3TG9A

The crystal structure of penicillin binding protein from bacillus halodurans
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
322
Chain Sequence
MKNHLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein
publication title The crystal structure of penicillin binding protein from Bacillus halodurans
rcsb
source organism Bacillus halodurans
molecule tags Penicillin binding protein
total genus 102
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3tg9A00
4MBHA 1MXOA 3N6IA 4K91A 4WEJA 1BLSA 1NZOA 3IF5A 1WE4A 3BEBA 3W8KA 3OPLA 2J9OA 5FSRA 3C7VA 3Q82A 3MBZA 4R23A 3ZG0A 3ZFZA 3NBLA 5FQMA 3NC8A 1XX2A 4MBKA 4BLMA 1K56A 1Q2PA 1S6RA 4BD0A 5U47A 3HVFA 5G18A 1U60A 3GV9A 1W5DA 2Y55A 3LEZA 2ZM8A 1ES5A 3SOIA 1FR6A 2Q9NA 2R9XA 4PM7A 3UE1A 1O7EA 1MWRA 5JYPA 4MEZA 3BRMA 3G35A 3ZVTA 5DF8A 3IWIA 4P6BA 3PTEA 4LENA 4GDNA 4B4ZA 1YT4A 1XGIA 1MPLA 3HLCA 4LV2A 3Q7VA 4PM8A 5DF9A 3IXHA 5E2FA 4KZBA 4KG5A 1SDEA 3OPRA 2RL3A 2ZQ9A 3OPPA 2Y2HA 4S2JA 4ZJ2A 2ZM0A 4OQIA 3WRZA 3UDFA 2WUQA 4O7DA 2XFTA 3Q1FA 5CHUA 2DCFA 2EX2A 5A91A 3A3FA 3G2ZA 4FH4A 1G6AA 3E2LA 3IXGA 2ZC4B 3VP2A 1Q2QA 2Y2PA 5M19A 3UNWA 2WGIA 3GRJA 2Y2JA 4QU3A 2P9VB 4OH0A 5JYOA 4Y0TA 2EX9A 3FWLA 3MZDA 2ZC3B 1W7FA 2B5RA 3ZGAB 5D3OA 1NJ4A 3V39A 1YLJA 4E3JA 5EUAA 1KGEA 1N9BA 4N92A 5AQBA 4UA9A 5CHJA 4X55A 1L0EA 5HW3A 3QHYA 1NXYA 3IT9A 5FATA 1ONHA 3OCLA 2Y4AA 3BFCA 4Y0OA 1RP5A 4X6TA 4PPRA 3ZG8B 4EWFA 5F82A 3QNBA 3VSKA 5GLBA 3IF6A 2WGWB 1KGGA 3AGEA 4U3TA 4N9KA 4R3JA 5FQKA 1BT5A 4WZ4A 1ERMA 1NRFA 1N4OA 1YMSA 1BLPA 4GNUA 5EPHA 3BFGA 2EFXA 3IXBA 2EX8A 3BYDA 5TR7A 1I5QA 3C7UA 4KZ6A 5L2FA 1GA9A 1XA7A 5FAPA 3IQAA 2ZQDA 4HBTA 1IEMA 4L0LA 4N9LA 3MKEA 4OVDA 5CGWA 3SS4A 4RA7A 1JWVA 3A3EA 1XXMA 5FI2A 2WK0A 1K54C 1FOFA 1CI8A 4B4XA 1K56D 2XR0A 1L0DA 1LL5A 4KQQA 5CGXA 5FQ9A 3WS0A 1MBLA 1K4FA 4KQOA 1PI4A 3PAEA 4WMCA 3WS4A 3VP3A 1OMEA 3UPPA 1AXBA 5DTSA 1M6KA 3NI9A 1CEGA 1K55A 3IXDA 3Q07A 3V3SA 4CPKA 4C75A 2XD1A 1VQQA 5CERA 4ZTKA 3P09A 1SHVA 1CI9A 3UE3A 4X56A 5BOHA 4R3BA 2FFYA 4BJPA 1J9MA 1TVFA 4E6XA 1ESIA 4B88A 4JXWA 4QD4A 3W4QA 4KZ7A 2Y2KA 1XP4A 3FKVA 4BL2A 4ID4A 5DTTA 3ZDJA 3UDXA 1NYMA 3RXWA 3MXRA 3GTCA 1HD8A 3CG5A 1CEFA 4JXVA 2BLSA 3SH9A 2JBFA 3WS5A 1E4DA 2EFUA 3C4PA 2GDNA 3Q7ZA 2EX6A 4OQ0A 5E2EA 2A3UA 4OPZA 2XH9A 1ZG4A 2P74A 5GLCA 3PBTA 3E2KA 1ZC2A 3Q7VB 3LO7A 3M6BA 1E3UA 4LV3A 5GLAA 1PWCA 2HDUA 2HP6A 1NZUA 3HLFA 2QPNA 3S1YA 3B3XA 2J8YA 4S2OA 4DE3A 4K0WA 2Z2LB 1ERQA 4JXGA 4U0XA 5AQAA 3AGFA 5FQJA 3IH8A 3IHAA 1MWTA 3VOZA 3DWKA 4E3KA 2WADA 2HDSA 4KG2A 1FCMA 4RX3A 3SH7A 4N1XA 1YLPA 4UA7A 4S2NA 1KE3A 5FAQA 2QZ6A 1FSWA 4X53A 1XKZA 4EV4A 4JXSA 4LV0A 2ZLYA 5A92A 1YQSA 5EVLA 1LL9A 1TDGA 3MZEA 3W4PA 1JWZA 1MWUA 1IYOA 5EECA 5FA7A 1YMXA 3SS3A 3BFFA 2XLNA 3OCNA 2Y2QA 2ZQ8A 3NCKA 4OPQA 3WS1A 3HLEA 5CHMA 4DRTA 4BD1A 1GHPA 5E2HA 4JF4A 5F1GA 2XQZA 4R0QA 4U0TA 4KG6A 1K38A 4X68A 3W4OA 3WWXA 1CK3A 1BLHA 5FQIA 3ZNYA 2Y59A 3PBRA 5HAPA 3VP4A 5HAQA 4WMCD 4S2LA 1LI9A 1QMFA 2X01A 2VGKA 1G68A 3P98A 1TEMA 3WRTA 3BLMA 3BFDA 4JKTA 5A90A 5KMWA 4ZJ3A 3UPOA 1LLBA 4HEFA 1W8QA 5HFOA 2ZMAA 5J8XA 3BM6A 3UE0A 1EWZA 5I94A 4E3NA 3G31A 4P87A 4OOLA 2WAFA 4PMAA 1WYBA 3ZNTA 3ZG5A 4M3KA 4EBPA 3OPHA 2Y2MA 2VGJA 4OP5A 5EVIA 4ZDXA 1M40A 3HL9A 2X02A 3HUMA 2G2WA 3ISGA 3WS2A 1FQGA 4ZAMA 2H10A 2XD5A 5FI6A 1PWDA 4FCFA 3Q81A 1ZG6A 3G30A 4XXRA 3NDEA 2HPBA 4Y0UA 4E3OA 2JC7A 3I7JA 4P0MA 1WYCA 1O07A 3LY3A 3MFDA 1K4EA 5EOEA 3FZCA 2DRWA 3DWZA 4GOGA 3PBSA 1E3UD 3LCEA 1ZKJA 1K6RA 2IWDA 1FSYA 2J7VA 2XDMA 4UAAA 1PW1A 2EXBA 2P9VA 3ZG7B 4IEDA 4KZ3A 5HX9A 4DF6A 2HDRA 4E6WA 3HUNA 1YM1A 3PAGA 4QB8A 2ZJ9A 4DDSA 2A49A 3CMZA 5HARA 3FYZA 4XUXA 4X69A 4CJNA 1PWGA 1K6SA 3ZVWA 5GHZA 1K57A 1W79A 2OLVA 3MKFA 4MLLA 3OZHA 3BFEA 5CEBA 2ZC6B 2WZZA 3M2KA 4C3QA 1IELA 1KE4A 3V5MA 1HZOA 2DNSA 2ZD8A 4OKPA 3TOIA 3NY4A 2PU4A 4JLFA 4DXCA 1JTGA 3FV7A 2WGWA 4QJGA 4UHUA 5FI7A 4DKIA 1IYPA 4GN2A 4PM9A 3GR2A 4R4SA 1BLCA 1FR1A 4WYYA 3DW0A 4N1HA 3M2JA 1BTLA 2BG1A 5EOOA 2C5WB 4WELA 3HREA 5KSHA 3BLSA 3FKWA 3N7WA 1NY0A 1ALQA 2XFSA 4NK3A 4F94A 2Z2MB 3N8SA 1SDNA 1YLTA 5CEDA 4HESA 4PM5A 4S2NC 2WZXA 5M18A 4DE2A 2Q9MA 3O88A 4DE1A 4FD8A 5M1AA 3VOYA 4WZ5A 3TG9A 4EUZA 4P85A 1TDLA 3ZHHA 2J9PA 4LCMA 1S0WA 4E3MA 3S22A 4ZJ1A 1JTDA 4S2MA 3VFFA 2H0YA 1HVBA 4OLGA 2OSUA 4GB7A 2WGVA 1GHMA 2WKEA 4S2KA 5EVID 1EROA 3HBRA 4QHCA 4OPYA 2Y91A 4EBLA 4E3LA 2V2FF 2E8IA 4GKUA 2XF3A 1IYQA 1GHIA 2G2UA 1I2WA 4BL3A 3IWQA 3BECA 2V1ZA 2OV5A 4H8RA 2PBYA 4OQGA 1KGFA 3V50A 1E25A 4FSFA 1H5XA 3QNCA 4IBXA 3GSGA 1DJAA 3LY4A 3NIAA 4IVKA 1JVJA 4C6YA 3V3RA 3JYIA 2PU2A 4KZ4A 4KZAA 1L0FA 2H5SA 1I2SA 5CRFA 5HL1A 4OPRA 4R1GA 3S4XA 4WEKA 3CJMA 4YINA 5AQ9A 1RGZA 4K0XA 3AGDA 2HP9A 3VP1A 3O86A 5EVIB 5A93A 3HLWA 5EVIC 3IF6B 3HLDA 4KZ9A 4OLDA 1MY8A 3IF6C 4R4RA 1XA1A 4LCLA 2HDQA 4LV1A 5FQQA 1SKFA 2EXAA 4WBGA 4XUZA 4MNRA 3IWOA 1Y54A 3ZCZA 2QMIA 4JPMA 1PZOA 3A3JA 4KZ8A 4S2PA 2WKIA 3MZFA 4EBNA 4E3IA 3OC2A 1ES3A 3EQVA 5TFQA 1XPBA 4OOYA 3CZDA 1EI5A 1KDWA 3PBQA 4OONA 3NDGA 1ESUA 1YLYA 2V20A 3UO9A 1GA0A 3HLGA 1MWSA 3VP0A 5CXWA 3VMAA 2XEPA 2WYXA 1BSGA 5GHYA 1KDSA 3GMWA 1NYYA 3HLBA 3A3IA 1JWPA 1MKIA 1DJCA 2Y2LA 5HAIA 1ES2A 4KZ5A 5TGFA 2R9WA 2ZC7A 1VM1A 3VSLA 1PW8A 1K57C 1K55C 4RX2A 2H0TA 5FAOA 3GVBA 5FDHA 5F1FA 1GCEA 4HBUA 1XGJA 5F83A 4Z9QA 1DY6A 4GD6A 4DXBA 1RGYA 4JBFA 1L2SA 2OLUA 4Y7PA 1HTZA 4QY5A 2WAEA 3ITAA 5CTMA 4OP8A 1L0GA 2FFFB 1K25A 3M6HA 5KZHA 1FCOA 1LHYA 2XGNA 2Y2OA 4IVIA 1Z6FA 4DE0A 4IBRA 3SS5A 3IHBA 2HP5A 3G34A 1SCWA 1W8YA 1H8ZA 1QMEA 3VFHA 1KE0A 5IHVA 4DDYA 3EQUA 1BULA 2XK1A 5DVAA 3RJUA 3G32A 1YLZA 2Y2NA 2CC1A 4GDBA 3A3DA 5DF7A 1KVLA 3DTMA 2RCXA 3PBOA 4KQRA 4UA6A 3N4IA 1ES4A 3IH9A 4A5RA 1IKIA 5GLDA 3G2YA 1BUEA 4BENA 1DJBA 3ITBA 5E2GA 1FCNA 3UY6A 1PI5A 3D4FA 3O87A 4WZ5C 4PM6A 3HUOA 5FASA 5E43A 2Y2IA 2I72A 4RVAA 1PIOA 2ZC5B 2IWCA 4NETA 4RYEA 3PBNA 5EE8A 4GZBA 2C6WB 2ZQ7A 1H8YA 2UWXA 4KENB 5DTKA 4MBFA 1KVMA 2IWBA 4GD8A 1LI0A 3UDIA 1C3BA 2ZQAA 5GL9A 1PYYA 4OQHA 3RXXA 1RCJA 1YLWA 2ZQCA 1K54A 3MXSA 4BQMA 4Q8IA 2JCHA 3C4OA 3G4PA 1BZAA 4JF6A 4YFMA 3TSGA 4S2IA 5AQ7A 3N8RA 1ONGA 3UN7A 4EQIA 3SH8A 3GQZA 1IKGA 2X71A 2ZM2A 4ZBEA 4D2OA 3O3VA 5CECA 1PZPA 4WM9A 1IYSA 4FH2A 3UPNA 3C5AA 5CTNA 5KSCA 5GHXA 2Y2GA 3N8LA 4JF5A 4OOMA 2WKHA 2JE5A 5CGSA 4QY6A 3ZG9B
chains in the Genus database with same CATH superfamily
4MBHA 3N6IA 5L09A 2VK3A 2KOIA 3S7QA 3NBLA 5TJJA 4BBUA 1S6RA 4BD0A 4NXGA 5G18A 1U60A 3GV9A 2Q9NA 1O7EA 5L07A 2Y8HA 4MEZA 3BRMA 3G35A 5DF8A 1DP9A 4LENA 2P7JA 1XGIA 3HLCA 4KZBA 4KG5A 2XRNA 1XJ4A 1SDEA 4F3LA 4BBVA 3UDFA 2WUQA 2DCFA 3A3FA 1G6AA 1Q2QA 3T1XA 2WGIA 2P9VB 4Y0TA 2EX9A 3FWLA 4NXFA 1YLJA 1PFLA 2V1AA 1KGEA 3C8CA 4CLCD 3R7WA 4LPZA 1NXYA 3IT9A 5HPIA 2Y4AA 1YSQA 4PPRA 1LT0A 3VSKA 4N9KA 3T4LA 4ETZA 4WZ4A 3K3DA 3LI9A 3BFGA 2GX5A 2EX8A 3BQ8A 4CLCC 1GA9A 3MFXA 3CITA 4L0LA 4OVDA 4RA7A 5FI2A 2OWJA 5CGXA 3WS4A 3VP3A 1AXBA 1YPRA 3NI9A 4HH2A 3EGXC 2L1MA 4X56A 4BJPA 1J9MA 2PT7A 4BL2A 4ID4A 3UDXA 1NYMA 1CEFA 1T18A 1VETB 3SH9A 1OJGA 2EWWA 3C4PA 4HP9A 2GDNA 1CF0A 2A3UA 2XH9A 3LO7A 3M6BA 4LV3A 4NXEA 2HP6A 2W3EA 2ZOHA 4DE3A 5FQJA 3B47A 3KSHA 4E3KA 5FAQA 4S2NA 4JXSA 4Q0JA 4LV0A 2ZLYA 1YQSA 1LL9A 3W4PA 1MWUA 5FA7A 3SS3A 3BFFA 2Y2QA 3NCKA 4OPQA 3WS1A 4R3AA 2V9AA 5E2HA 5DFXA 5F1GA 4AFIA 4U0TA 2KX6A 4X68A 4JGOA 3MF0A 3ZNYA 2Y59A 2GZAA 2W1TA 4LRXC 4H6JB 4HY8A 5KMWA 4ARZA 3KX0X 4GS9B 5J8XA 3VE3A 3G31A 2WAFA 4PMAA 2AVXA 3ZNTA 4EBPA 1M40A 3WS2A 1FQGA 2H10A 1LSWA 5FI6A 5HDCA 1ZG6A 2JKTM 3G30A 4Q0IA 2HPBA 4E3OA 4P0MA 2HV1A 3QP5A 3MFDA 1LSVA 3FZCA 2DRWA 4GOGA 1E3UD 3LCEA 2IWDA 4UAAA 4IEDA 4KZ3A 1GSVA 1YM1A 3NJAA 3CMZA 4XUXA 1K57A 3MKFA 5HWVA 5TBMB 3VOLA 5CEBA 2ZC6B 3M2KA 1IELA 5EM0A 3OLOA 3B42A 4QJGA 2WGWA 1IYPA 4PM9A 4R4SA 1BLCA 4WYYA 5EOOA 1TS7A 2C5WB 4WELA 3LIFA 1BYWA 2J3TD 4F94A 1YLTA 4PM5A 2WZXA 4DE1A 2Q9MA 3O88A 3T4OA 4P85A 1S0WA 3JVUA 3H82B 1JTDA 2H0YA 2WKEA 1GHMA 5J7EA 4S2KA 5EVID 1EROA 1VB6A 3IX3A 4QHCA 1YSPA 4EBLA 2J3TC 4GKUA 2G7UA 2PYPA 3S7NA 3IWQA 3P7NA 2PBYA 4HHDA 1N9LA 3V50A 4KUOA 1DJAA 3LY4A 3NECA 3NIAA 3V3RA 1OT9A 2O0YA 4KZAA 1L0FA 5HL1A 4R1GA 3S4XA 4WEKA 4YINA 4UQIM 4K0XA 4R70A 1YAXA 3O86A 5EVIC 3IF6B 3HLDA 4KZ9A 3E4PA 4YWZA 4R4RA 4LCLA 3IX8A 2HDQA 3MS6A 2W27A 5FQQA 4X1LA 4WBGA 1Y54A 4JPMA 1PZOA 4KZ8A 4S2PA 2MJ6A 1OTEA 2K7SA 1KDWA 1IOUA 3LEQA 3NDGA 1MWSA 3VMAA 2XEPA 3U4LP 5HPFA 3HLBA 1NLYA 1W63M 4QPRA 4KZ5A 5TGFA 1G5UA 3VSLA 1DP6A 1PW8A 1K55C 3O5YA 5FAOA 5FDHA 3LR4A 4HBUA 1DY6A 1RGYA 4FOFA 2PHYA 1HTZA 2WAEA 3ITAA 1L0GA 1LHYA 2HP5A 1V9ZA 1W8YA 1H8ZA 2Y2NA 4GDBA 5DF7A 1XJ3A 4UA6A 5HD5A 1ES4A 3IH9A 3G2YA 4BENA 3ITBA 3DBAA 4PM6A 5E43A 2Y2IA 3E4OA 1PIOA 5KIZA 4GZBA 4KENB 1TF1A 3UDIA 1PYYA 4OQHA 3CPTA 3MXSA 2W3DA 4WL9A 3EEHA 1BZAA 4I3IA 3SH8A 1OTBA 2ZM2A 4ZBEA 4D2OA 5G4ZA 1PZPA 4WM9A 4DN0A 2P04A 2OWHA 5CTNA 1SKOB 2YKFA 4OOMA 5FQMA 1MXOA 4K91A 3BEBA 3OPLA 2J9OA 1S1ZA 3Q82A 4R23A 3ZFZA 2V0WA 3LR5A 3NC8A 4LGWA 4BLMA 1K56A 1Q2PA 2VKSA 5U47A 5J4EA 1F98A 2W3FA 1W5DA 2Y55A 3SOIA 1ES5A 1FR6A 4LRYC 3H7WB 3VV4A 3NOTC 4O01A 3IWIA 4P6BA 4LLOB 4PM8A 3F1OA 5E2FA 3IXHA 2VGLM 5IU1A 2RL3A 2ZQ9A 3OPPA 4ZJ2A 5DKLA 2ZM0A 4IJGA 3FC7A 5A91A 3Q1FA 2KLIA 3E2LA 3FPVA 2Y2PA 3UNWA 4OH0A 3ZGAB 3MZDA 3LIBA 2B5RA 2B18A 1NJ4A 3V39A 1CJFA 3CUEC 3MXQA 4UA9A 5CHJA 4X55A 5HW3A 5FATA 3ZG8B 4EWFA 4EEPA 5GLBA 3MQ0A 3R4KA 2Q0OA 1KGGA 4U3TA 3IX4A 1HLUP 4R3JA 1BT5A 3QP6A 4HP4A 1ERMA 2EFXA 5EVEA 5C5KA 4LRZE 3F1PA 2ZQDA 2HJEA 4HBTA 4N9LA 1Y28A 3T1QB 4CQHA 1DP8A 2OAQ1 1FOFA 4B4XA 4KQQA 3WS0A 4ZRRA 2YKHA 1STZA 2HZ5A 1OMEA 3LIEA 2EWVA 1M6KA 1CEGA 4YNRA 1K55A 4CPKA 2XD1A 2O9CA 2GJ3A 1LL8A 1SHVA 2FFYA 1TVFA 1T1AA 3BJNA 1ESIA 4B88A 4JXWA 3W4QA 4KZ7A 1XP4A 3UB8A 3SW1A 3RXWA 3GTCA 3CG5A 3LYXA 2BLSA 2JBFA 3CHWP 4GLQA 2EFUA 4MCWA 3T4JA 4OQ0A 4OPZA 4EQ1A 5GLCA 3EWKA 3W2ZA 4MMNA 4M4XA 1PWCA 1S4RA 1NZUA 2QPNA 3RH8B 4HH3A 2ZL1A 3KYZA 2Z2LB 5AQAA 3IH8A 3LR3A 3IHAA 2XROA 2WADA 4KG2A 3UE6A 1FSWA 5EV0A 3IBJA 4Y15A 5EVLA 1EW0A 3R7WB 1D06A 1OTAA 4DRTA 4UEYA 4BD1A 4O0PA 1GHPA 5G4YA 4JF4A 1DRMA 4R0QA 4KG6A 3W4OA 1CK3A 1BLHA 5FQIA 1NLZA 5HAPA 5HAQA 4WMCD 2X01A 3WRTA 3BFDA 5A90A 1D1JA 1W8QA 1EWZA 4P87A 1WYBA 4M3KA 2ZMVA 3OPHA 3CWFA 2VGJA 3ICYA 2X02A 3HUMA 5LBRA 2I9VA 4X1MA 4ZAMA 2XD5A 1PWDA 3FG8A 4FCFA 2Y79A 4XXRA 3NDEA 1T1CA 4Y0UA 4Y3IA 3I7JA 1K4EA 4PHTA 2W3GA 3TJZC 2J7VA 4GCZA 1PW1A 2EXBA 2JHEA 2P9VA 3KYQA 4DF6A 3PAGA 3HCYA 3CUEA 4DDSA 5HARA 4X69A 3ZVWA 5GHZA 3OZHA 3BFEA 2WZZA 4GHIA 1V9YA 3MSHA 1P9RA 2JN7A 3CLOA 3L9KA 1JTGA 3MQOA 1XJ2A 3GR2A 3ULFA 2LB5A 1BTLA 4NKPA 5KSHA 3FKWA 3N7WA 1NY0A 1ALQA 1SDNA 4HESA 4NXBA 3S22A 4ZJ1A 2VJWA 4I5SA 4S2MA 3VFFA 1HVBA 3NOUC 2OSUA 1ODVA 2V2FF 2E8IA 2V1ZA 2OV5A 4H8RA 4WF0A 3QNCA 3G6OA 3GSGA 3JYIA 2PU2A 5CRFA 2HP9A 5A93A 3T12B 4K08A 3HJIA 3IF6C 4LV1A 4ME4A 4UQIS 4Y17A 1OT6A 1T19A 2WKIA 3MZFA 3CZDA 2L4RA 5CXWA 5HWTA 4Y5FA 3D9YA 1MKIA 2Y2LA 3QP8A 4ESPA 1VM1A 1D7EA 2H0TA 1GCEA 1TS8A 5F83A 4GD6A 4JBFA 1L2SA 4Y7PA 4HI4A 5KZHA 3M6HA 3KYEA 2XGNA 1Z6FA 4DE0A 4IBRA 2PDRA 3IHBA 4H6JA 2LB9A 3G34A 1KE0A 5IHVA 2XK1A 4GS9A 3A0SA 3A3DA 3PYPA 3PBOA 2RCXA 3N4IA 4A5RA 1IKIA 3KO6A 5HDDA 4HIAA 2H28A 1PI5A 3O87A 4WZ5C 3HUOA 2WKQA 3LI8A 3B33A 2IWCA 4NETA 4WLAA 5EE8A 1GSWA 4CLCA 3NOPC 5DTKA 4I3JA 3LFVA 2QWSA 2M7VA 4BQMA 4Q8IA 3TSGA 3F1NB 4S2IA 3N8RA 1ONGA 3K3CA 4EQIA 4HJ3A 3C5AA 4NG2A 2ZMFA 2Y2GA 4JF5A 2V20A 4QY6A 3ZG9B 1BLSA 2ZBBA 3DTIA 1WE4A 3IF5A 3W8KA 5FSRA 3MBZA 1H8MA 1XJ6A 2GNXA 1XX2A 4MBKA 2O99A 3A0VA 3HVFA 2ZM8A 4PM7A 3UE1A 4HNBA 1MWRA 3ZVTA 1IFQA 3PTEA 4B4ZA 1YT4A 4FUWA 1MPLA 2DMWA 4LV2A 3Q7VA 5I5LA 5DF9A 4S2JA 2Y2HA 2M1CA 3P01A 5AVFA 4O7DA 5EFWA 3G2ZA 4FH4A 2JKGA 2VGLS 3IXGA 5FEGA 4JGQA 2Y2JA 4QU3A 2Z6DA 4EU0A 1W7FA 3D72A 1CQAA 5D3OA 5AJGA 5EUAA 1S1YA 1N9BA 4N92A 2WKPA 2VLGA 1H3QA 3OCLA 1P9WA 3BFCA 4Y0OA 1RP5A 5FEFA 3IF6A 2VA0A 2O9BA 1FILA 2B95A 1YMSA 1BLPA 4GNUA 5EPHA 5IS1A 3C7UA 4KZ6A 5L2FA 1IEMA 3MKEA 3SS4A 1JWVA 1XXMA 3LIDA 1K54C 1G6OA 1CI8A 5FQ9A 1LL5A 2UV0E 4KQOA 1PI4A 3LICA 3UPPA 3T1RA 3EOIA 2VEAA 1VQQA 3RFBA 5CERA 1OJ5A 3P09A 2A24B 3UE3A 2XSSA 2ACGA 3IS2A 1UGUA 5L10A 4R3BA 4E6XA 4QD4A 3BY8A 2L0WA 2Y2KA 1KOUA 3FKVA 5DTTA 3VE4A 3OOVA 3MXRA 4JXVA 1N9OA 4L9GA 1VEUA 1VHMA 2EX6A 5E2EA 2K31A 3EEAA 2CMNA 1ZC2A 1E3UA 3F1OB 5GLAA 3HLFA 3B3XA 2J8YA 4II7A 4E04A 1ERQA 4U0XA 4BMWA 1MWTA 3VOZA 2HDSA 1FCMA 4RX3A 4P6ZM 3SH7A 4N1XA 5HWWA 2QZ6A 4X53A 1XKZA 4EV4A 1PRQA 1IYOA 5EECA 4EERA 1YMXA 4PKYA 2HJ9C 3OCNA 2ZQ8A 1TS6A 3HLEA 5CHMA 5EM1A 3BY9A 4JGRA 1K38A 3WWXA 3BQAA 3PBRA 3VP4A 3E4QA 1LI9A 2VGKA 1G68A 3P98A 3H9WA 2J3WA 5HSQA 3UB5P 3T50A 4ZJ3A 5FL3A 1LLBA 5HFOA 3BM6A 5I94A 2OAP1 4E3NA 3F1PB 4OOLA 3ZG5A 2INWA 2Y2MA 1MC0A 2V8FA 5HD3A 5EVIA 4ZDXA 2G2WA 3ISGA 3ZYTA 3K2NA 4O8GA 2A2LA 2HGVA 2FH5A 3DWZA 3PBSA 1K6RA 1FSYA 2HDRA 4E6WA 4QB8A 2ZJ9A 4MDZA 3FYZA 4QWOA 3PXPA 1PWGA 1K6SA 1W79A 2OLVA 3BW6A 3U2AA 3TW8A 2W0NA 3QP1A 4C3QA 3V5MA 1AWIA 1HZOA 2DNSA 2ZD8A 3NULA 4OKPA 2PU4A 2BASA 3ZQ5A 4JLFA 4DXCA 3FV7A 4DKIA 4Y2FA 2PR6A 4GN2A 4N1HA 3UB7A 2BG1A 4B93A 3UMEA 1P97A 3HREA 1T1BA 2XFSA 2Z2MB 5CEDA 3HJKA 4XT2A 4S2NC 2JKRM 5M18A 2IA2A 4FD8A 3TG9A 4DJ2A 1TDLA 3A0RA 2J9PA 3ZHHA 4LCMA 4F3LB 4OLGA 4GB7A 1XFQA 1Z09A 2XF3A 1IYQA 2XA7M 1GHIA 2G2UA 2NUPC 5DJUA 1E25A 4FSFA 1H5XA 4B9OA 4IVKA 1NRJA 4C6YA 2H5SA 3CJMA 3AGDA 3VP1A 4OLDA 1W63Q 1SKFA 2VV8A 2EXAA 1TD5A 3KSGA 4MNRA 2FZ0A 3ZCZA 3A3JA 4EBNA 3JPUA 5TFQA 1EI5A 2EA9A 3PBQA 1H0MA 3UO9A 1GA0A 3CAXA 5F69A 2JKFA 5GHYA 3GMWA 1NYYA 3A3IA 1JWPA 5HAIA 1ES2A 3SZTA 1MZUA 4YOFA 1K57C 5F1FA 3GVBA 1WA9A 4GHIB 4R38A 4Z9QA 5CX7A 4DXBA 2OLUA 4WN5A 2VV7A 2QJ7A 4I39A 5CTMA 4OP8A 3QP2A 1K25A 2Y2OA 5HL6A 3SS5A 2WKRA 1SCWA 4DDYA 5DVAA 3G32A 1YLZA 1X0OA 3DTMA 5L8MA 1BUEA 3E0YA 3D4FA 4MN7A 3GECA 2I72A 2ZQ7A 1KVMA 4HJ6A 4GD8A 2JKRI 1LI0A 5GL9A 4LFUA 2ZQCA 1UWNX 1MKMA 3G4PA 4JF6A 5DJTA 2QHKA 3GQZA 2X71A 3O3VA 2V8CA 5CECA 1IYSA 4IHQA 4FH2A 5HDSA 1YKDA 5KSCA 3N8LA 2PYRA 2OOLA 2JE5A 5CGSA 2Z6CA 4WEJA 1NZOA 2D01A 3C7VA 3ZG0A 2W1TB 5F5YA 4D60A 4ARZB 2QJ5A 3IBRA 1VETA 3LEZA 2R9XA 4EETB 5JYPA 2HF6A 4X25A 1FIKA 4GDNA 1K0KA 1TS0A 1XFNA 3OPRA 4Y13A 3CI6A 3DAVA 2B02A 4OQIA 3WRZA 5CHUA 2XFTA 2EX2A 2ZC4B 4KQDA 3VP2A 5M19A 3GRJA 2QYBA 5JYOA 2ZC3B 4E3JA 5AQBA 2V1BA 1ZTUA 1L0EA 1F5MA 3QHYA 1ONHA 4X6TA 5F82A 3S7PA 3QNBA 2W3HA 2WGWB 5AVEA 3AGEA 4KUKA 1P0ZA 5FQKA 1GSXA 1NRFA 1N4OA 1SZVA 3IXBA 4CLCB 3BYDA 1S4SA 5TR7A 1I5QA 1XA7A 5FAPA 3IQAA 5CGWA 3A3EA 2WK0A 4L9FA 3KSIA 3EGDC 4RQ9A 1K56D 2XR0A 1L0DA 1MBLA 1K4FA 4HOIA 3LGOA 3PAEA 4WMCA 5DTSA 3Q07A 3IXDA 4EUVA 3V3SA 4C75A 3L7HA 4ZTKA 1CI9A 4G3KA 5BOHA 3UB6A 3ZDJA 4CLCE 3C2WA 1LSXA 1HD8A 4EEUA 3WS5A 1E4DA 5DKKA 1F2KA 5TBMA 3Q7ZA 3BWLA 3UB9A 1ZG4A 2P74A 3PBTA 3E2KA 3Q7VB 2HDUA 3S1YA 4S2OA 4K0WA 4JXGA 3AGFA 2VV6A 3DWKA 1YLPA 2VX8A 4UA7A 1KE3A 1F9IA 3UMDA 5A92A 4HQAA 2BTFP 2ZOIA 1TDGA 3MZEA 1JWZA 4P6ZS 3F1NA 4G3WA 2XLNA 2M7UA 3H82A 3C38A 3LUQA 2XQZA 1S66L 5IT5A 5DFYA 3T4KA 3T4TA 4S2LA 5F68A 1QMFA 1TEMA 3BLMA 4JKTA 3UPOA 4HEFA 1A0KA 2PR5A 2ZMAA 3UE0A 4Q0HA 2D02A 4OP5A 3HL9A 3Q81A 2JKTI 4I3AA 3T1SA 2JC7A 1WYCA 1O07A 3LY3A 1PNEA 3MQQA 3D3OA 5EOEA 2QKPA 5J3WA 3IS2B 3CPTB 1ZKJA 2XDMA 3T4QA 3MJQA 3ZG7B 5HX9A 4BBTA 1OTDA 3HUNA 3DTEA 2A49A 4DJ3A 5HZHA 4CJNA 3TRCA 1VEUB 4MN6A 4MLLA 3C30A 1KE4A 3TOIA 3NY4A 3T4SA 4UHUA 5FI7A 4L9EA 1N9NA 1FR1A 3DW0A 3M2JA 4NEED 3BLSA 3FPWA 4IUHA 4NK3A 3N8SA 2W1RA 4DE2A 4PKYG 1L3LA 2PRFA 5M1AA 3VOYA 4WZ5A 4EUZA 4E3MA 2WGVA 5K5BA 3HBRA 4OPYA 2Y91A 2A24A 3DTKA 4E3LA 4Z1WA 1I2WA 4BL3A 3MMHA 3BECA 1Y4OA 4OQGA 1KGFA 4IBXA 3S7OA 4DMZA 1JVJA 2XA7S 3PHYA 2VZWA 4KZ4A 1I2SA 4OPRA 2R78A 5AQ9A 1RGZA 1SKOA 5EVIB 3HLWA 4JGPA 2O9AA 1MY8A 1XA1A 4WUJA 2PD7A 4XUZA 3IWOA 4I38A 2QMIA 4E3IA 3OC2A 5MC7A 1ES3A 3EQVA 1XPBA 2J80A 4OOYA 4OONA 2PBDP 3MR0A 1ESUA 1YLYA 3VP0A 3HLGA 3H7WA 2WYXA 2V0UA 4R6LA 1J3WA 1BSGA 3PR6A 1KDSA 1S67L 4EW7A 1DJCA 1G28A 4GJ4A 2R9WA 2PD8A 2ZC7A 4GW9A 3E98A 4RX2A 3JVVA 3KSFA 1XGJA 2KDKA 3RTYA 4EXOA 4QY5A 3GDIA 3TE8A 2FFFB 1FCOA 4IVIA 4BWIA 1ZHHB 4ETXA 3LIAA 1QMEA 3VFHA 2P08A 3EQUA 5FDSA 1BULA 3RJUA 2CC1A 1KVLA 4KQRA 4XT2B 1OPXA 5GLDA 4G3VA 4HJ4A 1DJBA 5E2GA 1FCNA 4FTXA 3UY6A 2ZL1B 5FASA 1ACFA 1OTIA 4EESA 4RVAA 2ZC5B 4RYEA 3PBNA 4PAUA 2C6WB 3QP4A 1NWZA 1H8YA 2UWXA 4MN5A 4MBFA 5F6AA 1UWPX 2IWBA 1C3BA 2ZQAA 3RXXA 1RCJA 1YLWA 3V67A 3NHQA 5A8BA 1K54A 3LR0A 2JCHA 3C4OA 4YFMA 5AQ7A 2E8JA 3OBFA 3UN7A 2NUTC 1IKGA 1JNUA 3UPNA 4IUKA 5GHXA 2PAVP 2WKHA 2K2NA
chains in the Genus database with same CATH topology
4MBHA 1MXOA 3N6IA 4K91A 4WEJA 1BLSA 1NZOA 3IF5A 1WE4A 3BEBA 3W8KA 3OPLA 2J9OA 5FSRA 3C7VA 3Q82A 3MBZA 4R23A 3ZG0A 3ZFZA 3NBLA 5FQMA 3NC8A 1XX2A 4MBKA 4BLMA 1K56A 1Q2PA 1S6RA 4BD0A 5U47A 3HVFA 5G18A 1U60A 3GV9A 1W5DA 2Y55A 3LEZA 2ZM8A 1ES5A 3SOIA 1FR6A 2Q9NA 2R9XA 4PM7A 3UE1A 1O7EA 1MWRA 5JYPA 4MEZA 3BRMA 3G35A 3ZVTA 5DF8A 3IWIA 4P6BA 3PTEA 4LENA 4GDNA 4B4ZA 1YT4A 1XGIA 1MPLA 3HLCA 4LV2A 3Q7VA 4PM8A 5DF9A 3IXHA 5E2FA 4KZBA 4KG5A 1SDEA 3OPRA 2RL3A 2ZQ9A 3OPPA 2Y2HA 4S2JA 4ZJ2A 2ZM0A 4OQIA 3WRZA 3UDFA 2WUQA 4O7DA 2XFTA 3Q1FA 5CHUA 2DCFA 2EX2A 5A91A 3A3FA 3G2ZA 4FH4A 1G6AA 3E2LA 3IXGA 2ZC4B 3VP2A 1Q2QA 2Y2PA 5M19A 3UNWA 2WGIA 3GRJA 2Y2JA 4QU3A 2P9VB 4OH0A 5JYOA 4Y0TA 2EX9A 3FWLA 3MZDA 2ZC3B 1W7FA 2B5RA 3ZGAB 5D3OA 1NJ4A 3V39A 1YLJA 4E3JA 5EUAA 1KGEA 1N9BA 4N92A 5AQBA 4UA9A 5CHJA 4X55A 1L0EA 5HW3A 3QHYA 1NXYA 3IT9A 5FATA 1ONHA 3OCLA 2Y4AA 3BFCA 4Y0OA 1RP5A 4X6TA 4PPRA 3ZG8B 4EWFA 5F82A 3QNBA 3VSKA 5GLBA 3IF6A 2WGWB 1KGGA 3AGEA 4U3TA 4N9KA 4R3JA 5FQKA 1BT5A 4WZ4A 1ERMA 1NRFA 1N4OA 1YMSA 1BLPA 4GNUA 5EPHA 3BFGA 2EFXA 3IXBA 2EX8A 3BYDA 5TR7A 1I5QA 3C7UA 4KZ6A 5L2FA 1GA9A 1XA7A 5FAPA 3IQAA 2ZQDA 4HBTA 1IEMA 4L0LA 4N9LA 3MKEA 4OVDA 5CGWA 3SS4A 4RA7A 1JWVA 3A3EA 1XXMA 5FI2A 2WK0A 1K54C 1FOFA 1CI8A 4B4XA 1K56D 2XR0A 1L0DA 1LL5A 4KQQA 5CGXA 5FQ9A 3WS0A 1MBLA 1K4FA 4KQOA 1PI4A 3PAEA 4WMCA 3WS4A 3VP3A 1OMEA 3UPPA 1AXBA 5DTSA 1M6KA 3NI9A 1CEGA 1K55A 3IXDA 3Q07A 3V3SA 4CPKA 4C75A 2XD1A 1VQQA 5CERA 4ZTKA 3P09A 1SHVA 1CI9A 3UE3A 4X56A 5BOHA 4R3BA 2FFYA 4BJPA 1J9MA 1TVFA 4E6XA 1ESIA 4B88A 4JXWA 4QD4A 3W4QA 4KZ7A 2Y2KA 1XP4A 3FKVA 4BL2A 4ID4A 5DTTA 3ZDJA 3UDXA 1NYMA 3RXWA 3MXRA 3GTCA 1HD8A 3CG5A 1CEFA 4JXVA 2BLSA 3SH9A 2JBFA 3WS5A 1E4DA 2EFUA 3C4PA 2GDNA 3Q7ZA 2EX6A 4OQ0A 5E2EA 2A3UA 4OPZA 2XH9A 1ZG4A 2P74A 5GLCA 3PBTA 3E2KA 1ZC2A 3Q7VB 3LO7A 3M6BA 1E3UA 4LV3A 5GLAA 1PWCA 2HDUA 2HP6A 1NZUA 3HLFA 2QPNA 3S1YA 3B3XA 2J8YA 4S2OA 4DE3A 4K0WA 2Z2LB 1ERQA 4JXGA 4U0XA 5AQAA 3AGFA 5FQJA 3IH8A 3IHAA 1MWTA 3VOZA 3DWKA 4E3KA 2WADA 2HDSA 4KG2A 1FCMA 4RX3A 3SH7A 4N1XA 1YLPA 4UA7A 4S2NA 1KE3A 5FAQA 2QZ6A 1FSWA 4X53A 1XKZA 4EV4A 4JXSA 4LV0A 2ZLYA 5A92A 1YQSA 5EVLA 1LL9A 1TDGA 3MZEA 3W4PA 1JWZA 1MWUA 1IYOA 5EECA 5FA7A 1YMXA 3SS3A 3BFFA 2XLNA 3OCNA 2Y2QA 2ZQ8A 3NCKA 4OPQA 3WS1A 3HLEA 5CHMA 4DRTA 4BD1A 1GHPA 5E2HA 4JF4A 5F1GA 2XQZA 4R0QA 4U0TA 4KG6A 1K38A 4X68A 3W4OA 3WWXA 1CK3A 1BLHA 5FQIA 3ZNYA 2Y59A 3PBRA 5HAPA 3VP4A 5HAQA 4WMCD 4S2LA 1LI9A 1QMFA 2X01A 2VGKA 1G68A 3P98A 1TEMA 3WRTA 3BLMA 3BFDA 4JKTA 5A90A 5KMWA 4ZJ3A 3UPOA 1LLBA 4HEFA 1W8QA 5HFOA 2ZMAA 5J8XA 3BM6A 3UE0A 1EWZA 5I94A 4E3NA 3G31A 4P87A 4OOLA 2WAFA 4PMAA 1WYBA 3ZNTA 3ZG5A 4M3KA 4EBPA 3OPHA 2Y2MA 2VGJA 4OP5A 5EVIA 4ZDXA 1M40A 3HL9A 2X02A 3HUMA 2G2WA 3ISGA 3WS2A 1FQGA 4ZAMA 2H10A 2XD5A 5FI6A 1PWDA 4FCFA 3Q81A 1ZG6A 3G30A 4XXRA 3NDEA 2HPBA 4Y0UA 4E3OA 2JC7A 3I7JA 4P0MA 1WYCA 1O07A 3LY3A 3MFDA 1K4EA 5EOEA 3FZCA 2DRWA 3DWZA 4GOGA 3PBSA 1E3UD 3LCEA 1ZKJA 1K6RA 2IWDA 1FSYA 2J7VA 2XDMA 4UAAA 1PW1A 2EXBA 2P9VA 3ZG7B 4IEDA 4KZ3A 5HX9A 4DF6A 2HDRA 4E6WA 3HUNA 1YM1A 3PAGA 4QB8A 2ZJ9A 4DDSA 2A49A 3CMZA 5HARA 3FYZA 4XUXA 4X69A 4CJNA 1PWGA 1K6SA 3ZVWA 5GHZA 1K57A 1W79A 2OLVA 3MKFA 4MLLA 3OZHA 3BFEA 5CEBA 2ZC6B 2WZZA 3M2KA 4C3QA 1IELA 1KE4A 3V5MA 1HZOA 2DNSA 2ZD8A 4OKPA 3TOIA 3NY4A 2PU4A 4JLFA 4DXCA 1JTGA 3FV7A 2WGWA 4QJGA 4UHUA 5FI7A 4DKIA 1IYPA 4GN2A 4PM9A 3GR2A 4R4SA 1BLCA 1FR1A 4WYYA 3DW0A 4N1HA 3M2JA 1BTLA 2BG1A 5EOOA 2C5WB 4WELA 3HREA 5KSHA 3BLSA 3FKWA 3N7WA 1NY0A 1ALQA 2XFSA 4NK3A 4F94A 2Z2MB 3N8SA 1SDNA 1YLTA 5CEDA 4HESA 4PM5A 4S2NC 2WZXA 5M18A 4DE2A 2Q9MA 3O88A 4DE1A 4FD8A 5M1AA 3VOYA 4WZ5A 3TG9A 4EUZA 4P85A 1TDLA 3ZHHA 2J9PA 4LCMA 1S0WA 4E3MA 3S22A 4ZJ1A 1JTDA 4S2MA 3VFFA 2H0YA 1HVBA 4OLGA 2OSUA 4GB7A 2WGVA 1GHMA 2WKEA 4S2KA 5EVID 1EROA 3HBRA 4QHCA 4OPYA 2Y91A 4EBLA 4E3LA 2V2FF 2E8IA 4GKUA 2XF3A 1IYQA 1GHIA 2G2UA 1I2WA 4BL3A 3IWQA 3BECA 2V1ZA 2OV5A 4H8RA 2PBYA 4OQGA 1KGFA 3V50A 1E25A 4FSFA 1H5XA 3QNCA 4IBXA 3GSGA 1DJAA 3LY4A 3NIAA 4IVKA 1JVJA 4C6YA 3V3RA 3JYIA 2PU2A 4KZ4A 4KZAA 1L0FA 2H5SA 1I2SA 5CRFA 5HL1A 4OPRA 4R1GA 3S4XA 4WEKA 3CJMA 4YINA 5AQ9A 1RGZA 4K0XA 3AGDA 2HP9A 3VP1A 3O86A 5EVIB 5A93A 3HLWA 5EVIC 3IF6B 3HLDA 4KZ9A 4OLDA 1MY8A 3IF6C 4R4RA 1XA1A 4LCLA 2HDQA 4LV1A 5FQQA 1SKFA 2EXAA 4WBGA 4XUZA 4MNRA 3IWOA 1Y54A 3ZCZA 2QMIA 4JPMA 1PZOA 3A3JA 4KZ8A 4S2PA 2WKIA 3MZFA 4EBNA 4E3IA 3OC2A 1ES3A 3EQVA 5TFQA 1XPBA 4OOYA 3CZDA 1EI5A 1KDWA 3PBQA 4OONA 3NDGA 1ESUA 1YLYA 2V20A 3UO9A 1GA0A 3HLGA 1MWSA 3VP0A 5CXWA 3VMAA 2XEPA 2WYXA 1BSGA 5GHYA 1KDSA 3GMWA 1NYYA 3HLBA 3A3IA 1JWPA 1MKIA 1DJCA 2Y2LA 5HAIA 1ES2A 4KZ5A 5TGFA 2R9WA 2ZC7A 1VM1A 3VSLA 1PW8A 1K57C 1K55C 4RX2A 2H0TA 5FAOA 3GVBA 5FDHA 5F1FA 1GCEA 4HBUA 1XGJA 5F83A 4Z9QA 1DY6A 4GD6A 4DXBA 1RGYA 4JBFA 1L2SA 2OLUA 4Y7PA 1HTZA 4QY5A 2WAEA 3ITAA 5CTMA 4OP8A 1L0GA 2FFFB 1K25A 3M6HA 5KZHA 1FCOA 1LHYA 2XGNA 2Y2OA 4IVIA 1Z6FA 4DE0A 4IBRA 3SS5A 3IHBA 2HP5A 3G34A 1SCWA 1W8YA 1H8ZA 1QMEA 3VFHA 1KE0A 5IHVA 4DDYA 3EQUA 1BULA 2XK1A 5DVAA 3RJUA 3G32A 1YLZA 2Y2NA 2CC1A 4GDBA 3A3DA 5DF7A 1KVLA 3DTMA 2RCXA 3PBOA 4KQRA 4UA6A 3N4IA 1ES4A 3IH9A 4A5RA 1IKIA 5GLDA 3G2YA 1BUEA 4BENA 1DJBA 3ITBA 5E2GA 1FCNA 3UY6A 1PI5A 3D4FA 3O87A 4WZ5C 4PM6A 3HUOA 5FASA 5E43A 2Y2IA 2I72A 4RVAA 1PIOA 2ZC5B 2IWCA 4NETA 4RYEA 3PBNA 5EE8A 4GZBA 2C6WB 2ZQ7A 1H8YA 2UWXA 4KENB 5DTKA 4MBFA 1KVMA 2IWBA 4GD8A 1LI0A 3UDIA 1C3BA 2ZQAA 5GL9A 1PYYA 4OQHA 3RXXA 1RCJA 1YLWA 2ZQCA 1K54A 3MXSA 4BQMA 4Q8IA 2JCHA 3C4OA 3G4PA 1BZAA 4JF6A 4YFMA 3TSGA 4S2IA 5AQ7A 3N8RA 1ONGA 3UN7A 4EQIA 3SH8A 3GQZA 1IKGA 2X71A 2ZM2A 4ZBEA 4D2OA 3O3VA 5CECA 1PZPA 4WM9A 1IYSA 4FH2A 3UPNA 3C5AA 5CTNA 5KSCA 5GHXA 2Y2GA 3N8LA 4JF5A 4OOMA 2WKHA 2JE5A 5CGSA 4QY6A 3ZG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBH A;  1MXO A;  3N6I A;  4K91 A;  4WEJ A;  1BLS A;  1NZO A;  3IF5 A;  1WE4 A;  3BEB A;  3W8K A;  3OPL A;  2J9O A;  5FSR A;  3C7V A;  3Q82 A;  3MBZ A;  4R23 A;  3ZG0 A;  3ZFZ A;  3NBL A;  5FQM A;  3NC8 A;  1XX2 A;  4MBK A;  4BLM A;  1K56 A;  1Q2P A;  1S6R A;  4BD0 A;  5U47 A;  3HVF A;  5G18 A;  1U60 A;  3GV9 A;  1W5D A;  2Y55 A;  3LEZ A;  2ZM8 A;  1ES5 A;  3SOI A;  1FR6 A;  2Q9N A;  2R9X A;  4PM7 A;  3UE1 A;  1O7E A;  1MWR A;  5JYP A;  4MEZ A;  3BRM A;  3G35 A;  3ZVT A;  5DF8 A;  3IWI A;  4P6B A;  3PTE A;  4LEN A;  4GDN A;  4B4Z A;  1YT4 A;  1XGI A;  1MPL A;  3HLC A;  4LV2 A;  3Q7V A;  4PM8 A;  5DF9 A;  3IXH A;  5E2F A;  4KZB A;  4KG5 A;  1SDE A;  3OPR A;  2RL3 A;  2ZQ9 A;  3OPP A;  2Y2H A;  4S2J A;  4ZJ2 A;  2ZM0 A;  4OQI A;  3WRZ A;  3UDF A;  2WUQ A;  4O7D A;  2XFT A;  3Q1F A;  5CHU A;  2DCF A;  2EX2 A;  5A91 A;  3A3F A;  3G2Z A;  4FH4 A;  1G6A A;  3E2L A;  3IXG A;  2ZC4 B;  3VP2 A;  1Q2Q A;  2Y2P A;  5M19 A;  3UNW A;  2WGI A;  3GRJ A;  2Y2J A;  4QU3 A;  2P9V B;  4OH0 A;  5JYO A;  4Y0T A;  2EX9 A;  3FWL A;  3MZD A;  2ZC3 B;  1W7F A;  2B5R A;  3ZGA B;  5D3O A;  1NJ4 A;  3V39 A;  1YLJ A;  4E3J A;  5EUA A;  1KGE A;  1N9B A;  4N92 A;  5AQB A;  4UA9 A;  5CHJ A;  4X55 A;  1L0E A;  5HW3 A;  3QHY A;  1NXY A;  3IT9 A;  5FAT A;  1ONH A;  3OCL A;  2Y4A A;  3BFC A;  4Y0O A;  1RP5 A;  4X6T A;  4PPR A;  3ZG8 B;  4EWF A;  5F82 A;  3QNB A;  3VSK A;  5GLB A;  3IF6 A;  2WGW B;  1KGG A;  3AGE A;  4U3T A;  4N9K A;  4R3J A;  5FQK A;  1BT5 A;  4WZ4 A;  1ERM A;  1NRF A;  1N4O A;  1YMS A;  1BLP A;  4GNU A;  5EPH A;  3BFG A;  2EFX A;  3IXB A;  2EX8 A;  3BYD A;  5TR7 A;  1I5Q A;  3C7U A;  4KZ6 A;  5L2F A;  1GA9 A;  1XA7 A;  5FAP A;  3IQA A;  2ZQD A;  4HBT A;  1IEM A;  4L0L A;  4N9L A;  3MKE A;  4OVD A;  5CGW A;  3SS4 A;  4RA7 A;  1JWV A;  3A3E A;  1XXM A;  5FI2 A;  2WK0 A;  1K54 C;  1FOF A;  1CI8 A;  4B4X A;  1K56 D;  2XR0 A;  1L0D A;  1LL5 A;  4KQQ A;  5CGX A;  5FQ9 A;  3WS0 A;  1MBL A;  1K4F A;  4KQO A;  1PI4 A;  3PAE A;  4WMC A;  3WS4 A;  3VP3 A;  1OME A;  3UPP A;  1AXB A;  5DTS A;  1M6K A;  3NI9 A;  1CEG A;  1K55 A;  3IXD A;  3Q07 A;  3V3S A;  4CPK A;  4C75 A;  2XD1 A;  1VQQ A;  5CER A;  4ZTK A;  3P09 A;  1SHV A;  1CI9 A;  3UE3 A;  4X56 A;  5BOH A;  4R3B A;  2FFY A;  4BJP A;  1J9M A;  1TVF A;  4E6X A;  1ESI A;  4B88 A;  4JXW A;  4QD4 A;  3W4Q A;  4KZ7 A;  2Y2K A;  1XP4 A;  3FKV A;  4BL2 A;  4ID4 A;  5DTT A;  3ZDJ A;  3UDX A;  1NYM A;  3RXW A;  3MXR A;  3GTC A;  1HD8 A;  3CG5 A;  1CEF A;  4JXV A;  2BLS A;  3SH9 A;  2JBF A;  3WS5 A;  1E4D A;  2EFU A;  3C4P A;  2GDN A;  3Q7Z A;  2EX6 A;  4OQ0 A;  5E2E A;  2A3U A;  4OPZ A;  2XH9 A;  1ZG4 A;  2P74 A;  5GLC A;  3PBT A;  3E2K A;  1ZC2 A;  3Q7V B;  3LO7 A;  3M6B A;  1E3U A;  4LV3 A;  5GLA A;  1PWC A;  2HDU A;  2HP6 A;  1NZU A;  3HLF A;  2QPN A;  3S1Y A;  3B3X A;  2J8Y A;  4S2O A;  4DE3 A;  4K0W A;  2Z2L B;  1ERQ A;  4JXG A;  4U0X A;  5AQA A;  3AGF A;  5FQJ A;  3IH8 A;  3IHA A;  1MWT A;  3VOZ A;  3DWK A;  4E3K A;  2WAD A;  2HDS A;  4KG2 A;  1FCM A;  4RX3 A;  3SH7 A;  4N1X A;  1YLP A;  4UA7 A;  4S2N A;  1KE3 A;  5FAQ A;  2QZ6 A;  1FSW A;  4X53 A;  1XKZ A;  4EV4 A;  4JXS A;  4LV0 A;  2ZLY A;  5A92 A;  1YQS A;  5EVL A;  1LL9 A;  1TDG A;  3MZE A;  3W4P A;  1JWZ A;  1MWU A;  1IYO A;  5EEC A;  5FA7 A;  1YMX A;  3SS3 A;  3BFF A;  2XLN A;  3OCN A;  2Y2Q A;  2ZQ8 A;  3NCK A;  4OPQ A;  3WS1 A;  3HLE A;  5CHM A;  4DRT A;  4BD1 A;  1GHP A;  5E2H A;  4JF4 A;  5F1G A;  2XQZ A;  4R0Q A;  4U0T A;  4KG6 A;  1K38 A;  4X68 A;  3W4O A;  3WWX A;  1CK3 A;  1BLH A;  5FQI A;  3ZNY A;  2Y59 A;  3PBR A;  5HAP A;  3VP4 A;  5HAQ A;  4WMC D;  4S2L A;  1LI9 A;  1QMF A;  2X01 A;  2VGK A;  1G68 A;  3P98 A;  1TEM A;  3WRT A;  3BLM A;  3BFD A;  4JKT A;  5A90 A;  5KMW A;  4ZJ3 A;  3UPO A;  1LLB A;  4HEF A;  1W8Q A;  5HFO A;  2ZMA A;  5J8X A;  3BM6 A;  3UE0 A;  1EWZ A;  5I94 A;  4E3N A;  3G31 A;  4P87 A;  4OOL A;  2WAF A;  4PMA A;  1WYB A;  3ZNT A;  3ZG5 A;  4M3K A;  4EBP A;  3OPH A;  2Y2M A;  2VGJ A;  4OP5 A;  5EVI A;  4ZDX A;  1M40 A;  3HL9 A;  2X02 A;  3HUM A;  2G2W A;  3ISG A;  3WS2 A;  1FQG A;  4ZAM A;  2H10 A;  2XD5 A;  5FI6 A;  1PWD A;  4FCF A;  3Q81 A;  1ZG6 A;  3G30 A;  4XXR A;  3NDE A;  2HPB A;  4Y0U A;  4E3O A;  2JC7 A;  3I7J A;  4P0M A;  1WYC A;  1O07 A;  3LY3 A;  3MFD A;  1K4E A;  5EOE A;  3FZC A;  2DRW A;  3DWZ A;  4GOG A;  3PBS A;  1E3U D;  3LCE A;  1ZKJ A;  1K6R A;  2IWD A;  1FSY A;  2J7V A;  2XDM A;  4UAA A;  1PW1 A;  2EXB A;  2P9V A;  3ZG7 B;  4IED A;  4KZ3 A;  5HX9 A;  4DF6 A;  2HDR A;  4E6W A;  3HUN A;  1YM1 A;  3PAG A;  4QB8 A;  2ZJ9 A;  4DDS A;  2A49 A;  3CMZ A;  5HAR A;  3FYZ A;  4XUX A;  4X69 A;  4CJN A;  1PWG A;  1K6S A;  3ZVW A;  5GHZ A;  1K57 A;  1W79 A;  2OLV A;  3MKF A;  4MLL A;  3OZH A;  3BFE A;  5CEB A;  2ZC6 B;  2WZZ A;  3M2K A;  4C3Q A;  1IEL A;  1KE4 A;  3V5M A;  1HZO A;  2DNS A;  2ZD8 A;  4OKP A;  3TOI A;  3NY4 A;  2PU4 A;  4JLF A;  4DXC A;  1JTG A;  3FV7 A;  2WGW A;  4QJG A;  4UHU A;  5FI7 A;  4DKI A;  1IYP A;  4GN2 A;  4PM9 A;  3GR2 A;  4R4S A;  1BLC A;  1FR1 A;  4WYY A;  3DW0 A;  4N1H A;  3M2J A;  1BTL A;  2BG1 A;  5EOO A;  2C5W B;  4WEL A;  3HRE A;  5KSH A;  3BLS A;  3FKW A;  3N7W A;  1NY0 A;  1ALQ A;  2XFS A;  4NK3 A;  4F94 A;  2Z2M B;  3N8S A;  1SDN A;  1YLT A;  5CED A;  4HES A;  4PM5 A;  4S2N C;  2WZX A;  5M18 A;  4DE2 A;  2Q9M A;  3O88 A;  4DE1 A;  4FD8 A;  5M1A A;  3VOY A;  4WZ5 A;  3TG9 A;  4EUZ A;  4P85 A;  1TDL A;  3ZHH A;  2J9P A;  4LCM A;  1S0W A;  4E3M A;  3S22 A;  4ZJ1 A;  1JTD A;  4S2M A;  3VFF A;  2H0Y A;  1HVB A;  4OLG A;  2OSU A;  4GB7 A;  2WGV A;  1GHM A;  2WKE A;  4S2K A;  5EVI D;  1ERO A;  3HBR A;  4QHC A;  4OPY A;  2Y91 A;  4EBL A;  4E3L A;  2V2F F;  2E8I A;  4GKU A;  2XF3 A;  1IYQ A;  1GHI A;  2G2U A;  1I2W A;  4BL3 A;  3IWQ A;  3BEC A;  2V1Z A;  2OV5 A;  4H8R A;  2PBY A;  4OQG A;  1KGF A;  3V50 A;  1E25 A;  4FSF A;  1H5X A;  3QNC A;  4IBX A;  3GSG A;  1DJA A;  3LY4 A;  3NIA A;  4IVK A;  1JVJ A;  4C6Y A;  3V3R A;  3JYI A;  2PU2 A;  4KZ4 A;  4KZA A;  1L0F A;  2H5S A;  1I2S A;  5CRF A;  5HL1 A;  4OPR A;  4R1G A;  3S4X A;  4WEK A;  3CJM A;  4YIN A;  5AQ9 A;  1RGZ A;  4K0X A;  3AGD A;  2HP9 A;  3VP1 A;  3O86 A;  5EVI B;  5A93 A;  3HLW A;  5EVI C;  3IF6 B;  3HLD A;  4KZ9 A;  4OLD A;  1MY8 A;  3IF6 C;  4R4R A;  1XA1 A;  4LCL A;  2HDQ A;  4LV1 A;  5FQQ A;  1SKF A;  2EXA A;  4WBG A;  4XUZ A;  4MNR A;  3IWO A;  1Y54 A;  3ZCZ A;  2QMI A;  4JPM A;  1PZO A;  3A3J A;  4KZ8 A;  4S2P A;  2WKI A;  3MZF A;  4EBN A;  4E3I A;  3OC2 A;  1ES3 A;  3EQV A;  5TFQ A;  1XPB A;  4OOY A;  3CZD A;  1EI5 A;  1KDW A;  3PBQ A;  4OON A;  3NDG A;  1ESU A;  1YLY A;  2V20 A;  3UO9 A;  1GA0 A;  3HLG A;  1MWS A;  3VP0 A;  5CXW A;  3VMA A;  2XEP A;  2WYX A;  1BSG A;  5GHY A;  1KDS A;  3GMW A;  1NYY A;  3HLB A;  3A3I A;  1JWP A;  1MKI A;  1DJC A;  2Y2L A;  5HAI A;  1ES2 A;  4KZ5 A;  5TGF A;  2R9W A;  2ZC7 A;  1VM1 A;  3VSL A;  1PW8 A;  1K57 C;  1K55 C;  4RX2 A;  2H0T A;  5FAO A;  3GVB A;  5FDH A;  5F1F A;  1GCE A;  4HBU A;  1XGJ A;  5F83 A;  4Z9Q A;  1DY6 A;  4GD6 A;  4DXB A;  1RGY A;  4JBF A;  1L2S A;  2OLU A;  4Y7P A;  1HTZ A;  4QY5 A;  2WAE A;  3ITA A;  5CTM A;  4OP8 A;  1L0G A;  2FFF B;  1K25 A;  3M6H A;  5KZH A;  1FCO A;  1LHY A;  2XGN A;  2Y2O A;  4IVI A;  1Z6F A;  4DE0 A;  4IBR A;  3SS5 A;  3IHB A;  2HP5 A;  3G34 A;  1SCW A;  1W8Y A;  1H8Z A;  1QME A;  3VFH A;  1KE0 A;  5IHV A;  4DDY A;  3EQU A;  1BUL A;  2XK1 A;  5DVA A;  3RJU A;  3G32 A;  1YLZ A;  2Y2N A;  2CC1 A;  4GDB A;  3A3D A;  5DF7 A;  1KVL A;  3DTM A;  2RCX A;  3PBO A;  4KQR A;  4UA6 A;  3N4I A;  1ES4 A;  3IH9 A;  4A5R A;  1IKI A;  5GLD A;  3G2Y A;  1BUE A;  4BEN A;  1DJB A;  3ITB A;  5E2G A;  1FCN A;  3UY6 A;  1PI5 A;  3D4F A;  3O87 A;  4WZ5 C;  4PM6 A;  3HUO A;  5FAS A;  5E43 A;  2Y2I A;  2I72 A;  4RVA A;  1PIO A;  2ZC5 B;  2IWC A;  4NET A;  4RYE A;  3PBN A;  5EE8 A;  4GZB A;  2C6W B;  2ZQ7 A;  1H8Y A;  2UWX A;  4KEN B;  5DTK A;  4MBF A;  1KVM A;  2IWB A;  4GD8 A;  1LI0 A;  3UDI A;  1C3B A;  2ZQA A;  5GL9 A;  1PYY A;  4OQH A;  3RXX A;  1RCJ A;  1YLW A;  2ZQC A;  1K54 A;  3MXS A;  4BQM A;  4Q8I A;  2JCH A;  3C4O A;  3G4P A;  1BZA A;  4JF6 A;  4YFM A;  3TSG A;  4S2I A;  5AQ7 A;  3N8R A;  1ONG A;  3UN7 A;  4EQI A;  3SH8 A;  3GQZ A;  1IKG A;  2X71 A;  2ZM2 A;  4ZBE A;  4D2O A;  3O3V A;  5CEC A;  1PZP A;  4WM9 A;  1IYS A;  4FH2 A;  3UPN A;  3C5A A;  5CTN A;  5KSC A;  5GHX A;  2Y2G A;  3N8L A;  4JF5 A;  4OOM A;  2WKH A;  2JE5 A;  5CGS A;  4QY6 A;  3ZG9 B; 
#chains in the Genus database with same CATH topology
 4MBH A;  3N6I A;  5L09 A;  2VK3 A;  2KOI A;  3S7Q A;  3NBL A;  5TJJ A;  4BBU A;  1S6R A;  4BD0 A;  4NXG A;  5G18 A;  1U60 A;  3GV9 A;  2Q9N A;  1O7E A;  5L07 A;  2Y8H A;  4MEZ A;  3BRM A;  3G35 A;  5DF8 A;  1DP9 A;  4LEN A;  2P7J A;  1XGI A;  3HLC A;  4KZB A;  4KG5 A;  2XRN A;  1XJ4 A;  1SDE A;  4F3L A;  4BBV A;  3UDF A;  2WUQ A;  2DCF A;  3A3F A;  1G6A A;  1Q2Q A;  3T1X A;  2WGI A;  2P9V B;  4Y0T A;  2EX9 A;  3FWL A;  4NXF A;  1YLJ A;  1PFL A;  2V1A A;  1KGE A;  3C8C A;  4CLC D;  3R7W A;  4LPZ A;  1NXY A;  3IT9 A;  5HPI A;  2Y4A A;  1YSQ A;  4PPR A;  1LT0 A;  3VSK A;  4N9K A;  3T4L A;  4ETZ A;  4WZ4 A;  3K3D A;  3LI9 A;  3BFG A;  2GX5 A;  2EX8 A;  3BQ8 A;  4CLC C;  1GA9 A;  3MFX A;  3CIT A;  4L0L A;  4OVD A;  4RA7 A;  5FI2 A;  2OWJ A;  5CGX A;  3WS4 A;  3VP3 A;  1AXB A;  1YPR A;  3NI9 A;  4HH2 A;  3EGX C;  2L1M A;  4X56 A;  4BJP A;  1J9M A;  2PT7 A;  4BL2 A;  4ID4 A;  3UDX A;  1NYM A;  1CEF A;  1T18 A;  1VET B;  3SH9 A;  1OJG A;  2EWW A;  3C4P A;  4HP9 A;  2GDN A;  1CF0 A;  2A3U A;  2XH9 A;  3LO7 A;  3M6B A;  4LV3 A;  4NXE A;  2HP6 A;  2W3E A;  2ZOH A;  4DE3 A;  5FQJ A;  3B47 A;  3KSH A;  4E3K A;  5FAQ A;  4S2N A;  4JXS A;  4Q0J A;  4LV0 A;  2ZLY A;  1YQS A;  1LL9 A;  3W4P A;  1MWU A;  5FA7 A;  3SS3 A;  3BFF A;  2Y2Q A;  3NCK A;  4OPQ A;  3WS1 A;  4R3A A;  2V9A A;  5E2H A;  5DFX A;  5F1G A;  4AFI A;  4U0T A;  2KX6 A;  4X68 A;  4JGO A;  3MF0 A;  3ZNY A;  2Y59 A;  2GZA A;  2W1T A;  4LRX C;  4H6J B;  4HY8 A;  5KMW A;  4ARZ A;  3KX0 X;  4GS9 B;  5J8X A;  3VE3 A;  3G31 A;  2WAF A;  4PMA A;  2AVX A;  3ZNT A;  4EBP A;  1M40 A;  3WS2 A;  1FQG A;  2H10 A;  1LSW A;  5FI6 A;  5HDC A;  1ZG6 A;  2JKT M;  3G30 A;  4Q0I A;  2HPB A;  4E3O A;  4P0M A;  2HV1 A;  3QP5 A;  3MFD A;  1LSV A;  3FZC A;  2DRW A;  4GOG A;  1E3U D;  3LCE A;  2IWD A;  4UAA A;  4IED A;  4KZ3 A;  1GSV A;  1YM1 A;  3NJA A;  3CMZ A;  4XUX A;  1K57 A;  3MKF A;  5HWV A;  5TBM B;  3VOL A;  5CEB A;  2ZC6 B;  3M2K A;  1IEL A;  5EM0 A;  3OLO A;  3B42 A;  4QJG A;  2WGW A;  1IYP A;  4PM9 A;  4R4S A;  1BLC A;  4WYY A;  5EOO A;  1TS7 A;  2C5W B;  4WEL A;  3LIF A;  1BYW A;  2J3T D;  4F94 A;  1YLT A;  4PM5 A;  2WZX A;  4DE1 A;  2Q9M A;  3O88 A;  3T4O A;  4P85 A;  1S0W A;  3JVU A;  3H82 B;  1JTD A;  2H0Y A;  2WKE A;  1GHM A;  5J7E A;  4S2K A;  5EVI D;  1ERO A;  1VB6 A;  3IX3 A;  4QHC A;  1YSP A;  4EBL A;  2J3T C;  4GKU A;  2G7U A;  2PYP A;  3S7N A;  3IWQ A;  3P7N A;  2PBY A;  4HHD A;  1N9L A;  3V50 A;  4KUO A;  1DJA A;  3LY4 A;  3NEC A;  3NIA A;  3V3R A;  1OT9 A;  2O0Y A;  4KZA A;  1L0F A;  5HL1 A;  4R1G A;  3S4X A;  4WEK A;  4YIN A;  4UQI M;  4K0X A;  4R70 A;  1YAX A;  3O86 A;  5EVI C;  3IF6 B;  3HLD A;  4KZ9 A;  3E4P A;  4YWZ A;  4R4R A;  4LCL A;  3IX8 A;  2HDQ A;  3MS6 A;  2W27 A;  5FQQ A;  4X1L A;  4WBG A;  1Y54 A;  4JPM A;  1PZO A;  4KZ8 A;  4S2P A;  2MJ6 A;  1OTE A;  2K7S A;  1KDW A;  1IOU A;  3LEQ A;  3NDG A;  1MWS A;  3VMA A;  2XEP A;  3U4L P;  5HPF A;  3HLB A;  1NLY A;  1W63 M;  4QPR A;  4KZ5 A;  5TGF A;  1G5U A;  3VSL A;  1DP6 A;  1PW8 A;  1K55 C;  3O5Y A;  5FAO A;  5FDH A;  3LR4 A;  4HBU A;  1DY6 A;  1RGY A;  4FOF A;  2PHY A;  1HTZ A;  2WAE A;  3ITA A;  1L0G A;  1LHY A;  2HP5 A;  1V9Z A;  1W8Y A;  1H8Z A;  2Y2N A;  4GDB A;  5DF7 A;  1XJ3 A;  4UA6 A;  5HD5 A;  1ES4 A;  3IH9 A;  3G2Y A;  4BEN A;  3ITB A;  3DBA A;  4PM6 A;  5E43 A;  2Y2I A;  3E4O A;  1PIO A;  5KIZ A;  4GZB A;  4KEN B;  1TF1 A;  3UDI A;  1PYY A;  4OQH A;  3CPT A;  3MXS A;  2W3D A;  4WL9 A;  3EEH A;  1BZA A;  4I3I A;  3SH8 A;  1OTB A;  2ZM2 A;  4ZBE A;  4D2O A;  5G4Z A;  1PZP A;  4WM9 A;  4DN0 A;  2P04 A;  2OWH A;  5CTN A;  1SKO B;  2YKF A;  4OOM A;  5FQM A;  1MXO A;  4K91 A;  3BEB A;  3OPL A;  2J9O A;  1S1Z A;  3Q82 A;  4R23 A;  3ZFZ A;  2V0W A;  3LR5 A;  3NC8 A;  4LGW A;  4BLM A;  1K56 A;  1Q2P A;  2VKS A;  5U47 A;  5J4E A;  1F98 A;  2W3F A;  1W5D A;  2Y55 A;  3SOI A;  1ES5 A;  1FR6 A;  4LRY C;  3H7W B;  3VV4 A;  3NOT C;  4O01 A;  3IWI A;  4P6B A;  4LLO B;  4PM8 A;  3F1O A;  5E2F A;  3IXH A;  2VGL M;  5IU1 A;  2RL3 A;  2ZQ9 A;  3OPP A;  4ZJ2 A;  5DKL A;  2ZM0 A;  4IJG A;  3FC7 A;  5A91 A;  3Q1F A;  2KLI A;  3E2L A;  3FPV A;  2Y2P A;  3UNW A;  4OH0 A;  3ZGA B;  3MZD A;  3LIB A;  2B5R A;  2B18 A;  1NJ4 A;  3V39 A;  1CJF A;  3CUE C;  3MXQ A;  4UA9 A;  5CHJ A;  4X55 A;  5HW3 A;  5FAT A;  3ZG8 B;  4EWF A;  4EEP A;  5GLB A;  3MQ0 A;  3R4K A;  2Q0O A;  1KGG A;  4U3T A;  3IX4 A;  1HLU P;  4R3J A;  1BT5 A;  3QP6 A;  4HP4 A;  1ERM A;  2EFX A;  5EVE A;  5C5K A;  4LRZ E;  3F1P A;  2ZQD A;  2HJE A;  4HBT A;  4N9L A;  1Y28 A;  3T1Q B;  4CQH A;  1DP8 A;  2OAQ 1;  1FOF A;  4B4X A;  4KQQ A;  3WS0 A;  4ZRR A;  2YKH A;  1STZ A;  2HZ5 A;  1OME A;  3LIE A;  2EWV A;  1M6K A;  1CEG A;  4YNR A;  1K55 A;  4CPK A;  2XD1 A;  2O9C A;  2GJ3 A;  1LL8 A;  1SHV A;  2FFY A;  1TVF A;  1T1A A;  3BJN A;  1ESI A;  4B88 A;  4JXW A;  3W4Q A;  4KZ7 A;  1XP4 A;  3UB8 A;  3SW1 A;  3RXW A;  3GTC A;  3CG5 A;  3LYX A;  2BLS A;  2JBF A;  3CHW P;  4GLQ A;  2EFU A;  4MCW A;  3T4J A;  4OQ0 A;  4OPZ A;  4EQ1 A;  5GLC A;  3EWK A;  3W2Z A;  4MMN A;  4M4X A;  1PWC A;  1S4R A;  1NZU A;  2QPN A;  3RH8 B;  4HH3 A;  2ZL1 A;  3KYZ A;  2Z2L B;  5AQA A;  3IH8 A;  3LR3 A;  3IHA A;  2XRO A;  2WAD A;  4KG2 A;  3UE6 A;  1FSW A;  5EV0 A;  3IBJ A;  4Y15 A;  5EVL A;  1EW0 A;  3R7W B;  1D06 A;  1OTA A;  4DRT A;  4UEY A;  4BD1 A;  4O0P A;  1GHP A;  5G4Y A;  4JF4 A;  1DRM A;  4R0Q A;  4KG6 A;  3W4O A;  1CK3 A;  1BLH A;  5FQI A;  1NLZ A;  5HAP A;  5HAQ A;  4WMC D;  2X01 A;  3WRT A;  3BFD A;  5A90 A;  1D1J A;  1W8Q A;  1EWZ A;  4P87 A;  1WYB A;  4M3K A;  2ZMV A;  3OPH A;  3CWF A;  2VGJ A;  3ICY A;  2X02 A;  3HUM A;  5LBR A;  2I9V A;  4X1M A;  4ZAM A;  2XD5 A;  1PWD A;  3FG8 A;  4FCF A;  2Y79 A;  4XXR A;  3NDE A;  1T1C A;  4Y0U A;  4Y3I A;  3I7J A;  1K4E A;  4PHT A;  2W3G A;  3TJZ C;  2J7V A;  4GCZ A;  1PW1 A;  2EXB A;  2JHE A;  2P9V A;  3KYQ A;  4DF6 A;  3PAG A;  3HCY A;  3CUE A;  4DDS A;  5HAR A;  4X69 A;  3ZVW A;  5GHZ A;  3OZH A;  3BFE A;  2WZZ A;  4GHI A;  1V9Y A;  3MSH A;  1P9R A;  2JN7 A;  3CLO A;  3L9K A;  1JTG A;  3MQO A;  1XJ2 A;  3GR2 A;  3ULF A;  2LB5 A;  1BTL A;  4NKP A;  5KSH A;  3FKW A;  3N7W A;  1NY0 A;  1ALQ A;  1SDN A;  4HES A;  4NXB A;  3S22 A;  4ZJ1 A;  2VJW A;  4I5S A;  4S2M A;  3VFF A;  1HVB A;  3NOU C;  2OSU A;  1ODV A;  2V2F F;  2E8I A;  2V1Z A;  2OV5 A;  4H8R A;  4WF0 A;  3QNC A;  3G6O A;  3GSG A;  3JYI A;  2PU2 A;  5CRF A;  2HP9 A;  5A93 A;  3T12 B;  4K08 A;  3HJI A;  3IF6 C;  4LV1 A;  4ME4 A;  4UQI S;  4Y17 A;  1OT6 A;  1T19 A;  2WKI A;  3MZF A;  3CZD A;  2L4R A;  5CXW A;  5HWT A;  4Y5F A;  3D9Y A;  1MKI A;  2Y2L A;  3QP8 A;  4ESP A;  1VM1 A;  1D7E A;  2H0T A;  1GCE A;  1TS8 A;  5F83 A;  4GD6 A;  4JBF A;  1L2S A;  4Y7P A;  4HI4 A;  5KZH A;  3M6H A;  3KYE A;  2XGN A;  1Z6F A;  4DE0 A;  4IBR A;  2PDR A;  3IHB A;  4H6J A;  2LB9 A;  3G34 A;  1KE0 A;  5IHV A;  2XK1 A;  4GS9 A;  3A0S A;  3A3D A;  3PYP A;  3PBO A;  2RCX A;  3N4I A;  4A5R A;  1IKI A;  3KO6 A;  5HDD A;  4HIA A;  2H28 A;  1PI5 A;  3O87 A;  4WZ5 C;  3HUO A;  2WKQ A;  3LI8 A;  3B33 A;  2IWC A;  4NET A;  4WLA A;  5EE8 A;  1GSW A;  4CLC A;  3NOP C;  5DTK A;  4I3J A;  3LFV A;  2QWS A;  2M7V A;  4BQM A;  4Q8I A;  3TSG A;  3F1N B;  4S2I A;  3N8R A;  1ONG A;  3K3C A;  4EQI A;  4HJ3 A;  3C5A A;  4NG2 A;  2ZMF A;  2Y2G A;  4JF5 A;  2V20 A;  4QY6 A;  3ZG9 B;  1BLS A;  2ZBB A;  3DTI A;  1WE4 A;  3IF5 A;  3W8K A;  5FSR A;  3MBZ A;  1H8M A;  1XJ6 A;  2GNX A;  1XX2 A;  4MBK A;  2O99 A;  3A0V A;  3HVF A;  2ZM8 A;  4PM7 A;  3UE1 A;  4HNB A;  1MWR A;  3ZVT A;  1IFQ A;  3PTE A;  4B4Z A;  1YT4 A;  4FUW A;  1MPL A;  2DMW A;  4LV2 A;  3Q7V A;  5I5L A;  5DF9 A;  4S2J A;  2Y2H A;  2M1C A;  3P01 A;  5AVF A;  4O7D A;  5EFW A;  3G2Z A;  4FH4 A;  2JKG A;  2VGL S;  3IXG A;  5FEG A;  4JGQ A;  2Y2J A;  4QU3 A;  2Z6D A;  4EU0 A;  1W7F A;  3D72 A;  1CQA A;  5D3O A;  5AJG A;  5EUA A;  1S1Y A;  1N9B A;  4N92 A;  2WKP A;  2VLG A;  1H3Q A;  3OCL A;  1P9W A;  3BFC A;  4Y0O A;  1RP5 A;  5FEF A;  3IF6 A;  2VA0 A;  2O9B A;  1FIL A;  2B95 A;  1YMS A;  1BLP A;  4GNU A;  5EPH A;  5IS1 A;  3C7U A;  4KZ6 A;  5L2F A;  1IEM A;  3MKE A;  3SS4 A;  1JWV A;  1XXM A;  3LID A;  1K54 C;  1G6O A;  1CI8 A;  5FQ9 A;  1LL5 A;  2UV0 E;  4KQO A;  1PI4 A;  3LIC A;  3UPP A;  3T1R A;  3EOI A;  2VEA A;  1VQQ A;  3RFB A;  5CER A;  1OJ5 A;  3P09 A;  2A24 B;  3UE3 A;  2XSS A;  2ACG A;  3IS2 A;  1UGU A;  5L10 A;  4R3B A;  4E6X A;  4QD4 A;  3BY8 A;  2L0W A;  2Y2K A;  1KOU A;  3FKV A;  5DTT A;  3VE4 A;  3OOV A;  3MXR A;  4JXV A;  1N9O A;  4L9G A;  1VEU A;  1VHM A;  2EX6 A;  5E2E A;  2K31 A;  3EEA A;  2CMN A;  1ZC2 A;  1E3U A;  3F1O B;  5GLA A;  3HLF A;  3B3X A;  2J8Y A;  4II7 A;  4E04 A;  1ERQ A;  4U0X A;  4BMW A;  1MWT A;  3VOZ A;  2HDS A;  1FCM A;  4RX3 A;  4P6Z M;  3SH7 A;  4N1X A;  5HWW A;  2QZ6 A;  4X53 A;  1XKZ A;  4EV4 A;  1PRQ A;  1IYO A;  5EEC A;  4EER A;  1YMX A;  4PKY A;  2HJ9 C;  3OCN A;  2ZQ8 A;  1TS6 A;  3HLE A;  5CHM A;  5EM1 A;  3BY9 A;  4JGR A;  1K38 A;  3WWX A;  3BQA A;  3PBR A;  3VP4 A;  3E4Q A;  1LI9 A;  2VGK A;  1G68 A;  3P98 A;  3H9W A;  2J3W A;  5HSQ A;  3UB5 P;  3T50 A;  4ZJ3 A;  5FL3 A;  1LLB A;  5HFO A;  3BM6 A;  5I94 A;  2OAP 1;  4E3N A;  3F1P B;  4OOL A;  3ZG5 A;  2INW A;  2Y2M A;  1MC0 A;  2V8F A;  5HD3 A;  5EVI A;  4ZDX A;  2G2W A;  3ISG A;  3ZYT A;  3K2N A;  4O8G A;  2A2L A;  2HGV A;  2FH5 A;  3DWZ A;  3PBS A;  1K6R A;  1FSY A;  2HDR A;  4E6W A;  4QB8 A;  2ZJ9 A;  4MDZ A;  3FYZ A;  4QWO A;  3PXP A;  1PWG A;  1K6S A;  1W79 A;  2OLV A;  3BW6 A;  3U2A A;  3TW8 A;  2W0N A;  3QP1 A;  4C3Q A;  3V5M A;  1AWI A;  1HZO A;  2DNS A;  2ZD8 A;  3NUL A;  4OKP A;  2PU4 A;  2BAS A;  3ZQ5 A;  4JLF A;  4DXC A;  3FV7 A;  4DKI A;  4Y2F A;  2PR6 A;  4GN2 A;  4N1H A;  3UB7 A;  2BG1 A;  4B93 A;  3UME A;  1P97 A;  3HRE A;  1T1B A;  2XFS A;  2Z2M B;  5CED A;  3HJK A;  4XT2 A;  4S2N C;  2JKR M;  5M18 A;  2IA2 A;  4FD8 A;  3TG9 A;  4DJ2 A;  1TDL A;  3A0R A;  2J9P A;  3ZHH A;  4LCM A;  4F3L B;  4OLG A;  4GB7 A;  1XFQ A;  1Z09 A;  2XF3 A;  1IYQ A;  2XA7 M;  1GHI A;  2G2U A;  2NUP C;  5DJU A;  1E25 A;  4FSF A;  1H5X A;  4B9O A;  4IVK A;  1NRJ A;  4C6Y A;  2H5S A;  3CJM A;  3AGD A;  3VP1 A;  4OLD A;  1W63 Q;  1SKF A;  2VV8 A;  2EXA A;  1TD5 A;  3KSG A;  4MNR A;  2FZ0 A;  3ZCZ A;  3A3J A;  4EBN A;  3JPU A;  5TFQ A;  1EI5 A;  2EA9 A;  3PBQ A;  1H0M A;  3UO9 A;  1GA0 A;  3CAX A;  5F69 A;  2JKF A;  5GHY A;  3GMW A;  1NYY A;  3A3I A;  1JWP A;  5HAI A;  1ES2 A;  3SZT A;  1MZU A;  4YOF A;  1K57 C;  5F1F A;  3GVB A;  1WA9 A;  4GHI B;  4R38 A;  4Z9Q A;  5CX7 A;  4DXB A;  2OLU A;  4WN5 A;  2VV7 A;  2QJ7 A;  4I39 A;  5CTM A;  4OP8 A;  3QP2 A;  1K25 A;  2Y2O A;  5HL6 A;  3SS5 A;  2WKR A;  1SCW A;  4DDY A;  5DVA A;  3G32 A;  1YLZ A;  1X0O A;  3DTM A;  5L8M A;  1BUE A;  3E0Y A;  3D4F A;  4MN7 A;  3GEC A;  2I72 A;  2ZQ7 A;  1KVM A;  4HJ6 A;  4GD8 A;  2JKR I;  1LI0 A;  5GL9 A;  4LFU A;  2ZQC A;  1UWN X;  1MKM A;  3G4P A;  4JF6 A;  5DJT A;  2QHK A;  3GQZ A;  2X71 A;  3O3V A;  2V8C A;  5CEC A;  1IYS A;  4IHQ A;  4FH2 A;  5HDS A;  1YKD A;  5KSC A;  3N8L A;  2PYR A;  2OOL A;  2JE5 A;  5CGS A;  2Z6C A;  4WEJ A;  1NZO A;  2D01 A;  3C7V A;  3ZG0 A;  2W1T B;  5F5Y A;  4D60 A;  4ARZ B;  2QJ5 A;  3IBR A;  1VET A;  3LEZ A;  2R9X A;  4EET B;  5JYP A;  2HF6 A;  4X25 A;  1FIK A;  4GDN A;  1K0K A;  1TS0 A;  1XFN A;  3OPR A;  4Y13 A;  3CI6 A;  3DAV A;  2B02 A;  4OQI A;  3WRZ A;  5CHU A;  2XFT A;  2EX2 A;  2ZC4 B;  4KQD A;  3VP2 A;  5M19 A;  3GRJ A;  2QYB A;  5JYO A;  2ZC3 B;  4E3J A;  5AQB A;  2V1B A;  1ZTU A;  1L0E A;  1F5M A;  3QHY A;  1ONH A;  4X6T A;  5F82 A;  3S7P A;  3QNB A;  2W3H A;  2WGW B;  5AVE A;  3AGE A;  4KUK A;  1P0Z A;  5FQK A;  1GSX A;  1NRF A;  1N4O A;  1SZV A;  3IXB A;  4CLC B;  3BYD A;  1S4S A;  5TR7 A;  1I5Q A;  1XA7 A;  5FAP A;  3IQA A;  5CGW A;  3A3E A;  2WK0 A;  4L9F A;  3KSI A;  3EGD C;  4RQ9 A;  1K56 D;  2XR0 A;  1L0D A;  1MBL A;  1K4F A;  4HOI A;  3LGO A;  3PAE A;  4WMC A;  5DTS A;  3Q07 A;  3IXD A;  4EUV A;  3V3S A;  4C75 A;  3L7H A;  4ZTK A;  1CI9 A;  4G3K A;  5BOH A;  3UB6 A;  3ZDJ A;  4CLC E;  3C2W A;  1LSX A;  1HD8 A;  4EEU A;  3WS5 A;  1E4D A;  5DKK A;  1F2K A;  5TBM A;  3Q7Z A;  3BWL A;  3UB9 A;  1ZG4 A;  2P74 A;  3PBT A;  3E2K A;  3Q7V B;  2HDU A;  3S1Y A;  4S2O A;  4K0W A;  4JXG A;  3AGF A;  2VV6 A;  3DWK A;  1YLP A;  2VX8 A;  4UA7 A;  1KE3 A;  1F9I A;  3UMD A;  5A92 A;  4HQA A;  2BTF P;  2ZOI A;  1TDG A;  3MZE A;  1JWZ A;  4P6Z S;  3F1N A;  4G3W A;  2XLN A;  2M7U A;  3H82 A;  3C38 A;  3LUQ A;  2XQZ A;  1S66 L;  5IT5 A;  5DFY A;  3T4K A;  3T4T A;  4S2L A;  5F68 A;  1QMF A;  1TEM A;  3BLM A;  4JKT A;  3UPO A;  4HEF A;  1A0K A;  2PR5 A;  2ZMA A;  3UE0 A;  4Q0H A;  2D02 A;  4OP5 A;  3HL9 A;  3Q81 A;  2JKT I;  4I3A A;  3T1S A;  2JC7 A;  1WYC A;  1O07 A;  3LY3 A;  1PNE A;  3MQQ A;  3D3O A;  5EOE A;  2QKP A;  5J3W A;  3IS2 B;  3CPT B;  1ZKJ A;  2XDM A;  3T4Q A;  3MJQ A;  3ZG7 B;  5HX9 A;  4BBT A;  1OTD A;  3HUN A;  3DTE A;  2A49 A;  4DJ3 A;  5HZH A;  4CJN A;  3TRC A;  1VEU B;  4MN6 A;  4MLL A;  3C30 A;  1KE4 A;  3TOI A;  3NY4 A;  3T4S A;  4UHU A;  5FI7 A;  4L9E A;  1N9N A;  1FR1 A;  3DW0 A;  3M2J A;  4NEE D;  3BLS A;  3FPW A;  4IUH A;  4NK3 A;  3N8S A;  2W1R A;  4DE2 A;  4PKY G;  1L3L A;  2PRF A;  5M1A A;  3VOY A;  4WZ5 A;  4EUZ A;  4E3M A;  2WGV A;  5K5B A;  3HBR A;  4OPY A;  2Y91 A;  2A24 A;  3DTK A;  4E3L A;  4Z1W A;  1I2W A;  4BL3 A;  3MMH A;  3BEC A;  1Y4O A;  4OQG A;  1KGF A;  4IBX A;  3S7O A;  4DMZ A;  1JVJ A;  2XA7 S;  3PHY A;  2VZW A;  4KZ4 A;  1I2S A;  4OPR A;  2R78 A;  5AQ9 A;  1RGZ A;  1SKO A;  5EVI B;  3HLW A;  4JGP A;  2O9A A;  1MY8 A;  1XA1 A;  4WUJ A;  2PD7 A;  4XUZ A;  3IWO A;  4I38 A;  2QMI A;  4E3I A;  3OC2 A;  5MC7 A;  1ES3 A;  3EQV A;  1XPB A;  2J80 A;  4OOY A;  4OON A;  2PBD P;  3MR0 A;  1ESU A;  1YLY A;  3VP0 A;  3HLG A;  3H7W A;  2WYX A;  2V0U A;  4R6L A;  1J3W A;  1BSG A;  3PR6 A;  1KDS A;  1S67 L;  4EW7 A;  1DJC A;  1G28 A;  4GJ4 A;  2R9W A;  2PD8 A;  2ZC7 A;  4GW9 A;  3E98 A;  4RX2 A;  3JVV A;  3KSF A;  1XGJ A;  2KDK A;  3RTY A;  4EXO A;  4QY5 A;  3GDI A;  3TE8 A;  2FFF B;  1FCO A;  4IVI A;  4BWI A;  1ZHH B;  4ETX A;  3LIA A;  1QME A;  3VFH A;  2P08 A;  3EQU A;  5FDS A;  1BUL A;  3RJU A;  2CC1 A;  1KVL A;  4KQR A;  4XT2 B;  1OPX A;  5GLD A;  4G3V A;  4HJ4 A;  1DJB A;  5E2G A;  1FCN A;  4FTX A;  3UY6 A;  2ZL1 B;  5FAS A;  1ACF A;  1OTI A;  4EES A;  4RVA A;  2ZC5 B;  4RYE A;  3PBN A;  4PAU A;  2C6W B;  3QP4 A;  1NWZ A;  1H8Y A;  2UWX A;  4MN5 A;  4MBF A;  5F6A A;  1UWP X;  2IWB A;  1C3B A;  2ZQA A;  3RXX A;  1RCJ A;  1YLW A;  3V67 A;  3NHQ A;  5A8B A;  1K54 A;  3LR0 A;  2JCH A;  3C4O A;  4YFM A;  5AQ7 A;  2E8J A;  3OBF A;  3UN7 A;  2NUT C;  1IKG A;  1JNU A;  3UPN A;  4IUK A;  5GHX A;  2PAV P;  2WKH A;  2K2N A; 
#chains in the Genus database with same CATH homology
 4MBH A;  1MXO A;  3N6I A;  4K91 A;  4WEJ A;  1BLS A;  1NZO A;  3IF5 A;  1WE4 A;  3BEB A;  3W8K A;  3OPL A;  2J9O A;  5FSR A;  3C7V A;  3Q82 A;  3MBZ A;  4R23 A;  3ZG0 A;  3ZFZ A;  3NBL A;  5FQM A;  3NC8 A;  1XX2 A;  4MBK A;  4BLM A;  1K56 A;  1Q2P A;  1S6R A;  4BD0 A;  5U47 A;  3HVF A;  5G18 A;  1U60 A;  3GV9 A;  1W5D A;  2Y55 A;  3LEZ A;  2ZM8 A;  1ES5 A;  3SOI A;  1FR6 A;  2Q9N A;  2R9X A;  4PM7 A;  3UE1 A;  1O7E A;  1MWR A;  5JYP A;  4MEZ A;  3BRM A;  3G35 A;  3ZVT A;  5DF8 A;  3IWI A;  4P6B A;  3PTE A;  4LEN A;  4GDN A;  4B4Z A;  1YT4 A;  1XGI A;  1MPL A;  3HLC A;  4LV2 A;  3Q7V A;  4PM8 A;  5DF9 A;  3IXH A;  5E2F A;  4KZB A;  4KG5 A;  1SDE A;  3OPR A;  2RL3 A;  2ZQ9 A;  3OPP A;  2Y2H A;  4S2J A;  4ZJ2 A;  2ZM0 A;  4OQI A;  3WRZ A;  3UDF A;  2WUQ A;  4O7D A;  2XFT A;  3Q1F A;  5CHU A;  2DCF A;  2EX2 A;  5A91 A;  3A3F A;  3G2Z A;  4FH4 A;  1G6A A;  3E2L A;  3IXG A;  2ZC4 B;  3VP2 A;  1Q2Q A;  2Y2P A;  5M19 A;  3UNW A;  2WGI A;  3GRJ A;  2Y2J A;  4QU3 A;  2P9V B;  4OH0 A;  5JYO A;  4Y0T A;  2EX9 A;  3FWL A;  3MZD A;  2ZC3 B;  1W7F A;  2B5R A;  3ZGA B;  5D3O A;  1NJ4 A;  3V39 A;  1YLJ A;  4E3J A;  5EUA A;  1KGE A;  1N9B A;  4N92 A;  5AQB A;  4UA9 A;  5CHJ A;  4X55 A;  1L0E A;  5HW3 A;  3QHY A;  1NXY A;  3IT9 A;  5FAT A;  1ONH A;  3OCL A;  2Y4A A;  3BFC A;  4Y0O A;  1RP5 A;  4X6T A;  4PPR A;  3ZG8 B;  4EWF A;  5F82 A;  3QNB A;  3VSK A;  5GLB A;  3IF6 A;  2WGW B;  1KGG A;  3AGE A;  4U3T A;  4N9K A;  4R3J A;  5FQK A;  1BT5 A;  4WZ4 A;  1ERM A;  1NRF A;  1N4O A;  1YMS A;  1BLP A;  4GNU A;  5EPH A;  3BFG A;  2EFX A;  3IXB A;  2EX8 A;  3BYD A;  5TR7 A;  1I5Q A;  3C7U A;  4KZ6 A;  5L2F A;  1GA9 A;  1XA7 A;  5FAP A;  3IQA A;  2ZQD A;  4HBT A;  1IEM A;  4L0L A;  4N9L A;  3MKE A;  4OVD A;  5CGW A;  3SS4 A;  4RA7 A;  1JWV A;  3A3E A;  1XXM A;  5FI2 A;  2WK0 A;  1K54 C;  1FOF A;  1CI8 A;  4B4X A;  1K56 D;  2XR0 A;  1L0D A;  1LL5 A;  4KQQ A;  5CGX A;  5FQ9 A;  3WS0 A;  1MBL A;  1K4F A;  4KQO A;  1PI4 A;  3PAE A;  4WMC A;  3WS4 A;  3VP3 A;  1OME A;  3UPP A;  1AXB A;  5DTS A;  1M6K A;  3NI9 A;  1CEG A;  1K55 A;  3IXD A;  3Q07 A;  3V3S A;  4CPK A;  4C75 A;  2XD1 A;  1VQQ A;  5CER A;  4ZTK A;  3P09 A;  1SHV A;  1CI9 A;  3UE3 A;  4X56 A;  5BOH A;  4R3B A;  2FFY A;  4BJP A;  1J9M A;  1TVF A;  4E6X A;  1ESI A;  4B88 A;  4JXW A;  4QD4 A;  3W4Q A;  4KZ7 A;  2Y2K A;  1XP4 A;  3FKV A;  4BL2 A;  4ID4 A;  5DTT A;  3ZDJ A;  3UDX A;  1NYM A;  3RXW A;  3MXR A;  3GTC A;  1HD8 A;  3CG5 A;  1CEF A;  4JXV A;  2BLS A;  3SH9 A;  2JBF A;  3WS5 A;  1E4D A;  2EFU A;  3C4P A;  2GDN A;  3Q7Z A;  2EX6 A;  4OQ0 A;  5E2E A;  2A3U A;  4OPZ A;  2XH9 A;  1ZG4 A;  2P74 A;  5GLC A;  3PBT A;  3E2K A;  1ZC2 A;  3Q7V B;  3LO7 A;  3M6B A;  1E3U A;  4LV3 A;  5GLA A;  1PWC A;  2HDU A;  2HP6 A;  1NZU A;  3HLF A;  2QPN A;  3S1Y A;  3B3X A;  2J8Y A;  4S2O A;  4DE3 A;  4K0W A;  2Z2L B;  1ERQ A;  4JXG A;  4U0X A;  5AQA A;  3AGF A;  5FQJ A;  3IH8 A;  3IHA A;  1MWT A;  3VOZ A;  3DWK A;  4E3K A;  2WAD A;  2HDS A;  4KG2 A;  1FCM A;  4RX3 A;  3SH7 A;  4N1X A;  1YLP A;  4UA7 A;  4S2N A;  1KE3 A;  5FAQ A;  2QZ6 A;  1FSW A;  4X53 A;  1XKZ A;  4EV4 A;  4JXS A;  4LV0 A;  2ZLY A;  5A92 A;  1YQS A;  5EVL A;  1LL9 A;  1TDG A;  3MZE A;  3W4P A;  1JWZ A;  1MWU A;  1IYO A;  5EEC A;  5FA7 A;  1YMX A;  3SS3 A;  3BFF A;  2XLN A;  3OCN A;  2Y2Q A;  2ZQ8 A;  3NCK A;  4OPQ A;  3WS1 A;  3HLE A;  5CHM A;  4DRT A;  4BD1 A;  1GHP A;  5E2H A;  4JF4 A;  5F1G A;  2XQZ A;  4R0Q A;  4U0T A;  4KG6 A;  1K38 A;  4X68 A;  3W4O A;  3WWX A;  1CK3 A;  1BLH A;  5FQI A;  3ZNY A;  2Y59 A;  3PBR A;  5HAP A;  3VP4 A;  5HAQ A;  4WMC D;  4S2L A;  1LI9 A;  1QMF A;  2X01 A;  2VGK A;  1G68 A;  3P98 A;  1TEM A;  3WRT A;  3BLM A;  3BFD A;  4JKT A;  5A90 A;  5KMW A;  4ZJ3 A;  3UPO A;  1LLB A;  4HEF A;  1W8Q A;  5HFO A;  2ZMA A;  5J8X A;  3BM6 A;  3UE0 A;  1EWZ A;  5I94 A;  4E3N A;  3G31 A;  4P87 A;  4OOL A;  2WAF A;  4PMA A;  1WYB A;  3ZNT A;  3ZG5 A;  4M3K A;  4EBP A;  3OPH A;  2Y2M A;  2VGJ A;  4OP5 A;  5EVI A;  4ZDX A;  1M40 A;  3HL9 A;  2X02 A;  3HUM A;  2G2W A;  3ISG A;  3WS2 A;  1FQG A;  4ZAM A;  2H10 A;  2XD5 A;  5FI6 A;  1PWD A;  4FCF A;  3Q81 A;  1ZG6 A;  3G30 A;  4XXR A;  3NDE A;  2HPB A;  4Y0U A;  4E3O A;  2JC7 A;  3I7J A;  4P0M A;  1WYC A;  1O07 A;  3LY3 A;  3MFD A;  1K4E A;  5EOE A;  3FZC A;  2DRW A;  3DWZ A;  4GOG A;  3PBS A;  1E3U D;  3LCE A;  1ZKJ A;  1K6R A;  2IWD A;  1FSY A;  2J7V A;  2XDM A;  4UAA A;  1PW1 A;  2EXB A;  2P9V A;  3ZG7 B;  4IED A;  4KZ3 A;  5HX9 A;  4DF6 A;  2HDR A;  4E6W A;  3HUN A;  1YM1 A;  3PAG A;  4QB8 A;  2ZJ9 A;  4DDS A;  2A49 A;  3CMZ A;  5HAR A;  3FYZ A;  4XUX A;  4X69 A;  4CJN A;  1PWG A;  1K6S A;  3ZVW A;  5GHZ A;  1K57 A;  1W79 A;  2OLV A;  3MKF A;  4MLL A;  3OZH A;  3BFE A;  5CEB A;  2ZC6 B;  2WZZ A;  3M2K A;  4C3Q A;  1IEL A;  1KE4 A;  3V5M A;  1HZO A;  2DNS A;  2ZD8 A;  4OKP A;  3TOI A;  3NY4 A;  2PU4 A;  4JLF A;  4DXC A;  1JTG A;  3FV7 A;  2WGW A;  4QJG A;  4UHU A;  5FI7 A;  4DKI A;  1IYP A;  4GN2 A;  4PM9 A;  3GR2 A;  4R4S A;  1BLC A;  1FR1 A;  4WYY A;  3DW0 A;  4N1H A;  3M2J A;  1BTL A;  2BG1 A;  5EOO A;  2C5W B;  4WEL A;  3HRE A;  5KSH A;  3BLS A;  3FKW A;  3N7W A;  1NY0 A;  1ALQ A;  2XFS A;  4NK3 A;  4F94 A;  2Z2M B;  3N8S A;  1SDN A;  1YLT A;  5CED A;  4HES A;  4PM5 A;  4S2N C;  2WZX A;  5M18 A;  4DE2 A;  2Q9M A;  3O88 A;  4DE1 A;  4FD8 A;  5M1A A;  3VOY A;  4WZ5 A;  3TG9 A;  4EUZ A;  4P85 A;  1TDL A;  3ZHH A;  2J9P A;  4LCM A;  1S0W A;  4E3M A;  3S22 A;  4ZJ1 A;  1JTD A;  4S2M A;  3VFF A;  2H0Y A;  1HVB A;  4OLG A;  2OSU A;  4GB7 A;  2WGV A;  1GHM A;  2WKE A;  4S2K A;  5EVI D;  1ERO A;  3HBR A;  4QHC A;  4OPY A;  2Y91 A;  4EBL A;  4E3L A;  2V2F F;  2E8I A;  4GKU A;  2XF3 A;  1IYQ A;  1GHI A;  2G2U A;  1I2W A;  4BL3 A;  3IWQ A;  3BEC A;  2V1Z A;  2OV5 A;  4H8R A;  2PBY A;  4OQG A;  1KGF A;  3V50 A;  1E25 A;  4FSF A;  1H5X A;  3QNC A;  4IBX A;  3GSG A;  1DJA A;  3LY4 A;  3NIA A;  4IVK A;  1JVJ A;  4C6Y A;  3V3R A;  3JYI A;  2PU2 A;  4KZ4 A;  4KZA A;  1L0F A;  2H5S A;  1I2S A;  5CRF A;  5HL1 A;  4OPR A;  4R1G A;  3S4X A;  4WEK A;  3CJM A;  4YIN A;  5AQ9 A;  1RGZ A;  4K0X A;  3AGD A;  2HP9 A;  3VP1 A;  3O86 A;  5EVI B;  5A93 A;  3HLW A;  5EVI C;  3IF6 B;  3HLD A;  4KZ9 A;  4OLD A;  1MY8 A;  3IF6 C;  4R4R A;  1XA1 A;  4LCL A;  2HDQ A;  4LV1 A;  5FQQ A;  1SKF A;  2EXA A;  4WBG A;  4XUZ A;  4MNR A;  3IWO A;  1Y54 A;  3ZCZ A;  2QMI A;  4JPM A;  1PZO A;  3A3J A;  4KZ8 A;  4S2P A;  2WKI A;  3MZF A;  4EBN A;  4E3I A;  3OC2 A;  1ES3 A;  3EQV A;  5TFQ A;  1XPB A;  4OOY A;  3CZD A;  1EI5 A;  1KDW A;  3PBQ A;  4OON A;  3NDG A;  1ESU A;  1YLY A;  2V20 A;  3UO9 A;  1GA0 A;  3HLG A;  1MWS A;  3VP0 A;  5CXW A;  3VMA A;  2XEP A;  2WYX A;  1BSG A;  5GHY A;  1KDS A;  3GMW A;  1NYY A;  3HLB A;  3A3I A;  1JWP A;  1MKI A;  1DJC A;  2Y2L A;  5HAI A;  1ES2 A;  4KZ5 A;  5TGF A;  2R9W A;  2ZC7 A;  1VM1 A;  3VSL A;  1PW8 A;  1K57 C;  1K55 C;  4RX2 A;  2H0T A;  5FAO A;  3GVB A;  5FDH A;  5F1F A;  1GCE A;  4HBU A;  1XGJ A;  5F83 A;  4Z9Q A;  1DY6 A;  4GD6 A;  4DXB A;  1RGY A;  4JBF A;  1L2S A;  2OLU A;  4Y7P A;  1HTZ A;  4QY5 A;  2WAE A;  3ITA A;  5CTM A;  4OP8 A;  1L0G A;  2FFF B;  1K25 A;  3M6H A;  5KZH A;  1FCO A;  1LHY A;  2XGN A;  2Y2O A;  4IVI A;  1Z6F A;  4DE0 A;  4IBR A;  3SS5 A;  3IHB A;  2HP5 A;  3G34 A;  1SCW A;  1W8Y A;  1H8Z A;  1QME A;  3VFH A;  1KE0 A;  5IHV A;  4DDY A;  3EQU A;  1BUL A;  2XK1 A;  5DVA A;  3RJU A;  3G32 A;  1YLZ A;  2Y2N A;  2CC1 A;  4GDB A;  3A3D A;  5DF7 A;  1KVL A;  3DTM A;  2RCX A;  3PBO A;  4KQR A;  4UA6 A;  3N4I A;  1ES4 A;  3IH9 A;  4A5R A;  1IKI A;  5GLD A;  3G2Y A;  1BUE A;  4BEN A;  1DJB A;  3ITB A;  5E2G A;  1FCN A;  3UY6 A;  1PI5 A;  3D4F A;  3O87 A;  4WZ5 C;  4PM6 A;  3HUO A;  5FAS A;  5E43 A;  2Y2I A;  2I72 A;  4RVA A;  1PIO A;  2ZC5 B;  2IWC A;  4NET A;  4RYE A;  3PBN A;  5EE8 A;  4GZB A;  2C6W B;  2ZQ7 A;  1H8Y A;  2UWX A;  4KEN B;  5DTK A;  4MBF A;  1KVM A;  2IWB A;  4GD8 A;  1LI0 A;  3UDI A;  1C3B A;  2ZQA A;  5GL9 A;  1PYY A;  4OQH A;  3RXX A;  1RCJ A;  1YLW A;  2ZQC A;  1K54 A;  3MXS A;  4BQM A;  4Q8I A;  2JCH A;  3C4O A;  3G4P A;  1BZA A;  4JF6 A;  4YFM A;  3TSG A;  4S2I A;  5AQ7 A;  3N8R A;  1ONG A;  3UN7 A;  4EQI A;  3SH8 A;  3GQZ A;  1IKG A;  2X71 A;  2ZM2 A;  4ZBE A;  4D2O A;  3O3V A;  5CEC A;  1PZP A;  4WM9 A;  1IYS A;  4FH2 A;  3UPN A;  3C5A A;  5CTN A;  5KSC A;  5GHX A;  2Y2G A;  3N8L A;  4JF5 A;  4OOM A;  2WKH A;  2JE5 A;  5CGS A;  4QY6 A;  3ZG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...