3TG9A

The crystal structure of penicillin binding protein from bacillus halodurans
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
322
Chain Sequence
MKNHLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein
publication title The crystal structure of penicillin binding protein from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Penicillin binding protein
total genus 102
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3tg9A00
4HBUA 3N8LA 4KQQA 3ZCZA 3CJMA 2JE5A 4OPQA 2P74A 4FH2A 1PYYA 4WMCA 3BYDA 3G2ZA 3N6IA 1H8YA 4KZBA 3W4OA 3B3XA 2IWCA 3UN7A 2WGVA 2Q9MA 3MXSA 4E3MA 1XA7A 3S1YA 2WKIA 5EVIC 3ZVTA 5FASA 3HUMA 4LCLA 4LV3A 3UY6A 3O87A 5I94A 4OOMA 3SS4A 2XR0A 4HESA 1E25A 3AGFA 2Y2MA 3Q7ZA 4RVAA 2WAEA 1HTZA 4S2MA 3WS5A 1DJBA 1TDLA 4WBGA 1ES4A 1L0DA 2A3UA 4JF6A 4OLDA 1CI8A 2WKEA 4OQ0A 4LV0A 4BD0A 3VMAA 5DF8A 4E3LA 1MWSA 4EBPA 2Y2QA 1TDGA 4N1XA 4OH0A 1NJ4A 5FI6A 4L0LA 4FD8A 4BQMA 4ZBEA 4O7DA 1XPBA 1FR1A 1SDNA 1IYPA 4KZ5A 1Y54A 2VGKA 3PAEA 3O88A 1MWRA 1SHVA 4C3QA 1KGEA 3W4QA 1W8QA 1Z6FA 4HEFA 1LI0A 5FQJA 4QHCA 3V3SA 3VP3A 1FQGA 4PPRA 3OPHA 5CECA 3GV9A 4H8RA 1K4FA 4R4RA 4X56A 3CZDA 2QMIA 5FQIA 5DVAA 2XD5A 4R4SA 2V1ZA 1QMEA 3W8KA 1HD8A 3ZNYA 1NXYA 1K56D 3I7JA 4RYEA 3NCKA 3PBRA 1KGFA 4KZ9A 4WYYA 4BJPA 1H5XA 1KE4A 2EX2A 4B88A 4DDSA 2XQZA 4N9KA 1JTGA 4WM9A 5EVIA 3ZG5A 4K0WA 4EBNA 1W8YA 1SCWA 5FQMA 2ZM0A 4Q8IA 4PM7A 1IELA 1K6RA 4KG5A 3FWLA 3IH8A 4QY6A 2G2WA 5CGSA 4ZTKA 4WEJA 4Z9QA 3IF6B 4ZJ2A 4QY5A 4WELA 1WYCA 2H0TA 2WUQA 4OVDA 2R9WA 4KZAA 1NY0A 3GMWA 3UE0A 3AGDA 2QPNA 4E3OA 1HZOA 4ZAMA 3SH8A 4GKUA 3GVBA 4KG2A 3BLMA 1DY6A 3LY3A 2Y2NA 3C7UA 1RGZA 5CRFA 1FCNA 3CG5A 4HBTA 4GDBA 1G6AA 4S2OA 3C4PA 2BG1A 3IWOA 3S4XA 5F1FA 5AQ7A 1YM1A 2XGNA 3G30A 1WYBA 3NC8A 3UDXA 1TEMA 4WZ5A 3BFGA 1LL5A 1NZUA 3GTCA 1L0FA 3UNWA 2G2UA 2WGWB 3Q7VB 2DCFA 1JTDA 5FAPA 3GR2A 2FFYA 3LO7A 4P85A 3HREA 1BLPA 2HDSA 3MZEA 3LY4A 4OP5A 4KG6A 3G2YA 5DTTA 1W79A 5FQ9A 4JXGA 4OLGA 1DJCA 1Q2QA 1FSWA 4JXWA 3HLGA 4UHUA 1M6KA 2X01A 5HFOA 3UO9A 3DTMA 5E2FA 4KZ7A 2Y4AA 4PM6A 4E3IA 1FOFA 5CHMA 3BFCA 3SS3A 1YT4A 1ZG6A 2H0YA 3DW0A 3HLWA 2ZMAA 1TVFA 3BRMA 1NRFA 5GL9A 1RGYA 4WZ4A 5FI2A 3M2KA 4PM5A 4XUZA 3ZHHA 3TOIA 3G35A 2Q9NA 1WE4A 1YMXA 1FCOA 2C5WB 2ZC5B 3M6HA 3A3DA 4KZ4A 1YLZA 5FQQA 3MKFA 4A5RA 4Y7PA 3BEBA 4E3NA 2CC1A 3NDEA 2PBYA 1NYMA 5EECA 2RL3A 3QHYA 1LHYA 3IF5A 4N1HA 4R3JA 4U0TA 3BFEA 1JWZA 3VP4A 1PWDA 4OPZA 5CERA 4DKIA 3V50A 2WADA 4KZ6A 3EQVA 2OV5A 2EX6A 3NIAA 5TFQA 1NZOA 4NETA 1K25A 4WMCD 1CI9A 3WS0A 5CXWA 3IXBA 1ES2A 1BULA 3HLCA 3G32A 1L2SA 2ZM8A 4F94A 3QNBA 3UPOA 1BLCA 3WS4A 1RCJA 1GHPA 3IQAA 2Y2GA 1BT5A 4K91A 4MBKA 4CPKA 1KVMA 1KE0A 1BLHA 1CEFA 1ERQA 5HX9A 3VSKA 2X71A 5EOOA 4Y0OA 4BL3A 1KVLA 1EWZA 1E3UD 1XGIA 3SS5A 3IWIA 1DJAA 2EFXA 2R9XA 1IEMA 4JPMA 4YFMA 2ZC7A 5GLBA 4P0MA 4S2PA 3OZHA 3OC2A 4DDYA 5FAQA 3NBLA 4PM8A 2HDRA 5DTKA 4S2LA 2JBFA 5AQBA 2A49A 5EVIB 4EQIA 3PBOA 3ZVWA 3HUOA 4JLFA 5HL1A 3C4OA 3IH9A 5AQAA 1U60A 2J8YA 5F83A 2WYXA 4WZ5C 2HP5A 3WWXA 4B4ZA 2HDUA 3HLEA 2ZQ8A 3ZFZA 1PWGA 4JXVA 2XLNA 1BZAA 1K54A 4GD8A 4DXBA 1GHMA 1JVJA 4NK3A 2ZQCA 1MKIA 2C6WB 4GDNA 4BD1A 3G34A 5KSCA 3BLSA 1RP5A 1FR6A 4GZBA 4RX3A 1I5QA 4OKPA 4KQRA 2H10A 3PBNA 5DF9A 4P87A 3FYZA 5EUAA 1O7EA 3V5MA 2X02A 1H8ZA 3IWQA 3HLBA 4JKTA 4WEKA 3WS1A 2QZ6A 5EVID 5E43A 3N8RA 1BLSA 2J9PA 1NYYA 2ZM2A 4M3KA 3EQUA 5KSHA 1BTLA 4S2KA 5A90A 3N8SA 1IYQA 3DWKA 4E3KA 3Q1FA 2PU2A 5FI7A 3IXGA 2FFFB 2ZC4B 4OP8A 4BLMA 2HPBA 5KZHA 1L0GA 4OQIA 1GCEA 2WAFA 4R3BA 3OPPA 4EUZA 1ZKJA 1YMSA 2VGJA 1FCMA 4E3JA 3VSLA 2EXAA 4FH4A 5FDHA 3GQZA 1YLTA 3VFHA 4QJGA 2B5RA 4GN2A 1YLYA 5M1AA 4CJNA 2ZD8A 5EVLA 4MLLA 2Z2LB 2Y91A 1HVBA 5CHUA 4OOYA 2H5SA 2Z2MB 3ITAA 1ES5A 3BFDA 3UPPA 4R0QA 4KZ3A 5JYOA 4MEZA 4LV2A 3SH9A 3VOZA 1PI5A 1Q2PA 4U3TA 2ZQ9A 4KQOA 3P98A 3P09A 2Y2IA 3BM6A 3FKWA 3IF6A 2WK0A 3AGEA 5CGXA 2IWBA 1EROA 4UAAA 1N9BA 3IHBA 5HAIA 2DNSA 2XD1A 3FZCA 1PZOA 4LCMA 3IT9A 3TSGA 4KZ8A 5GHZA 1GA9A 2XF3A 3V39A 2XEPA 3O86A 1K6SA 2ZJ9A 1XX2A 5EOEA 1C3BA 1KGGA 1SDEA 4QB8A 4E6WA 4OQHA 1I2WA 3ZNTA 1K55C 5CEBA 4N92A 4DXCA 3W4PA 3N4IA 1MBLA 3Q07A 1K54C 3VOYA 1YLPA 4DE3A 3V3RA 1PZPA 1MWUA 1YLJA 5GLAA 1K57A 1L0EA 3HVFA 1OMEA 5HAPA 3UE1A 3VFFA 5E2EA 1ZG4A 1IKIA 5FATA 3NY4A 1EI5A 3PBSA 2P9VA 4JBFA 1BSGA 1YLWA 4UA7A 5HARA 5D3OA 5J8XA 5A91A 3NDGA 1ESUA 4LENA 3D4FA 3G31A 5E2HA 1KE3A 5FSRA 4B4XA 4MBHA 4IVKA 3OCNA 5CTNA 1PWCA 5GLDA 3GRJA 3RXXA 3UPNA 1VM1A 5JYPA 4K0XA 5CGWA 1PW8A 3M6BA 3UE3A 2JCHA 3IXHA 3Q81A 5F82A 3Q82A 2XH9A 1KDSA 4FCFA 4EBLA 1I2SA 1LL9A 4XUXA 4YINA 5TR7A 2Y2PA 4E6XA 4JF4A 4IEDA 2XDMA 1XA1A 4S2IA 2EXBA 4BL2A 2RCXA 3ZDJA 2BLSA 4S2NC 2XFTA 3MFDA 3S22A 2Y2OA 1E3UA 1BUEA 2OLUA 2I72A 3GSGA 3ZG9B 3IXDA 2Y59A 1ONGA 3C7VA 4MBFA 3BFFA 3WRZA 3CMZA 3TG9A 1W7FA 3A3JA 3C5AA 3SOIA 4ZJ3A 1K55A 4PM9A 5A93A 5GHXA 2J9OA 5KMWA 1W5DA 2EX9A 2HP9A 5HAQA 3HLFA 4R1GA 5FA7A 2WKHA 3PBTA 4C6YA 3E2KA 1O07A 5FQKA 3WRTA 4C75A 3OCLA 4P6BA 1N4OA 1K38A 1MY8A 2Y2LA 1S0WA 4Y0UA 5FAOA 4X53A 3IF6C 5G18A 3M2JA 3PTEA 5CEDA 5AQ9A 1QMFA 3FV7A 5F1GA 5A92A 3JYIA 2E8IA 5TGFA 1IKGA 1KDWA 4JF5A 4JXSA 4OONA 1IYSA 1K56A 3NI9A 4LV1A 4IBRA 3HL9A 4ZJ1A 1M40A 3UDIA 2XK1A 4OQGA 4R23A 2Y55A 2J7VA 2ZQ7A 4GB7A 2WGIA 1PIOA 1SKFA 1ERMA 3LEZA 4RX2A 5BOHA 4IVIA 4DE1A 5GHYA 4U0XA 5CTMA 5DTSA 1G68A 1K4EA 4KENB 3FKVA 1S6RA 2Y2JA 1YQSA 5M18A 1JWPA 4ID4A 1XKZA 1MPLA 4QD4A 4GOGA 5GLCA 3VP1A 3A3EA 2Y2HA 1K57C 3MXRA 2GDNA 3A3FA 1MXOA 1LLBA 5L2FA 1FSYA 2V20A 1AXBA 2ZC3B 4RA7A 3ZG7B 4S2NA 1XP4A 4DRTA 2DRWA 3RXWA 5DF7A 4DF6A 2HP6A 1LI9A 3HUNA 4DE2A 4UA6A 4XXRA 4Y0TA 3LCEA 3ISGA 3A3IA 3ZGAB 2ZQDA 1CEGA 5CHJA 3SH7A 4X68A 3HBRA 1J9MA 3DWZA 1GA0A 2EX8A 3RJUA 4D2OA 2ZC6B 3O3VA 1XXMA 2JC7A 4IBXA 3MZDA 3VP2A 3PBQA 4GNUA 4PMAA 1ES3A 3UDFA 3OPRA 3ITBA 4X6TA 5HW3A 3E2LA 3MKEA 3IHAA 1E4DA 1ALQA 5E2GA 5U47A 3ZG8B 2ZLYA 2OLVA 2P9VB 3QNCA 1ZC2A 1VQQA 5EPHA 4OPYA 3BECA 4DE0A 4GD6A 4OOLA 5EE8A 3PAGA 2WZZA 4S2JA 1GHIA 4FSFA 4X55A 1PI4A 4BENA 1ONHA 3MBZA 5M19A 1PW1A 2IWDA 4UA9A 1JWVA 3OPLA 2XFSA 4QU3A 2V2FF 4ZDXA 1MWTA 1XGJA 1IYOA 2WZXA 3MZFA 2EFUA 4MNRA 3G4PA 4EWFA 2UWXA 4OPRA 2ZQAA 1ESIA 3ZG0A 2WGWA 3Q7VA 4X69A 2OSUA 3N7WA 5IHVA 2PU4A 3HLDA 2HDQA 2Y2KA 3VP0A 4N9LA 1CK3A 3WS2A 4EV4A
chains in the Genus database with same CATH superfamily
4KQQA 2JE5A 3SW1A 4BBUA 3BYDA 3G2ZA 3B3XA 2IWCA 2WGVA 4NXGA 2WKIA 5EVIC 2HGVA 4LCLA 4LV3A 4HIAA 4OOMA 3SS4A 3AGFA 3Q7ZA 4S2MA 1DJBA 1ES4A 2A3UA 1ZHHB 4EBPA 4HJ6A 4N1XA 2Y8HA 5FI6A 1DP9A 4YOFA 4BQMA 5HPFA 4ZBEA 3D3OA 3UMEA 4HOIA 4C3QA 3JVUA 3W4QA 4HEFA 3LFVA 1LI0A 1FQGA 3DTIA 2PAVP 4H8RA 4X56A 5FQIA 2VV8A 4R4SA 3W8KA 1HD8A 2VX8A 1NXYA 2KX6A 3MF0A 3PBRA 3BQAA 1KGFA 1H5XA 4N9KA 5EVIA 1VEUA 1T18A 4Q8IA 2ZM0A 4PM7A 4KG5A 3CI6A 2OWJA 2G2WA 1MC0A 1G5UA 3IF6B 4QY5A 2H0TA 3BWLA 4KZAA 3GMWA 3UE0A 1HZOA 4WN5A 3BLMA 3PXPA 3LY3A 2Y2NA 5AJGA 5AQ7A 1YM1A 3UDXA 3CWFA 3MS6A 3S7PA 1W63Q 3GR2A 2FFYA 3KX0X 4P85A 3D9YA 3IX3A 4HQAA 1W79A 1Q2QA 1FSWA 3UO9A 5HFOA 2Y4AA 1FOFA 2NUTC 2ZMFA 2QWSA 3HLWA 2ZMAA 2ZBBA 3ZHHA 3TOIA 1WE4A 2C5WB 1LSVA 1YLZA 3MKFA 4E3NA 3VE4A 2PBYA 1CQAA 4JGPA 4N1HA 3ULFA 3BFEA 1JWZA 1PWDA 4OPZA 5CERA 1UGUA 3EQVA 4WF0A 4WMCD 1CI9A 5CXWA 3IXBA 1BULA 4F94A 2AVXA 1VHMA 1P0ZA 3UB9A 3IQAA 4MBKA 2X71A 5EOOA 1KVLA 3T1QB 5HDSA 2ZC7A 2M7UA 3OC2A 5FAQA 4PM8A 4S2LA 5EVIB 1VEUB 3HUOA 3C4OA 3IH9A 1U60A 4GCZA 1BYWA 2WYXA 4WZ5C 2HP5A 1PWGA 3BW6A 1K54A 4GD8A 4DXBA 1GHMA 4NK3A 4GDNA 4HP4A 2JKGA 4UEYA 4OKPA 1G28A 4EUVA 4P87A 1H8ZA 3CITA 4X1MA 4M3KA 3LI9A 2B95A 5HL6A 5A8BA 5F68A 4E3KA 2PD8A 3IXGA 3MR0A 1GCEA 2VGJA 3VSLA 4FTXA 1TS0A 3T1XA 3CAXA 2ZD8A 5FDSA 3MQ0A 4MLLA 2Y91A 2Y79A 4R0QA 4MEZA 1YPRA 4LV2A 4U3TA 3R7WA 4KQOA 3P98A 3MJQA 3AGEA 2IWBA 1EROA 4UAAA 5HAIA 4NXFA 5EM0A 1PZOA 2O99A 3IT9A 4LCMA 5GHZA 3V39A 3O86A 2ZJ9A 1XX2A 1C3BA 3GDIA 3MQOA 2UV0E 1SZVA 3H9WA 3VOYA 1YLJA 5GLAA 1OMEA 1EI5A 3PBSA 5D3OA 5A91A 3NDGA 1ESUA 3D4FA 5E2HA 5DKKA 2VV7A 3QP2A 4MBHA 3OCNA 1G6OA 1PWCA 5GLDA 5CGWA 3UE6A 1VETA 3Q81A 4FCFA 1OPXA 2OWHA 3C8CA 5HSQA 1XA1A 4S2IA 4BL2A 3ZDJA 2BLSA 4S2NC 3NULA 4LPZA 3ZG9B 4DMZA 1ONGA 2YKHA 4MBFA 3CMZA 4GS9A 2VV6A 2J9OA 2EX9A 4Y5FA 2HP9A 3HLFA 3PBTA 4C6YA 5FQKA 2W3HA 1S0WA 2WKRA 4X53A 2H28A 2E8IA 1KDWA 4OONA 4JF5A 1IYSA 1K56A 1F98A 1S1ZA 4LV1A 4ZJ1A 4OQGA 2WGIA 1SKFA 3LEZA 5BOHA 3JPUA 5GHYA 4U0XA 4KENB 1S6RA 1YQSA 5M18A 4ID4A 4MN7A 4GOGA 3H82A 2Y2HA 5G4YA 1LLBA 1FSYA 1AXBA 4S2NA 4DRTA 2PD7A 3RXWA 3LIFA 1LI9A 4XXRA 4Y0TA 3LCEA 3A3IA 2ZQDA 4PAUA 2EX8A 2ZC6B 1XXMA 4Y15A 4PMAA 4MDZA 4Y13A 3OPRA 3ITBA 2W1TA 5HW3A 1E4DA 1XJ3A 4ETXA 1ALQA 3B33A 2ZLYA 2OAQ1 4GD6A 4Y2FA 5TBMA 3UB8A 1LSXA 5M19A 3MBZA 1PW1A 3LIDA 4QU3A 5J4EA 3MMHA 1T1CA 1VETB 3CPTA 1IYOA 3MZFA 2K7SA 5HWWA 3K3DA 2ZQAA 4H6JA 2WGWA 4X69A 5MC7A 2HDQA 3KO6A 3NJAA 3VP0A 3KSHA 2PRFA 2A2LA 5DKLA 3KYQA 3N8LA 3ZCZA 4IJGA 4R3AA 3E4QA 4OPQA 4KZBA 1H8YA 1S4RA 2QJ5A 2XA7S 3ZVTA 3UY6A 4CQHA 4MMNA 5I94A 4HESA 4ETZA 4RVAA 1TDLA 1XFQA 4X1LA 1H0MA 1L0DA 4JF6A 4QPRA 4OQ0A 4LV0A 4E3LA 4CLCE 4FD8A 4O7DA 2NUPC 4I5SA 1FR1A 4KZ5A 5TJJA 3PAEA 1MWRA 1S1YA 1DP6A 1W8QA 3H82B 5FQJA 4QHCA 3V3SA 3VP3A 2QJ7A 4JGQA 3OPHA 5CECA 3GV9A 3QP6A 4HI4A 3ZNYA 1H8MA 4WYYA 5L10A 4B88A 5HWVA 4I3JA 1JTGA 3ZG5A 4EBNA 3LUQA 1K6RA 3IH8A 5CGSA 2W1TB 4WEJA 3PR6A 4Z9QA 4ZJ2A 4WELA 2JHEA 2WUQA 3VOLA 3T1SA 3AGDA 4II7A 4ZAMA 5TBMB 3GVBA 2V0WA 3C7UA 1RGZA 2K31A 3CG5A 1MKMA 1G6AA 4GDBA 4S2OA 3IWOA 3L9KA 3CPTB 1WYBA 1YSPA 4H6JB 1L0FA 3UNWA 2G2UA 2J3TC 2WGWB 2DCFA 1JTDA 5FAPA 1OTBA 3EGXC 3LO7A 5FEFA 2HDSA 4NEED 3LY4A 2K2NA 1GSVA 5DTTA 2M7VA 4JXWA 2X01A 4E3IA 3MSHA 1F2KA 5DJUA 2BTFP 3SS3A 1ZG6A 3TW8A 1RGYA 1YMXA 1A0KA 3R4KA 5FQQA 4A5RA 2E8JA 1NYMA 5EECA 3QHYA 3IF5A 2W27A 2QYBA 2OOLA 2OV5A 5TFQA 1NZOA 4NETA 1ES2A 4EU0A 3IS2B 1BLCA 1J3WA 4K91A 1CEFA 1ERQA 3E98A 3VSKA 4Y0OA 4BL3A 2L1MA 3SS5A 2EFXA 4YFMA 1IEMA 4JPMA 4S2PA 4D60A 4GLQA 1X0OA 5DTKA 5AQBA 2JBFA 4EQIA 3EWKA 2HJ9C 5HDCA 2CMNA 3G6OA 5F83A 4B4ZA 3UB5P 3ZFZA 3O5YA 1SKOA 3LIBA 4JXVA 2XLNA 2L0WA 4ARZB 1JVJA 5G4ZA 3V67A 3H7WA 3D72A 4BD1A 3G34A 5KSCA 1FR6A 4PKYA 4CLCB 2H10A 1F5MA 3PBNA 5DF9A 3C30A 5EVEA 1FIKA 4HP9A 2QZ6A 5E43A 3T4JA 5KSHA 4S2KA 3N8SA 1IYQA 3DWKA 3B47A 2D02A 4BLMA 5KZHA 4OP8A 1L0GA 4R3BA 2MJ6A 4I3AA 4E3JA 4FH4A 5FDHA 2V1BA 4B93A 2B5RA 5M1AA 1GSWA 2Z2LB 1P9WA 1HVBA 4OOYA 2H5SA 2Z2MB 3ITAA 3UPPA 5JYOA 1PNEA 3W2ZA 4I3IA 3P09A 2EWWA 2Y2IA 2Q0OA 3IHBA 1ZTUA 4ZRRA 2DNSA 2PT7A 2XD1A 4KZ8A 5EOEA 4QB8A 3T4QA 1I2WA 3LI8A 4DXCA 5HZHA 2VLGA 3N4IA 1K54C 4R70A 3V3RA 1PZPA 4LRYC 3NOTC 1K57A 4XT2A 1L0EA 5HAPA 3VFFA 2HJEA 1ZG4A 5FATA 2P9VA 4JBFA 4UA7A 5J8XA 4O8GA 3FC7A 4WL9A 3G31A 3RH8B 4IVKA 2O9BA 5CTNA 3NECA 3RXXA 2I9VA 4K0XA 3TE8A 4L9GA 1IOUA 2XH9A 1KDSA 4P6ZM 1I2SA 2PHYA 3CHWP 4JF4A 1TD5A 3H7WB 3MFDA 3RFBA 1BUEA 2HZ5A 3IXDA 1EW0A 5F5YA 4G3VA 3A3JA 3SOIA 2Z6CA 3CUEC 5GHXA 3HJKA 4R1GA 3E2KA 3WRTA 3S7QA 3OCLA 4L9EA 1N4OA 4Y0UA 5G18A 5CEDA 1QMFA 3JYIA 3ZQ5A 5TGFA 3K3CA 2XK1A 4R23A 1S4SA 2Y55A 2J7VA 5EM1A 5I5LA 4O01A 5J7EA 4IVIA 4DE1A 3LGOA 5CTMA 3LR4A 4HNBA 3FKVA 2JKTI 2JN7A 1XKZA 4QD4A 3C38A 4UQIM 2GDNA 2GNXA 3DTEA 4EW7A 4DF6A 3ISGA 1N9OA 1CEGA 5CHJA 3CUEA 1J9MA 2LB9A 3MZDA 1ES3A 5E2GA 2QKPA 2OLVA 1W63M 2P9VB 1VB6A 5EE8A 3PAGA 2WZZA 1GHIA 1XJ4A 4X55A 1ONHA 3BQ8A 4IUKA 5KIZA 3OPLA 1OJGA 2V2FF 1MWTA 1XGJA 5L8MA 4EWFA 4OPRA 1ESIA 3ZG0A 3Q7VA 2OSUA 3N7WA 1PFLA 3HLDA 4EV4A 2P74A 1PYYA 4WMCA 2XA7M 3W4OA 3N6IA 3UN7A 4E3MA 3S1YA 2KDKA 2V8FA 4NG2A 1KOUA 3O87A 4P6ZS 3ZYTA 2XR0A 1XJ6A 2Y2MA 2WAEA 1HTZA 4EXOA 3WS5A 4WBGA 2EWVA 2VGLS 4OLDA 1CI8A 2WKEA 3VMAA 5DF8A 1MWSA 3C2WA 3KYEA 4OH0A 4GJ4A 3LR5A 3LIAA 1SDNA 1IYPA 2VGKA 3EGDC 4BWIA 3O88A 4LLOB 1KGEA 5FEGA 4DJ3A 3OOVA 2PYRA 4PPRA 2ZOHA 1K4FA 4KUKA 3CZDA 2HV1A 2QMIA 4G3KA 5DVAA 4GW9A 3VE3A 3HCYA 4KZ9A 1HLUP 2EX2A 4DDSA 2XQZA 4WM9A 4B9OA 5J3WA 5FQMA 3R7WB 5K5BA 2P7JA 4UQIS 4Y3IA 3T1RA 3DBAA 4BBTA 2GX5A 4OVDA 3F1NA 3BY9A 4E3OA 2KOIA 3SH8A 4GKUA 3KSIA 4HBTA 2BASA 3C4PA 3S4XA 4HJ4A 1N9LA 2XGNA 1TEMA 3GTCA 3Q7VB 5F69A 3JVVA 3HREA 5HPIA 3MZEA 4OP5A 4KG6A 5FQ9A 1TS7A 3LIEA 3HLGA 4UHUA 1M6KA 1TF1A 3DTMA 4PM6A 5CHMA 3BJNA 1TVFA 1LSWA 1NRFA 5GL9A 2GJ3A 3IBRA 4PM5A 4MCWA 3G35A 4R38A 1FCOA 1FILA 2ZC5B 3M6HA 3UB7A 4Y17A 3KYZA 4Y7PA 3BEBA 5EFWA 2RL3A 1LHYA 4R3JA 4U0TA 4GS9B 3VP4A 4YWZA 2WADA 4KZ6A 2EX6A 3WS0A 3HLCA 3T50A 3G32A 2VEAA 2ZM8A 3QNBA 3WS4A 1RCJA 1GHPA 4JGRA 4CPKA 1KVMA 1KE0A 5F6AA 4O0PA 1E3UD 1V9ZA 3A0RA 4I38A 3EEAA 4EEUA 3IWIA 2R9XA 4P0MA 3OZHA 3QP5A 3CLOA 3ZVWA 4LRXC 2HDUA 3HLEA 2IA2A 4F3LA 2ZOIA 2C6WB 3HJIA 3BLSA 1RP5A 4RX3A 1I5QA 5CX7A 3DTKA 5AVFA 2FH5A 5EUAA 1O7EA 3V5MA 4DN0A 3IWQA 4JKTA 3WS1A 5EVID 1D1JA 1NYYA 2JKRI 2ZM2A 3EQUA 1BTLA 1LL8A 5A90A 3Q1FA 2PU2A 5FI7A 2ZC4B 1CF0A 4OQIA 3OPPA 4EUZA 1YMSA 1STZA 3VFHA 1YLTA 4QJGA 4GN2A 5EVLA 4BBVA 1T19A 5CHUA 3S7OA 1ES5A 3BFDA 4KZ3A 3SH9A 3VOZA 2M1CA 1PI5A 3LICA 5IU1A 2WKQA 1V9YA 3FKWA 3IF6A 5CGXA 1WA9A 2PR5A 1N9BA 3F1PA 3L7HA 3E4OA 3TSGA 1DRMA 3A0SA 3QP1A 1P97A 2XF3A 4Q0JA 1KGGA 1SDEA 5CEBA 4E6WA 4OQHA 3ZNTA 1K55C 4N92A 1DP8A 4PKYG 2D01A 2V0UA 1MBLA 3OBFA 2OAP1 3HVFA 2J3WA 3UE1A 5E2EA 1IKIA 3NY4A 1BSGA 1YLWA 1YAXA 4LENA 4B4XA 3E0YA 1KE3A 4AFIA 1OTDA 2V9AA 3GRJA 5JYPA 2JCHA 3IXHA 2JKTM 3Q82A 5HWTA 1LL9A 4XUXA 2QHKA 2Y2PA 4E6XA 4F3LB 4IEDA 1NRJA 5DFYA 2Y2OA 1E3UA 4GHIA 3MFXA 3IX8A 1F9IA 3BFFA 4HJ3A 3TG9A 1W7FA 3C5AA 1K55A 4PM9A 4BMWA 5A93A 1W5DA 2WKHA 2V1AA 4C75A 3GECA 4P6BA 5HDDA 4Q0HA 3QP4A 3FV7A 5F1GA 5A92A 3UDIA 1ERMA 4R6LA 5DTSA 1G68A 1Z09A 1UWNX 2Y2JA 4QWOA 1JWPA 3NOPC 3VV4A 1K57C 3MXRA 1MXOA 5HD5A 4EERA 2V20A 2ZC3B 3RTYA 1H3QA 5FL3A 3ZG7B 1XP4A 3FPWA 3K2NA 1D06A 1OT6A 5DF7A 4WLAA 4DE2A 4UA6A 4MN5A 3F1PB 4X68A 3DWZA 2Z6DA 1GA0A 3RJUA 4JGOA 2JC7A 4IBXA 3VP2A 3PBQA 4X6TA 3MKEA 3IHAA 4EEPA 3B42A 3ZG8B 3QNCA 2LB5A 3LEQA 4OPYA 4DE0A 1PI4A 3EOIA 2IWDA 1XFNA 2PBDP 2XFSA 5DJTA 4ZDXA 2W3FA 4K08A 2WZXA 2EFUA 4MNRA 2UWXA 4LFUA 1T1BA 5IHVA 3P01A 3IBJA 4G3WA 1CK3A 1YSQA 4HBUA 5HD3A 4GHIB 3CJMA 4FH2A 2Q9MA 3MXSA 1XA7A 1SKOB 5FASA 3HUMA 1OTAA 2W1RA 2R78A 4FUWA 4HY8A 1E25A 2VGLM 5IT5A 1YKDA 4BD0A 2YKFA 2Y2QA 1TDGA 2PDRA 1NJ4A 4L0LA 3LR3A 1OTIA 2ZMVA 1XPBA 4NXBA 1D7EA 1Y54A 4PHTA 1SHVA 2VJWA 1Y4OA 3T12B 1Z6FA 4X25A 2O9AA 3UMDA 2A24A 4EQ1A 3T4LA 2J80A 4R4RA 2XD5A 2V1ZA 1QMEA 3I7JA 1K56D 1OTEA 1XJ2A 4RYEA 3NCKA 2JKFA 4BJPA 1KE4A 2GZAA 2O9CA 4K0WA 1W8YA 1SCWA 1IELA 2EA9A 3FWLA 2O0YA 4QY6A 4HH3A 4ZTKA 3T4TA 2W3EA 3U2AA 2G7UA 2VZWA 1WYCA 2R9WA 1NY0A 2QPNA 4EETB 4KG2A 1DY6A 4NXEA 5CRFA 1FCNA 2BG1A 4ME4A 4XT2B 5F1FA 2VA0A 3G30A 3NC8A 4WZ5A 3BFGA 1LL5A 1NZUA 2ZL1A 2W3GA 1BLPA 3G2YA 1ODVA 4JXGA 4OLGA 1DJCA 1L3LA 2B18A 4I39A 1N9NA 5E2FA 4KZ7A 3BFCA 1YT4A 2H0YA 3DW0A 3BRMA 4WZ4A 5FI2A 3M2KA 4XUZA 2Q9NA 3U4LP 3QP8A 3A3DA 4KZ4A 4YNRA 3P7NA 1K0KA 2CC1A 3NDEA 2P08A 3KSGA 1AWIA 5LBRA 4DKIA 3V50A 3TRCA 3NIAA 3LR0A 1K25A 1TS6A 1IFQA 1L2SA 1NLYA 3LYXA 3UPOA 2JKRM 2Y2GA 1BT5A 2W3DA 1BLHA 5HX9A 2A24B 1OJ5A 1EWZA 4EESA 1XGIA 2VKSA 3TJZC 1DJAA 1Y28A 5GLBA 1OT9A 4DDYA 3NBLA 2HDRA 2A49A 3PBOA 4Q0IA 4JLFA 4RQ9A 4WUJA 5HL1A 5AQAA 3A0VA 2J8YA 3T4OA 3WWXA 2ZQ8A 1BZAA 4IHQA 1T1AA 2ZQCA 1MKIA 3F1OA 1NWZA 4GZBA 4KQRA 4KUOA 1CJFA 3FYZA 4ESPA 2X02A 4LRZE 3HLBA 4WEKA 3N8RA 1BLSA 2J9PA 3FPVA 2FFFB 2HPBA 2W0NA 2ZL1B 2WAFA 1ZKJA 4IUHA 1FCMA 4CLCD 1S67L 2EXAA 3GQZA 3MQQA 1YLYA 4CJNA 3IX4A 3NOUC 2ACGA 1Q2PA 2ZQ9A 4DJ2A 3UB6A 3BM6A 2WK0A 2XSSA 3FZCA 1GA9A 2XEPA 1K6SA 1S66L 3W4PA 3Q07A 4DE3A 1YLPA 5EV0A 1MWUA 2V8CA 3FG8A 4HH2A 5HARA 3KSFA 5FSRA 3T4SA 3ICYA 1GSXA 5IS1A 3UPNA 1VM1A 4M4XA 1PW8A 3M6BA 3UE3A 1UWPX 5F82A 1ACFA 3MXQA 4EBLA 2L4RA 5AVEA 2J3TD 4YINA 5TR7A 1PRQA 4FOFA 2XDMA 3EEHA 2B02A 2EXBA 2RCXA 1TS8A 2DMWA 3T4KA 3F1OB 2XFTA 5L09A 3S22A 3NHQA 2OLUA 2I72A 3GSGA 2VK3A 2Y59A 3C7VA 3WRZA 2FZ0A 4ZJ3A 4CLCC 5KMWA 5HAQA 2PR6A 1MZUA 5FA7A 1NLZA 3S7NA 1O07A 3OLOA 3IS2A 4E04A 3F1NB 1K38A 1MY8A 2Y2LA 5FAOA 3IF6C 3M2JA 3PTEA 5AQ9A 4HHDA 1IKGA 4JXSA 4L9FA 3NI9A 4IBRA 3HL9A 1M40A 2ZQ7A 4GB7A 1PIOA 4RX2A 5L07A 2XROA 3PHYA 1K4EA 4MN6A 1MPLA 5GLCA 3VP1A 2KLIA 3A3EA 3A3FA 3SZTA 5L2FA 4RA7A 5C5KA 2DRWA 4ARZA 2HP6A 3HUNA 4KQDA 2PYPA 3ZGAB 3SH7A 2WKPA 4CLCA 3HBRA 4D2OA 4Z1WA 3O3VA 3E4PA 4GNUA 3UDFA 4LGWA 2XRNA 3E2LA 3PYPA 5U47A 1ZC2A 1VQQA 2HF6A 5EPHA 3BECA 2INWA 4OOLA 4S2JA 4FSFA 4BENA 4UA9A 1JWVA 4NKPA 5DFXA 3DAVA 2P04A 1P9RA 3G4PA 1LT0A 2PU4A 2Y2KA 4N9LA 1JNUA 3BY8A 3WS2A
chains in the Genus database with same CATH topology
4HBUA 3N8LA 4KQQA 3ZCZA 3CJMA 2JE5A 4OPQA 2P74A 4FH2A 1PYYA 4WMCA 3BYDA 3G2ZA 3N6IA 1H8YA 4KZBA 3W4OA 3B3XA 2IWCA 3UN7A 2WGVA 2Q9MA 3MXSA 4E3MA 1XA7A 3S1YA 2WKIA 5EVIC 3ZVTA 5FASA 3HUMA 4LCLA 4LV3A 3UY6A 3O87A 5I94A 4OOMA 3SS4A 2XR0A 4HESA 1E25A 3AGFA 2Y2MA 3Q7ZA 4RVAA 2WAEA 1HTZA 4S2MA 3WS5A 1DJBA 1TDLA 4WBGA 1ES4A 1L0DA 2A3UA 4JF6A 4OLDA 1CI8A 2WKEA 4OQ0A 4LV0A 4BD0A 3VMAA 5DF8A 4E3LA 1MWSA 4EBPA 2Y2QA 1TDGA 4N1XA 4OH0A 1NJ4A 5FI6A 4L0LA 4FD8A 4BQMA 4ZBEA 4O7DA 1XPBA 1FR1A 1SDNA 1IYPA 4KZ5A 1Y54A 2VGKA 3PAEA 3O88A 1MWRA 1SHVA 4C3QA 1KGEA 3W4QA 1W8QA 1Z6FA 4HEFA 1LI0A 5FQJA 4QHCA 3V3SA 3VP3A 1FQGA 4PPRA 3OPHA 5CECA 3GV9A 4H8RA 1K4FA 4R4RA 4X56A 3CZDA 2QMIA 5FQIA 5DVAA 2XD5A 4R4SA 2V1ZA 1QMEA 3W8KA 1HD8A 3ZNYA 1NXYA 1K56D 3I7JA 4RYEA 3NCKA 3PBRA 1KGFA 4KZ9A 4WYYA 4BJPA 1H5XA 1KE4A 2EX2A 4B88A 4DDSA 2XQZA 4N9KA 1JTGA 4WM9A 5EVIA 3ZG5A 4K0WA 4EBNA 1W8YA 1SCWA 5FQMA 2ZM0A 4Q8IA 4PM7A 1IELA 1K6RA 4KG5A 3FWLA 3IH8A 4QY6A 2G2WA 5CGSA 4ZTKA 4WEJA 4Z9QA 3IF6B 4ZJ2A 4QY5A 4WELA 1WYCA 2H0TA 2WUQA 4OVDA 2R9WA 4KZAA 1NY0A 3GMWA 3UE0A 3AGDA 2QPNA 4E3OA 1HZOA 4ZAMA 3SH8A 4GKUA 3GVBA 4KG2A 3BLMA 1DY6A 3LY3A 2Y2NA 3C7UA 1RGZA 5CRFA 1FCNA 3CG5A 4HBTA 4GDBA 1G6AA 4S2OA 3C4PA 2BG1A 3IWOA 3S4XA 5F1FA 5AQ7A 1YM1A 2XGNA 3G30A 1WYBA 3NC8A 3UDXA 1TEMA 4WZ5A 3BFGA 1LL5A 1NZUA 3GTCA 1L0FA 3UNWA 2G2UA 2WGWB 3Q7VB 2DCFA 1JTDA 5FAPA 3GR2A 2FFYA 3LO7A 4P85A 3HREA 1BLPA 2HDSA 3MZEA 3LY4A 4OP5A 4KG6A 3G2YA 5DTTA 1W79A 5FQ9A 4JXGA 4OLGA 1DJCA 1Q2QA 1FSWA 4JXWA 3HLGA 4UHUA 1M6KA 2X01A 5HFOA 3UO9A 3DTMA 5E2FA 4KZ7A 2Y4AA 4PM6A 4E3IA 1FOFA 5CHMA 3BFCA 3SS3A 1YT4A 1ZG6A 2H0YA 3DW0A 3HLWA 2ZMAA 1TVFA 3BRMA 1NRFA 5GL9A 1RGYA 4WZ4A 5FI2A 3M2KA 4PM5A 4XUZA 3ZHHA 3TOIA 3G35A 2Q9NA 1WE4A 1YMXA 1FCOA 2C5WB 2ZC5B 3M6HA 3A3DA 4KZ4A 1YLZA 5FQQA 3MKFA 4A5RA 4Y7PA 3BEBA 4E3NA 2CC1A 3NDEA 2PBYA 1NYMA 5EECA 2RL3A 3QHYA 1LHYA 3IF5A 4N1HA 4R3JA 4U0TA 3BFEA 1JWZA 3VP4A 1PWDA 4OPZA 5CERA 4DKIA 3V50A 2WADA 4KZ6A 3EQVA 2OV5A 2EX6A 3NIAA 5TFQA 1NZOA 4NETA 1K25A 4WMCD 1CI9A 3WS0A 5CXWA 3IXBA 1ES2A 1BULA 3HLCA 3G32A 1L2SA 2ZM8A 4F94A 3QNBA 3UPOA 1BLCA 3WS4A 1RCJA 1GHPA 3IQAA 2Y2GA 1BT5A 4K91A 4MBKA 4CPKA 1KVMA 1KE0A 1BLHA 1CEFA 1ERQA 5HX9A 3VSKA 2X71A 5EOOA 4Y0OA 4BL3A 1KVLA 1EWZA 1E3UD 1XGIA 3SS5A 3IWIA 1DJAA 2EFXA 2R9XA 1IEMA 4JPMA 4YFMA 2ZC7A 5GLBA 4P0MA 4S2PA 3OZHA 3OC2A 4DDYA 5FAQA 3NBLA 4PM8A 2HDRA 5DTKA 4S2LA 2JBFA 5AQBA 2A49A 5EVIB 4EQIA 3PBOA 3ZVWA 3HUOA 4JLFA 5HL1A 3C4OA 3IH9A 5AQAA 1U60A 2J8YA 5F83A 2WYXA 4WZ5C 2HP5A 3WWXA 4B4ZA 2HDUA 3HLEA 2ZQ8A 3ZFZA 1PWGA 4JXVA 2XLNA 1BZAA 1K54A 4GD8A 4DXBA 1GHMA 1JVJA 4NK3A 2ZQCA 1MKIA 2C6WB 4GDNA 4BD1A 3G34A 5KSCA 3BLSA 1RP5A 1FR6A 4GZBA 4RX3A 1I5QA 4OKPA 4KQRA 2H10A 3PBNA 5DF9A 4P87A 3FYZA 5EUAA 1O7EA 3V5MA 2X02A 1H8ZA 3IWQA 3HLBA 4JKTA 4WEKA 3WS1A 2QZ6A 5EVID 5E43A 3N8RA 1BLSA 2J9PA 1NYYA 2ZM2A 4M3KA 3EQUA 5KSHA 1BTLA 4S2KA 5A90A 3N8SA 1IYQA 3DWKA 4E3KA 3Q1FA 2PU2A 5FI7A 3IXGA 2FFFB 2ZC4B 4OP8A 4BLMA 2HPBA 5KZHA 1L0GA 4OQIA 1GCEA 2WAFA 4R3BA 3OPPA 4EUZA 1ZKJA 1YMSA 2VGJA 1FCMA 4E3JA 3VSLA 2EXAA 4FH4A 5FDHA 3GQZA 1YLTA 3VFHA 4QJGA 2B5RA 4GN2A 1YLYA 5M1AA 4CJNA 2ZD8A 5EVLA 4MLLA 2Z2LB 2Y91A 1HVBA 5CHUA 4OOYA 2H5SA 2Z2MB 3ITAA 1ES5A 3BFDA 3UPPA 4R0QA 4KZ3A 5JYOA 4MEZA 4LV2A 3SH9A 3VOZA 1PI5A 1Q2PA 4U3TA 2ZQ9A 4KQOA 3P98A 3P09A 2Y2IA 3BM6A 3FKWA 3IF6A 2WK0A 3AGEA 5CGXA 2IWBA 1EROA 4UAAA 1N9BA 3IHBA 5HAIA 2DNSA 2XD1A 3FZCA 1PZOA 4LCMA 3IT9A 3TSGA 4KZ8A 5GHZA 1GA9A 2XF3A 3V39A 2XEPA 3O86A 1K6SA 2ZJ9A 1XX2A 5EOEA 1C3BA 1KGGA 1SDEA 4QB8A 4E6WA 4OQHA 1I2WA 3ZNTA 1K55C 5CEBA 4N92A 4DXCA 3W4PA 3N4IA 1MBLA 3Q07A 1K54C 3VOYA 1YLPA 4DE3A 3V3RA 1PZPA 1MWUA 1YLJA 5GLAA 1K57A 1L0EA 3HVFA 1OMEA 5HAPA 3UE1A 3VFFA 5E2EA 1ZG4A 1IKIA 5FATA 3NY4A 1EI5A 3PBSA 2P9VA 4JBFA 1BSGA 1YLWA 4UA7A 5HARA 5D3OA 5J8XA 5A91A 3NDGA 1ESUA 4LENA 3D4FA 3G31A 5E2HA 1KE3A 5FSRA 4B4XA 4MBHA 4IVKA 3OCNA 5CTNA 1PWCA 5GLDA 3GRJA 3RXXA 3UPNA 1VM1A 5JYPA 4K0XA 5CGWA 1PW8A 3M6BA 3UE3A 2JCHA 3IXHA 3Q81A 5F82A 3Q82A 2XH9A 1KDSA 4FCFA 4EBLA 1I2SA 1LL9A 4XUXA 4YINA 5TR7A 2Y2PA 4E6XA 4JF4A 4IEDA 2XDMA 1XA1A 4S2IA 2EXBA 4BL2A 2RCXA 3ZDJA 2BLSA 4S2NC 2XFTA 3MFDA 3S22A 2Y2OA 1E3UA 1BUEA 2OLUA 2I72A 3GSGA 3ZG9B 3IXDA 2Y59A 1ONGA 3C7VA 4MBFA 3BFFA 3WRZA 3CMZA 3TG9A 1W7FA 3A3JA 3C5AA 3SOIA 4ZJ3A 1K55A 4PM9A 5A93A 5GHXA 2J9OA 5KMWA 1W5DA 2EX9A 2HP9A 5HAQA 3HLFA 4R1GA 5FA7A 2WKHA 3PBTA 4C6YA 3E2KA 1O07A 5FQKA 3WRTA 4C75A 3OCLA 4P6BA 1N4OA 1K38A 1MY8A 2Y2LA 1S0WA 4Y0UA 5FAOA 4X53A 3IF6C 5G18A 3M2JA 3PTEA 5CEDA 5AQ9A 1QMFA 3FV7A 5F1GA 5A92A 3JYIA 2E8IA 5TGFA 1IKGA 1KDWA 4JF5A 4JXSA 4OONA 1IYSA 1K56A 3NI9A 4LV1A 4IBRA 3HL9A 4ZJ1A 1M40A 3UDIA 2XK1A 4OQGA 4R23A 2Y55A 2J7VA 2ZQ7A 4GB7A 2WGIA 1PIOA 1SKFA 1ERMA 3LEZA 4RX2A 5BOHA 4IVIA 4DE1A 5GHYA 4U0XA 5CTMA 5DTSA 1G68A 1K4EA 4KENB 3FKVA 1S6RA 2Y2JA 1YQSA 5M18A 1JWPA 4ID4A 1XKZA 1MPLA 4QD4A 4GOGA 5GLCA 3VP1A 3A3EA 2Y2HA 1K57C 3MXRA 2GDNA 3A3FA 1MXOA 1LLBA 5L2FA 1FSYA 2V20A 1AXBA 2ZC3B 4RA7A 3ZG7B 4S2NA 1XP4A 4DRTA 2DRWA 3RXWA 5DF7A 4DF6A 2HP6A 1LI9A 3HUNA 4DE2A 4UA6A 4XXRA 4Y0TA 3LCEA 3ISGA 3A3IA 3ZGAB 2ZQDA 1CEGA 5CHJA 3SH7A 4X68A 3HBRA 1J9MA 3DWZA 1GA0A 2EX8A 3RJUA 4D2OA 2ZC6B 3O3VA 1XXMA 2JC7A 4IBXA 3MZDA 3VP2A 3PBQA 4GNUA 4PMAA 1ES3A 3UDFA 3OPRA 3ITBA 4X6TA 5HW3A 3E2LA 3MKEA 3IHAA 1E4DA 1ALQA 5E2GA 5U47A 3ZG8B 2ZLYA 2OLVA 2P9VB 3QNCA 1ZC2A 1VQQA 5EPHA 4OPYA 3BECA 4DE0A 4GD6A 4OOLA 5EE8A 3PAGA 2WZZA 4S2JA 1GHIA 4FSFA 4X55A 1PI4A 4BENA 1ONHA 3MBZA 5M19A 1PW1A 2IWDA 4UA9A 1JWVA 3OPLA 2XFSA 4QU3A 2V2FF 4ZDXA 1MWTA 1XGJA 1IYOA 2WZXA 3MZFA 2EFUA 4MNRA 3G4PA 4EWFA 2UWXA 4OPRA 2ZQAA 1ESIA 3ZG0A 2WGWA 3Q7VA 4X69A 2OSUA 3N7WA 5IHVA 2PU4A 3HLDA 2HDQA 2Y2KA 3VP0A 4N9LA 1CK3A 3WS2A 4EV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBU A;  3N8L A;  4KQQ A;  3ZCZ A;  3CJM A;  2JE5 A;  4OPQ A;  2P74 A;  4FH2 A;  1PYY A;  4WMC A;  3BYD A;  3G2Z A;  3N6I A;  1H8Y A;  4KZB A;  3W4O A;  3B3X A;  2IWC A;  3UN7 A;  2WGV A;  2Q9M A;  3MXS A;  4E3M A;  1XA7 A;  3S1Y A;  2WKI A;  5EVI C;  3ZVT A;  5FAS A;  3HUM A;  4LCL A;  4LV3 A;  3UY6 A;  3O87 A;  5I94 A;  4OOM A;  3SS4 A;  2XR0 A;  4HES A;  1E25 A;  3AGF A;  2Y2M A;  3Q7Z A;  4RVA A;  2WAE A;  1HTZ A;  4S2M A;  3WS5 A;  1DJB A;  1TDL A;  4WBG A;  1ES4 A;  1L0D A;  2A3U A;  4JF6 A;  4OLD A;  1CI8 A;  2WKE A;  4OQ0 A;  4LV0 A;  4BD0 A;  3VMA A;  5DF8 A;  4E3L A;  1MWS A;  4EBP A;  2Y2Q A;  1TDG A;  4N1X A;  4OH0 A;  1NJ4 A;  5FI6 A;  4L0L A;  4FD8 A;  4BQM A;  4ZBE A;  4O7D A;  1XPB A;  1FR1 A;  1SDN A;  1IYP A;  4KZ5 A;  1Y54 A;  2VGK A;  3PAE A;  3O88 A;  1MWR A;  1SHV A;  4C3Q A;  1KGE A;  3W4Q A;  1W8Q A;  1Z6F A;  4HEF A;  1LI0 A;  5FQJ A;  4QHC A;  3V3S A;  3VP3 A;  1FQG A;  4PPR A;  3OPH A;  5CEC A;  3GV9 A;  4H8R A;  1K4F A;  4R4R A;  4X56 A;  3CZD A;  2QMI A;  5FQI A;  5DVA A;  2XD5 A;  4R4S A;  2V1Z A;  1QME A;  3W8K A;  1HD8 A;  3ZNY A;  1NXY A;  1K56 D;  3I7J A;  4RYE A;  3NCK A;  3PBR A;  1KGF A;  4KZ9 A;  4WYY A;  4BJP A;  1H5X A;  1KE4 A;  2EX2 A;  4B88 A;  4DDS A;  2XQZ A;  4N9K A;  1JTG A;  4WM9 A;  5EVI A;  3ZG5 A;  4K0W A;  4EBN A;  1W8Y A;  1SCW A;  5FQM A;  2ZM0 A;  4Q8I A;  4PM7 A;  1IEL A;  1K6R A;  4KG5 A;  3FWL A;  3IH8 A;  4QY6 A;  2G2W A;  5CGS A;  4ZTK A;  4WEJ A;  4Z9Q A;  3IF6 B;  4ZJ2 A;  4QY5 A;  4WEL A;  1WYC A;  2H0T A;  2WUQ A;  4OVD A;  2R9W A;  4KZA A;  1NY0 A;  3GMW A;  3UE0 A;  3AGD A;  2QPN A;  4E3O A;  1HZO A;  4ZAM A;  3SH8 A;  4GKU A;  3GVB A;  4KG2 A;  3BLM A;  1DY6 A;  3LY3 A;  2Y2N A;  3C7U A;  1RGZ A;  5CRF A;  1FCN A;  3CG5 A;  4HBT A;  4GDB A;  1G6A A;  4S2O A;  3C4P A;  2BG1 A;  3IWO A;  3S4X A;  5F1F A;  5AQ7 A;  1YM1 A;  2XGN A;  3G30 A;  1WYB A;  3NC8 A;  3UDX A;  1TEM A;  4WZ5 A;  3BFG A;  1LL5 A;  1NZU A;  3GTC A;  1L0F A;  3UNW A;  2G2U A;  2WGW B;  3Q7V B;  2DCF A;  1JTD A;  5FAP A;  3GR2 A;  2FFY A;  3LO7 A;  4P85 A;  3HRE A;  1BLP A;  2HDS A;  3MZE A;  3LY4 A;  4OP5 A;  4KG6 A;  3G2Y A;  5DTT A;  1W79 A;  5FQ9 A;  4JXG A;  4OLG A;  1DJC A;  1Q2Q A;  1FSW A;  4JXW A;  3HLG A;  4UHU A;  1M6K A;  2X01 A;  5HFO A;  3UO9 A;  3DTM A;  5E2F A;  4KZ7 A;  2Y4A A;  4PM6 A;  4E3I A;  1FOF A;  5CHM A;  3BFC A;  3SS3 A;  1YT4 A;  1ZG6 A;  2H0Y A;  3DW0 A;  3HLW A;  2ZMA A;  1TVF A;  3BRM A;  1NRF A;  5GL9 A;  1RGY A;  4WZ4 A;  5FI2 A;  3M2K A;  4PM5 A;  4XUZ A;  3ZHH A;  3TOI A;  3G35 A;  2Q9N A;  1WE4 A;  1YMX A;  1FCO A;  2C5W B;  2ZC5 B;  3M6H A;  3A3D A;  4KZ4 A;  1YLZ A;  5FQQ A;  3MKF A;  4A5R A;  4Y7P A;  3BEB A;  4E3N A;  2CC1 A;  3NDE A;  2PBY A;  1NYM A;  5EEC A;  2RL3 A;  3QHY A;  1LHY A;  3IF5 A;  4N1H A;  4R3J A;  4U0T A;  3BFE A;  1JWZ A;  3VP4 A;  1PWD A;  4OPZ A;  5CER A;  4DKI A;  3V50 A;  2WAD A;  4KZ6 A;  3EQV A;  2OV5 A;  2EX6 A;  3NIA A;  5TFQ A;  1NZO A;  4NET A;  1K25 A;  4WMC D;  1CI9 A;  3WS0 A;  5CXW A;  3IXB A;  1ES2 A;  1BUL A;  3HLC A;  3G32 A;  1L2S A;  2ZM8 A;  4F94 A;  3QNB A;  3UPO A;  1BLC A;  3WS4 A;  1RCJ A;  1GHP A;  3IQA A;  2Y2G A;  1BT5 A;  4K91 A;  4MBK A;  4CPK A;  1KVM A;  1KE0 A;  1BLH A;  1CEF A;  1ERQ A;  5HX9 A;  3VSK A;  2X71 A;  5EOO A;  4Y0O A;  4BL3 A;  1KVL A;  1EWZ A;  1E3U D;  1XGI A;  3SS5 A;  3IWI A;  1DJA A;  2EFX A;  2R9X A;  1IEM A;  4JPM A;  4YFM A;  2ZC7 A;  5GLB A;  4P0M A;  4S2P A;  3OZH A;  3OC2 A;  4DDY A;  5FAQ A;  3NBL A;  4PM8 A;  2HDR A;  5DTK A;  4S2L A;  2JBF A;  5AQB A;  2A49 A;  5EVI B;  4EQI A;  3PBO A;  3ZVW A;  3HUO A;  4JLF A;  5HL1 A;  3C4O A;  3IH9 A;  5AQA A;  1U60 A;  2J8Y A;  5F83 A;  2WYX A;  4WZ5 C;  2HP5 A;  3WWX A;  4B4Z A;  2HDU A;  3HLE A;  2ZQ8 A;  3ZFZ A;  1PWG A;  4JXV A;  2XLN A;  1BZA A;  1K54 A;  4GD8 A;  4DXB A;  1GHM A;  1JVJ A;  4NK3 A;  2ZQC A;  1MKI A;  2C6W B;  4GDN A;  4BD1 A;  3G34 A;  5KSC A;  3BLS A;  1RP5 A;  1FR6 A;  4GZB A;  4RX3 A;  1I5Q A;  4OKP A;  4KQR A;  2H10 A;  3PBN A;  5DF9 A;  4P87 A;  3FYZ A;  5EUA A;  1O7E A;  3V5M A;  2X02 A;  1H8Z A;  3IWQ A;  3HLB A;  4JKT A;  4WEK A;  3WS1 A;  2QZ6 A;  5EVI D;  5E43 A;  3N8R A;  1BLS A;  2J9P A;  1NYY A;  2ZM2 A;  4M3K A;  3EQU A;  5KSH A;  1BTL A;  4S2K A;  5A90 A;  3N8S A;  1IYQ A;  3DWK A;  4E3K A;  3Q1F A;  2PU2 A;  5FI7 A;  3IXG A;  2FFF B;  2ZC4 B;  4OP8 A;  4BLM A;  2HPB A;  5KZH A;  1L0G A;  4OQI A;  1GCE A;  2WAF A;  4R3B A;  3OPP A;  4EUZ A;  1ZKJ A;  1YMS A;  2VGJ A;  1FCM A;  4E3J A;  3VSL A;  2EXA A;  4FH4 A;  5FDH A;  3GQZ A;  1YLT A;  3VFH A;  4QJG A;  2B5R A;  4GN2 A;  1YLY A;  5M1A A;  4CJN A;  2ZD8 A;  5EVL A;  4MLL A;  2Z2L B;  2Y91 A;  1HVB A;  5CHU A;  4OOY A;  2H5S A;  2Z2M B;  3ITA A;  1ES5 A;  3BFD A;  3UPP A;  4R0Q A;  4KZ3 A;  5JYO A;  4MEZ A;  4LV2 A;  3SH9 A;  3VOZ A;  1PI5 A;  1Q2P A;  4U3T A;  2ZQ9 A;  4KQO A;  3P98 A;  3P09 A;  2Y2I A;  3BM6 A;  3FKW A;  3IF6 A;  2WK0 A;  3AGE A;  5CGX A;  2IWB A;  1ERO A;  4UAA A;  1N9B A;  3IHB A;  5HAI A;  2DNS A;  2XD1 A;  3FZC A;  1PZO A;  4LCM A;  3IT9 A;  3TSG A;  4KZ8 A;  5GHZ A;  1GA9 A;  2XF3 A;  3V39 A;  2XEP A;  3O86 A;  1K6S A;  2ZJ9 A;  1XX2 A;  5EOE A;  1C3B A;  1KGG A;  1SDE A;  4QB8 A;  4E6W A;  4OQH A;  1I2W A;  3ZNT A;  1K55 C;  5CEB A;  4N92 A;  4DXC A;  3W4P A;  3N4I A;  1MBL A;  3Q07 A;  1K54 C;  3VOY A;  1YLP A;  4DE3 A;  3V3R A;  1PZP A;  1MWU A;  1YLJ A;  5GLA A;  1K57 A;  1L0E A;  3HVF A;  1OME A;  5HAP A;  3UE1 A;  3VFF A;  5E2E A;  1ZG4 A;  1IKI A;  5FAT A;  3NY4 A;  1EI5 A;  3PBS A;  2P9V A;  4JBF A;  1BSG A;  1YLW A;  4UA7 A;  5HAR A;  5D3O A;  5J8X A;  5A91 A;  3NDG A;  1ESU A;  4LEN A;  3D4F A;  3G31 A;  5E2H A;  1KE3 A;  5FSR A;  4B4X A;  4MBH A;  4IVK A;  3OCN A;  5CTN A;  1PWC A;  5GLD A;  3GRJ A;  3RXX A;  3UPN A;  1VM1 A;  5JYP A;  4K0X A;  5CGW A;  1PW8 A;  3M6B A;  3UE3 A;  2JCH A;  3IXH A;  3Q81 A;  5F82 A;  3Q82 A;  2XH9 A;  1KDS A;  4FCF A;  4EBL A;  1I2S A;  1LL9 A;  4XUX A;  4YIN A;  5TR7 A;  2Y2P A;  4E6X A;  4JF4 A;  4IED A;  2XDM A;  1XA1 A;  4S2I A;  2EXB A;  4BL2 A;  2RCX A;  3ZDJ A;  2BLS A;  4S2N C;  2XFT A;  3MFD A;  3S22 A;  2Y2O A;  1E3U A;  1BUE A;  2OLU A;  2I72 A;  3GSG A;  3ZG9 B;  3IXD A;  2Y59 A;  1ONG A;  3C7V A;  4MBF A;  3BFF A;  3WRZ A;  3CMZ A;  3TG9 A;  1W7F A;  3A3J A;  3C5A A;  3SOI A;  4ZJ3 A;  1K55 A;  4PM9 A;  5A93 A;  5GHX A;  2J9O A;  5KMW A;  1W5D A;  2EX9 A;  2HP9 A;  5HAQ A;  3HLF A;  4R1G A;  5FA7 A;  2WKH A;  3PBT A;  4C6Y A;  3E2K A;  1O07 A;  5FQK A;  3WRT A;  4C75 A;  3OCL A;  4P6B A;  1N4O A;  1K38 A;  1MY8 A;  2Y2L A;  1S0W A;  4Y0U A;  5FAO A;  4X53 A;  3IF6 C;  5G18 A;  3M2J A;  3PTE A;  5CED A;  5AQ9 A;  1QMF A;  3FV7 A;  5F1G A;  5A92 A;  3JYI A;  2E8I A;  5TGF A;  1IKG A;  1KDW A;  4JF5 A;  4JXS A;  4OON A;  1IYS A;  1K56 A;  3NI9 A;  4LV1 A;  4IBR A;  3HL9 A;  4ZJ1 A;  1M40 A;  3UDI A;  2XK1 A;  4OQG A;  4R23 A;  2Y55 A;  2J7V A;  2ZQ7 A;  4GB7 A;  2WGI A;  1PIO A;  1SKF A;  1ERM A;  3LEZ A;  4RX2 A;  5BOH A;  4IVI A;  4DE1 A;  5GHY A;  4U0X A;  5CTM A;  5DTS A;  1G68 A;  1K4E A;  4KEN B;  3FKV A;  1S6R A;  2Y2J A;  1YQS A;  5M18 A;  1JWP A;  4ID4 A;  1XKZ A;  1MPL A;  4QD4 A;  4GOG A;  5GLC A;  3VP1 A;  3A3E A;  2Y2H A;  1K57 C;  3MXR A;  2GDN A;  3A3F A;  1MXO A;  1LLB A;  5L2F A;  1FSY A;  2V20 A;  1AXB A;  2ZC3 B;  4RA7 A;  3ZG7 B;  4S2N A;  1XP4 A;  4DRT A;  2DRW A;  3RXW A;  5DF7 A;  4DF6 A;  2HP6 A;  1LI9 A;  3HUN A;  4DE2 A;  4UA6 A;  4XXR A;  4Y0T A;  3LCE A;  3ISG A;  3A3I A;  3ZGA B;  2ZQD A;  1CEG A;  5CHJ A;  3SH7 A;  4X68 A;  3HBR A;  1J9M A;  3DWZ A;  1GA0 A;  2EX8 A;  3RJU A;  4D2O A;  2ZC6 B;  3O3V A;  1XXM A;  2JC7 A;  4IBX A;  3MZD A;  3VP2 A;  3PBQ A;  4GNU A;  4PMA A;  1ES3 A;  3UDF A;  3OPR A;  3ITB A;  4X6T A;  5HW3 A;  3E2L A;  3MKE A;  3IHA A;  1E4D A;  1ALQ A;  5E2G A;  5U47 A;  3ZG8 B;  2ZLY A;  2OLV A;  2P9V B;  3QNC A;  1ZC2 A;  1VQQ A;  5EPH A;  4OPY A;  3BEC A;  4DE0 A;  4GD6 A;  4OOL A;  5EE8 A;  3PAG A;  2WZZ A;  4S2J A;  1GHI A;  4FSF A;  4X55 A;  1PI4 A;  4BEN A;  1ONH A;  3MBZ A;  5M19 A;  1PW1 A;  2IWD A;  4UA9 A;  1JWV A;  3OPL A;  2XFS A;  4QU3 A;  2V2F F;  4ZDX A;  1MWT A;  1XGJ A;  1IYO A;  2WZX A;  3MZF A;  2EFU A;  4MNR A;  3G4P A;  4EWF A;  2UWX A;  4OPR A;  2ZQA A;  1ESI A;  3ZG0 A;  2WGW A;  3Q7V A;  4X69 A;  2OSU A;  3N7W A;  5IHV A;  2PU4 A;  3HLD A;  2HDQ A;  2Y2K A;  3VP0 A;  4N9L A;  1CK3 A;  3WS2 A;  4EV4 A; 
#chains in the Genus database with same CATH topology
 4KQQ A;  2JE5 A;  3SW1 A;  4BBU A;  3BYD A;  3G2Z A;  3B3X A;  2IWC A;  2WGV A;  4NXG A;  2WKI A;  5EVI C;  2HGV A;  4LCL A;  4LV3 A;  4HIA A;  4OOM A;  3SS4 A;  3AGF A;  3Q7Z A;  4S2M A;  1DJB A;  1ES4 A;  2A3U A;  1ZHH B;  4EBP A;  4HJ6 A;  4N1X A;  2Y8H A;  5FI6 A;  1DP9 A;  4YOF A;  4BQM A;  5HPF A;  4ZBE A;  3D3O A;  3UME A;  4HOI A;  4C3Q A;  3JVU A;  3W4Q A;  4HEF A;  3LFV A;  1LI0 A;  1FQG A;  3DTI A;  2PAV P;  4H8R A;  4X56 A;  5FQI A;  2VV8 A;  4R4S A;  3W8K A;  1HD8 A;  2VX8 A;  1NXY A;  2KX6 A;  3MF0 A;  3PBR A;  3BQA A;  1KGF A;  1H5X A;  4N9K A;  5EVI A;  1VEU A;  1T18 A;  4Q8I A;  2ZM0 A;  4PM7 A;  4KG5 A;  3CI6 A;  2OWJ A;  2G2W A;  1MC0 A;  1G5U A;  3IF6 B;  4QY5 A;  2H0T A;  3BWL A;  4KZA A;  3GMW A;  3UE0 A;  1HZO A;  4WN5 A;  3BLM A;  3PXP A;  3LY3 A;  2Y2N A;  5AJG A;  5AQ7 A;  1YM1 A;  3UDX A;  3CWF A;  3MS6 A;  3S7P A;  1W63 Q;  3GR2 A;  2FFY A;  3KX0 X;  4P85 A;  3D9Y A;  3IX3 A;  4HQA A;  1W79 A;  1Q2Q A;  1FSW A;  3UO9 A;  5HFO A;  2Y4A A;  1FOF A;  2NUT C;  2ZMF A;  2QWS A;  3HLW A;  2ZMA A;  2ZBB A;  3ZHH A;  3TOI A;  1WE4 A;  2C5W B;  1LSV A;  1YLZ A;  3MKF A;  4E3N A;  3VE4 A;  2PBY A;  1CQA A;  4JGP A;  4N1H A;  3ULF A;  3BFE A;  1JWZ A;  1PWD A;  4OPZ A;  5CER A;  1UGU A;  3EQV A;  4WF0 A;  4WMC D;  1CI9 A;  5CXW A;  3IXB A;  1BUL A;  4F94 A;  2AVX A;  1VHM A;  1P0Z A;  3UB9 A;  3IQA A;  4MBK A;  2X71 A;  5EOO A;  1KVL A;  3T1Q B;  5HDS A;  2ZC7 A;  2M7U A;  3OC2 A;  5FAQ A;  4PM8 A;  4S2L A;  5EVI B;  1VEU B;  3HUO A;  3C4O A;  3IH9 A;  1U60 A;  4GCZ A;  1BYW A;  2WYX A;  4WZ5 C;  2HP5 A;  1PWG A;  3BW6 A;  1K54 A;  4GD8 A;  4DXB A;  1GHM A;  4NK3 A;  4GDN A;  4HP4 A;  2JKG A;  4UEY A;  4OKP A;  1G28 A;  4EUV A;  4P87 A;  1H8Z A;  3CIT A;  4X1M A;  4M3K A;  3LI9 A;  2B95 A;  5HL6 A;  5A8B A;  5F68 A;  4E3K A;  2PD8 A;  3IXG A;  3MR0 A;  1GCE A;  2VGJ A;  3VSL A;  4FTX A;  1TS0 A;  3T1X A;  3CAX A;  2ZD8 A;  5FDS A;  3MQ0 A;  4MLL A;  2Y91 A;  2Y79 A;  4R0Q A;  4MEZ A;  1YPR A;  4LV2 A;  4U3T A;  3R7W A;  4KQO A;  3P98 A;  3MJQ A;  3AGE A;  2IWB A;  1ERO A;  4UAA A;  5HAI A;  4NXF A;  5EM0 A;  1PZO A;  2O99 A;  3IT9 A;  4LCM A;  5GHZ A;  3V39 A;  3O86 A;  2ZJ9 A;  1XX2 A;  1C3B A;  3GDI A;  3MQO A;  2UV0 E;  1SZV A;  3H9W A;  3VOY A;  1YLJ A;  5GLA A;  1OME A;  1EI5 A;  3PBS A;  5D3O A;  5A91 A;  3NDG A;  1ESU A;  3D4F A;  5E2H A;  5DKK A;  2VV7 A;  3QP2 A;  4MBH A;  3OCN A;  1G6O A;  1PWC A;  5GLD A;  5CGW A;  3UE6 A;  1VET A;  3Q81 A;  4FCF A;  1OPX A;  2OWH A;  3C8C A;  5HSQ A;  1XA1 A;  4S2I A;  4BL2 A;  3ZDJ A;  2BLS A;  4S2N C;  3NUL A;  4LPZ A;  3ZG9 B;  4DMZ A;  1ONG A;  2YKH A;  4MBF A;  3CMZ A;  4GS9 A;  2VV6 A;  2J9O A;  2EX9 A;  4Y5F A;  2HP9 A;  3HLF A;  3PBT A;  4C6Y A;  5FQK A;  2W3H A;  1S0W A;  2WKR A;  4X53 A;  2H28 A;  2E8I A;  1KDW A;  4OON A;  4JF5 A;  1IYS A;  1K56 A;  1F98 A;  1S1Z A;  4LV1 A;  4ZJ1 A;  4OQG A;  2WGI A;  1SKF A;  3LEZ A;  5BOH A;  3JPU A;  5GHY A;  4U0X A;  4KEN B;  1S6R A;  1YQS A;  5M18 A;  4ID4 A;  4MN7 A;  4GOG A;  3H82 A;  2Y2H A;  5G4Y A;  1LLB A;  1FSY A;  1AXB A;  4S2N A;  4DRT A;  2PD7 A;  3RXW A;  3LIF A;  1LI9 A;  4XXR A;  4Y0T A;  3LCE A;  3A3I A;  2ZQD A;  4PAU A;  2EX8 A;  2ZC6 B;  1XXM A;  4Y15 A;  4PMA A;  4MDZ A;  4Y13 A;  3OPR A;  3ITB A;  2W1T A;  5HW3 A;  1E4D A;  1XJ3 A;  4ETX A;  1ALQ A;  3B33 A;  2ZLY A;  2OAQ 1;  4GD6 A;  4Y2F A;  5TBM A;  3UB8 A;  1LSX A;  5M19 A;  3MBZ A;  1PW1 A;  3LID A;  4QU3 A;  5J4E A;  3MMH A;  1T1C A;  1VET B;  3CPT A;  1IYO A;  3MZF A;  2K7S A;  5HWW A;  3K3D A;  2ZQA A;  4H6J A;  2WGW A;  4X69 A;  5MC7 A;  2HDQ A;  3KO6 A;  3NJA A;  3VP0 A;  3KSH A;  2PRF A;  2A2L A;  5DKL A;  3KYQ A;  3N8L A;  3ZCZ A;  4IJG A;  4R3A A;  3E4Q A;  4OPQ A;  4KZB A;  1H8Y A;  1S4R A;  2QJ5 A;  2XA7 S;  3ZVT A;  3UY6 A;  4CQH A;  4MMN A;  5I94 A;  4HES A;  4ETZ A;  4RVA A;  1TDL A;  1XFQ A;  4X1L A;  1H0M A;  1L0D A;  4JF6 A;  4QPR A;  4OQ0 A;  4LV0 A;  4E3L A;  4CLC E;  4FD8 A;  4O7D A;  2NUP C;  4I5S A;  1FR1 A;  4KZ5 A;  5TJJ A;  3PAE A;  1MWR A;  1S1Y A;  1DP6 A;  1W8Q A;  3H82 B;  5FQJ A;  4QHC A;  3V3S A;  3VP3 A;  2QJ7 A;  4JGQ A;  3OPH A;  5CEC A;  3GV9 A;  3QP6 A;  4HI4 A;  3ZNY A;  1H8M A;  4WYY A;  5L10 A;  4B88 A;  5HWV A;  4I3J A;  1JTG A;  3ZG5 A;  4EBN A;  3LUQ A;  1K6R A;  3IH8 A;  5CGS A;  2W1T B;  4WEJ A;  3PR6 A;  4Z9Q A;  4ZJ2 A;  4WEL A;  2JHE A;  2WUQ A;  3VOL A;  3T1S A;  3AGD A;  4II7 A;  4ZAM A;  5TBM B;  3GVB A;  2V0W A;  3C7U A;  1RGZ A;  2K31 A;  3CG5 A;  1MKM A;  1G6A A;  4GDB A;  4S2O A;  3IWO A;  3L9K A;  3CPT B;  1WYB A;  1YSP A;  4H6J B;  1L0F A;  3UNW A;  2G2U A;  2J3T C;  2WGW B;  2DCF A;  1JTD A;  5FAP A;  1OTB A;  3EGX C;  3LO7 A;  5FEF A;  2HDS A;  4NEE D;  3LY4 A;  2K2N A;  1GSV A;  5DTT A;  2M7V A;  4JXW A;  2X01 A;  4E3I A;  3MSH A;  1F2K A;  5DJU A;  2BTF P;  3SS3 A;  1ZG6 A;  3TW8 A;  1RGY A;  1YMX A;  1A0K A;  3R4K A;  5FQQ A;  4A5R A;  2E8J A;  1NYM A;  5EEC A;  3QHY A;  3IF5 A;  2W27 A;  2QYB A;  2OOL A;  2OV5 A;  5TFQ A;  1NZO A;  4NET A;  1ES2 A;  4EU0 A;  3IS2 B;  1BLC A;  1J3W A;  4K91 A;  1CEF A;  1ERQ A;  3E98 A;  3VSK A;  4Y0O A;  4BL3 A;  2L1M A;  3SS5 A;  2EFX A;  4YFM A;  1IEM A;  4JPM A;  4S2P A;  4D60 A;  4GLQ A;  1X0O A;  5DTK A;  5AQB A;  2JBF A;  4EQI A;  3EWK A;  2HJ9 C;  5HDC A;  2CMN A;  3G6O A;  5F83 A;  4B4Z A;  3UB5 P;  3ZFZ A;  3O5Y A;  1SKO A;  3LIB A;  4JXV A;  2XLN A;  2L0W A;  4ARZ B;  1JVJ A;  5G4Z A;  3V67 A;  3H7W A;  3D72 A;  4BD1 A;  3G34 A;  5KSC A;  1FR6 A;  4PKY A;  4CLC B;  2H10 A;  1F5M A;  3PBN A;  5DF9 A;  3C30 A;  5EVE A;  1FIK A;  4HP9 A;  2QZ6 A;  5E43 A;  3T4J A;  5KSH A;  4S2K A;  3N8S A;  1IYQ A;  3DWK A;  3B47 A;  2D02 A;  4BLM A;  5KZH A;  4OP8 A;  1L0G A;  4R3B A;  2MJ6 A;  4I3A A;  4E3J A;  4FH4 A;  5FDH A;  2V1B A;  4B93 A;  2B5R A;  5M1A A;  1GSW A;  2Z2L B;  1P9W A;  1HVB A;  4OOY A;  2H5S A;  2Z2M B;  3ITA A;  3UPP A;  5JYO A;  1PNE A;  3W2Z A;  4I3I A;  3P09 A;  2EWW A;  2Y2I A;  2Q0O A;  3IHB A;  1ZTU A;  4ZRR A;  2DNS A;  2PT7 A;  2XD1 A;  4KZ8 A;  5EOE A;  4QB8 A;  3T4Q A;  1I2W A;  3LI8 A;  4DXC A;  5HZH A;  2VLG A;  3N4I A;  1K54 C;  4R70 A;  3V3R A;  1PZP A;  4LRY C;  3NOT C;  1K57 A;  4XT2 A;  1L0E A;  5HAP A;  3VFF A;  2HJE A;  1ZG4 A;  5FAT A;  2P9V A;  4JBF A;  4UA7 A;  5J8X A;  4O8G A;  3FC7 A;  4WL9 A;  3G31 A;  3RH8 B;  4IVK A;  2O9B A;  5CTN A;  3NEC A;  3RXX A;  2I9V A;  4K0X A;  3TE8 A;  4L9G A;  1IOU A;  2XH9 A;  1KDS A;  4P6Z M;  1I2S A;  2PHY A;  3CHW P;  4JF4 A;  1TD5 A;  3H7W B;  3MFD A;  3RFB A;  1BUE A;  2HZ5 A;  3IXD A;  1EW0 A;  5F5Y A;  4G3V A;  3A3J A;  3SOI A;  2Z6C A;  3CUE C;  5GHX A;  3HJK A;  4R1G A;  3E2K A;  3WRT A;  3S7Q A;  3OCL A;  4L9E A;  1N4O A;  4Y0U A;  5G18 A;  5CED A;  1QMF A;  3JYI A;  3ZQ5 A;  5TGF A;  3K3C A;  2XK1 A;  4R23 A;  1S4S A;  2Y55 A;  2J7V A;  5EM1 A;  5I5L A;  4O01 A;  5J7E A;  4IVI A;  4DE1 A;  3LGO A;  5CTM A;  3LR4 A;  4HNB A;  3FKV A;  2JKT I;  2JN7 A;  1XKZ A;  4QD4 A;  3C38 A;  4UQI M;  2GDN A;  2GNX A;  3DTE A;  4EW7 A;  4DF6 A;  3ISG A;  1N9O A;  1CEG A;  5CHJ A;  3CUE A;  1J9M A;  2LB9 A;  3MZD A;  1ES3 A;  5E2G A;  2QKP A;  2OLV A;  1W63 M;  2P9V B;  1VB6 A;  5EE8 A;  3PAG A;  2WZZ A;  1GHI A;  1XJ4 A;  4X55 A;  1ONH A;  3BQ8 A;  4IUK A;  5KIZ A;  3OPL A;  1OJG A;  2V2F F;  1MWT A;  1XGJ A;  5L8M A;  4EWF A;  4OPR A;  1ESI A;  3ZG0 A;  3Q7V A;  2OSU A;  3N7W A;  1PFL A;  3HLD A;  4EV4 A;  2P74 A;  1PYY A;  4WMC A;  2XA7 M;  3W4O A;  3N6I A;  3UN7 A;  4E3M A;  3S1Y A;  2KDK A;  2V8F A;  4NG2 A;  1KOU A;  3O87 A;  4P6Z S;  3ZYT A;  2XR0 A;  1XJ6 A;  2Y2M A;  2WAE A;  1HTZ A;  4EXO A;  3WS5 A;  4WBG A;  2EWV A;  2VGL S;  4OLD A;  1CI8 A;  2WKE A;  3VMA A;  5DF8 A;  1MWS A;  3C2W A;  3KYE A;  4OH0 A;  4GJ4 A;  3LR5 A;  3LIA A;  1SDN A;  1IYP A;  2VGK A;  3EGD C;  4BWI A;  3O88 A;  4LLO B;  1KGE A;  5FEG A;  4DJ3 A;  3OOV A;  2PYR A;  4PPR A;  2ZOH A;  1K4F A;  4KUK A;  3CZD A;  2HV1 A;  2QMI A;  4G3K A;  5DVA A;  4GW9 A;  3VE3 A;  3HCY A;  4KZ9 A;  1HLU P;  2EX2 A;  4DDS A;  2XQZ A;  4WM9 A;  4B9O A;  5J3W A;  5FQM A;  3R7W B;  5K5B A;  2P7J A;  4UQI S;  4Y3I A;  3T1R A;  3DBA A;  4BBT A;  2GX5 A;  4OVD A;  3F1N A;  3BY9 A;  4E3O A;  2KOI A;  3SH8 A;  4GKU A;  3KSI A;  4HBT A;  2BAS A;  3C4P A;  3S4X A;  4HJ4 A;  1N9L A;  2XGN A;  1TEM A;  3GTC A;  3Q7V B;  5F69 A;  3JVV A;  3HRE A;  5HPI A;  3MZE A;  4OP5 A;  4KG6 A;  5FQ9 A;  1TS7 A;  3LIE A;  3HLG A;  4UHU A;  1M6K A;  1TF1 A;  3DTM A;  4PM6 A;  5CHM A;  3BJN A;  1TVF A;  1LSW A;  1NRF A;  5GL9 A;  2GJ3 A;  3IBR A;  4PM5 A;  4MCW A;  3G35 A;  4R38 A;  1FCO A;  1FIL A;  2ZC5 B;  3M6H A;  3UB7 A;  4Y17 A;  3KYZ A;  4Y7P A;  3BEB A;  5EFW A;  2RL3 A;  1LHY A;  4R3J A;  4U0T A;  4GS9 B;  3VP4 A;  4YWZ A;  2WAD A;  4KZ6 A;  2EX6 A;  3WS0 A;  3HLC A;  3T50 A;  3G32 A;  2VEA A;  2ZM8 A;  3QNB A;  3WS4 A;  1RCJ A;  1GHP A;  4JGR A;  4CPK A;  1KVM A;  1KE0 A;  5F6A A;  4O0P A;  1E3U D;  1V9Z A;  3A0R A;  4I38 A;  3EEA A;  4EEU A;  3IWI A;  2R9X A;  4P0M A;  3OZH A;  3QP5 A;  3CLO A;  3ZVW A;  4LRX C;  2HDU A;  3HLE A;  2IA2 A;  4F3L A;  2ZOI A;  2C6W B;  3HJI A;  3BLS A;  1RP5 A;  4RX3 A;  1I5Q A;  5CX7 A;  3DTK A;  5AVF A;  2FH5 A;  5EUA A;  1O7E A;  3V5M A;  4DN0 A;  3IWQ A;  4JKT A;  3WS1 A;  5EVI D;  1D1J A;  1NYY A;  2JKR I;  2ZM2 A;  3EQU A;  1BTL A;  1LL8 A;  5A90 A;  3Q1F A;  2PU2 A;  5FI7 A;  2ZC4 B;  1CF0 A;  4OQI A;  3OPP A;  4EUZ A;  1YMS A;  1STZ A;  3VFH A;  1YLT A;  4QJG A;  4GN2 A;  5EVL A;  4BBV A;  1T19 A;  5CHU A;  3S7O A;  1ES5 A;  3BFD A;  4KZ3 A;  3SH9 A;  3VOZ A;  2M1C A;  1PI5 A;  3LIC A;  5IU1 A;  2WKQ A;  1V9Y A;  3FKW A;  3IF6 A;  5CGX A;  1WA9 A;  2PR5 A;  1N9B A;  3F1P A;  3L7H A;  3E4O A;  3TSG A;  1DRM A;  3A0S A;  3QP1 A;  1P97 A;  2XF3 A;  4Q0J A;  1KGG A;  1SDE A;  5CEB A;  4E6W A;  4OQH A;  3ZNT A;  1K55 C;  4N92 A;  1DP8 A;  4PKY G;  2D01 A;  2V0U A;  1MBL A;  3OBF A;  2OAP 1;  3HVF A;  2J3W A;  3UE1 A;  5E2E A;  1IKI A;  3NY4 A;  1BSG A;  1YLW A;  1YAX A;  4LEN A;  4B4X A;  3E0Y A;  1KE3 A;  4AFI A;  1OTD A;  2V9A A;  3GRJ A;  5JYP A;  2JCH A;  3IXH A;  2JKT M;  3Q82 A;  5HWT A;  1LL9 A;  4XUX A;  2QHK A;  2Y2P A;  4E6X A;  4F3L B;  4IED A;  1NRJ A;  5DFY A;  2Y2O A;  1E3U A;  4GHI A;  3MFX A;  3IX8 A;  1F9I A;  3BFF A;  4HJ3 A;  3TG9 A;  1W7F A;  3C5A A;  1K55 A;  4PM9 A;  4BMW A;  5A93 A;  1W5D A;  2WKH A;  2V1A A;  4C75 A;  3GEC A;  4P6B A;  5HDD A;  4Q0H A;  3QP4 A;  3FV7 A;  5F1G A;  5A92 A;  3UDI A;  1ERM A;  4R6L A;  5DTS A;  1G68 A;  1Z09 A;  1UWN X;  2Y2J A;  4QWO A;  1JWP A;  3NOP C;  3VV4 A;  1K57 C;  3MXR A;  1MXO A;  5HD5 A;  4EER A;  2V20 A;  2ZC3 B;  3RTY A;  1H3Q A;  5FL3 A;  3ZG7 B;  1XP4 A;  3FPW A;  3K2N A;  1D06 A;  1OT6 A;  5DF7 A;  4WLA A;  4DE2 A;  4UA6 A;  4MN5 A;  3F1P B;  4X68 A;  3DWZ A;  2Z6D A;  1GA0 A;  3RJU A;  4JGO A;  2JC7 A;  4IBX A;  3VP2 A;  3PBQ A;  4X6T A;  3MKE A;  3IHA A;  4EEP A;  3B42 A;  3ZG8 B;  3QNC A;  2LB5 A;  3LEQ A;  4OPY A;  4DE0 A;  1PI4 A;  3EOI A;  2IWD A;  1XFN A;  2PBD P;  2XFS A;  5DJT A;  4ZDX A;  2W3F A;  4K08 A;  2WZX A;  2EFU A;  4MNR A;  2UWX A;  4LFU A;  1T1B A;  5IHV A;  3P01 A;  3IBJ A;  4G3W A;  1CK3 A;  1YSQ A;  4HBU A;  5HD3 A;  4GHI B;  3CJM A;  4FH2 A;  2Q9M A;  3MXS A;  1XA7 A;  1SKO B;  5FAS A;  3HUM A;  1OTA A;  2W1R A;  2R78 A;  4FUW A;  4HY8 A;  1E25 A;  2VGL M;  5IT5 A;  1YKD A;  4BD0 A;  2YKF A;  2Y2Q A;  1TDG A;  2PDR A;  1NJ4 A;  4L0L A;  3LR3 A;  1OTI A;  2ZMV A;  1XPB A;  4NXB A;  1D7E A;  1Y54 A;  4PHT A;  1SHV A;  2VJW A;  1Y4O A;  3T12 B;  1Z6F A;  4X25 A;  2O9A A;  3UMD A;  2A24 A;  4EQ1 A;  3T4L A;  2J80 A;  4R4R A;  2XD5 A;  2V1Z A;  1QME A;  3I7J A;  1K56 D;  1OTE A;  1XJ2 A;  4RYE A;  3NCK A;  2JKF A;  4BJP A;  1KE4 A;  2GZA A;  2O9C A;  4K0W A;  1W8Y A;  1SCW A;  1IEL A;  2EA9 A;  3FWL A;  2O0Y A;  4QY6 A;  4HH3 A;  4ZTK A;  3T4T A;  2W3E A;  3U2A A;  2G7U A;  2VZW A;  1WYC A;  2R9W A;  1NY0 A;  2QPN A;  4EET B;  4KG2 A;  1DY6 A;  4NXE A;  5CRF A;  1FCN A;  2BG1 A;  4ME4 A;  4XT2 B;  5F1F A;  2VA0 A;  3G30 A;  3NC8 A;  4WZ5 A;  3BFG A;  1LL5 A;  1NZU A;  2ZL1 A;  2W3G A;  1BLP A;  3G2Y A;  1ODV A;  4JXG A;  4OLG A;  1DJC A;  1L3L A;  2B18 A;  4I39 A;  1N9N A;  5E2F A;  4KZ7 A;  3BFC A;  1YT4 A;  2H0Y A;  3DW0 A;  3BRM A;  4WZ4 A;  5FI2 A;  3M2K A;  4XUZ A;  2Q9N A;  3U4L P;  3QP8 A;  3A3D A;  4KZ4 A;  4YNR A;  3P7N A;  1K0K A;  2CC1 A;  3NDE A;  2P08 A;  3KSG A;  1AWI A;  5LBR A;  4DKI A;  3V50 A;  3TRC A;  3NIA A;  3LR0 A;  1K25 A;  1TS6 A;  1IFQ A;  1L2S A;  1NLY A;  3LYX A;  3UPO A;  2JKR M;  2Y2G A;  1BT5 A;  2W3D A;  1BLH A;  5HX9 A;  2A24 B;  1OJ5 A;  1EWZ A;  4EES A;  1XGI A;  2VKS A;  3TJZ C;  1DJA A;  1Y28 A;  5GLB A;  1OT9 A;  4DDY A;  3NBL A;  2HDR A;  2A49 A;  3PBO A;  4Q0I A;  4JLF A;  4RQ9 A;  4WUJ A;  5HL1 A;  5AQA A;  3A0V A;  2J8Y A;  3T4O A;  3WWX A;  2ZQ8 A;  1BZA A;  4IHQ A;  1T1A A;  2ZQC A;  1MKI A;  3F1O A;  1NWZ A;  4GZB A;  4KQR A;  4KUO A;  1CJF A;  3FYZ A;  4ESP A;  2X02 A;  4LRZ E;  3HLB A;  4WEK A;  3N8R A;  1BLS A;  2J9P A;  3FPV A;  2FFF B;  2HPB A;  2W0N A;  2ZL1 B;  2WAF A;  1ZKJ A;  4IUH A;  1FCM A;  4CLC D;  1S67 L;  2EXA A;  3GQZ A;  3MQQ A;  1YLY A;  4CJN A;  3IX4 A;  3NOU C;  2ACG A;  1Q2P A;  2ZQ9 A;  4DJ2 A;  3UB6 A;  3BM6 A;  2WK0 A;  2XSS A;  3FZC A;  1GA9 A;  2XEP A;  1K6S A;  1S66 L;  3W4P A;  3Q07 A;  4DE3 A;  1YLP A;  5EV0 A;  1MWU A;  2V8C A;  3FG8 A;  4HH2 A;  5HAR A;  3KSF A;  5FSR A;  3T4S A;  3ICY A;  1GSX A;  5IS1 A;  3UPN A;  1VM1 A;  4M4X A;  1PW8 A;  3M6B A;  3UE3 A;  1UWP X;  5F82 A;  1ACF A;  3MXQ A;  4EBL A;  2L4R A;  5AVE A;  2J3T D;  4YIN A;  5TR7 A;  1PRQ A;  4FOF A;  2XDM A;  3EEH A;  2B02 A;  2EXB A;  2RCX A;  1TS8 A;  2DMW A;  3T4K A;  3F1O B;  2XFT A;  5L09 A;  3S22 A;  3NHQ A;  2OLU A;  2I72 A;  3GSG A;  2VK3 A;  2Y59 A;  3C7V A;  3WRZ A;  2FZ0 A;  4ZJ3 A;  4CLC C;  5KMW A;  5HAQ A;  2PR6 A;  1MZU A;  5FA7 A;  1NLZ A;  3S7N A;  1O07 A;  3OLO A;  3IS2 A;  4E04 A;  3F1N B;  1K38 A;  1MY8 A;  2Y2L A;  5FAO A;  3IF6 C;  3M2J A;  3PTE A;  5AQ9 A;  4HHD A;  1IKG A;  4JXS A;  4L9F A;  3NI9 A;  4IBR A;  3HL9 A;  1M40 A;  2ZQ7 A;  4GB7 A;  1PIO A;  4RX2 A;  5L07 A;  2XRO A;  3PHY A;  1K4E A;  4MN6 A;  1MPL A;  5GLC A;  3VP1 A;  2KLI A;  3A3E A;  3A3F A;  3SZT A;  5L2F A;  4RA7 A;  5C5K A;  2DRW A;  4ARZ A;  2HP6 A;  3HUN A;  4KQD A;  2PYP A;  3ZGA B;  3SH7 A;  2WKP A;  4CLC A;  3HBR A;  4D2O A;  4Z1W A;  3O3V A;  3E4P A;  4GNU A;  3UDF A;  4LGW A;  2XRN A;  3E2L A;  3PYP A;  5U47 A;  1ZC2 A;  1VQQ A;  2HF6 A;  5EPH A;  3BEC A;  2INW A;  4OOL A;  4S2J A;  4FSF A;  4BEN A;  4UA9 A;  1JWV A;  4NKP A;  5DFX A;  3DAV A;  2P04 A;  1P9R A;  3G4P A;  1LT0 A;  2PU4 A;  2Y2K A;  4N9L A;  1JNU A;  3BY8 A;  3WS2 A; 
#chains in the Genus database with same CATH homology
 4HBU A;  3N8L A;  4KQQ A;  3ZCZ A;  3CJM A;  2JE5 A;  4OPQ A;  2P74 A;  4FH2 A;  1PYY A;  4WMC A;  3BYD A;  3G2Z A;  3N6I A;  1H8Y A;  4KZB A;  3W4O A;  3B3X A;  2IWC A;  3UN7 A;  2WGV A;  2Q9M A;  3MXS A;  4E3M A;  1XA7 A;  3S1Y A;  2WKI A;  5EVI C;  3ZVT A;  5FAS A;  3HUM A;  4LCL A;  4LV3 A;  3UY6 A;  3O87 A;  5I94 A;  4OOM A;  3SS4 A;  2XR0 A;  4HES A;  1E25 A;  3AGF A;  2Y2M A;  3Q7Z A;  4RVA A;  2WAE A;  1HTZ A;  4S2M A;  3WS5 A;  1DJB A;  1TDL A;  4WBG A;  1ES4 A;  1L0D A;  2A3U A;  4JF6 A;  4OLD A;  1CI8 A;  2WKE A;  4OQ0 A;  4LV0 A;  4BD0 A;  3VMA A;  5DF8 A;  4E3L A;  1MWS A;  4EBP A;  2Y2Q A;  1TDG A;  4N1X A;  4OH0 A;  1NJ4 A;  5FI6 A;  4L0L A;  4FD8 A;  4BQM A;  4ZBE A;  4O7D A;  1XPB A;  1FR1 A;  1SDN A;  1IYP A;  4KZ5 A;  1Y54 A;  2VGK A;  3PAE A;  3O88 A;  1MWR A;  1SHV A;  4C3Q A;  1KGE A;  3W4Q A;  1W8Q A;  1Z6F A;  4HEF A;  1LI0 A;  5FQJ A;  4QHC A;  3V3S A;  3VP3 A;  1FQG A;  4PPR A;  3OPH A;  5CEC A;  3GV9 A;  4H8R A;  1K4F A;  4R4R A;  4X56 A;  3CZD A;  2QMI A;  5FQI A;  5DVA A;  2XD5 A;  4R4S A;  2V1Z A;  1QME A;  3W8K A;  1HD8 A;  3ZNY A;  1NXY A;  1K56 D;  3I7J A;  4RYE A;  3NCK A;  3PBR A;  1KGF A;  4KZ9 A;  4WYY A;  4BJP A;  1H5X A;  1KE4 A;  2EX2 A;  4B88 A;  4DDS A;  2XQZ A;  4N9K A;  1JTG A;  4WM9 A;  5EVI A;  3ZG5 A;  4K0W A;  4EBN A;  1W8Y A;  1SCW A;  5FQM A;  2ZM0 A;  4Q8I A;  4PM7 A;  1IEL A;  1K6R A;  4KG5 A;  3FWL A;  3IH8 A;  4QY6 A;  2G2W A;  5CGS A;  4ZTK A;  4WEJ A;  4Z9Q A;  3IF6 B;  4ZJ2 A;  4QY5 A;  4WEL A;  1WYC A;  2H0T A;  2WUQ A;  4OVD A;  2R9W A;  4KZA A;  1NY0 A;  3GMW A;  3UE0 A;  3AGD A;  2QPN A;  4E3O A;  1HZO A;  4ZAM A;  3SH8 A;  4GKU A;  3GVB A;  4KG2 A;  3BLM A;  1DY6 A;  3LY3 A;  2Y2N A;  3C7U A;  1RGZ A;  5CRF A;  1FCN A;  3CG5 A;  4HBT A;  4GDB A;  1G6A A;  4S2O A;  3C4P A;  2BG1 A;  3IWO A;  3S4X A;  5F1F A;  5AQ7 A;  1YM1 A;  2XGN A;  3G30 A;  1WYB A;  3NC8 A;  3UDX A;  1TEM A;  4WZ5 A;  3BFG A;  1LL5 A;  1NZU A;  3GTC A;  1L0F A;  3UNW A;  2G2U A;  2WGW B;  3Q7V B;  2DCF A;  1JTD A;  5FAP A;  3GR2 A;  2FFY A;  3LO7 A;  4P85 A;  3HRE A;  1BLP A;  2HDS A;  3MZE A;  3LY4 A;  4OP5 A;  4KG6 A;  3G2Y A;  5DTT A;  1W79 A;  5FQ9 A;  4JXG A;  4OLG A;  1DJC A;  1Q2Q A;  1FSW A;  4JXW A;  3HLG A;  4UHU A;  1M6K A;  2X01 A;  5HFO A;  3UO9 A;  3DTM A;  5E2F A;  4KZ7 A;  2Y4A A;  4PM6 A;  4E3I A;  1FOF A;  5CHM A;  3BFC A;  3SS3 A;  1YT4 A;  1ZG6 A;  2H0Y A;  3DW0 A;  3HLW A;  2ZMA A;  1TVF A;  3BRM A;  1NRF A;  5GL9 A;  1RGY A;  4WZ4 A;  5FI2 A;  3M2K A;  4PM5 A;  4XUZ A;  3ZHH A;  3TOI A;  3G35 A;  2Q9N A;  1WE4 A;  1YMX A;  1FCO A;  2C5W B;  2ZC5 B;  3M6H A;  3A3D A;  4KZ4 A;  1YLZ A;  5FQQ A;  3MKF A;  4A5R A;  4Y7P A;  3BEB A;  4E3N A;  2CC1 A;  3NDE A;  2PBY A;  1NYM A;  5EEC A;  2RL3 A;  3QHY A;  1LHY A;  3IF5 A;  4N1H A;  4R3J A;  4U0T A;  3BFE A;  1JWZ A;  3VP4 A;  1PWD A;  4OPZ A;  5CER A;  4DKI A;  3V50 A;  2WAD A;  4KZ6 A;  3EQV A;  2OV5 A;  2EX6 A;  3NIA A;  5TFQ A;  1NZO A;  4NET A;  1K25 A;  4WMC D;  1CI9 A;  3WS0 A;  5CXW A;  3IXB A;  1ES2 A;  1BUL A;  3HLC A;  3G32 A;  1L2S A;  2ZM8 A;  4F94 A;  3QNB A;  3UPO A;  1BLC A;  3WS4 A;  1RCJ A;  1GHP A;  3IQA A;  2Y2G A;  1BT5 A;  4K91 A;  4MBK A;  4CPK A;  1KVM A;  1KE0 A;  1BLH A;  1CEF A;  1ERQ A;  5HX9 A;  3VSK A;  2X71 A;  5EOO A;  4Y0O A;  4BL3 A;  1KVL A;  1EWZ A;  1E3U D;  1XGI A;  3SS5 A;  3IWI A;  1DJA A;  2EFX A;  2R9X A;  1IEM A;  4JPM A;  4YFM A;  2ZC7 A;  5GLB A;  4P0M A;  4S2P A;  3OZH A;  3OC2 A;  4DDY A;  5FAQ A;  3NBL A;  4PM8 A;  2HDR A;  5DTK A;  4S2L A;  2JBF A;  5AQB A;  2A49 A;  5EVI B;  4EQI A;  3PBO A;  3ZVW A;  3HUO A;  4JLF A;  5HL1 A;  3C4O A;  3IH9 A;  5AQA A;  1U60 A;  2J8Y A;  5F83 A;  2WYX A;  4WZ5 C;  2HP5 A;  3WWX A;  4B4Z A;  2HDU A;  3HLE A;  2ZQ8 A;  3ZFZ A;  1PWG A;  4JXV A;  2XLN A;  1BZA A;  1K54 A;  4GD8 A;  4DXB A;  1GHM A;  1JVJ A;  4NK3 A;  2ZQC A;  1MKI A;  2C6W B;  4GDN A;  4BD1 A;  3G34 A;  5KSC A;  3BLS A;  1RP5 A;  1FR6 A;  4GZB A;  4RX3 A;  1I5Q A;  4OKP A;  4KQR A;  2H10 A;  3PBN A;  5DF9 A;  4P87 A;  3FYZ A;  5EUA A;  1O7E A;  3V5M A;  2X02 A;  1H8Z A;  3IWQ A;  3HLB A;  4JKT A;  4WEK A;  3WS1 A;  2QZ6 A;  5EVI D;  5E43 A;  3N8R A;  1BLS A;  2J9P A;  1NYY A;  2ZM2 A;  4M3K A;  3EQU A;  5KSH A;  1BTL A;  4S2K A;  5A90 A;  3N8S A;  1IYQ A;  3DWK A;  4E3K A;  3Q1F A;  2PU2 A;  5FI7 A;  3IXG A;  2FFF B;  2ZC4 B;  4OP8 A;  4BLM A;  2HPB A;  5KZH A;  1L0G A;  4OQI A;  1GCE A;  2WAF A;  4R3B A;  3OPP A;  4EUZ A;  1ZKJ A;  1YMS A;  2VGJ A;  1FCM A;  4E3J A;  3VSL A;  2EXA A;  4FH4 A;  5FDH A;  3GQZ A;  1YLT A;  3VFH A;  4QJG A;  2B5R A;  4GN2 A;  1YLY A;  5M1A A;  4CJN A;  2ZD8 A;  5EVL A;  4MLL A;  2Z2L B;  2Y91 A;  1HVB A;  5CHU A;  4OOY A;  2H5S A;  2Z2M B;  3ITA A;  1ES5 A;  3BFD A;  3UPP A;  4R0Q A;  4KZ3 A;  5JYO A;  4MEZ A;  4LV2 A;  3SH9 A;  3VOZ A;  1PI5 A;  1Q2P A;  4U3T A;  2ZQ9 A;  4KQO A;  3P98 A;  3P09 A;  2Y2I A;  3BM6 A;  3FKW A;  3IF6 A;  2WK0 A;  3AGE A;  5CGX A;  2IWB A;  1ERO A;  4UAA A;  1N9B A;  3IHB A;  5HAI A;  2DNS A;  2XD1 A;  3FZC A;  1PZO A;  4LCM A;  3IT9 A;  3TSG A;  4KZ8 A;  5GHZ A;  1GA9 A;  2XF3 A;  3V39 A;  2XEP A;  3O86 A;  1K6S A;  2ZJ9 A;  1XX2 A;  5EOE A;  1C3B A;  1KGG A;  1SDE A;  4QB8 A;  4E6W A;  4OQH A;  1I2W A;  3ZNT A;  1K55 C;  5CEB A;  4N92 A;  4DXC A;  3W4P A;  3N4I A;  1MBL A;  3Q07 A;  1K54 C;  3VOY A;  1YLP A;  4DE3 A;  3V3R A;  1PZP A;  1MWU A;  1YLJ A;  5GLA A;  1K57 A;  1L0E A;  3HVF A;  1OME A;  5HAP A;  3UE1 A;  3VFF A;  5E2E A;  1ZG4 A;  1IKI A;  5FAT A;  3NY4 A;  1EI5 A;  3PBS A;  2P9V A;  4JBF A;  1BSG A;  1YLW A;  4UA7 A;  5HAR A;  5D3O A;  5J8X A;  5A91 A;  3NDG A;  1ESU A;  4LEN A;  3D4F A;  3G31 A;  5E2H A;  1KE3 A;  5FSR A;  4B4X A;  4MBH A;  4IVK A;  3OCN A;  5CTN A;  1PWC A;  5GLD A;  3GRJ A;  3RXX A;  3UPN A;  1VM1 A;  5JYP A;  4K0X A;  5CGW A;  1PW8 A;  3M6B A;  3UE3 A;  2JCH A;  3IXH A;  3Q81 A;  5F82 A;  3Q82 A;  2XH9 A;  1KDS A;  4FCF A;  4EBL A;  1I2S A;  1LL9 A;  4XUX A;  4YIN A;  5TR7 A;  2Y2P A;  4E6X A;  4JF4 A;  4IED A;  2XDM A;  1XA1 A;  4S2I A;  2EXB A;  4BL2 A;  2RCX A;  3ZDJ A;  2BLS A;  4S2N C;  2XFT A;  3MFD A;  3S22 A;  2Y2O A;  1E3U A;  1BUE A;  2OLU A;  2I72 A;  3GSG A;  3ZG9 B;  3IXD A;  2Y59 A;  1ONG A;  3C7V A;  4MBF A;  3BFF A;  3WRZ A;  3CMZ A;  3TG9 A;  1W7F A;  3A3J A;  3C5A A;  3SOI A;  4ZJ3 A;  1K55 A;  4PM9 A;  5A93 A;  5GHX A;  2J9O A;  5KMW A;  1W5D A;  2EX9 A;  2HP9 A;  5HAQ A;  3HLF A;  4R1G A;  5FA7 A;  2WKH A;  3PBT A;  4C6Y A;  3E2K A;  1O07 A;  5FQK A;  3WRT A;  4C75 A;  3OCL A;  4P6B A;  1N4O A;  1K38 A;  1MY8 A;  2Y2L A;  1S0W A;  4Y0U A;  5FAO A;  4X53 A;  3IF6 C;  5G18 A;  3M2J A;  3PTE A;  5CED A;  5AQ9 A;  1QMF A;  3FV7 A;  5F1G A;  5A92 A;  3JYI A;  2E8I A;  5TGF A;  1IKG A;  1KDW A;  4JF5 A;  4JXS A;  4OON A;  1IYS A;  1K56 A;  3NI9 A;  4LV1 A;  4IBR A;  3HL9 A;  4ZJ1 A;  1M40 A;  3UDI A;  2XK1 A;  4OQG A;  4R23 A;  2Y55 A;  2J7V A;  2ZQ7 A;  4GB7 A;  2WGI A;  1PIO A;  1SKF A;  1ERM A;  3LEZ A;  4RX2 A;  5BOH A;  4IVI A;  4DE1 A;  5GHY A;  4U0X A;  5CTM A;  5DTS A;  1G68 A;  1K4E A;  4KEN B;  3FKV A;  1S6R A;  2Y2J A;  1YQS A;  5M18 A;  1JWP A;  4ID4 A;  1XKZ A;  1MPL A;  4QD4 A;  4GOG A;  5GLC A;  3VP1 A;  3A3E A;  2Y2H A;  1K57 C;  3MXR A;  2GDN A;  3A3F A;  1MXO A;  1LLB A;  5L2F A;  1FSY A;  2V20 A;  1AXB A;  2ZC3 B;  4RA7 A;  3ZG7 B;  4S2N A;  1XP4 A;  4DRT A;  2DRW A;  3RXW A;  5DF7 A;  4DF6 A;  2HP6 A;  1LI9 A;  3HUN A;  4DE2 A;  4UA6 A;  4XXR A;  4Y0T A;  3LCE A;  3ISG A;  3A3I A;  3ZGA B;  2ZQD A;  1CEG A;  5CHJ A;  3SH7 A;  4X68 A;  3HBR A;  1J9M A;  3DWZ A;  1GA0 A;  2EX8 A;  3RJU A;  4D2O A;  2ZC6 B;  3O3V A;  1XXM A;  2JC7 A;  4IBX A;  3MZD A;  3VP2 A;  3PBQ A;  4GNU A;  4PMA A;  1ES3 A;  3UDF A;  3OPR A;  3ITB A;  4X6T A;  5HW3 A;  3E2L A;  3MKE A;  3IHA A;  1E4D A;  1ALQ A;  5E2G A;  5U47 A;  3ZG8 B;  2ZLY A;  2OLV A;  2P9V B;  3QNC A;  1ZC2 A;  1VQQ A;  5EPH A;  4OPY A;  3BEC A;  4DE0 A;  4GD6 A;  4OOL A;  5EE8 A;  3PAG A;  2WZZ A;  4S2J A;  1GHI A;  4FSF A;  4X55 A;  1PI4 A;  4BEN A;  1ONH A;  3MBZ A;  5M19 A;  1PW1 A;  2IWD A;  4UA9 A;  1JWV A;  3OPL A;  2XFS A;  4QU3 A;  2V2F F;  4ZDX A;  1MWT A;  1XGJ A;  1IYO A;  2WZX A;  3MZF A;  2EFU A;  4MNR A;  3G4P A;  4EWF A;  2UWX A;  4OPR A;  2ZQA A;  1ESI A;  3ZG0 A;  2WGW A;  3Q7V A;  4X69 A;  2OSU A;  3N7W A;  5IHV A;  2PU4 A;  3HLD A;  2HDQ A;  2Y2K A;  3VP0 A;  4N9L A;  1CK3 A;  3WS2 A;  4EV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...