDIA 3VE4A 3NOUC 4IUHA 4OOLA 4F3LB 5HWVA 2QWSA 4L0LA 4OOMA 4R38A 3V67A 4I38A 3D3OA 4BBUA 4NEED 4MN6A 2W3GA 1STZA 2G7UA 2Y8HA 2NUTC 4HIAA 3RH8B 1G28A 2KX6A 3T50A 1WA9A 2V9AA 2LB5A 5J7EA 2A24A 5K5BA 2VX8A 1TS7A 2QKPA 2YKFA 4ME4A 3E0YA 3BWLA 4I3IA 3EEHA 3PBNA 1XFQA 3ZYTA 4CLCB 1IFQA 1GSVA 3LR4A 3O5YA 4DJ3A 3MQOA 2VJWA 1DP8A 2PD7A 4UEYA 1UWNX 3T4SA 3UMDA 3A0VA 4LRXC 3P7NA 3EEAA 2EA9A 1H8MA 2BASA 4GJ4A 4EERA 1GSXA 3LI8A 3LR5A 4EESA 1V9YA 2J80A 2W0NA 2PT7A 4Q0JA 3BQ8A 2HJ9C 3DBAA 4MN7A 2VGLM 1T1CA 4L9FA 3HJKA 4K08A 1ZHHB 4GS9B 2HGVA 3EGXC 1DP9A 1XJ4A 2EWWA 4JGRA 4EUVA 3TW8A 1H3QA 2OWJA 4MN5A 5DJTA 3MMHA 4BWIA 3P01A 4Z1WA 4EXOA 3T4OA 4P6ZS 2JKTI 4ARZB 2IA2A 3LR3A 4BMWA 2J3TD 4I3JA 3PBOA 5A8BA 3E4OA 3F1OA 1OTBA 5HWTA 3G6OA 2VEAA 1T19A 3T4KA 3KSIA 4HNBA 3RFBA 4DMZA 3EOIA 4WEKA 1D7EA 1BYWA 1OJ5A 5F68A 3RTYA 3PBRA 5I5LA 2MJ6A 1TS0A 2XSSA 4PHTA 1N9NA 5HD3A 1YAXA 4O8GA 5AVEA 3BW6A 4KUKA 4M4XA 3VE3A 1ODVA 4HHDA 5G4ZA 4I39A 2HF6A 3B42A 5DFYA 3R7WA 5CX7A 3MR0A 3C2WA 1KOUA 1NRJA 3OCNA 4RQ9A 4WLAA 2XRNA 4XT2A 2PDRA 4HQAA 3NJAA 4L9EA 4LPZA 2Y79A 3HJIA 2DMWA 3MQ0A 2LB9A 1VHMA 4H6JA 4GHIA 5HWWA 3OLOA 2PYPA 3T4QA 3MFXA 2VV7A 4Q0IA 4IHQA 4BBVA 1ZTUA 4UQIS 3MJQA 5TBMA 3GECA 3VOLA 4P6ZM 4PKYG 1S1ZA 4EEUA 3LICA 4MCWA 4O0PA 3H82A 2B18A 3T4LA 1XJ6A 4HY8A 5IT5A 4AFIA 3UB8A 2GJ3A 4LRYC 4YOFA 4R6LA 3JVVA 2FH5A 2L0WA 3EGDC 5HDDA 4E04A 4R70A 4Y5FA 2QJ5A 3F1OB 4EQ1A 2D02A 4WF0A 3EQVA 4WN5A 4LRZE 2NUPC 5KIZA 4HP9A 1T1AA 3K2NA 1MKMA 3TRCA 4B9OA 3LIBA 3LUQA 4BJPA 3MF0A 1T18A 5G4YA 5F5YA 3F1PB 1TS8A 3CI6A 2O9CA 4NXBA 1YSPA 3IBJA 2JKRM 2V1AA 5TJJA 3VV4A 4QPRA 1LSXA 4NKPA 1LT0A 2HJEA 5IU1A 1OJGA 2VV6A 3LR0A 4IJGA 4NXEA 4EEPA 1DRMA 2INWA 2R78A 3HCYA 2O0YA 3F1NA 3OC2A 3OCLA 3E4QA 3ZQ5A 3IS2A 1TF1A 3ULFA 3UE3A 3NHQA 1MC0A 3FG8A 1S4SA 4G3VA 2W1TB 5MC7A 2GX5A 4UQIM 4Y2FA 5HDCA 2K7SA 2P08A 4YNRA 4HP4A 5HZHA 1OPXA 4KQOA 3C8CA 2WKQA 5F69A 1LL8A 1W63Q 2J3TC 3A0SA 4F3LA 4HJ3A 4I5SA 4G3WA 5C5KA 3TE8A 4II7A 3EWKA 5DFXA 3KO6A 3PYPA 4I3AA 4L9GA 5IS1A 2W3FA 4FOFA 3T4TA 3NOTC 2M7UA 4B93A 4PKYA 3CLOA 2CMNA 4GW9A 4CQHA 1UGUA 2A24B 3A0RA 4G3KA 2QYBA 5L8MA 5LBRA 1LSWA 3UE6A 2WKPA 4EETB 2I9VA 2B02A 3ICYA 4Y3IA 2V0UA 4JGPA 2H28A 1Y28A 3TJZC 3FC7A 3BY8A 2OWHA 1OT9A 3LIAA 2V0WA 4ETZA 4HOIA 3PXPA 3B47A 1IOUA 1N9LA 2VV8A 5HPIA 3KYQA 2XA7S 2PD8A 1UWPX 2PR5A 1MZUA 4GS9A 2VLGA 3KX0X 5F6AA 5DKLA 5HD5A 2QJ7A 1F5MA 1LSVA 5J3WA 4HH3A 4JGOA 4JGQA 3UMEA 5J4EA 3R4KA 3C38A 1F9IA 4NXFA 2L1MA 5DF9A 1TD5A 4LLOB 4MDZA 1P9WA 3E4PA 3H7WA 1EW0A 4ARZA 3CAXA 3K3DA 4EW7A 3CITA 2V1BA 2K2NA 2M7VA 4FSFA 4EU0A 2O9BA 2ZMFA 2YKHA 4WUJA 2VA0A 2P7JA 1P9RA 2JKTM 3KSGA 2KOIA 3PBTA 3W2ZA 2PR6A 2GZAA 2O9AA 3KSFA 1TS6A 3PR6A 5FL3A 1G6OA 2GNXA 4ETXA 1W63M 3MQQA 3T4JA 3OBFA 2P04A 1X0OA 1GSWA 2OAP1 2W3EA 5HDSA 3FPWA 3UB9A 4CLCE 1OTAA 2W27A 2W3HA 2L4RA 3KSHA 1DP6A 3R7WB 1NWZA 1V9ZA 1P0ZA 4PAUA 1JNUA 4HH2A 3K3CA 3LIEA 4R3AA 5AVFA 2XROA 2PHYA 4WELA 3LIDA 2W1RA 4XT2B 3S7NA 3S7QA 4GLQA 2EWVA 3U2AA 1N9OA 4NXGA 2XA7M 5DJUA 3EQUA 5HL6A 5EFWA 1D06A 4H6JB 4GHIB 2JHEA 2ZOHA 1NLZA 2HV1A 3D72A 3PHYA 2KLIA 3FPVA 1S66L 4Q0HA 1NLYA 5TBMB 4HJ6A 1XJ2A 3S7PA 1OT6A 4KUOA 4BBTA 2VKSA 1OTDA 3C30A 3SW1A 5KSHA 2D01A 5HSQA 3IBRA 3H82B 4HJ4A 3H7WB 2OAQ1 1S4RA 3MXQA 1P97A 3UB7A 3NOPC 2QHKA 3B33A 1YKDA 1S1YA 2OOLA 5AJGA 4O01A 1XFNA 1S67L 1YSQA 3E98A 2JKRI 2KDKA 4WEJA 4CLCA 4GCZA 4IUKA 1OTEA 3BQAA 3CUEA 1OTIA 3KYZA 3F1PA 3LI9A 3PBSA 2FZ0A 2VZWA 2Z6CA 4CLCD 2K31A 2M1CA 3BY9A 3OOVA 4CLCC 3CUEC 4DJ2A 3S7OA 1XJ3A 2ZMVA 3PBQA 3H9WA 2PYRA 3BJNA 4KQDA 1VB6A 3CWFA 4MMNA 3UB6A 2WKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F98 A;  4WL9 A;  5DKK A;  3F1N B;  4YWZ A;  3LIF A;  3IS2 B;  2JN7 A;  2ZOI A;  4HI4 A;  1T1B A;  2Z6D A;  2ZBB A;  3LYX A;  3GDI A;  3VE4 A;  3NOU C;  4F3L B;  5HWV A;  2QWS A;  4BBU A;  4R38 A;  4I38 A;  4MN6 A;  4HIA A;  3RH8 B;  1G28 A;  2KX6 A;  3T50 A;  1WA9 A;  2V9A A;  5J7E A;  2A24 A;  1TS7 A;  2QKP A;  2YKF A;  4I3I A;  3BWL A;  3EEH A;  1XFQ A;  1GSV A;  4DJ3 A;  3MQO A;  1DP8 A;  2PD7 A;  1UWN X;  3UMD A;  3A0V A;  4LRX C;  3P7N A;  2EA9 A;  2BAS A;  4EER A;  1GSX A;  3LI8 A;  4EES A;  1V9Y A;  2J80 A;  2W0N A;  1T1C A;  4L9F A;  3HJK A;  4K08 A;  4GS9 B;  1DP9 A;  1XJ4 A;  4JGR A;  2OWJ A;  4MN5 A;  5DJT A;  4EXO A;  4I3J A;  5A8B A;  3E4O A;  3F1O A;  1OTB A;  5HWT A;  3G6O A;  2VEA A;  1T19 A;  4HNB A;  1D7E A;  1BYW A;  1OJ5 A;  5F68 A;  3RTY A;  5I5L A;  1TS0 A;  1N9N A;  5HD3 A;  5AVE A;  4KUK A;  4M4X A;  3VE3 A;  1ODV A;  4HHD A;  5G4Z A;  4I39 A;  3MR0 A;  3C2W A;  1KOU A;  4RQ9 A;  4WLA A;  4XT2 A;  2PDR A;  4HQA A;  3NJA A;  4L9E A;  4LPZ A;  3HJI A;  4H6J A;  4GHI A;  5HWW A;  3OLO A;  2PYP A;  3MFX A;  2VV7 A;  4BBV A;  3MJQ A;  5TBM A;  3GEC A;  3VOL A;  4PKY G;  1S1Z A;  4EEU A;  3LIC A;  3H82 A;  1XJ6 A;  4HY8 A;  3UB8 A;  2GJ3 A;  4LRY C;  4R6L A;  2L0W A;  4E04 A;  5HDD A;  4R70 A;  2QJ5 A;  3F1O B;  4EQ1 A;  2D02 A;  4WF0 A;  4WN5 A;  4LRZ E;  5KIZ A;  4HP9 A;  1T1A A;  4B9O A;  3LIB A;  3LUQ A;  1T18 A;  5G4Y A;  5F5Y A;  3F1P B;  1TS8 A;  4NXB A;  2V1A A;  1LSX A;  1LT0 A;  5IU1 A;  1OJG A;  2VV6 A;  4NXE A;  4EEP A;  1DRM A;  2INW A;  2R78 A;  3F1N A;  3ZQ5 A;  3E4Q A;  3IS2 A;  3ULF A;  3NHQ A;  3FG8 A;  1S4S A;  5HDC A;  2K7S A;  4HP4 A;  5HZH A;  5F69 A;  3C8C A;  2WKQ A;  4F3L A;  1LL8 A;  3A0S A;  4HJ3 A;  4I5S A;  3EWK A;  3PYP A;  4I3A A;  4L9G A;  5IS1 A;  3NOT C;  4PKY A;  3CLO A;  2CMN A;  4GW9 A;  1UGU A;  2A24 B;  3A0R A;  1LSW A;  3UE6 A;  2WKP A;  4EET B;  2I9V A;  2B02 A;  3ICY A;  2V0U A;  4JGP A;  2H28 A;  1Y28 A;  3FC7 A;  3BY8 A;  2OWH A;  1OT9 A;  3LIA A;  2V0W A;  4HOI A;  1N9L A;  2VV8 A;  2PD8 A;  1UWP X;  2PR5 A;  1MZU A;  4GS9 A;  2VLG A;  3KX0 X;  5F6A A;  5DKL A;  5HD5 A;  2QJ7 A;  1LSV A;  5J3W A;  4HH3 A;  4JGO A;  4JGQ A;  3UME A;  5J4E A;  1F9I A;  4NXF A;  2L1M A;  4LLO B;  3E4P A;  3H7W A;  1EW0 A;  3CAX A;  3K3D A;  4EW7 A;  2V1B A;  2YKH A;  4WUJ A;  2P7J A;  2PR6 A;  1TS6 A;  3MQQ A;  1X0O A;  1GSW A;  5HDS A;  3UB9 A;  1OTA A;  2W27 A;  2L4R A;  1DP6 A;  1NWZ A;  1V9Z A;  1P0Z A;  1JNU A;  4HH2 A;  3K3C A;  3LIE A;  4R3A A;  5AVF A;  2PHY A;  3LID A;  4XT2 B;  1N9O A;  4NXG A;  5DJU A;  5EFW A;  1D06 A;  4H6J B;  4GHI B;  2JHE A;  2ZOH A;  2HV1 A;  3D72 A;  3PHY A;  1S66 L;  5TBM B;  4HJ6 A;  1XJ2 A;  1OT6 A;  4KUO A;  4BBT A;  1OTD A;  3SW1 A;  2D01 A;  5HSQ A;  3IBR A;  3H82 B;  4HJ4 A;  3H7W B;  1S4R A;  3MXQ A;  1P97 A;  3UB7 A;  3NOP C;  2QHK A;  3B33 A;  1S1Y A;  2OOL A;  1XFN A;  1S67 L;  2KDK A;  4GCZ A;  1OTE A;  1OTI A;  3F1P A;  3LI9 A;  2Z6C A;  2M1C A;  3BY9 A;  4DJ2 A;  1XJ3 A;  3H9W A;  2PYR A;  4KQD A;  1VB6 A;  3CWF A;  3UB6 A;  2WKR A; 
#chains in the Genus database with same CATH topology
 1F98 A;  3G4P A;  5GL9 A;  5FDS A;  4ZRR A;  1FCM A;  3QHY A;  3ITB A;  4DN0 A;  2VGL S;  2ZC6 B;  2JC7 A;  4LCL A;  2Z6D A;  2ZBB A;  2W3D A;  1LI9 A;  3ZFZ A;  3NOU C;  2VGJ A;  4K91 A;  1J3W A;  3PAG A;  1K38 A;  3V67 A;  3D3O A;  4ZJ2 A;  4X55 A;  4EQI A;  3A3E A;  3QP6 A;  3RH8 B;  3A3I A;  5CRF A;  2P9V A;  1HD8 A;  2A24 A;  5K5B A;  1TS7 A;  4I3I A;  3BWL A;  4CLC B;  1IFQ A;  2OSU A;  2GDN A;  3MQO A;  2VJW A;  3A0V A;  2XD1 A;  1YLT A;  3P7N A;  1H8M A;  2BAS A;  4GJ4 A;  1GSX A;  4Y0T A;  3UE1 A;  2W0N A;  4OP8 A;  4OKP A;  3IHB A;  1J9M A;  3GSG A;  1T1C A;  4L9F A;  3HJK A;  3QNC A;  2HGV A;  3EGX C;  2EWW A;  1H8Y A;  2PU4 A;  5DJT A;  4UA9 A;  3MMH A;  4B88 A;  4Z1W A;  4EXO A;  4P6Z S;  2JKT I;  4MBH A;  4QHC A;  2UWX A;  4BMW A;  1G6A A;  2FFY A;  3PBO A;  5A8B A;  1OTB A;  2XH9 A;  3G34 A;  2ZQ7 A;  2VEA A;  3T4K A;  3Q7V B;  1BLH A;  5I94 A;  3CPT A;  5GLC A;  3TOI A;  1VEU A;  3Q7Z A;  3GMW A;  1D1J A;  3WS4 A;  1IYS A;  1BUE A;  5AVE A;  2P9V B;  5EVI C;  5CER A;  1NYM A;  4HHD A;  5G4Z A;  3ZGA B;  2HF6 A;  5DFY A;  5CX7 A;  3MR0 A;  2Q9M A;  3GV9 A;  4WLA A;  4WZ4 A;  1KDS A;  3G2Z A;  3UDF A;  1NZO A;  2DMW A;  1MBL A;  4GHI A;  3SS3 A;  5AQB A;  3C4P A;  4BBV A;  2QPN A;  5TBM A;  1NXY A;  4DE2 A;  4RA7 A;  2EX8 A;  4AFI A;  4LRY C;  3HLB A;  5FQQ A;  4WYY A;  1ZC2 A;  2L0W A;  4K0W A;  4E04 A;  4R70 A;  2QJ5 A;  1CQA A;  4EQ1 A;  3EQV A;  1FIL A;  5EVL A;  4B9O A;  3CPT B;  3LUQ A;  4BJP A;  5F1F A;  1K55 A;  3BFG A;  3G32 A;  5G4Y A;  1TS8 A;  1DJC A;  1VEU B;  3SS5 A;  1YSP A;  2JKR M;  1O7E A;  5FAO A;  3HVF A;  5IHV A;  3PTE A;  1FCO A;  2HDR A;  4D60 A;  1EWZ A;  1IEL A;  2XQZ A;  2J7V A;  2HJE A;  1MWR A;  1OJG A;  2WKI A;  4BD1 A;  2O0Y A;  4BLM A;  3PAE A;  1HLU P;  4EV4 A;  1H0M A;  5CHU A;  4R1G A;  5MC7 A;  3IXH A;  4Y2F A;  5A93 A;  4DE0 A;  2XDM A;  4HP4 A;  1CEG A;  3Q81 A;  4P6B A;  2PBY A;  1W63 Q;  5CED A;  3SH7 A;  3UNW A;  3VP3 A;  3D9Y A;  3EWK A;  5DFX A;  2J8Y A;  2JCH A;  3CHW P;  4JPM A;  1MWT A;  2CMN A;  4GW9 A;  2AVX A;  3A0R A;  4EBN A;  5LBR A;  2WKP A;  4GD6 A;  3DWK A;  2RL3 A;  3MKF A;  4BEN A;  4PM8 A;  3M6B A;  4EBP A;  3WRT A;  4HOI A;  3B47 A;  2XA7 S;  3KX0 X;  5DKL A;  1K56 A;  2QJ7 A;  1F5M A;  5J3W A;  4HH3 A;  4Y13 A;  3V3R A;  3R4K A;  4WZ5 A;  3H7W A;  4KZ3 A;  2Y59 A;  3U4L P;  1MY8 A;  3K3D A;  4EW7 A;  1IKG A;  3CIT A;  5FAS A;  2V1B A;  2Z2L B;  2K2N A;  4FSF A;  4EU0 A;  2YKH A;  4R3J A;  4WUJ A;  2P7J A;  4X53 A;  3PBT A;  3NCK A;  4P85 A;  3A3D A;  3T1Q B;  5FL3 A;  2GNX A;  1ALQ A;  4QU3 A;  3T4J A;  4GNU A;  3OBF A;  2Y2P A;  4QWO A;  1K55 C;  2OAP 1;  5HDS A;  3FPW A;  1OTA A;  3BLM A;  5FA7 A;  5FAP A;  1NWZ A;  3ZG0 A;  3QP8 A;  3K3C A;  2WKH A;  1DY6 A;  5AVF A;  2XRO A;  3FKV A;  1HZO A;  2ZL1 B;  4XT2 B;  4KQQ A;  2EWV A;  4Y15 A;  3C7U A;  4IBR A;  3WS5 A;  1YM1 A;  3ITA A;  2ZOH A;  2Q0O A;  4ZDX A;  1NLZ A;  2HV1 A;  3RXX A;  2J9P A;  3FPV A;  2HP9 A;  1NLY A;  4E6W A;  4HJ6 A;  1FOF A;  1XJ2 A;  3S7P A;  1OT6 A;  4KUO A;  1YLY A;  5KSH A;  3IBR A;  2ZM2 A;  4S2N A;  4HJ4 A;  3L7H A;  3H7W B;  3AGE A;  4K0X A;  5TR7 A;  2QHK A;  3B33 A;  1S1Y A;  2OOL A;  5AJG A;  4D2O A;  1CF0 A;  2KDK A;  3MZE A;  3G2Y A;  4WM9 A;  4IUK A;  3ZNY A;  4JXG A;  1FR6 A;  4JF4 A;  3F1P A;  3PBS A;  1PZP A;  3C5A A;  3O87 A;  2K31 A;  3BY9 A;  3OOV A;  1SCW A;  2B5R A;  3BEC A;  3S7O A;  4RX3 A;  2WGW A;  1RCJ A;  3M6H A;  1W8Q A;  3IX8 A;  3IHA A;  2PYR A;  2ZM8 A;  4OQH A;  2DNS A;  1NZU A;  3F1N B;  2V2F F;  2XR0 A;  4CPK A;  4GDB A;  5HPF A;  2A2L A;  2JN7 A;  2JBF A;  1WYC A;  2Y2N A;  2ZOI A;  3N4I A;  5L10 A;  4JXV A;  2HDQ A;  3LYX A;  5L2F A;  4OQI A;  3VE4 A;  4IUH A;  4OOL A;  4OOM A;  4BBU A;  3ISG A;  4NEE D;  3BLS A;  4LV1 A;  1STZ A;  4OQG A;  1LLB A;  3FV7 A;  1PIO A;  1YMX A;  5DF8 A;  1WA9 A;  2V9A A;  5FQK A;  1Y4O A;  3SH9 A;  1LL5 A;  2VX8 A;  1K0K A;  5GHZ A;  3E0Y A;  4E3J A;  3WS2 A;  3ZYT A;  2Y2H A;  3JPU A;  2PD7 A;  1QMF A;  4NET A;  1BUL A;  4LRX C;  1SKF A;  2EA9 A;  5GLB A;  5M18 A;  3NIA A;  4KZ8 A;  4EER A;  2WGW B;  4EES A;  5D3O A;  2HJ9 C;  3DBA A;  4MN7 A;  3IF6 B;  4GS9 B;  1FCN A;  3NUL A;  1Q2P A;  1XJ4 A;  4WMC D;  4EUV A;  4IED A;  3S22 A;  1ONH A;  1G5U A;  4ARZ B;  5BOH A;  2ZQD A;  2IA2 A;  2J3T D;  2Y91 A;  5HL1 A;  3E2K A;  3IWQ A;  3VP4 A;  2G2W A;  4YIN A;  3RFB A;  5EVI A;  4WEK A;  1D7E A;  3VSK A;  3RTY A;  3IXD A;  5I5L A;  3ZCZ A;  2X01 A;  5FAT A;  5L09 A;  1VET A;  2HZ5 A;  2XSS A;  5EVI D;  1BSG A;  1ODV A;  3CJM A;  1IYP A;  5L07 A;  2JKG A;  2EX9 A;  5FQ9 A;  2HPB A;  5HFO A;  3C2W A;  3OCN A;  4RQ9 A;  2Y2M A;  3GVB A;  1W8Y A;  3BEB A;  3ZHH A;  5AQ9 A;  4FH4 A;  3NJA A;  4L9E A;  4LPZ A;  1SKO B;  2Q9N A;  4MBF A;  4S2L A;  2Y55 A;  3T4Q A;  2OV5 A;  1KVL A;  4Q0I A;  3VSL A;  4IHQ A;  3UPN A;  2V20 A;  5EUA A;  3G35 A;  3E2L A;  3GEC A;  4OOY A;  3LIC A;  3T4L A;  1XJ6 A;  4HY8 A;  3UDI A;  3N8R A;  2XF3 A;  4HBT A;  3FKW A;  1SHV A;  4YOF A;  3GR2 A;  4R6L A;  5F1G A;  3QP1 A;  5CGX A;  4E3M A;  4JLF A;  4WF0 A;  1XKZ A;  1PWG A;  5FI2 A;  1VQQ A;  4DXC A;  3NDE A;  3S4X A;  3LIB A;  3MF0 A;  1T18 A;  3S1Y A;  4E3K A;  4NXB A;  2Y2O A;  2I72 A;  2IWB A;  2V1A A;  4ZJ1 A;  5TJJ A;  4NKP A;  1LT0 A;  4R3B A;  5IU1 A;  2VV6 A;  3LR0 A;  1MPL A;  2R78 A;  1K54 C;  3OC2 A;  4KEN B;  3ZQ5 A;  3HRE A;  3IS2 A;  3NHQ A;  3FG8 A;  1PW1 A;  4UQI M;  5HDC A;  2P08 A;  1ESI A;  1OPX A;  2XEP A;  4F3L A;  1LL8 A;  3A0S A;  2J3T C;  3UE0 A;  4I5S A;  4G3W A;  5C5K A;  4II7 A;  1PWD A;  5AQ7 A;  3NI9 A;  1PZO A;  1I2W A;  5IS1 A;  2W3F A;  2A49 A;  4KG2 A;  3IH9 A;  4FOF A;  4C6Y A;  4LGW A;  2M7U A;  4B93 A;  2HP5 A;  4GD8 A;  3CLO A;  4S2P A;  1UGU A;  2A24 B;  1LSW A;  1PWC A;  3AGD A;  1TVF A;  4BL2 A;  3O86 A;  5DTK A;  2PU2 A;  4XUX A;  1JWV A;  4JBF A;  4LFU A;  4Y3I A;  2J9O A;  2V0U A;  2XD5 A;  3BRM A;  3D4F A;  4JGP A;  3IQA A;  3HLG A;  2DRW A;  4NG2 A;  3PXP A;  4ZJ3 A;  2XLN A;  2Y2Q A;  2PR5 A;  4B4X A;  4KZ9 A;  1I5Q A;  4JGQ A;  4MDZ A;  1P9W A;  3Q1F A;  3CAX A;  1PW8 A;  1U60 A;  4R0Q A;  4ZBE A;  1XA7 A;  2ZMF A;  4N1H A;  3CG5 A;  4BD0 A;  1FR1 A;  1TEM A;  2JKT M;  2ZC5 B;  2DCF A;  3KSG A;  3W2Z A;  5CHM A;  5GHY A;  1IEM A;  2XK1 A;  1IKI A;  1RGY A;  3OZH A;  2CC1 A;  2P04 A;  3OPP A;  3HBR A;  1FSW A;  4X1L A;  2XFT A;  5AQA A;  2W3H A;  5EV0 A;  4RVA A;  1V9Z A;  3HLF A;  1P0Z A;  3M2K A;  4HH2 A;  3UPP A;  2PHY A;  4WEL A;  2W1R A;  3S7N A;  1TDL A;  4WBG A;  1S0W A;  4QB8 A;  3DWZ A;  5HL6 A;  4QY5 A;  1D06 A;  2IWD A;  4GHI B;  2JHE A;  5DVA A;  3D72 A;  3PHY A;  3FWL A;  2ZQA A;  5DF7 A;  5TBM B;  5F83 A;  3CZD A;  3SW1 A;  4NK3 A;  5EE8 A;  3NY4 A;  4C3Q A;  3TG9 A;  1L0G A;  1VM1 A;  1YKD A;  4BL3 A;  4OLG A;  4O01 A;  1XFN A;  1YSQ A;  3E98 A;  2ZC7 A;  1JWP A;  3NEC A;  5E2E A;  3M2J A;  1IYQ A;  3LO7 A;  3LY4 A;  4X68 A;  1OTI A;  3VOY A;  3UN7 A;  2FZ0 A;  2VZW A;  4QD4 A;  2OLV A;  2RCX A;  3P09 A;  4KZ4 A;  3CUE C;  3G31 A;  2JKF A;  4DJ2 A;  1IYO A;  1XJ3 A;  3LGO A;  3LCE A;  1CJF A;  4B4Z A;  4CJN A;  5FI6 A;  3PBQ A;  3NBL A;  3CWF A;  1K6S A;  2WKR A;  4WL9 A;  4OH0 A;  4X69 A;  4YWZ A;  1YQS A;  3T1R A;  3LIF A;  2W1T A;  1CEF A;  2EXA A;  2J3W A;  4HI4 A;  1L0E A;  2WGI A;  2G2U A;  3GDI A;  3JYI A;  5HWV A;  3QP5 A;  4L0L A;  3OPH A;  4I38 A;  3AGF A;  2W3G A;  3NDG A;  2G7U A;  2PBD P;  1YLW A;  2Y8H A;  2JE5 A;  2NUT C;  4HIA A;  3SS4 A;  2B95 A;  1G28 A;  1S6R A;  4R23 A;  5KSC A;  1HTZ A;  1FSY A;  1XGI A;  4XXR A;  3O3V A;  1ACF A;  2QKP A;  2YKF A;  3MKE A;  4UHU A;  4ID4 A;  1GSV A;  4HEF A;  2QMI A;  4DJ3 A;  4N92 A;  3UMD A;  2EX6 A;  1K4F A;  3EEA A;  3BYD A;  3IT9 A;  1ES5 A;  3MS6 A;  3LI8 A;  3LR5 A;  4X6T A;  3IH8 A;  4F94 A;  1GHI A;  1QME A;  1H8Z A;  1V9Y A;  3QP4 A;  3HLW A;  1PFL A;  1Z6F A;  3N8S A;  4FD8 A;  3C4O A;  1ZHH B;  3W8K A;  5F82 A;  2X02 A;  3BFE A;  4E3O A;  5FEF A;  1SZV A;  1DP9 A;  1H3Q A;  3BFD A;  1JVJ A;  2V8F A;  1BLP A;  4YFM A;  3MXS A;  3VFF A;  4I3J A;  5HW3 A;  3G6O A;  1LL9 A;  5KZH A;  1T19 A;  4ZTK A;  3KSI A;  3N7W A;  4DMZ A;  3EOI A;  5CEB A;  1BYW A;  1PYY A;  5F68 A;  3PBR A;  2MJ6 A;  1TS0 A;  2HDU A;  2H5S A;  5FDH A;  4PHT A;  5HD3 A;  4O8G A;  3BW6 A;  3CMZ A;  1RGZ A;  4ZAM A;  3HLE A;  2E8J A;  3WRZ A;  4DE3 A;  4LV0 A;  1DJB A;  3B42 A;  3R7W A;  1KOU A;  1K57 C;  1BZA A;  5A91 A;  3FYZ A;  2XRN A;  3G30 A;  2PDR A;  4OLD A;  2Y79 A;  4PM7 A;  2LB9 A;  4H6J A;  4LV2 A;  5HWW A;  2PYP A;  3MFX A;  5EEC A;  1XPB A;  4JF6 A;  4UQI S;  3MBZ A;  1ES3 A;  3VOL A;  4MCW A;  1GA9 A;  3H82 A;  2B18 A;  3MSH A;  4RX2 A;  5HAR A;  2BG1 A;  2WK0 A;  3HL9 A;  3JVV A;  2FH5 A;  5HDD A;  2IWC A;  2WYX A;  3C7V A;  5M19 A;  4X25 A;  4WN5 A;  4DRT A;  4LRZ E;  2NUP C;  1T1A A;  1MKM A;  3TRC A;  5FQM A;  3F1P B;  5G18 A;  3CI6 A;  2O9C A;  3HLC A;  4KZA A;  1BLS A;  1XP4 A;  1F2K A;  1AWI A;  3IXG A;  3ZVW A;  1E3U D;  1K54 A;  1E4D A;  4QPR A;  1LSX A;  2ZJ9 A;  4IJG A;  4UAA A;  4EEP A;  4PM6 A;  4WMC A;  1DRM A;  4S2I A;  3HCY A;  4UA6 A;  4N1X A;  5A90 A;  1KE3 A;  3UB5 P;  4OQ0 A;  1M6K A;  4X56 A;  1MC0 A;  4N9K A;  1S4S A;  5EPH A;  2Y2I A;  2GX5 A;  3VP1 A;  1MWS A;  4MEZ A;  2EFX A;  3QP2 A;  1KDW A;  1N4O A;  5F69 A;  3C8C A;  1RP5 A;  4MNR A;  2XFS A;  4HJ3 A;  4N9L A;  3KO6 A;  1ZG4 A;  5CEC A;  3PYP A;  1K6R A;  2EFU A;  4C75 A;  2C5W B;  3I7J A;  1GA0 A;  3T4T A;  3NOT C;  3QNB A;  3W4Q A;  4PKY A;  3T12 B;  4UA7 A;  2QYB A;  2WAF A;  4OPY A;  1Z09 A;  3UE6 A;  2ZLY A;  4EET B;  3UPO A;  5EOO A;  2I9V A;  4KZ7 A;  3ICY A;  4Z9Q A;  1L3L A;  1ERM A;  5GHX A;  3DW0 A;  1Y28 A;  2V1Z A;  3B3X A;  3MFD A;  3FC7 A;  2EX2 A;  4E3L A;  1IOU A;  1N9L A;  3VP0 A;  3UO9 A;  3N6I A;  5FQJ A;  2ZQ9 A;  1W5D A;  4XUZ A;  5EOE A;  2VLG A;  3LY3 A;  5F6A A;  4S2J A;  1LSV A;  4OVD A;  1O07 A;  1F9I A;  4LLO B;  3VOZ A;  3IF6 C;  4MLL A;  1EW0 A;  4DDY A;  1GHM A;  3DTI A;  5U47 A;  5GLA A;  1MWU A;  1WYB A;  1LI0 A;  2O9B A;  1DJA A;  1SDE A;  2A3U A;  4P0M A;  4Y17 A;  3ZG7 B;  2VA0 A;  3Q7V A;  2KOI A;  1Y54 A;  3SOI A;  4Y0U A;  2PR6 A;  2O9A A;  5EVI B;  3PR6 A;  4PM9 A;  1BT5 A;  1PI5 A;  1VET B;  3ZG9 B;  3T1X A;  1GSW A;  5HX9 A;  1L0D A;  3P98 A;  4GB7 A;  2ZM0 A;  3UB9 A;  1SDN A;  5GLD A;  1DP6 A;  2QZ6 A;  1JNU A;  3HUN A;  4KG6 A;  3LIE A;  4R3A A;  1MKI A;  3IXB A;  5J8X A;  5CGS A;  1LHY A;  4GLQ A;  1N9O A;  4NXG A;  2Y2G A;  1CK3 A;  2WZX A;  1K25 A;  4BQM A;  2KLI A;  1S66 L;  2WZZ A;  2BLS A;  1KE4 A;  1XGJ A;  1OTD A;  2R9X A;  3C30 A;  4LV3 A;  3OPL A;  2ZMA A;  4FUW A;  1S4R A;  2Z2M B;  3MXQ A;  4X1M A;  1CI8 A;  3NOP C;  5JYP A;  2FFF B;  2JKR I;  1ZKJ A;  4GDN A;  1KVM A;  1OTE A;  3BQA A;  3MZD A;  3CUE A;  2WAE A;  3RXW A;  4DKI A;  1ZG6 A;  2PRF A;  3LI9 A;  2Z6C A;  1H5X A;  4R4S A;  5A92 A;  4CLC C;  5E2H A;  2WUQ A;  4S2O A;  2ZMV A;  2Y2L A;  4KZ6 A;  3Q07 A;  4E3N A;  3H9W A;  1EI5 A;  1VB6 A;  5KMW A;  3GTC A;  2EXB A;  3UB6 A;  4FTX A;  3T4O A;  3LEZ A;  5DKK A;  1G68 A;  3JVU A;  2WAD A;  2O99 A;  4A5R A;  3LFV A;  3IS2 B;  1XA1 A;  2H0T A;  5EM0 A;  1T1B A;  1KGE A;  4F3L B;  2QWS A;  3FZC A;  1YLZ A;  1XX2 A;  4R38 A;  3UDX A;  4MN6 A;  3DTM A;  3BFC A;  5CHJ A;  2KX6 A;  3T50 A;  2LB5 A;  5FAQ A;  1BTL A;  5J7E A;  5HAP A;  3Q82 A;  3IWO A;  4ME4 A;  2BTF P;  3EEH A;  3PBN A;  1XFQ A;  1PI4 A;  2ZC4 B;  3LR4 A;  3O5Y A;  4PM5 A;  2HP6 A;  1DP8 A;  3TSG A;  1YT4 A;  4UEY A;  1UWN X;  3T4S A;  1KGG A;  4EWF A;  3ZDJ A;  3L9K A;  2J80 A;  1JWZ A;  2PT7 A;  4FCF A;  4Q0J A;  4HES A;  1FIK A;  3BQ8 A;  2ACG A;  3VP2 A;  2VGL M;  4K08 A;  4S2K A;  4JGR A;  3TW8 A;  2OWJ A;  3SH8 A;  4MN5 A;  3HUM A;  1OME A;  4BWI A;  2WKE A;  3P01 A;  4DF6 A;  4DDS A;  1ONG A;  5FI7 A;  4HBU A;  3LR3 A;  5E2F A;  3DAV A;  3E4O A;  3F1O A;  4Y7P A;  4O7D A;  5EM1 A;  5HWT A;  1A0K A;  4OON A;  3IWI A;  4HNB A;  5HAQ A;  1OJ5 A;  2Y2K A;  1NJ4 A;  2ZC3 B;  2VGK A;  4S2M A;  5HAI A;  2WGV A;  1N9N A;  1YAX A;  4QJG A;  5M1A A;  4KUK A;  4M4X A;  3VE3 A;  1K57 A;  4I39 A;  1Q2Q A;  3V5M A;  1JTD A;  3N8L A;  2OLU A;  1NRJ A;  3RJU A;  2ZL1 A;  4XT2 A;  4HQA A;  4IBX A;  3HJI A;  3MQ0 A;  2Y2J A;  1VHM A;  3OLO A;  4GKU A;  2VV7 A;  2X71 A;  2E8I A;  1I2S A;  4JXW A;  3VMA A;  4E6X A;  1ZTU A;  3MJQ A;  3GQZ A;  3WWX A;  4P6Z M;  1NRF A;  1S1Z A;  4PKY G;  4EEU A;  4MBK A;  4O0P A;  3V50 A;  4GZB A;  4U0X A;  1ESU A;  5IT5 A;  3ZG8 B;  1K56 D;  3UB8 A;  2GJ3 A;  3KYE A;  4OPZ A;  1NY0 A;  3OPR A;  3EGD C;  4FH2 A;  4U3T A;  4Y5F A;  3F1O B;  4QY6 A;  2D02 A;  4RYE A;  5FEG A;  1CI9 A;  1ERQ A;  4OPR A;  1L0F A;  5KIZ A;  4JXS A;  4HP9 A;  3K2N A;  4P87 A;  3V3S A;  5FSR A;  5F5Y A;  3IF5 A;  3WS1 A;  3IBJ A;  1MXO A;  1W7F A;  4U0T A;  1JTG A;  4ESP A;  3VV4 A;  4NXE A;  4IVI A;  2INW A;  3F1N A;  3A3J A;  2H10 A;  3E4Q A;  3OCL A;  3HLD A;  1TF1 A;  3ULF A;  3UE3 A;  4G3V A;  2W1T B;  1ES4 A;  2K7S A;  1YMS A;  3IX3 A;  4YNR A;  5HZH A;  3BM6 A;  4PPR A;  4KQO A;  2WKQ A;  2ZQ8 A;  2XGN A;  1AXB A;  3TE8 A;  4OP5 A;  3ZVT A;  3LEQ A;  1XXM A;  1M40 A;  4I3A A;  4L9G A;  2ZQC A;  2ZD8 A;  4DXB A;  4PMA A;  1TDG A;  2R9W A;  4GN2 A;  4CQH A;  4JF5 A;  5CGW A;  4G3K A;  5L8M A;  3V39 A;  4DE1 A;  5FQI A;  5E43 A;  1WE4 A;  1K4E A;  2B02 A;  5TFQ A;  3DTE A;  1YLJ A;  2UV0 E;  2H28 A;  3TJZ C;  3BY8 A;  2OWH A;  3MXR A;  1OT9 A;  3LIA A;  5E2G A;  2V0W A;  4ETZ A;  1L2S A;  2VV8 A;  1N9B A;  5HPI A;  3KYQ A;  2PD8 A;  1UWP X;  1GCE A;  1MZU A;  3IF6 A;  2HDS A;  4GS9 A;  5HD5 A;  4KZ5 A;  4KZB A;  4JGO A;  3UME A;  5J4E A;  3C38 A;  4NXF A;  2L1M A;  5DF9 A;  1TD5 A;  3W4O A;  3E4P A;  4ARZ A;  1NYY A;  2C6W B;  4E3I A;  1ES2 A;  2M7V A;  4M3K A;  4WZ5 C;  1E25 A;  3WS0 A;  3DTK A;  3UY6 A;  1HVB A;  1P9R A;  5TGF A;  3IX4 A;  1KGF A;  3O88 A;  2GZA A;  4EBL A;  3KSF A;  4KG5 A;  1TS6 A;  5CTN A;  4Q8I A;  1G6O A;  1PNE A;  4ETX A;  1W63 M;  3MQQ A;  1E3U A;  1FQG A;  1X0O A;  2W3E A;  4CLC E;  2W27 A;  2L4R A;  3KSH A;  4KQR A;  2V8C A;  3R7W B;  4H8R A;  4PAU A;  3BFF A;  3VFH A;  3NC8 A;  3LID A;  3S7Q A;  1SKO A;  3U2A A;  4LCM A;  2XA7 M;  5DJU A;  3EQU A;  3HUO A;  5EFW A;  4H6J B;  4R4R A;  5DTT A;  3GRJ A;  2H0Y A;  4Q0H A;  4BBT A;  2VKS A;  1YPR A;  2D01 A;  5HSQ A;  2P74 A;  3H82 B;  5CTM A;  2OAQ 1;  1YLP A;  1P97 A;  3UB7 A;  4Y0O A;  4S2N C;  4EUZ A;  4LEN A;  5EVE A;  1S67 L;  3W4P A;  3ZNT A;  3T1S A;  2Y4A A;  3SZT A;  1BLC A;  4WEJ A;  4CLC A;  4GCZ A;  1W79 A;  4JKT A;  4IVK A;  1PRQ A;  3A3F A;  4GOG A;  1C3B A;  5JYO A;  3KYZ A;  4CLC D;  2M1C A;  1GHP A;  4OPQ A;  3ZG5 A;  1ERO A;  3MZF A;  2VK3 A;  2PAV P;  4KQD A;  3BJN A;  5DTS A;  1KE0 A;  4MMN A;  5CXW A; 
#chains in the Genus database with same CATH homology
 1F98 A;  4WL9 A;  5DKK A;  3F1N B;  3JVU A;  4YWZ A;  4ZRR A;  2O99 A;  3LFV A;  3LIF A;  5HPF A;  3IS2 B;  2A2L A;  4DN0 A;  2JN7 A;  2W1T A;  2VGL S;  2ZOI A;  2J3W A;  4HI4 A;  1T1B A;  2Z6D A;  2ZBB A;  3LYX A;  2W3D A;  3GDI A;  3VE4 A;  3NOU C;  4IUH A;  4OOL A;  4F3L B;  5HWV A;  2QWS A;  4L0L A;  4OOM A;  4R38 A;  3V67 A;  4I38 A;  3D3O A;  4BBU A;  4NEE D;  4MN6 A;  2W3G A;  1STZ A;  2G7U A;  2Y8H A;  2NUT C;  4HIA A;  3RH8 B;  1G28 A;  2KX6 A;  3T50 A;  1WA9 A;  2V9A A;  2LB5 A;  5J7E A;  2A24 A;  5K5B A;  2VX8 A;  1TS7 A;  2QKP A;  2YKF A;  4ME4 A;  3E0Y A;  3BWL A;  4I3I A;  3EEH A;  3PBN A;  1XFQ A;  3ZYT A;  4CLC B;  1IFQ A;  1GSV A;  3LR4 A;  3O5Y A;  4DJ3 A;  3MQO A;  2VJW A;  1DP8 A;  2PD7 A;  4UEY A;  1UWN X;  3T4S A;  3UMD A;  3A0V A;  4LRX C;  3P7N A;  3EEA A;  2EA9 A;  1H8M A;  2BAS A;  4GJ4 A;  4EER A;  1GSX A;  3LI8 A;  3LR5 A;  4EES A;  1V9Y A;  2J80 A;  2W0N A;  2PT7 A;  4Q0J A;  3BQ8 A;  2HJ9 C;  3DBA A;  4MN7 A;  2VGL M;  1T1C A;  4L9F A;  3HJK A;  4K08 A;  1ZHH B;  4GS9 B;  2HGV A;  3EGX C;  1DP9 A;  1XJ4 A;  2EWW A;  4JGR A;  4EUV A;  3TW8 A;  1H3Q A;  2OWJ A;  4MN5 A;  5DJT A;  3MMH A;  4BWI A;  3P01 A;  4Z1W A;  4EXO A;  3T4O A;  4P6Z S;  2JKT I;  4ARZ B;  2IA2 A;  3LR3 A;  4BMW A;  2J3T D;  4I3J A;  3PBO A;  5A8B A;  3E4O A;  3F1O A;  1OTB A;  5HWT A;  3G6O A;  2VEA A;  1T19 A;  3T4K A;  3KSI A;  4HNB A;  3RFB A;  4DMZ A;  3EOI A;  4WEK A;  1D7E A;  1BYW A;  1OJ5 A;  5F68 A;  3RTY A;  3PBR A;  5I5L A;  2MJ6 A;  1TS0 A;  2XSS A;  4PHT A;  1N9N A;  5HD3 A;  1YAX A;  4O8G A;  5AVE A;  3BW6 A;  4KUK A;  4M4X A;  3VE3 A;  1ODV A;  4HHD A;  5G4Z A;  4I39 A;  2HF6 A;  3B42 A;  5DFY A;  3R7W A;  5CX7 A;  3MR0 A;  3C2W A;  1KOU A;  1NRJ A;  3OCN A;  4RQ9 A;  4WLA A;  2XRN A;  4XT2 A;  2PDR A;  4HQA A;  3NJA A;  4L9E A;  4LPZ A;  2Y79 A;  3HJI A;  2DMW A;  3MQ0 A;  2LB9 A;  1VHM A;  4H6J A;  4GHI A;  5HWW A;  3OLO A;  2PYP A;  3T4Q A;  3MFX A;  2VV7 A;  4Q0I A;  4IHQ A;  4BBV A;  1ZTU A;  4UQI S;  3MJQ A;  5TBM A;  3GEC A;  3VOL A;  4P6Z M;  4PKY G;  1S1Z A;  4EEU A;  3LIC A;  4MCW A;  4O0P A;  3H82 A;  2B18 A;  3T4L A;  1XJ6 A;  4HY8 A;  5IT5 A;  4AFI A;  3UB8 A;  2GJ3 A;  4LRY C;  4YOF A;  4R6L A;  3JVV A;  2FH5 A;  2L0W A;  3EGD C;  5HDD A;  4E04 A;  4R70 A;  4Y5F A;  2QJ5 A;  3F1O B;  4EQ1 A;  2D02 A;  4WF0 A;  3EQV A;  4WN5 A;  4LRZ E;  2NUP C;  5KIZ A;  4HP9 A;  1T1A A;  3K2N A;  1MKM A;  3TRC A;  4B9O A;  3LIB A;  3LUQ A;  4BJP A;  3MF0 A;  1T18 A;  5G4Y A;  5F5Y A;  3F1P B;  1TS8 A;  3CI6 A;  2O9C A;  4NXB A;  1YSP A;  3IBJ A;  2JKR M;  2V1A A;  5TJJ A;  3VV4 A;  4QPR A;  1LSX A;  4NKP A;  1LT0 A;  2HJE A;  5IU1 A;  1OJG A;  2VV6 A;  3LR0 A;  4IJG A;  4NXE A;  4EEP A;  1DRM A;  2INW A;  2R78 A;  3HCY A;  2O0Y A;  3F1N A;  3OC2 A;  3OCL A;  3E4Q A;  3ZQ5 A;  3IS2 A;  1TF1 A;  3ULF A;  3UE3 A;  3NHQ A;  1MC0 A;  3FG8 A;  1S4S A;  4G3V A;  2W1T B;  5MC7 A;  2GX5 A;  4UQI M;  4Y2F A;  5HDC A;  2K7S A;  2P08 A;  4YNR A;  4HP4 A;  5HZH A;  1OPX A;  4KQO A;  3C8C A;  2WKQ A;  5F69 A;  1LL8 A;  1W63 Q;  2J3T C;  3A0S A;  4F3L A;  4HJ3 A;  4I5S A;  4G3W A;  5C5K A;  3TE8 A;  4II7 A;  3EWK A;  5DFX A;  3KO6 A;  3PYP A;  4I3A A;  4L9G A;  5IS1 A;  2W3F A;  4FOF A;  3T4T A;  3NOT C;  2M7U A;  4B93 A;  4PKY A;  3CLO A;  2CMN A;  4GW9 A;  4CQH A;  1UGU A;  2A24 B;  3A0R A;  4G3K A;  2QYB A;  5L8M A;  5LBR A;  1LSW A;  3UE6 A;  2WKP A;  4EET B;  2I9V A;  2B02 A;  3ICY A;  4Y3I A;  2V0U A;  4JGP A;  2H28 A;  1Y28 A;  3TJZ C;  3FC7 A;  3BY8 A;  2OWH A;  1OT9 A;  3LIA A;  2V0W A;  4ETZ A;  4HOI A;  3PXP A;  3B47 A;  1IOU A;  1N9L A;  2VV8 A;  5HPI A;  3KYQ A;  2XA7 S;  2PD8 A;  1UWP X;  2PR5 A;  1MZU A;  4GS9 A;  2VLG A;  3KX0 X;  5F6A A;  5DKL A;  5HD5 A;  2QJ7 A;  1F5M A;  1LSV A;  5J3W A;  4HH3 A;  4JGO A;  4JGQ A;  3UME A;  5J4E A;  3R4K A;  3C38 A;  1F9I A;  4NXF A;  2L1M A;  5DF9 A;  1TD5 A;  4LLO B;  4MDZ A;  1P9W A;  3E4P A;  3H7W A;  1EW0 A;  4ARZ A;  3CAX A;  3K3D A;  4EW7 A;  3CIT A;  2V1B A;  2K2N A;  2M7V A;  4FSF A;  4EU0 A;  2O9B A;  2ZMF A;  2YKH A;  4WUJ A;  2VA0 A;  2P7J A;  1P9R A;  2JKT M;  3KSG A;  2KOI A;  3PBT A;  3W2Z A;  2PR6 A;  2GZA A;  2O9A A;  3KSF A;  1TS6 A;  3PR6 A;  5FL3 A;  1G6O A;  2GNX A;  4ETX A;  1W63 M;  3MQQ A;  3T4J A;  3OBF A;  2P04 A;  1X0O A;  1GSW A;  2OAP 1;  2W3E A;  5HDS A;  3FPW A;  3UB9 A;  4CLC E;  1OTA A;  2W27 A;  2W3H A;  2L4R A;  3KSH A;  1DP6 A;  3R7W B;  1NWZ A;  1V9Z A;  1P0Z A;  4PAU A;  1JNU A;  4HH2 A;  3K3C A;  3LIE A;  4R3A A;  5AVF A;  2XRO A;  2PHY A;  4WEL A;  3LID A;  2W1R A;  4XT2 B;  3S7N A;  3S7Q A;  4GLQ A;  2EWV A;  3U2A A;  1N9O A;  4NXG A;  2XA7 M;  5DJU A;  3EQU A;  5HL6 A;  5EFW A;  1D06 A;  4H6J B;  4GHI B;  2JHE A;  2ZOH A;  1NLZ A;  2HV1 A;  3D72 A;  3PHY A;  2KLI A;  3FPV A;  1S66 L;  4Q0H A;  1NLY A;  5TBM B;  4HJ6 A;  1XJ2 A;  3S7P A;  1OT6 A;  4KUO A;  4BBT A;  2VKS A;  1OTD A;  3C30 A;  3SW1 A;  5KSH A;  2D01 A;  5HSQ A;  3IBR A;  3H82 B;  4HJ4 A;  3H7W B;  2OAQ 1;  1S4R A;  3MXQ A;  1P97 A;  3UB7 A;  3NOP C;  2QHK A;  3B33 A;  1YKD A;  1S1Y A;  2OOL A;  5AJG A;  4O01 A;  1XFN A;  1S67 L;  1YSQ A;  3E98 A;  2JKR I;  2KDK A;  4WEJ A;  4CLC A;  4GCZ A;  4IUK A;  1OTE A;  3BQA A;  3CUE A;  1OTI A;  3KYZ A;  3F1P A;  3LI9 A;  3PBS A;  2FZ0 A;  2VZW A;  2Z6C A;  4CLC D;  2K31 A;  2M1C A;  3BY9 A;  3OOV A;  4CLC C;  3CUE C;  4DJ2 A;  3S7O A;  1XJ3 A;  2ZMV A;  3PBQ A;  3H9W A;  2PYR A;  3BJN A;  4KQD A;  1VB6 A;  3CWF A;  4MMN A;  3UB6 A;  2WKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...