2KLIA

Structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor protein
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
total genus 33
structure length 172
sequence length 172
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kliA00
4ME4A 3KO6A 2VJWA 4LRZE 3G6OA 4R6LA 4IUKA 4EU0A 4Q0IA 2K31A 4DN0A 4PAUA 3BJNA 2B18A 3DBAA 4RQ9A 5LBRA 4YOFA 3NHQA 3K2NA 4MCWA 2M7UA 4Y2FA 2W1TA 4G3KA 2VZWA 2O9CA 2K2NA 2XSSA 5DFYA 1TD5A 4R70A 3E0YA 2KLIA 2XROA 2XRNA 3C2WA 2O9AA 3S7PA 4O0PA 2O99A 3W2ZA 1STZA 4Q0JA 3LFVA 5HPFA 4EUVA 3S7OA 3IBJA 2M7VA 3IBRA 4DMZA 5TJJA 2Y8HA 4E04A 5AJGA 4MMNA 4ETZA 2IA2A 2W3DA 2QYBA 3NOPC 1TF1A 5DFXA 3R4KA 3OOVA 4YNRA 5HL6A 3ZQ5A 2VKSA 4ZRRA 2GX5A 2W3HA 3VV4A 5I5LA 3CITA 4CQHA 3O5YA 4GW9A 3MF0A 4Z1WA 4QPRA 2VEAA 3EEAA 3KSFA 2W3EA 1YSQA 2W1RA 2ZMFA 4BWIA 2Y79A 4LRXC 3NOTC 4Q0HA 4MN7A 3OBFA 1MC0A 1F5MA 3CI6A 3KSIA 3RFBA 4G3WA 2G7UA 4FOFA 4Y5FA 4MDZA 2HGVA 2LB5A 2W3GA 3S7NA 1VHMA 3E98A 1MKMA 3S7QA 4O01A 4IJGA 3TRCA 4LRYC 4GLQA 3D3OA 2KOIA 1YKDA 3KSHA 4O8GA 3MQ0A 5L8MA 2LB9A 2OOLA 3NOUC 4G3VA 2O9BA 5HSQA 3MMHA 5K5BA 5C5KA 3HCYA 2W1TB 1ZTUA 2O0YA 4Y3IA 5HPIA 3KSGA 4ETXA 4IUHA 1YSPA 2W3FA
chains in the Genus database with same CATH superfamily
3BRMA 3O87A 4LRZE 2OSUA 4DDSA 1IYPA 3D4FA 1XFQA 3VP0A 4U0TA 3PBTA 1HVBA 2EX2A 3C5AA 3MZEA 3VP2A 1NZOA 3MZFA 1FSWA 1LL8A 2XRNA 3VP1A 2JCHA 2DMWA 5CX7A 3OPLA 4GS9B 3S7OA 1OMEA 1PFLA 3IBJA 1L3LA 4P6BA 2Y8HA 4E04A 3ZGAB 3GV9A 1HZOA 4BBTA 3CG5A 2KX6A 3T4KA 4RX2A 3S1YA 1EWZA 1W5DA 1PWCA 4EBLA 4HH2A 3BECA 1N9LA 2Y59A 1CEFA 5DF9A 2WAEA 1IKIA 2Y2QA 2ZMFA 4FSFA 1JTDA 3PHYA 1BLSA 3UMEA 2L0WA 4HY8A 2G2UA 3BFEA 3SH7A 2NUTC 3ZDJA 5E2FA 1DP9A 5F5YA 4LRYC 1PIOA 3W8KA 2JKGA 3IQAA 4XT2B 4JXVA 3GMWA 3T4TA 1GHIA 2D01A 3PR6A 2ZQAA 3IF6A 3FKWA 3HLGA 1E3UA 5D3OA 3ZCZA 4ME4A 2P9VA 2GNXA 3PYPA 1FCMA 4LFUA 1S1YA 2OAP1 4IBXA 4NKPA 4DN0A 1K4FA 3LR5A 3I7JA 1ERQA 3PBSA 2HZ5A 3NI9A 2W27A 5IHVA 2B5RA 3ZNTA 1IFQA 1GCEA 1TS0A 3G31A 3S22A 3CHWP 5HPFA 5GLCA 2WGWA 4DJ3A 1DY6A 4NXGA 3T4QA 3PAGA 1S6RA 3G2YA 1L0FA 3SS3A 3WS4A 3IT9A 3M2KA 2PU2A 4Y13A 2WZZA 3SS4A 5FAOA 4X6TA 3F1OB 4JKTA 4E3MA 2DCFA 2CMNA 4WN5A 4H6JB 5DTTA 4KQOA 5F83A 4S2OA 4DJ2A 3DAVA 3LEQA 3KYZA 5L2FA 2Y2NA 2OWHA 3B47A 2HGVA 2LB5A 3UB5P 3S7QA 3T4LA 3BQ8A 2QMIA 5FATA 1G5UA 5EVIA 5G4ZA 4N1XA 2OWJA 5HX9A 2J9OA 3RTYA 4HIAA 2Y2HA 1TS6A 3M6HA 1ZHHB 4RYEA 3IXBA 2E8IA 4II7A 3LUQA 4EEUA 3UDIA 3UE0A 1PRQA 2WKIA 2EFUA 3V3SA 4B9OA 3BJNA 1UWPX 4GCZA 4F94A 4HJ6A 5CHUA 1TD5A 1IKGA 4R70A 4PM5A 3DTEA 2WKRA 3L9KA 5F1FA 1PNEA 1QMFA 3A0VA 3A3IA 5DJTA 3UNWA 4DMZA 4WEKA 2VX8A 4PM6A 1ES5A 1P9WA 3H82A 1MXOA 2I72A 3E4PA 3T12B 3NCKA 2J80A 3CMZA 4PPRA 4OOMA 4L9EA 4DDYA 5KSHA 3IS2A 4Z9QA 4HHDA 5L07A 3DTIA 4ZJ1A 1XGIA 2Y4AA 3V3RA 5G4YA 1IYQA 1L2SA 3GVBA 1XJ4A 2Y2IA 3O3VA 1K0KA 1YLJA 3IF6B 4CLCE 4MBKA 2JHEA 4MDZA 2ZQDA 3LR0A 3G35A 3V39A 2QJ7A 4FH2A 3L7HA 1LSXA 1IOUA 4ARZA 1ES4A 3NULA 1DRMA 4C75A 5K5BA 2XH9A 4K08A 1XX2A 3EGDC 4HNBA 1W8YA 2ZQCA 3ZNYA 1YSPA 3FYZA 5HWTA 1L0EA 1XJ6A 1MPLA 3JVVA 3LCEA 3LO7A 5EECA 2VV6A 3MR0A 4Q0IA 3QP1A 4MN5A 3MS6A 4ZBEA 1SCWA 4PAUA 5E43A 3GSGA 5LBRA 4RVAA 1YAXA 4G3KA 4JLFA 2RCXA 4X56A 2XFSA 4WZ4A 5F69A 1ES3A 4U0XA 5DTSA 1ONGA 3FZCA 3OLOA 3S7PA 4HP4A 3K3CA 5E2GA 4PM8A 3AGFA 5HWVA 2W3HA 3D9YA 5HD5A 2ACGA 1K57C 1QMEA 3O5YA 4KZ9A 3LR3A 4OH0A 5AVEA 4DE3A 5EOOA 3BQAA 5EVIB 2J3TC 5BOHA 3IHAA 1KGGA 4E3LA 3C8CA 1PWDA 1FR6A 4GDNA 3W4PA 4B4ZA 2W3GA 5F82A 4E6XA 2VA0A 1LLBA 1K38A 1V9YA 2PDRA 5FQMA 4C3QA 3NOUC 2XF3A 5AVFA 4G3VA 3MBZA 3MMHA 3VP4A 5E2HA 4D2OA 4EERA 4X55A 1NYYA 3H9WA 3HREA 4S2NA 4P87A 4GZBA 2ZM8A 4KENB 5U47A 3FC7A 2WAFA 4B4XA 5GHZA 4WMCD 2XR0A 1XP4A 2EX6A 4ZJ2A 3K2NA 2Q9NA 2W0NA 2H0YA 1P97A 2I9VA 4S2PA 5DVAA 2K2NA 3FPVA 3H82B 3O88A 3PBOA 2XSSA 4GHIA 3QP6A 1DP8A 1WE4A 3T4OA 3FWLA 4UA9A 3WS2A 4PHTA 3IH8A 4WF0A 1NYMA 3IS2B 4E6WA 3IHBA 3H7WA 5FQQA 1XPBA 4E3KA 4PM7A 4I5SA 1E25A 2Y2GA 4BL2A 1D1JA 1YLTA 4GW9A 1RGYA 2J3TD 2Y2JA 4KZ5A 3Q1FA 2PHYA 1NLZA 1K55A 4KZ3A 1YQSA 4ARZB 4BBVA 3A3EA 3RXWA 3ZFZA 2HDRA 5IS1A 3NOTC 1MC0A 1KDWA 1O7EA 2PBDP 4DKIA 3S7NA 4O01A 3KSHA 1YMXA 4UHUA 2ZC5B 1NLYA 4EW7A 1EROA 5AQAA 2GZAA 1IYOA 3FKVA 5L09A 4DXCA 3HCYA 4R4SA 2FFFB 4JGRA 2V20A 3G6OA 4IUKA 2V0WA 3ISGA 4M4XA 2A49A 2VV7A 1PW8A 2HJEA 4X1MA 3HLEA 4KZAA 2VZWA 4KZBA 2XFTA 2O9CA 4HESA 1W79A 4EBPA 2PYPA 2EXBA 4E3IA 3WS0A 1C3BA 4ZDXA 2YKFA 4MBHA 3VSLA 3TG9A 5J3WA 4GNUA 1YLPA 3IBRA 5GHYA 1H8YA 3UPNA 3A0SA 5CERA 1JWVA 1PI5A 2PR6A 3OPRA 3NOPC 3EQUA 4UAAA 1GHMA 2E8JA 4WELA 2IWBA 3Q81A 3VV4A 1WYBA 1H3QA 3TE8A 5DF7A 3IXDA 4EWFA 2JKRI 3NJAA 1FR1A 4GOGA 2V1AA 3KSIA 5KZHA 4G3WA 1Y28A 5HAPA 3OC2A 2JKTI 3P7NA 2ZD8A 1Y54A 4LLOB 1XGJA 2PT7A 4HJ3A 1O07A 3GDIA 2NUPC 3CPTA 5HARA 1LT0A 2XLNA 2P74A 3PBQA 1ACFA 5FQJA 4QWOA 4GHIB 1YPRA 3IXHA 1HD8A 3WS5A 3SH8A 4BD1A 1KOUA 5DKLA 5IU1A 5HDDA 1FIKA 3TSGA 1H8MA 3LIEA 4YOFA 4ID4A 2WKHA 3VP3A 1BSGA 4UA7A 5AQ7A 1YMSA 5HD3A 1M6KA 3UN7A 1FCOA 1KGEA 5DFYA 3H7WB 3LIBA 3KYQA 2XROA 3N7WA 3C2WA 5A90A 2B02A 1FOFA 4LV3A 3LFVA 4KZ8A 4S2JA 1ODVA 1K54C 4X25A 3W4OA 3CUEC 2HDSA 2PR5A 4I3JA 2PYRA 3T1RA 3VE3A 1KE3A 3ZQ5A 4LV2A 1WA9A 4Y0OA 1KGFA 4K0XA 2PAVP 5A91A 4MLLA 2J3WA 4QPRA 3T4JA 3KSFA 2A3UA 4NG2A 4QJGA 4K0WA 3EQVA 5L10A 1U60A 2Y79A 1YLYA 2V2FF 1F98A 5EV0A 1NRFA 4BLMA 1GHPA 3BLMA 2ZC6B 5CHMA 1MKMA 4E3JA 1I2SA 4IJGA 4OKPA 1LI0A 3VFHA 2ZOIA 4PMAA 5EVEA 4GKUA 1VB6A 3MXRA 3UO9A 3ZVWA 3U2AA 5FASA 2O9BA 4KG2A 3MSHA 3PTEA 4WZ5C 1G6OA 1ZTUA 2PD7A 4UA6A 3UY6A 3U4LP 3P01A 3FV7A 4NXFA 4JBFA 2XDMA 2M1CA 2Q9MA 3KO6A 1KVLA 2Y55A 3ZG7B 4EU0A 3Q82A 2Y2PA 2X02A 3C7UA 3UE3A 2Z2LB 4PM9A 4OOLA 5GHXA 1MWSA 1VETA 4L9GA 4NXEA 1T1BA 1TEMA 1MBLA 4FTXA 4CPKA 1ES2A 3VSKA 3HLWA 1CQAA 4QY5A 4H8RA 3Q07A 3VOYA 4O0PA 4WBGA 3UB6A 2O99A 3VE4A 3DWZA 3MJQA 4A5RA 3GQZA 5FAQA 4YNRA 1JWPA 4DF6A 4EBNA 4JPMA 1OTAA 3GR2A 4JXSA 5GLDA 2ZMVA 4BQMA 4DE2A 1FCNA 1MWRA 4DXBA 1PZPA 1YSQA 4EQ1A 5EPHA 3CPTB 4OPRA 4S2MA 3UPPA 1ERMA 1F5MA 4OQ0A 5A93A 4FOFA 2ZM0A 3ITBA 2G2WA 4JGPA 3HUOA 3JYIA 3LEZA 3T1QB 2P08A 1P0ZA 3EOIA 5HW3A 3HLCA 4LCLA 1S1ZA 4L9FA 3V67A 5HPIA 3LIFA 2J7VA 3N8LA 2PD8A 4HP9A 3ZG8B 3IX4A 1W7FA 4NEED 1W63M 4CLCC 1TS7A 2PRFA 1GSWA 2OLUA 4R38A 3NHQA 2QHKA 4QY6A 4OOYA 3NY4A 4MN6A 3LIDA 1K57A 4GN2A 3LR4A 2WZXA 3BLSA 4N9KA 2BLSA 2HPBA 3ICYA 3DW0A 3ULFA 5FI6A 1TS8A 4EV4A 1IEMA 2H28A 1ZC2A 4EESA 1K56A 3NDGA 3C30A 4PKYA 1CF0A 5HWWA 4MEZA 4JXGA 3B42A 3WS1A 3B3XA 2HP6A 4R4RA 5DTKA 3A3JA 4N92A 3QP5A 5DFXA 5E2EA 2QZ6A 3SW1A 4DE0A 1NY0A 3SOIA 1I5QA 2JBFA 2WGVA 3IH9A 3QNCA 2Z2MB 4QU3A 3C38A 4Z1WA 1OTEA 4WYYA 4KZ7A 5KIZA 2V1ZA 3F1PA 3WWXA 3LI9A 3BW6A 2QPNA 3ZG0A 5F68A 3BM6A 4X68A 4X1LA 4GLQA 2UWXA 5EVID 3T50A 4IHQA 4KQQA 2EFXA 1NXYA 1RP5A 2RL3A 1PWGA 5C5KA 1VETB 2O0YA 1L0DA 5G18A 1E4DA 1OTDA 3T4SA 4CLCD 3NBLA 5CEDA 4N9LA 1KDSA 4R6LA 3R7WA 3C7VA 5CXWA 3DBAA 4ESPA 1VM1A 2ZL1A 4QB8A 2W1TA 1KE0A 2VV8A 2ZJ9A 2BTFP 3OCLA 2H5SA 4P6ZM 1P9RA 1BYWA 4M3KA 1CK3A 2R9XA 1SDEA 3JPUA 2VGLM 5TBMA 3MQQA 3V50A 5GLAA 2M7VA 4BBUA 3EWKA 2OLVA 5FSRA 1XKZA 2ZC4B 4MNRA 1OT6A 5EUAA 4XUXA 1VEUA 4CQHA 2Y91A 3RXXA 4Y15A 3ZYTA 3ZG5A 1JNUA 4P6ZS 4MBFA 5CGXA 2W1RA 4LRXC 4EXOA 2ZC3B 1CI9A 1VQQA 3QNBA 4IVIA 4AFIA 5HZHA 2VGKA 5F1GA 4U3TA 1BLPA 2V9AA 1S67L 1N4OA 5TR7A 3GRJA 2EX9A 5HAIA 4XXRA 5EE8A 3MKFA 2KOIA 1DJAA 3RJUA 4X53A 5HFOA 2V0UA 2XA7M 4KG6A 4IUHA 1T19A 4KZ6A 1OJGA 3HLDA 5FDSA 4N1HA 2K31A 5M19A 3IX3A 1WYCA 4JGOA 3AGEA 1S0WA 2JC7A 4BENA 2J9PA 3DTMA 4YWZA 4OQHA 3HLFA 2XA7S 3UDFA 2R78A 1PZOA 2YKHA 1SHVA 1OJ5A 2OAQ1 3KYEA 3GECA 5TJJA 4F3LB 4MMNA 3F1PB 3KX0X 3OOVA 1HLUP 1I2WA 3N8RA 3K3DA 2XD5A 2JKFA 1LSVA 2HP9A 3P98A 5CTNA 1XFNA 3N8SA 3MFDA 3BWLA 4OQIA 1N9OA 1AWIA 2VEAA 1PI4A 1UWNX 3BFFA 4NXBA 4KUKA 1TDGA 2QJ5A 5F6AA 1XXMA 1JVJA 2EWVA 3LYXA 5CGWA 1YT4A 4EQIA 5EM0A 3IXGA 3RFBA 1BTLA 1D06A 3EGXC 5TGFA 2R9WA 3E98A 4OPZA 2INWA 4OP8A 1OTBA 3IF5A 4O8GA 3IX8A 3R7WB 2OOLA 3TOIA 2ZL1B 2W1TB 4L0LA 4GDBA 1SDNA 3UPOA 4ETXA 5CGSA 2W3FA 3BFDA 3QP2A 5FAPA 1K54A 4BD0A 3E4OA 3CUEA 3T1XA 1CJFA 5TBMB 3LIAA 4OP5A 3NC8A 5CHJA 2JN7A 2WKQA 5FQIA 4I3AA 1KE4A 3VOZA 4LV1A 1VEUB 4OPYA 4Y0UA 4I38A 4EUVA 4FH4A 4IBRA 2ZOHA 5HL1A 2IA2A 1GA0A 2J8YA 2FZ0A 2VKSA 1KVMA 3CWFA 2GX5A 2C5WB 5I5LA 5KMWA 4HEFA 3QP8A 1G68A 4EEPA 2D02A 4WZ5A 4LPZA 2GJ3A 3B33A 3QHYA 4Q0HA 4KG5A 4MN7A 3SH9A 1Q2PA 4QD4A 1YLZA 1X0OA 5FA7A 4P0MA 4KZ4A 3TRCA 2WUQA 2XQZA 4JXWA 4UEYA 3P09A 3MXSA 5JYPA 1OTIA 3UB8A 5J8XA 2IWDA 1IYSA 1OT9A 3VFFA 4WUJA 4LENA 5HSQA 1ONHA 3BY8A 3UB7A 4Y3IA 2X01A 4HQAA 3LY4A 5GLBA 1T18A 3RH8B 5M18A 4EETB 1H8ZA 4GD8A 1NZUA 1JWZA 4HJ4A 2VGJA 3OPHA 3IWQA 4HI4A 4RQ9A 5FI2A 3D72A 2VK3A 1YLWA 3CZDA 4FCFA 1XJ2A 2AVXA 4Q8IA 5TFQA 4UQIM 5HDCA 3E0YA 2HDQA 2JKRM 3IF6C 2V8CA 2HJ9C 2Q0OA 1YM1A 3HBRA 1SZVA 2O9AA 4JF4A 2ZQ9A 5HDSA 4Q0JA 2HP5A 2XD1A 4WM9A 4JF5A 3VOLA 2WKEA 2JKTM 1LL9A 1CI8A 1TF1A 2V1BA 4ZJ3A 4OLDA 1MY8A 3UMDA 1K6RA 4ZRRA 4WL9A 3SS5A 2EXAA 4UQIS 3MF0A 4YINA 1L0GA 2Y2OA 2ZMAA 3EEAA 3ZVTA 2W3EA 2QWSA 3E2LA 3LI8A 4BWIA 1TDLA 4ZAMA 2OV5A 1JTGA 3OBFA 1BZAA 4R3BA 4XUZA 3CI6A 3LICA 2MJ6A 3LGOA 3TJZC 3G2ZA 2G7UA 3UB9A 4R0QA 3G32A 1VHMA 3BFGA 1H5XA 3A3FA 3GTCA 3NECA 2XK1A 4S2IA 4CLCA 1GSVA 2C6WB 1SKOA 4C6YA 4LCMA 1YKDA 1J3WA 3HLBA 2LB9A 3QP4A 3CAXA 4JGQA 5FL3A 2ZBBA 1DJBA 3N4IA 1N9BA 4LGWA 3ITAA 4PKYG 4BL3A 1LSWA 2Y2LA 1HTZA 1RCJA 2EA9A 2VJWA 2ZC7A 3O86A 4HBUA 1W63Q 4RA7A 4WMCA 4DRTA 5FEFA 1Q2QA 2HV1A 5CECA 1RGZA 4GJ4A 5EVIC 2EWWA 1GA9A 1E3UD 3NIAA 1FQGA 3G34A 3WRTA 3F1NA 2XGNA 5DF8A 1BLHA 1MZUA 5CTMA 4NETA 3CJMA 4OLGA 4I39A 1ZG6A 3LY3A 4FD8A 4KUOA 1J9MA 5MC7A 1CEGA 5AJGA 4GD6A 5FQ9A 2K7SA 2W3DA 1MKIA 1FSYA 3T1SA 1Z6FA 4D60A 4S2LA 4NK3A 1EW0A 2DRWA 1BUEA 2P9VB 5EVLA 1ESIA 3MZDA 3HJIA 4FUWA 4R1GA 3VMAA 1XJ3A 1BLCA 3Q7ZA 3Q7VA 2VLGA 4R3JA 1F2KA 5FDHA 2ZLYA 1MWUA 2FFYA 3BFCA 4S2KA 5AQ9A 5FEGA 4X69A 2BASA 3TW8A 3D3OA 1FILA 4JF6A 1G28A 1SKFA 3MQ0A 4LV0A 1D7EA 1IELA 5EOEA 2WGWB 3CLOA 4B88A 4F3LA 1EI5A 4O7DA 4QHCA 1GSXA 4HBTA 5FQKA 1LHYA 2A24A 2PU4A 3UE6A 2HDUA 2FH5A 2PBYA 1PYYA 3A3DA 3IWIA 2B18A 3JVUA 4WLAA 1ZKJA 4MCWA 4Y2FA 3G4PA 1MWTA 4P85A 5GL9A 5CEBA 2B95A 3OZHA 1NWZA 4B93A 2KLIA 3E2KA 2V8FA 3PXPA 4OVDA 1H0MA 3DWKA 3W2ZA 1STZA 3HVFA 4Y0TA 4ETZA 3M6BA 3R4KA 4OQGA 3SZTA 1UGUA 5HL6A 1S66L 1A0KA 4I3IA 3A0RA 3M2JA 4CLCB 1LL5A 1OPXA 2DNSA 1G6AA 1SKOB 4GS9A 1LI9A 2HF6A 5DJUA 2P04A 1DJCA 3HUMA 3PBNA 3N6IA 4DE1A 2EX8A 3BEBA 5FI7A 1BT5A 3C4OA 5I94A 2WK0A 4WEJA 3UE1A 2IWCA 1K25A 5CRFA 3G30A 4YFMA 1F9IA 3S4XA 1NJ4A 1T1CA 5M1AA 1Y4OA 2Z6CA 3HL9A 2Y2KA 3IWOA 3AGDA 2VGLS 3MFXA 3E4QA 2WADA 1S4SA 3BY9A 5HAQA 4BJPA 4ZTKA 4K91A 2P7JA 3F1NB 2UV0E 4GB7A 1AXBA 1ALQA 3FPWA 3FG8A 4XT2A 1XA1A 5J7EA 2ZQ8A 1TVFA 2H0TA 4HH3A 2M7UA 3MKEA 5EFWA 2XEPA 2A2LA 4BMWA 2CC1A 1N9NA 2Y2MA 3PAEA 1M40A 5AQBA 4Y17A 1W8QA 2L4RA 3BYDA 1Z09A 2H10A 1ZG4A 1K56D 4S2NC 2QKPA 1PW1A 1T1AA 5DKKA 3ZG9B 3UDXA 2KDKA 3ZHHA 4RX3A 1K4EA 3C4PA 2WKPA 4E3OA 3Q7VB 2GDNA 3EEHA 1ESUA 2QYBA 4R23A 3DTKA 4HOIA 5JYOA 3WRZA 1S4RA 4IEDA 4R3AA 3CITA 1XA7A 3OCNA 5IT5A 4KQRA 5A92A 4KQDA 1NRJA 2Z6DA 2BG1A 4EUZA 2L1MA 3PBRA 3HJKA 3NDEA 1BULA 2ZQ7A 2JE5A 4Y5FA 3W4QA 3OPPA 5EM1A 2A24B 2ZM2A 5KSCA 3F1OA 4Y7PA 2X71A 3V5MA 5L8MA 2WGIA 1V9ZA 4OONA 4OPQA 4H6JA 3MQOA 3MXQA 1K55C 5J4EA 5A8BA 4E3NA 1K6SA 3HUNA 3KSGA 4CJNA 1DP6A 2WYXA 4IVKA
chains in the Genus database with same CATH topology
4HP9A 4EETB 3FC7A 4NEED 4LRZE 1W63M 4HJ4A 4CLCC 1TS7A 4HI4A 1GSWA 4RQ9A 1XFQA 4R38A 3D72A 3K2NA 3NHQA 2QHKA 3PBTA 2W0NA 1P97A 2I9VA 2K2NA 3FPVA 3H82B 3PBOA 1XJ2A 2XSSA 4GHIA 4MN6A 3LIDA 3LR4A 4UQIM 5HDCA 1DP8A 3E0YA 1LL8A 2JKRM 2XRNA 3ICYA 2HJ9C 3ULFA 3T4OA 1TS8A 2O9AA 2H28A 4EESA 4PHTA 3C30A 4PKYA 5HDSA 2DMWA 4Q0JA 5CX7A 5HWWA 4GS9B 4WF0A 3S7OA 3IBJA 3IS2B 3VOLA 3B42A 2Y8HA 4E04A 2JKTM 4BBTA 1TF1A 5DFXA 2KX6A 2V1BA 3T4KA 3SW1A 3H7WA 3UMDA 4ZRRA 4WL9A 4I5SA 4HH2A 3C38A 4GW9A 2J3TD 1N9LA 3MF0A 4UQIS 5DF9A 1OTEA 4Z1WA 2PHYA 1NLZA 3EEAA 2W3EA 2QWSA 4ARZB 4BBVA 3LI8A 5KIZA 2ZMFA 4BWIA 5IS1A 4FSFA 3NOTC 3F1PA 3OBFA 3PHYA 3UMEA 2L0WA 1MC0A 4HY8A 3CI6A 3LICA 2MJ6A 3TJZC 2G7UA 3UB9A 3LI9A 3BW6A 2NUTC 3S7NA 1VHMA 5F68A 4CLCA 4O01A 1DP9A 1GSVA 5F5YA 4LRYC 4GLQA 1YKDA 3KSHA 2LB9A 1NLYA 3T50A 4XT2B 4IHQA 4EW7A 3T4TA 2GZAA 3CAXA 4JGQA 2D01A 5FL3A 2ZBBA 5C5KA 3HCYA 3PR6A 2O0YA 4PKYG 1LSWA 4ME4A 3T4SA 1OTDA 4CLCD 2GNXA 2EA9A 4JGRA 2VJWA 3PYPA 3G6OA 1S1YA 4R6LA 4IUKA 2OAP1 2V0WA 4NKPA 3R7WA 4M4XA 1W63Q 4DN0A 2VV7A 3DBAA 3LR5A 2HJEA 2HV1A 2W1TA 3PBSA 2VZWA 2O9CA 4GJ4A 2EWWA 2VV8A 2PYPA 2W27A 3F1NA 3OCLA 4P6ZM 1MZUA 1P9RA 1BYWA 1IFQA 1TS0A 2YKFA 4I39A 4KUOA 2VGLM 5TBMA 5J3WA 3MQQA 5HPFA 5MC7A 2M7VA 3IBRA 4BBUA 4DJ3A 3A0SA 3EWKA 4NXGA 5AJGA 3T4QA 2K7SA 2W3DA 2PR6A 3NOPC 3EQUA 4WELA 1OT6A 1EW0A 3VV4A 1H3QA 4CQHA 3TE8A 3HJIA 3F1OB 3ZYTA 1JNUA 1XJ3A 4P6ZS 2VLGA 2W1RA 2CMNA 4WN5A 4H6JB 2JKRI 3NJAA 4KQOA 4LRXC 4EXOA 4DJ2A 3KYZA 2V1AA 3KSIA 4AFIA 5HZHA 4G3WA 1Y28A 2OWHA 3B47A 2HGVA 2LB5A 2V9AA 3OC2A 1S67L 2JKTI 3P7NA 3S7QA 3T4LA 2BASA 4LLOB 3TW8A 3D3OA 3BQ8A 1G28A 2KOIA 2PT7A 3MQ0A 4HJ3A 1D7EA 3GDIA 2NUPC 5G4ZA 2OWJA 3CLOA 4F3LA 1LT0A 3RTYA 2V0UA 3PBQA 2XA7M 4HIAA 1GSXA 1TS6A 4GHIB 4IUHA 1ZHHB 4II7A 2A24A 1T19A 3LUQA 1OJGA 4EEUA 3UE6A 2FH5A 1KOUA 5DKLA 5IU1A 2K31A 4B9OA 5HDDA 3BJNA 2B18A 3JVUA 1H8MA 3LIEA 4JGOA 4YOFA 1UWPX 4WLAA 4MCWA 4GCZA 4Y2FA 5HD3A 4HJ6A 4YWZA 5DFYA 1TD5A 1NWZA 3H7WB 4R70A 4B93A 2XA7S 3LIBA 2KLIA 3KYQA 2XROA 2R78A 3C2WA 2YKHA 3PXPA 2B02A 2WKRA 1OJ5A 3W2ZA 1STZA 3A0VA 3LFVA 2OAQ1 1ODVA 5DJTA 4DMZA 3GECA 4WEKA 5TJJA 4F3LB 3CUEC 4MMNA 2VX8A 2PR5A 4ETZA 4I3JA 1P9WA 2PYRA 3F1PB 3H82A 3KX0X 3OOVA 3R4KA 1UGUA 3K3DA 3VE3A 5HL6A 1S66L 3ZQ5A 1WA9A 1LSVA 3E4PA 4I3IA 3A0RA 1XFNA 3BWLA 4CLCB 1OPXA 2J80A 1N9OA 4OOMA 2J3WA 4L9EA 4QPRA 3T4JA 2VEAA 3KSFA 4GS9A 5KSHA 1UWNX 3IS2A 3EQVA 4NXBA 2HF6A 2P04A 4HHDA 5DJUA 4KUKA 2QJ5A 5G4YA 5F6AA 2Y79A 2EWVA 3LYXA 3PBNA 1XJ4A 1F98A 3RFBA 1D06A 4CLCE 2JHEA 4MDZA 4WEJA 3EGXC 3LR0A 3E98A 1MKMA 1F9IA 4IJGA 2INWA 2QJ7A 1OTBA 2ZOIA 4O8GA 1IOUA 1LSXA 4ARZA 1VB6A 1DRMA 3R7WB 2OOLA 1T1CA 2Z6CA 3U2AA 2O9BA 5K5BA 4K08A 2VGLS 2W1TB 1G6OA 1ZTUA 2PD7A 3EGDC 4L0LA 3MFXA 4HNBA 3P01A 3E4QA 4NXFA 4ETXA 1S4SA 1YSPA 2M1CA 3BY9A 5HWTA 4BJPA 2W3FA 1XJ6A 3JVVA 3KO6A 2P7JA 3F1NB 3E4OA 2VV6A 4EU0A 3MR0A 3CUEA 3FPWA 4Q0IA 3FG8A 4MN5A 4XT2A 4PAUA 5TBMB 3LIAA 5J7EA 3UE3A 5LBRA 2JN7A 4HH3A 1YAXA 2WKQA 2M7UA 4OOLA 5EFWA 2A2LA 4BMWA 4G3KA 4L9GA 4NXEA 1T1BA 1N9NA 4I3AA 2L4RA 5F69A 2QKPA 3OLOA 1T1AA 4O0PA 5DKKA 3S7PA 3UB6A 2KDKA 2O99A 4HP4A 3VE4A 4I38A 4EUVA 3MJQA 2WKPA 2ZOHA 3EEHA 3K3CA 2IA2A 2QYBA 2FZ0A 4YNRA 4HOIA 2VKSA 3CWFA 2GX5A 1S4RA 5HWVA 2W3HA 4R3AA 5HD5A 5I5LA 3CITA 1OTAA 3OCNA 3O5YA 3LR3A 5IT5A 5AVEA 2ZMVA 3BQAA 4EEPA 2D02A 4LPZA 4KQDA 2GJ3A 3B33A 1NRJA 1YSQA 4EQ1A 2Z6DA 2J3TC 4Q0HA 2L1MA 3PBRA 4MN7A 3HJKA 1F5MA 3C8CA 4FOFA 4Y5FA 2W3GA 1X0OA 2A24B 2VA0A 4JGPA 1V9YA 2PDRA 3F1OA 3TRCA 4UEYA 1OTIA 5L8MA 2P08A 3NOUC 1V9ZA 1P0ZA 3UB8A 3EOIA 5AVFA 4G3VA 1OT9A 4H6JA 4WUJA 1S1ZA 4L9FA 5HSQA 3MMHA 3MQOA 3MXQA 3BY8A 4EERA 5J4EA 5A8BA 3V67A 3UB7A 3H9WA 4Y3IA 3LIFA 5HPIA 4HQAA 3KSGA 1DP6A 2PD8A 1T18A 3RH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME4 A;  3KO6 A;  2VJW A;  4LRZ E;  3G6O A;  4R6L A;  4IUK A;  4EU0 A;  4Q0I A;  2K31 A;  4DN0 A;  4PAU A;  3BJN A;  2B18 A;  3DBA A;  4RQ9 A;  5LBR A;  4YOF A;  3NHQ A;  3K2N A;  4MCW A;  2M7U A;  4Y2F A;  2W1T A;  4G3K A;  2VZW A;  2O9C A;  2K2N A;  2XSS A;  5DFY A;  1TD5 A;  4R70 A;  3E0Y A;  2KLI A;  2XRO A;  2XRN A;  3C2W A;  2O9A A;  3S7P A;  4O0P A;  2O99 A;  3W2Z A;  1STZ A;  4Q0J A;  3LFV A;  5HPF A;  4EUV A;  3S7O A;  3IBJ A;  2M7V A;  3IBR A;  4DMZ A;  5TJJ A;  2Y8H A;  4E04 A;  5AJG A;  4MMN A;  4ETZ A;  2IA2 A;  2W3D A;  2QYB A;  3NOP C;  1TF1 A;  5DFX A;  3R4K A;  3OOV A;  4YNR A;  5HL6 A;  3ZQ5 A;  2VKS A;  4ZRR A;  2GX5 A;  2W3H A;  3VV4 A;  5I5L A;  3CIT A;  4CQH A;  3O5Y A;  4GW9 A;  3MF0 A;  4Z1W A;  4QPR A;  2VEA A;  3EEA A;  3KSF A;  2W3E A;  1YSQ A;  2W1R A;  2ZMF A;  4BWI A;  2Y79 A;  4LRX C;  3NOT C;  4Q0H A;  4MN7 A;  3OBF A;  1MC0 A;  1F5M A;  3CI6 A;  3KSI A;  3RFB A;  4G3W A;  2G7U A;  4FOF A;  4Y5F A;  4MDZ A;  2HGV A;  2LB5 A;  2W3G A;  3S7N A;  1VHM A;  3E98 A;  1MKM A;  3S7Q A;  4O01 A;  4IJG A;  3TRC A;  4LRY C;  4GLQ A;  3D3O A;  2KOI A;  1YKD A;  3KSH A;  4O8G A;  3MQ0 A;  5L8M A;  2LB9 A;  2OOL A;  3NOU C;  4G3V A;  2O9B A;  5HSQ A;  3MMH A;  5K5B A;  5C5K A;  3HCY A;  2W1T B;  1ZTU A;  2O0Y A;  4Y3I A;  5HPI A;  3KSG A;  4ETX A;  4IUH A;  1YSP A;  2W3F A; 
#chains in the Genus database with same CATH topology
 3BRM A;  3O87 A;  4LRZ E;  2OSU A;  4DDS A;  1IYP A;  3D4F A;  1XFQ A;  3VP0 A;  4U0T A;  3PBT A;  1HVB A;  2EX2 A;  3C5A A;  3MZE A;  3VP2 A;  1NZO A;  3MZF A;  1FSW A;  1LL8 A;  2XRN A;  3VP1 A;  2JCH A;  2DMW A;  5CX7 A;  3OPL A;  4GS9 B;  3S7O A;  1OME A;  1PFL A;  3IBJ A;  1L3L A;  4P6B A;  2Y8H A;  4E04 A;  3ZGA B;  3GV9 A;  1HZO A;  4BBT A;  3CG5 A;  2KX6 A;  3T4K A;  4RX2 A;  3S1Y A;  1EWZ A;  1W5D A;  1PWC A;  4EBL A;  4HH2 A;  3BEC A;  1N9L A;  2Y59 A;  1CEF A;  5DF9 A;  2WAE A;  1IKI A;  2Y2Q A;  2ZMF A;  4FSF A;  1JTD A;  3PHY A;  1BLS A;  3UME A;  2L0W A;  4HY8 A;  2G2U A;  3BFE A;  3SH7 A;  2NUT C;  3ZDJ A;  5E2F A;  1DP9 A;  5F5Y A;  4LRY C;  1PIO A;  3W8K A;  2JKG A;  3IQA A;  4XT2 B;  4JXV A;  3GMW A;  3T4T A;  1GHI A;  2D01 A;  3PR6 A;  2ZQA A;  3IF6 A;  3FKW A;  3HLG A;  1E3U A;  5D3O A;  3ZCZ A;  4ME4 A;  2P9V A;  2GNX A;  3PYP A;  1FCM A;  4LFU A;  1S1Y A;  2OAP 1;  4IBX A;  4NKP A;  4DN0 A;  1K4F A;  3LR5 A;  3I7J A;  1ERQ A;  3PBS A;  2HZ5 A;  3NI9 A;  2W27 A;  5IHV A;  2B5R A;  3ZNT A;  1IFQ A;  1GCE A;  1TS0 A;  3G31 A;  3S22 A;  3CHW P;  5HPF A;  5GLC A;  2WGW A;  4DJ3 A;  1DY6 A;  4NXG A;  3T4Q A;  3PAG A;  1S6R A;  3G2Y A;  1L0F A;  3SS3 A;  3WS4 A;  3IT9 A;  3M2K A;  2PU2 A;  4Y13 A;  2WZZ A;  3SS4 A;  5FAO A;  4X6T A;  3F1O B;  4JKT A;  4E3M A;  2DCF A;  2CMN A;  4WN5 A;  4H6J B;  5DTT A;  4KQO A;  5F83 A;  4S2O A;  4DJ2 A;  3DAV A;  3LEQ A;  3KYZ A;  5L2F A;  2Y2N A;  2OWH A;  3B47 A;  2HGV A;  2LB5 A;  3UB5 P;  3S7Q A;  3T4L A;  3BQ8 A;  2QMI A;  5FAT A;  1G5U A;  5EVI A;  5G4Z A;  4N1X A;  2OWJ A;  5HX9 A;  2J9O A;  3RTY A;  4HIA A;  2Y2H A;  1TS6 A;  3M6H A;  1ZHH B;  4RYE A;  3IXB A;  2E8I A;  4II7 A;  3LUQ A;  4EEU A;  3UDI A;  3UE0 A;  1PRQ A;  2WKI A;  2EFU A;  3V3S A;  4B9O A;  3BJN A;  1UWP X;  4GCZ A;  4F94 A;  4HJ6 A;  5CHU A;  1TD5 A;  1IKG A;  4R70 A;  4PM5 A;  3DTE A;  2WKR A;  3L9K A;  5F1F A;  1PNE A;  1QMF A;  3A0V A;  3A3I A;  5DJT A;  3UNW A;  4DMZ A;  4WEK A;  2VX8 A;  4PM6 A;  1ES5 A;  1P9W A;  3H82 A;  1MXO A;  2I72 A;  3E4P A;  3T12 B;  3NCK A;  2J80 A;  3CMZ A;  4PPR A;  4OOM A;  4L9E A;  4DDY A;  5KSH A;  3IS2 A;  4Z9Q A;  4HHD A;  5L07 A;  3DTI A;  4ZJ1 A;  1XGI A;  2Y4A A;  3V3R A;  5G4Y A;  1IYQ A;  1L2S A;  3GVB A;  1XJ4 A;  2Y2I A;  3O3V A;  1K0K A;  1YLJ A;  3IF6 B;  4CLC E;  4MBK A;  2JHE A;  4MDZ A;  2ZQD A;  3LR0 A;  3G35 A;  3V39 A;  2QJ7 A;  4FH2 A;  3L7H A;  1LSX A;  1IOU A;  4ARZ A;  1ES4 A;  3NUL A;  1DRM A;  4C75 A;  5K5B A;  2XH9 A;  4K08 A;  1XX2 A;  3EGD C;  4HNB A;  1W8Y A;  2ZQC A;  3ZNY A;  1YSP A;  3FYZ A;  5HWT A;  1L0E A;  1XJ6 A;  1MPL A;  3JVV A;  3LCE A;  3LO7 A;  5EEC A;  2VV6 A;  3MR0 A;  4Q0I A;  3QP1 A;  4MN5 A;  3MS6 A;  4ZBE A;  1SCW A;  4PAU A;  5E43 A;  3GSG A;  5LBR A;  4RVA A;  1YAX A;  4G3K A;  4JLF A;  2RCX A;  4X56 A;  2XFS A;  4WZ4 A;  5F69 A;  1ES3 A;  4U0X A;  5DTS A;  1ONG A;  3FZC A;  3OLO A;  3S7P A;  4HP4 A;  3K3C A;  5E2G A;  4PM8 A;  3AGF A;  5HWV A;  2W3H A;  3D9Y A;  5HD5 A;  2ACG A;  1K57 C;  1QME A;  3O5Y A;  4KZ9 A;  3LR3 A;  4OH0 A;  5AVE A;  4DE3 A;  5EOO A;  3BQA A;  5EVI B;  2J3T C;  5BOH A;  3IHA A;  1KGG A;  4E3L A;  3C8C A;  1PWD A;  1FR6 A;  4GDN A;  3W4P A;  4B4Z A;  2W3G A;  5F82 A;  4E6X A;  2VA0 A;  1LLB A;  1K38 A;  1V9Y A;  2PDR A;  5FQM A;  4C3Q A;  3NOU C;  2XF3 A;  5AVF A;  4G3V A;  3MBZ A;  3MMH A;  3VP4 A;  5E2H A;  4D2O A;  4EER A;  4X55 A;  1NYY A;  3H9W A;  3HRE A;  4S2N A;  4P87 A;  4GZB A;  2ZM8 A;  4KEN B;  5U47 A;  3FC7 A;  2WAF A;  4B4X A;  5GHZ A;  4WMC D;  2XR0 A;  1XP4 A;  2EX6 A;  4ZJ2 A;  3K2N A;  2Q9N A;  2W0N A;  2H0Y A;  1P97 A;  2I9V A;  4S2P A;  5DVA A;  2K2N A;  3FPV A;  3H82 B;  3O88 A;  3PBO A;  2XSS A;  4GHI A;  3QP6 A;  1DP8 A;  1WE4 A;  3T4O A;  3FWL A;  4UA9 A;  3WS2 A;  4PHT A;  3IH8 A;  4WF0 A;  1NYM A;  3IS2 B;  4E6W A;  3IHB A;  3H7W A;  5FQQ A;  1XPB A;  4E3K A;  4PM7 A;  4I5S A;  1E25 A;  2Y2G A;  4BL2 A;  1D1J A;  1YLT A;  4GW9 A;  1RGY A;  2J3T D;  2Y2J A;  4KZ5 A;  3Q1F A;  2PHY A;  1NLZ A;  1K55 A;  4KZ3 A;  1YQS A;  4ARZ B;  4BBV A;  3A3E A;  3RXW A;  3ZFZ A;  2HDR A;  5IS1 A;  3NOT C;  1MC0 A;  1KDW A;  1O7E A;  2PBD P;  4DKI A;  3S7N A;  4O01 A;  3KSH A;  1YMX A;  4UHU A;  2ZC5 B;  1NLY A;  4EW7 A;  1ERO A;  5AQA A;  2GZA A;  1IYO A;  3FKV A;  5L09 A;  4DXC A;  3HCY A;  4R4S A;  2FFF B;  4JGR A;  2V20 A;  3G6O A;  4IUK A;  2V0W A;  3ISG A;  4M4X A;  2A49 A;  2VV7 A;  1PW8 A;  2HJE A;  4X1M A;  3HLE A;  4KZA A;  2VZW A;  4KZB A;  2XFT A;  2O9C A;  4HES A;  1W79 A;  4EBP A;  2PYP A;  2EXB A;  4E3I A;  3WS0 A;  1C3B A;  4ZDX A;  2YKF A;  4MBH A;  3VSL A;  3TG9 A;  5J3W A;  4GNU A;  1YLP A;  3IBR A;  5GHY A;  1H8Y A;  3UPN A;  3A0S A;  5CER A;  1JWV A;  1PI5 A;  2PR6 A;  3OPR A;  3NOP C;  3EQU A;  4UAA A;  1GHM A;  2E8J A;  4WEL A;  2IWB A;  3Q81 A;  3VV4 A;  1WYB A;  1H3Q A;  3TE8 A;  5DF7 A;  3IXD A;  4EWF A;  2JKR I;  3NJA A;  1FR1 A;  4GOG A;  2V1A A;  3KSI A;  5KZH A;  4G3W A;  1Y28 A;  5HAP A;  3OC2 A;  2JKT I;  3P7N A;  2ZD8 A;  1Y54 A;  4LLO B;  1XGJ A;  2PT7 A;  4HJ3 A;  1O07 A;  3GDI A;  2NUP C;  3CPT A;  5HAR A;  1LT0 A;  2XLN A;  2P74 A;  3PBQ A;  1ACF A;  5FQJ A;  4QWO A;  4GHI B;  1YPR A;  3IXH A;  1HD8 A;  3WS5 A;  3SH8 A;  4BD1 A;  1KOU A;  5DKL A;  5IU1 A;  5HDD A;  1FIK A;  3TSG A;  1H8M A;  3LIE A;  4YOF A;  4ID4 A;  2WKH A;  3VP3 A;  1BSG A;  4UA7 A;  5AQ7 A;  1YMS A;  5HD3 A;  1M6K A;  3UN7 A;  1FCO A;  1KGE A;  5DFY A;  3H7W B;  3LIB A;  3KYQ A;  2XRO A;  3N7W A;  3C2W A;  5A90 A;  2B02 A;  1FOF A;  4LV3 A;  3LFV A;  4KZ8 A;  4S2J A;  1ODV A;  1K54 C;  4X25 A;  3W4O A;  3CUE C;  2HDS A;  2PR5 A;  4I3J A;  2PYR A;  3T1R A;  3VE3 A;  1KE3 A;  3ZQ5 A;  4LV2 A;  1WA9 A;  4Y0O A;  1KGF A;  4K0X A;  2PAV P;  5A91 A;  4MLL A;  2J3W A;  4QPR A;  3T4J A;  3KSF A;  2A3U A;  4NG2 A;  4QJG A;  4K0W A;  3EQV A;  5L10 A;  1U60 A;  2Y79 A;  1YLY A;  2V2F F;  1F98 A;  5EV0 A;  1NRF A;  4BLM A;  1GHP A;  3BLM A;  2ZC6 B;  5CHM A;  1MKM A;  4E3J A;  1I2S A;  4IJG A;  4OKP A;  1LI0 A;  3VFH A;  2ZOI A;  4PMA A;  5EVE A;  4GKU A;  1VB6 A;  3MXR A;  3UO9 A;  3ZVW A;  3U2A A;  5FAS A;  2O9B A;  4KG2 A;  3MSH A;  3PTE A;  4WZ5 C;  1G6O A;  1ZTU A;  2PD7 A;  4UA6 A;  3UY6 A;  3U4L P;  3P01 A;  3FV7 A;  4NXF A;  4JBF A;  2XDM A;  2M1C A;  2Q9M A;  3KO6 A;  1KVL A;  2Y55 A;  3ZG7 B;  4EU0 A;  3Q82 A;  2Y2P A;  2X02 A;  3C7U A;  3UE3 A;  2Z2L B;  4PM9 A;  4OOL A;  5GHX A;  1MWS A;  1VET A;  4L9G A;  4NXE A;  1T1B A;  1TEM A;  1MBL A;  4FTX A;  4CPK A;  1ES2 A;  3VSK A;  3HLW A;  1CQA A;  4QY5 A;  4H8R A;  3Q07 A;  3VOY A;  4O0P A;  4WBG A;  3UB6 A;  2O99 A;  3VE4 A;  3DWZ A;  3MJQ A;  4A5R A;  3GQZ A;  5FAQ A;  4YNR A;  1JWP A;  4DF6 A;  4EBN A;  4JPM A;  1OTA A;  3GR2 A;  4JXS A;  5GLD A;  2ZMV A;  4BQM A;  4DE2 A;  1FCN A;  1MWR A;  4DXB A;  1PZP A;  1YSQ A;  4EQ1 A;  5EPH A;  3CPT B;  4OPR A;  4S2M A;  3UPP A;  1ERM A;  1F5M A;  4OQ0 A;  5A93 A;  4FOF A;  2ZM0 A;  3ITB A;  2G2W A;  4JGP A;  3HUO A;  3JYI A;  3LEZ A;  3T1Q B;  2P08 A;  1P0Z A;  3EOI A;  5HW3 A;  3HLC A;  4LCL A;  1S1Z A;  4L9F A;  3V67 A;  5HPI A;  3LIF A;  2J7V A;  3N8L A;  2PD8 A;  4HP9 A;  3ZG8 B;  3IX4 A;  1W7F A;  4NEE D;  1W63 M;  4CLC C;  1TS7 A;  2PRF A;  1GSW A;  2OLU A;  4R38 A;  3NHQ A;  2QHK A;  4QY6 A;  4OOY A;  3NY4 A;  4MN6 A;  3LID A;  1K57 A;  4GN2 A;  3LR4 A;  2WZX A;  3BLS A;  4N9K A;  2BLS A;  2HPB A;  3ICY A;  3DW0 A;  3ULF A;  5FI6 A;  1TS8 A;  4EV4 A;  1IEM A;  2H28 A;  1ZC2 A;  4EES A;  1K56 A;  3NDG A;  3C30 A;  4PKY A;  1CF0 A;  5HWW A;  4MEZ A;  4JXG A;  3B42 A;  3WS1 A;  3B3X A;  2HP6 A;  4R4R A;  5DTK A;  3A3J A;  4N92 A;  3QP5 A;  5DFX A;  5E2E A;  2QZ6 A;  3SW1 A;  4DE0 A;  1NY0 A;  3SOI A;  1I5Q A;  2JBF A;  2WGV A;  3IH9 A;  3QNC A;  2Z2M B;  4QU3 A;  3C38 A;  4Z1W A;  1OTE A;  4WYY A;  4KZ7 A;  5KIZ A;  2V1Z A;  3F1P A;  3WWX A;  3LI9 A;  3BW6 A;  2QPN A;  3ZG0 A;  5F68 A;  3BM6 A;  4X68 A;  4X1L A;  4GLQ A;  2UWX A;  5EVI D;  3T50 A;  4IHQ A;  4KQQ A;  2EFX A;  1NXY A;  1RP5 A;  2RL3 A;  1PWG A;  5C5K A;  1VET B;  2O0Y A;  1L0D A;  5G18 A;  1E4D A;  1OTD A;  3T4S A;  4CLC D;  3NBL A;  5CED A;  4N9L A;  1KDS A;  4R6L A;  3R7W A;  3C7V A;  5CXW A;  3DBA A;  4ESP A;  1VM1 A;  2ZL1 A;  4QB8 A;  2W1T A;  1KE0 A;  2VV8 A;  2ZJ9 A;  2BTF P;  3OCL A;  2H5S A;  4P6Z M;  1P9R A;  1BYW A;  4M3K A;  1CK3 A;  2R9X A;  1SDE A;  3JPU A;  2VGL M;  5TBM A;  3MQQ A;  3V50 A;  5GLA A;  2M7V A;  4BBU A;  3EWK A;  2OLV A;  5FSR A;  1XKZ A;  2ZC4 B;  4MNR A;  1OT6 A;  5EUA A;  4XUX A;  1VEU A;  4CQH A;  2Y91 A;  3RXX A;  4Y15 A;  3ZYT A;  3ZG5 A;  1JNU A;  4P6Z S;  4MBF A;  5CGX A;  2W1R A;  4LRX C;  4EXO A;  2ZC3 B;  1CI9 A;  1VQQ A;  3QNB A;  4IVI A;  4AFI A;  5HZH A;  2VGK A;  5F1G A;  4U3T A;  1BLP A;  2V9A A;  1S67 L;  1N4O A;  5TR7 A;  3GRJ A;  2EX9 A;  5HAI A;  4XXR A;  5EE8 A;  3MKF A;  2KOI A;  1DJA A;  3RJU A;  4X53 A;  5HFO A;  2V0U A;  2XA7 M;  4KG6 A;  4IUH A;  1T19 A;  4KZ6 A;  1OJG A;  3HLD A;  5FDS A;  4N1H A;  2K31 A;  5M19 A;  3IX3 A;  1WYC A;  4JGO A;  3AGE A;  1S0W A;  2JC7 A;  4BEN A;  2J9P A;  3DTM A;  4YWZ A;  4OQH A;  3HLF A;  2XA7 S;  3UDF A;  2R78 A;  1PZO A;  2YKH A;  1SHV A;  1OJ5 A;  2OAQ 1;  3KYE A;  3GEC A;  5TJJ A;  4F3L B;  4MMN A;  3F1P B;  3KX0 X;  3OOV A;  1HLU P;  1I2W A;  3N8R A;  3K3D A;  2XD5 A;  2JKF A;  1LSV A;  2HP9 A;  3P98 A;  5CTN A;  1XFN A;  3N8S A;  3MFD A;  3BWL A;  4OQI A;  1N9O A;  1AWI A;  2VEA A;  1PI4 A;  1UWN X;  3BFF A;  4NXB A;  4KUK A;  1TDG A;  2QJ5 A;  5F6A A;  1XXM A;  1JVJ A;  2EWV A;  3LYX A;  5CGW A;  1YT4 A;  4EQI A;  5EM0 A;  3IXG A;  3RFB A;  1BTL A;  1D06 A;  3EGX C;  5TGF A;  2R9W A;  3E98 A;  4OPZ A;  2INW A;  4OP8 A;  1OTB A;  3IF5 A;  4O8G A;  3IX8 A;  3R7W B;  2OOL A;  3TOI A;  2ZL1 B;  2W1T B;  4L0L A;  4GDB A;  1SDN A;  3UPO A;  4ETX A;  5CGS A;  2W3F A;  3BFD A;  3QP2 A;  5FAP A;  1K54 A;  4BD0 A;  3E4O A;  3CUE A;  3T1X A;  1CJF A;  5TBM B;  3LIA A;  4OP5 A;  3NC8 A;  5CHJ A;  2JN7 A;  2WKQ A;  5FQI A;  4I3A A;  1KE4 A;  3VOZ A;  4LV1 A;  1VEU B;  4OPY A;  4Y0U A;  4I38 A;  4EUV A;  4FH4 A;  4IBR A;  2ZOH A;  5HL1 A;  2IA2 A;  1GA0 A;  2J8Y A;  2FZ0 A;  2VKS A;  1KVM A;  3CWF A;  2GX5 A;  2C5W B;  5I5L A;  5KMW A;  4HEF A;  3QP8 A;  1G68 A;  4EEP A;  2D02 A;  4WZ5 A;  4LPZ A;  2GJ3 A;  3B33 A;  3QHY A;  4Q0H A;  4KG5 A;  4MN7 A;  3SH9 A;  1Q2P A;  4QD4 A;  1YLZ A;  1X0O A;  5FA7 A;  4P0M A;  4KZ4 A;  3TRC A;  2WUQ A;  2XQZ A;  4JXW A;  4UEY A;  3P09 A;  3MXS A;  5JYP A;  1OTI A;  3UB8 A;  5J8X A;  2IWD A;  1IYS A;  1OT9 A;  3VFF A;  4WUJ A;  4LEN A;  5HSQ A;  1ONH A;  3BY8 A;  3UB7 A;  4Y3I A;  2X01 A;  4HQA A;  3LY4 A;  5GLB A;  1T18 A;  3RH8 B;  5M18 A;  4EET B;  1H8Z A;  4GD8 A;  1NZU A;  1JWZ A;  4HJ4 A;  2VGJ A;  3OPH A;  3IWQ A;  4HI4 A;  4RQ9 A;  5FI2 A;  3D72 A;  2VK3 A;  1YLW A;  3CZD A;  4FCF A;  1XJ2 A;  2AVX A;  4Q8I A;  5TFQ A;  4UQI M;  5HDC A;  3E0Y A;  2HDQ A;  2JKR M;  3IF6 C;  2V8C A;  2HJ9 C;  2Q0O A;  1YM1 A;  3HBR A;  1SZV A;  2O9A A;  4JF4 A;  2ZQ9 A;  5HDS A;  4Q0J A;  2HP5 A;  2XD1 A;  4WM9 A;  4JF5 A;  3VOL A;  2WKE A;  2JKT M;  1LL9 A;  1CI8 A;  1TF1 A;  2V1B A;  4ZJ3 A;  4OLD A;  1MY8 A;  3UMD A;  1K6R A;  4ZRR A;  4WL9 A;  3SS5 A;  2EXA A;  4UQI S;  3MF0 A;  4YIN A;  1L0G A;  2Y2O A;  2ZMA A;  3EEA A;  3ZVT A;  2W3E A;  2QWS A;  3E2L A;  3LI8 A;  4BWI A;  1TDL A;  4ZAM A;  2OV5 A;  1JTG A;  3OBF A;  1BZA A;  4R3B A;  4XUZ A;  3CI6 A;  3LIC A;  2MJ6 A;  3LGO A;  3TJZ C;  3G2Z A;  2G7U A;  3UB9 A;  4R0Q A;  3G32 A;  1VHM A;  3BFG A;  1H5X A;  3A3F A;  3GTC A;  3NEC A;  2XK1 A;  4S2I A;  4CLC A;  1GSV A;  2C6W B;  1SKO A;  4C6Y A;  4LCM A;  1YKD A;  1J3W A;  3HLB A;  2LB9 A;  3QP4 A;  3CAX A;  4JGQ A;  5FL3 A;  2ZBB A;  1DJB A;  3N4I A;  1N9B A;  4LGW A;  3ITA A;  4PKY G;  4BL3 A;  1LSW A;  2Y2L A;  1HTZ A;  1RCJ A;  2EA9 A;  2VJW A;  2ZC7 A;  3O86 A;  4HBU A;  1W63 Q;  4RA7 A;  4WMC A;  4DRT A;  5FEF A;  1Q2Q A;  2HV1 A;  5CEC A;  1RGZ A;  4GJ4 A;  5EVI C;  2EWW A;  1GA9 A;  1E3U D;  3NIA A;  1FQG A;  3G34 A;  3WRT A;  3F1N A;  2XGN A;  5DF8 A;  1BLH A;  1MZU A;  5CTM A;  4NET A;  3CJM A;  4OLG A;  4I39 A;  1ZG6 A;  3LY3 A;  4FD8 A;  4KUO A;  1J9M A;  5MC7 A;  1CEG A;  5AJG A;  4GD6 A;  5FQ9 A;  2K7S A;  2W3D A;  1MKI A;  1FSY A;  3T1S A;  1Z6F A;  4D60 A;  4S2L A;  4NK3 A;  1EW0 A;  2DRW A;  1BUE A;  2P9V B;  5EVL A;  1ESI A;  3MZD A;  3HJI A;  4FUW A;  4R1G A;  3VMA A;  1XJ3 A;  1BLC A;  3Q7Z A;  3Q7V A;  2VLG A;  4R3J A;  1F2K A;  5FDH A;  2ZLY A;  1MWU A;  2FFY A;  3BFC A;  4S2K A;  5AQ9 A;  5FEG A;  4X69 A;  2BAS A;  3TW8 A;  3D3O A;  1FIL A;  4JF6 A;  1G28 A;  1SKF A;  3MQ0 A;  4LV0 A;  1D7E A;  1IEL A;  5EOE A;  2WGW B;  3CLO A;  4B88 A;  4F3L A;  1EI5 A;  4O7D A;  4QHC A;  1GSX A;  4HBT A;  5FQK A;  1LHY A;  2A24 A;  2PU4 A;  3UE6 A;  2HDU A;  2FH5 A;  2PBY A;  1PYY A;  3A3D A;  3IWI A;  2B18 A;  3JVU A;  4WLA A;  1ZKJ A;  4MCW A;  4Y2F A;  3G4P A;  1MWT A;  4P85 A;  5GL9 A;  5CEB A;  2B95 A;  3OZH A;  1NWZ A;  4B93 A;  2KLI A;  3E2K A;  2V8F A;  3PXP A;  4OVD A;  1H0M A;  3DWK A;  3W2Z A;  1STZ A;  3HVF A;  4Y0T A;  4ETZ A;  3M6B A;  3R4K A;  4OQG A;  3SZT A;  1UGU A;  5HL6 A;  1S66 L;  1A0K A;  4I3I A;  3A0R A;  3M2J A;  4CLC B;  1LL5 A;  1OPX A;  2DNS A;  1G6A A;  1SKO B;  4GS9 A;  1LI9 A;  2HF6 A;  5DJU A;  2P04 A;  1DJC A;  3HUM A;  3PBN A;  3N6I A;  4DE1 A;  2EX8 A;  3BEB A;  5FI7 A;  1BT5 A;  3C4O A;  5I94 A;  2WK0 A;  4WEJ A;  3UE1 A;  2IWC A;  1K25 A;  5CRF A;  3G30 A;  4YFM A;  1F9I A;  3S4X A;  1NJ4 A;  1T1C A;  5M1A A;  1Y4O A;  2Z6C A;  3HL9 A;  2Y2K A;  3IWO A;  3AGD A;  2VGL S;  3MFX A;  3E4Q A;  2WAD A;  1S4S A;  3BY9 A;  5HAQ A;  4BJP A;  4ZTK A;  4K91 A;  2P7J A;  3F1N B;  2UV0 E;  4GB7 A;  1AXB A;  1ALQ A;  3FPW A;  3FG8 A;  4XT2 A;  1XA1 A;  5J7E A;  2ZQ8 A;  1TVF A;  2H0T A;  4HH3 A;  2M7U A;  3MKE A;  5EFW A;  2XEP A;  2A2L A;  4BMW A;  2CC1 A;  1N9N A;  2Y2M A;  3PAE A;  1M40 A;  5AQB A;  4Y17 A;  1W8Q A;  2L4R A;  3BYD A;  1Z09 A;  2H10 A;  1ZG4 A;  1K56 D;  4S2N C;  2QKP A;  1PW1 A;  1T1A A;  5DKK A;  3ZG9 B;  3UDX A;  2KDK A;  3ZHH A;  4RX3 A;  1K4E A;  3C4P A;  2WKP A;  4E3O A;  3Q7V B;  2GDN A;  3EEH A;  1ESU A;  2QYB A;  4R23 A;  3DTK A;  4HOI A;  5JYO A;  3WRZ A;  1S4R A;  4IED A;  4R3A A;  3CIT A;  1XA7 A;  3OCN A;  5IT5 A;  4KQR A;  5A92 A;  4KQD A;  1NRJ A;  2Z6D A;  2BG1 A;  4EUZ A;  2L1M A;  3PBR A;  3HJK A;  3NDE A;  1BUL A;  2ZQ7 A;  2JE5 A;  4Y5F A;  3W4Q A;  3OPP A;  5EM1 A;  2A24 B;  2ZM2 A;  5KSC A;  3F1O A;  4Y7P A;  2X71 A;  3V5M A;  5L8M A;  2WGI A;  1V9Z A;  4OON A;  4OPQ A;  4H6J A;  3MQO A;  3MXQ A;  1K55 C;  5J4E A;  5A8B A;  4E3N A;  1K6S A;  3HUN A;  3KSG A;  4CJN A;  1DP6 A;  2WYX A;  4IVK A; 
#chains in the Genus database with same CATH homology
 4HP9 A;  4EET B;  3FC7 A;  4NEE D;  4LRZ E;  1W63 M;  4HJ4 A;  4CLC C;  1TS7 A;  4HI4 A;  1GSW A;  4RQ9 A;  1XFQ A;  4R38 A;  3D72 A;  3K2N A;  3NHQ A;  2QHK A;  3PBT A;  2W0N A;  1P97 A;  2I9V A;  2K2N A;  3FPV A;  3H82 B;  3PBO A;  1XJ2 A;  2XSS A;  4GHI A;  4MN6 A;  3LID A;  3LR4 A;  4UQI M;  5HDC A;  1DP8 A;  3E0Y A;  1LL8 A;  2JKR M;  2XRN A;  3ICY A;  2HJ9 C;  3ULF A;  3T4O A;  1TS8 A;  2O9A A;  2H28 A;  4EES A;  4PHT A;  3C30 A;  4PKY A;  5HDS A;  2DMW A;  4Q0J A;  5CX7 A;  5HWW A;  4GS9 B;  4WF0 A;  3S7O A;  3IBJ A;  3IS2 B;  3VOL A;  3B42 A;  2Y8H A;  4E04 A;  2JKT M;  4BBT A;  1TF1 A;  5DFX A;  2KX6 A;  2V1B A;  3T4K A;  3SW1 A;  3H7W A;  3UMD A;  4ZRR A;  4WL9 A;  4I5S A;  4HH2 A;  3C38 A;  4GW9 A;  2J3T D;  1N9L A;  3MF0 A;  4UQI S;  5DF9 A;  1OTE A;  4Z1W A;  2PHY A;  1NLZ A;  3EEA A;  2W3E A;  2QWS A;  4ARZ B;  4BBV A;  3LI8 A;  5KIZ A;  2ZMF A;  4BWI A;  5IS1 A;  4FSF A;  3NOT C;  3F1P A;  3OBF A;  3PHY A;  3UME A;  2L0W A;  1MC0 A;  4HY8 A;  3CI6 A;  3LIC A;  2MJ6 A;  3TJZ C;  2G7U A;  3UB9 A;  3LI9 A;  3BW6 A;  2NUT C;  3S7N A;  1VHM A;  5F68 A;  4CLC A;  4O01 A;  1DP9 A;  1GSV A;  5F5Y A;  4LRY C;  4GLQ A;  1YKD A;  3KSH A;  2LB9 A;  1NLY A;  3T50 A;  4XT2 B;  4IHQ A;  4EW7 A;  3T4T A;  2GZA A;  3CAX A;  4JGQ A;  2D01 A;  5FL3 A;  2ZBB A;  5C5K A;  3HCY A;  3PR6 A;  2O0Y A;  4PKY G;  1LSW A;  4ME4 A;  3T4S A;  1OTD A;  4CLC D;  2GNX A;  2EA9 A;  4JGR A;  2VJW A;  3PYP A;  3G6O A;  1S1Y A;  4R6L A;  4IUK A;  2OAP 1;  2V0W A;  4NKP A;  3R7W A;  4M4X A;  1W63 Q;  4DN0 A;  2VV7 A;  3DBA A;  3LR5 A;  2HJE A;  2HV1 A;  2W1T A;  3PBS A;  2VZW A;  2O9C A;  4GJ4 A;  2EWW A;  2VV8 A;  2PYP A;  2W27 A;  3F1N A;  3OCL A;  4P6Z M;  1MZU A;  1P9R A;  1BYW A;  1IFQ A;  1TS0 A;  2YKF A;  4I39 A;  4KUO A;  2VGL M;  5TBM A;  5J3W A;  3MQQ A;  5HPF A;  5MC7 A;  2M7V A;  3IBR A;  4BBU A;  4DJ3 A;  3A0S A;  3EWK A;  4NXG A;  5AJG A;  3T4Q A;  2K7S A;  2W3D A;  2PR6 A;  3NOP C;  3EQU A;  4WEL A;  1OT6 A;  1EW0 A;  3VV4 A;  1H3Q A;  4CQH A;  3TE8 A;  3HJI A;  3F1O B;  3ZYT A;  1JNU A;  1XJ3 A;  4P6Z S;  2VLG A;  2W1R A;  2CMN A;  4WN5 A;  4H6J B;  2JKR I;  3NJA A;  4KQO A;  4LRX C;  4EXO A;  4DJ2 A;  3KYZ A;  2V1A A;  3KSI A;  4AFI A;  5HZH A;  4G3W A;  1Y28 A;  2OWH A;  3B47 A;  2HGV A;  2LB5 A;  2V9A A;  3OC2 A;  1S67 L;  2JKT I;  3P7N A;  3S7Q A;  3T4L A;  2BAS A;  4LLO B;  3TW8 A;  3D3O A;  3BQ8 A;  1G28 A;  2KOI A;  2PT7 A;  3MQ0 A;  4HJ3 A;  1D7E A;  3GDI A;  2NUP C;  5G4Z A;  2OWJ A;  3CLO A;  4F3L A;  1LT0 A;  3RTY A;  2V0U A;  3PBQ A;  2XA7 M;  4HIA A;  1GSX A;  1TS6 A;  4GHI B;  4IUH A;  1ZHH B;  4II7 A;  2A24 A;  1T19 A;  3LUQ A;  1OJG A;  4EEU A;  3UE6 A;  2FH5 A;  1KOU A;  5DKL A;  5IU1 A;  2K31 A;  4B9O A;  5HDD A;  3BJN A;  2B18 A;  3JVU A;  1H8M A;  3LIE A;  4JGO A;  4YOF A;  1UWP X;  4WLA A;  4MCW A;  4GCZ A;  4Y2F A;  5HD3 A;  4HJ6 A;  4YWZ A;  5DFY A;  1TD5 A;  1NWZ A;  3H7W B;  4R70 A;  4B93 A;  2XA7 S;  3LIB A;  2KLI A;  3KYQ A;  2XRO A;  2R78 A;  3C2W A;  2YKH A;  3PXP A;  2B02 A;  2WKR A;  1OJ5 A;  3W2Z A;  1STZ A;  3A0V A;  3LFV A;  2OAQ 1;  1ODV A;  5DJT A;  4DMZ A;  3GEC A;  4WEK A;  5TJJ A;  4F3L B;  3CUE C;  4MMN A;  2VX8 A;  2PR5 A;  4ETZ A;  4I3J A;  1P9W A;  2PYR A;  3F1P B;  3H82 A;  3KX0 X;  3OOV A;  3R4K A;  1UGU A;  3K3D A;  3VE3 A;  5HL6 A;  1S66 L;  3ZQ5 A;  1WA9 A;  1LSV A;  3E4P A;  4I3I A;  3A0R A;  1XFN A;  3BWL A;  4CLC B;  1OPX A;  2J80 A;  1N9O A;  4OOM A;  2J3W A;  4L9E A;  4QPR A;  3T4J A;  2VEA A;  3KSF A;  4GS9 A;  5KSH A;  1UWN X;  3IS2 A;  3EQV A;  4NXB A;  2HF6 A;  2P04 A;  4HHD A;  5DJU A;  4KUK A;  2QJ5 A;  5G4Y A;  5F6A A;  2Y79 A;  2EWV A;  3LYX A;  3PBN A;  1XJ4 A;  1F98 A;  3RFB A;  1D06 A;  4CLC E;  2JHE A;  4MDZ A;  4WEJ A;  3EGX C;  3LR0 A;  3E98 A;  1MKM A;  1F9I A;  4IJG A;  2INW A;  2QJ7 A;  1OTB A;  2ZOI A;  4O8G A;  1IOU A;  1LSX A;  4ARZ A;  1VB6 A;  1DRM A;  3R7W B;  2OOL A;  1T1C A;  2Z6C A;  3U2A A;  2O9B A;  5K5B A;  4K08 A;  2VGL S;  2W1T B;  1G6O A;  1ZTU A;  2PD7 A;  3EGD C;  4L0L A;  3MFX A;  4HNB A;  3P01 A;  3E4Q A;  4NXF A;  4ETX A;  1S4S A;  1YSP A;  2M1C A;  3BY9 A;  5HWT A;  4BJP A;  2W3F A;  1XJ6 A;  3JVV A;  3KO6 A;  2P7J A;  3F1N B;  3E4O A;  2VV6 A;  4EU0 A;  3MR0 A;  3CUE A;  3FPW A;  4Q0I A;  3FG8 A;  4MN5 A;  4XT2 A;  4PAU A;  5TBM B;  3LIA A;  5J7E A;  3UE3 A;  5LBR A;  2JN7 A;  4HH3 A;  1YAX A;  2WKQ A;  2M7U A;  4OOL A;  5EFW A;  2A2L A;  4BMW A;  4G3K A;  4L9G A;  4NXE A;  1T1B A;  1N9N A;  4I3A A;  2L4R A;  5F69 A;  2QKP A;  3OLO A;  1T1A A;  4O0P A;  5DKK A;  3S7P A;  3UB6 A;  2KDK A;  2O99 A;  4HP4 A;  3VE4 A;  4I38 A;  4EUV A;  3MJQ A;  2WKP A;  2ZOH A;  3EEH A;  3K3C A;  2IA2 A;  2QYB A;  2FZ0 A;  4YNR A;  4HOI A;  2VKS A;  3CWF A;  2GX5 A;  1S4R A;  5HWV A;  2W3H A;  4R3A A;  5HD5 A;  5I5L A;  3CIT A;  1OTA A;  3OCN A;  3O5Y A;  3LR3 A;  5IT5 A;  5AVE A;  2ZMV A;  3BQA A;  4EEP A;  2D02 A;  4LPZ A;  4KQD A;  2GJ3 A;  3B33 A;  1NRJ A;  1YSQ A;  4EQ1 A;  2Z6D A;  2J3T C;  4Q0H A;  2L1M A;  3PBR A;  4MN7 A;  3HJK A;  1F5M A;  3C8C A;  4FOF A;  4Y5F A;  2W3G A;  1X0O A;  2A24 B;  2VA0 A;  4JGP A;  1V9Y A;  2PDR A;  3F1O A;  3TRC A;  4UEY A;  1OTI A;  5L8M A;  2P08 A;  3NOU C;  1V9Z A;  1P0Z A;  3UB8 A;  3EOI A;  5AVF A;  4G3V A;  1OT9 A;  4H6J A;  4WUJ A;  1S1Z A;  4L9F A;  5HSQ A;  3MMH A;  3MQO A;  3MXQ A;  3BY8 A;  4EER A;  5J4E A;  5A8B A;  3V67 A;  3UB7 A;  3H9W A;  4Y3I A;  3LIF A;  5HPI A;  4HQA A;  3KSG A;  1DP6 A;  2PD8 A;  1T18 A;  3RH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...