3TG9A

The crystal structure of penicillin binding protein from bacillus halodurans
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
329
structure length
322
Chain Sequence
b'MKNHLHTIMEDWKLSGTALMKKGEDIPFIASLGFANRAERIPNEHHTRFGIASGCKLFTAIAICQLVEAGKLSFDTPLSDWLDAPFPNVTIHHLLTHTSGVPDYFDEDLWKDVPMYHLRRLKDFLPLFQHAPMKFPPGHRFHYNNAGFILLGLVVESVSGVTFQEYVEANVFQRAGMHESGYFAFDTLPAKTALGYIDLEDGSWKTNLYSLPVIGGSDGGAYVTAEDMMKLWLALMRHELLNETYTQKLLTPHVHCEDDDYYGYGVWIKQQDGAISKYHVMGYDPGVCFHSAFYPTSNGIVVVCANQSSGAYDVMAAIEALF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein
molecule tags Penicillin binding protein
source organism Bacillus halodurans
publication title The crystal structure of penicillin binding protein from Bacillus halodurans
rcsb
total genus 102
structure length 322
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3tg9A00
5AQ9A 3VSLA 1Z6FA 1KGEA 3ZHHA 4OPYA 1SCWA 2Y55A 1H5XA 1PI5A 5EVIB 4S2LA 4WM9A 1W79A 1DY6A 2Z2LB 3NBLA 1SHVA 3G32A 3M6HA 3N8LA 5EECA 5EPHA 4HBUA 3UN7A 4B4XA 2ZC3B 3N7WA 3IXBA 4GNUA 4N1XA 5GLDA 4S2KA 3MBZA 4Q8IA 5CECA 5CEDA 2Y2OA 3BYDA 3VMAA 3N6IA 3C4PA 5CTNA 3OPPA 4DE1A 2GDNA 1GA0A 1ZKJA 2Z2MB 3QNCA 5A91A 1TVFA 1IELA 3O88A 4OLDA 5TR7A 4PM8A 1K56A 4LCMA 1KE3A 5F82A 4OP5A 4EBNA 4DKIA 4LV0A 1N9BA 1RCJA 4DE0A 4E3NA 2WUQA 2EX2A 3DWKA 3WRTA 3ZG0A 1DJAA 3A3DA 5DF9A 2FFFB 1Q2PA 3ZDJA 3NCKA 3ZGAB 1WE4A 3B3XA 3ZG5A 4JXSA 1K54A 1NY0A 3MXSA 2WK0A 1J9MA 2XD5A 3PBQA 1G68A 4KZBA 3ISGA 5CGXA 5CXWA 3V3SA 3VP3A 4X68A 2OLVA 4JLFA 1BSGA 1XX2A 4HESA 5KSCA 4OONA 4RX2A 1ES2A 1Q2QA 1KGGA 2ZQDA 2Y2PA 3M2KA 4IBRA 1MPLA 3UE1A 2P74A 4OOYA 5DTKA 4DXBA 1VQQA 2IWDA 4KQQA 2XQZA 1ES4A 4S2NC 1XXMA 2A3UA 4S2IA 5A93A 4R4SA 4ZBEA 1ES3A 2ZM0A 2IWCA 5DTSA 3HLFA 1E3UD 3A3FA 4LCLA 4OOLA 1ZG6A 5E2GA 5JYOA 3UY6A 3OPLA 1M6KA 3IWQA 2B5RA 1FR6A 2G2UA 3HLGA 3NC8A 3AGEA 3BFFA 3VFHA 1MWUA 5FQQA 4KZ4A 4Y7PA 4JXVA 1YLTA 1FSWA 3C4OA 1CEFA 2PU2A 1GA9A 2WYXA 3RJUA 4RA7A 3FZCA 3UPOA 3HUNA 2XR0A 1QMEA 4UAAA 5D3OA 1YLYA 3ZNTA 2BLSA 1L2SA 5CHMA 4CJNA 1ZG4A 2DNSA 1XP4A 2V20A 3PBOA 2Q9MA 1BTLA 2HDUA 4ID4A 1BLSA 4WMCD 3E2LA 3RXXA 3SS3A 4BLMA 4EBLA 5EOOA 3IXDA 1MY8A 4OQIA 4S2PA 5IHVA 4MBHA 1SKFA 3SOIA 3GTCA 5G18A 3WS0A 2RCXA 1PW8A 3G2YA 1K25A 1QMFA 4BL3A 2ZM2A 4B4ZA 3FKVA 4KG5A 5FAQA 1W8QA 5JYPA 4XXRA 1KDWA 5HFOA 2HP5A 2OLUA 2P9VB 4JF6A 1YM1A 4U0XA 3BFCA 4KQRA 1DJBA 5EVIC 4WYYA 4PPRA 2EX6A 3Q7ZA 1PW1A 4DDSA 1XGJA 2DRWA 3MZFA 3IF6A 4WZ4A 4KZ8A 5FQIA 2HDQA 2EX8A 3ZG9B 2HP9A 3FKWA 2E8IA 4PM7A 1JWZA 3TOIA 5E2FA 2JC7A 1HD8A 4JXGA 1IYSA 4C75A 1JWPA 5CGWA 3IXHA 1BULA 3Q1FA 5GHYA 2Y2MA 3LY4A 1ERMA 3BFDA 3O87A 4IBXA 1PZPA 3HBRA 4P6BA 4JF4A 1E3UA 3ITAA 3WRZA 3HLBA 2XK1A 1L0GA 5EVIA 4MEZA 3P09A 4C3QA 1HTZA 1NJ4A 5M19A 1IEMA 5FAOA 3VOYA 1OMEA 2G2WA 3MKEA 2WGWB 3ITBA 1MXOA 4GN2A 2Y2KA 2Y4AA 4X53A 1LL5A 4PMAA 4E3LA 3UO9A 4FD8A 5A92A 1CI8A 1FSYA 2XFTA 5CRFA 5FQ9A 5GLCA 2VGKA 3Q81A 1MWSA 1YMSA 4WBGA 1TDLA 4LV2A 1LI9A 4R4RA 2HPBA 1S0WA 4X56A 4WMCA 3WS1A 3SS4A 3S1YA 1HVBA 2EXBA 3W4OA 1U60A 4N9LA 3Q07A 4OPQA 3OPRA 3RXWA 4QY5A 3MXRA 2FFYA 1BLCA 4BD1A 3VP2A 3ZNYA 3PAEA 2XF3A 4X55A 1K57A 5M1AA 2WZZA 5FQMA 5FI6A 4KZ9A 5AQBA 5U47A 5J8XA 4PM5A 1BZAA 3G34A 3BLMA 1PWCA 3FWLA 4DRTA 1PI4A 4GB7A 4L0LA 5L2FA 4OPRA 1K55A 5FI7A 2Y91A 2ZC4B 5CHJA 4N92A 1IYQA 4WELA 5M18A 1ONGA 1MWTA 4GD6A 4S2NA 4WEKA 1XPBA 3BECA 2WAEA 2JBFA 2HP6A 3N4IA 4KZ5A 2Y2GA 4LV3A 4R23A 5HX9A 4RVAA 5HAQA 4IVIA 1MWRA 1NZOA 1LHYA 3PBNA 2R9WA 4JF5A 2QZ6A 4PM9A 3NDGA 3OPHA 1XKZA 2ZC6B 4KZAA 3ZG7B 3Q7VA 4O7DA 3IXGA 4Y0OA 1K6RA 1ONHA 5DVAA 5HAIA 3CJMA 3E2KA 2XD1A 4H8RA 1XGIA 5KSHA 4N9KA 3NIAA 3V39A 4EUZA 4R1GA 2A49A 2C6WB 2EXAA 2ZQ7A 2DCFA 4QY6A 3VFFA 3IF6C 5GLAA 4Y0UA 4RX3A 3QHYA 3UDIA 2V1ZA 3IF5A 1I2SA 2H5SA 2J8YA 3IHBA 5E2HA 3W4QA 1L0EA 4E3JA 1KVMA 4GD8A 1YQSA 5FQJA 4UA7A 2EX9A 1W8YA 3IH8A 4PM6A 3C5AA 5FSRA 5CTMA 4KENB 4BD0A 3FV7A 5DF7A 2J7VA 1HZOA 3DW0A 4E6WA 4OPZA 1KDSA 2Y59A 1JWVA 3GMWA 1JTGA 2X02A 2XFSA 2XDMA 5EUAA 4MNRA 4EQIA 1I5QA 5HL1A 1FCNA 4QB8A 1FOFA 1NYYA 4QU3A 4KZ6A 3IWOA 3Q7VB 4P0MA 2WKEA 3VSKA 1IKGA 1W5DA 4JXWA 3WS4A 3AGDA 3UPNA 1GHPA 3GQZA 4R3BA 3I7JA 4K0XA 4HEFA 5BOHA 5E43A 1BT5A 4OH0A 1VM1A 1C3BA 1I2WA 5FA7A 1EI5A 5GL9A 3TSGA 2ZD8A 3BM6A 4P87A 3VOZA 3HL9A 3P98A 3G31A 2QMIA 4GKUA 1K4FA 5EVID 2Y2IA 3HVFA 3ZFZA 1FCMA 2ZQCA 2C5WB 1K4EA 1NRFA 1NYMA 2J9PA 2Y2HA 3IHAA 4RYEA 3LO7A 1BLHA 1MKIA 3V50A 4BL2A 2WKHA 4K0WA 3ZVTA 4DXCA 4MLLA 3CMZA 3ZG8B 3DWZA 3GR2A 2EFXA 3C7UA 3NI9A 2ZQAA 3NDEA 3V5MA 1PWDA 5TFQA 4P85A 4WZ5C 2ZMAA 5FI2A 5KZHA 5DTTA 4GDNA 3M2JA 1AXBA 4JPMA 2Y2QA 1KGFA 3O3VA 1DJCA 1IYPA 4M3KA 3WS2A 1G6AA 3HUMA 4R3JA 4K91A 4A5RA 3ZVWA 4DF6A 3CG5A 4KG2A 3PAGA 4WEJA 5FQKA 2ZJ9A 1ERQA 1GHMA 3OCLA 4IVKA 4E3IA 2HDRA 4KZ7A 4X69A 2J9OA 4HBTA 3VP1A 2EFUA 2XEPA 3OC2A 4QD4A 3W8KA 4E3MA 1CI9A 4IEDA 4BQMA 1L0FA 1GCEA 5F1FA 3UDFA 1YLJA 3O86A 2WGWA 1XA1A 2X71A 2QPNA 3BFGA 4KZ3A 4UA6A 1FQGA 1ES5A 3CZDA 4XUXA 4YFMA 4Y0TA 2ZC7A 1O7EA 3HLEA 1XA7A 3PBSA 1RP5A 5HARA 3TG9A 3N8SA 1EWZA 2I72A 4WZ5A 4X6TA 3S22A 3A3EA 3HLDA 4FH4A 5GLBA 3IT9A 3MKFA 1CEGA 4DDYA 1PZOA 4S2OA 5FDHA 1H8ZA 1KE4A 2PBYA 4U3TA 2WGVA 2XH9A 3G30A 4NK3A 2OV5A 3EQUA 4ZDXA 1IKIA 4LV1A 4C6YA 2ZM8A 1FR1A 3BFEA 4ZAMA 1H8YA 1FCOA 1LI0A 1WYBA 3UPPA 2Y2NA 2VGJA 3G2ZA 3HUOA 4NETA 4KQOA 3IF6B 4U0TA 4FH2A 1E4DA 2Y2JA 3BRMA 1K54C 4OLGA 4GDBA 3VP4A 2WZXA 4MBFA 3G35A 4S2MA 3OZHA 3BLSA 3Q82A 4D2OA 4OVDA 4S2JA 2P9VA 4B88A 2H0TA 4QHCA 1BUEA 3HLWA 5A90A 2ZC5B 3SS5A 3IH9A 4GZBA 4MBKA 4EWFA 5I94A 1E25A 3N8RA 3A3JA 3AGFA 5CGSA 2ZQ9A 1YT4A 1YLPA 4Z9QA 3FYZA 4OP8A 1SDNA 3MZDA 2OSUA 2HDSA 4ZJ2A 1NZUA 3UE3A 1KVLA 1ALQA 4FCFA 4KG6A 1TDGA 3EQVA 3WWXA 3BEBA 5AQAA 2H0YA 1GHIA 1N4OA 5DF8A 4OOMA 1EROA 3UNWA 5HW3A 4OQHA 2BG1A 3MFDA 5CEBA 5KMWA 3WS5A 1BLPA 4OQGA 1RGYA 3OCNA 2XGNA 3SH9A 5HAPA 3HREA 1JTDA 1W7FA 5GHXA 1K56D 4EBPA 4JBFA 1YLWA 3UE0A 1KE0A 2PU4A 2H10A 2R9XA 3PBTA 1WYCA 2CC1A 5F83A 3PBRA 3V3RA 1ESUA 4YINA 4OQ0A 5E2EA 4OKPA 3S4XA 3UDXA 2V2FF 4LENA 3W4PA 5CHUA 1IYOA 3D4FA 4E3OA 3GVBA 1L0DA 5FASA 1LLBA 5FAPA 4E6XA 4QJGA 5GHZA 2XLNA 3NY4A 5EE8A 2IWBA 2WAFA 4EV4A 2WADA 1PIOA 4UHUA 4ZTKA 1MBLA 3JYIA 1LL9A 1K6SA 1M40A 1O07A 1TEMA 2UWXA 4R0QA 2RL3A 4ZJ3A 3VP0A 1K55C 4BENA 3M6BA 1ESIA 1PWGA 3ZCZA 3G4PA 1NXYA 3C7VA 2ZLYA 3HLCA 5EVLA 1SDEA 2Y2LA 5FATA 2WGIA 3DTMA 3GSGA 4ZJ1A 3IWIA 1K57C 2JCHA 3LCEA 3GV9A 5CERA 1YLZA 2X01A 1PYYA 4GOGA 4CPKA 2JE5A 4BJPA 5EOEA 2WKIA 3LY3A 3QNBA 5F1GA 1S6RA 3SH7A 4DE3A 4E3KA 3GRJA 4XUZA 4N1HA 4F94A 3MZEA 1CK3A 4FSFA 1YMXA 1K38A 3A3IA 3PTEA 4UA9A 3IQAA 3LEZA 1JVJA 3SH8A 2Q9NA 4DE2A 5AQ7A 1Y54A 1ZC2A 1RGZA 5TGFA 2ZQ8A 4JKTA
chains in the Genus database with same CATH superfamily
1DP9A 3ZHHA 1W79A 3NBLA 1SHVA 3N8LA 5F68A 3UN7A 3IXBA 2Y2OA 3VMAA 2LB9A 3KSIA 2VGLS 2M1CA 1ZKJA 2Z2MB 3QNCA 5A91A 1IELA 1VETB 2L1MA 3O88A 5TR7A 4LLOB 4OP5A 4MN7A 4DE0A 4E3NA 3SZTA 3WRTA 3ZG0A 3A3DA 3ZGAB 1WE4A 3ZG5A 5TBMB 1YPRA 3PBQA 3ISGA 3KSGA 3VP3A 4X68A 2W3DA 4X1MA 5KSCA 3UB8A 4Y13A 1MPLA 2P74A 4DXBA 2XQZA 3VE3A 5HDDA 4IHQA 5A93A 4R4SA 5EV0A 4DN0A 2IWCA 1ZG6A 1NLZA 3DBAA 3VFHA 4Y7PA 4JXVA 4MDZA 3C4OA 4HJ4A 1KOUA 1CEFA 2WYXA 3T12B 4HIAA 5TJJA 3PBOA 4ID4A 3MR0A 5EOOA 1K25A 3T1SA 1W8QA 3C30A 5JYPA 4XXRA 3RTYA 3QP1A 2OLUA 3T1XA 5I5LA 4KQRA 2OOLA 4WYYA 3Q7ZA 3T4QA 2DRWA 4YOFA 3MZFA 4LRXC 1ZTUA 4ZRRA 3QP4A 2HP9A 3CPTB 3FKWA 5E2FA 4EEPA 4JXGA 1Z09A 5CGWA 4O0PA 5GHYA 4EXOA 3BQAA 3LY4A 4EQ1A 4IBXA 3WRZA 2XK1A 2KLIA 4HH3A 1T1AA 5EVIA 4MEZA 2G2WA 3F1OA 3NOPC 4R3AA 3HJIA 2Y2KA 1CI8A 5FQ9A 1MWSA 3LEQA 1D1JA 1VEUA 3A0VA 3WS1A 1FIKA 1HVBA 3TW8A 3RXWA 4QY5A 1UWPX 3MXRA 1BLCA 4KZ9A 3BW6A 5U47A 4PM5A 3G34A 5HPFA 2ZL1B 4B9OA 2Q0OA 3LIEA 1X0OA 5M18A 4JGOA 4S2NA 5DFXA 2HP6A 2Y2GA 3R7WB 1FILA 4R6LA 4RVAA 3ZVWA 5CEDA 1XKZA 2ZC6B 4O7DA 3LIDA 1ONHA 1NWZA 2XD1A 3BY9A 4N9KA 4R70A 4EUZA 2C6WB 2ZQ7A 3VFFA 2GJ3A 4IUHA 2PAVP 1YKDA 2J8YA 5HPIA 4M4XA 4GD8A 1YQSA 4PM6A 2M7VA 3FV7A 4GS9A 2D02A 1HZOA 4E6WA 1JTGA 2XFSA 3F1NB 5HSQA 3A0SA 1NYYA 4QU3A 3IWOA 3BWLA 2WKEA 3WS4A 2BTFP 3AGDA 1GHPA 1PFLA 5BOHA 4HEFA 1H0MA 4LRYC 3PYPA 1EI5A 3TSGA 2ZD8A 4P87A 3CI6A 2V0UA 2Y2IA 3ZFZA 4NXBA 2ZL1A 5L10A 3V50A 2AVXA 4BL2A 5HZHA 3ZVTA 4MLLA 3DWZA 3GR2A 2EFXA 3C7UA 3EWKA 4P85A 4WZ5C 5KZHA 1W63M 4M3KA 3WS2A 3DTEA 4A5RA 2H28A 3CG5A 4KG2A 4IVKA 1ERQA 1GHMA 2KX6A 2EFUA 2XEPA 4QD4A 4BBTA 4IEDA 4R38A 1GCEA 4Y17A 4KZ3A 2QPNA 1ES5A 2ZC7A 3CUEA 1OPXA 4ETXA 5HARA 1EWZA 2I72A 3A3EA 3IT9A 1CEGA 5IS1A 4EW7A 2PBYA 2OV5A 3G30A 3EQUA 4ZDXA 4LV1A 4C6YA 3BFEA 4ZAMA 1LI0A 3UPPA 1XFQA 3G2ZA 4EERA 3IF6B 3NOTC 1K54C 4GDBA 3VP4A 2WZXA 4S2MA 3F1NA 2H0TA 4EEUA 3IH9A 4IUKA 2OSUA 3HCYA 3EQVA 2WKPA 5AQAA 2H0YA 3K2NA 3LUQA 3T4LA 1EROA 2QYBA 2BG1A 2XA7S 3IX3A 5EM0A 5KMWA 5HAPA 3MF0A 2PR6A 2OWHA 5F83A 1K0KA 2O9CA 1ESUA 4YINA 3S4XA 4QPRA 2V2FF 5CHUA 1IYOA 1L0DA 3P7NA 4KQDA 3NY4A 1F5MA 2WADA 3T4KA 1MBLA 1O07A 2FH5A 2RL3A 1K55C 2VGLM 5TBMA 2G7UA 1ESIA 2YKHA 5EVLA 1SDEA 2Y2LA 2WGIA 4WLAA 5CERA 2R78A 2W1TB 3LR4A 2JE5A 3QNBA 1S6RA 3SH7A 1OTEA 4HI4A 4L9EA 3MFXA 3L9KA 1K38A 3D72A 4Y15A 1Y54A 2GX5A 1Z6FA 5EVIB 3LYXA 2Z2LB 3G32A 4HBUA 5G4YA 3BYDA 1V9YA 5CTNA 1TVFA 4PM8A 4LCMA 4Q0JA 1KE3A 3KYZA 2PRFA 2XRNA 2O9BA 2W1TA 2K31A 4YNRA 1DJAA 3MMHA 1Q2PA 2W3GA 3IX8A 4JXSA 1ZHHB 2XD5A 1G68A 1Q2QA 1KGGA 2Y2PA 3M2KA 3UE1A 4OOYA 4Q0IA 1T1BA 5DTKA 3LI9A 1S4RA 4KQQA 2J80A 4X1LA 4S2NC 1XXMA 4S2IA 3UB7A 5DTSA 5JYOA 2XSSA 4CLCA 4HJ3A 2B5RA 4XT2A 3TJZC 3HLGA 3BFFA 5FQQA 4KZ4A 5FEFA 1N9LA 1XFNA 2XROA 4BBVA 3ZQ5A 3RJUA 2ZMFA 4UAAA 1QMEA 4JGPA 5D3OA 4CJNA 5CHMA 1ZG4A 2DNSA 4BLMA 3E2LA 3LR3A 3SS3A 3NHQA 3IXDA 2ZOIA 1OTAA 3GTCA 5G18A 3WS0A 1PW8A 1QMFA 4B4ZA 5CX7A 3FKVA 4F3LA 5F69A 5FAQA 2HP5A 2JKRM 2A2LA 1DJBA 5EVIC 1PW1A 5DJUA 4KZ8A 5FQIA 2HDQA 2EX8A 1JWZA 5HL6A 1VETA 2JC7A 1JWPA 2Y2MA 3S7NA 1PNEA 2EWWA 3CAXA 4P6BA 3HBRA 2HZ5A 4JF4A 1OT6A 4C3QA 1SZVA 1TF1A 5FAOA 1OMEA 1XJ3A 3MKEA 3ITBA 4GN2A 3JVUA 4X53A 3LGOA 2XFTA 5CRFA 5GLCA 3Q81A 4WBGA 1L3LA 1TDLA 4LV2A 4R4RA 1TS7A 1G28A 4WMCA 4WL9A 2EXBA 5DKKA 4GHIB 4BD1A 5HWTA 3PAEA 2XF3A 1K57A 5G4ZA 5AQBA 1BZAA 1PWCA 2MJ6A 3FWLA 4DRTA 1PI4A 4GB7A 4OPRA 2HF6A 2Y91A 3MQ0A 1MWTA 2WAEA 2JBFA 2ACGA 3N4IA 2BASA 4LV3A 4IVIA 1NZOA 1LHYA 3PBNA 2R9WA 4JF5A 3Q7VA 4MCWA 2INWA 3B47A 4KUOA 2W3HA 1SKOB 3NIAA 4R1GA 4GS9B 2OWJA 2A49A 1LSWA 4LFUA 2DCFA 3IF6C 4Y0UA 4RX3A 3UDIA 3IF5A 1I2SA 3S7OA 3P01A 2PT7A 2EX9A 2ZBBA 3T1QB 3RH8B 3UB9A 4KENB 4BD0A 1SKOA 2O0YA 4OPZA 3D9YA 3GMWA 2Z6CA 4MNRA 4EQIA 5HL1A 3TRCA 3VSKA 1W5DA 4JXWA 4HH2A 4R3BA 3I7JA 3C8CA 5FA7A 3K3CA 4HJ6A 3BM6A 3HL9A 2OAQ1 1K4FA 2JKFA 1K4EA 2J9PA 2Y2HA 3IHAA 1BLHA 1GSWA 1Y4OA 4K0WA 4MMNA 3ZG8B 3NI9A 2ZMAA 5DTTA 4GDNA 1KGFA 3O3VA 1IYPA 2V9AA 3CUEC 1G6AA 1GSVA 4R3JA 5KIZA 2QJ5A 1VEUB 2PYPA 5FQKA 4E3IA 2B02A 1YSPA 3VP1A 2KDKA 4BQMA 1L0FA 3MS6A 3UDFA 2WGWA 4XUXA 1FQGA 4YFMA 1XA7A 4JGRA 3TG9A 3N8SA 4LGWA 2M7UA 4WZ5A 4X6TA 4JGQA 4FH4A 5GLBA 3MKFA 4DDYA 1JNUA 4LPZA 4ARZA 2QJ7A 1KE4A 2XH9A 4NK3A 2O99A 1H8YA 3GECA 1WYBA 2PHYA 3O5YA 3HUOA 2ZMVA 4KQOA 4OLGA 2LB5A 3KSHA 4OVDA 4S2JA 2P9VA 4B88A 3L7HA 2DMWA 1BUEA 4GZBA 1S4SA 1P97A 3A3JA 2ZQ9A 1YT4A 4Z9QA 3LR5A 1KVLA 2VA0A 1TDGA 3NJAA 1BYWA 5DF8A 5F5YA 1XJ2A 3IBJA 1BLPA 1RGYA 3U2AA 1JTDA 2A24A 1K56D 4JBFA 1YLWA 1LSXA 2R9XA 3CITA 1N9OA 1H3QA 5E2EA 3UDXA 3EGXC 4E6XA 4QJGA 4EV4A 3MSHA 1K6SA 4R0QA 1M40A 1TEMA 4ME4A 4BENA 1XJ4A 4YWZA 3W2ZA 3OBFA 1NXYA 2W27A 4ZJ1A 3ULFA 3LIFA 2X01A 1V9ZA 4GOGA 4BJPA 5EOEA 3LY3A 2JKGA 3MZEA 3A3IA 4O01A 1WA9A 2KOIA 4Q0HA 1RGZA 1P9RA 3VSLA 4OPYA 1SCWA 2Y55A 1PI5A 4S2LA 4WM9A 3M6HA 3BQ8A 3CHWP 3LICA 2ZC3B 3N7WA 4GNUA 4N1XA 4Q8IA 3MBZA 2V1BA 3C4PA 3SW1A 3OPPA 4DE1A 2GDNA 1GA0A 5AJGA 3QP2A 1K56A 3CPTA 4HNBA 4EBNA 4LV0A 1N9BA 2WUQA 3ZDJA 3B3XA 1NY0A 2WK0A 4I38A 5CXWA 5CGXA 3G6OA 2OLVA 2ZOHA 4JLFA 4UEYA 4HESA 4OONA 3LIAA 1ES2A 2ZQDA 4IBRA 3B42A 3IS2B 1ES4A 4DJ3A 2A3UA 4ZBEA 1ES3A 2ZM0A 4LCLA 3A3FA 5E2GA 1TS0A 2V8FA 3OPLA 1M6KA 5C5KA 1FR6A 2G2UA 3FG8A 3NC8A 3AGEA 1MWUA 1YLTA 2PU2A 4RA7A 3UPOA 2PYRA 3K3DA 2XR0A 1YLYA 3ZNTA 2BLSA 1L2SA 2V20A 1BTLA 2HDUA 4WMCD 3B33A 3TE8A 3E4OA 4MBHA 1W63Q 3SOIA 4HOIA 2ZM2A 2E8JA 4FOFA 2Y8HA 1OTDA 4HY8A 3EEAA 1KDWA 2VLGA 2O9AA 4EUVA 2P9VB 4UQIM 4JF6A 1OTBA 3S7PA 1UWNX 3VOLA 4DDSA 1YSQA 3ZG9B 2E8IA 3TOIA 1HD8A 1BULA 3BFDA 3O87A 2QKPA 5K5BA 1PZPA 1E3UA 3ITAA 2FZ0A 1L0GA 2V0WA 3P09A 4DMZA 2HJ9C 1NJ4A 3NULA 3VOYA 4Z1WA 2WGWB 1OJ5A 2Y4AA 1LL5A 4NKPA 4FD8A 5A92A 4KUKA 4PKYG 2VGKA 2W1RA 3MXQA 4X56A 1LSVA 2Z6DA 1U60A 3Q07A 4II7A 2FFYA 2OAP1 1F9IA 3H9WA 5M1AA 2WZZA 3HJKA 5J8XA 3EGDC 3BLMA 1OJGA 3R4KA 2PD7A 4Y2FA 4G3VA 5FI7A 2ZC4B 1S67L 5CHJA 4N92A 4HP4A 1IYQA 4WELA 4NXEA 4GD6A 4I5SA 1XPBA 1YAXA 4KZ5A 4R23A 5HX9A 5HAQA 1Y28A 1MWRA 3PR6A 2QZ6A 3ZG7B 4Y0OA 2A24B 1K6RA 3RFBA 3CJMA 4H8RA 1XGIA 3V39A 4PKYA 4I39A 2V1ZA 2H5SA 2W3EA 3MQQA 3CWFA 1L0EA 3IBRA 5FQJA 4UA7A 1W8YA 3IH8A 4Y5FA 4HP9A 3U4LP 4NG2A 3BY8A 2V1AA 2Y59A 1JWVA 5EUAA 3T50A 1I5QA 1FOFA 2VV6A 3Q7VB 2VV8A 1IKGA 3UPNA 4I3IA 4NXFA 1BT5A 3H82A 4OH0A 1C3BA 1I2WA 5EM1A 5GL9A 3FC7A 4GKUA 2QMIA 4H6JB 2ZQCA 4L9FA 1NRFA 3LO7A 2WKHA 1STZA 3CMZA 3NDEA 5HDCA 5TFQA 4JPMA 3M2JA 2Y2QA 1DJCA 3HUMA 4K91A 2JN7A 4DF6A 5HD5A 5LBRA 3KYEA 4GLQA 1S1YA 2GNXA 2HDRA 2J9OA 2HGVA 4HBTA 4E3MA 3OC2A 1CI9A 1YLJA 2J3TD 3LIBA 1XA1A 2UV0E 4Y0TA 1LT0A 1TS8A 5J4EA 3HLDA 1PZOA 4S2OA 5FDHA 1H8ZA 4H6JA 4U3TA 2WGVA 4EESA 1IKIA 2ZM8A 1FR1A 2VV7A 2P08A 1VB6A 1F2KA 2VGJA 4NETA 5HWVA 1E4DA 3BRMA 1S66L 4GJ4A 4MBFA 3G35A 3BLSA 4D60A 2W0NA 1ODVA 4QHCA 3HLWA 5A90A 2ZC5B 3SS5A 4MBKA 5I94A 1E25A 2WKRA 3UB6A 3N8RA 3AGFA 1YLPA 3FYZA 4OP8A 1G5UA 3A0RA 3DTIA 1ALQA 1IFQA 4FCFA 3WWXA 4HQAA 1N9NA 3OLOA 4OOMA 3UNWA 4P6ZS 2CMNA 3WS5A 4OQGA 3OCNA 3SH9A 3HREA 1W7FA 3UE0A 4XT2B 2PU4A 2H10A 2CC1A 3PBRA 3R7WA 3V3RA 4OQ0A 5AVFA 4OKPA 5FEGA 4LENA 3W4PA 4E3OA 4HHDA 5GHZA 5EE8A 2IWBA 4ZTKA 4MN6A 3JYIA 4ZJ3A 4RQ9A 2PBDP 3ZCZA 1NLYA 3G4PA 3C7VA 2ZLYA 3HLCA 2XA7M 5FATA 3BJNA 2JKTI 3LCEA 1K57C 2JCHA 1YLZA 4DE3A 2JKTM 3FPWA 4XUZA 4F94A 1CK3A 4GW9A 1YMXA 5HD3A 1H8MA 3IQAA 1JVJA 2VKSA 3SH8A 4DE2A 2HV1A 1ZC2A 2ZQ8A 4JKTA 5AQ9A 1KGEA 4X25A 4MN5A 1H5XA 3KO6A 1DY6A 3T4OA 5EECA 5EPHA 4B4XA 4B93A 5CECA 5GLDA 4S2KA 3UE6A 3N6IA 2L4RA 4UQIS 4OLDA 3VE4A 3H7WA 5F82A 4DKIA 1RCJA 2EX2A 3DWKA 3PXPA 5DF9A 2FFFB 1XJ6A 1DP8A 3NCKA 1K54A 4NEED 3MXSA 1J9MA 4KZBA 3V3SA 1BSGA 1XX2A 5IU1A 2IA2A 4RX2A 1HLUP 2D01A 1VQQA 2IWDA 2J3WA 4IJGA 1NRJA 3FPVA 3HLFA 1E3UD 4OOLA 3UY6A 1PRQA 2PD8A 3IWQA 3F1PB 5EVEA 1D06A 4ETZA 2VK3A 1FSWA 3F1PA 1GA9A 5DFYA 3FZCA 3HUNA 4CLCB 2P04A 3PHYA 1XP4A 4CLCC 2Q9MA 3RXXA 4EBLA 1BLSA 4WF0A 1S1ZA 1P0ZA 1MY8A 4OQIA 4S2PA 5IHVA 3IS2A 1SKFA 2RCXA 3G2YA 5L07A 3EEHA 4I3AA 4BL3A 4KG5A 1OTIA 5HFOA 3E0YA 1YM1A 4U0XA 3BFCA 4PPRA 2EX6A 1XGJA 3IF6A 4WZ4A 3CLOA 3V67A 4DJ2A 4PHTA 4PM7A 3H7WB 1T19A 1IYSA 4C75A 4GCZA 2L0WA 3IXHA 3Q1FA 2EA9A 1ERMA 4ARZB 3T1RA 3HLBA 4BBUA 2Y79A 1HTZA 5M19A 1IEMA 3D3OA 1MXOA 3QP5A 4PMAA 4E3LA 3UO9A 1FSYA 1MZUA 1YMSA 1LI9A 2HPBA 1S0WA 3C38A 3SS4A 3S1YA 3W4OA 3NECA 4N9LA 1IOUA 4OPQA 3OPRA 3VP2A 3ZNYA 2YKFA 2QWSA 4X55A 4K08A 5FQMA 2P7JA 5FI6A 3UMEA 4FTXA 2VJWA 4L0LA 5L2FA 1K55A 4BMWA 1OT9A 3UMDA 1ONGA 1MKMA 4WEKA 3BECA 5J7EA 4PM9A 2GZAA 5A8BA 3NDGA 3OPHA 4KZAA 2WKQA 4PAUA 3IXGA 5DVAA 5MC7A 5HAIA 3E2KA 1GSXA 5KSHA 4WN5A 2EXAA 4QY6A 4WUJA 4LRZE 4G3KA 5GLAA 2VEAA 2PDRA 3QHYA 4CQHA 3IHBA 5E2HA 3W4QA 4E3JA 1KVMA 3QP8A 5EFWA 3E98A 3C5AA 5FSRA 2JKRI 1D7EA 3KX0X 5CTMA 1EW0A 5FL3A 5DF7A 2J7VA 3DW0A 4I3JA 1KDSA 3ICYA 2X02A 2XDMA 3EOIA 1FCNA 2VX8A 4QB8A 4KZ6A 4P0MA 3JPUA 2EWVA 3GQZA 2V8CA 4K0XA 5E43A 3IX4A 1VM1A 3VOZA 5J3WA 3P98A 3G31A 1MC0A 5EVID 3HVFA 1FCMA 2C5WB 1NYMA 4RYEA 1MKIA 5DJTA 4DXCA 4NXGA 2K7SA 3V5MA 5L09A 2ZQAA 3C2WA 1PWDA 5IT5A 5FI2A 1AWIA 1F98A 1AXBA 1T1CA 4L9GA 1DP6A 3PAGA 1A0KA 3OOVA 4WEJA 2NUTC 2ZJ9A 3OCLA 4KZ7A 4X69A 3W8KA 3E4QA 3E4PA 5L8MA 5F1FA 3O86A 2X71A 3BFGA 4UA6A 3CZDA 4CLCE 1O7EA 3HLEA 3PBSA 1RP5A 1CQAA 3S22A 4E04A 3VV4A 1DRMA 3MJQA 3S7QA 5DKLA 1J3WA 3MQOA 3ZYTA 1FCOA 3KYQA 3QP6A 3H82B 2Y2NA 2W3FA 3T4SA 4U0TA 4FH2A 2Y2JA 5HDSA 4O8GA 4Y3IA 3OZHA 3Q82A 3KSFA 5AVEA 2NUPC 4D2OA 1G6OA 4EU0A 4EWFA 4F3LB 2PR5A 4CLCD 5CGSA 1UGUA 1CJFA 1SDNA 3MZDA 3T4JA 2HDSA 4ZJ2A 1NZUA 3UE3A 4KG6A 2QHKA 1VHMA 3BEBA 2B95A 1ACFA 1GHIA 1N4OA 1P9WA 5HW3A 3LR0A 4OQHA 3MFDA 5CEBA 1LL8A 2XGNA 5GHXA 4EBPA 4BWIA 1KE0A 5FDSA 3DTKA 3PBTA 1WYCA 4G3WA 4P6ZM 3DAVA 1T18A 4ESPA 2B18A 3D4FA 3GVBA 1TD5A 5FASA 5HWWA 1LLBA 5FAPA 2XLNA 3LI8A 2WAFA 1PIOA 4UHUA 1LL9A 3GDIA 1CF0A 2UWXA 2VZWA 3VP0A 3LFVA 3M6BA 2K2NA 1PWGA 4FUWA 3T4TA 2HJEA 3JVVA 3DTMA 3GSGA 4EETB 3IWIA 3GV9A 2I9VA 1PYYA 3NOUC 4GHIA 2JHEA 4CPKA 4QWOA 2WKIA 5F1GA 4E3KA 3GRJA 4N1HA 2J3TC 4FSFA 3UB5P 1TS6A 3PTEA 4UA9A 3LEZA 2Q9NA 5AQ7A 5F6AA 5TGFA 4AFIA 3F1OB
chains in the Genus database with same CATH topology
5AQ9A 3VSLA 1Z6FA 1KGEA 3ZHHA 4OPYA 1SCWA 2Y55A 1H5XA 1PI5A 5EVIB 4S2LA 4WM9A 1W79A 1DY6A 2Z2LB 3NBLA 1SHVA 3G32A 3M6HA 3N8LA 5EECA 5EPHA 4HBUA 3UN7A 4B4XA 2ZC3B 3N7WA 3IXBA 4GNUA 4N1XA 5GLDA 4S2KA 3MBZA 4Q8IA 5CECA 5CEDA 2Y2OA 3BYDA 3VMAA 3N6IA 3C4PA 5CTNA 3OPPA 4DE1A 2GDNA 1GA0A 1ZKJA 2Z2MB 3QNCA 5A91A 1TVFA 1IELA 3O88A 4OLDA 5TR7A 4PM8A 1K56A 4LCMA 1KE3A 5F82A 4OP5A 4EBNA 4DKIA 4LV0A 1N9BA 1RCJA 4DE0A 4E3NA 2WUQA 2EX2A 3DWKA 3WRTA 3ZG0A 1DJAA 3A3DA 5DF9A 2FFFB 1Q2PA 3ZDJA 3NCKA 3ZGAB 1WE4A 3B3XA 3ZG5A 4JXSA 1K54A 1NY0A 3MXSA 2WK0A 1J9MA 2XD5A 3PBQA 1G68A 4KZBA 3ISGA 5CGXA 5CXWA 3V3SA 3VP3A 4X68A 2OLVA 4JLFA 1BSGA 1XX2A 4HESA 5KSCA 4OONA 4RX2A 1ES2A 1Q2QA 1KGGA 2ZQDA 2Y2PA 3M2KA 4IBRA 1MPLA 3UE1A 2P74A 4OOYA 5DTKA 4DXBA 1VQQA 2IWDA 4KQQA 2XQZA 1ES4A 4S2NC 1XXMA 2A3UA 4S2IA 5A93A 4R4SA 4ZBEA 1ES3A 2ZM0A 2IWCA 5DTSA 3HLFA 1E3UD 3A3FA 4LCLA 4OOLA 1ZG6A 5E2GA 5JYOA 3UY6A 3OPLA 1M6KA 3IWQA 2B5RA 1FR6A 2G2UA 3HLGA 3NC8A 3AGEA 3BFFA 3VFHA 1MWUA 5FQQA 4KZ4A 4Y7PA 4JXVA 1YLTA 1FSWA 3C4OA 1CEFA 2PU2A 1GA9A 2WYXA 3RJUA 4RA7A 3FZCA 3UPOA 3HUNA 2XR0A 1QMEA 4UAAA 5D3OA 1YLYA 3ZNTA 2BLSA 1L2SA 5CHMA 4CJNA 1ZG4A 2DNSA 1XP4A 2V20A 3PBOA 2Q9MA 1BTLA 2HDUA 4ID4A 1BLSA 4WMCD 3E2LA 3RXXA 3SS3A 4BLMA 4EBLA 5EOOA 3IXDA 1MY8A 4OQIA 4S2PA 5IHVA 4MBHA 1SKFA 3SOIA 3GTCA 5G18A 3WS0A 2RCXA 1PW8A 3G2YA 1K25A 1QMFA 4BL3A 2ZM2A 4B4ZA 3FKVA 4KG5A 5FAQA 1W8QA 5JYPA 4XXRA 1KDWA 5HFOA 2HP5A 2OLUA 2P9VB 4JF6A 1YM1A 4U0XA 3BFCA 4KQRA 1DJBA 5EVIC 4WYYA 4PPRA 2EX6A 3Q7ZA 1PW1A 4DDSA 1XGJA 2DRWA 3MZFA 3IF6A 4WZ4A 4KZ8A 5FQIA 2HDQA 2EX8A 3ZG9B 2HP9A 3FKWA 2E8IA 4PM7A 1JWZA 3TOIA 5E2FA 2JC7A 1HD8A 4JXGA 1IYSA 4C75A 1JWPA 5CGWA 3IXHA 1BULA 3Q1FA 5GHYA 2Y2MA 3LY4A 1ERMA 3BFDA 3O87A 4IBXA 1PZPA 3HBRA 4P6BA 4JF4A 1E3UA 3ITAA 3WRZA 3HLBA 2XK1A 1L0GA 5EVIA 4MEZA 3P09A 4C3QA 1HTZA 1NJ4A 5M19A 1IEMA 5FAOA 3VOYA 1OMEA 2G2WA 3MKEA 2WGWB 3ITBA 1MXOA 4GN2A 2Y2KA 2Y4AA 4X53A 1LL5A 4PMAA 4E3LA 3UO9A 4FD8A 5A92A 1CI8A 1FSYA 2XFTA 5CRFA 5FQ9A 5GLCA 2VGKA 3Q81A 1MWSA 1YMSA 4WBGA 1TDLA 4LV2A 1LI9A 4R4RA 2HPBA 1S0WA 4X56A 4WMCA 3WS1A 3SS4A 3S1YA 1HVBA 2EXBA 3W4OA 1U60A 4N9LA 3Q07A 4OPQA 3OPRA 3RXWA 4QY5A 3MXRA 2FFYA 1BLCA 4BD1A 3VP2A 3ZNYA 3PAEA 2XF3A 4X55A 1K57A 5M1AA 2WZZA 5FQMA 5FI6A 4KZ9A 5AQBA 5U47A 5J8XA 4PM5A 1BZAA 3G34A 3BLMA 1PWCA 3FWLA 4DRTA 1PI4A 4GB7A 4L0LA 5L2FA 4OPRA 1K55A 5FI7A 2Y91A 2ZC4B 5CHJA 4N92A 1IYQA 4WELA 5M18A 1ONGA 1MWTA 4GD6A 4S2NA 4WEKA 1XPBA 3BECA 2WAEA 2JBFA 2HP6A 3N4IA 4KZ5A 2Y2GA 4LV3A 4R23A 5HX9A 4RVAA 5HAQA 4IVIA 1MWRA 1NZOA 1LHYA 3PBNA 2R9WA 4JF5A 2QZ6A 4PM9A 3NDGA 3OPHA 1XKZA 2ZC6B 4KZAA 3ZG7B 3Q7VA 4O7DA 3IXGA 4Y0OA 1K6RA 1ONHA 5DVAA 5HAIA 3CJMA 3E2KA 2XD1A 4H8RA 1XGIA 5KSHA 4N9KA 3NIAA 3V39A 4EUZA 4R1GA 2A49A 2C6WB 2EXAA 2ZQ7A 2DCFA 4QY6A 3VFFA 3IF6C 5GLAA 4Y0UA 4RX3A 3QHYA 3UDIA 2V1ZA 3IF5A 1I2SA 2H5SA 2J8YA 3IHBA 5E2HA 3W4QA 1L0EA 4E3JA 1KVMA 4GD8A 1YQSA 5FQJA 4UA7A 2EX9A 1W8YA 3IH8A 4PM6A 3C5AA 5FSRA 5CTMA 4KENB 4BD0A 3FV7A 5DF7A 2J7VA 1HZOA 3DW0A 4E6WA 4OPZA 1KDSA 2Y59A 1JWVA 3GMWA 1JTGA 2X02A 2XFSA 2XDMA 5EUAA 4MNRA 4EQIA 1I5QA 5HL1A 1FCNA 4QB8A 1FOFA 1NYYA 4QU3A 4KZ6A 3IWOA 3Q7VB 4P0MA 2WKEA 3VSKA 1IKGA 1W5DA 4JXWA 3WS4A 3AGDA 3UPNA 1GHPA 3GQZA 4R3BA 3I7JA 4K0XA 4HEFA 5BOHA 5E43A 1BT5A 4OH0A 1VM1A 1C3BA 1I2WA 5FA7A 1EI5A 5GL9A 3TSGA 2ZD8A 3BM6A 4P87A 3VOZA 3HL9A 3P98A 3G31A 2QMIA 4GKUA 1K4FA 5EVID 2Y2IA 3HVFA 3ZFZA 1FCMA 2ZQCA 2C5WB 1K4EA 1NRFA 1NYMA 2J9PA 2Y2HA 3IHAA 4RYEA 3LO7A 1BLHA 1MKIA 3V50A 4BL2A 2WKHA 4K0WA 3ZVTA 4DXCA 4MLLA 3CMZA 3ZG8B 3DWZA 3GR2A 2EFXA 3C7UA 3NI9A 2ZQAA 3NDEA 3V5MA 1PWDA 5TFQA 4P85A 4WZ5C 2ZMAA 5FI2A 5KZHA 5DTTA 4GDNA 3M2JA 1AXBA 4JPMA 2Y2QA 1KGFA 3O3VA 1DJCA 1IYPA 4M3KA 3WS2A 1G6AA 3HUMA 4R3JA 4K91A 4A5RA 3ZVWA 4DF6A 3CG5A 4KG2A 3PAGA 4WEJA 5FQKA 2ZJ9A 1ERQA 1GHMA 3OCLA 4IVKA 4E3IA 2HDRA 4KZ7A 4X69A 2J9OA 4HBTA 3VP1A 2EFUA 2XEPA 3OC2A 4QD4A 3W8KA 4E3MA 1CI9A 4IEDA 4BQMA 1L0FA 1GCEA 5F1FA 3UDFA 1YLJA 3O86A 2WGWA 1XA1A 2X71A 2QPNA 3BFGA 4KZ3A 4UA6A 1FQGA 1ES5A 3CZDA 4XUXA 4YFMA 4Y0TA 2ZC7A 1O7EA 3HLEA 1XA7A 3PBSA 1RP5A 5HARA 3TG9A 3N8SA 1EWZA 2I72A 4WZ5A 4X6TA 3S22A 3A3EA 3HLDA 4FH4A 5GLBA 3IT9A 3MKFA 1CEGA 4DDYA 1PZOA 4S2OA 5FDHA 1H8ZA 1KE4A 2PBYA 4U3TA 2WGVA 2XH9A 3G30A 4NK3A 2OV5A 3EQUA 4ZDXA 1IKIA 4LV1A 4C6YA 2ZM8A 1FR1A 3BFEA 4ZAMA 1H8YA 1FCOA 1LI0A 1WYBA 3UPPA 2Y2NA 2VGJA 3G2ZA 3HUOA 4NETA 4KQOA 3IF6B 4U0TA 4FH2A 1E4DA 2Y2JA 3BRMA 1K54C 4OLGA 4GDBA 3VP4A 2WZXA 4MBFA 3G35A 4S2MA 3OZHA 3BLSA 3Q82A 4D2OA 4OVDA 4S2JA 2P9VA 4B88A 2H0TA 4QHCA 1BUEA 3HLWA 5A90A 2ZC5B 3SS5A 3IH9A 4GZBA 4MBKA 4EWFA 5I94A 1E25A 3N8RA 3A3JA 3AGFA 5CGSA 2ZQ9A 1YT4A 1YLPA 4Z9QA 3FYZA 4OP8A 1SDNA 3MZDA 2OSUA 2HDSA 4ZJ2A 1NZUA 3UE3A 1KVLA 1ALQA 4FCFA 4KG6A 1TDGA 3EQVA 3WWXA 3BEBA 5AQAA 2H0YA 1GHIA 1N4OA 5DF8A 4OOMA 1EROA 3UNWA 5HW3A 4OQHA 2BG1A 3MFDA 5CEBA 5KMWA 3WS5A 1BLPA 4OQGA 1RGYA 3OCNA 2XGNA 3SH9A 5HAPA 3HREA 1JTDA 1W7FA 5GHXA 1K56D 4EBPA 4JBFA 1YLWA 3UE0A 1KE0A 2PU4A 2H10A 2R9XA 3PBTA 1WYCA 2CC1A 5F83A 3PBRA 3V3RA 1ESUA 4YINA 4OQ0A 5E2EA 4OKPA 3S4XA 3UDXA 2V2FF 4LENA 3W4PA 5CHUA 1IYOA 3D4FA 4E3OA 3GVBA 1L0DA 5FASA 1LLBA 5FAPA 4E6XA 4QJGA 5GHZA 2XLNA 3NY4A 5EE8A 2IWBA 2WAFA 4EV4A 2WADA 1PIOA 4UHUA 4ZTKA 1MBLA 3JYIA 1LL9A 1K6SA 1M40A 1O07A 1TEMA 2UWXA 4R0QA 2RL3A 4ZJ3A 3VP0A 1K55C 4BENA 3M6BA 1ESIA 1PWGA 3ZCZA 3G4PA 1NXYA 3C7VA 2ZLYA 3HLCA 5EVLA 1SDEA 2Y2LA 5FATA 2WGIA 3DTMA 3GSGA 4ZJ1A 3IWIA 1K57C 2JCHA 3LCEA 3GV9A 5CERA 1YLZA 2X01A 1PYYA 4GOGA 4CPKA 2JE5A 4BJPA 5EOEA 2WKIA 3LY3A 3QNBA 5F1GA 1S6RA 3SH7A 4DE3A 4E3KA 3GRJA 4XUZA 4N1HA 4F94A 3MZEA 1CK3A 4FSFA 1YMXA 1K38A 3A3IA 3PTEA 4UA9A 3IQAA 3LEZA 1JVJA 3SH8A 2Q9NA 4DE2A 5AQ7A 1Y54A 1ZC2A 1RGZA 5TGFA 2ZQ8A 4JKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQ9 A;  3VSL A;  1Z6F A;  1KGE A;  3ZHH A;  4OPY A;  1SCW A;  2Y55 A;  1H5X A;  1PI5 A;  5EVI B;  4S2L A;  4WM9 A;  1W79 A;  1DY6 A;  2Z2L B;  3NBL A;  1SHV A;  3G32 A;  3M6H A;  3N8L A;  5EEC A;  5EPH A;  4HBU A;  3UN7 A;  4B4X A;  2ZC3 B;  3N7W A;  3IXB A;  4GNU A;  4N1X A;  5GLD A;  4S2K A;  3MBZ A;  4Q8I A;  5CEC A;  5CED A;  2Y2O A;  3BYD A;  3VMA A;  3N6I A;  3C4P A;  5CTN A;  3OPP A;  4DE1 A;  2GDN A;  1GA0 A;  1ZKJ A;  2Z2M B;  3QNC A;  5A91 A;  1TVF A;  1IEL A;  3O88 A;  4OLD A;  5TR7 A;  4PM8 A;  1K56 A;  4LCM A;  1KE3 A;  5F82 A;  4OP5 A;  4EBN A;  4DKI A;  4LV0 A;  1N9B A;  1RCJ A;  4DE0 A;  4E3N A;  2WUQ A;  2EX2 A;  3DWK A;  3WRT A;  3ZG0 A;  1DJA A;  3A3D A;  5DF9 A;  2FFF B;  1Q2P A;  3ZDJ A;  3NCK A;  3ZGA B;  1WE4 A;  3B3X A;  3ZG5 A;  4JXS A;  1K54 A;  1NY0 A;  3MXS A;  2WK0 A;  1J9M A;  2XD5 A;  3PBQ A;  1G68 A;  4KZB A;  3ISG A;  5CGX A;  5CXW A;  3V3S A;  3VP3 A;  4X68 A;  2OLV A;  4JLF A;  1BSG A;  1XX2 A;  4HES A;  5KSC A;  4OON A;  4RX2 A;  1ES2 A;  1Q2Q A;  1KGG A;  2ZQD A;  2Y2P A;  3M2K A;  4IBR A;  1MPL A;  3UE1 A;  2P74 A;  4OOY A;  5DTK A;  4DXB A;  1VQQ A;  2IWD A;  4KQQ A;  2XQZ A;  1ES4 A;  4S2N C;  1XXM A;  2A3U A;  4S2I A;  5A93 A;  4R4S A;  4ZBE A;  1ES3 A;  2ZM0 A;  2IWC A;  5DTS A;  3HLF A;  1E3U D;  3A3F A;  4LCL A;  4OOL A;  1ZG6 A;  5E2G A;  5JYO A;  3UY6 A;  3OPL A;  1M6K A;  3IWQ A;  2B5R A;  1FR6 A;  2G2U A;  3HLG A;  3NC8 A;  3AGE A;  3BFF A;  3VFH A;  1MWU A;  5FQQ A;  4KZ4 A;  4Y7P A;  4JXV A;  1YLT A;  1FSW A;  3C4O A;  1CEF A;  2PU2 A;  1GA9 A;  2WYX A;  3RJU A;  4RA7 A;  3FZC A;  3UPO A;  3HUN A;  2XR0 A;  1QME A;  4UAA A;  5D3O A;  1YLY A;  3ZNT A;  2BLS A;  1L2S A;  5CHM A;  4CJN A;  1ZG4 A;  2DNS A;  1XP4 A;  2V20 A;  3PBO A;  2Q9M A;  1BTL A;  2HDU A;  4ID4 A;  1BLS A;  4WMC D;  3E2L A;  3RXX A;  3SS3 A;  4BLM A;  4EBL A;  5EOO A;  3IXD A;  1MY8 A;  4OQI A;  4S2P A;  5IHV A;  4MBH A;  1SKF A;  3SOI A;  3GTC A;  5G18 A;  3WS0 A;  2RCX A;  1PW8 A;  3G2Y A;  1K25 A;  1QMF A;  4BL3 A;  2ZM2 A;  4B4Z A;  3FKV A;  4KG5 A;  5FAQ A;  1W8Q A;  5JYP A;  4XXR A;  1KDW A;  5HFO A;  2HP5 A;  2OLU A;  2P9V B;  4JF6 A;  1YM1 A;  4U0X A;  3BFC A;  4KQR A;  1DJB A;  5EVI C;  4WYY A;  4PPR A;  2EX6 A;  3Q7Z A;  1PW1 A;  4DDS A;  1XGJ A;  2DRW A;  3MZF A;  3IF6 A;  4WZ4 A;  4KZ8 A;  5FQI A;  2HDQ A;  2EX8 A;  3ZG9 B;  2HP9 A;  3FKW A;  2E8I A;  4PM7 A;  1JWZ A;  3TOI A;  5E2F A;  2JC7 A;  1HD8 A;  4JXG A;  1IYS A;  4C75 A;  1JWP A;  5CGW A;  3IXH A;  1BUL A;  3Q1F A;  5GHY A;  2Y2M A;  3LY4 A;  1ERM A;  3BFD A;  3O87 A;  4IBX A;  1PZP A;  3HBR A;  4P6B A;  4JF4 A;  1E3U A;  3ITA A;  3WRZ A;  3HLB A;  2XK1 A;  1L0G A;  5EVI A;  4MEZ A;  3P09 A;  4C3Q A;  1HTZ A;  1NJ4 A;  5M19 A;  1IEM A;  5FAO A;  3VOY A;  1OME A;  2G2W A;  3MKE A;  2WGW B;  3ITB A;  1MXO A;  4GN2 A;  2Y2K A;  2Y4A A;  4X53 A;  1LL5 A;  4PMA A;  4E3L A;  3UO9 A;  4FD8 A;  5A92 A;  1CI8 A;  1FSY A;  2XFT A;  5CRF A;  5FQ9 A;  5GLC A;  2VGK A;  3Q81 A;  1MWS A;  1YMS A;  4WBG A;  1TDL A;  4LV2 A;  1LI9 A;  4R4R A;  2HPB A;  1S0W A;  4X56 A;  4WMC A;  3WS1 A;  3SS4 A;  3S1Y A;  1HVB A;  2EXB A;  3W4O A;  1U60 A;  4N9L A;  3Q07 A;  4OPQ A;  3OPR A;  3RXW A;  4QY5 A;  3MXR A;  2FFY A;  1BLC A;  4BD1 A;  3VP2 A;  3ZNY A;  3PAE A;  2XF3 A;  4X55 A;  1K57 A;  5M1A A;  2WZZ A;  5FQM A;  5FI6 A;  4KZ9 A;  5AQB A;  5U47 A;  5J8X A;  4PM5 A;  1BZA A;  3G34 A;  3BLM A;  1PWC A;  3FWL A;  4DRT A;  1PI4 A;  4GB7 A;  4L0L A;  5L2F A;  4OPR A;  1K55 A;  5FI7 A;  2Y91 A;  2ZC4 B;  5CHJ A;  4N92 A;  1IYQ A;  4WEL A;  5M18 A;  1ONG A;  1MWT A;  4GD6 A;  4S2N A;  4WEK A;  1XPB A;  3BEC A;  2WAE A;  2JBF A;  2HP6 A;  3N4I A;  4KZ5 A;  2Y2G A;  4LV3 A;  4R23 A;  5HX9 A;  4RVA A;  5HAQ A;  4IVI A;  1MWR A;  1NZO A;  1LHY A;  3PBN A;  2R9W A;  4JF5 A;  2QZ6 A;  4PM9 A;  3NDG A;  3OPH A;  1XKZ A;  2ZC6 B;  4KZA A;  3ZG7 B;  3Q7V A;  4O7D A;  3IXG A;  4Y0O A;  1K6R A;  1ONH A;  5DVA A;  5HAI A;  3CJM A;  3E2K A;  2XD1 A;  4H8R A;  1XGI A;  5KSH A;  4N9K A;  3NIA A;  3V39 A;  4EUZ A;  4R1G A;  2A49 A;  2C6W B;  2EXA A;  2ZQ7 A;  2DCF A;  4QY6 A;  3VFF A;  3IF6 C;  5GLA A;  4Y0U A;  4RX3 A;  3QHY A;  3UDI A;  2V1Z A;  3IF5 A;  1I2S A;  2H5S A;  2J8Y A;  3IHB A;  5E2H A;  3W4Q A;  1L0E A;  4E3J A;  1KVM A;  4GD8 A;  1YQS A;  5FQJ A;  4UA7 A;  2EX9 A;  1W8Y A;  3IH8 A;  4PM6 A;  3C5A A;  5FSR A;  5CTM A;  4KEN B;  4BD0 A;  3FV7 A;  5DF7 A;  2J7V A;  1HZO A;  3DW0 A;  4E6W A;  4OPZ A;  1KDS A;  2Y59 A;  1JWV A;  3GMW A;  1JTG A;  2X02 A;  2XFS A;  2XDM A;  5EUA A;  4MNR A;  4EQI A;  1I5Q A;  5HL1 A;  1FCN A;  4QB8 A;  1FOF A;  1NYY A;  4QU3 A;  4KZ6 A;  3IWO A;  3Q7V B;  4P0M A;  2WKE A;  3VSK A;  1IKG A;  1W5D A;  4JXW A;  3WS4 A;  3AGD A;  3UPN A;  1GHP A;  3GQZ A;  4R3B A;  3I7J A;  4K0X A;  4HEF A;  5BOH A;  5E43 A;  1BT5 A;  4OH0 A;  1VM1 A;  1C3B A;  1I2W A;  5FA7 A;  1EI5 A;  5GL9 A;  3TSG A;  2ZD8 A;  3BM6 A;  4P87 A;  3VOZ A;  3HL9 A;  3P98 A;  3G31 A;  2QMI A;  4GKU A;  1K4F A;  5EVI D;  2Y2I A;  3HVF A;  3ZFZ A;  1FCM A;  2ZQC A;  2C5W B;  1K4E A;  1NRF A;  1NYM A;  2J9P A;  2Y2H A;  3IHA A;  4RYE A;  3LO7 A;  1BLH A;  1MKI A;  3V50 A;  4BL2 A;  2WKH A;  4K0W A;  3ZVT A;  4DXC A;  4MLL A;  3CMZ A;  3ZG8 B;  3DWZ A;  3GR2 A;  2EFX A;  3C7U A;  3NI9 A;  2ZQA A;  3NDE A;  3V5M A;  1PWD A;  5TFQ A;  4P85 A;  4WZ5 C;  2ZMA A;  5FI2 A;  5KZH A;  5DTT A;  4GDN A;  3M2J A;  1AXB A;  4JPM A;  2Y2Q A;  1KGF A;  3O3V A;  1DJC A;  1IYP A;  4M3K A;  3WS2 A;  1G6A A;  3HUM A;  4R3J A;  4K91 A;  4A5R A;  3ZVW A;  4DF6 A;  3CG5 A;  4KG2 A;  3PAG A;  4WEJ A;  5FQK A;  2ZJ9 A;  1ERQ A;  1GHM A;  3OCL A;  4IVK A;  4E3I A;  2HDR A;  4KZ7 A;  4X69 A;  2J9O A;  4HBT A;  3VP1 A;  2EFU A;  2XEP A;  3OC2 A;  4QD4 A;  3W8K A;  4E3M A;  1CI9 A;  4IED A;  4BQM A;  1L0F A;  1GCE A;  5F1F A;  3UDF A;  1YLJ A;  3O86 A;  2WGW A;  1XA1 A;  2X71 A;  2QPN A;  3BFG A;  4KZ3 A;  4UA6 A;  1FQG A;  1ES5 A;  3CZD A;  4XUX A;  4YFM A;  4Y0T A;  2ZC7 A;  1O7E A;  3HLE A;  1XA7 A;  3PBS A;  1RP5 A;  5HAR A;  3TG9 A;  3N8S A;  1EWZ A;  2I72 A;  4WZ5 A;  4X6T A;  3S22 A;  3A3E A;  3HLD A;  4FH4 A;  5GLB A;  3IT9 A;  3MKF A;  1CEG A;  4DDY A;  1PZO A;  4S2O A;  5FDH A;  1H8Z A;  1KE4 A;  2PBY A;  4U3T A;  2WGV A;  2XH9 A;  3G30 A;  4NK3 A;  2OV5 A;  3EQU A;  4ZDX A;  1IKI A;  4LV1 A;  4C6Y A;  2ZM8 A;  1FR1 A;  3BFE A;  4ZAM A;  1H8Y A;  1FCO A;  1LI0 A;  1WYB A;  3UPP A;  2Y2N A;  2VGJ A;  3G2Z A;  3HUO A;  4NET A;  4KQO A;  3IF6 B;  4U0T A;  4FH2 A;  1E4D A;  2Y2J A;  3BRM A;  1K54 C;  4OLG A;  4GDB A;  3VP4 A;  2WZX A;  4MBF A;  3G35 A;  4S2M A;  3OZH A;  3BLS A;  3Q82 A;  4D2O A;  4OVD A;  4S2J A;  2P9V A;  4B88 A;  2H0T A;  4QHC A;  1BUE A;  3HLW A;  5A90 A;  2ZC5 B;  3SS5 A;  3IH9 A;  4GZB A;  4MBK A;  4EWF A;  5I94 A;  1E25 A;  3N8R A;  3A3J A;  3AGF A;  5CGS A;  2ZQ9 A;  1YT4 A;  1YLP A;  4Z9Q A;  3FYZ A;  4OP8 A;  1SDN A;  3MZD A;  2OSU A;  2HDS A;  4ZJ2 A;  1NZU A;  3UE3 A;  1KVL A;  1ALQ A;  4FCF A;  4KG6 A;  1TDG A;  3EQV A;  3WWX A;  3BEB A;  5AQA A;  2H0Y A;  1GHI A;  1N4O A;  5DF8 A;  4OOM A;  1ERO A;  3UNW A;  5HW3 A;  4OQH A;  2BG1 A;  3MFD A;  5CEB A;  5KMW A;  3WS5 A;  1BLP A;  4OQG A;  1RGY A;  3OCN A;  2XGN A;  3SH9 A;  5HAP A;  3HRE A;  1JTD A;  1W7F A;  5GHX A;  1K56 D;  4EBP A;  4JBF A;  1YLW A;  3UE0 A;  1KE0 A;  2PU4 A;  2H10 A;  2R9X A;  3PBT A;  1WYC A;  2CC1 A;  5F83 A;  3PBR A;  3V3R A;  1ESU A;  4YIN A;  4OQ0 A;  5E2E A;  4OKP A;  3S4X A;  3UDX A;  2V2F F;  4LEN A;  3W4P A;  5CHU A;  1IYO A;  3D4F A;  4E3O A;  3GVB A;  1L0D A;  5FAS A;  1LLB A;  5FAP A;  4E6X A;  4QJG A;  5GHZ A;  2XLN A;  3NY4 A;  5EE8 A;  2IWB A;  2WAF A;  4EV4 A;  2WAD A;  1PIO A;  4UHU A;  4ZTK A;  1MBL A;  3JYI A;  1LL9 A;  1K6S A;  1M40 A;  1O07 A;  1TEM A;  2UWX A;  4R0Q A;  2RL3 A;  4ZJ3 A;  3VP0 A;  1K55 C;  4BEN A;  3M6B A;  1ESI A;  1PWG A;  3ZCZ A;  3G4P A;  1NXY A;  3C7V A;  2ZLY A;  3HLC A;  5EVL A;  1SDE A;  2Y2L A;  5FAT A;  2WGI A;  3DTM A;  3GSG A;  4ZJ1 A;  3IWI A;  1K57 C;  2JCH A;  3LCE A;  3GV9 A;  5CER A;  1YLZ A;  2X01 A;  1PYY A;  4GOG A;  4CPK A;  2JE5 A;  4BJP A;  5EOE A;  2WKI A;  3LY3 A;  3QNB A;  5F1G A;  1S6R A;  3SH7 A;  4DE3 A;  4E3K A;  3GRJ A;  4XUZ A;  4N1H A;  4F94 A;  3MZE A;  1CK3 A;  4FSF A;  1YMX A;  1K38 A;  3A3I A;  3PTE A;  4UA9 A;  3IQA A;  3LEZ A;  1JVJ A;  3SH8 A;  2Q9N A;  4DE2 A;  5AQ7 A;  1Y54 A;  1ZC2 A;  1RGZ A;  5TGF A;  2ZQ8 A;  4JKT A; 
#chains in the Genus database with same CATH topology
 1DP9 A;  3ZHH A;  1W79 A;  3NBL A;  1SHV A;  3N8L A;  5F68 A;  3UN7 A;  3IXB A;  2Y2O A;  3VMA A;  2LB9 A;  3KSI A;  2VGL S;  2M1C A;  1ZKJ A;  2Z2M B;  3QNC A;  5A91 A;  1IEL A;  1VET B;  2L1M A;  3O88 A;  5TR7 A;  4LLO B;  4OP5 A;  4MN7 A;  4DE0 A;  4E3N A;  3SZT A;  3WRT A;  3ZG0 A;  3A3D A;  3ZGA B;  1WE4 A;  3ZG5 A;  5TBM B;  1YPR A;  3PBQ A;  3ISG A;  3KSG A;  3VP3 A;  4X68 A;  2W3D A;  4X1M A;  5KSC A;  3UB8 A;  4Y13 A;  1MPL A;  2P74 A;  4DXB A;  2XQZ A;  3VE3 A;  5HDD A;  4IHQ A;  5A93 A;  4R4S A;  5EV0 A;  4DN0 A;  2IWC A;  1ZG6 A;  1NLZ A;  3DBA A;  3VFH A;  4Y7P A;  4JXV A;  4MDZ A;  3C4O A;  4HJ4 A;  1KOU A;  1CEF A;  2WYX A;  3T12 B;  4HIA A;  5TJJ A;  3PBO A;  4ID4 A;  3MR0 A;  5EOO A;  1K25 A;  3T1S A;  1W8Q A;  3C30 A;  5JYP A;  4XXR A;  3RTY A;  3QP1 A;  2OLU A;  3T1X A;  5I5L A;  4KQR A;  2OOL A;  4WYY A;  3Q7Z A;  3T4Q A;  2DRW A;  4YOF A;  3MZF A;  4LRX C;  1ZTU A;  4ZRR A;  3QP4 A;  2HP9 A;  3CPT B;  3FKW A;  5E2F A;  4EEP A;  4JXG A;  1Z09 A;  5CGW A;  4O0P A;  5GHY A;  4EXO A;  3BQA A;  3LY4 A;  4EQ1 A;  4IBX A;  3WRZ A;  2XK1 A;  2KLI A;  4HH3 A;  1T1A A;  5EVI A;  4MEZ A;  2G2W A;  3F1O A;  3NOP C;  4R3A A;  3HJI A;  2Y2K A;  1CI8 A;  5FQ9 A;  1MWS A;  3LEQ A;  1D1J A;  1VEU A;  3A0V A;  3WS1 A;  1FIK A;  1HVB A;  3TW8 A;  3RXW A;  4QY5 A;  1UWP X;  3MXR A;  1BLC A;  4KZ9 A;  3BW6 A;  5U47 A;  4PM5 A;  3G34 A;  5HPF A;  2ZL1 B;  4B9O A;  2Q0O A;  3LIE A;  1X0O A;  5M18 A;  4JGO A;  4S2N A;  5DFX A;  2HP6 A;  2Y2G A;  3R7W B;  1FIL A;  4R6L A;  4RVA A;  3ZVW A;  5CED A;  1XKZ A;  2ZC6 B;  4O7D A;  3LID A;  1ONH A;  1NWZ A;  2XD1 A;  3BY9 A;  4N9K A;  4R70 A;  4EUZ A;  2C6W B;  2ZQ7 A;  3VFF A;  2GJ3 A;  4IUH A;  2PAV P;  1YKD A;  2J8Y A;  5HPI A;  4M4X A;  4GD8 A;  1YQS A;  4PM6 A;  2M7V A;  3FV7 A;  4GS9 A;  2D02 A;  1HZO A;  4E6W A;  1JTG A;  2XFS A;  3F1N B;  5HSQ A;  3A0S A;  1NYY A;  4QU3 A;  3IWO A;  3BWL A;  2WKE A;  3WS4 A;  2BTF P;  3AGD A;  1GHP A;  1PFL A;  5BOH A;  4HEF A;  1H0M A;  4LRY C;  3PYP A;  1EI5 A;  3TSG A;  2ZD8 A;  4P87 A;  3CI6 A;  2V0U A;  2Y2I A;  3ZFZ A;  4NXB A;  2ZL1 A;  5L10 A;  3V50 A;  2AVX A;  4BL2 A;  5HZH A;  3ZVT A;  4MLL A;  3DWZ A;  3GR2 A;  2EFX A;  3C7U A;  3EWK A;  4P85 A;  4WZ5 C;  5KZH A;  1W63 M;  4M3K A;  3WS2 A;  3DTE A;  4A5R A;  2H28 A;  3CG5 A;  4KG2 A;  4IVK A;  1ERQ A;  1GHM A;  2KX6 A;  2EFU A;  2XEP A;  4QD4 A;  4BBT A;  4IED A;  4R38 A;  1GCE A;  4Y17 A;  4KZ3 A;  2QPN A;  1ES5 A;  2ZC7 A;  3CUE A;  1OPX A;  4ETX A;  5HAR A;  1EWZ A;  2I72 A;  3A3E A;  3IT9 A;  1CEG A;  5IS1 A;  4EW7 A;  2PBY A;  2OV5 A;  3G30 A;  3EQU A;  4ZDX A;  4LV1 A;  4C6Y A;  3BFE A;  4ZAM A;  1LI0 A;  3UPP A;  1XFQ A;  3G2Z A;  4EER A;  3IF6 B;  3NOT C;  1K54 C;  4GDB A;  3VP4 A;  2WZX A;  4S2M A;  3F1N A;  2H0T A;  4EEU A;  3IH9 A;  4IUK A;  2OSU A;  3HCY A;  3EQV A;  2WKP A;  5AQA A;  2H0Y A;  3K2N A;  3LUQ A;  3T4L A;  1ERO A;  2QYB A;  2BG1 A;  2XA7 S;  3IX3 A;  5EM0 A;  5KMW A;  5HAP A;  3MF0 A;  2PR6 A;  2OWH A;  5F83 A;  1K0K A;  2O9C A;  1ESU A;  4YIN A;  3S4X A;  4QPR A;  2V2F F;  5CHU A;  1IYO A;  1L0D A;  3P7N A;  4KQD A;  3NY4 A;  1F5M A;  2WAD A;  3T4K A;  1MBL A;  1O07 A;  2FH5 A;  2RL3 A;  1K55 C;  2VGL M;  5TBM A;  2G7U A;  1ESI A;  2YKH A;  5EVL A;  1SDE A;  2Y2L A;  2WGI A;  4WLA A;  5CER A;  2R78 A;  2W1T B;  3LR4 A;  2JE5 A;  3QNB A;  1S6R A;  3SH7 A;  1OTE A;  4HI4 A;  4L9E A;  3MFX A;  3L9K A;  1K38 A;  3D72 A;  4Y15 A;  1Y54 A;  2GX5 A;  1Z6F A;  5EVI B;  3LYX A;  2Z2L B;  3G32 A;  4HBU A;  5G4Y A;  3BYD A;  1V9Y A;  5CTN A;  1TVF A;  4PM8 A;  4LCM A;  4Q0J A;  1KE3 A;  3KYZ A;  2PRF A;  2XRN A;  2O9B A;  2W1T A;  2K31 A;  4YNR A;  1DJA A;  3MMH A;  1Q2P A;  2W3G A;  3IX8 A;  4JXS A;  1ZHH B;  2XD5 A;  1G68 A;  1Q2Q A;  1KGG A;  2Y2P A;  3M2K A;  3UE1 A;  4OOY A;  4Q0I A;  1T1B A;  5DTK A;  3LI9 A;  1S4R A;  4KQQ A;  2J80 A;  4X1L A;  4S2N C;  1XXM A;  4S2I A;  3UB7 A;  5DTS A;  5JYO A;  2XSS A;  4CLC A;  4HJ3 A;  2B5R A;  4XT2 A;  3TJZ C;  3HLG A;  3BFF A;  5FQQ A;  4KZ4 A;  5FEF A;  1N9L A;  1XFN A;  2XRO A;  4BBV A;  3ZQ5 A;  3RJU A;  2ZMF A;  4UAA A;  1QME A;  4JGP A;  5D3O A;  4CJN A;  5CHM A;  1ZG4 A;  2DNS A;  4BLM A;  3E2L A;  3LR3 A;  3SS3 A;  3NHQ A;  3IXD A;  2ZOI A;  1OTA A;  3GTC A;  5G18 A;  3WS0 A;  1PW8 A;  1QMF A;  4B4Z A;  5CX7 A;  3FKV A;  4F3L A;  5F69 A;  5FAQ A;  2HP5 A;  2JKR M;  2A2L A;  1DJB A;  5EVI C;  1PW1 A;  5DJU A;  4KZ8 A;  5FQI A;  2HDQ A;  2EX8 A;  1JWZ A;  5HL6 A;  1VET A;  2JC7 A;  1JWP A;  2Y2M A;  3S7N A;  1PNE A;  2EWW A;  3CAX A;  4P6B A;  3HBR A;  2HZ5 A;  4JF4 A;  1OT6 A;  4C3Q A;  1SZV A;  1TF1 A;  5FAO A;  1OME A;  1XJ3 A;  3MKE A;  3ITB A;  4GN2 A;  3JVU A;  4X53 A;  3LGO A;  2XFT A;  5CRF A;  5GLC A;  3Q81 A;  4WBG A;  1L3L A;  1TDL A;  4LV2 A;  4R4R A;  1TS7 A;  1G28 A;  4WMC A;  4WL9 A;  2EXB A;  5DKK A;  4GHI B;  4BD1 A;  5HWT A;  3PAE A;  2XF3 A;  1K57 A;  5G4Z A;  5AQB A;  1BZA A;  1PWC A;  2MJ6 A;  3FWL A;  4DRT A;  1PI4 A;  4GB7 A;  4OPR A;  2HF6 A;  2Y91 A;  3MQ0 A;  1MWT A;  2WAE A;  2JBF A;  2ACG A;  3N4I A;  2BAS A;  4LV3 A;  4IVI A;  1NZO A;  1LHY A;  3PBN A;  2R9W A;  4JF5 A;  3Q7V A;  4MCW A;  2INW A;  3B47 A;  4KUO A;  2W3H A;  1SKO B;  3NIA A;  4R1G A;  4GS9 B;  2OWJ A;  2A49 A;  1LSW A;  4LFU A;  2DCF A;  3IF6 C;  4Y0U A;  4RX3 A;  3UDI A;  3IF5 A;  1I2S A;  3S7O A;  3P01 A;  2PT7 A;  2EX9 A;  2ZBB A;  3T1Q B;  3RH8 B;  3UB9 A;  4KEN B;  4BD0 A;  1SKO A;  2O0Y A;  4OPZ A;  3D9Y A;  3GMW A;  2Z6C A;  4MNR A;  4EQI A;  5HL1 A;  3TRC A;  3VSK A;  1W5D A;  4JXW A;  4HH2 A;  4R3B A;  3I7J A;  3C8C A;  5FA7 A;  3K3C A;  4HJ6 A;  3BM6 A;  3HL9 A;  2OAQ 1;  1K4F A;  2JKF A;  1K4E A;  2J9P A;  2Y2H A;  3IHA A;  1BLH A;  1GSW A;  1Y4O A;  4K0W A;  4MMN A;  3ZG8 B;  3NI9 A;  2ZMA A;  5DTT A;  4GDN A;  1KGF A;  3O3V A;  1IYP A;  2V9A A;  3CUE C;  1G6A A;  1GSV A;  4R3J A;  5KIZ A;  2QJ5 A;  1VEU B;  2PYP A;  5FQK A;  4E3I A;  2B02 A;  1YSP A;  3VP1 A;  2KDK A;  4BQM A;  1L0F A;  3MS6 A;  3UDF A;  2WGW A;  4XUX A;  1FQG A;  4YFM A;  1XA7 A;  4JGR A;  3TG9 A;  3N8S A;  4LGW A;  2M7U A;  4WZ5 A;  4X6T A;  4JGQ A;  4FH4 A;  5GLB A;  3MKF A;  4DDY A;  1JNU A;  4LPZ A;  4ARZ A;  2QJ7 A;  1KE4 A;  2XH9 A;  4NK3 A;  2O99 A;  1H8Y A;  3GEC A;  1WYB A;  2PHY A;  3O5Y A;  3HUO A;  2ZMV A;  4KQO A;  4OLG A;  2LB5 A;  3KSH A;  4OVD A;  4S2J A;  2P9V A;  4B88 A;  3L7H A;  2DMW A;  1BUE A;  4GZB A;  1S4S A;  1P97 A;  3A3J A;  2ZQ9 A;  1YT4 A;  4Z9Q A;  3LR5 A;  1KVL A;  2VA0 A;  1TDG A;  3NJA A;  1BYW A;  5DF8 A;  5F5Y A;  1XJ2 A;  3IBJ A;  1BLP A;  1RGY A;  3U2A A;  1JTD A;  2A24 A;  1K56 D;  4JBF A;  1YLW A;  1LSX A;  2R9X A;  3CIT A;  1N9O A;  1H3Q A;  5E2E A;  3UDX A;  3EGX C;  4E6X A;  4QJG A;  4EV4 A;  3MSH A;  1K6S A;  4R0Q A;  1M40 A;  1TEM A;  4ME4 A;  4BEN A;  1XJ4 A;  4YWZ A;  3W2Z A;  3OBF A;  1NXY A;  2W27 A;  4ZJ1 A;  3ULF A;  3LIF A;  2X01 A;  1V9Z A;  4GOG A;  4BJP A;  5EOE A;  3LY3 A;  2JKG A;  3MZE A;  3A3I A;  4O01 A;  1WA9 A;  2KOI A;  4Q0H A;  1RGZ A;  1P9R A;  3VSL A;  4OPY A;  1SCW A;  2Y55 A;  1PI5 A;  4S2L A;  4WM9 A;  3M6H A;  3BQ8 A;  3CHW P;  3LIC A;  2ZC3 B;  3N7W A;  4GNU A;  4N1X A;  4Q8I A;  3MBZ A;  2V1B A;  3C4P A;  3SW1 A;  3OPP A;  4DE1 A;  2GDN A;  1GA0 A;  5AJG A;  3QP2 A;  1K56 A;  3CPT A;  4HNB A;  4EBN A;  4LV0 A;  1N9B A;  2WUQ A;  3ZDJ A;  3B3X A;  1NY0 A;  2WK0 A;  4I38 A;  5CXW A;  5CGX A;  3G6O A;  2OLV A;  2ZOH A;  4JLF A;  4UEY A;  4HES A;  4OON A;  3LIA A;  1ES2 A;  2ZQD A;  4IBR A;  3B42 A;  3IS2 B;  1ES4 A;  4DJ3 A;  2A3U A;  4ZBE A;  1ES3 A;  2ZM0 A;  4LCL A;  3A3F A;  5E2G A;  1TS0 A;  2V8F A;  3OPL A;  1M6K A;  5C5K A;  1FR6 A;  2G2U A;  3FG8 A;  3NC8 A;  3AGE A;  1MWU A;  1YLT A;  2PU2 A;  4RA7 A;  3UPO A;  2PYR A;  3K3D A;  2XR0 A;  1YLY A;  3ZNT A;  2BLS A;  1L2S A;  2V20 A;  1BTL A;  2HDU A;  4WMC D;  3B33 A;  3TE8 A;  3E4O A;  4MBH A;  1W63 Q;  3SOI A;  4HOI A;  2ZM2 A;  2E8J A;  4FOF A;  2Y8H A;  1OTD A;  4HY8 A;  3EEA A;  1KDW A;  2VLG A;  2O9A A;  4EUV A;  2P9V B;  4UQI M;  4JF6 A;  1OTB A;  3S7P A;  1UWN X;  3VOL A;  4DDS A;  1YSQ A;  3ZG9 B;  2E8I A;  3TOI A;  1HD8 A;  1BUL A;  3BFD A;  3O87 A;  2QKP A;  5K5B A;  1PZP A;  1E3U A;  3ITA A;  2FZ0 A;  1L0G A;  2V0W A;  3P09 A;  4DMZ A;  2HJ9 C;  1NJ4 A;  3NUL A;  3VOY A;  4Z1W A;  2WGW B;  1OJ5 A;  2Y4A A;  1LL5 A;  4NKP A;  4FD8 A;  5A92 A;  4KUK A;  4PKY G;  2VGK A;  2W1R A;  3MXQ A;  4X56 A;  1LSV A;  2Z6D A;  1U60 A;  3Q07 A;  4II7 A;  2FFY A;  2OAP 1;  1F9I A;  3H9W A;  5M1A A;  2WZZ A;  3HJK A;  5J8X A;  3EGD C;  3BLM A;  1OJG A;  3R4K A;  2PD7 A;  4Y2F A;  4G3V A;  5FI7 A;  2ZC4 B;  1S67 L;  5CHJ A;  4N92 A;  4HP4 A;  1IYQ A;  4WEL A;  4NXE A;  4GD6 A;  4I5S A;  1XPB A;  1YAX A;  4KZ5 A;  4R23 A;  5HX9 A;  5HAQ A;  1Y28 A;  1MWR A;  3PR6 A;  2QZ6 A;  3ZG7 B;  4Y0O A;  2A24 B;  1K6R A;  3RFB A;  3CJM A;  4H8R A;  1XGI A;  3V39 A;  4PKY A;  4I39 A;  2V1Z A;  2H5S A;  2W3E A;  3MQQ A;  3CWF A;  1L0E A;  3IBR A;  5FQJ A;  4UA7 A;  1W8Y A;  3IH8 A;  4Y5F A;  4HP9 A;  3U4L P;  4NG2 A;  3BY8 A;  2V1A A;  2Y59 A;  1JWV A;  5EUA A;  3T50 A;  1I5Q A;  1FOF A;  2VV6 A;  3Q7V B;  2VV8 A;  1IKG A;  3UPN A;  4I3I A;  4NXF A;  1BT5 A;  3H82 A;  4OH0 A;  1C3B A;  1I2W A;  5EM1 A;  5GL9 A;  3FC7 A;  4GKU A;  2QMI A;  4H6J B;  2ZQC A;  4L9F A;  1NRF A;  3LO7 A;  2WKH A;  1STZ A;  3CMZ A;  3NDE A;  5HDC A;  5TFQ A;  4JPM A;  3M2J A;  2Y2Q A;  1DJC A;  3HUM A;  4K91 A;  2JN7 A;  4DF6 A;  5HD5 A;  5LBR A;  3KYE A;  4GLQ A;  1S1Y A;  2GNX A;  2HDR A;  2J9O A;  2HGV A;  4HBT A;  4E3M A;  3OC2 A;  1CI9 A;  1YLJ A;  2J3T D;  3LIB A;  1XA1 A;  2UV0 E;  4Y0T A;  1LT0 A;  1TS8 A;  5J4E A;  3HLD A;  1PZO A;  4S2O A;  5FDH A;  1H8Z A;  4H6J A;  4U3T A;  2WGV A;  4EES A;  1IKI A;  2ZM8 A;  1FR1 A;  2VV7 A;  2P08 A;  1VB6 A;  1F2K A;  2VGJ A;  4NET A;  5HWV A;  1E4D A;  3BRM A;  1S66 L;  4GJ4 A;  4MBF A;  3G35 A;  3BLS A;  4D60 A;  2W0N A;  1ODV A;  4QHC A;  3HLW A;  5A90 A;  2ZC5 B;  3SS5 A;  4MBK A;  5I94 A;  1E25 A;  2WKR A;  3UB6 A;  3N8R A;  3AGF A;  1YLP A;  3FYZ A;  4OP8 A;  1G5U A;  3A0R A;  3DTI A;  1ALQ A;  1IFQ A;  4FCF A;  3WWX A;  4HQA A;  1N9N A;  3OLO A;  4OOM A;  3UNW A;  4P6Z S;  2CMN A;  3WS5 A;  4OQG A;  3OCN A;  3SH9 A;  3HRE A;  1W7F A;  3UE0 A;  4XT2 B;  2PU4 A;  2H10 A;  2CC1 A;  3PBR A;  3R7W A;  3V3R A;  4OQ0 A;  5AVF A;  4OKP A;  5FEG A;  4LEN A;  3W4P A;  4E3O A;  4HHD A;  5GHZ A;  5EE8 A;  2IWB A;  4ZTK A;  4MN6 A;  3JYI A;  4ZJ3 A;  4RQ9 A;  2PBD P;  3ZCZ A;  1NLY A;  3G4P A;  3C7V A;  2ZLY A;  3HLC A;  2XA7 M;  5FAT A;  3BJN A;  2JKT I;  3LCE A;  1K57 C;  2JCH A;  1YLZ A;  4DE3 A;  2JKT M;  3FPW A;  4XUZ A;  4F94 A;  1CK3 A;  4GW9 A;  1YMX A;  5HD3 A;  1H8M A;  3IQA A;  1JVJ A;  2VKS A;  3SH8 A;  4DE2 A;  2HV1 A;  1ZC2 A;  2ZQ8 A;  4JKT A;  5AQ9 A;  1KGE A;  4X25 A;  4MN5 A;  1H5X A;  3KO6 A;  1DY6 A;  3T4O A;  5EEC A;  5EPH A;  4B4X A;  4B93 A;  5CEC A;  5GLD A;  4S2K A;  3UE6 A;  3N6I A;  2L4R A;  4UQI S;  4OLD A;  3VE4 A;  3H7W A;  5F82 A;  4DKI A;  1RCJ A;  2EX2 A;  3DWK A;  3PXP A;  5DF9 A;  2FFF B;  1XJ6 A;  1DP8 A;  3NCK A;  1K54 A;  4NEE D;  3MXS A;  1J9M A;  4KZB A;  3V3S A;  1BSG A;  1XX2 A;  5IU1 A;  2IA2 A;  4RX2 A;  1HLU P;  2D01 A;  1VQQ A;  2IWD A;  2J3W A;  4IJG A;  1NRJ A;  3FPV A;  3HLF A;  1E3U D;  4OOL A;  3UY6 A;  1PRQ A;  2PD8 A;  3IWQ A;  3F1P B;  5EVE A;  1D06 A;  4ETZ A;  2VK3 A;  1FSW A;  3F1P A;  1GA9 A;  5DFY A;  3FZC A;  3HUN A;  4CLC B;  2P04 A;  3PHY A;  1XP4 A;  4CLC C;  2Q9M A;  3RXX A;  4EBL A;  1BLS A;  4WF0 A;  1S1Z A;  1P0Z A;  1MY8 A;  4OQI A;  4S2P A;  5IHV A;  3IS2 A;  1SKF A;  2RCX A;  3G2Y A;  5L07 A;  3EEH A;  4I3A A;  4BL3 A;  4KG5 A;  1OTI A;  5HFO A;  3E0Y A;  1YM1 A;  4U0X A;  3BFC A;  4PPR A;  2EX6 A;  1XGJ A;  3IF6 A;  4WZ4 A;  3CLO A;  3V67 A;  4DJ2 A;  4PHT A;  4PM7 A;  3H7W B;  1T19 A;  1IYS A;  4C75 A;  4GCZ A;  2L0W A;  3IXH A;  3Q1F A;  2EA9 A;  1ERM A;  4ARZ B;  3T1R A;  3HLB A;  4BBU A;  2Y79 A;  1HTZ A;  5M19 A;  1IEM A;  3D3O A;  1MXO A;  3QP5 A;  4PMA A;  4E3L A;  3UO9 A;  1FSY A;  1MZU A;  1YMS A;  1LI9 A;  2HPB A;  1S0W A;  3C38 A;  3SS4 A;  3S1Y A;  3W4O A;  3NEC A;  4N9L A;  1IOU A;  4OPQ A;  3OPR A;  3VP2 A;  3ZNY A;  2YKF A;  2QWS A;  4X55 A;  4K08 A;  5FQM A;  2P7J A;  5FI6 A;  3UME A;  4FTX A;  2VJW A;  4L0L A;  5L2F A;  1K55 A;  4BMW A;  1OT9 A;  3UMD A;  1ONG A;  1MKM A;  4WEK A;  3BEC A;  5J7E A;  4PM9 A;  2GZA A;  5A8B A;  3NDG A;  3OPH A;  4KZA A;  2WKQ A;  4PAU A;  3IXG A;  5DVA A;  5MC7 A;  5HAI A;  3E2K A;  1GSX A;  5KSH A;  4WN5 A;  2EXA A;  4QY6 A;  4WUJ A;  4LRZ E;  4G3K A;  5GLA A;  2VEA A;  2PDR A;  3QHY A;  4CQH A;  3IHB A;  5E2H A;  3W4Q A;  4E3J A;  1KVM A;  3QP8 A;  5EFW A;  3E98 A;  3C5A A;  5FSR A;  2JKR I;  1D7E A;  3KX0 X;  5CTM A;  1EW0 A;  5FL3 A;  5DF7 A;  2J7V A;  3DW0 A;  4I3J A;  1KDS A;  3ICY A;  2X02 A;  2XDM A;  3EOI A;  1FCN A;  2VX8 A;  4QB8 A;  4KZ6 A;  4P0M A;  3JPU A;  2EWV A;  3GQZ A;  2V8C A;  4K0X A;  5E43 A;  3IX4 A;  1VM1 A;  3VOZ A;  5J3W A;  3P98 A;  3G31 A;  1MC0 A;  5EVI D;  3HVF A;  1FCM A;  2C5W B;  1NYM A;  4RYE A;  1MKI A;  5DJT A;  4DXC A;  4NXG A;  2K7S A;  3V5M A;  5L09 A;  2ZQA A;  3C2W A;  1PWD A;  5IT5 A;  5FI2 A;  1AWI A;  1F98 A;  1AXB A;  1T1C A;  4L9G A;  1DP6 A;  3PAG A;  1A0K A;  3OOV A;  4WEJ A;  2NUT C;  2ZJ9 A;  3OCL A;  4KZ7 A;  4X69 A;  3W8K A;  3E4Q A;  3E4P A;  5L8M A;  5F1F A;  3O86 A;  2X71 A;  3BFG A;  4UA6 A;  3CZD A;  4CLC E;  1O7E A;  3HLE A;  3PBS A;  1RP5 A;  1CQA A;  3S22 A;  4E04 A;  3VV4 A;  1DRM A;  3MJQ A;  3S7Q A;  5DKL A;  1J3W A;  3MQO A;  3ZYT A;  1FCO A;  3KYQ A;  3QP6 A;  3H82 B;  2Y2N A;  2W3F A;  3T4S A;  4U0T A;  4FH2 A;  2Y2J A;  5HDS A;  4O8G A;  4Y3I A;  3OZH A;  3Q82 A;  3KSF A;  5AVE A;  2NUP C;  4D2O A;  1G6O A;  4EU0 A;  4EWF A;  4F3L B;  2PR5 A;  4CLC D;  5CGS A;  1UGU A;  1CJF A;  1SDN A;  3MZD A;  3T4J A;  2HDS A;  4ZJ2 A;  1NZU A;  3UE3 A;  4KG6 A;  2QHK A;  1VHM A;  3BEB A;  2B95 A;  1ACF A;  1GHI A;  1N4O A;  1P9W A;  5HW3 A;  3LR0 A;  4OQH A;  3MFD A;  5CEB A;  1LL8 A;  2XGN A;  5GHX A;  4EBP A;  4BWI A;  1KE0 A;  5FDS A;  3DTK A;  3PBT A;  1WYC A;  4G3W A;  4P6Z M;  3DAV A;  1T18 A;  4ESP A;  2B18 A;  3D4F A;  3GVB A;  1TD5 A;  5FAS A;  5HWW A;  1LLB A;  5FAP A;  2XLN A;  3LI8 A;  2WAF A;  1PIO A;  4UHU A;  1LL9 A;  3GDI A;  1CF0 A;  2UWX A;  2VZW A;  3VP0 A;  3LFV A;  3M6B A;  2K2N A;  1PWG A;  4FUW A;  3T4T A;  2HJE A;  3JVV A;  3DTM A;  3GSG A;  4EET B;  3IWI A;  3GV9 A;  2I9V A;  1PYY A;  3NOU C;  4GHI A;  2JHE A;  4CPK A;  4QWO A;  2WKI A;  5F1G A;  4E3K A;  3GRJ A;  4N1H A;  2J3T C;  4FSF A;  3UB5 P;  1TS6 A;  3PTE A;  4UA9 A;  3LEZ A;  2Q9N A;  5AQ7 A;  5F6A A;  5TGF A;  4AFI A;  3F1O B; 
#chains in the Genus database with same CATH homology
 5AQ9 A;  3VSL A;  1Z6F A;  1KGE A;  3ZHH A;  4OPY A;  1SCW A;  2Y55 A;  1H5X A;  1PI5 A;  5EVI B;  4S2L A;  4WM9 A;  1W79 A;  1DY6 A;  2Z2L B;  3NBL A;  1SHV A;  3G32 A;  3M6H A;  3N8L A;  5EEC A;  5EPH A;  4HBU A;  3UN7 A;  4B4X A;  2ZC3 B;  3N7W A;  3IXB A;  4GNU A;  4N1X A;  5GLD A;  4S2K A;  3MBZ A;  4Q8I A;  5CEC A;  5CED A;  2Y2O A;  3BYD A;  3VMA A;  3N6I A;  3C4P A;  5CTN A;  3OPP A;  4DE1 A;  2GDN A;  1GA0 A;  1ZKJ A;  2Z2M B;  3QNC A;  5A91 A;  1TVF A;  1IEL A;  3O88 A;  4OLD A;  5TR7 A;  4PM8 A;  1K56 A;  4LCM A;  1KE3 A;  5F82 A;  4OP5 A;  4EBN A;  4DKI A;  4LV0 A;  1N9B A;  1RCJ A;  4DE0 A;  4E3N A;  2WUQ A;  2EX2 A;  3DWK A;  3WRT A;  3ZG0 A;  1DJA A;  3A3D A;  5DF9 A;  2FFF B;  1Q2P A;  3ZDJ A;  3NCK A;  3ZGA B;  1WE4 A;  3B3X A;  3ZG5 A;  4JXS A;  1K54 A;  1NY0 A;  3MXS A;  2WK0 A;  1J9M A;  2XD5 A;  3PBQ A;  1G68 A;  4KZB A;  3ISG A;  5CGX A;  5CXW A;  3V3S A;  3VP3 A;  4X68 A;  2OLV A;  4JLF A;  1BSG A;  1XX2 A;  4HES A;  5KSC A;  4OON A;  4RX2 A;  1ES2 A;  1Q2Q A;  1KGG A;  2ZQD A;  2Y2P A;  3M2K A;  4IBR A;  1MPL A;  3UE1 A;  2P74 A;  4OOY A;  5DTK A;  4DXB A;  1VQQ A;  2IWD A;  4KQQ A;  2XQZ A;  1ES4 A;  4S2N C;  1XXM A;  2A3U A;  4S2I A;  5A93 A;  4R4S A;  4ZBE A;  1ES3 A;  2ZM0 A;  2IWC A;  5DTS A;  3HLF A;  1E3U D;  3A3F A;  4LCL A;  4OOL A;  1ZG6 A;  5E2G A;  5JYO A;  3UY6 A;  3OPL A;  1M6K A;  3IWQ A;  2B5R A;  1FR6 A;  2G2U A;  3HLG A;  3NC8 A;  3AGE A;  3BFF A;  3VFH A;  1MWU A;  5FQQ A;  4KZ4 A;  4Y7P A;  4JXV A;  1YLT A;  1FSW A;  3C4O A;  1CEF A;  2PU2 A;  1GA9 A;  2WYX A;  3RJU A;  4RA7 A;  3FZC A;  3UPO A;  3HUN A;  2XR0 A;  1QME A;  4UAA A;  5D3O A;  1YLY A;  3ZNT A;  2BLS A;  1L2S A;  5CHM A;  4CJN A;  1ZG4 A;  2DNS A;  1XP4 A;  2V20 A;  3PBO A;  2Q9M A;  1BTL A;  2HDU A;  4ID4 A;  1BLS A;  4WMC D;  3E2L A;  3RXX A;  3SS3 A;  4BLM A;  4EBL A;  5EOO A;  3IXD A;  1MY8 A;  4OQI A;  4S2P A;  5IHV A;  4MBH A;  1SKF A;  3SOI A;  3GTC A;  5G18 A;  3WS0 A;  2RCX A;  1PW8 A;  3G2Y A;  1K25 A;  1QMF A;  4BL3 A;  2ZM2 A;  4B4Z A;  3FKV A;  4KG5 A;  5FAQ A;  1W8Q A;  5JYP A;  4XXR A;  1KDW A;  5HFO A;  2HP5 A;  2OLU A;  2P9V B;  4JF6 A;  1YM1 A;  4U0X A;  3BFC A;  4KQR A;  1DJB A;  5EVI C;  4WYY A;  4PPR A;  2EX6 A;  3Q7Z A;  1PW1 A;  4DDS A;  1XGJ A;  2DRW A;  3MZF A;  3IF6 A;  4WZ4 A;  4KZ8 A;  5FQI A;  2HDQ A;  2EX8 A;  3ZG9 B;  2HP9 A;  3FKW A;  2E8I A;  4PM7 A;  1JWZ A;  3TOI A;  5E2F A;  2JC7 A;  1HD8 A;  4JXG A;  1IYS A;  4C75 A;  1JWP A;  5CGW A;  3IXH A;  1BUL A;  3Q1F A;  5GHY A;  2Y2M A;  3LY4 A;  1ERM A;  3BFD A;  3O87 A;  4IBX A;  1PZP A;  3HBR A;  4P6B A;  4JF4 A;  1E3U A;  3ITA A;  3WRZ A;  3HLB A;  2XK1 A;  1L0G A;  5EVI A;  4MEZ A;  3P09 A;  4C3Q A;  1HTZ A;  1NJ4 A;  5M19 A;  1IEM A;  5FAO A;  3VOY A;  1OME A;  2G2W A;  3MKE A;  2WGW B;  3ITB A;  1MXO A;  4GN2 A;  2Y2K A;  2Y4A A;  4X53 A;  1LL5 A;  4PMA A;  4E3L A;  3UO9 A;  4FD8 A;  5A92 A;  1CI8 A;  1FSY A;  2XFT A;  5CRF A;  5FQ9 A;  5GLC A;  2VGK A;  3Q81 A;  1MWS A;  1YMS A;  4WBG A;  1TDL A;  4LV2 A;  1LI9 A;  4R4R A;  2HPB A;  1S0W A;  4X56 A;  4WMC A;  3WS1 A;  3SS4 A;  3S1Y A;  1HVB A;  2EXB A;  3W4O A;  1U60 A;  4N9L A;  3Q07 A;  4OPQ A;  3OPR A;  3RXW A;  4QY5 A;  3MXR A;  2FFY A;  1BLC A;  4BD1 A;  3VP2 A;  3ZNY A;  3PAE A;  2XF3 A;  4X55 A;  1K57 A;  5M1A A;  2WZZ A;  5FQM A;  5FI6 A;  4KZ9 A;  5AQB A;  5U47 A;  5J8X A;  4PM5 A;  1BZA A;  3G34 A;  3BLM A;  1PWC A;  3FWL A;  4DRT A;  1PI4 A;  4GB7 A;  4L0L A;  5L2F A;  4OPR A;  1K55 A;  5FI7 A;  2Y91 A;  2ZC4 B;  5CHJ A;  4N92 A;  1IYQ A;  4WEL A;  5M18 A;  1ONG A;  1MWT A;  4GD6 A;  4S2N A;  4WEK A;  1XPB A;  3BEC A;  2WAE A;  2JBF A;  2HP6 A;  3N4I A;  4KZ5 A;  2Y2G A;  4LV3 A;  4R23 A;  5HX9 A;  4RVA A;  5HAQ A;  4IVI A;  1MWR A;  1NZO A;  1LHY A;  3PBN A;  2R9W A;  4JF5 A;  2QZ6 A;  4PM9 A;  3NDG A;  3OPH A;  1XKZ A;  2ZC6 B;  4KZA A;  3ZG7 B;  3Q7V A;  4O7D A;  3IXG A;  4Y0O A;  1K6R A;  1ONH A;  5DVA A;  5HAI A;  3CJM A;  3E2K A;  2XD1 A;  4H8R A;  1XGI A;  5KSH A;  4N9K A;  3NIA A;  3V39 A;  4EUZ A;  4R1G A;  2A49 A;  2C6W B;  2EXA A;  2ZQ7 A;  2DCF A;  4QY6 A;  3VFF A;  3IF6 C;  5GLA A;  4Y0U A;  4RX3 A;  3QHY A;  3UDI A;  2V1Z A;  3IF5 A;  1I2S A;  2H5S A;  2J8Y A;  3IHB A;  5E2H A;  3W4Q A;  1L0E A;  4E3J A;  1KVM A;  4GD8 A;  1YQS A;  5FQJ A;  4UA7 A;  2EX9 A;  1W8Y A;  3IH8 A;  4PM6 A;  3C5A A;  5FSR A;  5CTM A;  4KEN B;  4BD0 A;  3FV7 A;  5DF7 A;  2J7V A;  1HZO A;  3DW0 A;  4E6W A;  4OPZ A;  1KDS A;  2Y59 A;  1JWV A;  3GMW A;  1JTG A;  2X02 A;  2XFS A;  2XDM A;  5EUA A;  4MNR A;  4EQI A;  1I5Q A;  5HL1 A;  1FCN A;  4QB8 A;  1FOF A;  1NYY A;  4QU3 A;  4KZ6 A;  3IWO A;  3Q7V B;  4P0M A;  2WKE A;  3VSK A;  1IKG A;  1W5D A;  4JXW A;  3WS4 A;  3AGD A;  3UPN A;  1GHP A;  3GQZ A;  4R3B A;  3I7J A;  4K0X A;  4HEF A;  5BOH A;  5E43 A;  1BT5 A;  4OH0 A;  1VM1 A;  1C3B A;  1I2W A;  5FA7 A;  1EI5 A;  5GL9 A;  3TSG A;  2ZD8 A;  3BM6 A;  4P87 A;  3VOZ A;  3HL9 A;  3P98 A;  3G31 A;  2QMI A;  4GKU A;  1K4F A;  5EVI D;  2Y2I A;  3HVF A;  3ZFZ A;  1FCM A;  2ZQC A;  2C5W B;  1K4E A;  1NRF A;  1NYM A;  2J9P A;  2Y2H A;  3IHA A;  4RYE A;  3LO7 A;  1BLH A;  1MKI A;  3V50 A;  4BL2 A;  2WKH A;  4K0W A;  3ZVT A;  4DXC A;  4MLL A;  3CMZ A;  3ZG8 B;  3DWZ A;  3GR2 A;  2EFX A;  3C7U A;  3NI9 A;  2ZQA A;  3NDE A;  3V5M A;  1PWD A;  5TFQ A;  4P85 A;  4WZ5 C;  2ZMA A;  5FI2 A;  5KZH A;  5DTT A;  4GDN A;  3M2J A;  1AXB A;  4JPM A;  2Y2Q A;  1KGF A;  3O3V A;  1DJC A;  1IYP A;  4M3K A;  3WS2 A;  1G6A A;  3HUM A;  4R3J A;  4K91 A;  4A5R A;  3ZVW A;  4DF6 A;  3CG5 A;  4KG2 A;  3PAG A;  4WEJ A;  5FQK A;  2ZJ9 A;  1ERQ A;  1GHM A;  3OCL A;  4IVK A;  4E3I A;  2HDR A;  4KZ7 A;  4X69 A;  2J9O A;  4HBT A;  3VP1 A;  2EFU A;  2XEP A;  3OC2 A;  4QD4 A;  3W8K A;  4E3M A;  1CI9 A;  4IED A;  4BQM A;  1L0F A;  1GCE A;  5F1F A;  3UDF A;  1YLJ A;  3O86 A;  2WGW A;  1XA1 A;  2X71 A;  2QPN A;  3BFG A;  4KZ3 A;  4UA6 A;  1FQG A;  1ES5 A;  3CZD A;  4XUX A;  4YFM A;  4Y0T A;  2ZC7 A;  1O7E A;  3HLE A;  1XA7 A;  3PBS A;  1RP5 A;  5HAR A;  3TG9 A;  3N8S A;  1EWZ A;  2I72 A;  4WZ5 A;  4X6T A;  3S22 A;  3A3E A;  3HLD A;  4FH4 A;  5GLB A;  3IT9 A;  3MKF A;  1CEG A;  4DDY A;  1PZO A;  4S2O A;  5FDH A;  1H8Z A;  1KE4 A;  2PBY A;  4U3T A;  2WGV A;  2XH9 A;  3G30 A;  4NK3 A;  2OV5 A;  3EQU A;  4ZDX A;  1IKI A;  4LV1 A;  4C6Y A;  2ZM8 A;  1FR1 A;  3BFE A;  4ZAM A;  1H8Y A;  1FCO A;  1LI0 A;  1WYB A;  3UPP A;  2Y2N A;  2VGJ A;  3G2Z A;  3HUO A;  4NET A;  4KQO A;  3IF6 B;  4U0T A;  4FH2 A;  1E4D A;  2Y2J A;  3BRM A;  1K54 C;  4OLG A;  4GDB A;  3VP4 A;  2WZX A;  4MBF A;  3G35 A;  4S2M A;  3OZH A;  3BLS A;  3Q82 A;  4D2O A;  4OVD A;  4S2J A;  2P9V A;  4B88 A;  2H0T A;  4QHC A;  1BUE A;  3HLW A;  5A90 A;  2ZC5 B;  3SS5 A;  3IH9 A;  4GZB A;  4MBK A;  4EWF A;  5I94 A;  1E25 A;  3N8R A;  3A3J A;  3AGF A;  5CGS A;  2ZQ9 A;  1YT4 A;  1YLP A;  4Z9Q A;  3FYZ A;  4OP8 A;  1SDN A;  3MZD A;  2OSU A;  2HDS A;  4ZJ2 A;  1NZU A;  3UE3 A;  1KVL A;  1ALQ A;  4FCF A;  4KG6 A;  1TDG A;  3EQV A;  3WWX A;  3BEB A;  5AQA A;  2H0Y A;  1GHI A;  1N4O A;  5DF8 A;  4OOM A;  1ERO A;  3UNW A;  5HW3 A;  4OQH A;  2BG1 A;  3MFD A;  5CEB A;  5KMW A;  3WS5 A;  1BLP A;  4OQG A;  1RGY A;  3OCN A;  2XGN A;  3SH9 A;  5HAP A;  3HRE A;  1JTD A;  1W7F A;  5GHX A;  1K56 D;  4EBP A;  4JBF A;  1YLW A;  3UE0 A;  1KE0 A;  2PU4 A;  2H10 A;  2R9X A;  3PBT A;  1WYC A;  2CC1 A;  5F83 A;  3PBR A;  3V3R A;  1ESU A;  4YIN A;  4OQ0 A;  5E2E A;  4OKP A;  3S4X A;  3UDX A;  2V2F F;  4LEN A;  3W4P A;  5CHU A;  1IYO A;  3D4F A;  4E3O A;  3GVB A;  1L0D A;  5FAS A;  1LLB A;  5FAP A;  4E6X A;  4QJG A;  5GHZ A;  2XLN A;  3NY4 A;  5EE8 A;  2IWB A;  2WAF A;  4EV4 A;  2WAD A;  1PIO A;  4UHU A;  4ZTK A;  1MBL A;  3JYI A;  1LL9 A;  1K6S A;  1M40 A;  1O07 A;  1TEM A;  2UWX A;  4R0Q A;  2RL3 A;  4ZJ3 A;  3VP0 A;  1K55 C;  4BEN A;  3M6B A;  1ESI A;  1PWG A;  3ZCZ A;  3G4P A;  1NXY A;  3C7V A;  2ZLY A;  3HLC A;  5EVL A;  1SDE A;  2Y2L A;  5FAT A;  2WGI A;  3DTM A;  3GSG A;  4ZJ1 A;  3IWI A;  1K57 C;  2JCH A;  3LCE A;  3GV9 A;  5CER A;  1YLZ A;  2X01 A;  1PYY A;  4GOG A;  4CPK A;  2JE5 A;  4BJP A;  5EOE A;  2WKI A;  3LY3 A;  3QNB A;  5F1G A;  1S6R A;  3SH7 A;  4DE3 A;  4E3K A;  3GRJ A;  4XUZ A;  4N1H A;  4F94 A;  3MZE A;  1CK3 A;  4FSF A;  1YMX A;  1K38 A;  3A3I A;  3PTE A;  4UA9 A;  3IQA A;  3LEZ A;  1JVJ A;  3SH8 A;  2Q9N A;  4DE2 A;  5AQ7 A;  1Y54 A;  1ZC2 A;  1RGZ A;  5TGF A;  2ZQ8 A;  4JKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...