5EECA

Crystal structure of kpc-2 beta-lactamase in complex with the s02030 boronic acid inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carbapenem-hydrolyzing beta-lactamase KPC
publication title Crystal Structures of KPC-2 and SHV-1 beta-Lactamases in Complex with the Boronic Acid Transition State Analog S02030.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 95
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eecA00
2JC7A 5EVID 4R3JA 1NXYA 3VOYA 5FA7A 5HW3A 1GHIA 4GDBA 3GV9A 1RGYA 3B3XA 4IVIA 2QMIA 4WZ5C 4S2MA 1O07A 1FCOA 2XR0A 2Y2MA 4OQIA 2WK0A 4DRTA 4LCMA 3UE0A 3ZVTA 4C6YA 3ITAA 1SCWA 5GLAA 3O88A 4E3JA 1M40A 2X02A 5AQ9A 1RGZA 1SDEA 3IF6C 2ZQDA 4OONA 5JYPA 3UPOA 3HBRA 2OSUA 4C75A 1SHVA 1IYSA 4S2KA 3W4QA 1PWCA 1HTZA 1IELA 3NDGA 4U0TA 5EECA 4K0XA 4BL3A 1L0GA 4GOGA 3A3JA 3FKWA 3G34A 4ZJ2A 3GVBA 3S22A 4S2IA 1CEGA 1K54A 5FQKA 3WWXA 3NCKA 2HDRA 3FYZA 3HLGA 4B4XA 1NYYA 1IYPA 4LV1A 3HUNA 2XD1A 2XFSA 1MY8A 1W79A 2Y2GA 1GHPA 3EQVA 3FV7A 1W5DA 5DF7A 5CXWA 2A3UA 3IH9A 4OOYA 4MEZA 5CGWA 4ZJ1A 3PBNA 4JF6A 2HDQA 3ZFZA 1CEFA 5I94A 4CJNA 2EFXA 1ZKJA 3EQUA 4A5RA 5AQ7A 4N9KA 4X53A 1S6RA 1K54C 4N9LA 3ZGAB 1Y54A 4KZ3A 4R4SA 4QY6A 4YINA 5GL9A 5A91A 3G30A 1YLYA 3PBOA 3UPPA 4R1GA 1IKGA 1O7EA 2ZQ9A 3PAEA 4B4ZA 2FFFB 1KDWA 1MWUA 2XH9A 3G2ZA 4GKUA 4UA6A 4QJGA 5A92A 3M2KA 3VP3A 2EXBA 1I2WA 1K56D 4E6WA 4EQIA 3G32A 3GRJA 1IYQA 1NZOA 5G18A 3TOIA 3MFDA 1PIOA 3A3FA 3MKFA 1NZUA 2G2WA 2XK1A 3LY3A 1BLCA 1YLZA 3BFGA 1TDGA 4JF4A 4PM9A 2EX9A 3NY4A 3W4OA 5FQ9A 5F1FA 3CZDA 5L2FA 4XXRA 3ZG0A 2RCXA 1CK3A 1VQQA 4KZ6A 4BD0A 3HLEA 1YM1A 3RJUA 1PWGA 4JBFA 5FASA 2EX8A 3HLFA 1GA0A 3IXHA 1PW8A 3N4IA 5BOHA 3IHAA 1HD8A 3Q7ZA 1JVJA 1LL5A 5AQBA 2DRWA 4E3NA 3GQZA 1SDNA 2XDMA 4FCFA 1LI0A 1PW1A 5HFOA 5DVAA 3VSKA 2WYXA 3MKEA 5M18A 5M19A 4RA7A 2GDNA 2EX6A 2ZQ7A 2P74A 5E43A 1L0DA 4QB8A 2CC1A 2OLUA 4S2JA 1LL9A 3S4XA 4QU3A 3VMAA 3NBLA 3O86A 2HPBA 1KVLA 1KVMA 4DDSA 1FR6A 4EWFA 1L0FA 1K4FA 3JYIA 1XGJA 1ONHA 1CI8A 3VP0A 4HBUA 5A93A 3P98A 4LV0A 4WEJA 4Y7PA 3S1YA 3O87A 4XUXA 3W4PA 2Y2NA 4ZTKA 2J7VA 1KE0A 2WUQA 3Q7VB 1FR1A 1GA9A 1FSYA 1G6AA 1KGFA 2ZC7A 3N8RA 3SH8A 4WMCA 3C4OA 3UDXA 3E2LA 1TEMA 4OOLA 5CERA 2HP6A 4PM7A 3MXRA 3A3EA 3NC8A 2RL3A 1ES4A 1WE4A 4WBGA 1KGEA 4KG2A 1XX2A 3IWOA 3O3VA 1OMEA 5GHYA 1ZG4A 1JTGA 2UWXA 3N8SA 4PM5A 1XA7A 4DE3A 1BLPA 4ZBEA 4MNRA 1HVBA 3AGFA 2PBYA 4P6BA 5EUAA 2Y4AA 2H10A 3BFDA 4MBKA 4OPZA 1M6KA 3MXSA 4R4RA 3PTEA 4P0MA 1MKIA 4O7DA 2DCFA 4HESA 3HLDA 2A49A 4U0XA 4GD6A 1ESIA 4E3OA 3M2JA 3AGEA 3BM6A 5EPHA 4KENB 1KE3A 3AGDA 4OLDA 2OV5A 4LCLA 2E8IA 5CHUA 4ZAMA 3UE1A 4DDYA 3SOIA 4M3KA 4JLFA 1K25A 2P9VA 2WGWB 1I5QA 1C3BA 3LO7A 2Y2QA 5EOEA 1W7FA 3ZG9B 2Q9NA 1ES2A 2Y2PA 5FAPA 3OCLA 2Y55A 1PWDA 4S2LA 2C6WB 4PMAA 1MPLA 5DTKA 1DJBA 3V3RA 4R3BA 5FSRA 3WRZA 2IWDA 5F83A 1ONGA 3GMWA 4IBRA 3SH7A 3TSGA 4GN2A 4DKIA 2WKEA 2XGNA 1BLHA 4PM8A 1JTDA 1Z6FA 3WS5A 1MWRA 4WM9A 2H5SA 3MBZA 3PAGA 1PI5A 4WZ4A 4OLGA 4X6TA 3VP1A 4OH0A 3SS3A 5CTMA 4KZ4A 1L0EA 3BLSA 3PBTA 3MZDA 2Y59A 3W8KA 1LI9A 2Z2MB 1K6RA 1DJAA 1YMSA 5TFQA 4OVDA 3IWQA 4GDNA 2JBFA 4KZ8A 5DTTA 3FZCA 3LCEA 3G2YA 3Q7VA 3ZVWA 1K38A 2J9OA 5TR7A 1K4EA 3IF5A 2I72A 1QMFA 4OPYA 4K0WA 5CHMA 3ZG7B 3ZNTA 2XLNA 1K55A 2PU2A 2Y2LA 5GLCA 5F82A 4KZ5A 3VOZA 5A90A 1BLSA 2ZM0A 1NRFA 2OLVA 2Y2JA 3HUMA 4DE1A 4RVAA 3PBRA 1W8QA 3CJMA 1YQSA 4KZ9A 3NIAA 3UDFA 3QNCA 2ZLYA 3IT9A 4CPKA 2X01A 3ITBA 3VFFA 1H8YA 2Y2KA 2V1ZA 4RX2A 3ZHHA 3Q1FA 4ZDXA 5CEDA 3GR2A 4KZAA 3HUOA 4KZ7A 4OP5A 3G4PA 5HX9A 1BZAA 3BEBA 5KSCA 4E3MA 4R23A 1S0WA 4X68A 1PI4A 2B5RA 3DWZA 4Y0OA 5EOOA 3M6HA 4BD1A 2IWBA 1MBLA 4QD4A 1K55C 1YLPA 1LLBA 4KQQA 4DE0A 2HP9A 5CHJA 1LHYA 5EVIB 2PU4A 4Q8IA 1SKFA 4BL2A 2ZM8A 4JXVA 3Q81A 2WGWA 4DF6A 5KZHA 1BULA 3IQAA 3N7WA 5FQQA 3ZDJA 5KMWA 2EXAA 4C3QA 3BLMA 2ZC5B 1K57A 4FH4A 4WMCD 4N1XA 4HEFA 3OC2A 3G31A 1YLTA 2V2FF 2C5WB 2QPNA 1MWTA 1G68A 1K6SA 2XQZA 2Z2LB 5KSHA 2R9XA 4MBHA 3VP4A 4E3KA 2WGIA 3MZEA 4JXSA 4GB7A 3M6BA 4OPRA 4WYYA 5FI6A 1XKZA 4IVKA 1Q2PA 4RYEA 3SS4A 3BFFA 4PM6A 5FATA 1IEMA 1CI9A 2Y2OA 2ZQ8A 4JF5A 4UHUA 1XP4A 3A3DA 4S2PA 2ZQCA 3C4PA 3DW0A 1K57C 4OQHA 3IWIA 1EWZA 3IXGA 3Q82A 5E2EA 3OZHA 2WADA 4NK3A 4WEKA 3IH8A 4S2OA 4OP8A 5FQMA 3BRMA 2ZD8A 3N8LA 3OCNA 1GCEA 4ID4A 5HAIA 1IYOA 2ZC4B 3WS2A 4JPMA 1VM1A 1ES5A 4OQGA 3RXWA 1XXMA 2WZXA 1E25A 1ZC2A 3HL9A 1JWPA 4OQ0A 4DE2A 5M1AA 2WKIA 4LV3A 4Y0TA 2BG1A 2H0YA 1HZOA 5IHVA 5GLDA 3MZFA 5TGFA 1H8ZA 5HAPA 5GHXA 3OPLA 1QMEA 1MXOA 3CMZA 1YT4A 3HLBA 1FCMA 4IEDA 1JWZA 5CECA 5GHZA 3HVFA 1NY0A 3NI9A 3SS5A 4MBFA 5DF8A 1PZOA 1PYYA 4P85A 5CEBA 4HBTA 4Z9QA 3BFEA 3QHYA 5F1GA 3OPPA 4YFMA 4GZBA 3IXDA 1ERMA 3BFCA 5FAQA 3VSLA 5EVIA 1TVFA 2Y2IA 3FWLA 4ZJ3A 5FAOA 3G35A 2X71A 4KG5A 1GHMA 5DTSA 5FI2A 3D4FA 4F94A 4LV2A 3ZG8B 3TG9A 4E3LA 3C5AA 2QZ6A 3CG5A 3E2KA 1YLJA 1XGIA 5AQAA 1IKIA 4WELA 3PBQA 3HLCA 5EVLA 3ZNYA 3A3IA 1YMXA 2ZC3B 2ZM2A 4EV4A 2J9PA 2XEPA 2HP5A 2WGVA 3IHBA 1E4DA 1N4OA 2XD5A 4QY5A 3UPNA 5JYOA 5EVIC 4L0LA 2J8YA 5EE8A 1ALQA 2DNSA 3N6IA 4GNUA 4U3TA 3VFHA 4DXCA 1RCJA 3I7JA 2XFTA 3UY6A 1TDLA 2VGKA 4R0QA 5GLBA 4RX3A 4DXBA 4EUZA 5E2FA 4KQOA 3SH9A 4EBPA 3IF6B 1ERQA 1Q2QA 4JKTA 4X56A 3QNBA 3UO9A 1N9BA 1PZPA 1BUEA 1BTLA 4H8RA 4FSFA 4JXWA 5CGSA 3DWKA 3IXBA 4UA9A 5FI7A 1BSGA 3PBSA 1ESUA 1FOFA 1WYBA 2H0TA 1EI5A 2HDUA 3ZG5A 1WYCA 4UA7A 1FQGA 1KE4A 4KQRA 3DTMA 4KZBA 4Y0UA 4N92A 4FH2A 4MLLA 5HAQA 1MWSA 1U60A 4OPQA 3UNWA 3WS1A 5FDHA 5FQJA 2P9VB 2BLSA 1FSWA 2R9WA 3ISGA 1JWVA 1K56A 3V50A 3WS4A 4BQMA 1E3UD 3V5MA 2ZMAA 3C7UA 5DF9A 1BT5A 1H5XA 2Q9MA 3LY4A 3HREA 5HARA 4EBLA 4XUZA 2WKHA 3BECA 2ZC6B 4K91A 4E3IA 3V3SA 1YLWA 3BYDA 5U47A 3ZCZA 4KG6A 3HLWA 4QHCA 4X69A 4LENA 1L2SA 1KGGA 5FQIA 3UE3A 1E3UA 1NYMA 2JCHA 4FD8A 2IWCA 1FCNA 3Q07A 2XF3A 4P87A 3UDIA 1W8YA 3GTCA 3V39A 2JE5A 1AXBA 1ES3A 1XA1A 5HL1A 4X55A 2EX2A 3VP2A 4S2NA 4IBXA 3RXXA 4EBNA 2WAFA 4OOMA 1I2SA 5D3OA 1NJ4A 4PPRA 4BENA 2VGJA 1DY6A 4E6XA 4BJPA 1ZG6A 4NETA 4WZ5A 5E2GA 3P09A 3UN7A 2WAEA 3GSGA 3LEZA 2WZZA 2G2UA 1XPBA 3OPRA 4N1HA 4OKPA 5E2HA 3WS0A 2ZQAA 3OPHA 2Y91A 1J9MA 2V20A 2HDSA 2Y2HA 3C7VA 4D2OA 1EROA 2EFUA 3FKVA 2FFYA 2ZJ9A 5CRFA 4JXGA 4UAAA 3IF6A 4GD8A 1KDSA 5CTNA 3WRTA 4BLMA 5J8XA 4B88A 1RP5A 3NDEA 4S2NC 5CGXA 1DJCA
chains in the Genus database with same CATH superfamily
4R3JA 3VOYA 3P7NA 5CX7A 3GV9A 4WZ5C 2QMIA 3LI9A 4G3VA 3TRCA 2WK0A 4LCMA 3L9KA 5GLAA 4E3JA 1H8MA 1ZHHB 3IF6C 4HY8A 5JYPA 4LRZE 4C75A 5F69A 3A0SA 1PWCA 4K0XA 4GOGA 4FOFA 4S2IA 5FQKA 3WWXA 1NYYA 3EEAA 3EQVA 1NRJA 3IH9A 2HJEA 3PBNA 3T50A 2CMNA 2YKFA 1Y54A 4R4SA 4QY6A 5A91A 3G30A 1O7EA 5IU1A 2ZQ9A 2FFFB 1KDWA 1MWUA 2XH9A 3G2ZA 4HNBA 2EXBA 1I2WA 4E6WA 5G18A 3MFDA 1PIOA 4HP4A 4II7A 1BLCA 2W1RA 3BFGA 1SZVA 2EX9A 3T4JA 3CZDA 5L2FA 2B02A 2VV6A 5HD5A 1VQQA 4KZ6A 3RJUA 4JBFA 2PYRA 3HLFA 3C30A 3IHAA 1LL5A 5AQBA 4FCFA 3LR5A 4H6JB 2WYXA 4O01A 3LFVA 1D06A 3KSHA 1A0KA 2B95A 3O86A 1KVLA 1KVMA 3R7WB 1OTAA 3JYIA 1CI8A 4WF0A 2QHKA 5EM1A 3SH8A 1FSYA 4X1LA 2GZAA 3UDXA 5CERA 3VE4A 4WBGA 5HDSA 1XX2A 3IWOA 1OMEA 1ZG4A 1K0KA 1OTEA 4DE3A 1XFNA 4LPZA 3NULA 1HVBA 3BFDA 1CJFA 2W3GA 3MS6A 4HESA 2A49A 3KX0X 3MFXA 4KENB 2OV5A 3QP8A 2W0NA 4LCLA 2VKSA 1N9OA 2L4RA 2P9VA 1I5QA 3LO7A 2Y2QA 2AVXA 3ZG9B 3MMHA 5HPFA 1PWDA 2H28A 2C6WB 4R3BA 5FSRA 2IWDA 5F83A 3GMWA 4IBRA 3TSGA 3SH7A 4DKIA 2JKGA 4WM9A 3R7WA 3EWKA 1CQAA 1L0EA 2FH5A 2V9AA 1DJAA 3LCEA 3ZVWA 1K38A 2J9OA 3UB5P 3ZNTA 2PRFA 1K55A 2PU2A 4KZ5A 1BLSA 1NRFA 4BMWA 3CJMA 5TJJA 2QYBA 3UDFA 2X01A 3T12B 4ZDXA 2V1ZA 2GNXA 5CEDA 5HX9A 4R23A 1PI4A 2B5RA 3LYXA 3M6HA 2IWBA 1MBLA 4DJ3A 1YLPA 3DTKA 3NOPC 3DTEA 5EVIB 4BL2A 4JXVA 5KZHA 3N7WA 5HDCA 2BASA 4HEFA 3G31A 3ZYTA 2V2FF 3T4KA 1G68A 3S7PA 4MBHA 4JGQA 3MZEA 5FI6A 4ETZA 4RYEA 3SS4A 4PM6A 5FATA 5IT5A 4ETXA 2Y2OA 1J3WA 3C4PA 4NK3A 2WADA 4S2OA 2M7VA 1ES5A 1E25A 4FTXA 5TGFA 1QMEA 3CMZA 1YT4A 2VJWA 4IEDA 5CECA 1S1ZA 3HVFA 3SS5A 3ZQ5A 4P85A 5CEBA 2K7SA 2W27A 4G3WA 2V8FA 3BFCA 3OOVA 5EVIA 3FWLA 1F9IA 2W3FA 2V0UA 3D4FA 3ZG8B 3C8CA 1OJ5A 4WELA 2Y8HA 3ZNYA 3VE3A 2ZC3B 5C5KA 4Y15A 2WGVA 1N4OA 1TD5A 1HLUP 2J8YA 5EE8A 4GNUA 1RCJA 1OTBA 4PKYA 2JHEA 4KQOA 3SH9A 3IF6B 4R70A 3DTIA 1OT9A 3QNBA 3UO9A 4I39A 4FSFA 1FOFA 2HDUA 1WYCA 5L07A 5TBMB 4EW7A 1FQGA 5HAQA 4Y0UA 2EWWA 3CWFA 2HJ9C 1JWVA 1K56A 3WS4A 3LUQA 2VV7A 3K3CA 4HH3A 2J3TD 2ZOHA 3LY4A 4XUZA 2WKHA 2ZC6B 1YLWA 3ZCZA 1IOUA 3LR3A 4X69A 4LENA 1NYMA 2JCHA 1TS8A 5HL1A 4X55A 4IHQA 2OWHA 4IBXA 4EBNA 2DMWA 3T4QA 4BJPA 1ZG6A 4WZ5A 2WAEA 2G2UA 2ZQAA 2V20A 2Y2HA 2HDSA 4JXGA 2QWSA 1T1BA 3IF6A 1KDSA 3WRTA 3NDEA 4S2NC 3LIBA 1DJCA 1NXYA 4GDBA 1XJ3A 1RGYA 3B3XA 3RH8B 4S2MA 2K2NA 4GW9A 4DRTA 5TBMA 3O88A 1M40A 2OAP1 5AQ9A 2KX6A 1RGZA 1SDEA 4OONA 3A0RA 2ZMFA 3UPOA 3HBRA 3PYPA 4U0TA 1IELA 4EQ1A 1L0GA 3A3JA 4ZJ2A 4G3KA 3S22A 1CEGA 3NCKA 4B4XA 4LV1A 1IYPA 4EESA 2VV8A 2XFSA 2Y2GA 1S67L 3FV7A 3FG8A 5L09A 5CGWA 4ZJ1A 3UB6A 4JF6A 2PR6A 3ZFZA 4B93A 4A5RA 2WKPA 3NHQA 3S7NA 4N9KA 1S6RA 1K54C 3ZGAB 4YINA 5AVEA 4EERA 3PBOA 3UPPA 1IKGA 1FILA 2P08A 4GKUA 4UA6A 3QP6A 3M2KA 1L3LA 3G32A 4Y17A 3A3FA 3HCYA 1NZUA 2PHYA 2V8CA 3LEQA 1YLZA 1TDGA 5F1FA 1YKDA 5FDSA 3E4QA 4MCWA 2V1BA 2RCXA 3LI8A 3HLEA 1YM1A 4KUOA 1LSWA 2XA7M 3C38A 3Q7ZA 1JVJA 3PR6A 4E3NA 1F5MA 3GQZA 2XDMA 3FPVA 4CLCC 5M19A 1LSXA 1V9YA 2EX6A 3LIFA 2ZQ7A 4QB8A 2CC1A 2OLUA 4S2JA 3NBLA 2HPBA 4EWFA 2E8JA 1L0FA 1K4FA 4R6LA 3MQ0A 3VP0A 4HBUA 4AFIA 3P98A 4LV0A 4Y7PA 3CLOA 3O87A 4XUXA 3W4PA 3KSGA 3Q7VB 1FR1A 2ZC7A 3N8RA 1G6AA 1KGFA 3IBRA 4NKPA 1TEMA 3O5YA 3MXRA 3IX3A 5I5LA 3A0VA 3CHWP 4KG2A 2L1MA 4ME4A 5GHYA 4PM5A 1XA7A 1BLPA 4ZBEA 4MNRA 3AGFA 2PBYA 3QP5A 5EUAA 4OPZA 3MXSA 2GJ3A 1MKIA 4P6ZM 2DCFA 4GD6A 3VOLA 1CF0A 3AGEA 3D72A 3UE1A 4JLFA 4ESPA 1KOUA 5DKLA 3K2NA 4GLQA 2PAVP 4L9EA 4R3AA 2Y55A 5DTKA 3V3RA 3H82B 2ZL1A 3B33A 3WRZA 3R4KA 5MC7A 5EFWA 4GN2A 3ULFA 1BLHA 1JTDA 4WN5A 3MBZA 1BYWA 4OH0A 3SS3A 4HJ4A 3W8KA 1LI9A 3CI6A 2Z2MB 5TFQA 2XSSA 1IFQA 4KZ8A 3K3DA 3SW1A 3FZCA 2QJ7A 3Q7VA 2ZOIA 1K4EA 2I72A 1LSVA 5CHMA 3UB7A 5F82A 4DE1A 4RVAA 2BTFP 1YQSA 3NIAA 3QNCA 4CPKA 2Y2KA 1S1YA 3HUOA 4OP5A 5L8MA 5KSCA 3BEBA 2Y79A 4BD1A 3BY8A 4QD4A 2OAQ1 1LLBA 4B9OA 1LHYA 2QJ5A 4DF6A 2EXAA 4C3QA 2ZC5B 2XA7S 4N1XA 3OLOA 3OC2A 2XROA 2O9BA 2EA9A 4ARZB 3B42A 3BQ8A 2Z2LB 3H82A 4DJ2A 4PHTA 1VB6A 2R9XA 4GB7A 3T4LA 1Q2PA 1W63M 3EGDC 2Q0OA 4UHUA 2A24B 3GECA 3F1PB 4S2PA 3DW0A 3IWIA 3IXGA 3Q82A 3OZHA 4WEKA 3IH8A 2NUTC 3BRMA 2VGLM 3OCNA 1IYOA 2ZC4B 1VM1A 1XXMA 2WZXA 2VZWA 4OQ0A 4DE2A 1P97A 2WKIA 3T1XA 4Y0TA 2BG1A 5IHVA 1HZOA 1DP6A 2PD7A 3C2WA 3JVVA 1MXOA 1JWZA 3NI9A 3B47A 4P6ZS 4Q0JA 1S66L 3U2AA 4Z9QA 3QHYA 5F1GA 3OPPA 4X25A 3QP1A 3IXDA 1ERMA 4H6JA 4I38A 1OPXA 5J3WA 1GHMA 4WUJA 2W1TB 5DTSA 3TG9A 4K08A 4E3LA 3C5AA 3CG5A 3E2KA 1XGIA 1YSQA 1YMXA 2ZM2A 3NECA 2HP5A 4EEUA 2KLIA 4L0LA 3VFHA 2K31A 4YOFA 2A24A 3F1PA 4UQIM 4R0QA 3NOTC 1ERQA 1F98A 1VETB 1N9BA 1PZPA 1BUEA 1STZA 4H8RA 4F3LB 3DWKA 3CUEC 4UA9A 1BSGA 4Q0IA 1WYBA 2QKPA 5J7EA 4LRYC 3JVUA 1VEUB 4EEPA 5EV0A 2M1CA 3SZTA 4KQRA 3DTMA 4OPQA 5FDHA 5FQJA 3ISGA 2R78A 3W2ZA 3V50A 2ZMAA 5DF9A 1BT5A 1H5XA 2Q9MA 3HREA 5HARA 5AVFA 3H9WA 1ODVA 3V3SA 3BYDA 5U47A 1L2SA 4NXGA 3UDIA 2IWCA 1FCNA 3H7WB 3LIAA 4IUHA 5F68A 3GTCA 2JE5A 1AXBA 3KYZA 1ES3A 2EX2A 3VP2A 4S2NA 3TE8A 3RXXA 2WAFA 4I3AA 1I2SA 4BENA 2JKRM 2JKFA 1H0MA 4NETA 5E2GA 4BBTA 3P09A 3UN7A 3GSGA 3LEZA 1TF1A 1XPBA 4N1HA 4OKPA 5E2HA 3WS0A 2UV0E 2Y91A 1J9MA 3C7VA 4Q0HA 4D2OA 1EROA 2EFUA 4CLCB 2VGLS 5HD3A 4BLMA 4B88A 5CGXA 1X0OA 5EVID 4F3LA 5HW3A 1GHIA 4IVIA 3NOUC 1O07A 1FCOA 1PNEA 4E04A 3ZVTA 3UE0A 3ITAA 4Y13A 3DAVA 4JGPA 3HJIA 1GSVA 2ZQDA 2OSUA 1SHVA 1IYSA 4S2KA 3W4QA 1HTZA 3NDGA 4BL3A 4HIAA 1D7EA 3GVBA 1K54A 3EEHA 3HLGA 1DP8A 3HUNA 3S7OA 2XD1A 4GJ4A 1MY8A 2EWVA 1GHPA 1XJ2A 2PT7A 5CXWA 2A3UA 4XT2B 4OOYA 4MEZA 2HDQA 1CEFA 5I94A 4CJNA 2EFXA 5AQ7A 3S7QA 5KIZA 4N9LA 3LR4A 5GL9A 1YLYA 4R38A 4UQIS 4B4ZA 3UB9A 5A92A 3G6OA 1K56D 4LGWA 3GRJA 1IYQA 1NZOA 4CLCA 3IX4A 3TOIA 3D9YA 3MKFA 4DN0A 2XK1A 3LY3A 2A2LA 4JF4A 4PM9A 4Y3IA 5DJUA 4X1MA 1VHMA 5FQ9A 2G7UA 3ZG0A 1S4SA 4UEYA 2EX8A 3IXHA 1GA0A 3N4IA 1PW8A 1HD8A 4QWOA 2V1AA 4LLOB 3LGOA 2DRWA 1T19A 1LI0A 1PW1A 5HFOA 3DBAA 5DVAA 3MF0A 3VSKA 3MKEA 5M18A 4RA7A 4HJ6A 2P74A 5E43A 1L0DA 2O9AA 1LL9A 3VMAA 4DDSA 3E4OA 3KSIA 1MKMA 4HOIA 4WEJA 3S1YA 5EM0A 2Y2NA 1YPRA 1KE0A 4WMCA 4XT2A 2P7JA 3A3EA 2RL3A 1WE4A 3O3VA 2JKTM 2VX8A 4P6BA 4MBKA 1EW0A 1TS6A 4E3OA 2JN7A 2PBDP 3M2JA 3IX8A 2E8IA 5CHUA 4DDYA 3SOIA 1K25A 5EOEA 4YWZA 1W7FA 2Q9NA 1ES2A 2Y2PA 3HJKA 1SKOB 5FAPA 3OCLA 4S2LA 3E98A 4PMAA 3LICA 1MPLA 3TW8A 1DJBA 2HF6A 1ONGA 2WKEA 3VV4A 4PM8A 4LRXC 5G4ZA 1Z6FA 3WS5A 1MWRA 1PRQA 1OT6A 4I3IA 3PAGA 3VP1A 5CTMA 4KZ4A 3BLSA 3PBTA 3MZDA 2Y59A 1V9ZA 4OVDA 3IWQA 2ZBBA 3T4SA 5TR7A 4WL9A 3IF5A 4IJGA 3VOZA 5GLCA 2J80A 2OLVA 5J4EA 2Y2JA 2I9VA 3EOIA 3HUMA 3PBRA 1W8QA 4KZ9A 2ZLYA 3VFFA 3ITBA 3LIEA 1H8YA 1G6OA 3ZHHA 4JGOA 4KZ7A 4E3MA 1S0WA 4Y0OA 5EOOA 3MSHA 4KQQA 2HGVA 2PD8A 4Q8IA 4NG2A 1BULA 3TJZC 1LT0A 1NLYA 1GSXA 5KMWA 1MZUA 2XRNA 2MJ6A 1YLTA 1SKOA 2QPNA 1MWTA 5KSHA 2KOIA 2D02A 3VP4A 2WGIA 4JXSA 4WYYA 5HL6A 3BFFA 1CI9A 2ZQ8A 3GDIA 3A3DA 2ZQCA 1K57C 3PXPA 3NJAA 4OP8A 4HI4A 3T1QB 2ZD8A 3ICYA 3N8LA 3U4LP 1GCEA 2ZMVA 3WS2A 5IS1A 3E0YA 4OQGA 3RXWA 1ZC2A 3HL9A 1JWPA 3OBFA 4LV3A 3LR0A 3FC7A 3KYQA 5EVEA 4BBVA 3OPLA 1FCMA 5GHZA 1NY0A 4Y5FA 3UMEA 2W3DA 4GZBA 2P04A 3VSLA 2Y2IA 4ZJ3A 5FAOA 3G35A 2X71A 5F5YA 4MN5A 5FI2A 4I5SA 1XFQA 4M4XA 1NWZA 2GX5A 1YSPA 3A3IA 2VK3A 5HWTA 1Z09A 3UE6A 3CUEA 5FEFA 2NUPC 2OWJA 2XD5A 4KQDA 4DXCA 3I7JA 2XFTA 3UY6A 5HPIA 4RX3A 5AJGA 5E2FA 4EBPA 1Q2QA 4JKTA 3MQOA 2VLGA 5HWVA 4L9GA 1LL8A 1ESUA 2H0TA 1FIKA 2WKQA 3ZG5A 4DMZA 4N92A 4MLLA 2P9VB 2BLSA 2OOLA 2R9WA 4BQMA 2ACGA 1E3UD 1Y28A 1MC0A 2YKHA 3L7HA 3C7UA 2W3EA 4HHDA 4O0PA 1G28A 2HV1A 5L10A 4NXEA 4EBLA 3BECA 5FQIA 1E3UA 4FD8A 4P87A 3Q07A 4HJ3A 2XF3A 2FZ0A 3BWLA 1UWPX 1W8YA 1XA1A 5HSQA 3E4PA 4OOMA 5D3OA 1NJ4A 4PPRA 1DY6A 2IA2A 4NXFA 2D01A 2LB9A 3FKVA 3BW6A 5CTNA 4GD8A 1N9NA 1RP5A 3KO6A 4D60A 2JC7A 5FA7A 2XR0A 2Y2MA 1YAXA 3KSFA 4OQIA 4PAUA 4C6YA 1SCWA 1JNUA 2PYPA 2X02A 3IBJA 4EXOA 5EECA 5FEGA 2L0WA 1PFLA 3FKWA 3G34A 4ARZA 2HDRA 3FYZA 1W79A 1W5DA 1OJGA 5DF7A 2PR5A 1ZKJA 3EQUA 4X53A 1H3QA 4KZ3A 1TS0A 4R1GA 3PAEA 3KYEA 4QJGA 3VP3A 3BJNA 4EQIA 4ZRRA 2G2WA 2WKRA 2O9CA 3NY4A 3W4OA 4XXRA 1CK3A 4BD0A 5FL3A 1PWGA 5FASA 5BOHA 1SDNA 1T18A 4L9FA 2GDNA 2W1TA 4O8GA 3S4XA 4QU3A 1FR6A 1XGJA 1ONHA 4RQ9A 5A93A 4ZTKA 2J7VA 2WUQA 5G4YA 1GA9A 4BBUA 1F2KA 3C4OA 3E2LA 1TS7A 4OOLA 2HP6A 4PM7A 4GHIB 3NC8A 1ES4A 1KGEA 3PHYA 5LBRA 1VETA 1JTGA 2UWXA 3N8SA 4MMNA 5F6AA 4EUVA 4Y2FA 3UMDA 3T1SA 2Y4AA 1ZTUA 2H10A 5HDDA 1M6KA 4R4RA 3PTEA 4GS9B 4P0MA 4O7DA 1VEUA 3HLDA 4U0XA 1ESIA 3BM6A 5EPHA 4WLAA 1KE3A 3AGDA 4OLDA 1P9RA 4ZAMA 4MDZA 3CAXA 4M3KA 3T4TA 2WGWB 1ACFA 1C3BA 3T4OA 4PKYG 3JPUA 4HQAA 1N9LA 3F1OB 4CQHA 2XGNA 4FUWA 3H7WA 2H5SA 4WZ4A 1PI5A 4I3JA 4OLGA 4X6TA 3BY9A 4CLCD 1K6RA 1YMSA 4Z1WA 4GCZA 4GDNA 2JBFA 3T1RA 5DTTA 3G2YA 3ZG7B 4OPYA 1QMFA 4K0WA 4MN7A 2XLNA 2Y2LA 4GHIA 5A90A 3CPTB 2ZM0A 1T1AA 3QP4A 3IT9A 4IUKA 1S4RA 1T1CA 4RX2A 3Q1FA 3GR2A 2Z6CA 4KZAA 3UB8A 3G4PA 1BZAA 4GS9A 4X68A 3DWZA 1DRMA 1K55C 4DE0A 2HP9A 5CHJA 3RTYA 2PU4A 1SKFA 2JKRI 1G5UA 2ZM8A 3Q81A 2WGWA 3MXQA 3IQAA 5FQQA 3ZDJA 3BLMA 1K57A 5HZHA 4FH4A 4WMCD 4BWIA 2KDKA 3MR0A 2C5WB 1K6SA 2XQZA 3IS2B 2Z6DA 2O0YA 4MN6A 4E3KA 4OPRA 3F1OA 3M6BA 1XKZA 4IVKA 1IEMA 4NEED 4JF5A 1XP4A 3LIDA 2INWA 4OQHA 1EWZA 5DKKA 5E2EA 5FQMA 3P01A 4ID4A 5HAIA 1AWIA 4JPMA 3RFBA 1W63Q 3D3OA 5M1AA 2H0YA 3CPTA 5GLDA 3MZFA 1H8ZA 5HAPA 5GHXA 3MQQA 3HLBA 2V0WA 4MBFA 5DF8A 3EGXC 1PZOA 1PYYA 4EETB 4HBTA 4QPRA 3BFEA 4YFMA 1DP9A 5FAQA 1TVFA 4KG5A 3CITA 2PDRA 4EU0A 4F94A 2W3HA 4JGRA 4LV2A 1NLZA 2QZ6A 1YLJA 5AQAA 1IKIA 4HH2A 3PBQA 3F1NB 3HLCA 5EVLA 3QP2A 3IS2A 4EV4A 2B18A 2J9PA 2XEPA 3IHBA 1E4DA 4QY5A 3UPNA 5JYOA 5EVIC 1ALQA 2DNSA 3N6IA 4U3TA 5K5BA 2M7UA 1WA9A 1TDLA 2VGKA 5DJTA 5GLBA 4DXBA 4EUZA 4X56A 5DFYA 1GSWA 2O99A 1BTLA 1P9WA 4JXWA 5CGSA 3IXBA 5FI7A 3PBSA 5DFXA 1EI5A 4UA7A 4YNRA 1XJ6A 1KE4A 4KZBA 4FH2A 1MWSA 1U60A 3UNWA 3WS1A 1UGUA 5HWWA 1FSWA 2HZ5A 2VA0A 3FPWA 1OTDA 3V5MA 4CLCE 1D1JA 2ZL1B 4HP9A 4LFUA 4K91A 4E3IA 4KG6A 3HLWA 4QHCA 2JKTI 5A8BA 1KGGA 3UE3A 4NXBA 2J3WA 4KUKA 3V39A 1UWNX 1XJ4A 1P0ZA 3BQAA 3F1NA 1Y4OA 2VGJA 4E6XA 3V67A 1OTIA 3MJQA 2WZZA 3OPRA 3OPHA 2FFYA 2ZJ9A 2J3TC 5CRFA 4UAAA 2LB5A 5J8XA 2VEAA
chains in the Genus database with same CATH topology
2JC7A 5EVID 4R3JA 1NXYA 3VOYA 5FA7A 5HW3A 1GHIA 4GDBA 3GV9A 1RGYA 3B3XA 4IVIA 2QMIA 4WZ5C 4S2MA 1O07A 1FCOA 2XR0A 2Y2MA 4OQIA 2WK0A 4DRTA 4LCMA 3UE0A 3ZVTA 4C6YA 3ITAA 1SCWA 5GLAA 3O88A 4E3JA 1M40A 2X02A 5AQ9A 1RGZA 1SDEA 3IF6C 2ZQDA 4OONA 5JYPA 3UPOA 3HBRA 2OSUA 4C75A 1SHVA 1IYSA 4S2KA 3W4QA 1PWCA 1HTZA 1IELA 3NDGA 4U0TA 5EECA 4K0XA 4BL3A 1L0GA 4GOGA 3A3JA 3FKWA 3G34A 4ZJ2A 3GVBA 3S22A 4S2IA 1CEGA 1K54A 5FQKA 3WWXA 3NCKA 2HDRA 3FYZA 3HLGA 4B4XA 1NYYA 1IYPA 4LV1A 3HUNA 2XD1A 2XFSA 1MY8A 1W79A 2Y2GA 1GHPA 3EQVA 3FV7A 1W5DA 5DF7A 5CXWA 2A3UA 3IH9A 4OOYA 4MEZA 5CGWA 4ZJ1A 3PBNA 4JF6A 2HDQA 3ZFZA 1CEFA 5I94A 4CJNA 2EFXA 1ZKJA 3EQUA 4A5RA 5AQ7A 4N9KA 4X53A 1S6RA 1K54C 4N9LA 3ZGAB 1Y54A 4KZ3A 4R4SA 4QY6A 4YINA 5GL9A 5A91A 3G30A 1YLYA 3PBOA 3UPPA 4R1GA 1IKGA 1O7EA 2ZQ9A 3PAEA 4B4ZA 2FFFB 1KDWA 1MWUA 2XH9A 3G2ZA 4GKUA 4UA6A 4QJGA 5A92A 3M2KA 3VP3A 2EXBA 1I2WA 1K56D 4E6WA 4EQIA 3G32A 3GRJA 1IYQA 1NZOA 5G18A 3TOIA 3MFDA 1PIOA 3A3FA 3MKFA 1NZUA 2G2WA 2XK1A 3LY3A 1BLCA 1YLZA 3BFGA 1TDGA 4JF4A 4PM9A 2EX9A 3NY4A 3W4OA 5FQ9A 5F1FA 3CZDA 5L2FA 4XXRA 3ZG0A 2RCXA 1CK3A 1VQQA 4KZ6A 4BD0A 3HLEA 1YM1A 3RJUA 1PWGA 4JBFA 5FASA 2EX8A 3HLFA 1GA0A 3IXHA 1PW8A 3N4IA 5BOHA 3IHAA 1HD8A 3Q7ZA 1JVJA 1LL5A 5AQBA 2DRWA 4E3NA 3GQZA 1SDNA 2XDMA 4FCFA 1LI0A 1PW1A 5HFOA 5DVAA 3VSKA 2WYXA 3MKEA 5M18A 5M19A 4RA7A 2GDNA 2EX6A 2ZQ7A 2P74A 5E43A 1L0DA 4QB8A 2CC1A 2OLUA 4S2JA 1LL9A 3S4XA 4QU3A 3VMAA 3NBLA 3O86A 2HPBA 1KVLA 1KVMA 4DDSA 1FR6A 4EWFA 1L0FA 1K4FA 3JYIA 1XGJA 1ONHA 1CI8A 3VP0A 4HBUA 5A93A 3P98A 4LV0A 4WEJA 4Y7PA 3S1YA 3O87A 4XUXA 3W4PA 2Y2NA 4ZTKA 2J7VA 1KE0A 2WUQA 3Q7VB 1FR1A 1GA9A 1FSYA 1G6AA 1KGFA 2ZC7A 3N8RA 3SH8A 4WMCA 3C4OA 3UDXA 3E2LA 1TEMA 4OOLA 5CERA 2HP6A 4PM7A 3MXRA 3A3EA 3NC8A 2RL3A 1ES4A 1WE4A 4WBGA 1KGEA 4KG2A 1XX2A 3IWOA 3O3VA 1OMEA 5GHYA 1ZG4A 1JTGA 2UWXA 3N8SA 4PM5A 1XA7A 4DE3A 1BLPA 4ZBEA 4MNRA 1HVBA 3AGFA 2PBYA 4P6BA 5EUAA 2Y4AA 2H10A 3BFDA 4MBKA 4OPZA 1M6KA 3MXSA 4R4RA 3PTEA 4P0MA 1MKIA 4O7DA 2DCFA 4HESA 3HLDA 2A49A 4U0XA 4GD6A 1ESIA 4E3OA 3M2JA 3AGEA 3BM6A 5EPHA 4KENB 1KE3A 3AGDA 4OLDA 2OV5A 4LCLA 2E8IA 5CHUA 4ZAMA 3UE1A 4DDYA 3SOIA 4M3KA 4JLFA 1K25A 2P9VA 2WGWB 1I5QA 1C3BA 3LO7A 2Y2QA 5EOEA 1W7FA 3ZG9B 2Q9NA 1ES2A 2Y2PA 5FAPA 3OCLA 2Y55A 1PWDA 4S2LA 2C6WB 4PMAA 1MPLA 5DTKA 1DJBA 3V3RA 4R3BA 5FSRA 3WRZA 2IWDA 5F83A 1ONGA 3GMWA 4IBRA 3SH7A 3TSGA 4GN2A 4DKIA 2WKEA 2XGNA 1BLHA 4PM8A 1JTDA 1Z6FA 3WS5A 1MWRA 4WM9A 2H5SA 3MBZA 3PAGA 1PI5A 4WZ4A 4OLGA 4X6TA 3VP1A 4OH0A 3SS3A 5CTMA 4KZ4A 1L0EA 3BLSA 3PBTA 3MZDA 2Y59A 3W8KA 1LI9A 2Z2MB 1K6RA 1DJAA 1YMSA 5TFQA 4OVDA 3IWQA 4GDNA 2JBFA 4KZ8A 5DTTA 3FZCA 3LCEA 3G2YA 3Q7VA 3ZVWA 1K38A 2J9OA 5TR7A 1K4EA 3IF5A 2I72A 1QMFA 4OPYA 4K0WA 5CHMA 3ZG7B 3ZNTA 2XLNA 1K55A 2PU2A 2Y2LA 5GLCA 5F82A 4KZ5A 3VOZA 5A90A 1BLSA 2ZM0A 1NRFA 2OLVA 2Y2JA 3HUMA 4DE1A 4RVAA 3PBRA 1W8QA 3CJMA 1YQSA 4KZ9A 3NIAA 3UDFA 3QNCA 2ZLYA 3IT9A 4CPKA 2X01A 3ITBA 3VFFA 1H8YA 2Y2KA 2V1ZA 4RX2A 3ZHHA 3Q1FA 4ZDXA 5CEDA 3GR2A 4KZAA 3HUOA 4KZ7A 4OP5A 3G4PA 5HX9A 1BZAA 3BEBA 5KSCA 4E3MA 4R23A 1S0WA 4X68A 1PI4A 2B5RA 3DWZA 4Y0OA 5EOOA 3M6HA 4BD1A 2IWBA 1MBLA 4QD4A 1K55C 1YLPA 1LLBA 4KQQA 4DE0A 2HP9A 5CHJA 1LHYA 5EVIB 2PU4A 4Q8IA 1SKFA 4BL2A 2ZM8A 4JXVA 3Q81A 2WGWA 4DF6A 5KZHA 1BULA 3IQAA 3N7WA 5FQQA 3ZDJA 5KMWA 2EXAA 4C3QA 3BLMA 2ZC5B 1K57A 4FH4A 4WMCD 4N1XA 4HEFA 3OC2A 3G31A 1YLTA 2V2FF 2C5WB 2QPNA 1MWTA 1G68A 1K6SA 2XQZA 2Z2LB 5KSHA 2R9XA 4MBHA 3VP4A 4E3KA 2WGIA 3MZEA 4JXSA 4GB7A 3M6BA 4OPRA 4WYYA 5FI6A 1XKZA 4IVKA 1Q2PA 4RYEA 3SS4A 3BFFA 4PM6A 5FATA 1IEMA 1CI9A 2Y2OA 2ZQ8A 4JF5A 4UHUA 1XP4A 3A3DA 4S2PA 2ZQCA 3C4PA 3DW0A 1K57C 4OQHA 3IWIA 1EWZA 3IXGA 3Q82A 5E2EA 3OZHA 2WADA 4NK3A 4WEKA 3IH8A 4S2OA 4OP8A 5FQMA 3BRMA 2ZD8A 3N8LA 3OCNA 1GCEA 4ID4A 5HAIA 1IYOA 2ZC4B 3WS2A 4JPMA 1VM1A 1ES5A 4OQGA 3RXWA 1XXMA 2WZXA 1E25A 1ZC2A 3HL9A 1JWPA 4OQ0A 4DE2A 5M1AA 2WKIA 4LV3A 4Y0TA 2BG1A 2H0YA 1HZOA 5IHVA 5GLDA 3MZFA 5TGFA 1H8ZA 5HAPA 5GHXA 3OPLA 1QMEA 1MXOA 3CMZA 1YT4A 3HLBA 1FCMA 4IEDA 1JWZA 5CECA 5GHZA 3HVFA 1NY0A 3NI9A 3SS5A 4MBFA 5DF8A 1PZOA 1PYYA 4P85A 5CEBA 4HBTA 4Z9QA 3BFEA 3QHYA 5F1GA 3OPPA 4YFMA 4GZBA 3IXDA 1ERMA 3BFCA 5FAQA 3VSLA 5EVIA 1TVFA 2Y2IA 3FWLA 4ZJ3A 5FAOA 3G35A 2X71A 4KG5A 1GHMA 5DTSA 5FI2A 3D4FA 4F94A 4LV2A 3ZG8B 3TG9A 4E3LA 3C5AA 2QZ6A 3CG5A 3E2KA 1YLJA 1XGIA 5AQAA 1IKIA 4WELA 3PBQA 3HLCA 5EVLA 3ZNYA 3A3IA 1YMXA 2ZC3B 2ZM2A 4EV4A 2J9PA 2XEPA 2HP5A 2WGVA 3IHBA 1E4DA 1N4OA 2XD5A 4QY5A 3UPNA 5JYOA 5EVIC 4L0LA 2J8YA 5EE8A 1ALQA 2DNSA 3N6IA 4GNUA 4U3TA 3VFHA 4DXCA 1RCJA 3I7JA 2XFTA 3UY6A 1TDLA 2VGKA 4R0QA 5GLBA 4RX3A 4DXBA 4EUZA 5E2FA 4KQOA 3SH9A 4EBPA 3IF6B 1ERQA 1Q2QA 4JKTA 4X56A 3QNBA 3UO9A 1N9BA 1PZPA 1BUEA 1BTLA 4H8RA 4FSFA 4JXWA 5CGSA 3DWKA 3IXBA 4UA9A 5FI7A 1BSGA 3PBSA 1ESUA 1FOFA 1WYBA 2H0TA 1EI5A 2HDUA 3ZG5A 1WYCA 4UA7A 1FQGA 1KE4A 4KQRA 3DTMA 4KZBA 4Y0UA 4N92A 4FH2A 4MLLA 5HAQA 1MWSA 1U60A 4OPQA 3UNWA 3WS1A 5FDHA 5FQJA 2P9VB 2BLSA 1FSWA 2R9WA 3ISGA 1JWVA 1K56A 3V50A 3WS4A 4BQMA 1E3UD 3V5MA 2ZMAA 3C7UA 5DF9A 1BT5A 1H5XA 2Q9MA 3LY4A 3HREA 5HARA 4EBLA 4XUZA 2WKHA 3BECA 2ZC6B 4K91A 4E3IA 3V3SA 1YLWA 3BYDA 5U47A 3ZCZA 4KG6A 3HLWA 4QHCA 4X69A 4LENA 1L2SA 1KGGA 5FQIA 3UE3A 1E3UA 1NYMA 2JCHA 4FD8A 2IWCA 1FCNA 3Q07A 2XF3A 4P87A 3UDIA 1W8YA 3GTCA 3V39A 2JE5A 1AXBA 1ES3A 1XA1A 5HL1A 4X55A 2EX2A 3VP2A 4S2NA 4IBXA 3RXXA 4EBNA 2WAFA 4OOMA 1I2SA 5D3OA 1NJ4A 4PPRA 4BENA 2VGJA 1DY6A 4E6XA 4BJPA 1ZG6A 4NETA 4WZ5A 5E2GA 3P09A 3UN7A 2WAEA 3GSGA 3LEZA 2WZZA 2G2UA 1XPBA 3OPRA 4N1HA 4OKPA 5E2HA 3WS0A 2ZQAA 3OPHA 2Y91A 1J9MA 2V20A 2HDSA 2Y2HA 3C7VA 4D2OA 1EROA 2EFUA 3FKVA 2FFYA 2ZJ9A 5CRFA 4JXGA 4UAAA 3IF6A 4GD8A 1KDSA 5CTNA 3WRTA 4BLMA 5J8XA 4B88A 1RP5A 3NDEA 4S2NC 5CGXA 1DJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JC7 A;  5EVI D;  4R3J A;  1NXY A;  3VOY A;  5FA7 A;  5HW3 A;  1GHI A;  4GDB A;  3GV9 A;  1RGY A;  3B3X A;  4IVI A;  2QMI A;  4WZ5 C;  4S2M A;  1O07 A;  1FCO A;  2XR0 A;  2Y2M A;  4OQI A;  2WK0 A;  4DRT A;  4LCM A;  3UE0 A;  3ZVT A;  4C6Y A;  3ITA A;  1SCW A;  5GLA A;  3O88 A;  4E3J A;  1M40 A;  2X02 A;  5AQ9 A;  1RGZ A;  1SDE A;  3IF6 C;  2ZQD A;  4OON A;  5JYP A;  3UPO A;  3HBR A;  2OSU A;  4C75 A;  1SHV A;  1IYS A;  4S2K A;  3W4Q A;  1PWC A;  1HTZ A;  1IEL A;  3NDG A;  4U0T A;  5EEC A;  4K0X A;  4BL3 A;  1L0G A;  4GOG A;  3A3J A;  3FKW A;  3G34 A;  4ZJ2 A;  3GVB A;  3S22 A;  4S2I A;  1CEG A;  1K54 A;  5FQK A;  3WWX A;  3NCK A;  2HDR A;  3FYZ A;  3HLG A;  4B4X A;  1NYY A;  1IYP A;  4LV1 A;  3HUN A;  2XD1 A;  2XFS A;  1MY8 A;  1W79 A;  2Y2G A;  1GHP A;  3EQV A;  3FV7 A;  1W5D A;  5DF7 A;  5CXW A;  2A3U A;  3IH9 A;  4OOY A;  4MEZ A;  5CGW A;  4ZJ1 A;  3PBN A;  4JF6 A;  2HDQ A;  3ZFZ A;  1CEF A;  5I94 A;  4CJN A;  2EFX A;  1ZKJ A;  3EQU A;  4A5R A;  5AQ7 A;  4N9K A;  4X53 A;  1S6R A;  1K54 C;  4N9L A;  3ZGA B;  1Y54 A;  4KZ3 A;  4R4S A;  4QY6 A;  4YIN A;  5GL9 A;  5A91 A;  3G30 A;  1YLY A;  3PBO A;  3UPP A;  4R1G A;  1IKG A;  1O7E A;  2ZQ9 A;  3PAE A;  4B4Z A;  2FFF B;  1KDW A;  1MWU A;  2XH9 A;  3G2Z A;  4GKU A;  4UA6 A;  4QJG A;  5A92 A;  3M2K A;  3VP3 A;  2EXB A;  1I2W A;  1K56 D;  4E6W A;  4EQI A;  3G32 A;  3GRJ A;  1IYQ A;  1NZO A;  5G18 A;  3TOI A;  3MFD A;  1PIO A;  3A3F A;  3MKF A;  1NZU A;  2G2W A;  2XK1 A;  3LY3 A;  1BLC A;  1YLZ A;  3BFG A;  1TDG A;  4JF4 A;  4PM9 A;  2EX9 A;  3NY4 A;  3W4O A;  5FQ9 A;  5F1F A;  3CZD A;  5L2F A;  4XXR A;  3ZG0 A;  2RCX A;  1CK3 A;  1VQQ A;  4KZ6 A;  4BD0 A;  3HLE A;  1YM1 A;  3RJU A;  1PWG A;  4JBF A;  5FAS A;  2EX8 A;  3HLF A;  1GA0 A;  3IXH A;  1PW8 A;  3N4I A;  5BOH A;  3IHA A;  1HD8 A;  3Q7Z A;  1JVJ A;  1LL5 A;  5AQB A;  2DRW A;  4E3N A;  3GQZ A;  1SDN A;  2XDM A;  4FCF A;  1LI0 A;  1PW1 A;  5HFO A;  5DVA A;  3VSK A;  2WYX A;  3MKE A;  5M18 A;  5M19 A;  4RA7 A;  2GDN A;  2EX6 A;  2ZQ7 A;  2P74 A;  5E43 A;  1L0D A;  4QB8 A;  2CC1 A;  2OLU A;  4S2J A;  1LL9 A;  3S4X A;  4QU3 A;  3VMA A;  3NBL A;  3O86 A;  2HPB A;  1KVL A;  1KVM A;  4DDS A;  1FR6 A;  4EWF A;  1L0F A;  1K4F A;  3JYI A;  1XGJ A;  1ONH A;  1CI8 A;  3VP0 A;  4HBU A;  5A93 A;  3P98 A;  4LV0 A;  4WEJ A;  4Y7P A;  3S1Y A;  3O87 A;  4XUX A;  3W4P A;  2Y2N A;  4ZTK A;  2J7V A;  1KE0 A;  2WUQ A;  3Q7V B;  1FR1 A;  1GA9 A;  1FSY A;  1G6A A;  1KGF A;  2ZC7 A;  3N8R A;  3SH8 A;  4WMC A;  3C4O A;  3UDX A;  3E2L A;  1TEM A;  4OOL A;  5CER A;  2HP6 A;  4PM7 A;  3MXR A;  3A3E A;  3NC8 A;  2RL3 A;  1ES4 A;  1WE4 A;  4WBG A;  1KGE A;  4KG2 A;  1XX2 A;  3IWO A;  3O3V A;  1OME A;  5GHY A;  1ZG4 A;  1JTG A;  2UWX A;  3N8S A;  4PM5 A;  1XA7 A;  4DE3 A;  1BLP A;  4ZBE A;  4MNR A;  1HVB A;  3AGF A;  2PBY A;  4P6B A;  5EUA A;  2Y4A A;  2H10 A;  3BFD A;  4MBK A;  4OPZ A;  1M6K A;  3MXS A;  4R4R A;  3PTE A;  4P0M A;  1MKI A;  4O7D A;  2DCF A;  4HES A;  3HLD A;  2A49 A;  4U0X A;  4GD6 A;  1ESI A;  4E3O A;  3M2J A;  3AGE A;  3BM6 A;  5EPH A;  4KEN B;  1KE3 A;  3AGD A;  4OLD A;  2OV5 A;  4LCL A;  2E8I A;  5CHU A;  4ZAM A;  3UE1 A;  4DDY A;  3SOI A;  4M3K A;  4JLF A;  1K25 A;  2P9V A;  2WGW B;  1I5Q A;  1C3B A;  3LO7 A;  2Y2Q A;  5EOE A;  1W7F A;  3ZG9 B;  2Q9N A;  1ES2 A;  2Y2P A;  5FAP A;  3OCL A;  2Y55 A;  1PWD A;  4S2L A;  2C6W B;  4PMA A;  1MPL A;  5DTK A;  1DJB A;  3V3R A;  4R3B A;  5FSR A;  3WRZ A;  2IWD A;  5F83 A;  1ONG A;  3GMW A;  4IBR A;  3SH7 A;  3TSG A;  4GN2 A;  4DKI A;  2WKE A;  2XGN A;  1BLH A;  4PM8 A;  1JTD A;  1Z6F A;  3WS5 A;  1MWR A;  4WM9 A;  2H5S A;  3MBZ A;  3PAG A;  1PI5 A;  4WZ4 A;  4OLG A;  4X6T A;  3VP1 A;  4OH0 A;  3SS3 A;  5CTM A;  4KZ4 A;  1L0E A;  3BLS A;  3PBT A;  3MZD A;  2Y59 A;  3W8K A;  1LI9 A;  2Z2M B;  1K6R A;  1DJA A;  1YMS A;  5TFQ A;  4OVD A;  3IWQ A;  4GDN A;  2JBF A;  4KZ8 A;  5DTT A;  3FZC A;  3LCE A;  3G2Y A;  3Q7V A;  3ZVW A;  1K38 A;  2J9O A;  5TR7 A;  1K4E A;  3IF5 A;  2I72 A;  1QMF A;  4OPY A;  4K0W A;  5CHM A;  3ZG7 B;  3ZNT A;  2XLN A;  1K55 A;  2PU2 A;  2Y2L A;  5GLC A;  5F82 A;  4KZ5 A;  3VOZ A;  5A90 A;  1BLS A;  2ZM0 A;  1NRF A;  2OLV A;  2Y2J A;  3HUM A;  4DE1 A;  4RVA A;  3PBR A;  1W8Q A;  3CJM A;  1YQS A;  4KZ9 A;  3NIA A;  3UDF A;  3QNC A;  2ZLY A;  3IT9 A;  4CPK A;  2X01 A;  3ITB A;  3VFF A;  1H8Y A;  2Y2K A;  2V1Z A;  4RX2 A;  3ZHH A;  3Q1F A;  4ZDX A;  5CED A;  3GR2 A;  4KZA A;  3HUO A;  4KZ7 A;  4OP5 A;  3G4P A;  5HX9 A;  1BZA A;  3BEB A;  5KSC A;  4E3M A;  4R23 A;  1S0W A;  4X68 A;  1PI4 A;  2B5R A;  3DWZ A;  4Y0O A;  5EOO A;  3M6H A;  4BD1 A;  2IWB A;  1MBL A;  4QD4 A;  1K55 C;  1YLP A;  1LLB A;  4KQQ A;  4DE0 A;  2HP9 A;  5CHJ A;  1LHY A;  5EVI B;  2PU4 A;  4Q8I A;  1SKF A;  4BL2 A;  2ZM8 A;  4JXV A;  3Q81 A;  2WGW A;  4DF6 A;  5KZH A;  1BUL A;  3IQA A;  3N7W A;  5FQQ A;  3ZDJ A;  5KMW A;  2EXA A;  4C3Q A;  3BLM A;  2ZC5 B;  1K57 A;  4FH4 A;  4WMC D;  4N1X A;  4HEF A;  3OC2 A;  3G31 A;  1YLT A;  2V2F F;  2C5W B;  2QPN A;  1MWT A;  1G68 A;  1K6S A;  2XQZ A;  2Z2L B;  5KSH A;  2R9X A;  4MBH A;  3VP4 A;  4E3K A;  2WGI A;  3MZE A;  4JXS A;  4GB7 A;  3M6B A;  4OPR A;  4WYY A;  5FI6 A;  1XKZ A;  4IVK A;  1Q2P A;  4RYE A;  3SS4 A;  3BFF A;  4PM6 A;  5FAT A;  1IEM A;  1CI9 A;  2Y2O A;  2ZQ8 A;  4JF5 A;  4UHU A;  1XP4 A;  3A3D A;  4S2P A;  2ZQC A;  3C4P A;  3DW0 A;  1K57 C;  4OQH A;  3IWI A;  1EWZ A;  3IXG A;  3Q82 A;  5E2E A;  3OZH A;  2WAD A;  4NK3 A;  4WEK A;  3IH8 A;  4S2O A;  4OP8 A;  5FQM A;  3BRM A;  2ZD8 A;  3N8L A;  3OCN A;  1GCE A;  4ID4 A;  5HAI A;  1IYO A;  2ZC4 B;  3WS2 A;  4JPM A;  1VM1 A;  1ES5 A;  4OQG A;  3RXW A;  1XXM A;  2WZX A;  1E25 A;  1ZC2 A;  3HL9 A;  1JWP A;  4OQ0 A;  4DE2 A;  5M1A A;  2WKI A;  4LV3 A;  4Y0T A;  2BG1 A;  2H0Y A;  1HZO A;  5IHV A;  5GLD A;  3MZF A;  5TGF A;  1H8Z A;  5HAP A;  5GHX A;  3OPL A;  1QME A;  1MXO A;  3CMZ A;  1YT4 A;  3HLB A;  1FCM A;  4IED A;  1JWZ A;  5CEC A;  5GHZ A;  3HVF A;  1NY0 A;  3NI9 A;  3SS5 A;  4MBF A;  5DF8 A;  1PZO A;  1PYY A;  4P85 A;  5CEB A;  4HBT A;  4Z9Q A;  3BFE A;  3QHY A;  5F1G A;  3OPP A;  4YFM A;  4GZB A;  3IXD A;  1ERM A;  3BFC A;  5FAQ A;  3VSL A;  5EVI A;  1TVF A;  2Y2I A;  3FWL A;  4ZJ3 A;  5FAO A;  3G35 A;  2X71 A;  4KG5 A;  1GHM A;  5DTS A;  5FI2 A;  3D4F A;  4F94 A;  4LV2 A;  3ZG8 B;  3TG9 A;  4E3L A;  3C5A A;  2QZ6 A;  3CG5 A;  3E2K A;  1YLJ A;  1XGI A;  5AQA A;  1IKI A;  4WEL A;  3PBQ A;  3HLC A;  5EVL A;  3ZNY A;  3A3I A;  1YMX A;  2ZC3 B;  2ZM2 A;  4EV4 A;  2J9P A;  2XEP A;  2HP5 A;  2WGV A;  3IHB A;  1E4D A;  1N4O A;  2XD5 A;  4QY5 A;  3UPN A;  5JYO A;  5EVI C;  4L0L A;  2J8Y A;  5EE8 A;  1ALQ A;  2DNS A;  3N6I A;  4GNU A;  4U3T A;  3VFH A;  4DXC A;  1RCJ A;  3I7J A;  2XFT A;  3UY6 A;  1TDL A;  2VGK A;  4R0Q A;  5GLB A;  4RX3 A;  4DXB A;  4EUZ A;  5E2F A;  4KQO A;  3SH9 A;  4EBP A;  3IF6 B;  1ERQ A;  1Q2Q A;  4JKT A;  4X56 A;  3QNB A;  3UO9 A;  1N9B A;  1PZP A;  1BUE A;  1BTL A;  4H8R A;  4FSF A;  4JXW A;  5CGS A;  3DWK A;  3IXB A;  4UA9 A;  5FI7 A;  1BSG A;  3PBS A;  1ESU A;  1FOF A;  1WYB A;  2H0T A;  1EI5 A;  2HDU A;  3ZG5 A;  1WYC A;  4UA7 A;  1FQG A;  1KE4 A;  4KQR A;  3DTM A;  4KZB A;  4Y0U A;  4N92 A;  4FH2 A;  4MLL A;  5HAQ A;  1MWS A;  1U60 A;  4OPQ A;  3UNW A;  3WS1 A;  5FDH A;  5FQJ A;  2P9V B;  2BLS A;  1FSW A;  2R9W A;  3ISG A;  1JWV A;  1K56 A;  3V50 A;  3WS4 A;  4BQM A;  1E3U D;  3V5M A;  2ZMA A;  3C7U A;  5DF9 A;  1BT5 A;  1H5X A;  2Q9M A;  3LY4 A;  3HRE A;  5HAR A;  4EBL A;  4XUZ A;  2WKH A;  3BEC A;  2ZC6 B;  4K91 A;  4E3I A;  3V3S A;  1YLW A;  3BYD A;  5U47 A;  3ZCZ A;  4KG6 A;  3HLW A;  4QHC A;  4X69 A;  4LEN A;  1L2S A;  1KGG A;  5FQI A;  3UE3 A;  1E3U A;  1NYM A;  2JCH A;  4FD8 A;  2IWC A;  1FCN A;  3Q07 A;  2XF3 A;  4P87 A;  3UDI A;  1W8Y A;  3GTC A;  3V39 A;  2JE5 A;  1AXB A;  1ES3 A;  1XA1 A;  5HL1 A;  4X55 A;  2EX2 A;  3VP2 A;  4S2N A;  4IBX A;  3RXX A;  4EBN A;  2WAF A;  4OOM A;  1I2S A;  5D3O A;  1NJ4 A;  4PPR A;  4BEN A;  2VGJ A;  1DY6 A;  4E6X A;  4BJP A;  1ZG6 A;  4NET A;  4WZ5 A;  5E2G A;  3P09 A;  3UN7 A;  2WAE A;  3GSG A;  3LEZ A;  2WZZ A;  2G2U A;  1XPB A;  3OPR A;  4N1H A;  4OKP A;  5E2H A;  3WS0 A;  2ZQA A;  3OPH A;  2Y91 A;  1J9M A;  2V20 A;  2HDS A;  2Y2H A;  3C7V A;  4D2O A;  1ERO A;  2EFU A;  3FKV A;  2FFY A;  2ZJ9 A;  5CRF A;  4JXG A;  4UAA A;  3IF6 A;  4GD8 A;  1KDS A;  5CTN A;  3WRT A;  4BLM A;  5J8X A;  4B88 A;  1RP5 A;  3NDE A;  4S2N C;  5CGX A;  1DJC A; 
#chains in the Genus database with same CATH topology
 4R3J A;  3VOY A;  3P7N A;  5CX7 A;  3GV9 A;  4WZ5 C;  2QMI A;  3LI9 A;  4G3V A;  3TRC A;  2WK0 A;  4LCM A;  3L9K A;  5GLA A;  4E3J A;  1H8M A;  1ZHH B;  3IF6 C;  4HY8 A;  5JYP A;  4LRZ E;  4C75 A;  5F69 A;  3A0S A;  1PWC A;  4K0X A;  4GOG A;  4FOF A;  4S2I A;  5FQK A;  3WWX A;  1NYY A;  3EEA A;  3EQV A;  1NRJ A;  3IH9 A;  2HJE A;  3PBN A;  3T50 A;  2CMN A;  2YKF A;  1Y54 A;  4R4S A;  4QY6 A;  5A91 A;  3G30 A;  1O7E A;  5IU1 A;  2ZQ9 A;  2FFF B;  1KDW A;  1MWU A;  2XH9 A;  3G2Z A;  4HNB A;  2EXB A;  1I2W A;  4E6W A;  5G18 A;  3MFD A;  1PIO A;  4HP4 A;  4II7 A;  1BLC A;  2W1R A;  3BFG A;  1SZV A;  2EX9 A;  3T4J A;  3CZD A;  5L2F A;  2B02 A;  2VV6 A;  5HD5 A;  1VQQ A;  4KZ6 A;  3RJU A;  4JBF A;  2PYR A;  3HLF A;  3C30 A;  3IHA A;  1LL5 A;  5AQB A;  4FCF A;  3LR5 A;  4H6J B;  2WYX A;  4O01 A;  3LFV A;  1D06 A;  3KSH A;  1A0K A;  2B95 A;  3O86 A;  1KVL A;  1KVM A;  3R7W B;  1OTA A;  3JYI A;  1CI8 A;  4WF0 A;  2QHK A;  5EM1 A;  3SH8 A;  1FSY A;  4X1L A;  2GZA A;  3UDX A;  5CER A;  3VE4 A;  4WBG A;  5HDS A;  1XX2 A;  3IWO A;  1OME A;  1ZG4 A;  1K0K A;  1OTE A;  4DE3 A;  1XFN A;  4LPZ A;  3NUL A;  1HVB A;  3BFD A;  1CJF A;  2W3G A;  3MS6 A;  4HES A;  2A49 A;  3KX0 X;  3MFX A;  4KEN B;  2OV5 A;  3QP8 A;  2W0N A;  4LCL A;  2VKS A;  1N9O A;  2L4R A;  2P9V A;  1I5Q A;  3LO7 A;  2Y2Q A;  2AVX A;  3ZG9 B;  3MMH A;  5HPF A;  1PWD A;  2H28 A;  2C6W B;  4R3B A;  5FSR A;  2IWD A;  5F83 A;  3GMW A;  4IBR A;  3TSG A;  3SH7 A;  4DKI A;  2JKG A;  4WM9 A;  3R7W A;  3EWK A;  1CQA A;  1L0E A;  2FH5 A;  2V9A A;  1DJA A;  3LCE A;  3ZVW A;  1K38 A;  2J9O A;  3UB5 P;  3ZNT A;  2PRF A;  1K55 A;  2PU2 A;  4KZ5 A;  1BLS A;  1NRF A;  4BMW A;  3CJM A;  5TJJ A;  2QYB A;  3UDF A;  2X01 A;  3T12 B;  4ZDX A;  2V1Z A;  2GNX A;  5CED A;  5HX9 A;  4R23 A;  1PI4 A;  2B5R A;  3LYX A;  3M6H A;  2IWB A;  1MBL A;  4DJ3 A;  1YLP A;  3DTK A;  3NOP C;  3DTE A;  5EVI B;  4BL2 A;  4JXV A;  5KZH A;  3N7W A;  5HDC A;  2BAS A;  4HEF A;  3G31 A;  3ZYT A;  2V2F F;  3T4K A;  1G68 A;  3S7P A;  4MBH A;  4JGQ A;  3MZE A;  5FI6 A;  4ETZ A;  4RYE A;  3SS4 A;  4PM6 A;  5FAT A;  5IT5 A;  4ETX A;  2Y2O A;  1J3W A;  3C4P A;  4NK3 A;  2WAD A;  4S2O A;  2M7V A;  1ES5 A;  1E25 A;  4FTX A;  5TGF A;  1QME A;  3CMZ A;  1YT4 A;  2VJW A;  4IED A;  5CEC A;  1S1Z A;  3HVF A;  3SS5 A;  3ZQ5 A;  4P85 A;  5CEB A;  2K7S A;  2W27 A;  4G3W A;  2V8F A;  3BFC A;  3OOV A;  5EVI A;  3FWL A;  1F9I A;  2W3F A;  2V0U A;  3D4F A;  3ZG8 B;  3C8C A;  1OJ5 A;  4WEL A;  2Y8H A;  3ZNY A;  3VE3 A;  2ZC3 B;  5C5K A;  4Y15 A;  2WGV A;  1N4O A;  1TD5 A;  1HLU P;  2J8Y A;  5EE8 A;  4GNU A;  1RCJ A;  1OTB A;  4PKY A;  2JHE A;  4KQO A;  3SH9 A;  3IF6 B;  4R70 A;  3DTI A;  1OT9 A;  3QNB A;  3UO9 A;  4I39 A;  4FSF A;  1FOF A;  2HDU A;  1WYC A;  5L07 A;  5TBM B;  4EW7 A;  1FQG A;  5HAQ A;  4Y0U A;  2EWW A;  3CWF A;  2HJ9 C;  1JWV A;  1K56 A;  3WS4 A;  3LUQ A;  2VV7 A;  3K3C A;  4HH3 A;  2J3T D;  2ZOH A;  3LY4 A;  4XUZ A;  2WKH A;  2ZC6 B;  1YLW A;  3ZCZ A;  1IOU A;  3LR3 A;  4X69 A;  4LEN A;  1NYM A;  2JCH A;  1TS8 A;  5HL1 A;  4X55 A;  4IHQ A;  2OWH A;  4IBX A;  4EBN A;  2DMW A;  3T4Q A;  4BJP A;  1ZG6 A;  4WZ5 A;  2WAE A;  2G2U A;  2ZQA A;  2V20 A;  2Y2H A;  2HDS A;  4JXG A;  2QWS A;  1T1B A;  3IF6 A;  1KDS A;  3WRT A;  3NDE A;  4S2N C;  3LIB A;  1DJC A;  1NXY A;  4GDB A;  1XJ3 A;  1RGY A;  3B3X A;  3RH8 B;  4S2M A;  2K2N A;  4GW9 A;  4DRT A;  5TBM A;  3O88 A;  1M40 A;  2OAP 1;  5AQ9 A;  2KX6 A;  1RGZ A;  1SDE A;  4OON A;  3A0R A;  2ZMF A;  3UPO A;  3HBR A;  3PYP A;  4U0T A;  1IEL A;  4EQ1 A;  1L0G A;  3A3J A;  4ZJ2 A;  4G3K A;  3S22 A;  1CEG A;  3NCK A;  4B4X A;  4LV1 A;  1IYP A;  4EES A;  2VV8 A;  2XFS A;  2Y2G A;  1S67 L;  3FV7 A;  3FG8 A;  5L09 A;  5CGW A;  4ZJ1 A;  3UB6 A;  4JF6 A;  2PR6 A;  3ZFZ A;  4B93 A;  4A5R A;  2WKP A;  3NHQ A;  3S7N A;  4N9K A;  1S6R A;  1K54 C;  3ZGA B;  4YIN A;  5AVE A;  4EER A;  3PBO A;  3UPP A;  1IKG A;  1FIL A;  2P08 A;  4GKU A;  4UA6 A;  3QP6 A;  3M2K A;  1L3L A;  3G32 A;  4Y17 A;  3A3F A;  3HCY A;  1NZU A;  2PHY A;  2V8C A;  3LEQ A;  1YLZ A;  1TDG A;  5F1F A;  1YKD A;  5FDS A;  3E4Q A;  4MCW A;  2V1B A;  2RCX A;  3LI8 A;  3HLE A;  1YM1 A;  4KUO A;  1LSW A;  2XA7 M;  3C38 A;  3Q7Z A;  1JVJ A;  3PR6 A;  4E3N A;  1F5M A;  3GQZ A;  2XDM A;  3FPV A;  4CLC C;  5M19 A;  1LSX A;  1V9Y A;  2EX6 A;  3LIF A;  2ZQ7 A;  4QB8 A;  2CC1 A;  2OLU A;  4S2J A;  3NBL A;  2HPB A;  4EWF A;  2E8J A;  1L0F A;  1K4F A;  4R6L A;  3MQ0 A;  3VP0 A;  4HBU A;  4AFI A;  3P98 A;  4LV0 A;  4Y7P A;  3CLO A;  3O87 A;  4XUX A;  3W4P A;  3KSG A;  3Q7V B;  1FR1 A;  2ZC7 A;  3N8R A;  1G6A A;  1KGF A;  3IBR A;  4NKP A;  1TEM A;  3O5Y A;  3MXR A;  3IX3 A;  5I5L A;  3A0V A;  3CHW P;  4KG2 A;  2L1M A;  4ME4 A;  5GHY A;  4PM5 A;  1XA7 A;  1BLP A;  4ZBE A;  4MNR A;  3AGF A;  2PBY A;  3QP5 A;  5EUA A;  4OPZ A;  3MXS A;  2GJ3 A;  1MKI A;  4P6Z M;  2DCF A;  4GD6 A;  3VOL A;  1CF0 A;  3AGE A;  3D72 A;  3UE1 A;  4JLF A;  4ESP A;  1KOU A;  5DKL A;  3K2N A;  4GLQ A;  2PAV P;  4L9E A;  4R3A A;  2Y55 A;  5DTK A;  3V3R A;  3H82 B;  2ZL1 A;  3B33 A;  3WRZ A;  3R4K A;  5MC7 A;  5EFW A;  4GN2 A;  3ULF A;  1BLH A;  1JTD A;  4WN5 A;  3MBZ A;  1BYW A;  4OH0 A;  3SS3 A;  4HJ4 A;  3W8K A;  1LI9 A;  3CI6 A;  2Z2M B;  5TFQ A;  2XSS A;  1IFQ A;  4KZ8 A;  3K3D A;  3SW1 A;  3FZC A;  2QJ7 A;  3Q7V A;  2ZOI A;  1K4E A;  2I72 A;  1LSV A;  5CHM A;  3UB7 A;  5F82 A;  4DE1 A;  4RVA A;  2BTF P;  1YQS A;  3NIA A;  3QNC A;  4CPK A;  2Y2K A;  1S1Y A;  3HUO A;  4OP5 A;  5L8M A;  5KSC A;  3BEB A;  2Y79 A;  4BD1 A;  3BY8 A;  4QD4 A;  2OAQ 1;  1LLB A;  4B9O A;  1LHY A;  2QJ5 A;  4DF6 A;  2EXA A;  4C3Q A;  2ZC5 B;  2XA7 S;  4N1X A;  3OLO A;  3OC2 A;  2XRO A;  2O9B A;  2EA9 A;  4ARZ B;  3B42 A;  3BQ8 A;  2Z2L B;  3H82 A;  4DJ2 A;  4PHT A;  1VB6 A;  2R9X A;  4GB7 A;  3T4L A;  1Q2P A;  1W63 M;  3EGD C;  2Q0O A;  4UHU A;  2A24 B;  3GEC A;  3F1P B;  4S2P A;  3DW0 A;  3IWI A;  3IXG A;  3Q82 A;  3OZH A;  4WEK A;  3IH8 A;  2NUT C;  3BRM A;  2VGL M;  3OCN A;  1IYO A;  2ZC4 B;  1VM1 A;  1XXM A;  2WZX A;  2VZW A;  4OQ0 A;  4DE2 A;  1P97 A;  2WKI A;  3T1X A;  4Y0T A;  2BG1 A;  5IHV A;  1HZO A;  1DP6 A;  2PD7 A;  3C2W A;  3JVV A;  1MXO A;  1JWZ A;  3NI9 A;  3B47 A;  4P6Z S;  4Q0J A;  1S66 L;  3U2A A;  4Z9Q A;  3QHY A;  5F1G A;  3OPP A;  4X25 A;  3QP1 A;  3IXD A;  1ERM A;  4H6J A;  4I38 A;  1OPX A;  5J3W A;  1GHM A;  4WUJ A;  2W1T B;  5DTS A;  3TG9 A;  4K08 A;  4E3L A;  3C5A A;  3CG5 A;  3E2K A;  1XGI A;  1YSQ A;  1YMX A;  2ZM2 A;  3NEC A;  2HP5 A;  4EEU A;  2KLI A;  4L0L A;  3VFH A;  2K31 A;  4YOF A;  2A24 A;  3F1P A;  4UQI M;  4R0Q A;  3NOT C;  1ERQ A;  1F98 A;  1VET B;  1N9B A;  1PZP A;  1BUE A;  1STZ A;  4H8R A;  4F3L B;  3DWK A;  3CUE C;  4UA9 A;  1BSG A;  4Q0I A;  1WYB A;  2QKP A;  5J7E A;  4LRY C;  3JVU A;  1VEU B;  4EEP A;  5EV0 A;  2M1C A;  3SZT A;  4KQR A;  3DTM A;  4OPQ A;  5FDH A;  5FQJ A;  3ISG A;  2R78 A;  3W2Z A;  3V50 A;  2ZMA A;  5DF9 A;  1BT5 A;  1H5X A;  2Q9M A;  3HRE A;  5HAR A;  5AVF A;  3H9W A;  1ODV A;  3V3S A;  3BYD A;  5U47 A;  1L2S A;  4NXG A;  3UDI A;  2IWC A;  1FCN A;  3H7W B;  3LIA A;  4IUH A;  5F68 A;  3GTC A;  2JE5 A;  1AXB A;  3KYZ A;  1ES3 A;  2EX2 A;  3VP2 A;  4S2N A;  3TE8 A;  3RXX A;  2WAF A;  4I3A A;  1I2S A;  4BEN A;  2JKR M;  2JKF A;  1H0M A;  4NET A;  5E2G A;  4BBT A;  3P09 A;  3UN7 A;  3GSG A;  3LEZ A;  1TF1 A;  1XPB A;  4N1H A;  4OKP A;  5E2H A;  3WS0 A;  2UV0 E;  2Y91 A;  1J9M A;  3C7V A;  4Q0H A;  4D2O A;  1ERO A;  2EFU A;  4CLC B;  2VGL S;  5HD3 A;  4BLM A;  4B88 A;  5CGX A;  1X0O A;  5EVI D;  4F3L A;  5HW3 A;  1GHI A;  4IVI A;  3NOU C;  1O07 A;  1FCO A;  1PNE A;  4E04 A;  3ZVT A;  3UE0 A;  3ITA A;  4Y13 A;  3DAV A;  4JGP A;  3HJI A;  1GSV A;  2ZQD A;  2OSU A;  1SHV A;  1IYS A;  4S2K A;  3W4Q A;  1HTZ A;  3NDG A;  4BL3 A;  4HIA A;  1D7E A;  3GVB A;  1K54 A;  3EEH A;  3HLG A;  1DP8 A;  3HUN A;  3S7O A;  2XD1 A;  4GJ4 A;  1MY8 A;  2EWV A;  1GHP A;  1XJ2 A;  2PT7 A;  5CXW A;  2A3U A;  4XT2 B;  4OOY A;  4MEZ A;  2HDQ A;  1CEF A;  5I94 A;  4CJN A;  2EFX A;  5AQ7 A;  3S7Q A;  5KIZ A;  4N9L A;  3LR4 A;  5GL9 A;  1YLY A;  4R38 A;  4UQI S;  4B4Z A;  3UB9 A;  5A92 A;  3G6O A;  1K56 D;  4LGW A;  3GRJ A;  1IYQ A;  1NZO A;  4CLC A;  3IX4 A;  3TOI A;  3D9Y A;  3MKF A;  4DN0 A;  2XK1 A;  3LY3 A;  2A2L A;  4JF4 A;  4PM9 A;  4Y3I A;  5DJU A;  4X1M A;  1VHM A;  5FQ9 A;  2G7U A;  3ZG0 A;  1S4S A;  4UEY A;  2EX8 A;  3IXH A;  1GA0 A;  3N4I A;  1PW8 A;  1HD8 A;  4QWO A;  2V1A A;  4LLO B;  3LGO A;  2DRW A;  1T19 A;  1LI0 A;  1PW1 A;  5HFO A;  3DBA A;  5DVA A;  3MF0 A;  3VSK A;  3MKE A;  5M18 A;  4RA7 A;  4HJ6 A;  2P74 A;  5E43 A;  1L0D A;  2O9A A;  1LL9 A;  3VMA A;  4DDS A;  3E4O A;  3KSI A;  1MKM A;  4HOI A;  4WEJ A;  3S1Y A;  5EM0 A;  2Y2N A;  1YPR A;  1KE0 A;  4WMC A;  4XT2 A;  2P7J A;  3A3E A;  2RL3 A;  1WE4 A;  3O3V A;  2JKT M;  2VX8 A;  4P6B A;  4MBK A;  1EW0 A;  1TS6 A;  4E3O A;  2JN7 A;  2PBD P;  3M2J A;  3IX8 A;  2E8I A;  5CHU A;  4DDY A;  3SOI A;  1K25 A;  5EOE A;  4YWZ A;  1W7F A;  2Q9N A;  1ES2 A;  2Y2P A;  3HJK A;  1SKO B;  5FAP A;  3OCL A;  4S2L A;  3E98 A;  4PMA A;  3LIC A;  1MPL A;  3TW8 A;  1DJB A;  2HF6 A;  1ONG A;  2WKE A;  3VV4 A;  4PM8 A;  4LRX C;  5G4Z A;  1Z6F A;  3WS5 A;  1MWR A;  1PRQ A;  1OT6 A;  4I3I A;  3PAG A;  3VP1 A;  5CTM A;  4KZ4 A;  3BLS A;  3PBT A;  3MZD A;  2Y59 A;  1V9Z A;  4OVD A;  3IWQ A;  2ZBB A;  3T4S A;  5TR7 A;  4WL9 A;  3IF5 A;  4IJG A;  3VOZ A;  5GLC A;  2J80 A;  2OLV A;  5J4E A;  2Y2J A;  2I9V A;  3EOI A;  3HUM A;  3PBR A;  1W8Q A;  4KZ9 A;  2ZLY A;  3VFF A;  3ITB A;  3LIE A;  1H8Y A;  1G6O A;  3ZHH A;  4JGO A;  4KZ7 A;  4E3M A;  1S0W A;  4Y0O A;  5EOO A;  3MSH A;  4KQQ A;  2HGV A;  2PD8 A;  4Q8I A;  4NG2 A;  1BUL A;  3TJZ C;  1LT0 A;  1NLY A;  1GSX A;  5KMW A;  1MZU A;  2XRN A;  2MJ6 A;  1YLT A;  1SKO A;  2QPN A;  1MWT A;  5KSH A;  2KOI A;  2D02 A;  3VP4 A;  2WGI A;  4JXS A;  4WYY A;  5HL6 A;  3BFF A;  1CI9 A;  2ZQ8 A;  3GDI A;  3A3D A;  2ZQC A;  1K57 C;  3PXP A;  3NJA A;  4OP8 A;  4HI4 A;  3T1Q B;  2ZD8 A;  3ICY A;  3N8L A;  3U4L P;  1GCE A;  2ZMV A;  3WS2 A;  5IS1 A;  3E0Y A;  4OQG A;  3RXW A;  1ZC2 A;  3HL9 A;  1JWP A;  3OBF A;  4LV3 A;  3LR0 A;  3FC7 A;  3KYQ A;  5EVE A;  4BBV A;  3OPL A;  1FCM A;  5GHZ A;  1NY0 A;  4Y5F A;  3UME A;  2W3D A;  4GZB A;  2P04 A;  3VSL A;  2Y2I A;  4ZJ3 A;  5FAO A;  3G35 A;  2X71 A;  5F5Y A;  4MN5 A;  5FI2 A;  4I5S A;  1XFQ A;  4M4X A;  1NWZ A;  2GX5 A;  1YSP A;  3A3I A;  2VK3 A;  5HWT A;  1Z09 A;  3UE6 A;  3CUE A;  5FEF A;  2NUP C;  2OWJ A;  2XD5 A;  4KQD A;  4DXC A;  3I7J A;  2XFT A;  3UY6 A;  5HPI A;  4RX3 A;  5AJG A;  5E2F A;  4EBP A;  1Q2Q A;  4JKT A;  3MQO A;  2VLG A;  5HWV A;  4L9G A;  1LL8 A;  1ESU A;  2H0T A;  1FIK A;  2WKQ A;  3ZG5 A;  4DMZ A;  4N92 A;  4MLL A;  2P9V B;  2BLS A;  2OOL A;  2R9W A;  4BQM A;  2ACG A;  1E3U D;  1Y28 A;  1MC0 A;  2YKH A;  3L7H A;  3C7U A;  2W3E A;  4HHD A;  4O0P A;  1G28 A;  2HV1 A;  5L10 A;  4NXE A;  4EBL A;  3BEC A;  5FQI A;  1E3U A;  4FD8 A;  4P87 A;  3Q07 A;  4HJ3 A;  2XF3 A;  2FZ0 A;  3BWL A;  1UWP X;  1W8Y A;  1XA1 A;  5HSQ A;  3E4P A;  4OOM A;  5D3O A;  1NJ4 A;  4PPR A;  1DY6 A;  2IA2 A;  4NXF A;  2D01 A;  2LB9 A;  3FKV A;  3BW6 A;  5CTN A;  4GD8 A;  1N9N A;  1RP5 A;  3KO6 A;  4D60 A;  2JC7 A;  5FA7 A;  2XR0 A;  2Y2M A;  1YAX A;  3KSF A;  4OQI A;  4PAU A;  4C6Y A;  1SCW A;  1JNU A;  2PYP A;  2X02 A;  3IBJ A;  4EXO A;  5EEC A;  5FEG A;  2L0W A;  1PFL A;  3FKW A;  3G34 A;  4ARZ A;  2HDR A;  3FYZ A;  1W79 A;  1W5D A;  1OJG A;  5DF7 A;  2PR5 A;  1ZKJ A;  3EQU A;  4X53 A;  1H3Q A;  4KZ3 A;  1TS0 A;  4R1G A;  3PAE A;  3KYE A;  4QJG A;  3VP3 A;  3BJN A;  4EQI A;  4ZRR A;  2G2W A;  2WKR A;  2O9C A;  3NY4 A;  3W4O A;  4XXR A;  1CK3 A;  4BD0 A;  5FL3 A;  1PWG A;  5FAS A;  5BOH A;  1SDN A;  1T18 A;  4L9F A;  2GDN A;  2W1T A;  4O8G A;  3S4X A;  4QU3 A;  1FR6 A;  1XGJ A;  1ONH A;  4RQ9 A;  5A93 A;  4ZTK A;  2J7V A;  2WUQ A;  5G4Y A;  1GA9 A;  4BBU A;  1F2K A;  3C4O A;  3E2L A;  1TS7 A;  4OOL A;  2HP6 A;  4PM7 A;  4GHI B;  3NC8 A;  1ES4 A;  1KGE A;  3PHY A;  5LBR A;  1VET A;  1JTG A;  2UWX A;  3N8S A;  4MMN A;  5F6A A;  4EUV A;  4Y2F A;  3UMD A;  3T1S A;  2Y4A A;  1ZTU A;  2H10 A;  5HDD A;  1M6K A;  4R4R A;  3PTE A;  4GS9 B;  4P0M A;  4O7D A;  1VEU A;  3HLD A;  4U0X A;  1ESI A;  3BM6 A;  5EPH A;  4WLA A;  1KE3 A;  3AGD A;  4OLD A;  1P9R A;  4ZAM A;  4MDZ A;  3CAX A;  4M3K A;  3T4T A;  2WGW B;  1ACF A;  1C3B A;  3T4O A;  4PKY G;  3JPU A;  4HQA A;  1N9L A;  3F1O B;  4CQH A;  2XGN A;  4FUW A;  3H7W A;  2H5S A;  4WZ4 A;  1PI5 A;  4I3J A;  4OLG A;  4X6T A;  3BY9 A;  4CLC D;  1K6R A;  1YMS A;  4Z1W A;  4GCZ A;  4GDN A;  2JBF A;  3T1R A;  5DTT A;  3G2Y A;  3ZG7 B;  4OPY A;  1QMF A;  4K0W A;  4MN7 A;  2XLN A;  2Y2L A;  4GHI A;  5A90 A;  3CPT B;  2ZM0 A;  1T1A A;  3QP4 A;  3IT9 A;  4IUK A;  1S4R A;  1T1C A;  4RX2 A;  3Q1F A;  3GR2 A;  2Z6C A;  4KZA A;  3UB8 A;  3G4P A;  1BZA A;  4GS9 A;  4X68 A;  3DWZ A;  1DRM A;  1K55 C;  4DE0 A;  2HP9 A;  5CHJ A;  3RTY A;  2PU4 A;  1SKF A;  2JKR I;  1G5U A;  2ZM8 A;  3Q81 A;  2WGW A;  3MXQ A;  3IQA A;  5FQQ A;  3ZDJ A;  3BLM A;  1K57 A;  5HZH A;  4FH4 A;  4WMC D;  4BWI A;  2KDK A;  3MR0 A;  2C5W B;  1K6S A;  2XQZ A;  3IS2 B;  2Z6D A;  2O0Y A;  4MN6 A;  4E3K A;  4OPR A;  3F1O A;  3M6B A;  1XKZ A;  4IVK A;  1IEM A;  4NEE D;  4JF5 A;  1XP4 A;  3LID A;  2INW A;  4OQH A;  1EWZ A;  5DKK A;  5E2E A;  5FQM A;  3P01 A;  4ID4 A;  5HAI A;  1AWI A;  4JPM A;  3RFB A;  1W63 Q;  3D3O A;  5M1A A;  2H0Y A;  3CPT A;  5GLD A;  3MZF A;  1H8Z A;  5HAP A;  5GHX A;  3MQQ A;  3HLB A;  2V0W A;  4MBF A;  5DF8 A;  3EGX C;  1PZO A;  1PYY A;  4EET B;  4HBT A;  4QPR A;  3BFE A;  4YFM A;  1DP9 A;  5FAQ A;  1TVF A;  4KG5 A;  3CIT A;  2PDR A;  4EU0 A;  4F94 A;  2W3H A;  4JGR A;  4LV2 A;  1NLZ A;  2QZ6 A;  1YLJ A;  5AQA A;  1IKI A;  4HH2 A;  3PBQ A;  3F1N B;  3HLC A;  5EVL A;  3QP2 A;  3IS2 A;  4EV4 A;  2B18 A;  2J9P A;  2XEP A;  3IHB A;  1E4D A;  4QY5 A;  3UPN A;  5JYO A;  5EVI C;  1ALQ A;  2DNS A;  3N6I A;  4U3T A;  5K5B A;  2M7U A;  1WA9 A;  1TDL A;  2VGK A;  5DJT A;  5GLB A;  4DXB A;  4EUZ A;  4X56 A;  5DFY A;  1GSW A;  2O99 A;  1BTL A;  1P9W A;  4JXW A;  5CGS A;  3IXB A;  5FI7 A;  3PBS A;  5DFX A;  1EI5 A;  4UA7 A;  4YNR A;  1XJ6 A;  1KE4 A;  4KZB A;  4FH2 A;  1MWS A;  1U60 A;  3UNW A;  3WS1 A;  1UGU A;  5HWW A;  1FSW A;  2HZ5 A;  2VA0 A;  3FPW A;  1OTD A;  3V5M A;  4CLC E;  1D1J A;  2ZL1 B;  4HP9 A;  4LFU A;  4K91 A;  4E3I A;  4KG6 A;  3HLW A;  4QHC A;  2JKT I;  5A8B A;  1KGG A;  3UE3 A;  4NXB A;  2J3W A;  4KUK A;  3V39 A;  1UWN X;  1XJ4 A;  1P0Z A;  3BQA A;  3F1N A;  1Y4O A;  2VGJ A;  4E6X A;  3V67 A;  1OTI A;  3MJQ A;  2WZZ A;  3OPR A;  3OPH A;  2FFY A;  2ZJ9 A;  2J3T C;  5CRF A;  4UAA A;  2LB5 A;  5J8X A;  2VEA A; 
#chains in the Genus database with same CATH homology
 2JC7 A;  5EVI D;  4R3J A;  1NXY A;  3VOY A;  5FA7 A;  5HW3 A;  1GHI A;  4GDB A;  3GV9 A;  1RGY A;  3B3X A;  4IVI A;  2QMI A;  4WZ5 C;  4S2M A;  1O07 A;  1FCO A;  2XR0 A;  2Y2M A;  4OQI A;  2WK0 A;  4DRT A;  4LCM A;  3UE0 A;  3ZVT A;  4C6Y A;  3ITA A;  1SCW A;  5GLA A;  3O88 A;  4E3J A;  1M40 A;  2X02 A;  5AQ9 A;  1RGZ A;  1SDE A;  3IF6 C;  2ZQD A;  4OON A;  5JYP A;  3UPO A;  3HBR A;  2OSU A;  4C75 A;  1SHV A;  1IYS A;  4S2K A;  3W4Q A;  1PWC A;  1HTZ A;  1IEL A;  3NDG A;  4U0T A;  5EEC A;  4K0X A;  4BL3 A;  1L0G A;  4GOG A;  3A3J A;  3FKW A;  3G34 A;  4ZJ2 A;  3GVB A;  3S22 A;  4S2I A;  1CEG A;  1K54 A;  5FQK A;  3WWX A;  3NCK A;  2HDR A;  3FYZ A;  3HLG A;  4B4X A;  1NYY A;  1IYP A;  4LV1 A;  3HUN A;  2XD1 A;  2XFS A;  1MY8 A;  1W79 A;  2Y2G A;  1GHP A;  3EQV A;  3FV7 A;  1W5D A;  5DF7 A;  5CXW A;  2A3U A;  3IH9 A;  4OOY A;  4MEZ A;  5CGW A;  4ZJ1 A;  3PBN A;  4JF6 A;  2HDQ A;  3ZFZ A;  1CEF A;  5I94 A;  4CJN A;  2EFX A;  1ZKJ A;  3EQU A;  4A5R A;  5AQ7 A;  4N9K A;  4X53 A;  1S6R A;  1K54 C;  4N9L A;  3ZGA B;  1Y54 A;  4KZ3 A;  4R4S A;  4QY6 A;  4YIN A;  5GL9 A;  5A91 A;  3G30 A;  1YLY A;  3PBO A;  3UPP A;  4R1G A;  1IKG A;  1O7E A;  2ZQ9 A;  3PAE A;  4B4Z A;  2FFF B;  1KDW A;  1MWU A;  2XH9 A;  3G2Z A;  4GKU A;  4UA6 A;  4QJG A;  5A92 A;  3M2K A;  3VP3 A;  2EXB A;  1I2W A;  1K56 D;  4E6W A;  4EQI A;  3G32 A;  3GRJ A;  1IYQ A;  1NZO A;  5G18 A;  3TOI A;  3MFD A;  1PIO A;  3A3F A;  3MKF A;  1NZU A;  2G2W A;  2XK1 A;  3LY3 A;  1BLC A;  1YLZ A;  3BFG A;  1TDG A;  4JF4 A;  4PM9 A;  2EX9 A;  3NY4 A;  3W4O A;  5FQ9 A;  5F1F A;  3CZD A;  5L2F A;  4XXR A;  3ZG0 A;  2RCX A;  1CK3 A;  1VQQ A;  4KZ6 A;  4BD0 A;  3HLE A;  1YM1 A;  3RJU A;  1PWG A;  4JBF A;  5FAS A;  2EX8 A;  3HLF A;  1GA0 A;  3IXH A;  1PW8 A;  3N4I A;  5BOH A;  3IHA A;  1HD8 A;  3Q7Z A;  1JVJ A;  1LL5 A;  5AQB A;  2DRW A;  4E3N A;  3GQZ A;  1SDN A;  2XDM A;  4FCF A;  1LI0 A;  1PW1 A;  5HFO A;  5DVA A;  3VSK A;  2WYX A;  3MKE A;  5M18 A;  5M19 A;  4RA7 A;  2GDN A;  2EX6 A;  2ZQ7 A;  2P74 A;  5E43 A;  1L0D A;  4QB8 A;  2CC1 A;  2OLU A;  4S2J A;  1LL9 A;  3S4X A;  4QU3 A;  3VMA A;  3NBL A;  3O86 A;  2HPB A;  1KVL A;  1KVM A;  4DDS A;  1FR6 A;  4EWF A;  1L0F A;  1K4F A;  3JYI A;  1XGJ A;  1ONH A;  1CI8 A;  3VP0 A;  4HBU A;  5A93 A;  3P98 A;  4LV0 A;  4WEJ A;  4Y7P A;  3S1Y A;  3O87 A;  4XUX A;  3W4P A;  2Y2N A;  4ZTK A;  2J7V A;  1KE0 A;  2WUQ A;  3Q7V B;  1FR1 A;  1GA9 A;  1FSY A;  1G6A A;  1KGF A;  2ZC7 A;  3N8R A;  3SH8 A;  4WMC A;  3C4O A;  3UDX A;  3E2L A;  1TEM A;  4OOL A;  5CER A;  2HP6 A;  4PM7 A;  3MXR A;  3A3E A;  3NC8 A;  2RL3 A;  1ES4 A;  1WE4 A;  4WBG A;  1KGE A;  4KG2 A;  1XX2 A;  3IWO A;  3O3V A;  1OME A;  5GHY A;  1ZG4 A;  1JTG A;  2UWX A;  3N8S A;  4PM5 A;  1XA7 A;  4DE3 A;  1BLP A;  4ZBE A;  4MNR A;  1HVB A;  3AGF A;  2PBY A;  4P6B A;  5EUA A;  2Y4A A;  2H10 A;  3BFD A;  4MBK A;  4OPZ A;  1M6K A;  3MXS A;  4R4R A;  3PTE A;  4P0M A;  1MKI A;  4O7D A;  2DCF A;  4HES A;  3HLD A;  2A49 A;  4U0X A;  4GD6 A;  1ESI A;  4E3O A;  3M2J A;  3AGE A;  3BM6 A;  5EPH A;  4KEN B;  1KE3 A;  3AGD A;  4OLD A;  2OV5 A;  4LCL A;  2E8I A;  5CHU A;  4ZAM A;  3UE1 A;  4DDY A;  3SOI A;  4M3K A;  4JLF A;  1K25 A;  2P9V A;  2WGW B;  1I5Q A;  1C3B A;  3LO7 A;  2Y2Q A;  5EOE A;  1W7F A;  3ZG9 B;  2Q9N A;  1ES2 A;  2Y2P A;  5FAP A;  3OCL A;  2Y55 A;  1PWD A;  4S2L A;  2C6W B;  4PMA A;  1MPL A;  5DTK A;  1DJB A;  3V3R A;  4R3B A;  5FSR A;  3WRZ A;  2IWD A;  5F83 A;  1ONG A;  3GMW A;  4IBR A;  3SH7 A;  3TSG A;  4GN2 A;  4DKI A;  2WKE A;  2XGN A;  1BLH A;  4PM8 A;  1JTD A;  1Z6F A;  3WS5 A;  1MWR A;  4WM9 A;  2H5S A;  3MBZ A;  3PAG A;  1PI5 A;  4WZ4 A;  4OLG A;  4X6T A;  3VP1 A;  4OH0 A;  3SS3 A;  5CTM A;  4KZ4 A;  1L0E A;  3BLS A;  3PBT A;  3MZD A;  2Y59 A;  3W8K A;  1LI9 A;  2Z2M B;  1K6R A;  1DJA A;  1YMS A;  5TFQ A;  4OVD A;  3IWQ A;  4GDN A;  2JBF A;  4KZ8 A;  5DTT A;  3FZC A;  3LCE A;  3G2Y A;  3Q7V A;  3ZVW A;  1K38 A;  2J9O A;  5TR7 A;  1K4E A;  3IF5 A;  2I72 A;  1QMF A;  4OPY A;  4K0W A;  5CHM A;  3ZG7 B;  3ZNT A;  2XLN A;  1K55 A;  2PU2 A;  2Y2L A;  5GLC A;  5F82 A;  4KZ5 A;  3VOZ A;  5A90 A;  1BLS A;  2ZM0 A;  1NRF A;  2OLV A;  2Y2J A;  3HUM A;  4DE1 A;  4RVA A;  3PBR A;  1W8Q A;  3CJM A;  1YQS A;  4KZ9 A;  3NIA A;  3UDF A;  3QNC A;  2ZLY A;  3IT9 A;  4CPK A;  2X01 A;  3ITB A;  3VFF A;  1H8Y A;  2Y2K A;  2V1Z A;  4RX2 A;  3ZHH A;  3Q1F A;  4ZDX A;  5CED A;  3GR2 A;  4KZA A;  3HUO A;  4KZ7 A;  4OP5 A;  3G4P A;  5HX9 A;  1BZA A;  3BEB A;  5KSC A;  4E3M A;  4R23 A;  1S0W A;  4X68 A;  1PI4 A;  2B5R A;  3DWZ A;  4Y0O A;  5EOO A;  3M6H A;  4BD1 A;  2IWB A;  1MBL A;  4QD4 A;  1K55 C;  1YLP A;  1LLB A;  4KQQ A;  4DE0 A;  2HP9 A;  5CHJ A;  1LHY A;  5EVI B;  2PU4 A;  4Q8I A;  1SKF A;  4BL2 A;  2ZM8 A;  4JXV A;  3Q81 A;  2WGW A;  4DF6 A;  5KZH A;  1BUL A;  3IQA A;  3N7W A;  5FQQ A;  3ZDJ A;  5KMW A;  2EXA A;  4C3Q A;  3BLM A;  2ZC5 B;  1K57 A;  4FH4 A;  4WMC D;  4N1X A;  4HEF A;  3OC2 A;  3G31 A;  1YLT A;  2V2F F;  2C5W B;  2QPN A;  1MWT A;  1G68 A;  1K6S A;  2XQZ A;  2Z2L B;  5KSH A;  2R9X A;  4MBH A;  3VP4 A;  4E3K A;  2WGI A;  3MZE A;  4JXS A;  4GB7 A;  3M6B A;  4OPR A;  4WYY A;  5FI6 A;  1XKZ A;  4IVK A;  1Q2P A;  4RYE A;  3SS4 A;  3BFF A;  4PM6 A;  5FAT A;  1IEM A;  1CI9 A;  2Y2O A;  2ZQ8 A;  4JF5 A;  4UHU A;  1XP4 A;  3A3D A;  4S2P A;  2ZQC A;  3C4P A;  3DW0 A;  1K57 C;  4OQH A;  3IWI A;  1EWZ A;  3IXG A;  3Q82 A;  5E2E A;  3OZH A;  2WAD A;  4NK3 A;  4WEK A;  3IH8 A;  4S2O A;  4OP8 A;  5FQM A;  3BRM A;  2ZD8 A;  3N8L A;  3OCN A;  1GCE A;  4ID4 A;  5HAI A;  1IYO A;  2ZC4 B;  3WS2 A;  4JPM A;  1VM1 A;  1ES5 A;  4OQG A;  3RXW A;  1XXM A;  2WZX A;  1E25 A;  1ZC2 A;  3HL9 A;  1JWP A;  4OQ0 A;  4DE2 A;  5M1A A;  2WKI A;  4LV3 A;  4Y0T A;  2BG1 A;  2H0Y A;  1HZO A;  5IHV A;  5GLD A;  3MZF A;  5TGF A;  1H8Z A;  5HAP A;  5GHX A;  3OPL A;  1QME A;  1MXO A;  3CMZ A;  1YT4 A;  3HLB A;  1FCM A;  4IED A;  1JWZ A;  5CEC A;  5GHZ A;  3HVF A;  1NY0 A;  3NI9 A;  3SS5 A;  4MBF A;  5DF8 A;  1PZO A;  1PYY A;  4P85 A;  5CEB A;  4HBT A;  4Z9Q A;  3BFE A;  3QHY A;  5F1G A;  3OPP A;  4YFM A;  4GZB A;  3IXD A;  1ERM A;  3BFC A;  5FAQ A;  3VSL A;  5EVI A;  1TVF A;  2Y2I A;  3FWL A;  4ZJ3 A;  5FAO A;  3G35 A;  2X71 A;  4KG5 A;  1GHM A;  5DTS A;  5FI2 A;  3D4F A;  4F94 A;  4LV2 A;  3ZG8 B;  3TG9 A;  4E3L A;  3C5A A;  2QZ6 A;  3CG5 A;  3E2K A;  1YLJ A;  1XGI A;  5AQA A;  1IKI A;  4WEL A;  3PBQ A;  3HLC A;  5EVL A;  3ZNY A;  3A3I A;  1YMX A;  2ZC3 B;  2ZM2 A;  4EV4 A;  2J9P A;  2XEP A;  2HP5 A;  2WGV A;  3IHB A;  1E4D A;  1N4O A;  2XD5 A;  4QY5 A;  3UPN A;  5JYO A;  5EVI C;  4L0L A;  2J8Y A;  5EE8 A;  1ALQ A;  2DNS A;  3N6I A;  4GNU A;  4U3T A;  3VFH A;  4DXC A;  1RCJ A;  3I7J A;  2XFT A;  3UY6 A;  1TDL A;  2VGK A;  4R0Q A;  5GLB A;  4RX3 A;  4DXB A;  4EUZ A;  5E2F A;  4KQO A;  3SH9 A;  4EBP A;  3IF6 B;  1ERQ A;  1Q2Q A;  4JKT A;  4X56 A;  3QNB A;  3UO9 A;  1N9B A;  1PZP A;  1BUE A;  1BTL A;  4H8R A;  4FSF A;  4JXW A;  5CGS A;  3DWK A;  3IXB A;  4UA9 A;  5FI7 A;  1BSG A;  3PBS A;  1ESU A;  1FOF A;  1WYB A;  2H0T A;  1EI5 A;  2HDU A;  3ZG5 A;  1WYC A;  4UA7 A;  1FQG A;  1KE4 A;  4KQR A;  3DTM A;  4KZB A;  4Y0U A;  4N92 A;  4FH2 A;  4MLL A;  5HAQ A;  1MWS A;  1U60 A;  4OPQ A;  3UNW A;  3WS1 A;  5FDH A;  5FQJ A;  2P9V B;  2BLS A;  1FSW A;  2R9W A;  3ISG A;  1JWV A;  1K56 A;  3V50 A;  3WS4 A;  4BQM A;  1E3U D;  3V5M A;  2ZMA A;  3C7U A;  5DF9 A;  1BT5 A;  1H5X A;  2Q9M A;  3LY4 A;  3HRE A;  5HAR A;  4EBL A;  4XUZ A;  2WKH A;  3BEC A;  2ZC6 B;  4K91 A;  4E3I A;  3V3S A;  1YLW A;  3BYD A;  5U47 A;  3ZCZ A;  4KG6 A;  3HLW A;  4QHC A;  4X69 A;  4LEN A;  1L2S A;  1KGG A;  5FQI A;  3UE3 A;  1E3U A;  1NYM A;  2JCH A;  4FD8 A;  2IWC A;  1FCN A;  3Q07 A;  2XF3 A;  4P87 A;  3UDI A;  1W8Y A;  3GTC A;  3V39 A;  2JE5 A;  1AXB A;  1ES3 A;  1XA1 A;  5HL1 A;  4X55 A;  2EX2 A;  3VP2 A;  4S2N A;  4IBX A;  3RXX A;  4EBN A;  2WAF A;  4OOM A;  1I2S A;  5D3O A;  1NJ4 A;  4PPR A;  4BEN A;  2VGJ A;  1DY6 A;  4E6X A;  4BJP A;  1ZG6 A;  4NET A;  4WZ5 A;  5E2G A;  3P09 A;  3UN7 A;  2WAE A;  3GSG A;  3LEZ A;  2WZZ A;  2G2U A;  1XPB A;  3OPR A;  4N1H A;  4OKP A;  5E2H A;  3WS0 A;  2ZQA A;  3OPH A;  2Y91 A;  1J9M A;  2V20 A;  2HDS A;  2Y2H A;  3C7V A;  4D2O A;  1ERO A;  2EFU A;  3FKV A;  2FFY A;  2ZJ9 A;  5CRF A;  4JXG A;  4UAA A;  3IF6 A;  4GD8 A;  1KDS A;  5CTN A;  3WRT A;  4BLM A;  5J8X A;  4B88 A;  1RP5 A;  3NDE A;  4S2N C;  5CGX A;  1DJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...