2KLIA

Structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
b'LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
total genus 33
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kliA00
4DMZA 4Y3IA 4GLQA 3HCYA 2VJWA 2O9CA 2W3EA 2LB5A 3RFBA 1TF1A 2IA2A 4G3VA 4PAUA 4Z1WA 4O01A 4Q0JA 4IUHA 4YOFA 4MDZA 4G3KA 1YSQA 5LBRA 2GX5A 2O9BA 3W2ZA 2B18A 3NOPC 4R6LA 2LB9A 3ZQ5A 4IUKA 3G6OA 2W3FA 5AJGA 3D3OA 2W1RA 4Q0IA 4CQHA 2KLIA 3LFVA 5TJJA 5HPIA 2W1TB 4EUVA 4Q0HA 2XSSA 2O9AA 5L8MA 4DN0A 3BJNA 5DFYA 2VKSA 2M7VA 1MKMA 3MF0A 3OBFA 4ZRRA 2M7UA 5DFXA 4LRXC 4ETXA 2G7UA 1VHMA 4LRZE 3S7OA 3E98A 4BWIA 4FOFA 3KSHA 2XRNA 2HGVA 4G3WA 4QPRA 2O0YA 3C2WA 4O8GA 5HL6A 2ZMFA 4ETZA 3NHQA 2W3GA 2VEAA 4YNRA 1F5MA 2VZWA 3CITA 3MQ0A 4O0PA 3VV4A 1MC0A 3MMHA 1STZA 3DBAA 4Y2FA 5I5LA 3OOVA 4MN7A 5HPFA 2KOIA 2W1TA 3TRCA 3KSIA 2K31A 2O99A 1YSPA 4ME4A 3EEAA 3S7NA 2Y8HA 2W3HA 1ZTUA 4IJGA 4LRYC 4EU0A 3NOTC 4GW9A 3NOUC 3KO6A 3R4KA 3KSFA 4RQ9A 2XROA 4MCWA 2K2NA 2W3DA 1YKDA 5HSQA 3CI6A 3S7QA 3O5YA 2OOLA 3IBRA 5K5BA 3S7PA 2Y79A 3E0YA 5C5KA 4MMNA 3IBJA 2QYBA 3KSGA 1TD5A 4Y5FA 3K2NA 4R70A 4E04A
chains in the Genus database with same CATH superfamily
3ZFZA 2PBYA 1L3LA 1H0MA 1OT9A 2XLNA 2LB5A 2K7SA 5KIZA 5AVFA 4Q0JA 4IEDA 3W4OA 1MPLA 3UO9A 2AVXA 2GNXA 3DTIA 3DAVA 4Y0OA 3A3JA 4U0TA 1HZOA 3ZNYA 5HZHA 2Q9MA 1S1ZA 1P0ZA 4L9GA 3N8RA 3WRTA 3VP0A 3PXPA 5TBMB 2XSSA 3W4QA 1BZAA 4S2NA 1EW0A 3FC7A 5U47A 3P7NA 2EXAA 5E2EA 3F1PA 3IXDA 3VFHA 2G7UA 1VHMA 4XT2B 4JXSA 1K0KA 1PRQA 1OTDA 5F6AA 1O07A 3QNBA 4O8GA 3SH8A 2H28A 1HD8A 2W3GA 2VK3A 1F5MA 4LGWA 5EOOA 4I3JA 3VV4A 5KSHA 2OLVA 1IKIA 1PI5A 1S67L 4PHTA 1G6OA 3HLWA 4E3LA 1S66L 2O99A 4ME4A 5FASA 3E2LA 4F3LB 3MFDA 3K3DA 1SKFA 1BT5A 5FQJA 4WMCA 3NOTC 4X1LA 5F5YA 2IWCA 4BL3A 1FCNA 5DJTA 3T4QA 1ERQA 3UB6A 2DRWA 4HEFA 3CPTA 1V9YA 1F9IA 5AQ9A 1GA9A 3UE3A 1IELA 3QP1A 4KQOA 2Y2JA 1TS8A 1YAXA 3HL9A 1CJFA 3R7WA 3S1YA 3JVUA 3IWOA 4N1XA 3CUEA 4BMWA 2XA7S 4HNBA 4ID4A 4CLCD 1VB6A 2XD5A 5FAQA 3MSHA 4R0QA 2B18A 4CLCC 3IWIA 2PR5A 2Y2QA 3MXQA 4NXGA 4GHIA 5G4ZA 4DDSA 2PD8A 3NBLA 3BJNA 4LV0A 4HIAA 3RTYA 3H82B 2P08A 1K57C 2P7JA 2VGLS 3IS2B 1ZG6A 5FA7A 2V0UA 1LL8A 1JTDA 5CHJA 3BFEA 3SZTA 4X69A 4CLCB 4GD8A 3TRCA 4BQMA 4MBFA 5DF7A 3U2AA 1NZUA 3LIFA 3T4OA 3OCLA 1KE0A 3KYQA 4EQIA 4PM6A 1OPXA 3FG8A 2XFTA 3F1NB 3KO6A 2XROA 4LV2A 1XXMA 2A24A 4BL2A 4R4SA 2Y2KA 3FPVA 3NULA 5L09A 4GJ4A 3BW6A 2P9VA 4I5SA 4L0LA 1MY8A 2Y91A 1UWPX 3Q1FA 3UB8A 3VE4A 3FYZA 4YOFA 3IT9A 1RGYA 1BSGA 3LY4A 3NECA 2JKFA 3RXWA 2E8IA 3UDFA 3LY3A 1L0EA 2FH5A 1CEFA 3NDEA 1JTGA 1I5QA 2WGWB 5DFYA 4DE2A 4OQHA 2ZL1B 3IQAA 4LRXC 4UA7A 3QP4A 2A2LA 3MQQA 3BQAA 3C7VA 2ZLYA 4IVKA 3P98A 3G32A 3N6IA 3UPOA 1NY0A 1RP5A 1KGEA 5F68A 2PYRA 3T1XA 2VZWA 4PM9A 3PBQA 4ZBEA 4OLDA 1FSWA 2PR6A 5DKLA 2QPNA 1CEGA 3UDIA 5HPFA 5TBMA 5F83A 3V3SA 5IU1A 1EI5A 3EEAA 5CTNA 3A0SA 4B88A 4XT2A 1D1JA 4S2IA 2V2FF 4ZJ1A 2V1BA 3Q7VB 4S2NC 4NEED 1A0KA 3O87A 1LL9A 1DJBA 2P74A 2OOLA 3BFDA 3E0YA 4JXVA 3PTEA 1SKOB 2INWA 1ES2A 4AFIA 4K08A 1GCEA 1G28A 4IBRA 5CGXA 3BLSA 1W63Q 1VETB 3LR3A 2R9XA 1CQAA 1K55C 3FWLA 4DF6A 3QP6A 4B93A 3QP8A 1ALQA 1OT6A 3VSLA 2W27A 2XEPA 3NOPC 4R6LA 2G2UA 4WN5A 3BQ8A 2V1ZA 5GLAA 4CQHA 4X56A 2ZOHA 2ZQDA 3MXSA 2M7VA 4EUZA 5BOHA 2GDNA 4R3BA 3ITBA 1ZG4A 4ZDXA 4HI4A 4LPZA 4BWIA 4Y15A 3WS4A 3DWKA 3HJIA 4MEZA 3CITA 4N9KA 3VOYA 3TG9A 1W8QA 1MC0A 2PDRA 5E43A 1KVLA 1BTLA 3ZDJA 4WLAA 2J3TD 5FQIA 2Y8HA 3VOLA 3TJZC 2J3TC 3G4PA 4DXBA 1VQQA 4FTXA 3LIDA 4S2MA 3H82A 3MS6A 3TOIA 4YWZA 1H8YA 2K2NA 5FQQA 5HSQA 1LSWA 4P87A 5FI7A 1OTBA 1FR1A 2Y79A 3ULFA 4JGOA 3T4JA 1AXBA 4OP5A 1KGGA 4CLCA 4O7DA 4LV3A 4GOGA 3VP2A 4HH3A 2FZ0A 3QHYA 3WRZA 4GZBA 2Y59A 4C3QA 4HQAA 3ISGA 3IH9A 4E3MA 2DNSA 1IFQA 2HP9A 3HBRA 3F1NA 2O9BA 1VM1A 5DKKA 1H3QA 4E6WA 1K57A 5GL9A 5TGFA 2ZC4B 3D3OA 2C6WB 3BWLA 4YINA 3FPWA 4GN2A 5L8MA 4IHQA 4HJ6A 1FCOA 2HDSA 1L0GA 3OBFA 4LCLA 4GKUA 3M2KA 2HF6A 4QJGA 5A93A 3OPRA 4BBUA 2HGVA 5FEFA 1NRFA 4KG6A 5HWVA 2WGIA 1OTIA 1SDNA 5FAPA 4EESA 2QJ7A 3MQ0A 1XPBA 2V9AA 3LIBA 3HLFA 4DXCA 4KENB 3MR0A 1HLUP 1T1BA 2V1AA 2BTFP 4Y7PA 4Y0UA 2BASA 2ZL1A 2V8CA 1T1CA 1Q2QA 1K38A 1K6RA 2Y2OA 4BJPA 4QB8A 3MZFA 4WZ5C 3R4KA 3VMAA 2PAVP 2MJ6A 5HD5A 3T4LA 1S1YA 1PNEA 3G2ZA 1KDSA 1N9BA 1T1AA 3IXBA 3K2NA 3SS3A 4BLMA 3NJAA 2Z6CA 2G2WA 2A49A 4DKIA 2KDKA 1CK3A 1TF1A 4HY8A 4O01A 4OPRA 5DVAA 5FQKA 4IUHA 3WS0A 4DDYA 5GLDA 3MQOA 3IWQA 1BLHA 4UA9A 3G2YA 1BYWA 3QP2A 3Q7VA 2JKRM 2XQZA 1NLZA 1N4OA 1XJ4A 1SKOA 5E2GA 2W1TB 3EQUA 4Q0HA 4DN0A 1MWUA 4EV4A 1NZOA 5CHMA 5FQ9A 5CECA 5I94A 4QD4A 3S22A 1P9RA 2ZQ8A 1GA0A 4NXFA 2PD7A 3SH7A 1IYPA 4NG2A 3AGEA 5L07A 4MBKA 2M1CA 5GLBA 5I5LA 3UMEA 2EFXA 1Y54A 3C30A 3PAEA 5AQ7A 4FD8A 3FKVA 5F1FA 4QHCA 2EX6A 1XJ3A 1F98A 3NOUC 3KYEA 4WM9A 3CI6A 1K55A 3H7WB 1TS7A 3KYZA 3EOIA 2WKHA 3IBJA 1WYBA 2FFFB 3I7JA 3SOIA 4EBNA 5EM0A 3T50A 2V8FA 4N1HA 5IT5A 4QU3A 4GB7A 1ONHA 5AQAA 5M1AA 3WS5A 1TDGA 1LI0A 3TW8A 3T1QB 5J4EA 3CLOA 1LSVA 2R9WA 1G5UA 3LR5A 3LIEA 4EXOA 1BULA 2JKTI 4OKPA 4BD0A 1LSXA 3C4PA 2LB9A 2IWBA 4H6JB 2HP6A 5DF8A 4XUXA 2JC7A 1PWCA 2H10A 3LEZA 3LO7A 4RX3A 2GJ3A 1BLSA 1ESUA 3FZCA 3LUQA 2Q9NA 4OPZA 4LRZE 5CGWA 4I38A 1C3BA 1HVBA 3KSHA 1G68A 1NYMA 2VGJA 5J8XA 3C2WA 3ZVTA 2ZMFA 3UDXA 1P97A 3F1OA 4O0PA 1XA7A 3LICA 5TFQA 1IYSA 2ZMAA 1FOFA 3D4FA 2X01A 2XK1A 4NETA 4PMAA 2W3HA 3B47A 5FI6A 2EXBA 1IYOA 3BRMA 2ZM8A 3G30A 4KZ4A 3A3EA 3M6BA 3S7PA 4LV1A 2JHEA 5C5KA 1EWZA 1NWZA 4Y17A 4I39A 4EETB 1ONGA 2XA7M 2QWSA 3HCYA 4QY6A 3ZG5A 3BFFA 1XA1A 2IA2A 4PAUA 4KQRA 4R1GA 2WAEA 5A8BA 3B3XA 2HZ5A 3JVVA 3HUOA 5CXWA 1CI9A 3V67A 3LI8A 4G3KA 3CMZA 3HLCA 4Y13A 5IHVA 3IHAA 2OAP1 1OTEA 3MKEA 1KGFA 2H5SA 2Y2IA 2R78A 1ODVA 4X25A 5HPIA 3MJQA 2VGLM 4E3NA 4DE1A 1F2KA 1UGUA 4UQIS 4WUJA 2W0NA 3QNCA 2H0TA 3E4QA 3ZNTA 2ZM0A 5HX9A 4R38A 2XD1A 5CHUA 4G3WA 5EE8A 3ZHHA 4XXRA 5A92A 4KQQA 3IH8A 3PYPA 4WZ5A 4RA7A 3BECA 2JN7A 4HP9A 3EWKA 2B02A 3PHYA 3LGOA 4PKYG 3SS4A 5DJUA 4B4XA 3DBAA 5EVEA 3VP4A 1KVMA 4CLCE 2DMWA 2W1TA 1L0FA 3T12B 3W4PA 5CTMA 3O86A 5EV0A 4U0XA 1DJCA 1S6RA 3PBOA 1LHYA 4IJGA 3V50A 1AWIA 2C5WB 3N7WA 3C7UA 1W5DA 1DP9A 4QWOA 5HAQA 5MC7A 1D06A 3MFXA 2PYPA 3GRJA 4Z9QA 1PWDA 4MMNA 1IEMA 2Q0OA 2QYBA 1LL5A 5DTTA 4Y5FA 2JCHA 2V0WA 4E3IA 4FH4A 1GHPA 2WKQA 4K0XA 4PM8A 3N8LA 5DTKA 1YLTA 1JWZA 3S4XA 4JXGA 1K56D 4HP4A 1PYYA 1XJ6A 5HWTA 4IUKA 4OONA 4FSFA 3ZG0A 3H7WA 4RX2A 3E4OA 3BYDA 3V3RA 2B95A 2E8JA 5FQMA 4F3LA 3NY4A 4JKTA 3UE6A 3GECA 3IXGA 2ZMVA 5F1GA 4ZTKA 4XUZA 3S7OA 5HAIA 3VE3A 5KSCA 2WZZA 3IF5A 5L10A 3EEHA 3K3CA 3BY9A 2YKHA 3NC8A 4H6JA 4Y2FA 1P9WA 2H0YA 3MKFA 2KOIA 1Z09A 3WWXA 4X1MA 1YSPA 2WK0A 5E2FA 4KQDA 2JBFA 2JKGA 5FI2A 5EFWA 5FSRA 1MWRA 1ESIA 4EU0A 4IVIA 4GW9A 4RQ9A 5HWWA 4OPQA 5EPHA 3M6HA 4KZ8A 3NIAA 3UE1A 2XH9A 3O5YA 1N9NA 4L9EA 2BLSA 4X68A 3KSGA 4R3AA 4E04A 1X0OA 1MZUA 3E2KA 2KX6A 4EBLA 2VJWA 2VA0A 3RFBA 3IX8A 3PBNA 4HBTA 3DW0A 3HLDA 3OZHA 1NXYA 4EWFA 3ZCZA 5M19A 3IS2A 5FAOA 3ICYA 5LBRA 1T19A 1TVFA 3LIAA 4OVDA 4JPMA 3ZQ5A 5GLCA 2NUPC 5EUAA 3IX3A 3B42A 2KLIA 1CI8A 3HUMA 2J9PA 5EVID 3D9YA 2O9AA 3Q81A 3HLEA 5EVIC 5GHXA 3A0RA 4KZ3A 5A91A 5HDDA 4S2KA 3C4OA 5HFOA 4N9LA 2ZC5B 1ACFA 4S2JA 4FOFA 5EOEA 2D02A 1T18A 3DWZA 3SH9A 3NHQA 4NKPA 4UEYA 3BEBA 1TEMA 1K54A 1YLWA 1GSXA 3VOZA 4ARZB 3EQVA 2JE5A 3OOVA 4OQIA 1K4FA 1Y4OA 3KSIA 5L2FA 3UB9A 2RL3A 1N9OA 2PU4A 2BG1A 4P6ZS 2J8YA 5EVIB 2WGVA 1PWGA 1L0DA 5CGSA 4LRYC 1YLPA 1XKZA 4DE0A 1M6KA 3FV7A 4FUWA 5FDSA 3KSFA 2J9OA 4MCWA 2HPBA 3G35A 1NJ4A 4OP8A 5CX7A 3EGXC 5K5BA 1G6AA 1RGZA 3V39A 1MWTA 2ZC7A 1SCWA 3T4TA 1GSWA 3PAGA 3T1RA 3CAXA 2WGWA 1XJ2A 4R70A 1K6SA 3WS1A 1ES5A 5TR7A 2W3EA 3FKWA 4Z1WA 1XFNA 5G4YA 3IHBA 5HW3A 1H8ZA 1Q2PA 4LLOB 4A5RA 3BY8A 4PPRA 4E6XA 1LLBA 4JGRA 4KUKA 5AJGA 4WYYA 4ZJ3A 5KMWA 4JLFA 3W8KA 4DJ3A 2WADA 3H9WA 4ESPA 3CHWP 4K91A 5DFXA 3C38A 2Y2HA 1OTAA 4KZ6A 4OOYA 4P6BA 4JXWA 4X55A 3N4IA 3BFCA 3ZG8B 4DE3A 4BENA 4NK3A 3AGDA 4QPRA 2O0YA 2VGKA 2HDRA 2QJ5A 2NUTC 4HOIA 3P09A 3PBTA 4PM7A 1GHMA 4D2OA 5JYPA 1E25A 1RCJA 3CJMA 1E4DA 1YMXA 2K31A 2DCFA 4WZ4A 2X02A 1VETA 3S7NA 4K0WA 1KE4A 1W7FA 3C8CA 2HJ9C 2ZQAA 5CERA 2ACGA 3RJUA 1IOUA 3UB7A 4JF6A 4OQGA 2ZQ7A 1S4RA 1TDLA 4KZBA 2J3WA 4N92A 3TE8A 3JYIA 1YQSA 4JF4A 4DMZA 1K56A 1DP8A 5HARA 1PI4A 1DRMA 5KZHA 3CWFA 4G3VA 2WKRA 1PIOA 4ZAMA 3GTCA 1YT4A 1JWPA 3A0VA 4Y0TA 2XR0A 3IF6C 1L2SA 4BBVA 3UB5P 1WA9A 4C6YA 1YLYA 1YMSA 4HJ3A 1K25A 2XDMA 4L9FA 2PU2A 3OLOA 3HLBA 1I2WA 3HUNA 2ZM2A 1OMEA 1J9MA 1KDWA 2I9VA 4OPYA 4MN5A 5HDCA 4U3TA 2EWWA 4S2PA 4ZRRA 1ZHHB 4GNUA 4MN6A 4GS9B 4OH0A 1O7EA 4KUOA 3HVFA 3IF6B 5HL6A 1W79A 4ETZA 2JKTM 1W63M 2Y55A 3G34A 3OCNA 5HDSA 2PBDP 2Y2MA 4LENA 4WL9A 2X71A 5CEBA 2V20A 1YM1A 2UWXA 4GDNA 2J80A 4P0MA 1NYYA 2WKPA 1EROA 3DTMA 4C75A 2EX2A 3TSGA 4GDBA 3LI9A 2HP5A 1FSYA 4BD1A 4NXBA 2Y2PA 4Y3IA 4ARZA 1LT0A 4RYEA 5HD3A 2Z2MB 2OWJA 5EVIA 2PT7A 4MDZA 1K54C 1UWNX 4KZ9A 4BBTA 1U60A 5J3WA 2OSUA 4HBUA 3G6OA 3LFVA 1ES3A 4B4ZA 1NRJA 3A3DA 4EBPA 3BLMA 2L4RA 1MKMA 3MF0A 4CPKA 5DTSA 4ETXA 3RH8B 1OJGA 2L1MA 4GCZA 3VP1A 4HJ4A 4HESA 1E3UD 3CZDA 2Y2NA 5HAPA 1M40A 1FIKA 1HTZA 2Y2LA 3LYXA 1IKGA 2PHYA 5GHYA 4ZJ2A 3UMDA 4QY5A 4I3IA 4E3KA 4EEUA 3NCKA 2CMNA 3GVBA 3GQZA 5E2HA 2J7VA 2ZC6B 4OOMA 3VFFA 2IWDA 4DRTA 2WKEA 1GHIA 4F94A 3T4SA 3IBRA 2OWHA 4WF0A 5FL3A 2Y4AA 2QMIA 1SZVA 3OC2A 3MXRA 2QZ6A 3DTEA 1BLPA 4LCMA 3LR0A 5GHZA 4E3OA 2P04A 4EEPA 4MBHA 1LI9A 2HDUA 3QP5A 3C5AA 3BFGA 3T4KA 2VV6A 5HL1A 1JNUA 1XX2A 1YSQA 3O3VA 1DP6A 4UQIM 3HLGA 2WKIA 1KE3A 4IBXA 4YFMA 2I72A 1PW8A 2HJEA 1TS6A 5FDHA 1WE4A 1VEUB 2ZJ9A 4PM5A 3SW1A 4RVAA 2W3FA 5FATA 4WEKA 1N9LA 3Q07A 3VP3A 5TJJA 3GMWA 2EX8A 3P01A 1IYQA 3A3IA 1SDEA 3L9KA 2HDQA 3N8SA 2M7UA 3IXHA 5EVLA 5IS1A 5CEDA 5D3OA 1SHVA 3OPPA 2Z6DA 4B9OA 2WZXA 5AQBA 2WAFA 2XRNA 3PR6A 1YPRA 2VV7A 1V9ZA 4II7A 2B5RA 2EX9A 1GSVA 1BUEA 2VEAA 4GD6A 2WYXA 3UY6A 1BLCA 4WBGA 1ERMA 1FQGA 3MMHA 1STZA 4NXEA 4R23A 1I2SA 4R4RA 3GSGA 4MN7A 4EW7A 3GV9A 4JF5A 4GS9A 1OJ5A 2PRFA 3SS5A 5M18A 3IF6A 1YLJA 1MBLA 3ZVWA 2VV8A 3HJKA 3OPLA 1FCMA 2ZC3B 1ES4A 5EECA 1CF0A 4WMCD 3F1PB 3UPPA 1H8MA 1QMFA 3MZEA 3NDGA 3V5MA 1ZC2A 4EERA 2FFYA 1DY6A 2L0WA 5AVEA 1QMEA 2ZBBA 2GX5A 2EA9A 3W2ZA 2Z2LB 5G18A 5EM1A 2OAQ1 4WEJA 3UPNA 2W1RA 3L7HA 1D7EA 2RCXA 4Q8IA 3UE0A 1MWSA 1ZKJA 2ZOIA 3CUEC 4X53A 4HH2A 4X6TA 4I3AA 3E98A 4CJNA 3GR2A 4D60A 1NLYA 2OLUA 4JGPA 4UHUA 2EWVA 3WS2A 2CC1A 3ITAA 2QHKA 4YNRA 3CPTB 1XFQA 4M4XA 2XFSA 3JPUA 1Z6FA 1KOUA 4LFUA 1Y28A 3NI9A 1K4EA 1XGIA 3R7WB 3DTKA 1XP4A 3E4PA 4M3KA 5FEGA 5J7EA 3D72A 3ZG9B 3UN7A 3Q7ZA 2QKPA 4KG5A 4S2LA 1YKDA 3S7QA 3O88A 3UNWA 3B33A 4OLGA 4H8RA 4OQ0A 5F69A 3CG5A 4R3JA 4GHIB 4JBFA 4KZ7A 2YKFA 4HHDA 3F1OB 4GLQA 1PZOA 4MNRA 4OOLA 4MLLA 3VSKA 2O9CA 4P85A 3LCEA 5CRFA 3MBZA 2ZQ9A 5A90A 2Y2GA 1YLZA 1PW1A 3IX4A 3MZDA 3KX0X 4FCFA 2XGNA 4JGQA 2XF3A 3RXXA 2EFUA 4S2OA 1FR6A 4WELA 4Q0IA 3T1SA 3LEQA 4EUVA 1E3UA 2VLGA 2VKSA 2OV5A 3U4LP 2HV1A 1MXOA 3BM6A 3HREA 3G31A 1PZPA 3PBRA 5DF9A 4P6ZM 2VX8A 1JVJA 1WYCA 2ZQCA 4KZAA 3OPHA 4KZ5A 1J3WA 2A24B 1VEUA 4UAAA 1PFLA 3LR4A 3ZGAB 1H5XA 2P9VB 3AGFA 3PBSA 2ZD8A 3A3FA 1S0WA 4PKYA 2A3UA 2WUQA 4UA6A 2D01A 1S4SA 4KG2A 2UV0E 1ZTUA 3M2JA 3GDIA 3ZYTA 1MKIA 4EQ1A 4E3JA 1DJAA 1JWVA 2W3DA 3ZG7B 2JKRI 1W8YA 3EGDC 1FILA 5F82A 4FH2A 3Q82A 1TS0A 5JYOA 1XGJA 2GZAA 1TD5A 4DJ2A
chains in the Genus database with same CATH topology
4CLCA 4Y3IA 4ARZA 1LT0A 4HH3A 2FZ0A 5HD3A 1OT9A 2WKQA 2LB5A 2K7SA 2OWJA 5KIZA 4HQAA 5AVFA 4Q0JA 2PT7A 4MDZA 2GNXA 1UWNX 1IFQA 4BBTA 3F1NA 5J3WA 2O9BA 4HP4A 5DKKA 5HZHA 1XJ6A 5HWTA 1H3QA 4IUKA 3G6OA 4FSFA 1S1ZA 3H7WA 1P0ZA 3D3OA 4L9GA 3BWLA 3LFVA 3FPWA 3E4OA 3PXPA 2XSSA 5TBMB 1NRJA 5L8MA 4IHQA 4HJ6A 1EW0A 3FC7A 2L4RA 3P7NA 4F3LA 3UE6A 1MKMA 3MF0A 3OBFA 3F1PA 4ETXA 3GECA 2G7UA 1VHMA 2HF6A 4XT2B 3RH8B 1OJGA 2L1MA 2ZMVA 4GCZA 3S7OA 4BBUA 1OTDA 4HJ4A 5F6AA 2HGVA 3VE3A 4O8GA 5HWVA 2H28A 1OTIA 3EEHA 2W3GA 4EESA 1F5MA 3K3CA 3BY9A 2YKHA 4I3JA 2QJ7A 3MQ0A 4H6JA 3LYXA 3UMDA 2PHYA 3VV4A 5KSHA 2V9AA 4Y2FA 3LIBA 4I3IA 1P9WA 1S67L 2KOIA 4EEUA 4PHTA 3MR0A 1G6OA 1S66L 2O99A 1YSPA 4ME4A 1T1BA 2V1AA 2CMNA 4KQDA 2BASA 4F3LB 1T1CA 3K3DA 5EFWA 4OOMA 4BJPA 4EU0A 3NOTC 4GW9A 5F5YA 3R4KA 4RQ9A 5HWWA 2MJ6A 5HD5A 5DJTA 3T4LA 3T4QA 1S1YA 3O5YA 3T4SA 3IBRA 2OWHA 3UB6A 1N9NA 1T1AA 4L9EA 4WF0A 5FL3A 3KSGA 4R3AA 3K2NA 3OC2A 4E04A 1X0OA 3NJAA 1V9YA 2Z6CA 1F9IA 1MZUA 2KX6A 2VJWA 3LR0A 2VA0A 3UE3A 4KQOA 2KDKA 2P04A 3RFBA 4EEPA 1TF1A 4HY8A 1TS8A 1YAXA 3PBNA 4O01A 3R7WA 4IUHA 3T4KA 2VV6A 3JVUA 3MQOA 3CUEA 1JNUA 1YSQA 3IS2A 4BMWA 1DP6A 4UQIM 3ICYA 5LBRA 1T19A 2XA7S 1BYWA 4HNBA 4CLCD 2HJEA 1VB6A 1TS6A 2B18A 3LIAA 4CLCC 3ZQ5A 2PR5A 2JKRM 3SW1A 1NLZA 2NUPC 2W3FA 3MXQA 4NXGA 3B42A 4WEKA 1N9LA 1XJ4A 2KLIA 4GHIA 5TJJA 2W1TB 3EQUA 4Q0HA 2O9AA 5G4ZA 4DN0A 2PD8A 3P01A 3A0RA 3BJNA 2M7UA 5IS1A 5HDDA 4HIAA 3RTYA 3H82B 1P9RA 2P08A 2Z6DA 4B9OA 4FOFA 2XRNA 3PR6A 2VV7A 4NXFA 2P7JA 2VGLS 2PD7A 3IS2B 1V9ZA 2D02A 1T18A 4II7A 2V0UA 1LL8A 1GSVA 3NHQA 4NKPA 2VEAA 4UEYA 4CLCB 1GSXA 3MMHA 2M1CA 1STZA 4ARZB 4NXEA 3EQVA 5I5LA 3UMEA 3OOVA 4MN7A 3C30A 3KSIA 3TRCA 3UB9A 1N9OA 3U2AA 4EW7A 3LIFA 4P6ZS 3T4OA 3OCLA 3KYQA 4GS9A 4LRYC 1OJ5A 1OPXA 3FG8A 1XJ3A 1F98A 3F1NB 3KO6A 3NOUC 3KSFA 2XROA 4MCWA 3CI6A 5CX7A 3EGXC 5K5BA 3H7WB 1TS7A 3KYZA 2VV8A 2A24A 3EOIA 3HJKA 3T4TA 3FPVA 1GSWA 3IBJA 4GJ4A 3CAXA 1XJ2A 3BW6A 4R70A 3T50A 5IT5A 4I5SA 4L0LA 2W3EA 3F1PB 1H8MA 1UWPX 3UB8A 4Z1WA 1XFNA 3VE4A 4YOFA 4EERA 3TW8A 5G4YA 2L0WA 5AVEA 4LLOB 5J4EA 2ZBBA 3BY8A 2GX5A 3CLOA 1LSVA 2EA9A 3LR5A 3LIEA 3W2ZA 4EXOA 2JKTI 1LSXA 2LB9A 4H6JB 4JGRA 2OAQ1 2FH5A 4WEJA 4KUKA 5AJGA 2W1RA 1D7EA 4DJ3A 5DFYA 2GJ3A 3H9WA 2ZOIA 3CUEC 5DFXA 3C38A 3LUQA 4LRXC 1OTAA 4HH2A 4I3AA 2A2LA 4LRZE 3MQQA 4I38A 3BQAA 3E98A 3KSHA 1NLYA 4QPRA 2O0YA 3C2WA 4JGPA 2ZMFA 5F68A 2PYRA 2QJ5A 2EWVA 2QHKA 2NUTC 4YNRA 1P97A 1XFQA 2VZWA 4HOIA 3PBTA 3F1OA 4M4XA 4O0PA 3PBQA 1KOUA 1Y28A 3LICA 2PR6A 5DKLA 5HPFA 2K31A 5TBMA 3R7WB 5IU1A 3EEAA 3E4PA 3S7NA 2W3HA 3A0SA 3B47A 3C8CA 2HJ9C 5J7EA 3D72A 4XT2A 1IOUA 2QKPA 3UB7A 2V1BA 4NEED 1YKDA 3S7QA 2OOLA 3B33A 3S7PA 1S4RA 5F69A 2J3WA 2JHEA 3E0YA 5C5KA 4GHIB 1NWZA 2INWA 3TE8A 2YKFA 4I39A 4HHDA 4EETB 2XA7M 3F1OB 2QWSA 4DMZA 4GLQA 3HCYA 4K08A 4AFIA 1DP8A 4OOLA 2O9CA 1G28A 1DRMA 3CWFA 2IA2A 2WKRA 4G3VA 4PAUA 1W63Q 5A8BA 3A0VA 3JVVA 3LR3A 3V67A 4BBVA 3LI8A 4G3KA 1WA9A 4B93A 4HJ3A 1OT6A 3KX0X 4L9FA 2W27A 3OLOA 3NOPC 4JGQA 4R6LA 4WN5A 3BQ8A 2OAP1 1OTEA 4WELA 2R78A 1ODVA 4Q0IA 4CQHA 5HPIA 3MJQA 4EUVA 2VGLM 2I9VA 2ZOHA 2VLGA 4MN5A 1UGUA 4UQIS 4WUJA 2VKSA 2M7VA 5HDCA 2EWWA 2W0NA 4ZRRA 2HV1A 1ZHHB 4MN6A 4GS9B 3E4QA 4KUOA 4HI4A 3PBRA 4R38A 4LPZA 4BWIA 5DF9A 4G3WA 4P6ZM 5HL6A 2VX8A 3PYPA 4ETZA 2A24B 2JKTM 1W63M 3HJIA 2JN7A 3CITA 4HP9A 3EWKA 2B02A 3PHYA 3LR4A 4PKYG 3OCNA 5HDSA 1MC0A 5DJUA 3DBAA 2PDRA 4CLCE 3PBSA 2DMWA 2W1TA 4WL9A 4PKYA 4WLAA 2D01A 2J3TD 1S4SA 2Y8HA 3VOLA 3PBOA 1ZTUA 3TJZC 4IJGA 2J3TC 3GDIA 2J80A 3LIDA 3H82A 3ZYTA 2WKPA 1DP9A 4YWZA 4EQ1A 5MC7A 1D06A 2K2NA 2PYPA 1LSWA 2W3DA 3MFXA 5HSQA 1OTBA 2JKRI 2Y79A 3ULFA 4JGOA 3EGDC 4DJ2A 3LI9A 3T4JA 4MMNA 1TS0A 2QYBA 2GZAA 4NXBA 1TD5A 4Y5FA 2V0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMZ A;  4Y3I A;  4GLQ A;  3HCY A;  2VJW A;  2O9C A;  2W3E A;  2LB5 A;  3RFB A;  1TF1 A;  2IA2 A;  4G3V A;  4PAU A;  4Z1W A;  4O01 A;  4Q0J A;  4IUH A;  4YOF A;  4MDZ A;  4G3K A;  1YSQ A;  5LBR A;  2GX5 A;  2O9B A;  3W2Z A;  2B18 A;  3NOP C;  4R6L A;  2LB9 A;  3ZQ5 A;  4IUK A;  3G6O A;  2W3F A;  5AJG A;  3D3O A;  2W1R A;  4Q0I A;  4CQH A;  2KLI A;  3LFV A;  5TJJ A;  5HPI A;  2W1T B;  4EUV A;  4Q0H A;  2XSS A;  2O9A A;  5L8M A;  4DN0 A;  3BJN A;  5DFY A;  2VKS A;  2M7V A;  1MKM A;  3MF0 A;  3OBF A;  4ZRR A;  2M7U A;  5DFX A;  4LRX C;  4ETX A;  2G7U A;  1VHM A;  4LRZ E;  3S7O A;  3E98 A;  4BWI A;  4FOF A;  3KSH A;  2XRN A;  2HGV A;  4G3W A;  4QPR A;  2O0Y A;  3C2W A;  4O8G A;  5HL6 A;  2ZMF A;  4ETZ A;  3NHQ A;  2W3G A;  2VEA A;  4YNR A;  1F5M A;  2VZW A;  3CIT A;  3MQ0 A;  4O0P A;  3VV4 A;  1MC0 A;  3MMH A;  1STZ A;  3DBA A;  4Y2F A;  5I5L A;  3OOV A;  4MN7 A;  5HPF A;  2KOI A;  2W1T A;  3TRC A;  3KSI A;  2K31 A;  2O99 A;  1YSP A;  4ME4 A;  3EEA A;  3S7N A;  2Y8H A;  2W3H A;  1ZTU A;  4IJG A;  4LRY C;  4EU0 A;  3NOT C;  4GW9 A;  3NOU C;  3KO6 A;  3R4K A;  3KSF A;  4RQ9 A;  2XRO A;  4MCW A;  2K2N A;  2W3D A;  1YKD A;  5HSQ A;  3CI6 A;  3S7Q A;  3O5Y A;  2OOL A;  3IBR A;  5K5B A;  3S7P A;  2Y79 A;  3E0Y A;  5C5K A;  4MMN A;  3IBJ A;  2QYB A;  3KSG A;  1TD5 A;  4Y5F A;  3K2N A;  4R70 A;  4E04 A; 
#chains in the Genus database with same CATH topology
 3ZFZ A;  2PBY A;  1L3L A;  1H0M A;  1OT9 A;  2XLN A;  2LB5 A;  2K7S A;  5KIZ A;  5AVF A;  4Q0J A;  4IED A;  3W4O A;  1MPL A;  3UO9 A;  2AVX A;  2GNX A;  3DTI A;  3DAV A;  4Y0O A;  3A3J A;  4U0T A;  1HZO A;  3ZNY A;  5HZH A;  2Q9M A;  1S1Z A;  1P0Z A;  4L9G A;  3N8R A;  3WRT A;  3VP0 A;  3PXP A;  5TBM B;  2XSS A;  3W4Q A;  1BZA A;  4S2N A;  1EW0 A;  3FC7 A;  5U47 A;  3P7N A;  2EXA A;  5E2E A;  3F1P A;  3IXD A;  3VFH A;  2G7U A;  1VHM A;  4XT2 B;  4JXS A;  1K0K A;  1PRQ A;  1OTD A;  5F6A A;  1O07 A;  3QNB A;  4O8G A;  3SH8 A;  2H28 A;  1HD8 A;  2W3G A;  2VK3 A;  1F5M A;  4LGW A;  5EOO A;  4I3J A;  3VV4 A;  5KSH A;  2OLV A;  1IKI A;  1PI5 A;  1S67 L;  4PHT A;  1G6O A;  3HLW A;  4E3L A;  1S66 L;  2O99 A;  4ME4 A;  5FAS A;  3E2L A;  4F3L B;  3MFD A;  3K3D A;  1SKF A;  1BT5 A;  5FQJ A;  4WMC A;  3NOT C;  4X1L A;  5F5Y A;  2IWC A;  4BL3 A;  1FCN A;  5DJT A;  3T4Q A;  1ERQ A;  3UB6 A;  2DRW A;  4HEF A;  3CPT A;  1V9Y A;  1F9I A;  5AQ9 A;  1GA9 A;  3UE3 A;  1IEL A;  3QP1 A;  4KQO A;  2Y2J A;  1TS8 A;  1YAX A;  3HL9 A;  1CJF A;  3R7W A;  3S1Y A;  3JVU A;  3IWO A;  4N1X A;  3CUE A;  4BMW A;  2XA7 S;  4HNB A;  4ID4 A;  4CLC D;  1VB6 A;  2XD5 A;  5FAQ A;  3MSH A;  4R0Q A;  2B18 A;  4CLC C;  3IWI A;  2PR5 A;  2Y2Q A;  3MXQ A;  4NXG A;  4GHI A;  5G4Z A;  4DDS A;  2PD8 A;  3NBL A;  3BJN A;  4LV0 A;  4HIA A;  3RTY A;  3H82 B;  2P08 A;  1K57 C;  2P7J A;  2VGL S;  3IS2 B;  1ZG6 A;  5FA7 A;  2V0U A;  1LL8 A;  1JTD A;  5CHJ A;  3BFE A;  3SZT A;  4X69 A;  4CLC B;  4GD8 A;  3TRC A;  4BQM A;  4MBF A;  5DF7 A;  3U2A A;  1NZU A;  3LIF A;  3T4O A;  3OCL A;  1KE0 A;  3KYQ A;  4EQI A;  4PM6 A;  1OPX A;  3FG8 A;  2XFT A;  3F1N B;  3KO6 A;  2XRO A;  4LV2 A;  1XXM A;  2A24 A;  4BL2 A;  4R4S A;  2Y2K A;  3FPV A;  3NUL A;  5L09 A;  4GJ4 A;  3BW6 A;  2P9V A;  4I5S A;  4L0L A;  1MY8 A;  2Y91 A;  1UWP X;  3Q1F A;  3UB8 A;  3VE4 A;  3FYZ A;  4YOF A;  3IT9 A;  1RGY A;  1BSG A;  3LY4 A;  3NEC A;  2JKF A;  3RXW A;  2E8I A;  3UDF A;  3LY3 A;  1L0E A;  2FH5 A;  1CEF A;  3NDE A;  1JTG A;  1I5Q A;  2WGW B;  5DFY A;  4DE2 A;  4OQH A;  2ZL1 B;  3IQA A;  4LRX C;  4UA7 A;  3QP4 A;  2A2L A;  3MQQ A;  3BQA A;  3C7V A;  2ZLY A;  4IVK A;  3P98 A;  3G32 A;  3N6I A;  3UPO A;  1NY0 A;  1RP5 A;  1KGE A;  5F68 A;  2PYR A;  3T1X A;  2VZW A;  4PM9 A;  3PBQ A;  4ZBE A;  4OLD A;  1FSW A;  2PR6 A;  5DKL A;  2QPN A;  1CEG A;  3UDI A;  5HPF A;  5TBM A;  5F83 A;  3V3S A;  5IU1 A;  1EI5 A;  3EEA A;  5CTN A;  3A0S A;  4B88 A;  4XT2 A;  1D1J A;  4S2I A;  2V2F F;  4ZJ1 A;  2V1B A;  3Q7V B;  4S2N C;  4NEE D;  1A0K A;  3O87 A;  1LL9 A;  1DJB A;  2P74 A;  2OOL A;  3BFD A;  3E0Y A;  4JXV A;  3PTE A;  1SKO B;  2INW A;  1ES2 A;  4AFI A;  4K08 A;  1GCE A;  1G28 A;  4IBR A;  5CGX A;  3BLS A;  1W63 Q;  1VET B;  3LR3 A;  2R9X A;  1CQA A;  1K55 C;  3FWL A;  4DF6 A;  3QP6 A;  4B93 A;  3QP8 A;  1ALQ A;  1OT6 A;  3VSL A;  2W27 A;  2XEP A;  3NOP C;  4R6L A;  2G2U A;  4WN5 A;  3BQ8 A;  2V1Z A;  5GLA A;  4CQH A;  4X56 A;  2ZOH A;  2ZQD A;  3MXS A;  2M7V A;  4EUZ A;  5BOH A;  2GDN A;  4R3B A;  3ITB A;  1ZG4 A;  4ZDX A;  4HI4 A;  4LPZ A;  4BWI A;  4Y15 A;  3WS4 A;  3DWK A;  3HJI A;  4MEZ A;  3CIT A;  4N9K A;  3VOY A;  3TG9 A;  1W8Q A;  1MC0 A;  2PDR A;  5E43 A;  1KVL A;  1BTL A;  3ZDJ A;  4WLA A;  2J3T D;  5FQI A;  2Y8H A;  3VOL A;  3TJZ C;  2J3T C;  3G4P A;  4DXB A;  1VQQ A;  4FTX A;  3LID A;  4S2M A;  3H82 A;  3MS6 A;  3TOI A;  4YWZ A;  1H8Y A;  2K2N A;  5FQQ A;  5HSQ A;  1LSW A;  4P87 A;  5FI7 A;  1OTB A;  1FR1 A;  2Y79 A;  3ULF A;  4JGO A;  3T4J A;  1AXB A;  4OP5 A;  1KGG A;  4CLC A;  4O7D A;  4LV3 A;  4GOG A;  3VP2 A;  4HH3 A;  2FZ0 A;  3QHY A;  3WRZ A;  4GZB A;  2Y59 A;  4C3Q A;  4HQA A;  3ISG A;  3IH9 A;  4E3M A;  2DNS A;  1IFQ A;  2HP9 A;  3HBR A;  3F1N A;  2O9B A;  1VM1 A;  5DKK A;  1H3Q A;  4E6W A;  1K57 A;  5GL9 A;  5TGF A;  2ZC4 B;  3D3O A;  2C6W B;  3BWL A;  4YIN A;  3FPW A;  4GN2 A;  5L8M A;  4IHQ A;  4HJ6 A;  1FCO A;  2HDS A;  1L0G A;  3OBF A;  4LCL A;  4GKU A;  3M2K A;  2HF6 A;  4QJG A;  5A93 A;  3OPR A;  4BBU A;  2HGV A;  5FEF A;  1NRF A;  4KG6 A;  5HWV A;  2WGI A;  1OTI A;  1SDN A;  5FAP A;  4EES A;  2QJ7 A;  3MQ0 A;  1XPB A;  2V9A A;  3LIB A;  3HLF A;  4DXC A;  4KEN B;  3MR0 A;  1HLU P;  1T1B A;  2V1A A;  2BTF P;  4Y7P A;  4Y0U A;  2BAS A;  2ZL1 A;  2V8C A;  1T1C A;  1Q2Q A;  1K38 A;  1K6R A;  2Y2O A;  4BJP A;  4QB8 A;  3MZF A;  4WZ5 C;  3R4K A;  3VMA A;  2PAV P;  2MJ6 A;  5HD5 A;  3T4L A;  1S1Y A;  1PNE A;  3G2Z A;  1KDS A;  1N9B A;  1T1A A;  3IXB A;  3K2N A;  3SS3 A;  4BLM A;  3NJA A;  2Z6C A;  2G2W A;  2A49 A;  4DKI A;  2KDK A;  1CK3 A;  1TF1 A;  4HY8 A;  4O01 A;  4OPR A;  5DVA A;  5FQK A;  4IUH A;  3WS0 A;  4DDY A;  5GLD A;  3MQO A;  3IWQ A;  1BLH A;  4UA9 A;  3G2Y A;  1BYW A;  3QP2 A;  3Q7V A;  2JKR M;  2XQZ A;  1NLZ A;  1N4O A;  1XJ4 A;  1SKO A;  5E2G A;  2W1T B;  3EQU A;  4Q0H A;  4DN0 A;  1MWU A;  4EV4 A;  1NZO A;  5CHM A;  5FQ9 A;  5CEC A;  5I94 A;  4QD4 A;  3S22 A;  1P9R A;  2ZQ8 A;  1GA0 A;  4NXF A;  2PD7 A;  3SH7 A;  1IYP A;  4NG2 A;  3AGE A;  5L07 A;  4MBK A;  2M1C A;  5GLB A;  5I5L A;  3UME A;  2EFX A;  1Y54 A;  3C30 A;  3PAE A;  5AQ7 A;  4FD8 A;  3FKV A;  5F1F A;  4QHC A;  2EX6 A;  1XJ3 A;  1F98 A;  3NOU C;  3KYE A;  4WM9 A;  3CI6 A;  1K55 A;  3H7W B;  1TS7 A;  3KYZ A;  3EOI A;  2WKH A;  3IBJ A;  1WYB A;  2FFF B;  3I7J A;  3SOI A;  4EBN A;  5EM0 A;  3T50 A;  2V8F A;  4N1H A;  5IT5 A;  4QU3 A;  4GB7 A;  1ONH A;  5AQA A;  5M1A A;  3WS5 A;  1TDG A;  1LI0 A;  3TW8 A;  3T1Q B;  5J4E A;  3CLO A;  1LSV A;  2R9W A;  1G5U A;  3LR5 A;  3LIE A;  4EXO A;  1BUL A;  2JKT I;  4OKP A;  4BD0 A;  1LSX A;  3C4P A;  2LB9 A;  2IWB A;  4H6J B;  2HP6 A;  5DF8 A;  4XUX A;  2JC7 A;  1PWC A;  2H10 A;  3LEZ A;  3LO7 A;  4RX3 A;  2GJ3 A;  1BLS A;  1ESU A;  3FZC A;  3LUQ A;  2Q9N A;  4OPZ A;  4LRZ E;  5CGW A;  4I38 A;  1C3B A;  1HVB A;  3KSH A;  1G68 A;  1NYM A;  2VGJ A;  5J8X A;  3C2W A;  3ZVT A;  2ZMF A;  3UDX A;  1P97 A;  3F1O A;  4O0P A;  1XA7 A;  3LIC A;  5TFQ A;  1IYS A;  2ZMA A;  1FOF A;  3D4F A;  2X01 A;  2XK1 A;  4NET A;  4PMA A;  2W3H A;  3B47 A;  5FI6 A;  2EXB A;  1IYO A;  3BRM A;  2ZM8 A;  3G30 A;  4KZ4 A;  3A3E A;  3M6B A;  3S7P A;  4LV1 A;  2JHE A;  5C5K A;  1EWZ A;  1NWZ A;  4Y17 A;  4I39 A;  4EET B;  1ONG A;  2XA7 M;  2QWS A;  3HCY A;  4QY6 A;  3ZG5 A;  3BFF A;  1XA1 A;  2IA2 A;  4PAU A;  4KQR A;  4R1G A;  2WAE A;  5A8B A;  3B3X A;  2HZ5 A;  3JVV A;  3HUO A;  5CXW A;  1CI9 A;  3V67 A;  3LI8 A;  4G3K A;  3CMZ A;  3HLC A;  4Y13 A;  5IHV A;  3IHA A;  2OAP 1;  1OTE A;  3MKE A;  1KGF A;  2H5S A;  2Y2I A;  2R78 A;  1ODV A;  4X25 A;  5HPI A;  3MJQ A;  2VGL M;  4E3N A;  4DE1 A;  1F2K A;  1UGU A;  4UQI S;  4WUJ A;  2W0N A;  3QNC A;  2H0T A;  3E4Q A;  3ZNT A;  2ZM0 A;  5HX9 A;  4R38 A;  2XD1 A;  5CHU A;  4G3W A;  5EE8 A;  3ZHH A;  4XXR A;  5A92 A;  4KQQ A;  3IH8 A;  3PYP A;  4WZ5 A;  4RA7 A;  3BEC A;  2JN7 A;  4HP9 A;  3EWK A;  2B02 A;  3PHY A;  3LGO A;  4PKY G;  3SS4 A;  5DJU A;  4B4X A;  3DBA A;  5EVE A;  3VP4 A;  1KVM A;  4CLC E;  2DMW A;  2W1T A;  1L0F A;  3T12 B;  3W4P A;  5CTM A;  3O86 A;  5EV0 A;  4U0X A;  1DJC A;  1S6R A;  3PBO A;  1LHY A;  4IJG A;  3V50 A;  1AWI A;  2C5W B;  3N7W A;  3C7U A;  1W5D A;  1DP9 A;  4QWO A;  5HAQ A;  5MC7 A;  1D06 A;  3MFX A;  2PYP A;  3GRJ A;  4Z9Q A;  1PWD A;  4MMN A;  1IEM A;  2Q0O A;  2QYB A;  1LL5 A;  5DTT A;  4Y5F A;  2JCH A;  2V0W A;  4E3I A;  4FH4 A;  1GHP A;  2WKQ A;  4K0X A;  4PM8 A;  3N8L A;  5DTK A;  1YLT A;  1JWZ A;  3S4X A;  4JXG A;  1K56 D;  4HP4 A;  1PYY A;  1XJ6 A;  5HWT A;  4IUK A;  4OON A;  4FSF A;  3ZG0 A;  3H7W A;  4RX2 A;  3E4O A;  3BYD A;  3V3R A;  2B95 A;  2E8J A;  5FQM A;  4F3L A;  3NY4 A;  4JKT A;  3UE6 A;  3GEC A;  3IXG A;  2ZMV A;  5F1G A;  4ZTK A;  4XUZ A;  3S7O A;  5HAI A;  3VE3 A;  5KSC A;  2WZZ A;  3IF5 A;  5L10 A;  3EEH A;  3K3C A;  3BY9 A;  2YKH A;  3NC8 A;  4H6J A;  4Y2F A;  1P9W A;  2H0Y A;  3MKF A;  2KOI A;  1Z09 A;  3WWX A;  4X1M A;  1YSP A;  2WK0 A;  5E2F A;  4KQD A;  2JBF A;  2JKG A;  5FI2 A;  5EFW A;  5FSR A;  1MWR A;  1ESI A;  4EU0 A;  4IVI A;  4GW9 A;  4RQ9 A;  5HWW A;  4OPQ A;  5EPH A;  3M6H A;  4KZ8 A;  3NIA A;  3UE1 A;  2XH9 A;  3O5Y A;  1N9N A;  4L9E A;  2BLS A;  4X68 A;  3KSG A;  4R3A A;  4E04 A;  1X0O A;  1MZU A;  3E2K A;  2KX6 A;  4EBL A;  2VJW A;  2VA0 A;  3RFB A;  3IX8 A;  3PBN A;  4HBT A;  3DW0 A;  3HLD A;  3OZH A;  1NXY A;  4EWF A;  3ZCZ A;  5M19 A;  3IS2 A;  5FAO A;  3ICY A;  5LBR A;  1T19 A;  1TVF A;  3LIA A;  4OVD A;  4JPM A;  3ZQ5 A;  5GLC A;  2NUP C;  5EUA A;  3IX3 A;  3B42 A;  2KLI A;  1CI8 A;  3HUM A;  2J9P A;  5EVI D;  3D9Y A;  2O9A A;  3Q81 A;  3HLE A;  5EVI C;  5GHX A;  3A0R A;  4KZ3 A;  5A91 A;  5HDD A;  4S2K A;  3C4O A;  5HFO A;  4N9L A;  2ZC5 B;  1ACF A;  4S2J A;  4FOF A;  5EOE A;  2D02 A;  1T18 A;  3DWZ A;  3SH9 A;  3NHQ A;  4NKP A;  4UEY A;  3BEB A;  1TEM A;  1K54 A;  1YLW A;  1GSX A;  3VOZ A;  4ARZ B;  3EQV A;  2JE5 A;  3OOV A;  4OQI A;  1K4F A;  1Y4O A;  3KSI A;  5L2F A;  3UB9 A;  2RL3 A;  1N9O A;  2PU4 A;  2BG1 A;  4P6Z S;  2J8Y A;  5EVI B;  2WGV A;  1PWG A;  1L0D A;  5CGS A;  4LRY C;  1YLP A;  1XKZ A;  4DE0 A;  1M6K A;  3FV7 A;  4FUW A;  5FDS A;  3KSF A;  2J9O A;  4MCW A;  2HPB A;  3G35 A;  1NJ4 A;  4OP8 A;  5CX7 A;  3EGX C;  5K5B A;  1G6A A;  1RGZ A;  3V39 A;  1MWT A;  2ZC7 A;  1SCW A;  3T4T A;  1GSW A;  3PAG A;  3T1R A;  3CAX A;  2WGW A;  1XJ2 A;  4R70 A;  1K6S A;  3WS1 A;  1ES5 A;  5TR7 A;  2W3E A;  3FKW A;  4Z1W A;  1XFN A;  5G4Y A;  3IHB A;  5HW3 A;  1H8Z A;  1Q2P A;  4LLO B;  4A5R A;  3BY8 A;  4PPR A;  4E6X A;  1LLB A;  4JGR A;  4KUK A;  5AJG A;  4WYY A;  4ZJ3 A;  5KMW A;  4JLF A;  3W8K A;  4DJ3 A;  2WAD A;  3H9W A;  4ESP A;  3CHW P;  4K91 A;  5DFX A;  3C38 A;  2Y2H A;  1OTA A;  4KZ6 A;  4OOY A;  4P6B A;  4JXW A;  4X55 A;  3N4I A;  3BFC A;  3ZG8 B;  4DE3 A;  4BEN A;  4NK3 A;  3AGD A;  4QPR A;  2O0Y A;  2VGK A;  2HDR A;  2QJ5 A;  2NUT C;  4HOI A;  3P09 A;  3PBT A;  4PM7 A;  1GHM A;  4D2O A;  5JYP A;  1E25 A;  1RCJ A;  3CJM A;  1E4D A;  1YMX A;  2K31 A;  2DCF A;  4WZ4 A;  2X02 A;  1VET A;  3S7N A;  4K0W A;  1KE4 A;  1W7F A;  3C8C A;  2HJ9 C;  2ZQA A;  5CER A;  2ACG A;  3RJU A;  1IOU A;  3UB7 A;  4JF6 A;  4OQG A;  2ZQ7 A;  1S4R A;  1TDL A;  4KZB A;  2J3W A;  4N92 A;  3TE8 A;  3JYI A;  1YQS A;  4JF4 A;  4DMZ A;  1K56 A;  1DP8 A;  5HAR A;  1PI4 A;  1DRM A;  5KZH A;  3CWF A;  4G3V A;  2WKR A;  1PIO A;  4ZAM A;  3GTC A;  1YT4 A;  1JWP A;  3A0V A;  4Y0T A;  2XR0 A;  3IF6 C;  1L2S A;  4BBV A;  3UB5 P;  1WA9 A;  4C6Y A;  1YLY A;  1YMS A;  4HJ3 A;  1K25 A;  2XDM A;  4L9F A;  2PU2 A;  3OLO A;  3HLB A;  1I2W A;  3HUN A;  2ZM2 A;  1OME A;  1J9M A;  1KDW A;  2I9V A;  4OPY A;  4MN5 A;  5HDC A;  4U3T A;  2EWW A;  4S2P A;  4ZRR A;  1ZHH B;  4GNU A;  4MN6 A;  4GS9 B;  4OH0 A;  1O7E A;  4KUO A;  3HVF A;  3IF6 B;  5HL6 A;  1W79 A;  4ETZ A;  2JKT M;  1W63 M;  2Y55 A;  3G34 A;  3OCN A;  5HDS A;  2PBD P;  2Y2M A;  4LEN A;  4WL9 A;  2X71 A;  5CEB A;  2V20 A;  1YM1 A;  2UWX A;  4GDN A;  2J80 A;  4P0M A;  1NYY A;  2WKP A;  1ERO A;  3DTM A;  4C75 A;  2EX2 A;  3TSG A;  4GDB A;  3LI9 A;  2HP5 A;  1FSY A;  4BD1 A;  4NXB A;  2Y2P A;  4Y3I A;  4ARZ A;  1LT0 A;  4RYE A;  5HD3 A;  2Z2M B;  2OWJ A;  5EVI A;  2PT7 A;  4MDZ A;  1K54 C;  1UWN X;  4KZ9 A;  4BBT A;  1U60 A;  5J3W A;  2OSU A;  4HBU A;  3G6O A;  3LFV A;  1ES3 A;  4B4Z A;  1NRJ A;  3A3D A;  4EBP A;  3BLM A;  2L4R A;  1MKM A;  3MF0 A;  4CPK A;  5DTS A;  4ETX A;  3RH8 B;  1OJG A;  2L1M A;  4GCZ A;  3VP1 A;  4HJ4 A;  4HES A;  1E3U D;  3CZD A;  2Y2N A;  5HAP A;  1M40 A;  1FIK A;  1HTZ A;  2Y2L A;  3LYX A;  1IKG A;  2PHY A;  5GHY A;  4ZJ2 A;  3UMD A;  4QY5 A;  4I3I A;  4E3K A;  4EEU A;  3NCK A;  2CMN A;  3GVB A;  3GQZ A;  5E2H A;  2J7V A;  2ZC6 B;  4OOM A;  3VFF A;  2IWD A;  4DRT A;  2WKE A;  1GHI A;  4F94 A;  3T4S A;  3IBR A;  2OWH A;  4WF0 A;  5FL3 A;  2Y4A A;  2QMI A;  1SZV A;  3OC2 A;  3MXR A;  2QZ6 A;  3DTE A;  1BLP A;  4LCM A;  3LR0 A;  5GHZ A;  4E3O A;  2P04 A;  4EEP A;  4MBH A;  1LI9 A;  2HDU A;  3QP5 A;  3C5A A;  3BFG A;  3T4K A;  2VV6 A;  5HL1 A;  1JNU A;  1XX2 A;  1YSQ A;  3O3V A;  1DP6 A;  4UQI M;  3HLG A;  2WKI A;  1KE3 A;  4IBX A;  4YFM A;  2I72 A;  1PW8 A;  2HJE A;  1TS6 A;  5FDH A;  1WE4 A;  1VEU B;  2ZJ9 A;  4PM5 A;  3SW1 A;  4RVA A;  2W3F A;  5FAT A;  4WEK A;  1N9L A;  3Q07 A;  3VP3 A;  5TJJ A;  3GMW A;  2EX8 A;  3P01 A;  1IYQ A;  3A3I A;  1SDE A;  3L9K A;  2HDQ A;  3N8S A;  2M7U A;  3IXH A;  5EVL A;  5IS1 A;  5CED A;  5D3O A;  1SHV A;  3OPP A;  2Z6D A;  4B9O A;  2WZX A;  5AQB A;  2WAF A;  2XRN A;  3PR6 A;  1YPR A;  2VV7 A;  1V9Z A;  4II7 A;  2B5R A;  2EX9 A;  1GSV A;  1BUE A;  2VEA A;  4GD6 A;  2WYX A;  3UY6 A;  1BLC A;  4WBG A;  1ERM A;  1FQG A;  3MMH A;  1STZ A;  4NXE A;  4R23 A;  1I2S A;  4R4R A;  3GSG A;  4MN7 A;  4EW7 A;  3GV9 A;  4JF5 A;  4GS9 A;  1OJ5 A;  2PRF A;  3SS5 A;  5M18 A;  3IF6 A;  1YLJ A;  1MBL A;  3ZVW A;  2VV8 A;  3HJK A;  3OPL A;  1FCM A;  2ZC3 B;  1ES4 A;  5EEC A;  1CF0 A;  4WMC D;  3F1P B;  3UPP A;  1H8M A;  1QMF A;  3MZE A;  3NDG A;  3V5M A;  1ZC2 A;  4EER A;  2FFY A;  1DY6 A;  2L0W A;  5AVE A;  1QME A;  2ZBB A;  2GX5 A;  2EA9 A;  3W2Z A;  2Z2L B;  5G18 A;  5EM1 A;  2OAQ 1;  4WEJ A;  3UPN A;  2W1R A;  3L7H A;  1D7E A;  2RCX A;  4Q8I A;  3UE0 A;  1MWS A;  1ZKJ A;  2ZOI A;  3CUE C;  4X53 A;  4HH2 A;  4X6T A;  4I3A A;  3E98 A;  4CJN A;  3GR2 A;  4D60 A;  1NLY A;  2OLU A;  4JGP A;  4UHU A;  2EWV A;  3WS2 A;  2CC1 A;  3ITA A;  2QHK A;  4YNR A;  3CPT B;  1XFQ A;  4M4X A;  2XFS A;  3JPU A;  1Z6F A;  1KOU A;  4LFU A;  1Y28 A;  3NI9 A;  1K4E A;  1XGI A;  3R7W B;  3DTK A;  1XP4 A;  3E4P A;  4M3K A;  5FEG A;  5J7E A;  3D72 A;  3ZG9 B;  3UN7 A;  3Q7Z A;  2QKP A;  4KG5 A;  4S2L A;  1YKD A;  3S7Q A;  3O88 A;  3UNW A;  3B33 A;  4OLG A;  4H8R A;  4OQ0 A;  5F69 A;  3CG5 A;  4R3J A;  4GHI B;  4JBF A;  4KZ7 A;  2YKF A;  4HHD A;  3F1O B;  4GLQ A;  1PZO A;  4MNR A;  4OOL A;  4MLL A;  3VSK A;  2O9C A;  4P85 A;  3LCE A;  5CRF A;  3MBZ A;  2ZQ9 A;  5A90 A;  2Y2G A;  1YLZ A;  1PW1 A;  3IX4 A;  3MZD A;  3KX0 X;  4FCF A;  2XGN A;  4JGQ A;  2XF3 A;  3RXX A;  2EFU A;  4S2O A;  1FR6 A;  4WEL A;  4Q0I A;  3T1S A;  3LEQ A;  4EUV A;  1E3U A;  2VLG A;  2VKS A;  2OV5 A;  3U4L P;  2HV1 A;  1MXO A;  3BM6 A;  3HRE A;  3G31 A;  1PZP A;  3PBR A;  5DF9 A;  4P6Z M;  2VX8 A;  1JVJ A;  1WYC A;  2ZQC A;  4KZA A;  3OPH A;  4KZ5 A;  1J3W A;  2A24 B;  1VEU A;  4UAA A;  1PFL A;  3LR4 A;  3ZGA B;  1H5X A;  2P9V B;  3AGF A;  3PBS A;  2ZD8 A;  3A3F A;  1S0W A;  4PKY A;  2A3U A;  2WUQ A;  4UA6 A;  2D01 A;  1S4S A;  4KG2 A;  2UV0 E;  1ZTU A;  3M2J A;  3GDI A;  3ZYT A;  1MKI A;  4EQ1 A;  4E3J A;  1DJA A;  1JWV A;  2W3D A;  3ZG7 B;  2JKR I;  1W8Y A;  3EGD C;  1FIL A;  5F82 A;  4FH2 A;  3Q82 A;  1TS0 A;  5JYO A;  1XGJ A;  2GZA A;  1TD5 A;  4DJ2 A; 
#chains in the Genus database with same CATH homology
 4CLC A;  4Y3I A;  4ARZ A;  1LT0 A;  4HH3 A;  2FZ0 A;  5HD3 A;  1OT9 A;  2WKQ A;  2LB5 A;  2K7S A;  2OWJ A;  5KIZ A;  4HQA A;  5AVF A;  4Q0J A;  2PT7 A;  4MDZ A;  2GNX A;  1UWN X;  1IFQ A;  4BBT A;  3F1N A;  5J3W A;  2O9B A;  4HP4 A;  5DKK A;  5HZH A;  1XJ6 A;  5HWT A;  1H3Q A;  4IUK A;  3G6O A;  4FSF A;  1S1Z A;  3H7W A;  1P0Z A;  3D3O A;  4L9G A;  3BWL A;  3LFV A;  3FPW A;  3E4O A;  3PXP A;  2XSS A;  5TBM B;  1NRJ A;  5L8M A;  4IHQ A;  4HJ6 A;  1EW0 A;  3FC7 A;  2L4R A;  3P7N A;  4F3L A;  3UE6 A;  1MKM A;  3MF0 A;  3OBF A;  3F1P A;  4ETX A;  3GEC A;  2G7U A;  1VHM A;  2HF6 A;  4XT2 B;  3RH8 B;  1OJG A;  2L1M A;  2ZMV A;  4GCZ A;  3S7O A;  4BBU A;  1OTD A;  4HJ4 A;  5F6A A;  2HGV A;  3VE3 A;  4O8G A;  5HWV A;  2H28 A;  1OTI A;  3EEH A;  2W3G A;  4EES A;  1F5M A;  3K3C A;  3BY9 A;  2YKH A;  4I3J A;  2QJ7 A;  3MQ0 A;  4H6J A;  3LYX A;  3UMD A;  2PHY A;  3VV4 A;  5KSH A;  2V9A A;  4Y2F A;  3LIB A;  4I3I A;  1P9W A;  1S67 L;  2KOI A;  4EEU A;  4PHT A;  3MR0 A;  1G6O A;  1S66 L;  2O99 A;  1YSP A;  4ME4 A;  1T1B A;  2V1A A;  2CMN A;  4KQD A;  2BAS A;  4F3L B;  1T1C A;  3K3D A;  5EFW A;  4OOM A;  4BJP A;  4EU0 A;  3NOT C;  4GW9 A;  5F5Y A;  3R4K A;  4RQ9 A;  5HWW A;  2MJ6 A;  5HD5 A;  5DJT A;  3T4L A;  3T4Q A;  1S1Y A;  3O5Y A;  3T4S A;  3IBR A;  2OWH A;  3UB6 A;  1N9N A;  1T1A A;  4L9E A;  4WF0 A;  5FL3 A;  3KSG A;  4R3A A;  3K2N A;  3OC2 A;  4E04 A;  1X0O A;  3NJA A;  1V9Y A;  2Z6C A;  1F9I A;  1MZU A;  2KX6 A;  2VJW A;  3LR0 A;  2VA0 A;  3UE3 A;  4KQO A;  2KDK A;  2P04 A;  3RFB A;  4EEP A;  1TF1 A;  4HY8 A;  1TS8 A;  1YAX A;  3PBN A;  4O01 A;  3R7W A;  4IUH A;  3T4K A;  2VV6 A;  3JVU A;  3MQO A;  3CUE A;  1JNU A;  1YSQ A;  3IS2 A;  4BMW A;  1DP6 A;  4UQI M;  3ICY A;  5LBR A;  1T19 A;  2XA7 S;  1BYW A;  4HNB A;  4CLC D;  2HJE A;  1VB6 A;  1TS6 A;  2B18 A;  3LIA A;  4CLC C;  3ZQ5 A;  2PR5 A;  2JKR M;  3SW1 A;  1NLZ A;  2NUP C;  2W3F A;  3MXQ A;  4NXG A;  3B42 A;  4WEK A;  1N9L A;  1XJ4 A;  2KLI A;  4GHI A;  5TJJ A;  2W1T B;  3EQU A;  4Q0H A;  2O9A A;  5G4Z A;  4DN0 A;  2PD8 A;  3P01 A;  3A0R A;  3BJN A;  2M7U A;  5IS1 A;  5HDD A;  4HIA A;  3RTY A;  3H82 B;  1P9R A;  2P08 A;  2Z6D A;  4B9O A;  4FOF A;  2XRN A;  3PR6 A;  2VV7 A;  4NXF A;  2P7J A;  2VGL S;  2PD7 A;  3IS2 B;  1V9Z A;  2D02 A;  1T18 A;  4II7 A;  2V0U A;  1LL8 A;  1GSV A;  3NHQ A;  4NKP A;  2VEA A;  4UEY A;  4CLC B;  1GSX A;  3MMH A;  2M1C A;  1STZ A;  4ARZ B;  4NXE A;  3EQV A;  5I5L A;  3UME A;  3OOV A;  4MN7 A;  3C30 A;  3KSI A;  3TRC A;  3UB9 A;  1N9O A;  3U2A A;  4EW7 A;  3LIF A;  4P6Z S;  3T4O A;  3OCL A;  3KYQ A;  4GS9 A;  4LRY C;  1OJ5 A;  1OPX A;  3FG8 A;  1XJ3 A;  1F98 A;  3F1N B;  3KO6 A;  3NOU C;  3KSF A;  2XRO A;  4MCW A;  3CI6 A;  5CX7 A;  3EGX C;  5K5B A;  3H7W B;  1TS7 A;  3KYZ A;  2VV8 A;  2A24 A;  3EOI A;  3HJK A;  3T4T A;  3FPV A;  1GSW A;  3IBJ A;  4GJ4 A;  3CAX A;  1XJ2 A;  3BW6 A;  4R70 A;  3T50 A;  5IT5 A;  4I5S A;  4L0L A;  2W3E A;  3F1P B;  1H8M A;  1UWP X;  3UB8 A;  4Z1W A;  1XFN A;  3VE4 A;  4YOF A;  4EER A;  3TW8 A;  5G4Y A;  2L0W A;  5AVE A;  4LLO B;  5J4E A;  2ZBB A;  3BY8 A;  2GX5 A;  3CLO A;  1LSV A;  2EA9 A;  3LR5 A;  3LIE A;  3W2Z A;  4EXO A;  2JKT I;  1LSX A;  2LB9 A;  4H6J B;  4JGR A;  2OAQ 1;  2FH5 A;  4WEJ A;  4KUK A;  5AJG A;  2W1R A;  1D7E A;  4DJ3 A;  5DFY A;  2GJ3 A;  3H9W A;  2ZOI A;  3CUE C;  5DFX A;  3C38 A;  3LUQ A;  4LRX C;  1OTA A;  4HH2 A;  4I3A A;  2A2L A;  4LRZ E;  3MQQ A;  4I38 A;  3BQA A;  3E98 A;  3KSH A;  1NLY A;  4QPR A;  2O0Y A;  3C2W A;  4JGP A;  2ZMF A;  5F68 A;  2PYR A;  2QJ5 A;  2EWV A;  2QHK A;  2NUT C;  4YNR A;  1P97 A;  1XFQ A;  2VZW A;  4HOI A;  3PBT A;  3F1O A;  4M4X A;  4O0P A;  3PBQ A;  1KOU A;  1Y28 A;  3LIC A;  2PR6 A;  5DKL A;  5HPF A;  2K31 A;  5TBM A;  3R7W B;  5IU1 A;  3EEA A;  3E4P A;  3S7N A;  2W3H A;  3A0S A;  3B47 A;  3C8C A;  2HJ9 C;  5J7E A;  3D72 A;  4XT2 A;  1IOU A;  2QKP A;  3UB7 A;  2V1B A;  4NEE D;  1YKD A;  3S7Q A;  2OOL A;  3B33 A;  3S7P A;  1S4R A;  5F69 A;  2J3W A;  2JHE A;  3E0Y A;  5C5K A;  4GHI B;  1NWZ A;  2INW A;  3TE8 A;  2YKF A;  4I39 A;  4HHD A;  4EET B;  2XA7 M;  3F1O B;  2QWS A;  4DMZ A;  4GLQ A;  3HCY A;  4K08 A;  4AFI A;  1DP8 A;  4OOL A;  2O9C A;  1G28 A;  1DRM A;  3CWF A;  2IA2 A;  2WKR A;  4G3V A;  4PAU A;  1W63 Q;  5A8B A;  3A0V A;  3JVV A;  3LR3 A;  3V67 A;  4BBV A;  3LI8 A;  4G3K A;  1WA9 A;  4B93 A;  4HJ3 A;  1OT6 A;  3KX0 X;  4L9F A;  2W27 A;  3OLO A;  3NOP C;  4JGQ A;  4R6L A;  4WN5 A;  3BQ8 A;  2OAP 1;  1OTE A;  4WEL A;  2R78 A;  1ODV A;  4Q0I A;  4CQH A;  5HPI A;  3MJQ A;  4EUV A;  2VGL M;  2I9V A;  2ZOH A;  2VLG A;  4MN5 A;  1UGU A;  4UQI S;  4WUJ A;  2VKS A;  2M7V A;  5HDC A;  2EWW A;  2W0N A;  4ZRR A;  2HV1 A;  1ZHH B;  4MN6 A;  4GS9 B;  3E4Q A;  4KUO A;  4HI4 A;  3PBR A;  4R38 A;  4LPZ A;  4BWI A;  5DF9 A;  4G3W A;  4P6Z M;  5HL6 A;  2VX8 A;  3PYP A;  4ETZ A;  2A24 B;  2JKT M;  1W63 M;  3HJI A;  2JN7 A;  3CIT A;  4HP9 A;  3EWK A;  2B02 A;  3PHY A;  3LR4 A;  4PKY G;  3OCN A;  5HDS A;  1MC0 A;  5DJU A;  3DBA A;  2PDR A;  4CLC E;  3PBS A;  2DMW A;  2W1T A;  4WL9 A;  4PKY A;  4WLA A;  2D01 A;  2J3T D;  1S4S A;  2Y8H A;  3VOL A;  3PBO A;  1ZTU A;  3TJZ C;  4IJG A;  2J3T C;  3GDI A;  2J80 A;  3LID A;  3H82 A;  3ZYT A;  2WKP A;  1DP9 A;  4YWZ A;  4EQ1 A;  5MC7 A;  1D06 A;  2K2N A;  2PYP A;  1LSW A;  2W3D A;  3MFX A;  5HSQ A;  1OTB A;  2JKR I;  2Y79 A;  3ULF A;  4JGO A;  3EGD C;  4DJ2 A;  3LI9 A;  3T4J A;  4MMN A;  1TS0 A;  2QYB A;  2GZA A;  4NXB A;  1TD5 A;  4Y5F A;  2V0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...