3TG9A

The crystal structure of penicillin binding protein from bacillus halodurans
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
322
Chain Sequence
MKNHLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Penicillin binding protein
molecule keywords Penicillin-binding protein
publication title The crystal structure of penicillin binding protein from Bacillus halodurans
rcsb
source organism Bacillus halodurans
total genus 102
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3tg9A00
2XFTA 2Y2IA 5HW3A 1MKIA 5CGXA 4BENA 1GHIA 4WZ4A 5FQ9A 3HLEA 2XK1A 3N8SA 5FASA 1C3BA 3VSLA 4XUZA 1JTDA 4JF4A 4S2OA 1WYCA 4FH4A 1K57C 1YLZA 1K6RA 1CK3A 1CEGA 2Y59A 1ZG6A 1IYSA 4S2MA 5FA7A 3V5MA 5FI2A 4LCMA 3WS0A 2OV5A 3P98A 4KG6A 5FQKA 3UE1A 1MY8A 4Y7PA 3W4OA 3C4PA 4R3JA 4EBNA 3DW0A 4QJGA 1KE0A 3UNWA 1YLTA 3GV9A 5F1FA 1GHPA 1JTGA 3UY6A 1ALQA 4OVDA 1JWVA 1W79A 1L0FA 4OP8A 5DVAA 4LV3A 4BQMA 2PBYA 1E25A 3G34A 5GHZA 2XGNA 4LCLA 3UN7A 3PTEA 1TEMA 2C6WB 2XF3A 5FAQA 2HPBA 4YINA 2JBFA 4ZBEA 1I2WA 4BL3A 4EWFA 1KGFA 3NCKA 5HFOA 4BD0A 1EI5A 1PWDA 2XH9A 1Z6FA 2XD5A 3ITBA 5CERA 4FD8A 2ZD8A 5E2EA 3BFCA 1JWPA 2VGKA 4JXVA 2A3UA 4EBPA 3NBLA 3IXGA 1BLCA 1PI5A 4N92A 1SHVA 2WADA 2DNSA 1BLHA 3C7UA 3OPPA 4GKUA 2PU4A 5D3OA 1XGJA 4M3KA 4F94A 2HP5A 5CGWA 1HTZA 3IWOA 4JBFA 3GTCA 3BECA 3BFEA 3G2ZA 3IF6A 4BJPA 5EPHA 1XA1A 1H8ZA 1ZG4A 1QMEA 4K0XA 5E2HA 2JE5A 4UA9A 4L0LA 4ZDXA 4HEFA 2ZC4B 3P09A 4HBTA 2ZC7A 5A91A 3TSGA 2EFXA 3NDEA 2WKHA 3IXBA 1DY6A 5GHYA 4MBFA 3ZHHA 4WZ5C 2P9VB 4P0MA 3OCLA 4ZJ3A 3LY4A 1S0WA 3G30A 5GLBA 3V3RA 1ES2A 3DTMA 3DWZA 4GD8A 1ONHA 4CJNA 4K91A 4R1GA 1K4EA 3Q07A 1H5XA 3PBNA 3FZCA 1PI4A 2EX2A 2ZMAA 3D4FA 1K56A 2FFFB 2XEPA 3GMWA 3MXSA 1XP4A 3N4IA 4P6BA 3VOYA 1K57A 4XXRA 1CI9A 2WGWB 1BLPA 3LCEA 1O7EA 1FCOA 2V20A 2V2FF 3NDGA 1NXYA 1H8YA 2IWBA 3BEBA 4KZ6A 2RCXA 2XLNA 3UO9A 1TDGA 5TGFA 3UDXA 1K55C 4GNUA 1RCJA 3WS2A 4JF5A 5DF8A 1FR1A 2Y2LA 1XA7A 4OQGA 3PAGA 4U0XA 1QMFA 1L0DA 3GRJA 4WBGA 2Y55A 1I5QA 5CHMA 4PM5A 3NIAA 1BUEA 1YT4A 1DJCA 4KZ7A 4IBXA 4QY6A 2DRWA 4FCFA 3PBTA 4KZ8A 4X55A 3A3IA 4MNRA 4QB8A 5M1AA 4EQIA 4UA7A 4DXBA 3SOIA 3FV7A 5JYOA 4KENB 1DJAA 1GHMA 4IEDA 3GR2A 3S1YA 4ZTKA 2IWCA 1LLBA 3WRTA 3B3XA 3ZFZA 5F1GA 2Y2OA 5HL1A 3O87A 5JYPA 3EQUA 2WZXA 1PW8A 2EXBA 3IH8A 3BYDA 5M19A 3Q7VA 1IYPA 4R4SA 1MXOA 5CTMA 1KVLA 4GB7A 1G6AA 4GN2A 4DE3A 3VP1A 2ZC5B 4C3QA 3NI9A 4FH2A 2Y2NA 4GZBA 4NK3A 1Y54A 4N9KA 5CEBA 3VMAA 4P87A 4DRTA 4X69A 4RX2A 4R23A 1BSGA 4DE2A 3MZEA 2WKIA 5CEDA 4WELA 3IH9A 1BT5A 2I72A 3RXWA 1RGYA 3MKEA 3WRZA 4B4XA 3VP4A 4EV4A 4EUZA 2OLVA 3FKVA 4JPMA 4OPYA 2ZC3B 3MKFA 4WZ5A 5M18A 5FAPA 4KZ4A 2HDUA 1BTLA 1FSYA 5EECA 5DTTA 5EVIC 1FSWA 1TDLA 2XQZA 3OC2A 4Y0TA 3MZDA 1N9BA 1Q2QA 1MWUA 3FWLA 1W8QA 2ZQ8A 3IF6B 4KG2A 1L0GA 3TOIA 1YMXA 4DDSA 3HUOA 5F83A 5DF9A 3IQAA 2HDSA 4N1XA 4KZBA 4E3NA 2Q9MA 2WAFA 3CJMA 5HAIA 2Q9NA 3ZG8B 3O3VA 5F82A 5KMWA 1W8YA 3LEZA 3WS5A 1K55A 2IWDA 3HLGA 4JKTA 3W4QA 3ZVWA 4GDBA 5EOOA 3IWQA 3RJUA 3ZNTA 1IELA 4K0WA 1LHYA 4DKIA 3IXHA 3PBOA 3M6HA 1KDWA 2H10A 5FQMA 4QY5A 1PYYA 4JXSA 4Q8IA 1KVMA 4A5RA 3BFFA 2Y91A 1PW1A 1CI8A 2ZQAA 3W8KA 1HVBA 3GSGA 4UA6A 2WZZA 3ZG0A 4S2PA 3HUNA 4PM6A 1NY0A 1BULA 3HBRA 4QU3A 5EUAA 1NZUA 1ESUA 1MBLA 1I2SA 1RP5A 1NZOA 4ID4A 1O07A 5L2FA 1RGZA 1K38A 1VM1A 2XD1A 3RXXA 4E3KA 3MXRA 3BRMA 3MBZA 2ZLYA 3CZDA 3EQVA 3O88A 3M2KA 4IVIA 4RVAA 1OMEA 4OQHA 1GA9A 3HLWA 3Q82A 5GLCA 1MWRA 2QMIA 2UWXA 4R4RA 4E3IA 1WYBA 2GDNA 2A49A 2ZQDA 1PZPA 1SCWA 5EVLA 1IKIA 2XFSA 4YFMA 4PM8A 3VOZA 5CGSA 5E2FA 1LI0A 4QD4A 1KDSA 5FQQA 5FQJA 4GD6A 2XR0A 4B4ZA 4E3MA 3C4OA 1ESIA 3ZCZA 4OH0A 3V39A 4U0TA 3VFHA 3C5AA 3BLMA 3PBQA 1YMSA 5A93A 1FCMA 3Q7VB 2WUQA 3OPHA 4S2IA 5EVIA 5IHVA 1KE3A 3G4PA 1FOFA 2BLSA 3OPRA 4U3TA 1K54C 2C5WB 2H0TA 2WK0A 3N8RA 4KQOA 5A92A 1YM1A 1ERMA 4PPRA 5FDHA 5GLAA 3ZVTA 4OQIA 1K56D 3IT9A 3SS5A 2G2WA 5CRFA 4D2OA 3Q81A 2EXAA 2R9WA 2PU2A 1PWGA 3IF5A 3MFDA 3SH7A 5AQ7A 3BLSA 4MBKA 1YLJA 5CXWA 4ZAMA 4N9LA 4OONA 1IYOA 4DXCA 1W5DA 3UDFA 1IYQA 1IKGA 3HLCA 3VP0A 1FQGA 1XGIA 3BM6A 3WS1A 4MBHA 1BZAA 3ITAA 1M40A 5FATA 3AGEA 3W4PA 5EVID 1WE4A 5FSRA 1M6KA 3UE3A 2WGIA 3G32A 4E6XA 2FFYA 1FR6A 2OLUA 1K4FA 1ES4A 2J7VA 4UAAA 3ZNYA 3NY4A 4Z9QA 1Q2PA 1GCEA 3OZHA 4X56A 3OCNA 2Y2QA 5FQIA 4OOYA 2Y2MA 1MWTA 2J8YA 1FCNA 3ISGA 4OKPA 3M2JA 4P85A 1W7FA 4OP5A 5GHXA 5FI6A 2X02A 4OPQA 3HL9A 5FI7A 1ONGA 1LL5A 4KG5A 3E2KA 2JC7A 4O7DA 3PBSA 4N1HA 5CTNA 4LV2A 1E3UA 1NJ4A 3GQZA 1YQSA 4NETA 1HZOA 1J9MA 4S2LA 2QPNA 4JXGA 4OLGA 3UPNA 5GLDA 4B88A 3SH8A 2E8IA 3PAEA 5BOHA 1MPLA 2ZM2A 5J8XA 1E4DA 3BFGA 4KQQA 3QNCA 3IHAA 4EBLA 3SH9A 4GDNA 4DE0A 2HDRA 4S2NC 3VSKA 2BG1A 2H0YA 4E3LA 1ZKJA 4RYEA 3FYZA 2X71A 4KZAA 3C7VA 5EOEA 3WWXA 3UE0A 2RL3A 3LY3A 1L2SA 3G2YA 5CECA 3Q7ZA 4KQRA 4RA7A 4S2JA 5KZHA 1ZC2A 2EX9A 4H8RA 5TR7A 2J9PA 3I7JA 4OPZA 1YLPA 5HAPA 1DJBA 3S22A 3SS3A 5CHUA 1VQQA 4CPKA 2WGVA 4JXWA 4IVKA 4DE1A 3S4XA 1MWSA 5U47A 3A3DA 1EWZA 3N7WA 1K54A 1E3UD 4R3BA 5AQAA 1S6RA 5KSCA 4GOGA 4WM9A 3HREA 4JLFA 1PZOA 4BL2A 1XPBA 4QHCA 2H5SA 1XX2A 5DF7A 2X01A 4PMAA 4DF6A 1G68A 4DDYA 1L0EA 4Y0UA 2P74A 3A3EA 1KE4A 2EFUA 3O86A 5G18A 4ZJ1A 2JCHA 3GVBA 5FAOA 4BLMA 1BLSA 3IXDA 4C6YA 4E6WA 4FSFA 5E43A 4WMCA 1XXMA 5EE8A 4OLDA 1N4OA 3CMZA 3AGFA 3VP2A 1JWZA 4WYYA 2HP6A 2ZQ7A 3BFDA 4OOMA 3ZGAB 2ZQ9A 1NYYA 1K6SA 1U60A 2WYXA 5EVIB 5KSHA 4MEZA 3HLBA 3NC8A 2ZM8A 3HLFA 3DWKA 3IHBA 1ERQA 4R0QA 5DTSA 4OOLA 3TG9A 1SKFA 3QNBA 3UPPA 2OSUA 3A3JA 4KZ9A 2ZC6B 2R9XA 3UDIA 3UPOA 2HDQA 2Y2PA 1NYMA 2J9OA 4OPRA 4MLLA 3VFFA 1K25A 2Y2GA 1NRFA 5I94A 1SDEA 2ZQCA 1LI9A 1YLYA 3G35A 1IEMA 3N8LA 3HUMA 4Y0OA 4KZ5A 4XUXA 3V3SA 4E3OA 3V50A 3OPLA 4LENA 1EROA 2Y2JA 5HX9A 3ZDJA 4OQ0A 2Z2LB 3WS4A 4PM7A 5HARA 3CG5A 1XKZA 2XDMA 4WMCD 4UHUA 1JVJA 3IWIA 2P9VA 3QHYA 2V1ZA 2WKEA 4WEKA 3E2LA 4LV0A 3VP3A 2CC1A 2DCFA 5A90A 1LL9A 1HD8A 2WAEA 3A3FA 4KZ3A 3HLDA 1KGGA 2G2UA 3Q1FA 3MZFA 5HAQA 1AXBA 2Z2MB 1ES3A 1GA0A 3ZG7B 3M6BA 4WEJA 1KGEA 2Y2KA 4S2NA 2EX6A 1PWCA 4IBRA 3IF6C 4C75A 2Y2HA 4ZJ2A 1TVFA 3N6IA 4LV1A 5CHJA 4HESA 4JF6A 2WGWA 2VGJA 3G31A 2QZ6A 2ZJ9A 4E3JA 1SDNA 3SS4A 2B5RA 2Y4AA 3FKWA 5DTKA 4S2KA 4RX3A 5TFQA 1ES5A 1YLWA 3JYIA 2ZM0A 5E2GA 3ZG5A 4BD1A 5AQBA 4X68A 3LO7A 4PM9A 3AGDA 4X6TA 1PIOA 3ZG9B 2HP9A 5AQ9A 3HVFA 3PBRA 5GL9A 4X53A 4HBUA 2EX8A 1CEFA
chains in the Genus database with same CATH superfamily
5HW3A 1GHIA 4WZ4A 2EWWA 1C3BA 4JF4A 2O9BA 3UB6A 2YKHA 3LEQA 1WYCA 1YLZA 1K6RA 1CEGA 1ZG6A 3V5MA 4LCMA 1FIKA 1MY8A 4MMNA 3C4PA 4EBNA 4GHIA 1MKMA 1JWVA 1L0FA 4LV3A 2PYPA 2VV7A 2XGNA 4LCLA 3UN7A 3PTEA 2KDKA 2C6WB 4PKYA 4X25A 5DKLA 3IX8A 1KGFA 3NCKA 3MSHA 5CERA 5DJUA 1JWPA 2VGKA 3MMHA 4H6JB 3NULA 3KSGA 3OPPA 4GLQA 2PU4A 1XGJA 2HP5A 4LRXC 4JBFA 3GTCA 3BECA 3NJAA 3BFEA 3G2ZA 4ME4A 3IF6A 1ZG4A 4K0XA 4L0LA 3C8CA 2ZC4B 3U4LP 1OTAA 3NDEA 2WKHA 2P7JA 5GHYA 3ZHHA 4ZJ3A 4P0MA 1S0WA 1DP9A 2JKTM 4GD8A 3DTMA 2V8FA 4HP9A 4NG2A 4R1GA 2Q0OA 3P01A 2D02A 3QP4A 3FZCA 1PI4A 1S4SA 2ZMAA 5J3WA 3MXSA 3CITA 4P6BA 1K57A 3UB7A 1Z09A 2WGWB 2EA9A 4KZ6A 2XLNA 3UO9A 4O01A 5TGFA 4XT2A 1FR1A 2P04A 4U0XA 3VV4A 1L0DA 4K08A 1OJ5A 2Y55A 3NIAA 5F5YA 1YT4A 4KZ7A 3QP8A 3PBTA 1EW0A 4Y5FA 1NLZA 4BBVA 3A3IA 3TJZC 4R6LA 3BY8A 4EQIA 4UA7A 4KENB 4IEDA 2YKFA 1T1CA 4ZTKA 1LLBA 1P9RA 2W3HA 5DKKA 1XJ6A 3O87A 1VEUB 2WZXA 3FPVA 1PW8A 1XJ4A 3Q7VA 3KSIA 1KVLA 4C3QA 3NI9A 4FH2A 2J3TC 4NK3A 1Y54A 1L3LA 5HDSA 4DRTA 3KSHA 2KLIA 3R7WB 5HPIA 1BSGA 2OAP1 2XA7M 3CUEA 4HI4A 4WELA 1VEUA 3VE4A 1BT5A 2I72A 4LRZE 3MKEA 3VP4A 3FKVA 4OPYA 4L9FA 2HDUA 5EVIC 2ZMVA 4CLCA 3R7WA 4I3JA 2ZQ8A 2ZL1A 3IQAA 2PBDP 4CLCE 4MN5A 1XFQA 3ZG8B 1W8YA 1K55A 3HLGA 4JKTA 4GDBA 2VA0A 1IELA 3PHYA 3PBOA 4CQHA 3FC7A 1G6OA 1CI8A 3H9WA 1TF1A 2WZZA 3HUNA 2L0WA 1BULA 2VLGA 4QU3A 1ESUA 3ICYA 1I2SA 1NZOA 3NHQA 1AWIA 1RGZA 1VM1A 4L9EA 3BRMA 3MBZA 3EQVA 4RVAA 3HLWA 2A24B 1WYBA 2ZOHA 3C2WA 5CGSA 5E2FA 3L7HA 4L9GA 1ESIA 3ZCZA 3V39A 1UWPX 1YMSA 1FCMA 3OPHA 1V9ZA 2BLSA 1NRJA 3LFVA 4U3TA 2WKQA 1YM1A 2J3TD 4OQIA 1K56D 3IT9A 3SW1A 3CPTA 4D2OA 3A0RA 2R9WA 3LICA 5AQ7A 3BLSA 4MBKA 4OONA 4LRYC 1OT6A 1ACFA 4DXCA 3HLCA 2JKGA 1XGIA 1BZAA 3LR0A 1OTEA 3W4PA 5EVID 3UE3A 4E6XA 4EU0A 2OLUA 3NY4A 4JGOA 3NOPC 3OZHA 1MWTA 1W7FA 3HL9A 5FI7A 1LL5A 3U2AA 4UEYA 3PBSA 3TE8A 5CTNA 3K3DA 3ZQ5A 3T1XA 4B93A 3SH8A 5FDSA 5J8XA 4D60A 1DP6A 3VSKA 1GSXA 2H0YA 3C7VA 2RL3A 3LI8A 5CECA 4H8RA 4OPZA 2PDRA 1YLPA 2O9CA 4JXWA 5U47A 3N7WA 1STZA 1S6RA 2G7UA 1S1ZA 5KSCA 5TJJA 1PZOA 2PYRA 4BL2A 3LR5A 2H5SA 3UMEA 4DF6A 4DDYA 1L0EA 5A8BA 4Y0UA 2P74A 2EFUA 4ZJ1A 3L9KA 3IXDA 4E6WA 2W3GA 1H0MA 1XXMA 4WYYA 4OOMA 1OTIA 4JGQA 5KSHA 3NC8A 3DWKA 3TG9A 1ERQA 4OOLA 3QNBA 3H82B 3A3JA 4KZ9A 2HDQA 1VHMA 2J9OA 3G35A 3N8LA 3W2ZA 4FUWA 3V3SA 4EW7A 3JVUA 3ZDJA 3MQQA 3T1QB 2Z2LB 5HARA 3NECA 3QHYA 2WKEA 3VP3A 3CLOA 2CC1A 1HD8A 1G28A 3A3FA 3HLDA 1TD5A 3MZFA 3M6BA 4WEJA 1KGEA 1PWCA 2VZWA 2JN7A 4I38A 4C75A 5L07A 3N6IA 4LV1A 1YSPA 1XJ2A 5DTKA 2J3WA 3LIFA 4X68A 3DAVA 4PM9A 4X6TA 3OOVA 3ZG9B 3D3OA 5IT5A 1WA9A 1H8ZA 2V1AA 2XFTA 5CGXA 5FASA 3VSLA 4ETZA 4XUZA 1JTDA 2JKRI 4FH4A 3JVVA 5FA7A 2V0UA 1F98A 3WS0A 1KE0A 4DJ2A 3F1PA 5F1FA 3UY6A 1ALQA 1W79A 5KIZA 1IOUA 4OP8A 5DVAA 4BQMA 2PBYA 1E25A 3G34A 4EEUA 1TEMA 1J3WA 2XF3A 4YINA 2JBFA 4ZBEA 4EWFA 4BD0A 3ITBA 4EETB 2A3UA 3S7PA 2PT7A 5CX7A 4N92A 2DNSA 1BLHA 4GKUA 5HWTA 1LSXA 5J4EA 2H28A 1HTZA 4MN7A 2M7VA 5I5LA 3T4LA 4EXOA 4ZDXA 4HEFA 1XJ3A 1ODVA 2EFXA 2Z6DA 4MBFA 4WZ5C 5J7EA 5GLBA 1X0OA 1ONHA 4F3LA 5HWVA 2EX2A 1K56A 2FFFB 3N4IA 1XP4A 5HWWA 2W3EA 3V67A 4E04A 1H8YA 2RCXA 1W63M 1TDGA 3UDXA 3WS2A 5DF8A 2Y2LA 3PAGA 4YNRA 1QMFA 4WBGA 3RTYA 1I5QA 5CHMA 1BUEA 2QHKA 4IBXA 4QY6A 2DRWA 1H3QA 2VJWA 3UB9A 4KZ8A 3SOIA 3FV7A 3S1YA 2FZ0A 3B3XA 2Y2OA 5HL1A 3EQUA 2EXBA 3BYDA 4R4SA 3E98A 4GB7A 4NEED 1G6AA 4GS9A 5DJTA 3CHWP 1Y28A 2Y2NA 4GZBA 5CEBA 4NXGA 2QKPA 4RX2A 5TBMA 4JGRA 3MZEA 2O0YA 3VE3A 4EESA 3MKFA 3B42A 3CWFA 1FSYA 1FSWA 2XQZA 2QJ5A 3IF6B 4HIAA 2W1RA 4I3AA 5F83A 1MC0A 1IFQA 3S7NA 4KZBA 4NXEA 3T50A 1LL8A 1D1JA 3HJIA 4IHQA 3WS5A 3ZVWA 3W4QA 5EOOA 3E4PA 3ZNTA 1KDWA 4QY5A 1PYYA 3DTKA 1KVMA 4A5RA 4FTXA 3W8KA 3O5YA 3GSGA 4UA6A 1CF0A 3PXPA 1NY0A 2OOLA 5EUAA 2DMWA 1RP5A 4ID4A 5L2FA 2K31A 5AJGA 4XT2B 3RXXA 4E3KA 3MXRA 3M2KA 1GA9A 3Q82A 2UWXA 4R4RA 2PHYA 5FEFA 2A49A 3BY9A 1PZPA 3LGOA 4YFMA 4PM8A 2VKSA 5HD3A 4E3MA 3C4OA 4U0TA 3VFHA 2GJ3A 3PBQA 3SZTA 5A93A 3MQOA 3Q7VB 5IHVA 5IU1A 2I9VA 3G4PA 5FL3A 3BWLA 2Y79A 3T4QA 1LT0A 2H0TA 2WK0A 4KQOA 3T4OA 4PPRA 3SS5A 5CRFA 3EGXC 2PU2A 1PWGA 3IF5A 3MFDA 3SH7A 2ZOIA 1YLJA 3C38A 1IYOA 3MJQA 3WS1A 4MBHA 2VV8A 3ITAA 1WE4A 1M6KA 4CLCB 2FFYA 1FR6A 2ZL1B 1ES4A 4Y3IA 4Z9QA 1Q2PA 1MZUA 1YSQA 2HV1A 4P85A 3D72A 3KYZA 4OP5A 5FI6A 2HJ9C 1GSWA 2MJ6A 4KG5A 3RXWA 4LV2A 1E3UA 3QP6A 4B88A 5G4ZA 2E8IA 3PAEA 5BOHA 4WUJA 2BTFP 3QNCA 4GDNA 2HDRA 3K2NA 3LYXA 1F2KA 1T19A 4HHDA 3UB8A 2B95A 1ZKJA 4IUKA 2XROA 5AVFA 3LY3A 3HJKA 3G2YA 4S2JA 2GX5A 2W1TA 5HAPA 5HD5A 1DJBA 4EUVA 5CHUA 4I3IA 3A3DA 1EWZA 2JKFA 1K54A 4R3BA 4GOGA 4WM9A 3HREA 4JLFA 1XPBA 4QHCA 3LUQA 4PMAA 4X1LA 1G68A 2JCHA 3GVBA 4FSFA 4WMCA 2XSSA 3AGFA 1JWZA 3ZGAB 2HP6A 2ZQ7A 1NYYA 1K6SA 3R4KA 2ZM8A 3HLFA 5DTSA 3KO6A 1D06A 5G4YA 4MLLA 1K25A 1LI9A 4HOIA 1IEMA 3CPTB 1LSWA 3HUMA 5HL6A 4Y0OA 3ULFA 3OPLA 4R38A 2Y2JA 4OQ0A 2HF6A 3CG5A 3IWIA 2P9VA 2V1ZA 4WEKA 4G3VA 1LL9A 2G2UA 5HAQA 3KYEA 1ES3A 3ZG7B 3EGDC 4S2NA 2EX6A 2M1CA 3OBFA 3LIBA 3IF6C 4HJ3A 2Y2HA 4E3JA 2B5RA 3FKWA 1ES5A 1YLWA 4BD1A 2ZM0A 4HY8A 2B02A 3CAXA 1PIOA 2HP9A 3OLOA 5AQ9A 4R3AA 3UMDA 2Y2IA 5MC7A 3FPWA 3HLEA 2XK1A 2W0NA 4S2OA 3JPUA 1K57C 4ESPA 1CK3A 1IYSA 4S2MA 2OV5A 3P98A 5FQKA 3W4OA 3UNWA 3GV9A 2WKRA 3IBJA 2WKPA 4OVDA 2PR6A 5FAQA 2HPBA 1I2WA 4BL3A 2XH9A 1Z6FA 1SKOA 3QP5A 2ZD8A 3KSFA 1XFNA 1BLCA 1PI5A 1SHVA 4HH3A 1YAXA 5HSQA 4QWOA 3LIAA 4M3KA 5CGWA 3MS6A 2O99A 4MDZA 1XA1A 1QMEA 3MF0A 5E2HA 4UA9A 5A91A 2ZC7A 3TSGA 1DY6A 3OCLA 2GZAA 3G30A 1ES2A 2PR5A 3DWZA 4K91A 3QP2A 4GW9A 5HPFA 4CLCC 3PBNA 3D4FA 4HQAA 3GMWA 2XEPA 3MXQA 3RH8B 1CI9A 3LCEA 2V2FF 1FCOA 3NDGA 2HZ5A 2IWBA 3BEBA 5IS1A 1K55C 4GNUA 4JF5A 3F1OA 1XA7A 4OQGA 3DTEA 4Y13A 1YKDA 1DJCA 1SZVA 5M1AA 5JYOA 3RFBA 1DJAA 3ZFZA 3WRTA 5EM1A 5F1GA 2VGLM 2EWVA 5JYPA 3F1PB 1IYPA 3VOLA 3IX4A 5CTMA 4GN2A 3VP1A 4N9KA 3VMAA 4P87A 4X69A 5AVEA 1V9YA 4DE2A 2VEAA 3A0SA 4EQ1A 2WKIA 3P7NA 3IH9A 4AFIA 4PKYG 4P6ZM 2LB5A 4EV4A 4GCZA 2OLVA 3C30A 1ZHHB 5FAPA 4KZ4A 1BTLA 5EECA 5DFYA 1PFLA 3OC2A 4Y0TA 3MZDA 4IJGA 2JHEA 1MWUA 3FWLA 1W8QA 1YMXA 4I5SA 5DF9A 1TS8A 2W3DA 1G5UA 2HDSA 3EEHA 4G3WA 3LEZA 3RJUA 3IWQA 1YPRA 1NWZA 3EWKA 4K0WA 5EM0A 4F3LB 2H10A 2PRFA 4Q8IA 2ZQAA 4BWIA 3ZYTA 4CLCD 1HVBA 4S2PA 2W3FA 2V9AA 1CQAA 3HBRA 1NZUA 5C5KA 3UE6A 4ARZA 1K38A 2XD1A 1OT9A 1F9IA 4IVIA 1OMEA 5L8MA 1MWRA 2JKTI 3S7OA 3T4TA 1DRMA 2GDNA 3H7WA 4MCWA 5EVLA 1LI0A 4QD4A 1HLUP 1KDSA 5FQQA 5FQJA 2B18A 2XR0A 4B4ZA 1VETA 4OH0A 3NOTC 2OAQ1 3C5AA 4LGWA 3S7QA 5EVIA 1KE3A 1FOFA 1OTBA 4GS9B 2AVXA 1ERMA 3IS2A 2G2WA 3MFXA 5TBMB 2EXAA 3T4JA 1JNUA 5CXWA 4ZAMA 4N9LA 4WL9A 4PHTA 3GDIA 4WF0A 1IKGA 4Y17A 3LR4A 2VV6A 3VP0A 1FQGA 3BM6A 5FATA 2K2NA 1M40A 2Z6CA 1TS7A 5FSRA 3LIDA 3G32A 2J7VA 3ZNYA 2JKRM 4GJ4A 4ETXA 2CMNA 4OKPA 3M2JA 5GHXA 4OPQA 2UV0E 3PYPA 1P9WA 4NXFA 2JC7A 4O7DA 1H8MA 1NJ4A 1YQSA 4NETA 1HZOA 1J9MA 2QPNA 4JXGA 4OLGA 4UQIM 3UPNA 5GLDA 1MPLA 1E4DA 3MR0A 4KQQA 4EBLA 3KYQA 1OPXA 4WN5A 4E3LA 2BG1A 4QPRA 3FYZA 4KZAA 3WWXA 4RA7A 5KZHA 1ZC2A 1ZTUA 2J9PA 1PNEA 3T12B 2PD7A 1LSVA 4DN0A 3SS3A 4CPKA 2WGVA 4IVKA 4DE1A 1MWSA 5F6AA 5DFXA 4KUKA 4YWZA 4BLMA 1KE4A 5G18A 2V0WA 2FH5A 5FAOA 2HJEA 2R78A 3DTIA 1N4OA 3CMZA 1W63Q 3VP2A 2ZQ9A 4NKPA 2WYXA 4H6JA 2QJ7A 4MEZA 3IHBA 4R0QA 3T4KA 1SKFA 4LFUA 3UPPA 2OSUA 3E0YA 2R9XA 3UDIA 2Y2PA 1A0KA 4OPRA 3VFFA 2Y2GA 1NRFA 2ZQCA 1TS6A 2D01A 3V50A 1CJFA 4PM7A 1XKZA 2LB9A 1JVJA 2ZMFA 4LV0A 4LPZA 2DCFA 5A90A 2WAEA 3Q1FA 1S67L 4EEPA 4MN6A 3DBAA 1TVFA 4JF6A 2WGWA 2QZ6A 2OWJA 3SS4A 2Y4AA 4HJ4A 4RX3A 5TFQA 3JYIA 5E2GA 3ZG5A 4RQ9A 3NOUC 3LO7A 5GL9A 4X53A 1N9LA 4HBUA 5CHJA 1CEFA 2EX8A 2L1MA 1MKIA 4BENA 5FQ9A 3N8SA 1TS0A 5EVEA 4B9OA 3CI6A 2Y59A 4BMWA 5FI2A 4LLOB 2W1TB 4KG6A 2NUPC 3UE1A 3LIEA 4Y7PA 4QJGA 4R3JA 3DW0A 1T18A 3B33A 1YLTA 3T4SA 2O9AA 1GHPA 1JTGA 3E4OA 5LBRA 4YOFA 2BASA 5GHZA 4Q0IA 5HFOA 5L10A 1EI5A 1PWDA 2XD5A 4FD8A 5E2EA 3BFCA 4JXVA 4Y2FA 4EBPA 3NBLA 3IXGA 3G6OA 2WADA 3C7UA 5D3OA 1P0ZA 3UB5P 4F94A 3IWOA 2KOIA 4BJPA 5EPHA 2JE5A 3F1NB 3P09A 4HBTA 3IXBA 2P9VB 3LY4A 3V3RA 1GSVA 1K4EA 2E8JA 2KX6A 3Q07A 1H5XA 3F1NA 4WLAA 3VOYA 4Q0HA 4XXRA 1BLPA 2VGLS 1O7EA 2V20A 3LR3A 1NXYA 1RCJA 2Y8HA 3HCYA 3GRJA 2A24A 3A0VA 4PM5A 4FCFA 3KX0X 4X55A 4MNRA 4P6ZS 1OTDA 4QB8A 4DXBA 3TRCA 1F5MA 1GHMA 3GR2A 1D7EA 3TW8A 2IWCA 3IH8A 5M19A 2L4RA 1MXOA 3B47A 4DE3A 2ZC5B 3GECA 4O0PA 2VX8A 1FILA 1DP8A 3EOIA 4ZRRA 4R23A 2V8CA 3BQAA 3BQ8A 1SKOB 4PAUA 5CEDA 1NLYA 1RGYA 3WRZA 4KQDA 4B4XA 4EUZA 2HGVA 4JPMA 2ZC3B 5M18A 4WZ5A 5DTTA 3IX3A 1TDLA 1N9BA 1Q2QA 1L0GA 4KG2A 3IBRA 3TOIA 1UGUA 4DDSA 3HUOA 2A2LA 4N1XA 4E3NA 2Q9MA 2WAFA 3CJMA 2VK3A 2IA2A 5HAIA 2Q9NA 3O3VA 5F82A 5KMWA 2NUTC 2IWDA 1LHYA 4DKIA 3IXHA 3M6HA 5FQMA 4JXSA 4X1MA 5K5BA 3K3CA 3BFFA 2Y91A 1PW1A 4O8GA 3CUEC 3ZG0A 4PM6A 5HDDA 3PR6A 1MBLA 3BW6A 1O07A 4R70A 1S1YA 3F1OB 3O88A 2ZLYA 3CZDA 4OQHA 1T1BA 3BJNA 5GLCA 2QMIA 3MQ0A 3T1SA 4E3IA 2ZQDA 5EFWA 1SCWA 1IKIA 4HH2A 2XFSA 3VOZA 4GD6A 2ACGA 3LI9A 3BLMA 2WUQA 4S2IA 4Q0JA 4JGPA 3OPRA 3H82A 1K54C 2C5WB 4I39A 3N8RA 5A92A 5FDHA 5GLAA 3ZVTA 3E4QA 3Q81A 1VB6A 1KOUA 5F68A 5HDCA 1OJGA 1S4RA 1W5DA 3UDFA 1IYQA 5L09A 4UQIS 3QP1A 3AGEA 2WGIA 1K4FA 4UAAA 5HZHA 1GCEA 4X56A 4DJ3A 4HP4A 3OCNA 2Y2QA 5FQIA 4OOYA 1S66L 2Y2MA 2J8YA 1FCNA 3ISGA 2X02A 1ONGA 3E2KA 4KUOA 4N1HA 4CJNA 3GQZA 4S2LA 5F69A 2J80A 2ZM2A 3BFGA 2GNXA 3IHAA 3SH9A 4DE0A 5EV0A 4S2NC 3FG8A 1UWNX 4M4XA 4NXBA 4RYEA 1Y4OA 2X71A 5EOEA 2PD8A 3UE0A 1L2SA 3Q7ZA 4KQRA 4ARZB 2EX9A 5TR7A 3I7JA 3T1RA 3S22A 1VQQA 2W27A 4HNBA 3S4XA 1E3UD 1PRQA 5AQAA 3H7WB 4BBUA 5DF7A 1XX2A 2X01A 1T1AA 1N9NA 3A3EA 3O86A 4C6YA 1VETB 1BLSA 2P08A 5E43A 2M7UA 5EE8A 4OLDA 3BFDA 4FOFA 1U60A 4HJ6A 1P97A 5EVIB 1BYWA 3HLBA 4Y15A 5FEGA 2ZC6B 3UPOA 1NYMA 5I94A 1SDEA 3IS2B 1YLYA 2QWSA 2XRNA 4KZ5A 4XUXA 4E3OA 2ZBBA 4LENA 1EROA 2QYBA 5HX9A 3WS4A 2INWA 4BBTA 2XDMA 4WMCD 4UHUA 3D9YA 3E2LA 4KZ3A 4Z1WA 2K7SA 1KGGA 2OWHA 1AXBA 2Z2MB 4DMZA 1GA0A 2Y2KA 2PAVP 4IBRA 4G3KA 3EEAA 4II7A 4ZJ2A 4HESA 2VGJA 3G31A 2XA7S 4IUHA 1K0KA 2ZJ9A 1SDNA 1N9OA 4S2KA 4EERA 5AQBA 3AGDA 2V1BA 3HVFA 3PBRA 4GHIB
chains in the Genus database with same CATH topology
2XFTA 2Y2IA 5HW3A 1MKIA 5CGXA 4BENA 1GHIA 4WZ4A 5FQ9A 3HLEA 2XK1A 3N8SA 5FASA 1C3BA 3VSLA 4XUZA 1JTDA 4JF4A 4S2OA 1WYCA 4FH4A 1K57C 1YLZA 1K6RA 1CK3A 1CEGA 2Y59A 1ZG6A 1IYSA 4S2MA 5FA7A 3V5MA 5FI2A 4LCMA 3WS0A 2OV5A 3P98A 4KG6A 5FQKA 3UE1A 1MY8A 4Y7PA 3W4OA 3C4PA 4R3JA 4EBNA 3DW0A 4QJGA 1KE0A 3UNWA 1YLTA 3GV9A 5F1FA 1GHPA 1JTGA 3UY6A 1ALQA 4OVDA 1JWVA 1W79A 1L0FA 4OP8A 5DVAA 4LV3A 4BQMA 2PBYA 1E25A 3G34A 5GHZA 2XGNA 4LCLA 3UN7A 3PTEA 1TEMA 2C6WB 2XF3A 5FAQA 2HPBA 4YINA 2JBFA 4ZBEA 1I2WA 4BL3A 4EWFA 1KGFA 3NCKA 5HFOA 4BD0A 1EI5A 1PWDA 2XH9A 1Z6FA 2XD5A 3ITBA 5CERA 4FD8A 2ZD8A 5E2EA 3BFCA 1JWPA 2VGKA 4JXVA 2A3UA 4EBPA 3NBLA 3IXGA 1BLCA 1PI5A 4N92A 1SHVA 2WADA 2DNSA 1BLHA 3C7UA 3OPPA 4GKUA 2PU4A 5D3OA 1XGJA 4M3KA 4F94A 2HP5A 5CGWA 1HTZA 3IWOA 4JBFA 3GTCA 3BECA 3BFEA 3G2ZA 3IF6A 4BJPA 5EPHA 1XA1A 1H8ZA 1ZG4A 1QMEA 4K0XA 5E2HA 2JE5A 4UA9A 4L0LA 4ZDXA 4HEFA 2ZC4B 3P09A 4HBTA 2ZC7A 5A91A 3TSGA 2EFXA 3NDEA 2WKHA 3IXBA 1DY6A 5GHYA 4MBFA 3ZHHA 4WZ5C 2P9VB 4P0MA 3OCLA 4ZJ3A 3LY4A 1S0WA 3G30A 5GLBA 3V3RA 1ES2A 3DTMA 3DWZA 4GD8A 1ONHA 4CJNA 4K91A 4R1GA 1K4EA 3Q07A 1H5XA 3PBNA 3FZCA 1PI4A 2EX2A 2ZMAA 3D4FA 1K56A 2FFFB 2XEPA 3GMWA 3MXSA 1XP4A 3N4IA 4P6BA 3VOYA 1K57A 4XXRA 1CI9A 2WGWB 1BLPA 3LCEA 1O7EA 1FCOA 2V20A 2V2FF 3NDGA 1NXYA 1H8YA 2IWBA 3BEBA 4KZ6A 2RCXA 2XLNA 3UO9A 1TDGA 5TGFA 3UDXA 1K55C 4GNUA 1RCJA 3WS2A 4JF5A 5DF8A 1FR1A 2Y2LA 1XA7A 4OQGA 3PAGA 4U0XA 1QMFA 1L0DA 3GRJA 4WBGA 2Y55A 1I5QA 5CHMA 4PM5A 3NIAA 1BUEA 1YT4A 1DJCA 4KZ7A 4IBXA 4QY6A 2DRWA 4FCFA 3PBTA 4KZ8A 4X55A 3A3IA 4MNRA 4QB8A 5M1AA 4EQIA 4UA7A 4DXBA 3SOIA 3FV7A 5JYOA 4KENB 1DJAA 1GHMA 4IEDA 3GR2A 3S1YA 4ZTKA 2IWCA 1LLBA 3WRTA 3B3XA 3ZFZA 5F1GA 2Y2OA 5HL1A 3O87A 5JYPA 3EQUA 2WZXA 1PW8A 2EXBA 3IH8A 3BYDA 5M19A 3Q7VA 1IYPA 4R4SA 1MXOA 5CTMA 1KVLA 4GB7A 1G6AA 4GN2A 4DE3A 3VP1A 2ZC5B 4C3QA 3NI9A 4FH2A 2Y2NA 4GZBA 4NK3A 1Y54A 4N9KA 5CEBA 3VMAA 4P87A 4DRTA 4X69A 4RX2A 4R23A 1BSGA 4DE2A 3MZEA 2WKIA 5CEDA 4WELA 3IH9A 1BT5A 2I72A 3RXWA 1RGYA 3MKEA 3WRZA 4B4XA 3VP4A 4EV4A 4EUZA 2OLVA 3FKVA 4JPMA 4OPYA 2ZC3B 3MKFA 4WZ5A 5M18A 5FAPA 4KZ4A 2HDUA 1BTLA 1FSYA 5EECA 5DTTA 5EVIC 1FSWA 1TDLA 2XQZA 3OC2A 4Y0TA 3MZDA 1N9BA 1Q2QA 1MWUA 3FWLA 1W8QA 2ZQ8A 3IF6B 4KG2A 1L0GA 3TOIA 1YMXA 4DDSA 3HUOA 5F83A 5DF9A 3IQAA 2HDSA 4N1XA 4KZBA 4E3NA 2Q9MA 2WAFA 3CJMA 5HAIA 2Q9NA 3ZG8B 3O3VA 5F82A 5KMWA 1W8YA 3LEZA 3WS5A 1K55A 2IWDA 3HLGA 4JKTA 3W4QA 3ZVWA 4GDBA 5EOOA 3IWQA 3RJUA 3ZNTA 1IELA 4K0WA 1LHYA 4DKIA 3IXHA 3PBOA 3M6HA 1KDWA 2H10A 5FQMA 4QY5A 1PYYA 4JXSA 4Q8IA 1KVMA 4A5RA 3BFFA 2Y91A 1PW1A 1CI8A 2ZQAA 3W8KA 1HVBA 3GSGA 4UA6A 2WZZA 3ZG0A 4S2PA 3HUNA 4PM6A 1NY0A 1BULA 3HBRA 4QU3A 5EUAA 1NZUA 1ESUA 1MBLA 1I2SA 1RP5A 1NZOA 4ID4A 1O07A 5L2FA 1RGZA 1K38A 1VM1A 2XD1A 3RXXA 4E3KA 3MXRA 3BRMA 3MBZA 2ZLYA 3CZDA 3EQVA 3O88A 3M2KA 4IVIA 4RVAA 1OMEA 4OQHA 1GA9A 3HLWA 3Q82A 5GLCA 1MWRA 2QMIA 2UWXA 4R4RA 4E3IA 1WYBA 2GDNA 2A49A 2ZQDA 1PZPA 1SCWA 5EVLA 1IKIA 2XFSA 4YFMA 4PM8A 3VOZA 5CGSA 5E2FA 1LI0A 4QD4A 1KDSA 5FQQA 5FQJA 4GD6A 2XR0A 4B4ZA 4E3MA 3C4OA 1ESIA 3ZCZA 4OH0A 3V39A 4U0TA 3VFHA 3C5AA 3BLMA 3PBQA 1YMSA 5A93A 1FCMA 3Q7VB 2WUQA 3OPHA 4S2IA 5EVIA 5IHVA 1KE3A 3G4PA 1FOFA 2BLSA 3OPRA 4U3TA 1K54C 2C5WB 2H0TA 2WK0A 3N8RA 4KQOA 5A92A 1YM1A 1ERMA 4PPRA 5FDHA 5GLAA 3ZVTA 4OQIA 1K56D 3IT9A 3SS5A 2G2WA 5CRFA 4D2OA 3Q81A 2EXAA 2R9WA 2PU2A 1PWGA 3IF5A 3MFDA 3SH7A 5AQ7A 3BLSA 4MBKA 1YLJA 5CXWA 4ZAMA 4N9LA 4OONA 1IYOA 4DXCA 1W5DA 3UDFA 1IYQA 1IKGA 3HLCA 3VP0A 1FQGA 1XGIA 3BM6A 3WS1A 4MBHA 1BZAA 3ITAA 1M40A 5FATA 3AGEA 3W4PA 5EVID 1WE4A 5FSRA 1M6KA 3UE3A 2WGIA 3G32A 4E6XA 2FFYA 1FR6A 2OLUA 1K4FA 1ES4A 2J7VA 4UAAA 3ZNYA 3NY4A 4Z9QA 1Q2PA 1GCEA 3OZHA 4X56A 3OCNA 2Y2QA 5FQIA 4OOYA 2Y2MA 1MWTA 2J8YA 1FCNA 3ISGA 4OKPA 3M2JA 4P85A 1W7FA 4OP5A 5GHXA 5FI6A 2X02A 4OPQA 3HL9A 5FI7A 1ONGA 1LL5A 4KG5A 3E2KA 2JC7A 4O7DA 3PBSA 4N1HA 5CTNA 4LV2A 1E3UA 1NJ4A 3GQZA 1YQSA 4NETA 1HZOA 1J9MA 4S2LA 2QPNA 4JXGA 4OLGA 3UPNA 5GLDA 4B88A 3SH8A 2E8IA 3PAEA 5BOHA 1MPLA 2ZM2A 5J8XA 1E4DA 3BFGA 4KQQA 3QNCA 3IHAA 4EBLA 3SH9A 4GDNA 4DE0A 2HDRA 4S2NC 3VSKA 2BG1A 2H0YA 4E3LA 1ZKJA 4RYEA 3FYZA 2X71A 4KZAA 3C7VA 5EOEA 3WWXA 3UE0A 2RL3A 3LY3A 1L2SA 3G2YA 5CECA 3Q7ZA 4KQRA 4RA7A 4S2JA 5KZHA 1ZC2A 2EX9A 4H8RA 5TR7A 2J9PA 3I7JA 4OPZA 1YLPA 5HAPA 1DJBA 3S22A 3SS3A 5CHUA 1VQQA 4CPKA 2WGVA 4JXWA 4IVKA 4DE1A 3S4XA 1MWSA 5U47A 3A3DA 1EWZA 3N7WA 1K54A 1E3UD 4R3BA 5AQAA 1S6RA 5KSCA 4GOGA 4WM9A 3HREA 4JLFA 1PZOA 4BL2A 1XPBA 4QHCA 2H5SA 1XX2A 5DF7A 2X01A 4PMAA 4DF6A 1G68A 4DDYA 1L0EA 4Y0UA 2P74A 3A3EA 1KE4A 2EFUA 3O86A 5G18A 4ZJ1A 2JCHA 3GVBA 5FAOA 4BLMA 1BLSA 3IXDA 4C6YA 4E6WA 4FSFA 5E43A 4WMCA 1XXMA 5EE8A 4OLDA 1N4OA 3CMZA 3AGFA 3VP2A 1JWZA 4WYYA 2HP6A 2ZQ7A 3BFDA 4OOMA 3ZGAB 2ZQ9A 1NYYA 1K6SA 1U60A 2WYXA 5EVIB 5KSHA 4MEZA 3HLBA 3NC8A 2ZM8A 3HLFA 3DWKA 3IHBA 1ERQA 4R0QA 5DTSA 4OOLA 3TG9A 1SKFA 3QNBA 3UPPA 2OSUA 3A3JA 4KZ9A 2ZC6B 2R9XA 3UDIA 3UPOA 2HDQA 2Y2PA 1NYMA 2J9OA 4OPRA 4MLLA 3VFFA 1K25A 2Y2GA 1NRFA 5I94A 1SDEA 2ZQCA 1LI9A 1YLYA 3G35A 1IEMA 3N8LA 3HUMA 4Y0OA 4KZ5A 4XUXA 3V3SA 4E3OA 3V50A 3OPLA 4LENA 1EROA 2Y2JA 5HX9A 3ZDJA 4OQ0A 2Z2LB 3WS4A 4PM7A 5HARA 3CG5A 1XKZA 2XDMA 4WMCD 4UHUA 1JVJA 3IWIA 2P9VA 3QHYA 2V1ZA 2WKEA 4WEKA 3E2LA 4LV0A 3VP3A 2CC1A 2DCFA 5A90A 1LL9A 1HD8A 2WAEA 3A3FA 4KZ3A 3HLDA 1KGGA 2G2UA 3Q1FA 3MZFA 5HAQA 1AXBA 2Z2MB 1ES3A 1GA0A 3ZG7B 3M6BA 4WEJA 1KGEA 2Y2KA 4S2NA 2EX6A 1PWCA 4IBRA 3IF6C 4C75A 2Y2HA 4ZJ2A 1TVFA 3N6IA 4LV1A 5CHJA 4HESA 4JF6A 2WGWA 2VGJA 3G31A 2QZ6A 2ZJ9A 4E3JA 1SDNA 3SS4A 2B5RA 2Y4AA 3FKWA 5DTKA 4S2KA 4RX3A 5TFQA 1ES5A 1YLWA 3JYIA 2ZM0A 5E2GA 3ZG5A 4BD1A 5AQBA 4X68A 3LO7A 4PM9A 3AGDA 4X6TA 1PIOA 3ZG9B 2HP9A 5AQ9A 3HVFA 3PBRA 5GL9A 4X53A 4HBUA 2EX8A 1CEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFT A;  2Y2I A;  5HW3 A;  1MKI A;  5CGX A;  4BEN A;  1GHI A;  4WZ4 A;  5FQ9 A;  3HLE A;  2XK1 A;  3N8S A;  5FAS A;  1C3B A;  3VSL A;  4XUZ A;  1JTD A;  4JF4 A;  4S2O A;  1WYC A;  4FH4 A;  1K57 C;  1YLZ A;  1K6R A;  1CK3 A;  1CEG A;  2Y59 A;  1ZG6 A;  1IYS A;  4S2M A;  5FA7 A;  3V5M A;  5FI2 A;  4LCM A;  3WS0 A;  2OV5 A;  3P98 A;  4KG6 A;  5FQK A;  3UE1 A;  1MY8 A;  4Y7P A;  3W4O A;  3C4P A;  4R3J A;  4EBN A;  3DW0 A;  4QJG A;  1KE0 A;  3UNW A;  1YLT A;  3GV9 A;  5F1F A;  1GHP A;  1JTG A;  3UY6 A;  1ALQ A;  4OVD A;  1JWV A;  1W79 A;  1L0F A;  4OP8 A;  5DVA A;  4LV3 A;  4BQM A;  2PBY A;  1E25 A;  3G34 A;  5GHZ A;  2XGN A;  4LCL A;  3UN7 A;  3PTE A;  1TEM A;  2C6W B;  2XF3 A;  5FAQ A;  2HPB A;  4YIN A;  2JBF A;  4ZBE A;  1I2W A;  4BL3 A;  4EWF A;  1KGF A;  3NCK A;  5HFO A;  4BD0 A;  1EI5 A;  1PWD A;  2XH9 A;  1Z6F A;  2XD5 A;  3ITB A;  5CER A;  4FD8 A;  2ZD8 A;  5E2E A;  3BFC A;  1JWP A;  2VGK A;  4JXV A;  2A3U A;  4EBP A;  3NBL A;  3IXG A;  1BLC A;  1PI5 A;  4N92 A;  1SHV A;  2WAD A;  2DNS A;  1BLH A;  3C7U A;  3OPP A;  4GKU A;  2PU4 A;  5D3O A;  1XGJ A;  4M3K A;  4F94 A;  2HP5 A;  5CGW A;  1HTZ A;  3IWO A;  4JBF A;  3GTC A;  3BEC A;  3BFE A;  3G2Z A;  3IF6 A;  4BJP A;  5EPH A;  1XA1 A;  1H8Z A;  1ZG4 A;  1QME A;  4K0X A;  5E2H A;  2JE5 A;  4UA9 A;  4L0L A;  4ZDX A;  4HEF A;  2ZC4 B;  3P09 A;  4HBT A;  2ZC7 A;  5A91 A;  3TSG A;  2EFX A;  3NDE A;  2WKH A;  3IXB A;  1DY6 A;  5GHY A;  4MBF A;  3ZHH A;  4WZ5 C;  2P9V B;  4P0M A;  3OCL A;  4ZJ3 A;  3LY4 A;  1S0W A;  3G30 A;  5GLB A;  3V3R A;  1ES2 A;  3DTM A;  3DWZ A;  4GD8 A;  1ONH A;  4CJN A;  4K91 A;  4R1G A;  1K4E A;  3Q07 A;  1H5X A;  3PBN A;  3FZC A;  1PI4 A;  2EX2 A;  2ZMA A;  3D4F A;  1K56 A;  2FFF B;  2XEP A;  3GMW A;  3MXS A;  1XP4 A;  3N4I A;  4P6B A;  3VOY A;  1K57 A;  4XXR A;  1CI9 A;  2WGW B;  1BLP A;  3LCE A;  1O7E A;  1FCO A;  2V20 A;  2V2F F;  3NDG A;  1NXY A;  1H8Y A;  2IWB A;  3BEB A;  4KZ6 A;  2RCX A;  2XLN A;  3UO9 A;  1TDG A;  5TGF A;  3UDX A;  1K55 C;  4GNU A;  1RCJ A;  3WS2 A;  4JF5 A;  5DF8 A;  1FR1 A;  2Y2L A;  1XA7 A;  4OQG A;  3PAG A;  4U0X A;  1QMF A;  1L0D A;  3GRJ A;  4WBG A;  2Y55 A;  1I5Q A;  5CHM A;  4PM5 A;  3NIA A;  1BUE A;  1YT4 A;  1DJC A;  4KZ7 A;  4IBX A;  4QY6 A;  2DRW A;  4FCF A;  3PBT A;  4KZ8 A;  4X55 A;  3A3I A;  4MNR A;  4QB8 A;  5M1A A;  4EQI A;  4UA7 A;  4DXB A;  3SOI A;  3FV7 A;  5JYO A;  4KEN B;  1DJA A;  1GHM A;  4IED A;  3GR2 A;  3S1Y A;  4ZTK A;  2IWC A;  1LLB A;  3WRT A;  3B3X A;  3ZFZ A;  5F1G A;  2Y2O A;  5HL1 A;  3O87 A;  5JYP A;  3EQU A;  2WZX A;  1PW8 A;  2EXB A;  3IH8 A;  3BYD A;  5M19 A;  3Q7V A;  1IYP A;  4R4S A;  1MXO A;  5CTM A;  1KVL A;  4GB7 A;  1G6A A;  4GN2 A;  4DE3 A;  3VP1 A;  2ZC5 B;  4C3Q A;  3NI9 A;  4FH2 A;  2Y2N A;  4GZB A;  4NK3 A;  1Y54 A;  4N9K A;  5CEB A;  3VMA A;  4P87 A;  4DRT A;  4X69 A;  4RX2 A;  4R23 A;  1BSG A;  4DE2 A;  3MZE A;  2WKI A;  5CED A;  4WEL A;  3IH9 A;  1BT5 A;  2I72 A;  3RXW A;  1RGY A;  3MKE A;  3WRZ A;  4B4X A;  3VP4 A;  4EV4 A;  4EUZ A;  2OLV A;  3FKV A;  4JPM A;  4OPY A;  2ZC3 B;  3MKF A;  4WZ5 A;  5M18 A;  5FAP A;  4KZ4 A;  2HDU A;  1BTL A;  1FSY A;  5EEC A;  5DTT A;  5EVI C;  1FSW A;  1TDL A;  2XQZ A;  3OC2 A;  4Y0T A;  3MZD A;  1N9B A;  1Q2Q A;  1MWU A;  3FWL A;  1W8Q A;  2ZQ8 A;  3IF6 B;  4KG2 A;  1L0G A;  3TOI A;  1YMX A;  4DDS A;  3HUO A;  5F83 A;  5DF9 A;  3IQA A;  2HDS A;  4N1X A;  4KZB A;  4E3N A;  2Q9M A;  2WAF A;  3CJM A;  5HAI A;  2Q9N A;  3ZG8 B;  3O3V A;  5F82 A;  5KMW A;  1W8Y A;  3LEZ A;  3WS5 A;  1K55 A;  2IWD A;  3HLG A;  4JKT A;  3W4Q A;  3ZVW A;  4GDB A;  5EOO A;  3IWQ A;  3RJU A;  3ZNT A;  1IEL A;  4K0W A;  1LHY A;  4DKI A;  3IXH A;  3PBO A;  3M6H A;  1KDW A;  2H10 A;  5FQM A;  4QY5 A;  1PYY A;  4JXS A;  4Q8I A;  1KVM A;  4A5R A;  3BFF A;  2Y91 A;  1PW1 A;  1CI8 A;  2ZQA A;  3W8K A;  1HVB A;  3GSG A;  4UA6 A;  2WZZ A;  3ZG0 A;  4S2P A;  3HUN A;  4PM6 A;  1NY0 A;  1BUL A;  3HBR A;  4QU3 A;  5EUA A;  1NZU A;  1ESU A;  1MBL A;  1I2S A;  1RP5 A;  1NZO A;  4ID4 A;  1O07 A;  5L2F A;  1RGZ A;  1K38 A;  1VM1 A;  2XD1 A;  3RXX A;  4E3K A;  3MXR A;  3BRM A;  3MBZ A;  2ZLY A;  3CZD A;  3EQV A;  3O88 A;  3M2K A;  4IVI A;  4RVA A;  1OME A;  4OQH A;  1GA9 A;  3HLW A;  3Q82 A;  5GLC A;  1MWR A;  2QMI A;  2UWX A;  4R4R A;  4E3I A;  1WYB A;  2GDN A;  2A49 A;  2ZQD A;  1PZP A;  1SCW A;  5EVL A;  1IKI A;  2XFS A;  4YFM A;  4PM8 A;  3VOZ A;  5CGS A;  5E2F A;  1LI0 A;  4QD4 A;  1KDS A;  5FQQ A;  5FQJ A;  4GD6 A;  2XR0 A;  4B4Z A;  4E3M A;  3C4O A;  1ESI A;  3ZCZ A;  4OH0 A;  3V39 A;  4U0T A;  3VFH A;  3C5A A;  3BLM A;  3PBQ A;  1YMS A;  5A93 A;  1FCM A;  3Q7V B;  2WUQ A;  3OPH A;  4S2I A;  5EVI A;  5IHV A;  1KE3 A;  3G4P A;  1FOF A;  2BLS A;  3OPR A;  4U3T A;  1K54 C;  2C5W B;  2H0T A;  2WK0 A;  3N8R A;  4KQO A;  5A92 A;  1YM1 A;  1ERM A;  4PPR A;  5FDH A;  5GLA A;  3ZVT A;  4OQI A;  1K56 D;  3IT9 A;  3SS5 A;  2G2W A;  5CRF A;  4D2O A;  3Q81 A;  2EXA A;  2R9W A;  2PU2 A;  1PWG A;  3IF5 A;  3MFD A;  3SH7 A;  5AQ7 A;  3BLS A;  4MBK A;  1YLJ A;  5CXW A;  4ZAM A;  4N9L A;  4OON A;  1IYO A;  4DXC A;  1W5D A;  3UDF A;  1IYQ A;  1IKG A;  3HLC A;  3VP0 A;  1FQG A;  1XGI A;  3BM6 A;  3WS1 A;  4MBH A;  1BZA A;  3ITA A;  1M40 A;  5FAT A;  3AGE A;  3W4P A;  5EVI D;  1WE4 A;  5FSR A;  1M6K A;  3UE3 A;  2WGI A;  3G32 A;  4E6X A;  2FFY A;  1FR6 A;  2OLU A;  1K4F A;  1ES4 A;  2J7V A;  4UAA A;  3ZNY A;  3NY4 A;  4Z9Q A;  1Q2P A;  1GCE A;  3OZH A;  4X56 A;  3OCN A;  2Y2Q A;  5FQI A;  4OOY A;  2Y2M A;  1MWT A;  2J8Y A;  1FCN A;  3ISG A;  4OKP A;  3M2J A;  4P85 A;  1W7F A;  4OP5 A;  5GHX A;  5FI6 A;  2X02 A;  4OPQ A;  3HL9 A;  5FI7 A;  1ONG A;  1LL5 A;  4KG5 A;  3E2K A;  2JC7 A;  4O7D A;  3PBS A;  4N1H A;  5CTN A;  4LV2 A;  1E3U A;  1NJ4 A;  3GQZ A;  1YQS A;  4NET A;  1HZO A;  1J9M A;  4S2L A;  2QPN A;  4JXG A;  4OLG A;  3UPN A;  5GLD A;  4B88 A;  3SH8 A;  2E8I A;  3PAE A;  5BOH A;  1MPL A;  2ZM2 A;  5J8X A;  1E4D A;  3BFG A;  4KQQ A;  3QNC A;  3IHA A;  4EBL A;  3SH9 A;  4GDN A;  4DE0 A;  2HDR A;  4S2N C;  3VSK A;  2BG1 A;  2H0Y A;  4E3L A;  1ZKJ A;  4RYE A;  3FYZ A;  2X71 A;  4KZA A;  3C7V A;  5EOE A;  3WWX A;  3UE0 A;  2RL3 A;  3LY3 A;  1L2S A;  3G2Y A;  5CEC A;  3Q7Z A;  4KQR A;  4RA7 A;  4S2J A;  5KZH A;  1ZC2 A;  2EX9 A;  4H8R A;  5TR7 A;  2J9P A;  3I7J A;  4OPZ A;  1YLP A;  5HAP A;  1DJB A;  3S22 A;  3SS3 A;  5CHU A;  1VQQ A;  4CPK A;  2WGV A;  4JXW A;  4IVK A;  4DE1 A;  3S4X A;  1MWS A;  5U47 A;  3A3D A;  1EWZ A;  3N7W A;  1K54 A;  1E3U D;  4R3B A;  5AQA A;  1S6R A;  5KSC A;  4GOG A;  4WM9 A;  3HRE A;  4JLF A;  1PZO A;  4BL2 A;  1XPB A;  4QHC A;  2H5S A;  1XX2 A;  5DF7 A;  2X01 A;  4PMA A;  4DF6 A;  1G68 A;  4DDY A;  1L0E A;  4Y0U A;  2P74 A;  3A3E A;  1KE4 A;  2EFU A;  3O86 A;  5G18 A;  4ZJ1 A;  2JCH A;  3GVB A;  5FAO A;  4BLM A;  1BLS A;  3IXD A;  4C6Y A;  4E6W A;  4FSF A;  5E43 A;  4WMC A;  1XXM A;  5EE8 A;  4OLD A;  1N4O A;  3CMZ A;  3AGF A;  3VP2 A;  1JWZ A;  4WYY A;  2HP6 A;  2ZQ7 A;  3BFD A;  4OOM A;  3ZGA B;  2ZQ9 A;  1NYY A;  1K6S A;  1U60 A;  2WYX A;  5EVI B;  5KSH A;  4MEZ A;  3HLB A;  3NC8 A;  2ZM8 A;  3HLF A;  3DWK A;  3IHB A;  1ERQ A;  4R0Q A;  5DTS A;  4OOL A;  3TG9 A;  1SKF A;  3QNB A;  3UPP A;  2OSU A;  3A3J A;  4KZ9 A;  2ZC6 B;  2R9X A;  3UDI A;  3UPO A;  2HDQ A;  2Y2P A;  1NYM A;  2J9O A;  4OPR A;  4MLL A;  3VFF A;  1K25 A;  2Y2G A;  1NRF A;  5I94 A;  1SDE A;  2ZQC A;  1LI9 A;  1YLY A;  3G35 A;  1IEM A;  3N8L A;  3HUM A;  4Y0O A;  4KZ5 A;  4XUX A;  3V3S A;  4E3O A;  3V50 A;  3OPL A;  4LEN A;  1ERO A;  2Y2J A;  5HX9 A;  3ZDJ A;  4OQ0 A;  2Z2L B;  3WS4 A;  4PM7 A;  5HAR A;  3CG5 A;  1XKZ A;  2XDM A;  4WMC D;  4UHU A;  1JVJ A;  3IWI A;  2P9V A;  3QHY A;  2V1Z A;  2WKE A;  4WEK A;  3E2L A;  4LV0 A;  3VP3 A;  2CC1 A;  2DCF A;  5A90 A;  1LL9 A;  1HD8 A;  2WAE A;  3A3F A;  4KZ3 A;  3HLD A;  1KGG A;  2G2U A;  3Q1F A;  3MZF A;  5HAQ A;  1AXB A;  2Z2M B;  1ES3 A;  1GA0 A;  3ZG7 B;  3M6B A;  4WEJ A;  1KGE A;  2Y2K A;  4S2N A;  2EX6 A;  1PWC A;  4IBR A;  3IF6 C;  4C75 A;  2Y2H A;  4ZJ2 A;  1TVF A;  3N6I A;  4LV1 A;  5CHJ A;  4HES A;  4JF6 A;  2WGW A;  2VGJ A;  3G31 A;  2QZ6 A;  2ZJ9 A;  4E3J A;  1SDN A;  3SS4 A;  2B5R A;  2Y4A A;  3FKW A;  5DTK A;  4S2K A;  4RX3 A;  5TFQ A;  1ES5 A;  1YLW A;  3JYI A;  2ZM0 A;  5E2G A;  3ZG5 A;  4BD1 A;  5AQB A;  4X68 A;  3LO7 A;  4PM9 A;  3AGD A;  4X6T A;  1PIO A;  3ZG9 B;  2HP9 A;  5AQ9 A;  3HVF A;  3PBR A;  5GL9 A;  4X53 A;  4HBU A;  2EX8 A;  1CEF A; 
#chains in the Genus database with same CATH topology
 5HW3 A;  1GHI A;  4WZ4 A;  2EWW A;  1C3B A;  4JF4 A;  2O9B A;  3UB6 A;  2YKH A;  3LEQ A;  1WYC A;  1YLZ A;  1K6R A;  1CEG A;  1ZG6 A;  3V5M A;  4LCM A;  1FIK A;  1MY8 A;  4MMN A;  3C4P A;  4EBN A;  4GHI A;  1MKM A;  1JWV A;  1L0F A;  4LV3 A;  2PYP A;  2VV7 A;  2XGN A;  4LCL A;  3UN7 A;  3PTE A;  2KDK A;  2C6W B;  4PKY A;  4X25 A;  5DKL A;  3IX8 A;  1KGF A;  3NCK A;  3MSH A;  5CER A;  5DJU A;  1JWP A;  2VGK A;  3MMH A;  4H6J B;  3NUL A;  3KSG A;  3OPP A;  4GLQ A;  2PU4 A;  1XGJ A;  2HP5 A;  4LRX C;  4JBF A;  3GTC A;  3BEC A;  3NJA A;  3BFE A;  3G2Z A;  4ME4 A;  3IF6 A;  1ZG4 A;  4K0X A;  4L0L A;  3C8C A;  2ZC4 B;  3U4L P;  1OTA A;  3NDE A;  2WKH A;  2P7J A;  5GHY A;  3ZHH A;  4ZJ3 A;  4P0M A;  1S0W A;  1DP9 A;  2JKT M;  4GD8 A;  3DTM A;  2V8F A;  4HP9 A;  4NG2 A;  4R1G A;  2Q0O A;  3P01 A;  2D02 A;  3QP4 A;  3FZC A;  1PI4 A;  1S4S A;  2ZMA A;  5J3W A;  3MXS A;  3CIT A;  4P6B A;  1K57 A;  3UB7 A;  1Z09 A;  2WGW B;  2EA9 A;  4KZ6 A;  2XLN A;  3UO9 A;  4O01 A;  5TGF A;  4XT2 A;  1FR1 A;  2P04 A;  4U0X A;  3VV4 A;  1L0D A;  4K08 A;  1OJ5 A;  2Y55 A;  3NIA A;  5F5Y A;  1YT4 A;  4KZ7 A;  3QP8 A;  3PBT A;  1EW0 A;  4Y5F A;  1NLZ A;  4BBV A;  3A3I A;  3TJZ C;  4R6L A;  3BY8 A;  4EQI A;  4UA7 A;  4KEN B;  4IED A;  2YKF A;  1T1C A;  4ZTK A;  1LLB A;  1P9R A;  2W3H A;  5DKK A;  1XJ6 A;  3O87 A;  1VEU B;  2WZX A;  3FPV A;  1PW8 A;  1XJ4 A;  3Q7V A;  3KSI A;  1KVL A;  4C3Q A;  3NI9 A;  4FH2 A;  2J3T C;  4NK3 A;  1Y54 A;  1L3L A;  5HDS A;  4DRT A;  3KSH A;  2KLI A;  3R7W B;  5HPI A;  1BSG A;  2OAP 1;  2XA7 M;  3CUE A;  4HI4 A;  4WEL A;  1VEU A;  3VE4 A;  1BT5 A;  2I72 A;  4LRZ E;  3MKE A;  3VP4 A;  3FKV A;  4OPY A;  4L9F A;  2HDU A;  5EVI C;  2ZMV A;  4CLC A;  3R7W A;  4I3J A;  2ZQ8 A;  2ZL1 A;  3IQA A;  2PBD P;  4CLC E;  4MN5 A;  1XFQ A;  3ZG8 B;  1W8Y A;  1K55 A;  3HLG A;  4JKT A;  4GDB A;  2VA0 A;  1IEL A;  3PHY A;  3PBO A;  4CQH A;  3FC7 A;  1G6O A;  1CI8 A;  3H9W A;  1TF1 A;  2WZZ A;  3HUN A;  2L0W A;  1BUL A;  2VLG A;  4QU3 A;  1ESU A;  3ICY A;  1I2S A;  1NZO A;  3NHQ A;  1AWI A;  1RGZ A;  1VM1 A;  4L9E A;  3BRM A;  3MBZ A;  3EQV A;  4RVA A;  3HLW A;  2A24 B;  1WYB A;  2ZOH A;  3C2W A;  5CGS A;  5E2F A;  3L7H A;  4L9G A;  1ESI A;  3ZCZ A;  3V39 A;  1UWP X;  1YMS A;  1FCM A;  3OPH A;  1V9Z A;  2BLS A;  1NRJ A;  3LFV A;  4U3T A;  2WKQ A;  1YM1 A;  2J3T D;  4OQI A;  1K56 D;  3IT9 A;  3SW1 A;  3CPT A;  4D2O A;  3A0R A;  2R9W A;  3LIC A;  5AQ7 A;  3BLS A;  4MBK A;  4OON A;  4LRY C;  1OT6 A;  1ACF A;  4DXC A;  3HLC A;  2JKG A;  1XGI A;  1BZA A;  3LR0 A;  1OTE A;  3W4P A;  5EVI D;  3UE3 A;  4E6X A;  4EU0 A;  2OLU A;  3NY4 A;  4JGO A;  3NOP C;  3OZH A;  1MWT A;  1W7F A;  3HL9 A;  5FI7 A;  1LL5 A;  3U2A A;  4UEY A;  3PBS A;  3TE8 A;  5CTN A;  3K3D A;  3ZQ5 A;  3T1X A;  4B93 A;  3SH8 A;  5FDS A;  5J8X A;  4D60 A;  1DP6 A;  3VSK A;  1GSX A;  2H0Y A;  3C7V A;  2RL3 A;  3LI8 A;  5CEC A;  4H8R A;  4OPZ A;  2PDR A;  1YLP A;  2O9C A;  4JXW A;  5U47 A;  3N7W A;  1STZ A;  1S6R A;  2G7U A;  1S1Z A;  5KSC A;  5TJJ A;  1PZO A;  2PYR A;  4BL2 A;  3LR5 A;  2H5S A;  3UME A;  4DF6 A;  4DDY A;  1L0E A;  5A8B A;  4Y0U A;  2P74 A;  2EFU A;  4ZJ1 A;  3L9K A;  3IXD A;  4E6W A;  2W3G A;  1H0M A;  1XXM A;  4WYY A;  4OOM A;  1OTI A;  4JGQ A;  5KSH A;  3NC8 A;  3DWK A;  3TG9 A;  1ERQ A;  4OOL A;  3QNB A;  3H82 B;  3A3J A;  4KZ9 A;  2HDQ A;  1VHM A;  2J9O A;  3G35 A;  3N8L A;  3W2Z A;  4FUW A;  3V3S A;  4EW7 A;  3JVU A;  3ZDJ A;  3MQQ A;  3T1Q B;  2Z2L B;  5HAR A;  3NEC A;  3QHY A;  2WKE A;  3VP3 A;  3CLO A;  2CC1 A;  1HD8 A;  1G28 A;  3A3F A;  3HLD A;  1TD5 A;  3MZF A;  3M6B A;  4WEJ A;  1KGE A;  1PWC A;  2VZW A;  2JN7 A;  4I38 A;  4C75 A;  5L07 A;  3N6I A;  4LV1 A;  1YSP A;  1XJ2 A;  5DTK A;  2J3W A;  3LIF A;  4X68 A;  3DAV A;  4PM9 A;  4X6T A;  3OOV A;  3ZG9 B;  3D3O A;  5IT5 A;  1WA9 A;  1H8Z A;  2V1A A;  2XFT A;  5CGX A;  5FAS A;  3VSL A;  4ETZ A;  4XUZ A;  1JTD A;  2JKR I;  4FH4 A;  3JVV A;  5FA7 A;  2V0U A;  1F98 A;  3WS0 A;  1KE0 A;  4DJ2 A;  3F1P A;  5F1F A;  3UY6 A;  1ALQ A;  1W79 A;  5KIZ A;  1IOU A;  4OP8 A;  5DVA A;  4BQM A;  2PBY A;  1E25 A;  3G34 A;  4EEU A;  1TEM A;  1J3W A;  2XF3 A;  4YIN A;  2JBF A;  4ZBE A;  4EWF A;  4BD0 A;  3ITB A;  4EET B;  2A3U A;  3S7P A;  2PT7 A;  5CX7 A;  4N92 A;  2DNS A;  1BLH A;  4GKU A;  5HWT A;  1LSX A;  5J4E A;  2H28 A;  1HTZ A;  4MN7 A;  2M7V A;  5I5L A;  3T4L A;  4EXO A;  4ZDX A;  4HEF A;  1XJ3 A;  1ODV A;  2EFX A;  2Z6D A;  4MBF A;  4WZ5 C;  5J7E A;  5GLB A;  1X0O A;  1ONH A;  4F3L A;  5HWV A;  2EX2 A;  1K56 A;  2FFF B;  3N4I A;  1XP4 A;  5HWW A;  2W3E A;  3V67 A;  4E04 A;  1H8Y A;  2RCX A;  1W63 M;  1TDG A;  3UDX A;  3WS2 A;  5DF8 A;  2Y2L A;  3PAG A;  4YNR A;  1QMF A;  4WBG A;  3RTY A;  1I5Q A;  5CHM A;  1BUE A;  2QHK A;  4IBX A;  4QY6 A;  2DRW A;  1H3Q A;  2VJW A;  3UB9 A;  4KZ8 A;  3SOI A;  3FV7 A;  3S1Y A;  2FZ0 A;  3B3X A;  2Y2O A;  5HL1 A;  3EQU A;  2EXB A;  3BYD A;  4R4S A;  3E98 A;  4GB7 A;  4NEE D;  1G6A A;  4GS9 A;  5DJT A;  3CHW P;  1Y28 A;  2Y2N A;  4GZB A;  5CEB A;  4NXG A;  2QKP A;  4RX2 A;  5TBM A;  4JGR A;  3MZE A;  2O0Y A;  3VE3 A;  4EES A;  3MKF A;  3B42 A;  3CWF A;  1FSY A;  1FSW A;  2XQZ A;  2QJ5 A;  3IF6 B;  4HIA A;  2W1R A;  4I3A A;  5F83 A;  1MC0 A;  1IFQ A;  3S7N A;  4KZB A;  4NXE A;  3T50 A;  1LL8 A;  1D1J A;  3HJI A;  4IHQ A;  3WS5 A;  3ZVW A;  3W4Q A;  5EOO A;  3E4P A;  3ZNT A;  1KDW A;  4QY5 A;  1PYY A;  3DTK A;  1KVM A;  4A5R A;  4FTX A;  3W8K A;  3O5Y A;  3GSG A;  4UA6 A;  1CF0 A;  3PXP A;  1NY0 A;  2OOL A;  5EUA A;  2DMW A;  1RP5 A;  4ID4 A;  5L2F A;  2K31 A;  5AJG A;  4XT2 B;  3RXX A;  4E3K A;  3MXR A;  3M2K A;  1GA9 A;  3Q82 A;  2UWX A;  4R4R A;  2PHY A;  5FEF A;  2A49 A;  3BY9 A;  1PZP A;  3LGO A;  4YFM A;  4PM8 A;  2VKS A;  5HD3 A;  4E3M A;  3C4O A;  4U0T A;  3VFH A;  2GJ3 A;  3PBQ A;  3SZT A;  5A93 A;  3MQO A;  3Q7V B;  5IHV A;  5IU1 A;  2I9V A;  3G4P A;  5FL3 A;  3BWL A;  2Y79 A;  3T4Q A;  1LT0 A;  2H0T A;  2WK0 A;  4KQO A;  3T4O A;  4PPR A;  3SS5 A;  5CRF A;  3EGX C;  2PU2 A;  1PWG A;  3IF5 A;  3MFD A;  3SH7 A;  2ZOI A;  1YLJ A;  3C38 A;  1IYO A;  3MJQ A;  3WS1 A;  4MBH A;  2VV8 A;  3ITA A;  1WE4 A;  1M6K A;  4CLC B;  2FFY A;  1FR6 A;  2ZL1 B;  1ES4 A;  4Y3I A;  4Z9Q A;  1Q2P A;  1MZU A;  1YSQ A;  2HV1 A;  4P85 A;  3D72 A;  3KYZ A;  4OP5 A;  5FI6 A;  2HJ9 C;  1GSW A;  2MJ6 A;  4KG5 A;  3RXW A;  4LV2 A;  1E3U A;  3QP6 A;  4B88 A;  5G4Z A;  2E8I A;  3PAE A;  5BOH A;  4WUJ A;  2BTF P;  3QNC A;  4GDN A;  2HDR A;  3K2N A;  3LYX A;  1F2K A;  1T19 A;  4HHD A;  3UB8 A;  2B95 A;  1ZKJ A;  4IUK A;  2XRO A;  5AVF A;  3LY3 A;  3HJK A;  3G2Y A;  4S2J A;  2GX5 A;  2W1T A;  5HAP A;  5HD5 A;  1DJB A;  4EUV A;  5CHU A;  4I3I A;  3A3D A;  1EWZ A;  2JKF A;  1K54 A;  4R3B A;  4GOG A;  4WM9 A;  3HRE A;  4JLF A;  1XPB A;  4QHC A;  3LUQ A;  4PMA A;  4X1L A;  1G68 A;  2JCH A;  3GVB A;  4FSF A;  4WMC A;  2XSS A;  3AGF A;  1JWZ A;  3ZGA B;  2HP6 A;  2ZQ7 A;  1NYY A;  1K6S A;  3R4K A;  2ZM8 A;  3HLF A;  5DTS A;  3KO6 A;  1D06 A;  5G4Y A;  4MLL A;  1K25 A;  1LI9 A;  4HOI A;  1IEM A;  3CPT B;  1LSW A;  3HUM A;  5HL6 A;  4Y0O A;  3ULF A;  3OPL A;  4R38 A;  2Y2J A;  4OQ0 A;  2HF6 A;  3CG5 A;  3IWI A;  2P9V A;  2V1Z A;  4WEK A;  4G3V A;  1LL9 A;  2G2U A;  5HAQ A;  3KYE A;  1ES3 A;  3ZG7 B;  3EGD C;  4S2N A;  2EX6 A;  2M1C A;  3OBF A;  3LIB A;  3IF6 C;  4HJ3 A;  2Y2H A;  4E3J A;  2B5R A;  3FKW A;  1ES5 A;  1YLW A;  4BD1 A;  2ZM0 A;  4HY8 A;  2B02 A;  3CAX A;  1PIO A;  2HP9 A;  3OLO A;  5AQ9 A;  4R3A A;  3UMD A;  2Y2I A;  5MC7 A;  3FPW A;  3HLE A;  2XK1 A;  2W0N A;  4S2O A;  3JPU A;  1K57 C;  4ESP A;  1CK3 A;  1IYS A;  4S2M A;  2OV5 A;  3P98 A;  5FQK A;  3W4O A;  3UNW A;  3GV9 A;  2WKR A;  3IBJ A;  2WKP A;  4OVD A;  2PR6 A;  5FAQ A;  2HPB A;  1I2W A;  4BL3 A;  2XH9 A;  1Z6F A;  1SKO A;  3QP5 A;  2ZD8 A;  3KSF A;  1XFN A;  1BLC A;  1PI5 A;  1SHV A;  4HH3 A;  1YAX A;  5HSQ A;  4QWO A;  3LIA A;  4M3K A;  5CGW A;  3MS6 A;  2O99 A;  4MDZ A;  1XA1 A;  1QME A;  3MF0 A;  5E2H A;  4UA9 A;  5A91 A;  2ZC7 A;  3TSG A;  1DY6 A;  3OCL A;  2GZA A;  3G30 A;  1ES2 A;  2PR5 A;  3DWZ A;  4K91 A;  3QP2 A;  4GW9 A;  5HPF A;  4CLC C;  3PBN A;  3D4F A;  4HQA A;  3GMW A;  2XEP A;  3MXQ A;  3RH8 B;  1CI9 A;  3LCE A;  2V2F F;  1FCO A;  3NDG A;  2HZ5 A;  2IWB A;  3BEB A;  5IS1 A;  1K55 C;  4GNU A;  4JF5 A;  3F1O A;  1XA7 A;  4OQG A;  3DTE A;  4Y13 A;  1YKD A;  1DJC A;  1SZV A;  5M1A A;  5JYO A;  3RFB A;  1DJA A;  3ZFZ A;  3WRT A;  5EM1 A;  5F1G A;  2VGL M;  2EWV A;  5JYP A;  3F1P B;  1IYP A;  3VOL A;  3IX4 A;  5CTM A;  4GN2 A;  3VP1 A;  4N9K A;  3VMA A;  4P87 A;  4X69 A;  5AVE A;  1V9Y A;  4DE2 A;  2VEA A;  3A0S A;  4EQ1 A;  2WKI A;  3P7N A;  3IH9 A;  4AFI A;  4PKY G;  4P6Z M;  2LB5 A;  4EV4 A;  4GCZ A;  2OLV A;  3C30 A;  1ZHH B;  5FAP A;  4KZ4 A;  1BTL A;  5EEC A;  5DFY A;  1PFL A;  3OC2 A;  4Y0T A;  3MZD A;  4IJG A;  2JHE A;  1MWU A;  3FWL A;  1W8Q A;  1YMX A;  4I5S A;  5DF9 A;  1TS8 A;  2W3D A;  1G5U A;  2HDS A;  3EEH A;  4G3W A;  3LEZ A;  3RJU A;  3IWQ A;  1YPR A;  1NWZ A;  3EWK A;  4K0W A;  5EM0 A;  4F3L B;  2H10 A;  2PRF A;  4Q8I A;  2ZQA A;  4BWI A;  3ZYT A;  4CLC D;  1HVB A;  4S2P A;  2W3F A;  2V9A A;  1CQA A;  3HBR A;  1NZU A;  5C5K A;  3UE6 A;  4ARZ A;  1K38 A;  2XD1 A;  1OT9 A;  1F9I A;  4IVI A;  1OME A;  5L8M A;  1MWR A;  2JKT I;  3S7O A;  3T4T A;  1DRM A;  2GDN A;  3H7W A;  4MCW A;  5EVL A;  1LI0 A;  4QD4 A;  1HLU P;  1KDS A;  5FQQ A;  5FQJ A;  2B18 A;  2XR0 A;  4B4Z A;  1VET A;  4OH0 A;  3NOT C;  2OAQ 1;  3C5A A;  4LGW A;  3S7Q A;  5EVI A;  1KE3 A;  1FOF A;  1OTB A;  4GS9 B;  2AVX A;  1ERM A;  3IS2 A;  2G2W A;  3MFX A;  5TBM B;  2EXA A;  3T4J A;  1JNU A;  5CXW A;  4ZAM A;  4N9L A;  4WL9 A;  4PHT A;  3GDI A;  4WF0 A;  1IKG A;  4Y17 A;  3LR4 A;  2VV6 A;  3VP0 A;  1FQG A;  3BM6 A;  5FAT A;  2K2N A;  1M40 A;  2Z6C A;  1TS7 A;  5FSR A;  3LID A;  3G32 A;  2J7V A;  3ZNY A;  2JKR M;  4GJ4 A;  4ETX A;  2CMN A;  4OKP A;  3M2J A;  5GHX A;  4OPQ A;  2UV0 E;  3PYP A;  1P9W A;  4NXF A;  2JC7 A;  4O7D A;  1H8M A;  1NJ4 A;  1YQS A;  4NET A;  1HZO A;  1J9M A;  2QPN A;  4JXG A;  4OLG A;  4UQI M;  3UPN A;  5GLD A;  1MPL A;  1E4D A;  3MR0 A;  4KQQ A;  4EBL A;  3KYQ A;  1OPX A;  4WN5 A;  4E3L A;  2BG1 A;  4QPR A;  3FYZ A;  4KZA A;  3WWX A;  4RA7 A;  5KZH A;  1ZC2 A;  1ZTU A;  2J9P A;  1PNE A;  3T12 B;  2PD7 A;  1LSV A;  4DN0 A;  3SS3 A;  4CPK A;  2WGV A;  4IVK A;  4DE1 A;  1MWS A;  5F6A A;  5DFX A;  4KUK A;  4YWZ A;  4BLM A;  1KE4 A;  5G18 A;  2V0W A;  2FH5 A;  5FAO A;  2HJE A;  2R78 A;  3DTI A;  1N4O A;  3CMZ A;  1W63 Q;  3VP2 A;  2ZQ9 A;  4NKP A;  2WYX A;  4H6J A;  2QJ7 A;  4MEZ A;  3IHB A;  4R0Q A;  3T4K A;  1SKF A;  4LFU A;  3UPP A;  2OSU A;  3E0Y A;  2R9X A;  3UDI A;  2Y2P A;  1A0K A;  4OPR A;  3VFF A;  2Y2G A;  1NRF A;  2ZQC A;  1TS6 A;  2D01 A;  3V50 A;  1CJF A;  4PM7 A;  1XKZ A;  2LB9 A;  1JVJ A;  2ZMF A;  4LV0 A;  4LPZ A;  2DCF A;  5A90 A;  2WAE A;  3Q1F A;  1S67 L;  4EEP A;  4MN6 A;  3DBA A;  1TVF A;  4JF6 A;  2WGW A;  2QZ6 A;  2OWJ A;  3SS4 A;  2Y4A A;  4HJ4 A;  4RX3 A;  5TFQ A;  3JYI A;  5E2G A;  3ZG5 A;  4RQ9 A;  3NOU C;  3LO7 A;  5GL9 A;  4X53 A;  1N9L A;  4HBU A;  5CHJ A;  1CEF A;  2EX8 A;  2L1M A;  1MKI A;  4BEN A;  5FQ9 A;  3N8S A;  1TS0 A;  5EVE A;  4B9O A;  3CI6 A;  2Y59 A;  4BMW A;  5FI2 A;  4LLO B;  2W1T B;  4KG6 A;  2NUP C;  3UE1 A;  3LIE A;  4Y7P A;  4QJG A;  4R3J A;  3DW0 A;  1T18 A;  3B33 A;  1YLT A;  3T4S A;  2O9A A;  1GHP A;  1JTG A;  3E4O A;  5LBR A;  4YOF A;  2BAS A;  5GHZ A;  4Q0I A;  5HFO A;  5L10 A;  1EI5 A;  1PWD A;  2XD5 A;  4FD8 A;  5E2E A;  3BFC A;  4JXV A;  4Y2F A;  4EBP A;  3NBL A;  3IXG A;  3G6O A;  2WAD A;  3C7U A;  5D3O A;  1P0Z A;  3UB5 P;  4F94 A;  3IWO A;  2KOI A;  4BJP A;  5EPH A;  2JE5 A;  3F1N B;  3P09 A;  4HBT A;  3IXB A;  2P9V B;  3LY4 A;  3V3R A;  1GSV A;  1K4E A;  2E8J A;  2KX6 A;  3Q07 A;  1H5X A;  3F1N A;  4WLA A;  3VOY A;  4Q0H A;  4XXR A;  1BLP A;  2VGL S;  1O7E A;  2V20 A;  3LR3 A;  1NXY A;  1RCJ A;  2Y8H A;  3HCY A;  3GRJ A;  2A24 A;  3A0V A;  4PM5 A;  4FCF A;  3KX0 X;  4X55 A;  4MNR A;  4P6Z S;  1OTD A;  4QB8 A;  4DXB A;  3TRC A;  1F5M A;  1GHM A;  3GR2 A;  1D7E A;  3TW8 A;  2IWC A;  3IH8 A;  5M19 A;  2L4R A;  1MXO A;  3B47 A;  4DE3 A;  2ZC5 B;  3GEC A;  4O0P A;  2VX8 A;  1FIL A;  1DP8 A;  3EOI A;  4ZRR A;  4R23 A;  2V8C A;  3BQA A;  3BQ8 A;  1SKO B;  4PAU A;  5CED A;  1NLY A;  1RGY A;  3WRZ A;  4KQD A;  4B4X A;  4EUZ A;  2HGV A;  4JPM A;  2ZC3 B;  5M18 A;  4WZ5 A;  5DTT A;  3IX3 A;  1TDL A;  1N9B A;  1Q2Q A;  1L0G A;  4KG2 A;  3IBR A;  3TOI A;  1UGU A;  4DDS A;  3HUO A;  2A2L A;  4N1X A;  4E3N A;  2Q9M A;  2WAF A;  3CJM A;  2VK3 A;  2IA2 A;  5HAI A;  2Q9N A;  3O3V A;  5F82 A;  5KMW A;  2NUT C;  2IWD A;  1LHY A;  4DKI A;  3IXH A;  3M6H A;  5FQM A;  4JXS A;  4X1M A;  5K5B A;  3K3C A;  3BFF A;  2Y91 A;  1PW1 A;  4O8G A;  3CUE C;  3ZG0 A;  4PM6 A;  5HDD A;  3PR6 A;  1MBL A;  3BW6 A;  1O07 A;  4R70 A;  1S1Y A;  3F1O B;  3O88 A;  2ZLY A;  3CZD A;  4OQH A;  1T1B A;  3BJN A;  5GLC A;  2QMI A;  3MQ0 A;  3T1S A;  4E3I A;  2ZQD A;  5EFW A;  1SCW A;  1IKI A;  4HH2 A;  2XFS A;  3VOZ A;  4GD6 A;  2ACG A;  3LI9 A;  3BLM A;  2WUQ A;  4S2I A;  4Q0J A;  4JGP A;  3OPR A;  3H82 A;  1K54 C;  2C5W B;  4I39 A;  3N8R A;  5A92 A;  5FDH A;  5GLA A;  3ZVT A;  3E4Q A;  3Q81 A;  1VB6 A;  1KOU A;  5F68 A;  5HDC A;  1OJG A;  1S4R A;  1W5D A;  3UDF A;  1IYQ A;  5L09 A;  4UQI S;  3QP1 A;  3AGE A;  2WGI A;  1K4F A;  4UAA A;  5HZH A;  1GCE A;  4X56 A;  4DJ3 A;  4HP4 A;  3OCN A;  2Y2Q A;  5FQI A;  4OOY A;  1S66 L;  2Y2M A;  2J8Y A;  1FCN A;  3ISG A;  2X02 A;  1ONG A;  3E2K A;  4KUO A;  4N1H A;  4CJN A;  3GQZ A;  4S2L A;  5F69 A;  2J80 A;  2ZM2 A;  3BFG A;  2GNX A;  3IHA A;  3SH9 A;  4DE0 A;  5EV0 A;  4S2N C;  3FG8 A;  1UWN X;  4M4X A;  4NXB A;  4RYE A;  1Y4O A;  2X71 A;  5EOE A;  2PD8 A;  3UE0 A;  1L2S A;  3Q7Z A;  4KQR A;  4ARZ B;  2EX9 A;  5TR7 A;  3I7J A;  3T1R A;  3S22 A;  1VQQ A;  2W27 A;  4HNB A;  3S4X A;  1E3U D;  1PRQ A;  5AQA A;  3H7W B;  4BBU A;  5DF7 A;  1XX2 A;  2X01 A;  1T1A A;  1N9N A;  3A3E A;  3O86 A;  4C6Y A;  1VET B;  1BLS A;  2P08 A;  5E43 A;  2M7U A;  5EE8 A;  4OLD A;  3BFD A;  4FOF A;  1U60 A;  4HJ6 A;  1P97 A;  5EVI B;  1BYW A;  3HLB A;  4Y15 A;  5FEG A;  2ZC6 B;  3UPO A;  1NYM A;  5I94 A;  1SDE A;  3IS2 B;  1YLY A;  2QWS A;  2XRN A;  4KZ5 A;  4XUX A;  4E3O A;  2ZBB A;  4LEN A;  1ERO A;  2QYB A;  5HX9 A;  3WS4 A;  2INW A;  4BBT A;  2XDM A;  4WMC D;  4UHU A;  3D9Y A;  3E2L A;  4KZ3 A;  4Z1W A;  2K7S A;  1KGG A;  2OWH A;  1AXB A;  2Z2M B;  4DMZ A;  1GA0 A;  2Y2K A;  2PAV P;  4IBR A;  4G3K A;  3EEA A;  4II7 A;  4ZJ2 A;  4HES A;  2VGJ A;  3G31 A;  2XA7 S;  4IUH A;  1K0K A;  2ZJ9 A;  1SDN A;  1N9O A;  4S2K A;  4EER A;  5AQB A;  3AGD A;  2V1B A;  3HVF A;  3PBR A;  4GHI B; 
#chains in the Genus database with same CATH homology
 2XFT A;  2Y2I A;  5HW3 A;  1MKI A;  5CGX A;  4BEN A;  1GHI A;  4WZ4 A;  5FQ9 A;  3HLE A;  2XK1 A;  3N8S A;  5FAS A;  1C3B A;  3VSL A;  4XUZ A;  1JTD A;  4JF4 A;  4S2O A;  1WYC A;  4FH4 A;  1K57 C;  1YLZ A;  1K6R A;  1CK3 A;  1CEG A;  2Y59 A;  1ZG6 A;  1IYS A;  4S2M A;  5FA7 A;  3V5M A;  5FI2 A;  4LCM A;  3WS0 A;  2OV5 A;  3P98 A;  4KG6 A;  5FQK A;  3UE1 A;  1MY8 A;  4Y7P A;  3W4O A;  3C4P A;  4R3J A;  4EBN A;  3DW0 A;  4QJG A;  1KE0 A;  3UNW A;  1YLT A;  3GV9 A;  5F1F A;  1GHP A;  1JTG A;  3UY6 A;  1ALQ A;  4OVD A;  1JWV A;  1W79 A;  1L0F A;  4OP8 A;  5DVA A;  4LV3 A;  4BQM A;  2PBY A;  1E25 A;  3G34 A;  5GHZ A;  2XGN A;  4LCL A;  3UN7 A;  3PTE A;  1TEM A;  2C6W B;  2XF3 A;  5FAQ A;  2HPB A;  4YIN A;  2JBF A;  4ZBE A;  1I2W A;  4BL3 A;  4EWF A;  1KGF A;  3NCK A;  5HFO A;  4BD0 A;  1EI5 A;  1PWD A;  2XH9 A;  1Z6F A;  2XD5 A;  3ITB A;  5CER A;  4FD8 A;  2ZD8 A;  5E2E A;  3BFC A;  1JWP A;  2VGK A;  4JXV A;  2A3U A;  4EBP A;  3NBL A;  3IXG A;  1BLC A;  1PI5 A;  4N92 A;  1SHV A;  2WAD A;  2DNS A;  1BLH A;  3C7U A;  3OPP A;  4GKU A;  2PU4 A;  5D3O A;  1XGJ A;  4M3K A;  4F94 A;  2HP5 A;  5CGW A;  1HTZ A;  3IWO A;  4JBF A;  3GTC A;  3BEC A;  3BFE A;  3G2Z A;  3IF6 A;  4BJP A;  5EPH A;  1XA1 A;  1H8Z A;  1ZG4 A;  1QME A;  4K0X A;  5E2H A;  2JE5 A;  4UA9 A;  4L0L A;  4ZDX A;  4HEF A;  2ZC4 B;  3P09 A;  4HBT A;  2ZC7 A;  5A91 A;  3TSG A;  2EFX A;  3NDE A;  2WKH A;  3IXB A;  1DY6 A;  5GHY A;  4MBF A;  3ZHH A;  4WZ5 C;  2P9V B;  4P0M A;  3OCL A;  4ZJ3 A;  3LY4 A;  1S0W A;  3G30 A;  5GLB A;  3V3R A;  1ES2 A;  3DTM A;  3DWZ A;  4GD8 A;  1ONH A;  4CJN A;  4K91 A;  4R1G A;  1K4E A;  3Q07 A;  1H5X A;  3PBN A;  3FZC A;  1PI4 A;  2EX2 A;  2ZMA A;  3D4F A;  1K56 A;  2FFF B;  2XEP A;  3GMW A;  3MXS A;  1XP4 A;  3N4I A;  4P6B A;  3VOY A;  1K57 A;  4XXR A;  1CI9 A;  2WGW B;  1BLP A;  3LCE A;  1O7E A;  1FCO A;  2V20 A;  2V2F F;  3NDG A;  1NXY A;  1H8Y A;  2IWB A;  3BEB A;  4KZ6 A;  2RCX A;  2XLN A;  3UO9 A;  1TDG A;  5TGF A;  3UDX A;  1K55 C;  4GNU A;  1RCJ A;  3WS2 A;  4JF5 A;  5DF8 A;  1FR1 A;  2Y2L A;  1XA7 A;  4OQG A;  3PAG A;  4U0X A;  1QMF A;  1L0D A;  3GRJ A;  4WBG A;  2Y55 A;  1I5Q A;  5CHM A;  4PM5 A;  3NIA A;  1BUE A;  1YT4 A;  1DJC A;  4KZ7 A;  4IBX A;  4QY6 A;  2DRW A;  4FCF A;  3PBT A;  4KZ8 A;  4X55 A;  3A3I A;  4MNR A;  4QB8 A;  5M1A A;  4EQI A;  4UA7 A;  4DXB A;  3SOI A;  3FV7 A;  5JYO A;  4KEN B;  1DJA A;  1GHM A;  4IED A;  3GR2 A;  3S1Y A;  4ZTK A;  2IWC A;  1LLB A;  3WRT A;  3B3X A;  3ZFZ A;  5F1G A;  2Y2O A;  5HL1 A;  3O87 A;  5JYP A;  3EQU A;  2WZX A;  1PW8 A;  2EXB A;  3IH8 A;  3BYD A;  5M19 A;  3Q7V A;  1IYP A;  4R4S A;  1MXO A;  5CTM A;  1KVL A;  4GB7 A;  1G6A A;  4GN2 A;  4DE3 A;  3VP1 A;  2ZC5 B;  4C3Q A;  3NI9 A;  4FH2 A;  2Y2N A;  4GZB A;  4NK3 A;  1Y54 A;  4N9K A;  5CEB A;  3VMA A;  4P87 A;  4DRT A;  4X69 A;  4RX2 A;  4R23 A;  1BSG A;  4DE2 A;  3MZE A;  2WKI A;  5CED A;  4WEL A;  3IH9 A;  1BT5 A;  2I72 A;  3RXW A;  1RGY A;  3MKE A;  3WRZ A;  4B4X A;  3VP4 A;  4EV4 A;  4EUZ A;  2OLV A;  3FKV A;  4JPM A;  4OPY A;  2ZC3 B;  3MKF A;  4WZ5 A;  5M18 A;  5FAP A;  4KZ4 A;  2HDU A;  1BTL A;  1FSY A;  5EEC A;  5DTT A;  5EVI C;  1FSW A;  1TDL A;  2XQZ A;  3OC2 A;  4Y0T A;  3MZD A;  1N9B A;  1Q2Q A;  1MWU A;  3FWL A;  1W8Q A;  2ZQ8 A;  3IF6 B;  4KG2 A;  1L0G A;  3TOI A;  1YMX A;  4DDS A;  3HUO A;  5F83 A;  5DF9 A;  3IQA A;  2HDS A;  4N1X A;  4KZB A;  4E3N A;  2Q9M A;  2WAF A;  3CJM A;  5HAI A;  2Q9N A;  3ZG8 B;  3O3V A;  5F82 A;  5KMW A;  1W8Y A;  3LEZ A;  3WS5 A;  1K55 A;  2IWD A;  3HLG A;  4JKT A;  3W4Q A;  3ZVW A;  4GDB A;  5EOO A;  3IWQ A;  3RJU A;  3ZNT A;  1IEL A;  4K0W A;  1LHY A;  4DKI A;  3IXH A;  3PBO A;  3M6H A;  1KDW A;  2H10 A;  5FQM A;  4QY5 A;  1PYY A;  4JXS A;  4Q8I A;  1KVM A;  4A5R A;  3BFF A;  2Y91 A;  1PW1 A;  1CI8 A;  2ZQA A;  3W8K A;  1HVB A;  3GSG A;  4UA6 A;  2WZZ A;  3ZG0 A;  4S2P A;  3HUN A;  4PM6 A;  1NY0 A;  1BUL A;  3HBR A;  4QU3 A;  5EUA A;  1NZU A;  1ESU A;  1MBL A;  1I2S A;  1RP5 A;  1NZO A;  4ID4 A;  1O07 A;  5L2F A;  1RGZ A;  1K38 A;  1VM1 A;  2XD1 A;  3RXX A;  4E3K A;  3MXR A;  3BRM A;  3MBZ A;  2ZLY A;  3CZD A;  3EQV A;  3O88 A;  3M2K A;  4IVI A;  4RVA A;  1OME A;  4OQH A;  1GA9 A;  3HLW A;  3Q82 A;  5GLC A;  1MWR A;  2QMI A;  2UWX A;  4R4R A;  4E3I A;  1WYB A;  2GDN A;  2A49 A;  2ZQD A;  1PZP A;  1SCW A;  5EVL A;  1IKI A;  2XFS A;  4YFM A;  4PM8 A;  3VOZ A;  5CGS A;  5E2F A;  1LI0 A;  4QD4 A;  1KDS A;  5FQQ A;  5FQJ A;  4GD6 A;  2XR0 A;  4B4Z A;  4E3M A;  3C4O A;  1ESI A;  3ZCZ A;  4OH0 A;  3V39 A;  4U0T A;  3VFH A;  3C5A A;  3BLM A;  3PBQ A;  1YMS A;  5A93 A;  1FCM A;  3Q7V B;  2WUQ A;  3OPH A;  4S2I A;  5EVI A;  5IHV A;  1KE3 A;  3G4P A;  1FOF A;  2BLS A;  3OPR A;  4U3T A;  1K54 C;  2C5W B;  2H0T A;  2WK0 A;  3N8R A;  4KQO A;  5A92 A;  1YM1 A;  1ERM A;  4PPR A;  5FDH A;  5GLA A;  3ZVT A;  4OQI A;  1K56 D;  3IT9 A;  3SS5 A;  2G2W A;  5CRF A;  4D2O A;  3Q81 A;  2EXA A;  2R9W A;  2PU2 A;  1PWG A;  3IF5 A;  3MFD A;  3SH7 A;  5AQ7 A;  3BLS A;  4MBK A;  1YLJ A;  5CXW A;  4ZAM A;  4N9L A;  4OON A;  1IYO A;  4DXC A;  1W5D A;  3UDF A;  1IYQ A;  1IKG A;  3HLC A;  3VP0 A;  1FQG A;  1XGI A;  3BM6 A;  3WS1 A;  4MBH A;  1BZA A;  3ITA A;  1M40 A;  5FAT A;  3AGE A;  3W4P A;  5EVI D;  1WE4 A;  5FSR A;  1M6K A;  3UE3 A;  2WGI A;  3G32 A;  4E6X A;  2FFY A;  1FR6 A;  2OLU A;  1K4F A;  1ES4 A;  2J7V A;  4UAA A;  3ZNY A;  3NY4 A;  4Z9Q A;  1Q2P A;  1GCE A;  3OZH A;  4X56 A;  3OCN A;  2Y2Q A;  5FQI A;  4OOY A;  2Y2M A;  1MWT A;  2J8Y A;  1FCN A;  3ISG A;  4OKP A;  3M2J A;  4P85 A;  1W7F A;  4OP5 A;  5GHX A;  5FI6 A;  2X02 A;  4OPQ A;  3HL9 A;  5FI7 A;  1ONG A;  1LL5 A;  4KG5 A;  3E2K A;  2JC7 A;  4O7D A;  3PBS A;  4N1H A;  5CTN A;  4LV2 A;  1E3U A;  1NJ4 A;  3GQZ A;  1YQS A;  4NET A;  1HZO A;  1J9M A;  4S2L A;  2QPN A;  4JXG A;  4OLG A;  3UPN A;  5GLD A;  4B88 A;  3SH8 A;  2E8I A;  3PAE A;  5BOH A;  1MPL A;  2ZM2 A;  5J8X A;  1E4D A;  3BFG A;  4KQQ A;  3QNC A;  3IHA A;  4EBL A;  3SH9 A;  4GDN A;  4DE0 A;  2HDR A;  4S2N C;  3VSK A;  2BG1 A;  2H0Y A;  4E3L A;  1ZKJ A;  4RYE A;  3FYZ A;  2X71 A;  4KZA A;  3C7V A;  5EOE A;  3WWX A;  3UE0 A;  2RL3 A;  3LY3 A;  1L2S A;  3G2Y A;  5CEC A;  3Q7Z A;  4KQR A;  4RA7 A;  4S2J A;  5KZH A;  1ZC2 A;  2EX9 A;  4H8R A;  5TR7 A;  2J9P A;  3I7J A;  4OPZ A;  1YLP A;  5HAP A;  1DJB A;  3S22 A;  3SS3 A;  5CHU A;  1VQQ A;  4CPK A;  2WGV A;  4JXW A;  4IVK A;  4DE1 A;  3S4X A;  1MWS A;  5U47 A;  3A3D A;  1EWZ A;  3N7W A;  1K54 A;  1E3U D;  4R3B A;  5AQA A;  1S6R A;  5KSC A;  4GOG A;  4WM9 A;  3HRE A;  4JLF A;  1PZO A;  4BL2 A;  1XPB A;  4QHC A;  2H5S A;  1XX2 A;  5DF7 A;  2X01 A;  4PMA A;  4DF6 A;  1G68 A;  4DDY A;  1L0E A;  4Y0U A;  2P74 A;  3A3E A;  1KE4 A;  2EFU A;  3O86 A;  5G18 A;  4ZJ1 A;  2JCH A;  3GVB A;  5FAO A;  4BLM A;  1BLS A;  3IXD A;  4C6Y A;  4E6W A;  4FSF A;  5E43 A;  4WMC A;  1XXM A;  5EE8 A;  4OLD A;  1N4O A;  3CMZ A;  3AGF A;  3VP2 A;  1JWZ A;  4WYY A;  2HP6 A;  2ZQ7 A;  3BFD A;  4OOM A;  3ZGA B;  2ZQ9 A;  1NYY A;  1K6S A;  1U60 A;  2WYX A;  5EVI B;  5KSH A;  4MEZ A;  3HLB A;  3NC8 A;  2ZM8 A;  3HLF A;  3DWK A;  3IHB A;  1ERQ A;  4R0Q A;  5DTS A;  4OOL A;  3TG9 A;  1SKF A;  3QNB A;  3UPP A;  2OSU A;  3A3J A;  4KZ9 A;  2ZC6 B;  2R9X A;  3UDI A;  3UPO A;  2HDQ A;  2Y2P A;  1NYM A;  2J9O A;  4OPR A;  4MLL A;  3VFF A;  1K25 A;  2Y2G A;  1NRF A;  5I94 A;  1SDE A;  2ZQC A;  1LI9 A;  1YLY A;  3G35 A;  1IEM A;  3N8L A;  3HUM A;  4Y0O A;  4KZ5 A;  4XUX A;  3V3S A;  4E3O A;  3V50 A;  3OPL A;  4LEN A;  1ERO A;  2Y2J A;  5HX9 A;  3ZDJ A;  4OQ0 A;  2Z2L B;  3WS4 A;  4PM7 A;  5HAR A;  3CG5 A;  1XKZ A;  2XDM A;  4WMC D;  4UHU A;  1JVJ A;  3IWI A;  2P9V A;  3QHY A;  2V1Z A;  2WKE A;  4WEK A;  3E2L A;  4LV0 A;  3VP3 A;  2CC1 A;  2DCF A;  5A90 A;  1LL9 A;  1HD8 A;  2WAE A;  3A3F A;  4KZ3 A;  3HLD A;  1KGG A;  2G2U A;  3Q1F A;  3MZF A;  5HAQ A;  1AXB A;  2Z2M B;  1ES3 A;  1GA0 A;  3ZG7 B;  3M6B A;  4WEJ A;  1KGE A;  2Y2K A;  4S2N A;  2EX6 A;  1PWC A;  4IBR A;  3IF6 C;  4C75 A;  2Y2H A;  4ZJ2 A;  1TVF A;  3N6I A;  4LV1 A;  5CHJ A;  4HES A;  4JF6 A;  2WGW A;  2VGJ A;  3G31 A;  2QZ6 A;  2ZJ9 A;  4E3J A;  1SDN A;  3SS4 A;  2B5R A;  2Y4A A;  3FKW A;  5DTK A;  4S2K A;  4RX3 A;  5TFQ A;  1ES5 A;  1YLW A;  3JYI A;  2ZM0 A;  5E2G A;  3ZG5 A;  4BD1 A;  5AQB A;  4X68 A;  3LO7 A;  4PM9 A;  3AGD A;  4X6T A;  1PIO A;  3ZG9 B;  2HP9 A;  5AQ9 A;  3HVF A;  3PBR A;  5GL9 A;  4X53 A;  4HBU A;  2EX8 A;  1CEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...