2KLIA

Structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
molecule keywords Sensor protein
total genus 33
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kliA00
3KO6A 2XSSA 4E04A 2O9AA 4MDZA 3KSFA 2KLIA 3ZQ5A 3K2NA 4Z1WA 3MMHA 2M7VA 4CQHA 4G3VA 2W3GA 4LRZE 2W1TB 2W1TA 2Y79A 2K31A 4YOFA 3DBAA 1MKMA 4IUKA 3S7OA 2OOLA 3R4KA 4PAUA 4O01A 4IUHA 3TRCA 2VJWA 4Y3IA 2O9BA 5LBRA 2LB9A 3IBJA 2O99A 4LRXC 5I5LA 4G3WA 5L8MA 3CI6A 2W1RA 2XRNA 4Y2FA 3LFVA 4IJGA 2IA2A 2O9CA 1STZA 4RQ9A 4MMNA 2B18A 3E0YA 4Q0IA 4Y5FA 4YNRA 3KSHA 5HSQA 5HPFA 3OOVA 4LRYC 4DN0A 4O0PA 3RFBA 2XROA 4ME4A 3EEAA 2QYBA 4ETZA 1VHMA 4G3KA 1YSQA 4Q0HA 5TJJA 3S7QA 3MF0A 4QPRA 3O5YA 5C5KA 4BWIA 4EUVA 4ZRRA 1TD5A 4GLQA 4GW9A 4EU0A 3S7NA 1MC0A 2W3EA 3E98A 5AJGA 2K2NA 2LB5A 2VEAA 2M7UA 3S7PA 2GX5A 1TF1A 5DFXA 4R70A 2ZMFA 1YSPA 4ETXA 5HPIA 3C2WA 3KSIA 3G6OA 4FOFA 2HGVA 3D3OA 4Q0JA 3BJNA 2VKSA 1F5MA 3KSGA 3CITA 5K5BA 3NOUC 3HCYA 4DMZA 4O8GA 2O0YA 2Y8HA 4R6LA 3VV4A 2VZWA 3MQ0A 5HL6A 2W3DA 5DFYA 1YKDA 2KOIA 3NOPC 1ZTUA 3NHQA 4MN7A 3W2ZA 3IBRA 3NOTC 4MCWA 3OBFA 2G7UA 2W3FA 2W3HA
chains in the Genus database with same CATH superfamily
4OP5A 4MDZA 4BL2A 1TDLA 2XR0A 2M7VA 1NZUA 3LIBA 3V67A 5FL3A 2FFFB 3KYEA 2RL3A 2Y4AA 4QB8A 1H3QA 1W5DA 5DTTA 2WKRA 5F68A 2IWBA 4PKYG 5E2GA 5EECA 2O99A 3JYIA 4PMAA 1PW8A 2Y59A 3T4KA 1K4EA 2PRFA 2ZQ9A 4IJGA 4DRTA 3HJKA 2XF3A 1E3UD 3P09A 3IH9A 4MEZA 2ZC4B 2OWHA 3E0YA 4Q0IA 1BLHA 3IF5A 4OP8A 5F1GA 5TBMB 5FQ9A 2Y2NA 5TJJA 3DWKA 4GLQA 2H10A 3SH9A 5KSCA 3G2ZA 4OPZA 1GHPA 1W8YA 5M18A 5AQ7A 2BG1A 5KSHA 3UB7A 2NUPC 2J80A 1BLCA 4LCLA 1YPRA 4YINA 1EWZA 3LYXA 4BLMA 4HH3A 5GLAA 1P97A 1WYCA 1J9MA 5EVIA 3ZG5A 3NOPC 4Y15A 3CHWP 3EGXC 3UE3A 1T1CA 2ZM8A 4X53A 1ZHHB 4FTXA 4LFUA 2INWA 3VE4A 2QJ5A 1PW1A 5DTSA 3LUQA 3MMHA 2PBDP 3BFDA 3TW8A 3T4JA 2EFXA 2W3GA 1IFQA 4ZJ3A 1T1AA 2Y2GA 4EQIA 1MXOA 4DXBA 1RP5A 2V1AA 5TGFA 1KGFA 1TS7A 4O01A 4S2NA 2ZM2A 2XEPA 1P0ZA 4K08A 3FPVA 3SS5A 4EEUA 4LV2A 4Y2FA 1N9BA 4BENA 4YWZA 2B18A 4YNRA 2K7SA 1S4RA 2E8JA 5AVFA 3B47A 3GQZA 4AFIA 5CX7A 1ERMA 1FQGA 4ETZA 3G31A 1NRFA 5KZHA 2Z2LB 3MZEA 3GDIA 1NJ4A 2ZQDA 3HLWA 4QJGA 4RX3A 3LCEA 1TEMA 3BWLA 4LCMA 1SDNA 3CUEC 3MXQA 1Y28A 1F9IA 4HJ6A 3A0RA 3D4FA 2XQZA 4Y13A 2ZL1A 4DDSA 1DP6A 4WYYA 1N9NA 1FOFA 5HL6A 1YLTA 1L0EA 1KE0A 3A3EA 4CLCE 3NOTC 3B33A 1X0OA 3WS5A 4WELA 4Z1WA 4KQRA 3T4TA 1J3WA 4LRZE 3D72A 3Q81A 1W79A 3IWOA 3P01A 2HDQA 3N8LA 5EVEA 3UB6A 4Y3IA 3LICA 1KE3A 3IBJA 2HF6A 1XXMA 3VFHA 2VK3A 3PYPA 1BT5A 4RQ9A 2ZLYA 1G6OA 4HOIA 2G2WA 5CEBA 4U0XA 4HBTA 5EOOA 1H8MA 1LSVA 1OTBA 3S7QA 4RX2A 2C6WB 4GHIB 4WM9A 1RCJA 4NXEA 1QMFA 4BD0A 1K56A 3G30A 5HPIA 1LI0A 4QD4A 1K55C 5DKLA 4DE0A 4B4ZA 5EV0A 4R3JA 1K25A 1T18A 1CEGA 3IWQA 4M3KA 3OPLA 4GN2A 2PR5A 1CI9A 2YKFA 3QP1A 5DF9A 3QHYA 4PM5A 3ULFA 1KOUA 3BFCA 1G68A 3NHQA 3IHAA 4S2LA 3OBFA 2WK0A 2W3FA 4S2KA 4U0TA 2VV7A 5DKKA 3I7JA 3OC2A 4BQMA 1GHIA 2D01A 3GRJA 3IXBA 5HWWA 5L10A 1C3BA 1M6KA 3UO9A 4KQDA 3FC7A 4PAUA 4BJPA 1PRQA 1O07A 1NZOA 2V9AA 2VJWA 3RXXA 1K55A 3R7WB 1W63M 2C5WB 2DNSA 2WZZA 3LFVA 1D06A 2J9PA 5GL9A 1EW0A 3ZVWA 4LRYC 1NYYA 3UPNA 3M6BA 3RFBA 4DE1A 1IOUA 1HVBA 1VHMA 5DVAA 2XD1A 1XJ6A 4JPMA 1TS8A 4IEDA 1BTLA 1IKIA 5GHXA 3ZG0A 3HBRA 3DTMA 4WZ4A 3BRMA 4I38A 1OTEA 3G35A 3PBRA 3PXPA 4HI4A 4S2PA 5IS1A 3JVVA 1SDEA 3IS2B 1YSPA 3IXHA 1H8YA 2BTFP 4OQIA 2D02A 4JXSA 2ZL1B 1K54C 1AWIA 5FEGA 1NWZA 4DMZA 2O0YA 4OOLA 4GB7A 3OLOA 3G34A 4P87A 5F1FA 5CGXA 1YLWA 3T1QB 4KZ7A 1L0GA 3JVUA 2PYRA 3V39A 2G7UA 5A8BA 2UWXA 4R23A 5FAQA 3U2AA 3ITBA 2EXAA 4L9GA 3MJQA 5FAOA 1DP8A 2EWWA 3EQUA 1ZC2A 3BQAA 2VGKA 2Z6CA 3QP6A 2W1TB 4KUOA 3TOIA 2ZJ9A 4NG2A 2X02A 1MKMA 4Z9QA 1SZVA 1Y54A 4LENA 4IVIA 3BFEA 1GHMA 3M6HA 3L9KA 2V8CA 3CJMA 1W8QA 4NEED 4JLFA 5J7EA 3MZFA 3T50A 2EX8A 4GDBA 2XRNA 4EBPA 2HP5A 2O9CA 5E2EA 4X56A 5KMWA 4UAAA 3A3JA 4E3IA 1FILA 4ME4A 1Q2QA 1ESIA 2HDUA 1ZG6A 4GDNA 5HAIA 4WZ5A 3O5YA 4EUVA 2VGJA 5FA7A 3BECA 4MBHA 3ZG7B 3E2KA 1PWCA 5CEDA 3ZVTA 4E6WA 4EW7A 1YLYA 4CLCB 5G4YA 5HARA 2JKFA 3G4PA 2VX8A 2QZ6A 5M19A 1NLYA 3VP0A 4KZ4A 3OCLA 2WKPA 3HL9A 3VSLA 1NY0A 1OTIA 3RTYA 2H5SA 2V1ZA 1UGUA 4H6JA 4LPZA 4JGOA 4OVDA 4MCWA 2J3TD 2EX2A 4E04A 3MFDA 3K2NA 3LI8A 4NK3A 2JBFA 5FQKA 2DRWA 4YOFA 4B9OA 4LLOB 3T12B 3TJZC 3LIAA 4KENB 3S7OA 4Y0OA 2BASA 2P7JA 5A93A 3BYDA 3UMEA 3UMDA 5L2FA 3BLMA 4Y7PA 5HWTA 2ACGA 4N92A 5E43A 4WN5A 1YM1A 2EWVA 3LI9A 2W1RA 3H82A 5DJTA 3H82B 1P9RA 4MMNA 4Y5FA 1FCOA 5FSRA 3LEQA 5HPFA 3MR0A 1IYPA 3IX8A 3T4LA 5HAPA 4E3OA 1K0KA 1MWTA 1YQSA 4DE2A 3EEHA 5IU1A 3FV7A 1HTZA 5F69A 1PFLA 2PR6A 4QY5A 4EETB 1HZOA 3E98A 4LGWA 3IF6A 5DTKA 3C4OA 1TF1A 2GNXA 3HLBA 2OV5A 2V20A 1L2SA 3UPPA 4M4XA 3D3OA 3BJNA 3KSGA 2Y2MA 1ERQA 4WL9A 1IYSA 4DDYA 5HFOA 3HCYA 4OKPA 2WGIA 1YLJA 1XA7A 3C8CA 1KDWA 3F1PA 2V2FF 3MQ0A 3MKFA 1VEUA 2KOIA 2WZXA 3HLGA 4XT2A 4QU3A 4R4SA 1H0MA 1TS6A 5I94A 4RYEA 1OT6A 3IQAA 5GHZA 1YT4A 2W3HA 1ONGA 2XSSA 4R0QA 4JF5A 2IWCA 3N6IA 1DRMA 2L0WA 2IWDA 4ESPA 1XJ2A 3Q07A 3BFFA 1RGZA 2W0NA 4OLDA 3NECA 3WS4A 3T1RA 4IBXA 1FCNA 2ZC3B 1JTDA 3UDXA 3LR4A 1CJFA 3AGFA 2EX6A 1N9LA 3TRCA 4Y0TA 3VSKA 3S22A 5AVEA 4LRXC 2P04A 3IH8A 4EQ1A 3UDFA 2JKTM 2HV1A 1PI5A 3SH7A 1SHVA 1LLBA 2V8FA 4K0WA 3WS0A 2XA7M 2QWSA 3PTEA 4JKTA 4K91A 3ICYA 1SKOB 2EFUA 3CPTA 4GW9A 2VV6A 3HUMA 1L3LA 4S2IA 1GCEA 4DF6A 1K57C 2L4RA 3NY4A 1SKFA 4ETXA 2GDNA 3UB8A 3KSIA 5HW3A 2Y2PA 4F3LA 3QNCA 1FIKA 2BLSA 4F3LB 3FKVA 1O7EA 1H8ZA 3VOLA 3CITA 3DTKA 1Z09A 3FG8A 5IT5A 1MY8A 3BY9A 4EXOA 3U4LP 2JN7A 4X1LA 1CI8A 4HH2A 3VOZA 2HDRA 3S4XA 1W63Q 3UE1A 3V50A 3VP4A 3K3CA 3MFXA 1PYYA 1PNEA 4JXGA 5HD5A 1AXBA 1S1ZA 1ODVA 5F6AA 1XGJA 4X55A 2HPBA 4ZJ2A 3T4SA 1LSWA 4F94A 1VB6A 4Y17A 5DF8A 2K31A 4BL3A 2NUTC 4LV3A 2OOLA 1S0WA 3GV9A 2H28A 1I5QA 3WWXA 1DJAA 1OTAA 3DAVA 2LB9A 3RH8B 3HREA 5I5LA 1KVLA 4PKYA 5HDDA 4PM7A 4E6XA 2WAEA 4IVKA 3PBQA 1XX2A 3IXGA 1ES4A 4O0PA 2J3TC 1LL5A 2A3UA 3A3FA 2J7VA 3CG5A 1UWPX 2VGLM 2XA7S 3E4OA 4L9EA 1BLSA 3Q82A 4KZ5A 3LR0A 5GHYA 2VEAA 2PU4A 1F2KA 4GS9A 2A24B 2Y2HA 2A24A 2UV0E 2HGVA 4Q0JA 2WUQA 4B4XA 5L07A 4ZJ1A 2XD5A 3ZCZA 3UY6A 3IXDA 5U47A 3M2JA 4PM6A 4MBKA 5M1AA 2CMNA 3ZG8B 4EEPA 3BY8A 3F1PB 1XFQA 3E4QA 1XA1A 4JGQA 1BULA 3Q7VB 3K3DA 1RGYA 3W2ZA 3VE3A 3BM6A 3O86A 1PWGA 2O9AA 5FI2A 3ZQ5A 1EROA 1MWUA 5CECA 2J3WA 4OQGA 4R3BA 2Y79A 5HAQA 4C6YA 3SH8A 1TVFA 3W8KA 3CWFA 2FH5A 1KGGA 3UN7A 3VP1A 1ZG4A 5CTMA 3TG9A 4P6ZS 3DWZA 3GECA 4R4RA 4G3WA 5FASA 4GJ4A 4OOYA 4OH0A 1KDSA 3NI9A 2WYXA 4JF4A 4S2MA 2WKHA 5HSQA 2PU2A 4PPRA 3W4QA 4G3KA 4HESA 1UWNX 3MF0A 5HDCA 1IYQA 4DXCA 4ZRRA 1YMSA 2WADA 1ACFA 3G32A 4HJ4A 2M7UA 4EBLA 4UQIS 2XK1A 1OJ5A 2OAQ1 4E3NA 4OOMA 2EXBA 3BW6A 3F1OB 2MJ6A 3KX0X 1XFNA 4O8GA 1Y4OA 3HUOA 2OLUA 4JXVA 1MPLA 4CLCC 4HJ3A 4JBFA 5EPHA 3LY4A 3UB5P 4N9LA 2JKRM 2EX9A 1YKDA 4EUZA 1JTGA 3D9YA 4JF6A 3F1NB 3IWIA 5J8XA 3UE6A 3FPWA 2HP6A 3W4PA 4B93A 3IX3A 1E3UA 4RVAA 1L0FA 5FAPA 5FI6A 5HZHA 4L0LA 5HL1A 5GLCA 4RA7A 1FSWA 3MQQA 4QWOA 4MN6A 2ZC5B 4I3JA 2ZC7A 3SW1A 3H9WA 5D3OA 5HD3A 4LV1A 4E3KA 1CK3A 3IX4A 3PBNA 3ZDJA 4X69A 3LR5A 5CGWA 1T19A 1YLZA 4CLCA 3OOVA 1BLPA 2Y91A 2GJ3A 4N9KA 1V9YA 4Q0HA 5KIZA 5IHVA 4FH2A 4NXBA 1FSYA 3HUNA 3S7NA 1MC0A 5EVID 2G2UA 2GX5A 1ALQA 1CF0A 1K38A 4OQ0A 2DCFA 4B88A 1QMEA 5EUAA 1F98A 4HHDA 2OAP1 1YAXA 4Y0UA 3SS4A 3PBOA 1T1BA 2JC7A 4R6LA 3CPTB 5AQ9A 5CXWA 4CLCD 2ZOIA 3FKWA 1NXYA 2OLVA 4LV0A 1WA9A 5HX9A 1IYOA 4MBFA 1LI9A 5EVLA 2HP9A 5G18A 2QKPA 4KQQA 1PI4A 4XT2B 2RCXA 4MN7A 1K54A 1HLUP 1ZKJA 3IBRA 3F1OA 3PBSA 2P9VA 3BQ8A 2KLIA 1IKGA 3NCKA 4EV4A 4NXGA 4OPQA 4GD6A 4CQHA 3ZFZA 3KYZA 2A49A 4L9FA 3LY3A 4BBVA 2WGWA 3GMWA 2V0UA 3C7VA 1N4OA 4GOGA 5CHJA 5F5YA 1IEMA 1JNUA 4HEFA 2XFTA 3E2LA 2JHEA 4EERA 1JWPA 3CI6A 5CHUA 1NYMA 2Q9NA 3A0SA 3NULA 1U60A 1FR6A 3OPPA 4I39A 4NKPA 3UB9A 4GS9B 5FQMA 3UE0A 4NXFA 3SS3A 3HLDA 4XUZA 4KQOA 2XROA 1PZOA 4ARZB 3ZNYA 4JXWA 3NIAA 3LGOA 4WLAA 3A3DA 1SCWA 3CAXA 3LEZA 2M1CA 2V1BA 4FCFA 4P0MA 3S7PA 1I2SA 2B5RA 2Y2JA 4R70A 2VLGA 3O3VA 3C2WA 2XDMA 4DKIA 3E4PA 4KUKA 4HQAA 1ES3A 3C5AA 3MQOA 3P98A 1E4DA 1XP4A 1KVMA 1ESUA 2AVXA 3EOIA 4GKUA 3N8RA 5FI7A 2PDRA 2ZM0A 5EFWA 3OPHA 3A3IA 3OZHA 1G5UA 3UPOA 4DJ2A 3MS6A 4OPRA 2PT7A 2HZ5A 5DJUA 1EI5A 2JKRI 2H0YA 1TDGA 3MBZA 3ZHHA 3QP5A 2QHKA 2JCHA 1BSGA 2YKHA 3CUEA 2ZMVA 1XGIA 5LBRA 5CGSA 3OCNA 4JGPA 5L8MA 2Y55A 3V3SA 3PAGA 1Z6FA 3BFGA 2KDKA 1NRJA 3TE8A 3VP2A 3NBLA 3OPRA 3NDEA 4HIAA 3MSHA 3T4QA 4S2JA 4WBGA 1HD8A 3DTIA 4QPRA 4D2OA 4E3JA 3PR6A 4YFMA 1VETA 5A90A 2LB5A 4PM9A 3IF6B 3C38A 2PYPA 3HLEA 3IS2A 2ZD8A 4H6JB 3FZCA 2WKQA 2VGLS 3H7WB 5TBMA 4KG5A 5K5BA 4EWFA 4GZBA 1OJGA 2PD7A 2PAVP 2Y8HA 2I9VA 2J8YA 3EWKA 2R9XA 3HVFA 3ZNTA 1VEUB 4H8RA 4KZAA 2XFSA 1P9WA 1DJBA 4WEJA 3KYQA 3BEBA 3RXWA 3Q7VA 1MWSA 3JPUA 3VOYA 2PHYA 3WRZA 2R78A 2Y2KA 3LIDA 5CERA 1OTDA 4BBTA 4UA6A 4G3VA 1S4SA 2W1TA 2DMWA 2B02A 4JGRA 2FFYA 4DJ3A 1LL8A 3F1NA 1K6SA 2J9OA 2O9BA 4DE3A 1FR1A 3A0VA 3LIFA 1K4FA 4XUXA 3IF6C 3WS1A 4UEYA 1VETB 4MN5A 2IA2A 2ZMAA 1STZA 2B95A 3AGEA 3M2KA 2VV8A 4QHCA 4PM8A 4MNRA 5CRFA 1K6RA 2WAFA 4QY6A 3T1XA 1GSXA 1YSQA 2Y2LA 4I3AA 1K57A 1ONHA 4BWIA 1SKOA 4WF0A 5FDHA 2W3EA 2ZQ7A 2X01A 1WYBA 4E3LA 2WKIA 3W4OA 5CHMA 3GSGA 5EE8A 3CZDA 1DP9A 4WMCA 2EA9A 3C30A 3GTCA 3C4PA 3ZYTA 2OWJA 3L7HA 2P9VB 2Z6DA 3N7WA 4OONA 2HJEA 4NETA 2H0TA 3O87A 5CTNA 3LIEA 3MKEA 5E2FA 1ES2A 2OSUA 1E25A 4OLGA 1PIOA 3NC8A 4KZBA 4X68A 4C3QA 1GA9A 5BOHA 1KGEA 1ZTUA 2QMIA 4P6BA 3ITAA 4HNBA 1A0KA 3V5MA 2Y2IA 2XGNA 4HP9A 1DJCA 4UA9A 5FQQA 3VP3A 3WRTA 3FYZA 4K0XA 1S67L 2L1MA 1DY6A 4WEKA 4GCZA 4UA7A 2Q9MA 3QP8A 4Q8IA 3Q7ZA 2I72A 4HY8A 5J3WA 2ZQAA 3GVBA 2A2LA 5HDSA 4KZ6A 2CC1A 3HLCA 1N9OA 1LT0A 2ZOHA 1PZPA 1Q2PA 1JVJA 3Q1FA 4WUJA 3SOIA 3ZGAB 2WGWB 2HDSA 5EOEA 4DN0A 5L09A 3UNWA 4KG6A 3EEAA 4S2OA 4P85A 2WGVA 3G2YA 3ZG9B 4X1MA 4OPYA 1LHYA 5C5KA 1CQAA 4E3MA 2FZ0A 1H5XA 1MBLA 4ZDXA 3RJUA 1VQQA 2Y2OA 2JKTI 3G6OA 2QJ7A 2P08A 5EM0A 3S1YA 3H7WA 3N4IA 2Z2MB 2VKSA 3GR2A 4ARZA 4ZTKA 3NOUC 4WMCD 1PWDA 5JYOA 1WE4A 1TS0A 3DW0A 1G28A 4HP4A 4N1XA 4KG2A 4P6ZM 4ZBEA 4X6TA 4KZ8A 4OQHA 4GNUA 3ISGA 4FD8A 1OMEA 1S6RA 2PBYA 2V0WA 5TR7A 1V9ZA 1IELA 1LSXA 4N1HA 5AQBA 4EBNA 3MXSA 3T1SA 5FDSA 5DF7A 4CPKA 3DBAA 1GSWA 4D60A 4KZ9A 4IUKA 4KZ3A 3PBTA 4IBRA 1GA0A 4S2NC 3R4KA 4IUHA 5TFQA 3B3XA 5FQIA 5FEFA 5GLDA 4GD8A 4R1GA 5FATA 1GSVA 4UQIM 2E8IA 2HJ9C 3QP4A 3IHBA 2XH9A 1S66L 2QYBA 4HBUA 1VM1A 2VA0A 1YMXA 2ZBBA 3NDGA 1BUEA 3P7NA 2P74A 4C75A 3DTEA 1I2WA 2PD8A 4IHQA 4EU0A 4BMWA 5AJGA 2K2NA 2QPNA 4WZ5C 1YLPA 2ZQCA 3MZDA 2Q0OA 4U3TA 3LO7A 4FUWA 3CMZA 3AGDA 1XJ3A 1S1YA 1D1JA 1D7EA 2GZAA 4PHTA 4EESA 3VV4A 3B42A 5FQJA 3EQVA 2VZWA 2ZQ8A 2WKEA 4FSFA 5A91A 5DFYA 1XKZA 4CJNA 1XJ4A 4XXRA 4I3IA 1KE4A 3LR3A 2X71A 5AQAA 3UDIA 3KO6A 3KSFA 4R38A 5HWVA 1G6AA 4ID4A 5EVIC 3VFFA 5E2HA 4A5RA 1XPBA 3PAEA 1MZUA 3QNBA 1MKIA 3TSGA 2JE5A 2XLNA 3HLFA 5J4EA 2ZC6B 3MXRA 4I5SA 5A92A 4R3AA 4BBUA 1CEFA 5GLBA 3V3RA 1MWRA 1FCMA 3R7WA 5MC7A 3O88A 3N8SA 4GHIA 5F82A 4II7A 4MLLA 2W27A 3KSHA 1JWZA 1NLZA 3T4OA 5JYPA 5F83A 1BZAA 1OPXA 3VMAA 3HJIA 4O7DA 1K56D 2R9WA 4X25A 1TD5A 3EGDC 1ES5A 4ZAMA 5DFXA 2ZMFA 5EVIB 2JKGA 4FOFA 4UHUA 1BYWA 1F5MA 3BLSA 3FWLA 3IT9A 3QP2A 1JWVA 3SZTA 3C7UA 5EM1A 2KX6A 1L0DA 1W7FA 3CLOA 3PHYA 2Y2QA 1M40A 2W3DA 3NJAA 3WS2A 1OT9A 4BD1A 1LL9A 4FH4A 5G4ZA
chains in the Genus database with same CATH topology
2O9AA 4MDZA 3U2AA 2R78A 3ZQ5A 4L9GA 3LIDA 3MJQA 1DP8A 2EWWA 1OTDA 2M7VA 2J3WA 3EQUA 3LIBA 3V67A 4BBTA 3BQAA 5FL3A 4G3VA 2Z6CA 2W1TB 1S4SA 4KUOA 2W1TA 2Y79A 2DMWA 2B02A 4JGRA 1MKMA 3CWFA 4DJ3A 1LL8A 3F1NA 1H3QA 2FH5A 2WKRA 5F68A 4P6ZS 2O9BA 4PKYG 3A0VA 4NEED 3LIFA 2O99A 5J7EA 3T50A 3GECA 4G3WA 3T4KA 4GJ4A 2XRNA 4UEYA 4IJGA 4MN5A 2IA2A 2O9CA 1STZA 3HJKA 2OWHA 3E0YA 4Q0IA 2VV8A 5HSQA 5G4ZA 4ME4A 5TBMB 4G3KA 1GSXA 1YSQA 5TJJA 4I3AA 1UWNX 3MF0A 3O5YA 4EUVA 4BWIA 4WF0A 5HDCA 4ZRRA 4GLQA 2W3EA 4HJ4A 2M7UA 4EW7A 4UQIS 4CLCB 5G4YA 1DP9A 1OJ5A 2OAQ1 4OOMA 2EA9A 3BW6A 3C30A 3ZYTA 5KSHA 3UB7A 3F1OB 2VX8A 2OWJA 2NUPC 2J80A 2MJ6A 2Z6DA 3KX0X 1XFNA 4O8GA 1NLYA 3LYXA 2HJEA 3OCLA 4CLCC 2WKPA 4HH3A 4HJ3A 1P97A 3LIEA 1OTIA 2JKRM 3RTYA 1YKDA 3NOPC 1UGUA 1ZTUA 4HNBA 4H6JA 3EGXC 4LPZA 3UE3A 1T1CA 3F1NB 4JGOA 4MCWA 4HP9A 2J3TD 1ZHHB 3UE6A 4E04A 3FPWA 2INWA 3VE4A 4B93A 3K2NA 3LI8A 1S67L 2QJ5A 2L1MA 3LUQA 3MMHA 4WEKA 4GCZA 5HZHA 4L0LA 3TW8A 3T4JA 2W3GA 1IFQA 1T1AA 4YOFA 4B9OA 4LLOB 3MQQA 4MN6A 3LIAA 3S7OA 3TJZC 2BASA 2P7JA 2V1AA 4I3JA 3UMEA 1TS7A 3UMDA 4O01A 3SW1A 3H9WA 4HY8A 1P0ZA 4K08A 5HD3A 5J3WA 5HWTA 3FPVA 4WN5A 4EEUA 2A2LA 3PBNA 2EWVA 5HDSA 3LI9A 2W1RA 3H82A 4Y2FA 5DJTA 3LR5A 3H82B 1N9OA 1LT0A 1P9RA 2ZOHA 4YWZA 4MMNA 2B18A 4YNRA 4Y5FA 2K7SA 4WUJA 1S4RA 1T19A 5HPFA 3MR0A 5AVFA 3B47A 3OOVA 4AFIA 4CLCA 3T4LA 4DN0A 5CX7A 3EEAA 4ETZA 2GJ3A 3EEHA 1V9YA 4Q0HA 5KIZA 5IU1A 3GDIA 5F69A 2PR6A 4NXBA 5C5KA 4EETB 3S7NA 1MC0A 3E98A 2FZ0A 2GX5A 1TF1A 2GNXA 2JKTI 3BWLA 3G6OA 2QJ7A 4M4XA 2P08A 3CUEC 3D3OA 1F98A 3BJNA 3MXQA 1Y28A 3H7WA 1F9IA 4HJ6A 4HHDA 3KSGA 3A0RA 2VKSA 2OAP1 4ARZA 4WL9A 1YAXA 3NOUC 3HCYA 3PBOA 1T1BA 4R6LA 1DP6A 4CLCD 2ZOIA 1N9NA 3C8CA 1TS0A 1WA9A 3F1PA 3MQ0A 1G28A 5HL6A 4HP4A 2QKPA 2KOIA 4XT2A 4XT2B 4MN7A 4P6ZM 4CLCE 1TS6A 3IBRA 3F1OA 3NOTC 3PBSA 1OT6A 3BQ8A 3B33A 2W3HA 1X0OA 2XSSA 2KLIA 4WELA 4Z1WA 4NXGA 2V0WA 1V9ZA 1DRMA 2L0WA 3T4TA 4CQHA 1LSXA 4LRZE 3D72A 3KYZA 1XJ2A 4L9FA 3DBAA 1GSWA 2W0NA 4BBVA 4IUKA 2V0UA 3PBTA 3R4KA 3P01A 3LR4A 4IUHA 3UB6A 1N9LA 3TRCA 5F5YA 4Y3IA 1JNUA 3LICA 5AVEA 3IBJA 4LRXC 2JHEA 2HF6A 2P04A 4EQ1A 4EERA 3CI6A 2JKTM 1GSVA 4UQIM 2HV1A 3A0SA 3PYPA 4RQ9A 1G6OA 2HJ9C 4HOIA 4I39A 4NKPA 3UB9A 4GS9B 4NXFA 1S66L 4KQOA 2XROA 2QYBA 1H8MA 1LSVA 1OTBA 2XA7M 4ARZB 2VA0A 2ZBBA 2QWSA 3S7QA 3P7NA 4WLAA 4GHIB 3CAXA 3ICYA 2M1CA 2V1BA 4NXEA 2PD8A 4GW9A 4IHQA 2VV6A 4EU0A 4BMWA 5AJGA 2K2NA 3S7PA 2L4RA 4R70A 2VLGA 4ETXA 3UB8A 5HPIA 3C2WA 3KSIA 3E4PA 4KUKA 4F3LA 4F3LB 5DKLA 3VOLA 1XJ3A 4HQAA 3CITA 1S1YA 1D7EA 1T18A 2GZAA 4PHTA 4EESA 3MQOA 3FG8A 3VV4A 3B42A 5IT5A 3BY9A 3EQVA 4EXOA 2PR5A 2VZWA 4FSFA 2JN7A 3EOIA 2YKFA 4HH2A 5DF9A 5DFYA 2PDRA 1W63Q 3ULFA 1KOUA 1XJ4A 3NHQA 3K3CA 3MFXA 4I3IA 5EFWA 3LR3A 3OBFA 4DJ2A 2W3FA 5HD5A 2PT7A 3KO6A 3KSFA 4R38A 5HWVA 1S1ZA 2VV7A 1ODVA 5F6AA 5DJUA 5DKKA 3OC2A 3T4SA 2JKRI 2D01A 1LSWA 1VB6A 5HWWA 2K31A 2NUTC 4KQDA 1MZUA 2QHKA 2OOLA 3FC7A 4PAUA 4BJPA 5J4EA 2H28A 2YKHA 2V9AA 4I5SA 4R3AA 2VJWA 1OTAA 4BBUA 3CUEA 2ZMVA 5LBRA 2LB9A 3R7WA 3RH8B 3OCNA 3R7WB 5I5LA 1W63M 5MC7A 4GHIA 4JGPA 5L8MA 4PKYA 5HDDA 4II7A 3LFVA 2W27A 2KDKA 1NRJA 1D06A 3PBQA 3KSHA 3TE8A 1EW0A 4LRYC 1NLZA 3T4OA 4O0PA 3RFBA 2J3TC 1IOUA 1VHMA 1XJ6A 4HIAA 3T4QA 1TS8A 1OPXA 4QPRA 1UWPX 2VGLM 3HJIA 3PR6A 1TD5A 2XA7S 3E4OA 3EGDC 4I38A 4L9EA 1OTEA 3PBRA 3LR0A 2LB5A 3PXPA 2VEAA 4HI4A 3C38A 5IS1A 2PYPA 4GS9A 2A24B 3IS2A 3JVVA 5DFXA 2ZMFA 2A24A 3IS2B 1YSPA 4FOFA 2HGVA 4Q0JA 4H6JB 1BYWA 3H7WB 2D02A 2VGLS 2WKQA 1F5MA 5TBMA 5K5BA 1NWZA 4DMZA 1OJGA 2O0YA 2PD7A 2Y8HA 2I9VA 2KX6A 2CMNA 3CLOA 3EWKA 4EEPA 4OOLA 3BY8A 3F1PB 3OLOA 1XFQA 3PHYA 3E4QA 1P9WA 2W3DA 4WEJA 3KYQA 4JGQA 3NJAA 1OT9A 3K3DA 3W2ZA 3JVUA 3VE3A 2PYRA 2G7UA 5A8BA 2PHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KO6 A;  2XSS A;  4E04 A;  2O9A A;  4MDZ A;  3KSF A;  2KLI A;  3ZQ5 A;  3K2N A;  4Z1W A;  3MMH A;  2M7V A;  4CQH A;  4G3V A;  2W3G A;  4LRZ E;  2W1T B;  2W1T A;  2Y79 A;  2K31 A;  4YOF A;  3DBA A;  1MKM A;  4IUK A;  3S7O A;  2OOL A;  3R4K A;  4PAU A;  4O01 A;  4IUH A;  3TRC A;  2VJW A;  4Y3I A;  2O9B A;  5LBR A;  2LB9 A;  3IBJ A;  2O99 A;  4LRX C;  5I5L A;  4G3W A;  5L8M A;  3CI6 A;  2W1R A;  2XRN A;  4Y2F A;  3LFV A;  4IJG A;  2IA2 A;  2O9C A;  1STZ A;  4RQ9 A;  4MMN A;  2B18 A;  3E0Y A;  4Q0I A;  4Y5F A;  4YNR A;  3KSH A;  5HSQ A;  5HPF A;  3OOV A;  4LRY C;  4DN0 A;  4O0P A;  3RFB A;  2XRO A;  4ME4 A;  3EEA A;  2QYB A;  4ETZ A;  1VHM A;  4G3K A;  1YSQ A;  4Q0H A;  5TJJ A;  3S7Q A;  3MF0 A;  4QPR A;  3O5Y A;  5C5K A;  4BWI A;  4EUV A;  4ZRR A;  1TD5 A;  4GLQ A;  4GW9 A;  4EU0 A;  3S7N A;  1MC0 A;  2W3E A;  3E98 A;  5AJG A;  2K2N A;  2LB5 A;  2VEA A;  2M7U A;  3S7P A;  2GX5 A;  1TF1 A;  5DFX A;  4R70 A;  2ZMF A;  1YSP A;  4ETX A;  5HPI A;  3C2W A;  3KSI A;  3G6O A;  4FOF A;  2HGV A;  3D3O A;  4Q0J A;  3BJN A;  2VKS A;  1F5M A;  3KSG A;  3CIT A;  5K5B A;  3NOU C;  3HCY A;  4DMZ A;  4O8G A;  2O0Y A;  2Y8H A;  4R6L A;  3VV4 A;  2VZW A;  3MQ0 A;  5HL6 A;  2W3D A;  5DFY A;  1YKD A;  2KOI A;  3NOP C;  1ZTU A;  3NHQ A;  4MN7 A;  3W2Z A;  3IBR A;  3NOT C;  4MCW A;  3OBF A;  2G7U A;  2W3F A;  2W3H A; 
#chains in the Genus database with same CATH topology
 4OP5 A;  4MDZ A;  4BL2 A;  1TDL A;  2XR0 A;  2M7V A;  1NZU A;  3LIB A;  3V67 A;  5FL3 A;  2FFF B;  3KYE A;  2RL3 A;  2Y4A A;  4QB8 A;  1H3Q A;  1W5D A;  5DTT A;  2WKR A;  5F68 A;  2IWB A;  4PKY G;  5E2G A;  5EEC A;  2O99 A;  3JYI A;  4PMA A;  1PW8 A;  2Y59 A;  3T4K A;  1K4E A;  2PRF A;  2ZQ9 A;  4IJG A;  4DRT A;  3HJK A;  2XF3 A;  1E3U D;  3P09 A;  3IH9 A;  4MEZ A;  2ZC4 B;  2OWH A;  3E0Y A;  4Q0I A;  1BLH A;  3IF5 A;  4OP8 A;  5F1G A;  5TBM B;  5FQ9 A;  2Y2N A;  5TJJ A;  3DWK A;  4GLQ A;  2H10 A;  3SH9 A;  5KSC A;  3G2Z A;  4OPZ A;  1GHP A;  1W8Y A;  5M18 A;  5AQ7 A;  2BG1 A;  5KSH A;  3UB7 A;  2NUP C;  2J80 A;  1BLC A;  4LCL A;  1YPR A;  4YIN A;  1EWZ A;  3LYX A;  4BLM A;  4HH3 A;  5GLA A;  1P97 A;  1WYC A;  1J9M A;  5EVI A;  3ZG5 A;  3NOP C;  4Y15 A;  3CHW P;  3EGX C;  3UE3 A;  1T1C A;  2ZM8 A;  4X53 A;  1ZHH B;  4FTX A;  4LFU A;  2INW A;  3VE4 A;  2QJ5 A;  1PW1 A;  5DTS A;  3LUQ A;  3MMH A;  2PBD P;  3BFD A;  3TW8 A;  3T4J A;  2EFX A;  2W3G A;  1IFQ A;  4ZJ3 A;  1T1A A;  2Y2G A;  4EQI A;  1MXO A;  4DXB A;  1RP5 A;  2V1A A;  5TGF A;  1KGF A;  1TS7 A;  4O01 A;  4S2N A;  2ZM2 A;  2XEP A;  1P0Z A;  4K08 A;  3FPV A;  3SS5 A;  4EEU A;  4LV2 A;  4Y2F A;  1N9B A;  4BEN A;  4YWZ A;  2B18 A;  4YNR A;  2K7S A;  1S4R A;  2E8J A;  5AVF A;  3B47 A;  3GQZ A;  4AFI A;  5CX7 A;  1ERM A;  1FQG A;  4ETZ A;  3G31 A;  1NRF A;  5KZH A;  2Z2L B;  3MZE A;  3GDI A;  1NJ4 A;  2ZQD A;  3HLW A;  4QJG A;  4RX3 A;  3LCE A;  1TEM A;  3BWL A;  4LCM A;  1SDN A;  3CUE C;  3MXQ A;  1Y28 A;  1F9I A;  4HJ6 A;  3A0R A;  3D4F A;  2XQZ A;  4Y13 A;  2ZL1 A;  4DDS A;  1DP6 A;  4WYY A;  1N9N A;  1FOF A;  5HL6 A;  1YLT A;  1L0E A;  1KE0 A;  3A3E A;  4CLC E;  3NOT C;  3B33 A;  1X0O A;  3WS5 A;  4WEL A;  4Z1W A;  4KQR A;  3T4T A;  1J3W A;  4LRZ E;  3D72 A;  3Q81 A;  1W79 A;  3IWO A;  3P01 A;  2HDQ A;  3N8L A;  5EVE A;  3UB6 A;  4Y3I A;  3LIC A;  1KE3 A;  3IBJ A;  2HF6 A;  1XXM A;  3VFH A;  2VK3 A;  3PYP A;  1BT5 A;  4RQ9 A;  2ZLY A;  1G6O A;  4HOI A;  2G2W A;  5CEB A;  4U0X A;  4HBT A;  5EOO A;  1H8M A;  1LSV A;  1OTB A;  3S7Q A;  4RX2 A;  2C6W B;  4GHI B;  4WM9 A;  1RCJ A;  4NXE A;  1QMF A;  4BD0 A;  1K56 A;  3G30 A;  5HPI A;  1LI0 A;  4QD4 A;  1K55 C;  5DKL A;  4DE0 A;  4B4Z A;  5EV0 A;  4R3J A;  1K25 A;  1T18 A;  1CEG A;  3IWQ A;  4M3K A;  3OPL A;  4GN2 A;  2PR5 A;  1CI9 A;  2YKF A;  3QP1 A;  5DF9 A;  3QHY A;  4PM5 A;  3ULF A;  1KOU A;  3BFC A;  1G68 A;  3NHQ A;  3IHA A;  4S2L A;  3OBF A;  2WK0 A;  2W3F A;  4S2K A;  4U0T A;  2VV7 A;  5DKK A;  3I7J A;  3OC2 A;  4BQM A;  1GHI A;  2D01 A;  3GRJ A;  3IXB A;  5HWW A;  5L10 A;  1C3B A;  1M6K A;  3UO9 A;  4KQD A;  3FC7 A;  4PAU A;  4BJP A;  1PRQ A;  1O07 A;  1NZO A;  2V9A A;  2VJW A;  3RXX A;  1K55 A;  3R7W B;  1W63 M;  2C5W B;  2DNS A;  2WZZ A;  3LFV A;  1D06 A;  2J9P A;  5GL9 A;  1EW0 A;  3ZVW A;  4LRY C;  1NYY A;  3UPN A;  3M6B A;  3RFB A;  4DE1 A;  1IOU A;  1HVB A;  1VHM A;  5DVA A;  2XD1 A;  1XJ6 A;  4JPM A;  1TS8 A;  4IED A;  1BTL A;  1IKI A;  5GHX A;  3ZG0 A;  3HBR A;  3DTM A;  4WZ4 A;  3BRM A;  4I38 A;  1OTE A;  3G35 A;  3PBR A;  3PXP A;  4HI4 A;  4S2P A;  5IS1 A;  3JVV A;  1SDE A;  3IS2 B;  1YSP A;  3IXH A;  1H8Y A;  2BTF P;  4OQI A;  2D02 A;  4JXS A;  2ZL1 B;  1K54 C;  1AWI A;  5FEG A;  1NWZ A;  4DMZ A;  2O0Y A;  4OOL A;  4GB7 A;  3OLO A;  3G34 A;  4P87 A;  5F1F A;  5CGX A;  1YLW A;  3T1Q B;  4KZ7 A;  1L0G A;  3JVU A;  2PYR A;  3V39 A;  2G7U A;  5A8B A;  2UWX A;  4R23 A;  5FAQ A;  3U2A A;  3ITB A;  2EXA A;  4L9G A;  3MJQ A;  5FAO A;  1DP8 A;  2EWW A;  3EQU A;  1ZC2 A;  3BQA A;  2VGK A;  2Z6C A;  3QP6 A;  2W1T B;  4KUO A;  3TOI A;  2ZJ9 A;  4NG2 A;  2X02 A;  1MKM A;  4Z9Q A;  1SZV A;  1Y54 A;  4LEN A;  4IVI A;  3BFE A;  1GHM A;  3M6H A;  3L9K A;  2V8C A;  3CJM A;  1W8Q A;  4NEE D;  4JLF A;  5J7E A;  3MZF A;  3T50 A;  2EX8 A;  4GDB A;  2XRN A;  4EBP A;  2HP5 A;  2O9C A;  5E2E A;  4X56 A;  5KMW A;  4UAA A;  3A3J A;  4E3I A;  1FIL A;  4ME4 A;  1Q2Q A;  1ESI A;  2HDU A;  1ZG6 A;  4GDN A;  5HAI A;  4WZ5 A;  3O5Y A;  4EUV A;  2VGJ A;  5FA7 A;  3BEC A;  4MBH A;  3ZG7 B;  3E2K A;  1PWC A;  5CED A;  3ZVT A;  4E6W A;  4EW7 A;  1YLY A;  4CLC B;  5G4Y A;  5HAR A;  2JKF A;  3G4P A;  2VX8 A;  2QZ6 A;  5M19 A;  1NLY A;  3VP0 A;  4KZ4 A;  3OCL A;  2WKP A;  3HL9 A;  3VSL A;  1NY0 A;  1OTI A;  3RTY A;  2H5S A;  2V1Z A;  1UGU A;  4H6J A;  4LPZ A;  4JGO A;  4OVD A;  4MCW A;  2J3T D;  2EX2 A;  4E04 A;  3MFD A;  3K2N A;  3LI8 A;  4NK3 A;  2JBF A;  5FQK A;  2DRW A;  4YOF A;  4B9O A;  4LLO B;  3T12 B;  3TJZ C;  3LIA A;  4KEN B;  3S7O A;  4Y0O A;  2BAS A;  2P7J A;  5A93 A;  3BYD A;  3UME A;  3UMD A;  5L2F A;  3BLM A;  4Y7P A;  5HWT A;  2ACG A;  4N92 A;  5E43 A;  4WN5 A;  1YM1 A;  2EWV A;  3LI9 A;  2W1R A;  3H82 A;  5DJT A;  3H82 B;  1P9R A;  4MMN A;  4Y5F A;  1FCO A;  5FSR A;  3LEQ A;  5HPF A;  3MR0 A;  1IYP A;  3IX8 A;  3T4L A;  5HAP A;  4E3O A;  1K0K A;  1MWT A;  1YQS A;  4DE2 A;  3EEH A;  5IU1 A;  3FV7 A;  1HTZ A;  5F69 A;  1PFL A;  2PR6 A;  4QY5 A;  4EET B;  1HZO A;  3E98 A;  4LGW A;  3IF6 A;  5DTK A;  3C4O A;  1TF1 A;  2GNX A;  3HLB A;  2OV5 A;  2V20 A;  1L2S A;  3UPP A;  4M4X A;  3D3O A;  3BJN A;  3KSG A;  2Y2M A;  1ERQ A;  4WL9 A;  1IYS A;  4DDY A;  5HFO A;  3HCY A;  4OKP A;  2WGI A;  1YLJ A;  1XA7 A;  3C8C A;  1KDW A;  3F1P A;  2V2F F;  3MQ0 A;  3MKF A;  1VEU A;  2KOI A;  2WZX A;  3HLG A;  4XT2 A;  4QU3 A;  4R4S A;  1H0M A;  1TS6 A;  5I94 A;  4RYE A;  1OT6 A;  3IQA A;  5GHZ A;  1YT4 A;  2W3H A;  1ONG A;  2XSS A;  4R0Q A;  4JF5 A;  2IWC A;  3N6I A;  1DRM A;  2L0W A;  2IWD A;  4ESP A;  1XJ2 A;  3Q07 A;  3BFF A;  1RGZ A;  2W0N A;  4OLD A;  3NEC A;  3WS4 A;  3T1R A;  4IBX A;  1FCN A;  2ZC3 B;  1JTD A;  3UDX A;  3LR4 A;  1CJF A;  3AGF A;  2EX6 A;  1N9L A;  3TRC A;  4Y0T A;  3VSK A;  3S22 A;  5AVE A;  4LRX C;  2P04 A;  3IH8 A;  4EQ1 A;  3UDF A;  2JKT M;  2HV1 A;  1PI5 A;  3SH7 A;  1SHV A;  1LLB A;  2V8F A;  4K0W A;  3WS0 A;  2XA7 M;  2QWS A;  3PTE A;  4JKT A;  4K91 A;  3ICY A;  1SKO B;  2EFU A;  3CPT A;  4GW9 A;  2VV6 A;  3HUM A;  1L3L A;  4S2I A;  1GCE A;  4DF6 A;  1K57 C;  2L4R A;  3NY4 A;  1SKF A;  4ETX A;  2GDN A;  3UB8 A;  3KSI A;  5HW3 A;  2Y2P A;  4F3L A;  3QNC A;  1FIK A;  2BLS A;  4F3L B;  3FKV A;  1O7E A;  1H8Z A;  3VOL A;  3CIT A;  3DTK A;  1Z09 A;  3FG8 A;  5IT5 A;  1MY8 A;  3BY9 A;  4EXO A;  3U4L P;  2JN7 A;  4X1L A;  1CI8 A;  4HH2 A;  3VOZ A;  2HDR A;  3S4X A;  1W63 Q;  3UE1 A;  3V50 A;  3VP4 A;  3K3C A;  3MFX A;  1PYY A;  1PNE A;  4JXG A;  5HD5 A;  1AXB A;  1S1Z A;  1ODV A;  5F6A A;  1XGJ A;  4X55 A;  2HPB A;  4ZJ2 A;  3T4S A;  1LSW A;  4F94 A;  1VB6 A;  4Y17 A;  5DF8 A;  2K31 A;  4BL3 A;  2NUT C;  4LV3 A;  2OOL A;  1S0W A;  3GV9 A;  2H28 A;  1I5Q A;  3WWX A;  1DJA A;  1OTA A;  3DAV A;  2LB9 A;  3RH8 B;  3HRE A;  5I5L A;  1KVL A;  4PKY A;  5HDD A;  4PM7 A;  4E6X A;  2WAE A;  4IVK A;  3PBQ A;  1XX2 A;  3IXG A;  1ES4 A;  4O0P A;  2J3T C;  1LL5 A;  2A3U A;  3A3F A;  2J7V A;  3CG5 A;  1UWP X;  2VGL M;  2XA7 S;  3E4O A;  4L9E A;  1BLS A;  3Q82 A;  4KZ5 A;  3LR0 A;  5GHY A;  2VEA A;  2PU4 A;  1F2K A;  4GS9 A;  2A24 B;  2Y2H A;  2A24 A;  2UV0 E;  2HGV A;  4Q0J A;  2WUQ A;  4B4X A;  5L07 A;  4ZJ1 A;  2XD5 A;  3ZCZ A;  3UY6 A;  3IXD A;  5U47 A;  3M2J A;  4PM6 A;  4MBK A;  5M1A A;  2CMN A;  3ZG8 B;  4EEP A;  3BY8 A;  3F1P B;  1XFQ A;  3E4Q A;  1XA1 A;  4JGQ A;  1BUL A;  3Q7V B;  3K3D A;  1RGY A;  3W2Z A;  3VE3 A;  3BM6 A;  3O86 A;  1PWG A;  2O9A A;  5FI2 A;  3ZQ5 A;  1ERO A;  1MWU A;  5CEC A;  2J3W A;  4OQG A;  4R3B A;  2Y79 A;  5HAQ A;  4C6Y A;  3SH8 A;  1TVF A;  3W8K A;  3CWF A;  2FH5 A;  1KGG A;  3UN7 A;  3VP1 A;  1ZG4 A;  5CTM A;  3TG9 A;  4P6Z S;  3DWZ A;  3GEC A;  4R4R A;  4G3W A;  5FAS A;  4GJ4 A;  4OOY A;  4OH0 A;  1KDS A;  3NI9 A;  2WYX A;  4JF4 A;  4S2M A;  2WKH A;  5HSQ A;  2PU2 A;  4PPR A;  3W4Q A;  4G3K A;  4HES A;  1UWN X;  3MF0 A;  5HDC A;  1IYQ A;  4DXC A;  4ZRR A;  1YMS A;  2WAD A;  1ACF A;  3G32 A;  4HJ4 A;  2M7U A;  4EBL A;  4UQI S;  2XK1 A;  1OJ5 A;  2OAQ 1;  4E3N A;  4OOM A;  2EXB A;  3BW6 A;  3F1O B;  2MJ6 A;  3KX0 X;  1XFN A;  4O8G A;  1Y4O A;  3HUO A;  2OLU A;  4JXV A;  1MPL A;  4CLC C;  4HJ3 A;  4JBF A;  5EPH A;  3LY4 A;  3UB5 P;  4N9L A;  2JKR M;  2EX9 A;  1YKD A;  4EUZ A;  1JTG A;  3D9Y A;  4JF6 A;  3F1N B;  3IWI A;  5J8X A;  3UE6 A;  3FPW A;  2HP6 A;  3W4P A;  4B93 A;  3IX3 A;  1E3U A;  4RVA A;  1L0F A;  5FAP A;  5FI6 A;  5HZH A;  4L0L A;  5HL1 A;  5GLC A;  4RA7 A;  1FSW A;  3MQQ A;  4QWO A;  4MN6 A;  2ZC5 B;  4I3J A;  2ZC7 A;  3SW1 A;  3H9W A;  5D3O A;  5HD3 A;  4LV1 A;  4E3K A;  1CK3 A;  3IX4 A;  3PBN A;  3ZDJ A;  4X69 A;  3LR5 A;  5CGW A;  1T19 A;  1YLZ A;  4CLC A;  3OOV A;  1BLP A;  2Y91 A;  2GJ3 A;  4N9K A;  1V9Y A;  4Q0H A;  5KIZ A;  5IHV A;  4FH2 A;  4NXB A;  1FSY A;  3HUN A;  3S7N A;  1MC0 A;  5EVI D;  2G2U A;  2GX5 A;  1ALQ A;  1CF0 A;  1K38 A;  4OQ0 A;  2DCF A;  4B88 A;  1QME A;  5EUA A;  1F98 A;  4HHD A;  2OAP 1;  1YAX A;  4Y0U A;  3SS4 A;  3PBO A;  1T1B A;  2JC7 A;  4R6L A;  3CPT B;  5AQ9 A;  5CXW A;  4CLC D;  2ZOI A;  3FKW A;  1NXY A;  2OLV A;  4LV0 A;  1WA9 A;  5HX9 A;  1IYO A;  4MBF A;  1LI9 A;  5EVL A;  2HP9 A;  5G18 A;  2QKP A;  4KQQ A;  1PI4 A;  4XT2 B;  2RCX A;  4MN7 A;  1K54 A;  1HLU P;  1ZKJ A;  3IBR A;  3F1O A;  3PBS A;  2P9V A;  3BQ8 A;  2KLI A;  1IKG A;  3NCK A;  4EV4 A;  4NXG A;  4OPQ A;  4GD6 A;  4CQH A;  3ZFZ A;  3KYZ A;  2A49 A;  4L9F A;  3LY3 A;  4BBV A;  2WGW A;  3GMW A;  2V0U A;  3C7V A;  1N4O A;  4GOG A;  5CHJ A;  5F5Y A;  1IEM A;  1JNU A;  4HEF A;  2XFT A;  3E2L A;  2JHE A;  4EER A;  1JWP A;  3CI6 A;  5CHU A;  1NYM A;  2Q9N A;  3A0S A;  3NUL A;  1U60 A;  1FR6 A;  3OPP A;  4I39 A;  4NKP A;  3UB9 A;  4GS9 B;  5FQM A;  3UE0 A;  4NXF A;  3SS3 A;  3HLD A;  4XUZ A;  4KQO A;  2XRO A;  1PZO A;  4ARZ B;  3ZNY A;  4JXW A;  3NIA A;  3LGO A;  4WLA A;  3A3D A;  1SCW A;  3CAX A;  3LEZ A;  2M1C A;  2V1B A;  4FCF A;  4P0M A;  3S7P A;  1I2S A;  2B5R A;  2Y2J A;  4R70 A;  2VLG A;  3O3V A;  3C2W A;  2XDM A;  4DKI A;  3E4P A;  4KUK A;  4HQA A;  1ES3 A;  3C5A A;  3MQO A;  3P98 A;  1E4D A;  1XP4 A;  1KVM A;  1ESU A;  2AVX A;  3EOI A;  4GKU A;  3N8R A;  5FI7 A;  2PDR A;  2ZM0 A;  5EFW A;  3OPH A;  3A3I A;  3OZH A;  1G5U A;  3UPO A;  4DJ2 A;  3MS6 A;  4OPR A;  2PT7 A;  2HZ5 A;  5DJU A;  1EI5 A;  2JKR I;  2H0Y A;  1TDG A;  3MBZ A;  3ZHH A;  3QP5 A;  2QHK A;  2JCH A;  1BSG A;  2YKH A;  3CUE A;  2ZMV A;  1XGI A;  5LBR A;  5CGS A;  3OCN A;  4JGP A;  5L8M A;  2Y55 A;  3V3S A;  3PAG A;  1Z6F A;  3BFG A;  2KDK A;  1NRJ A;  3TE8 A;  3VP2 A;  3NBL A;  3OPR A;  3NDE A;  4HIA A;  3MSH A;  3T4Q A;  4S2J A;  4WBG A;  1HD8 A;  3DTI A;  4QPR A;  4D2O A;  4E3J A;  3PR6 A;  4YFM A;  1VET A;  5A90 A;  2LB5 A;  4PM9 A;  3IF6 B;  3C38 A;  2PYP A;  3HLE A;  3IS2 A;  2ZD8 A;  4H6J B;  3FZC A;  2WKQ A;  2VGL S;  3H7W B;  5TBM A;  4KG5 A;  5K5B A;  4EWF A;  4GZB A;  1OJG A;  2PD7 A;  2PAV P;  2Y8H A;  2I9V A;  2J8Y A;  3EWK A;  2R9X A;  3HVF A;  3ZNT A;  1VEU B;  4H8R A;  4KZA A;  2XFS A;  1P9W A;  1DJB A;  4WEJ A;  3KYQ A;  3BEB A;  3RXW A;  3Q7V A;  1MWS A;  3JPU A;  3VOY A;  2PHY A;  3WRZ A;  2R78 A;  2Y2K A;  3LID A;  5CER A;  1OTD A;  4BBT A;  4UA6 A;  4G3V A;  1S4S A;  2W1T A;  2DMW A;  2B02 A;  4JGR A;  2FFY A;  4DJ3 A;  1LL8 A;  3F1N A;  1K6S A;  2J9O A;  2O9B A;  4DE3 A;  1FR1 A;  3A0V A;  3LIF A;  1K4F A;  4XUX A;  3IF6 C;  3WS1 A;  4UEY A;  1VET B;  4MN5 A;  2IA2 A;  2ZMA A;  1STZ A;  2B95 A;  3AGE A;  3M2K A;  2VV8 A;  4QHC A;  4PM8 A;  4MNR A;  5CRF A;  1K6R A;  2WAF A;  4QY6 A;  3T1X A;  1GSX A;  1YSQ A;  2Y2L A;  4I3A A;  1K57 A;  1ONH A;  4BWI A;  1SKO A;  4WF0 A;  5FDH A;  2W3E A;  2ZQ7 A;  2X01 A;  1WYB A;  4E3L A;  2WKI A;  3W4O A;  5CHM A;  3GSG A;  5EE8 A;  3CZD A;  1DP9 A;  4WMC A;  2EA9 A;  3C30 A;  3GTC A;  3C4P A;  3ZYT A;  2OWJ A;  3L7H A;  2P9V B;  2Z6D A;  3N7W A;  4OON A;  2HJE A;  4NET A;  2H0T A;  3O87 A;  5CTN A;  3LIE A;  3MKE A;  5E2F A;  1ES2 A;  2OSU A;  1E25 A;  4OLG A;  1PIO A;  3NC8 A;  4KZB A;  4X68 A;  4C3Q A;  1GA9 A;  5BOH A;  1KGE A;  1ZTU A;  2QMI A;  4P6B A;  3ITA A;  4HNB A;  1A0K A;  3V5M A;  2Y2I A;  2XGN A;  4HP9 A;  1DJC A;  4UA9 A;  5FQQ A;  3VP3 A;  3WRT A;  3FYZ A;  4K0X A;  1S67 L;  2L1M A;  1DY6 A;  4WEK A;  4GCZ A;  4UA7 A;  2Q9M A;  3QP8 A;  4Q8I A;  3Q7Z A;  2I72 A;  4HY8 A;  5J3W A;  2ZQA A;  3GVB A;  2A2L A;  5HDS A;  4KZ6 A;  2CC1 A;  3HLC A;  1N9O A;  1LT0 A;  2ZOH A;  1PZP A;  1Q2P A;  1JVJ A;  3Q1F A;  4WUJ A;  3SOI A;  3ZGA B;  2WGW B;  2HDS A;  5EOE A;  4DN0 A;  5L09 A;  3UNW A;  4KG6 A;  3EEA A;  4S2O A;  4P85 A;  2WGV A;  3G2Y A;  3ZG9 B;  4X1M A;  4OPY A;  1LHY A;  5C5K A;  1CQA A;  4E3M A;  2FZ0 A;  1H5X A;  1MBL A;  4ZDX A;  3RJU A;  1VQQ A;  2Y2O A;  2JKT I;  3G6O A;  2QJ7 A;  2P08 A;  5EM0 A;  3S1Y A;  3H7W A;  3N4I A;  2Z2M B;  2VKS A;  3GR2 A;  4ARZ A;  4ZTK A;  3NOU C;  4WMC D;  1PWD A;  5JYO A;  1WE4 A;  1TS0 A;  3DW0 A;  1G28 A;  4HP4 A;  4N1X A;  4KG2 A;  4P6Z M;  4ZBE A;  4X6T A;  4KZ8 A;  4OQH A;  4GNU A;  3ISG A;  4FD8 A;  1OME A;  1S6R A;  2PBY A;  2V0W A;  5TR7 A;  1V9Z A;  1IEL A;  1LSX A;  4N1H A;  5AQB A;  4EBN A;  3MXS A;  3T1S A;  5FDS A;  5DF7 A;  4CPK A;  3DBA A;  1GSW A;  4D60 A;  4KZ9 A;  4IUK A;  4KZ3 A;  3PBT A;  4IBR A;  1GA0 A;  4S2N C;  3R4K A;  4IUH A;  5TFQ A;  3B3X A;  5FQI A;  5FEF A;  5GLD A;  4GD8 A;  4R1G A;  5FAT A;  1GSV A;  4UQI M;  2E8I A;  2HJ9 C;  3QP4 A;  3IHB A;  2XH9 A;  1S66 L;  2QYB A;  4HBU A;  1VM1 A;  2VA0 A;  1YMX A;  2ZBB A;  3NDG A;  1BUE A;  3P7N A;  2P74 A;  4C75 A;  3DTE A;  1I2W A;  2PD8 A;  4IHQ A;  4EU0 A;  4BMW A;  5AJG A;  2K2N A;  2QPN A;  4WZ5 C;  1YLP A;  2ZQC A;  3MZD A;  2Q0O A;  4U3T A;  3LO7 A;  4FUW A;  3CMZ A;  3AGD A;  1XJ3 A;  1S1Y A;  1D1J A;  1D7E A;  2GZA A;  4PHT A;  4EES A;  3VV4 A;  3B42 A;  5FQJ A;  3EQV A;  2VZW A;  2ZQ8 A;  2WKE A;  4FSF A;  5A91 A;  5DFY A;  1XKZ A;  4CJN A;  1XJ4 A;  4XXR A;  4I3I A;  1KE4 A;  3LR3 A;  2X71 A;  5AQA A;  3UDI A;  3KO6 A;  3KSF A;  4R38 A;  5HWV A;  1G6A A;  4ID4 A;  5EVI C;  3VFF A;  5E2H A;  4A5R A;  1XPB A;  3PAE A;  1MZU A;  3QNB A;  1MKI A;  3TSG A;  2JE5 A;  2XLN A;  3HLF A;  5J4E A;  2ZC6 B;  3MXR A;  4I5S A;  5A92 A;  4R3A A;  4BBU A;  1CEF A;  5GLB A;  3V3R A;  1MWR A;  1FCM A;  3R7W A;  5MC7 A;  3O88 A;  3N8S A;  4GHI A;  5F82 A;  4II7 A;  4MLL A;  2W27 A;  3KSH A;  1JWZ A;  1NLZ A;  3T4O A;  5JYP A;  5F83 A;  1BZA A;  1OPX A;  3VMA A;  3HJI A;  4O7D A;  1K56 D;  2R9W A;  4X25 A;  1TD5 A;  3EGD C;  1ES5 A;  4ZAM A;  5DFX A;  2ZMF A;  5EVI B;  2JKG A;  4FOF A;  4UHU A;  1BYW A;  1F5M A;  3BLS A;  3FWL A;  3IT9 A;  3QP2 A;  1JWV A;  3SZT A;  3C7U A;  5EM1 A;  2KX6 A;  1L0D A;  1W7F A;  3CLO A;  3PHY A;  2Y2Q A;  1M40 A;  2W3D A;  3NJA A;  3WS2 A;  1OT9 A;  4BD1 A;  1LL9 A;  4FH4 A;  5G4Z A; 
#chains in the Genus database with same CATH homology
 2O9A A;  4MDZ A;  3U2A A;  2R78 A;  3ZQ5 A;  4L9G A;  3LID A;  3MJQ A;  1DP8 A;  2EWW A;  1OTD A;  2M7V A;  2J3W A;  3EQU A;  3LIB A;  3V67 A;  4BBT A;  3BQA A;  5FL3 A;  4G3V A;  2Z6C A;  2W1T B;  1S4S A;  4KUO A;  2W1T A;  2Y79 A;  2DMW A;  2B02 A;  4JGR A;  1MKM A;  3CWF A;  4DJ3 A;  1LL8 A;  3F1N A;  1H3Q A;  2FH5 A;  2WKR A;  5F68 A;  4P6Z S;  2O9B A;  4PKY G;  3A0V A;  4NEE D;  3LIF A;  2O99 A;  5J7E A;  3T50 A;  3GEC A;  4G3W A;  3T4K A;  4GJ4 A;  2XRN A;  4UEY A;  4IJG A;  4MN5 A;  2IA2 A;  2O9C A;  1STZ A;  3HJK A;  2OWH A;  3E0Y A;  4Q0I A;  2VV8 A;  5HSQ A;  5G4Z A;  4ME4 A;  5TBM B;  4G3K A;  1GSX A;  1YSQ A;  5TJJ A;  4I3A A;  1UWN X;  3MF0 A;  3O5Y A;  4EUV A;  4BWI A;  4WF0 A;  5HDC A;  4ZRR A;  4GLQ A;  2W3E A;  4HJ4 A;  2M7U A;  4EW7 A;  4UQI S;  4CLC B;  5G4Y A;  1DP9 A;  1OJ5 A;  2OAQ 1;  4OOM A;  2EA9 A;  3BW6 A;  3C30 A;  3ZYT A;  5KSH A;  3UB7 A;  3F1O B;  2VX8 A;  2OWJ A;  2NUP C;  2J80 A;  2MJ6 A;  2Z6D A;  3KX0 X;  1XFN A;  4O8G A;  1NLY A;  3LYX A;  2HJE A;  3OCL A;  4CLC C;  2WKP A;  4HH3 A;  4HJ3 A;  1P97 A;  3LIE A;  1OTI A;  2JKR M;  3RTY A;  1YKD A;  3NOP C;  1UGU A;  1ZTU A;  4HNB A;  4H6J A;  3EGX C;  4LPZ A;  3UE3 A;  1T1C A;  3F1N B;  4JGO A;  4MCW A;  4HP9 A;  2J3T D;  1ZHH B;  3UE6 A;  4E04 A;  3FPW A;  2INW A;  3VE4 A;  4B93 A;  3K2N A;  3LI8 A;  1S67 L;  2QJ5 A;  2L1M A;  3LUQ A;  3MMH A;  4WEK A;  4GCZ A;  5HZH A;  4L0L A;  3TW8 A;  3T4J A;  2W3G A;  1IFQ A;  1T1A A;  4YOF A;  4B9O A;  4LLO B;  3MQQ A;  4MN6 A;  3LIA A;  3S7O A;  3TJZ C;  2BAS A;  2P7J A;  2V1A A;  4I3J A;  3UME A;  1TS7 A;  3UMD A;  4O01 A;  3SW1 A;  3H9W A;  4HY8 A;  1P0Z A;  4K08 A;  5HD3 A;  5J3W A;  5HWT A;  3FPV A;  4WN5 A;  4EEU A;  2A2L A;  3PBN A;  2EWV A;  5HDS A;  3LI9 A;  2W1R A;  3H82 A;  4Y2F A;  5DJT A;  3LR5 A;  3H82 B;  1N9O A;  1LT0 A;  1P9R A;  2ZOH A;  4YWZ A;  4MMN A;  2B18 A;  4YNR A;  4Y5F A;  2K7S A;  4WUJ A;  1S4R A;  1T19 A;  5HPF A;  3MR0 A;  5AVF A;  3B47 A;  3OOV A;  4AFI A;  4CLC A;  3T4L A;  4DN0 A;  5CX7 A;  3EEA A;  4ETZ A;  2GJ3 A;  3EEH A;  1V9Y A;  4Q0H A;  5KIZ A;  5IU1 A;  3GDI A;  5F69 A;  2PR6 A;  4NXB A;  5C5K A;  4EET B;  3S7N A;  1MC0 A;  3E98 A;  2FZ0 A;  2GX5 A;  1TF1 A;  2GNX A;  2JKT I;  3BWL A;  3G6O A;  2QJ7 A;  4M4X A;  2P08 A;  3CUE C;  3D3O A;  1F98 A;  3BJN A;  3MXQ A;  1Y28 A;  3H7W A;  1F9I A;  4HJ6 A;  4HHD A;  3KSG A;  3A0R A;  2VKS A;  2OAP 1;  4ARZ A;  4WL9 A;  1YAX A;  3NOU C;  3HCY A;  3PBO A;  1T1B A;  4R6L A;  1DP6 A;  4CLC D;  2ZOI A;  1N9N A;  3C8C A;  1TS0 A;  1WA9 A;  3F1P A;  3MQ0 A;  1G28 A;  5HL6 A;  4HP4 A;  2QKP A;  2KOI A;  4XT2 A;  4XT2 B;  4MN7 A;  4P6Z M;  4CLC E;  1TS6 A;  3IBR A;  3F1O A;  3NOT C;  3PBS A;  1OT6 A;  3BQ8 A;  3B33 A;  2W3H A;  1X0O A;  2XSS A;  2KLI A;  4WEL A;  4Z1W A;  4NXG A;  2V0W A;  1V9Z A;  1DRM A;  2L0W A;  3T4T A;  4CQH A;  1LSX A;  4LRZ E;  3D72 A;  3KYZ A;  1XJ2 A;  4L9F A;  3DBA A;  1GSW A;  2W0N A;  4BBV A;  4IUK A;  2V0U A;  3PBT A;  3R4K A;  3P01 A;  3LR4 A;  4IUH A;  3UB6 A;  1N9L A;  3TRC A;  5F5Y A;  4Y3I A;  1JNU A;  3LIC A;  5AVE A;  3IBJ A;  4LRX C;  2JHE A;  2HF6 A;  2P04 A;  4EQ1 A;  4EER A;  3CI6 A;  2JKT M;  1GSV A;  4UQI M;  2HV1 A;  3A0S A;  3PYP A;  4RQ9 A;  1G6O A;  2HJ9 C;  4HOI A;  4I39 A;  4NKP A;  3UB9 A;  4GS9 B;  4NXF A;  1S66 L;  4KQO A;  2XRO A;  2QYB A;  1H8M A;  1LSV A;  1OTB A;  2XA7 M;  4ARZ B;  2VA0 A;  2ZBB A;  2QWS A;  3S7Q A;  3P7N A;  4WLA A;  4GHI B;  3CAX A;  3ICY A;  2M1C A;  2V1B A;  4NXE A;  2PD8 A;  4GW9 A;  4IHQ A;  2VV6 A;  4EU0 A;  4BMW A;  5AJG A;  2K2N A;  3S7P A;  2L4R A;  4R70 A;  2VLG A;  4ETX A;  3UB8 A;  5HPI A;  3C2W A;  3KSI A;  3E4P A;  4KUK A;  4F3L A;  4F3L B;  5DKL A;  3VOL A;  1XJ3 A;  4HQA A;  3CIT A;  1S1Y A;  1D7E A;  1T18 A;  2GZA A;  4PHT A;  4EES A;  3MQO A;  3FG8 A;  3VV4 A;  3B42 A;  5IT5 A;  3BY9 A;  3EQV A;  4EXO A;  2PR5 A;  2VZW A;  4FSF A;  2JN7 A;  3EOI A;  2YKF A;  4HH2 A;  5DF9 A;  5DFY A;  2PDR A;  1W63 Q;  3ULF A;  1KOU A;  1XJ4 A;  3NHQ A;  3K3C A;  3MFX A;  4I3I A;  5EFW A;  3LR3 A;  3OBF A;  4DJ2 A;  2W3F A;  5HD5 A;  2PT7 A;  3KO6 A;  3KSF A;  4R38 A;  5HWV A;  1S1Z A;  2VV7 A;  1ODV A;  5F6A A;  5DJU A;  5DKK A;  3OC2 A;  3T4S A;  2JKR I;  2D01 A;  1LSW A;  1VB6 A;  5HWW A;  2K31 A;  2NUT C;  4KQD A;  1MZU A;  2QHK A;  2OOL A;  3FC7 A;  4PAU A;  4BJP A;  5J4E A;  2H28 A;  2YKH A;  2V9A A;  4I5S A;  4R3A A;  2VJW A;  1OTA A;  4BBU A;  3CUE A;  2ZMV A;  5LBR A;  2LB9 A;  3R7W A;  3RH8 B;  3OCN A;  3R7W B;  5I5L A;  1W63 M;  5MC7 A;  4GHI A;  4JGP A;  5L8M A;  4PKY A;  5HDD A;  4II7 A;  3LFV A;  2W27 A;  2KDK A;  1NRJ A;  1D06 A;  3PBQ A;  3KSH A;  3TE8 A;  1EW0 A;  4LRY C;  1NLZ A;  3T4O A;  4O0P A;  3RFB A;  2J3T C;  1IOU A;  1VHM A;  1XJ6 A;  4HIA A;  3T4Q A;  1TS8 A;  1OPX A;  4QPR A;  1UWP X;  2VGL M;  3HJI A;  3PR6 A;  1TD5 A;  2XA7 S;  3E4O A;  3EGD C;  4I38 A;  4L9E A;  1OTE A;  3PBR A;  3LR0 A;  2LB5 A;  3PXP A;  2VEA A;  4HI4 A;  3C38 A;  5IS1 A;  2PYP A;  4GS9 A;  2A24 B;  3IS2 A;  3JVV A;  5DFX A;  2ZMF A;  2A24 A;  3IS2 B;  1YSP A;  4FOF A;  2HGV A;  4Q0J A;  4H6J B;  1BYW A;  3H7W B;  2D02 A;  2VGL S;  2WKQ A;  1F5M A;  5TBM A;  5K5B A;  1NWZ A;  4DMZ A;  1OJG A;  2O0Y A;  2PD7 A;  2Y8H A;  2I9V A;  2KX6 A;  2CMN A;  3CLO A;  3EWK A;  4EEP A;  4OOL A;  3BY8 A;  3F1P B;  3OLO A;  1XFQ A;  3PHY A;  3E4Q A;  1P9W A;  2W3D A;  4WEJ A;  3KYQ A;  4JGQ A;  3NJA A;  1OT9 A;  3K3D A;  3W2Z A;  3JVU A;  3VE3 A;  2PYR A;  2G7U A;  5A8B A;  2PHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...