5EECA

Crystal structure of kpc-2 beta-lactamase in complex with the s02030 boronic acid inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
b'LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbapenem-hydrolyzing beta-lactamase KPC
publication title Crystal Structures of KPC-2 and SHV-1 beta-Lactamases in Complex with the Boronic Acid Transition State Analog S02030.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eecA00
4IBRA 3A3DA 1H8ZA 2IWDA 4ZDXA 1CK3A 1L2SA 4H8RA 3ZCZA 4JF5A 5E43A 5CGWA 1BT5A 3O87A 1MWUA 5CHUA 1DJBA 4WZ5A 5EECA 3DW0A 3OCNA 4ZJ3A 4EBLA 1PWDA 3FZCA 1E3UD 2Y2LA 4QJGA 4GD8A 1CEFA 4PM8A 4ZTKA 5FATA 3Q81A 5U47A 3VFFA 4XUXA 1YMXA 4N1XA 2WK0A 3RJUA 3WS0A 5A91A 2ZC3B 2EX9A 4L0LA 4QY6A 1K55C 4KZ5A 5FQKA 5FI6A 4F94A 4WMCD 5DTKA 4PM5A 1HTZA 4RYEA 4ZJ2A 4CJNA 2ZC6B 2Y55A 1Y54A 1WE4A 1DJAA 4A5RA 3B3XA 3UO9A 4N9KA 5CEDA 2A3UA 2BG1A 2DNSA 1ES4A 3G35A 1ERQA 4B4XA 4E3IA 1ESIA 1ES3A 3P98A 4S2MA 4S2PA 4EUZA 4IVIA 5FQQA 3N6IA 1I2SA 2Z2MB 3HL9A 5CEBA 4MBHA 3Q7ZA 4DXBA 4XUZA 4KG2A 2WKHA 4UHUA 2Q9MA 2XR0A 4K91A 2X02A 3IF6B 5FI7A 3PBRA 1S6RA 3ZG8B 1W8QA 3IHAA 4BD0A 5L2FA 2C6WB 1TEMA 3IT9A 3N7WA 4KZ8A 2WAFA 4ID4A 1PW1A 3UY6A 4OPRA 2ZLYA 4K0XA 5HAIA 2HP6A 3ZNTA 2J9OA 3BLMA 1CI9A 3PBOA 3VSLA 1J9MA 4QD4A 3IWQA 1KDWA 5HARA 5EUAA 4KQRA 2WADA 1W7FA 3M2KA 4JXGA 4JXVA 4DF6A 1MPLA 1PIOA 1SDNA 1K57A 2EX6A 2EX2A 3C7UA 4WEKA 2JBFA 5TGFA 4Y7PA 4X68A 4S2NC 2P9VA 2V2FF 2ZQ7A 3GR2A 4EV4A 3JYIA 1I2WA 3N8LA 2Y59A 1G68A 4JLFA 1RCJA 4PM6A 4UA9A 3IWOA 4WZ4A 1FCMA 1GA0A 2IWCA 2WYXA 2ZQ8A 4GKUA 3LO7A 3FKVA 3ITBA 5M1AA 5I94A 3TSGA 2Y2NA 3G31A 4KZ4A 1ERMA 2XK1A 4GOGA 1LLBA 1YT4A 4C75A 3A3IA 1IYQA 4KZ7A 3IXBA 5M19A 2A49A 2EXAA 4LCLA 4E3NA 3HUOA 1O7EA 1BZAA 4ZBEA 1FOFA 3SH8A 3UE1A 4E3JA 3EQVA 3NBLA 2XD5A 5EVIA 5A90A 4S2IA 2Y2JA 1BTLA 5FI2A 4GB7A 4R0QA 3E2LA 5AQBA 5A93A 1KE3A 1EROA 1L0FA 2Y2HA 2XDMA 3OC2A 4OP5A 2HDSA 1ONGA 1Q2PA 1OMEA 5EOEA 1FQGA 4DE3A 5F83A 5FSRA 2P9VB 4QB8A 4HBTA 3V50A 1NYYA 3HREA 1ZG4A 3PAEA 5DF8A 1YLWA 3CG5A 1XA1A 5EOOA 4HESA 3GSGA 2Z2LB 3MXRA 4N1HA 4BQMA 1LL5A 3Q1FA 3ZG0A 3AGFA 2OV5A 1KE4A 3C4OA 3MKEA 3SH7A 1KVLA 4XXRA 2EXBA 3G2ZA 1GA9A 3RXXA 4R4SA 2XLNA 3HLWA 1XPBA 1K55A 2PBYA 3HLCA 1TVFA 1XGJA 5TFQA 1MWSA 5D3OA 1ZG6A 4KG6A 5GLAA 1ES5A 3AGEA 1W8YA 4LV1A 1MXOA 3GQZA 4C6YA 3BRMA 3N8SA 1DY6A 3DWZA 5HW3A 3RXWA 4JKTA 2Y91A 3PBQA 2E8IA 3DTMA 4GD6A 5G18A 3D4FA 1PWGA 1NJ4A 1MY8A 5DVAA 2JCHA 4PM7A 4BL3A 5E2HA 2ZC4B 4OH0A 5CHMA 5GLBA 1L0DA 2PU4A 1K4EA 4GZBA 3M6HA 1NXYA 4LV3A 2WKEA 4FCFA 4RVAA 1K56A 2ZD8A 1SCWA 1XX2A 1KE0A 3BFCA 1C3BA 1EI5A 2H10A 3IQAA 5CGXA 3GTCA 3MXSA 1YLZA 4UA7A 2QPNA 1XP4A 2OLVA 4GNUA 3OPRA 1RGYA 4GDBA 1KGFA 2Y2PA 2Y2IA 4HBUA 4OPZA 2ZM2A 1FSWA 3Q82A 1MWTA 3VOYA 2HP5A 1HZOA 4E3KA 1ZKJA 3QHYA 5HFOA 3UE3A 2VGKA 2Y2KA 4S2NA 1SKFA 1VM1A 3VP1A 3C4PA 3Q7VA 2H5SA 2WKIA 3QNCA 1FR1A 4HEFA 2H0YA 4IVKA 3S4XA 1SDEA 4EWFA 1IYPA 2WZZA 2EFXA 1L0EA 1EWZA 1PW8A 2HP9A 2WAEA 3ISGA 3W4OA 1FSYA 4BD1A 1PZPA 4JBFA 4DE2A 4OP8A 3UPNA 2HPBA 1K54C 1BUEA 4Z9QA 3PBTA 1BLSA 2XGNA 3VMAA 5CERA 3HLBA 3SS5A 3OPHA 4OQ0A 5FAOA 1K38A 2Y2QA 3PTEA 3BFDA 5HX9A 3MKFA 4R4RA 1NZOA 4Y0OA 1PZOA 1ES2A 1H8YA 3E2KA 1E4DA 3CZDA 3VFHA 1W5DA 4CPKA 1MKIA 4B4ZA 1XKZA 3ITAA 1IYSA 3VP3A 2Y2GA 3I7JA 3S1YA 3Q7VB 2JC7A 2V1ZA 3W4PA 1IKIA 5FDHA 3GV9A 3IF6C 4E6XA 1TDLA 2Y2OA 4Y0UA 4MBKA 4DKIA 1K6SA 4RX3A 1SHVA 4DXCA 2GDNA 4P6BA 2P74A 4GDNA 4JXWA 4R23A 1K6RA 3WS2A 5F1GA 2Q9NA 5E2FA 5JYPA 3HUMA 3IXDA 4KQOA 4ZAMA 3A3JA 5FASA 1HD8A 3HLEA 5BOHA 4WYYA 4QY5A 5CECA 2G2WA 3C5AA 5GHZA 2J7VA 1IKGA 1Q2QA 4MLLA 2WGWA 3V39A 3SOIA 1ZC2A 2WZXA 3A3EA 5FQJA 5GHYA 3VOZA 3N4IA 3FYZA 2ZM0A 2CC1A 1M40A 3QNBA 5FAQA 4EQIA 2R9XA 5HAPA 3BYDA 4UA6A 3IXGA 1HVBA 4X6TA 3ZG9B 3OPLA 2JE5A 3NDEA 4D2OA 2XEPA 3IF5A 4GN2A 2OSUA 3G4PA 3MBZA 4C3QA 3TOIA 1YLJA 4S2OA 1FR6A 5F82A 2X71A 3OZHA 4JF6A 4OKPA 4OVDA 1IELA 2ZM8A 1O07A 5DTTA 4OQIA 4U0TA 1YLTA 3V3SA 4E3OA 5KZHA 3SS4A 4WBGA 5DF7A 4KENB 1QMFA 3IH9A 1PYYA 2B5RA 2QZ6A 3IHBA 1KGGA 5CHJA 4YINA 5EVIB 2I72A 4UAAA 5CXWA 3BFFA 3LY3A 4X69A 1GCEA 1AXBA 3NI9A 4OPQA 4LCMA 4R3JA 4NETA 4JF4A 1E3UA 4X55A 4IEDA 2HDUA 4S2KA 1U60A 4O7DA 2WGVA 2RL3A 1ONHA 5EVID 5KSHA 1ALQA 1XA7A 3UDXA 1JWPA 1WYCA 4DE1A 3UN7A 5F1FA 1JVJA 3G2YA 4R1GA 5FQIA 5DF9A 3FWLA 3IXHA 4WMCA 4KG5A 5CTMA 1K25A 4BLMA 3DWKA 3UDIA 1QMEA 3FKWA 5AQAA 3OPPA 4LV0A 4ZJ1A 2ZMAA 4RX2A 3NY4A 3GMWA 1GHMA 2Y4AA 5CTNA 3UPOA 1YLYA 1Z6FA 3SH9A 4Y0TA 3HLDA 1K54A 2XH9A 3NCKA 1K4FA 1H5XA 4S2LA 3LCEA 3FV7A 3ZVTA 1BULA 1BSGA 2ZQCA 1JTGA 3O3VA 4E3LA 3G30A 4OQHA 5E2EA 2R9WA 1JWVA 3SS3A 4QHCA 1PI5A 1CI8A 3VP2A 4OOYA 1L0GA 3WS1A 3WWXA 3HLFA 3CJMA 5FAPA 4Q8IA 1BLPA 3IF6A 2ZQAA 3OCLA 1IEMA 1KDSA 1DJCA 3NDGA 5GLDA 2DCFA 3C7VA 5IHVA 3TG9A 2G2UA 5DTSA 4KQQA 4U3TA 1KGEA 1XGIA 1CEGA 2FFFB 1LHYA 3HUNA 2C5WB 3LEZA 3WS4A 4OQGA 5GL9A 1FCNA 1W79A 3EQUA 1K56D 3ZG7B 2BLSA 4DRTA 3ZFZA 5TR7A 5KMWA 2X01A 1XXMA 3CMZA 5FA7A 5M18A 4KZAA 1GHIA 1IYOA 4P0MA 3UDFA 4E3MA 4OONA 3G34A 3O88A 3ZNYA 4WZ5C 3BEBA 3HBRA 2ZQ9A 1N9BA 2UWXA 3W4QA 4OOLA 1YM1A 1G6AA 2RCXA 3PBSA 3BECA 3Q07A 1BLHA 4NK3A 3A3FA 3GVBA 3BFGA 2ZC7A 1PI4A 3MZFA 1S0WA 2WGIA 1WYBA 4JXSA 2WUQA 4FD8A 3G32A 4WELA 4YFMA 4PMAA 3MZEA 2XD1A 3IH8A 3BFEA 1N4OA 3ZHHA 4BJPA 2IWBA 2J8YA 4FH2A 4BL2A 4EBPA 3ZGAB 2DRWA 2PU2A 1JTDA 1YQSA 3ZG5A 4OLGA 4PM9A 3M6BA 2ZJ9A 3PAGA 1LL9A 1E25A 2XF3A 5CRFA 2EFUA 4KZ9A 4N92A 1M6KA 5E2GA 3S22A 5HAQA 4E6WA 5EE8A 1ESUA 1GHPA 1NZUA 2QMIA 4P87A 5JYOA 5AQ9A 2OLUA 1MWRA 3BLSA 5AQ7A 1LI9A 3VSKA 1JWZA 4QU3A 1TDGA 3HLGA 1FCOA 3NIAA 1KVMA 4DDYA 5FQ9A 4MNRA 3M2JA 1I5QA 4KZ6A 4LV2A 2J9PA 4U0XA 3UE0A 2XFTA 4EBNA 3V3RA 1YMSA 1NRFA 4PPRA 2ZC5B 2ZQDA 4WM9A 5A92A 3AGDA 3N8RA 4WEJA 5EPHA 4MBFA 4FSFA 3ZVWA 4DDSA 1K57C 3IWIA 3GRJA 2V20A 4IBXA 3LY4A 4OOMA 5GHXA 3V5MA 2WGWB 4M3KA 5KSCA 1MBLA 4P85A 2HDRA 3MFDA 3MZDA 3VP0A 2EX8A 3ZDJA 2XFSA 2XQZA 1YLPA 4N9LA 5FQMA 1PWCA 1LI0A 4X56A 5HL1A 2H0TA 4S2JA 2HDQA 5EVLA 4K0WA 3VP4A 3WRZA 4B88A 3WRTA 4MEZA 3BM6A 1RGZA 3WS5A 5GLCA 2VGJA 1RP5A 4KZ3A 4BENA 1NYMA 2FFYA 3UNWA 4X53A 2Y2MA 5J8XA 4R3BA 3NC8A 1VQQA 3P09A 3O86A 3PBNA 4KZBA 5CGSA 5EVIC 4DE0A 3HVFA 4JPMA 3UPPA 1NY0A 4OPYA 4LENA 4RA7A 4OLDA 3W8KA 4FH4A 1BLCA
chains in the Genus database with same CATH superfamily
2QJ7A 1H8ZA 5IU1A 2ACGA 2INWA 4ZDXA 2M7UA 4H8RA 3T12B 1DJBA 1OTAA 3DW0A 5DFXA 4R6LA 1E3UD 2Y2LA 5L8MA 1GSVA 1CEFA 3Q81A 3VFFA 5J7EA 1YMXA 5A91A 3KSIA 1N9LA 2EX9A 4QY6A 1K55C 5FQKA 4PM5A 1HTZA 4ZJ2A 2ZC6B 1WE4A 3UO9A 4N9KA 3CWFA 4B9OA 3G35A 3ZQ5A 4E3IA 1ES3A 3P98A 4S2MA 4S2PA 4EUZA 3E98A 2Z2MB 2WKHA 4UHUA 4K91A 3IF6B 3T4JA 3QP1A 4BD0A 4H6JB 1TEMA 2WAFA 1D7EA 5HAIA 3ZNTA 2J9OA 3BLMA 3F1PB 4MN5A 4Q0JA 1J9MA 1KDWA 4Y15A 5HARA 4KQRA 2WADA 4JXGA 1SDNA 3NULA 1WA9A 2VV6A 1T1AA 3IWOA 2IWCA 3LO7A 3FKVA 3CPTA 5I94A 2Y2NA 4KZ4A 4GOGA 1YT4A 3A3IA 4HNBA 1STZA 4LCLA 1LL8A 2JHEA 3UE1A 4E3NA 1BZAA 2XD5A 4R0QA 4L9FA 5AQBA 1EROA 2XDMA 1ONGA 3R7WA 1Q2PA 1OMEA 5F83A 5FSRA 2P9VB 4HBTA 3V50A 1NYYA 4ETXA 3CG5A 5EOOA 3AGFA 1KVLA 1XFQA 1EW0A 2HV1A 1ZG6A 5GLAA 1ES5A 4LV1A 1MXOA 3EEAA 2HJEA 3RXWA 2J3TD 1MY8A 4BL3A 5GLBA 2PU4A 3MQOA 2WKEA 3E4QA 4RVAA 1K56A 1XX2A 1P9WA 1F2KA 2VLGA 1EI5A 3GTCA 3MXSA 3LR5A 3PYPA 3TRCA 3OPRA 4GDBA 2Y2PA 2PYRA 3Q82A 3ULFA 3PXPA 3T4TA 3L7HA 4HH3A 3OLOA 3C4PA 2WKIA 2O9CA 2EFXA 4RQ9A 1EWZA 2HP9A 4OP8A 1S67L 1BLSA 2K7SA 3VE4A 4EESA 3OPHA 5FAOA 1GSXA 3BJNA 3MKFA 3LICA 1ES2A 1H8YA 3E2KA 4B4ZA 1XKZA 2V1ZA 3BY9A 5FDHA 3LI8A 3IF6C 4E6XA 4Y0UA 1DP9A 1SHVA 4R23A 3WS2A 2Q9NA 4KQOA 1UWNX 2QYBA 5I5LA 1HD8A 2J7VA 1IKGA 3JVVA 3SOIA 2WZXA 3A3EA 1F98A 5FQJA 5GHYA 1M40A 4PKYG 4R38A 4FTXA 5HAPA 3BYDA 4HJ4A 4L9EA 2JE5A 3NDEA 4EW7A 2XEPA 3IF5A 4WF0A 1OT6A 3OZHA 4OKPA 5DTTA 4U0TA 1YAXA 4KENB 1D1JA 1QMFA 3T4KA 2PD7A 5CHJA 4YINA 5EVIB 3NECA 4UAAA 3BFFA 3LY3A 1AXBA 1ACFA 3W2ZA 4JF4A 1E3UA 2I9VA 5AVFA 4IEDA 2HDUA 4QPRA 1U60A 4S2KA 2RL3A 4CLCD 5FQIA 4PHTA 3FWLA 1G28A 5CTMA 3DWKA 3UDIA 1CF0A 5AQAA 2ZMAA 3GMWA 5CTNA 3K2NA 3GECA 1K4FA 3ZVTA 4G3VA 5E2EA 4OQHA 2W3GA 3MS6A 3NOTC 3VP2A 4JGOA 4OOYA 4IJGA 3FPVA 4Q8IA 4BBUA 2EA9A 1LT0A 3C7VA 3TG9A 4U3TA 1KGEA 3EQUA 4MN7A 3ZG7B 5TR7A 3B33A 1DRMA 2X01A 3CMZA 4KZAA 2DMWA 4P0MA 4OONA 3E0YA 4EUVA 3G34A 2FH5A 2JKGA 1N9BA 3W4QA 1FIKA 1YM1A 3Q07A 1BLHA 1JNUA 4GHIB 3A3FA 2JN7A 3GVBA 4NK3A 3BFGA 1S0WA 1WYBA 4FD8A 3FPWA 3G32A 4YFMA 3C2WA 3MZEA 3BY8A 3RH8B 1F9IA 3BFEA 2W3HA 2Z6DA 4BL2A 2IWBA 4FH2A 1MKMA 3ZG5A 2ZJ9A 3PAGA 4L9GA 1IFQA 4KZ9A 1M6KA 5E2GA 5HAQA 4HI4A 2KX6A 3CUEA 4Y3IA 2OLUA 1F5MA 5AQ7A 1LI9A 3L9KA 4MN6A 3VSKA 3IX4A 4QU3A 1TDGA 4G3WA 4I5SA 5FQ9A 4EEUA 3V3RA 1NRFA 2ZQDA 1NRJA 2V0UA 5EPHA 4MBFA 4FSFA 3ZVWA 3LY4A 3V5MA 2M7VA 2WGWB 5KSCA 3BWLA 3VE3A 4P6ZS 2EX8A 2EWVA 2XQZA 1YLPA 3KSHA 4HHDA 1LI0A 2H0TA 4S2JA 4Y13A 2JKRI 4K0WA 3VP4A 4B88A 1S66L 1XJ2A 3UNWA 4P6ZM 4X53A 2Y2MA 2Y79A 5J8XA 1VQQA 4II7A 5EVIC 3LYXA 5CGSA 4HOIA 4JPMA 3VV4A 1LSXA 3A3DA 3H82B 1L2SA 5E43A 5CGWA 3O87A 2NUTC 3UMEA 4HQAA 5FATA 3DAVA 3LGOA 2WK0A 2ZC3B 1UWPX 2EWWA 4KZ5A 1H3QA 5MC7A 1Y54A 3B3XA 2A3UA 4BBTA 2DNSA 1ES4A 5FQQA 3HL9A 5CEBA 4O0PA 4DXBA 3IBRA 2Q9MA 2X02A 5FI7A 4DN0A 3PBRA 1W8QA 3F1NA 4KZ8A 2ZLYA 4K0XA 2HP6A 1YSPA 3PBOA 3IWQA 3QP4A 4LFUA 3T1RA 4I39A 4XT2B 1PIOA 1K57A 4WEKA 4Y7PA 4X68A 2K31A 4S2NC 1N9NA 5CX7A 1NWZA 1I2WA 1RCJA 3LIDA 2GNXA 2WYXA 3MSHA 2JKTI 4GJ4A 1ERMA 2XK1A 4C75A 3IXBA 1PNEA 2A49A 3SH8A 4ZBEA 3UB9A 4E3JA 3EQVA 2Y2JA 3E2LA 3D3OA 3T1SA 1L0FA 2G7UA 4CLCA 3H7WB 3K3CA 5EOEA 5AVEA 2H28A 4QB8A 1UGUA 3T4SA 1ZG4A 3PAEA 1YLWA 1XA1A 5HSQA 3MXRA 1LL5A 3LFVA 3Q1FA 5HL6A 3SH7A 1VEUA 2VX8A 4XXRA 3G2ZA 4E04A 3RXXA 2XLNA 2VV7A 3HLWA 1K55A 3HLCA 5D3OA 2W1TA 3AGEA 2CMNA 3BRMA 3R7WB 3JPUA 1S4SA 4GS9A 2E8IA 3DTMA 5HPFA 3D4FA 3NOPC 5DJUA 1NJ4A 5DVAA 3BQ8A 1G5UA 1DP8A 2W3FA 5CHMA 3TE8A 2A2LA 1K4EA 4GZBA 3M6HA 1OTEA 4LV3A 1SCWA 1KE0A 1OTIA 5CGXA 3T1QB 2FZ0A 4Q0IA 2QPNA 4GNUA 4HBUA 4OPZA 1XJ3A 1FSWA 1HZOA 4CLCE 5HFOA 2VGKA 4ARZA 4F3LB 3LEQA 1SKFA 2H5SA 4HEFA 2H0YA 2WZZA 2WAEA 1P0ZA 4BD1A 4QWOA 2HPBA 1OTBA 4Z1WA 3KX0X 3VMAA 3T4QA 1K38A 5HX9A 3BFDA 4GCZA 4Y0OA 1E4DA 1TS8A 1W5DA 2Z6CA 1XJ6A 2JC7A 1IKIA 2Y2OA 4MBKA 4DKIA 1K6SA 5EM0A 2P74A 4GDNA 2A24B 4JXWA 5F1GA 5JYPA 2E8JA 3IXDA 2WKQA 3LIBA 3A3JA 2ZOIA 5FASA 3HLEA 3FC7A 4WYYA 2G2WA 5GHZA 2L1MA 1NLYA 2R78A 3FYZA 2CC1A 4Y5FA 4EQIA 2R9XA 3MQQA 4X6TA 4FOFA 4LGWA 5EM1A 4GN2A 2OSUA 3G4PA 2PAVP 3TOIA 4S2OA 1TD5A 3D72A 1O07A 2Y8HA 4GLQA 4E3OA 3QP8A 4WBGA 4I38A 5HDCA 4BMWA 4R3AA 1KGGA 3MJQA 2I72A 1ZTUA 3NI9A 4OPQA 5HWVA 5DJTA 5EVID 4O7DA 1ONHA 5KSHA 1XA7A 2O9BA 4DE1A 3UN7A 3CI6A 2OAQ1 3ICYA 4KG5A 1K25A 4UQIS 5IS1A 1AWIA 4RX2A 3NY4A 5L07A 3SH9A 3HLDA 2XH9A 2PR6A 3MR0A 3O3VA 4E3LA 1P9RA 4QHCA 4UQIM 2BASA 1CI8A 2OAP1 5LBRA 3IF6A 2ZQAA 1KDSA 5HPIA 5GLDA 2DCFA 1FILA 2QHKA 1XGIA 1CEGA 3HUNA 3WS4A 4BWIA 2W3EA 2WKRA 4JGRA 4ME4A 2BLSA 3B47A 1XXMA 3MMHA 5J3WA 4WZ5C 3BEBA 2ZQ9A 1LSWA 1G6AA 2RCXA 3BECA 4Q0HA 3F1OB 2WGIA 2WUQA 4K08A 4PMAA 5HD3A 3ZHHA 3SZTA 4MMNA 4OLGA 4PM9A 1TF1A 2GJ3A 3NOUC 1E25A 2XF3A 2ZBBA 4N92A 1GHPA 1NZUA 4P87A 3BLSA 2ZMVA 1JWZA 4WN5A 1FCOA 3NIAA 5G4YA 3H9WA 3BQAA 2J9PA 2OOLA 4U0XA 4PKYA 4HIAA 2LB9A 3AGDA 3TW8A 4DDSA 3T4LA 2KLIA 2V20A 2YKFA 5GHXA 4NEED 2VJWA 1MBLA 3UB5P 3VP0A 1PWCA 4X56A 2HDQA 4ESPA 3UMDA 4EEPA 5DFYA 4MEZA 1OPXA 3WS5A 4EU0A 2VGJA 4KZ3A 1NYMA 2FFYA 1VB6A 4DE0A 3O86A 4KZBA 5TBMB 3HVFA 3UPPA 3IS2B 4OPYA 3LR0A 1H0MA 4OLDA 1BLCA 3UPNA 4LLOB 2IWDA 2VA0A 2VKSA 3ZCZA 2V8CA 4JF5A 4O8GA 1BT5A 1MWUA 2B95A 5CHUA 3OCNA 4ZJ3A 4EBLA 4GD8A 4PM8A 4ZTKA 1SKOB 5U47A 1YKDA 4N1XA 3RJUA 4I3IA 1PRQA 5J4EA 3O5YA 3VOLA 4D60A 2XSSA 5FI6A 3DTIA 3T50A 2YKHA 4CJNA 5HWTA 1DJAA 4A5RA 2BG1A 2PDRA 3N6IA 1I2SA 4EERA 4MBHA 4XUZA 2XR0A 3ZG8B 2V9AA 3IHAA 5L2FA 2C6WB 3IT9A 3KYZA 4ID4A 1CI9A 3VSLA 2XA7S 3EGXC 3M2KA 4DF6A 4JXVA 1MPLA 2EX2A 2JBFA 2V2FF 3MXQA 4PAUA 3JYIA 3N8LA 1G68A 2GZAA 4UA9A 1T1BA 4DJ2A 2XA7M 4WZ4A 1FCMA 1GA0A 3U4LP 2ZQ8A 4GKUA 3ITBA 5M1AA 3TSGA 3F1NB 4WL9A 1VETB 1IYQA 1Y28A 1S4RA 2EXAA 1Y4OA 1ZHHB 3HUOA 4IUHA 5DKKA 3NBLA 5EVIA 4HJ6A 5A90A 5FI2A 2B18A 4GB7A 1KE3A 3OC2A 4DE3A 5DF8A 2V0WA 3CITA 3GSGA 2Z2LB 3LR4A 4N1HA 3LI9A 2JKRM 4EQ1A 3DBAA 2EXBA 2PBDP 1XGJA 3UE6A 1MWSA 1W8YA 4C6YA 2ZL1B 3DWZA 4JKTA 3PBQA 1XJ4A 2XROA 3JVUA 3V67A 4JGPA 2ZC4B 5E2HA 4LRZE 1L0DA 3MF0A 3D9YA 3KSFA 3BFCA 3TJZC 3IQAA 4X25A 1NLZA 2W3DA 4UA7A 2VEAA 4X1LA 2OLVA 1RGYA 1KGFA 2ZM2A 1MWTA 3VOYA 2HP5A 1ZKJA 3QHYA 4UEYA 4S2NA 1VM1A 3VP1A 4I3JA 3Q7VA 1IOUA 3QNCA 3S4XA 1FR1A 4IVKA 1IYPA 3R4KA 1PFLA 3ISGA 4GHIA 2W27A 2PRFA 4DE2A 3NJAA 1K54C 1BUEA 3PBTA 2XGNA 3P7NA 5CERA 2WKPA 3SS5A 4OQ0A 4JGQA 3PTEA 4R4RA 1NZOA 1PZOA 1J3WA 3CZDA 5F6AA 3ITAA 1IYSA 3CHWP 2Y2GA 3I7JA 3S1YA 2JKFA 3W4PA 1TDLA 3OBFA 4HP4A 2JKTM 1V9ZA 4X1MA 3RFBA 3KSGA 5CECA 4MLLA 2HGVA 2WGWA 3V39A 3ZYTA 3N4IA 3IXGA 3ZG9B 3OPLA 2VK3A 5FEFA 4C3QA 1T1CA 5K5BA 5F82A 2X71A 3CPTB 4JF6A 2ZM8A 3V3SA 5KZHA 3SS4A 5DF7A 4HH2A 3IH9A 1PYYA 2MJ6A 1S1YA 3H82A 4X69A 1GCEA 4R3JA 4LCMA 3S7OA 2WGVA 3UDXA 1JVJA 5DF9A 3IXHA 1QMEA 3FKWA 4AFIA 2OWHA 1GHMA 3UPOA 1Z6FA 4Y0TA 3NCKA 3NHQA 2D01A 3LCEA 2ZQCA 5FEGA 2O9AA 1JTGA 3G30A 3EOIA 4B93A 1L0GA 3WWXA 3HLFA 5FAPA 1BLPA 3OCLA 3SW1A 5DKLA 5IHVA 4YNRA 2G2UA 5DTSA 4KQQA 3S7NA 5HZHA 3P01A 3LEZA 5GL9A 1FCNA 4XT2A 3ZFZA 1TS0A 1GHIA 1IYOA 4HP9A 4E3MA 3PR6A 3HBRA 1OT9A 2VV8A 2UWXA 4ETZA 1PI4A 3MZFA 2P08A 4JXSA 2V1AA 4WELA 2HZ5A 3IH8A 4HY8A 3ZGAB 3H7WA 1JTDA 4MCWA 1YQSA 5TJJA 3CLOA 2EFUA 3OOVA 3S22A 4E6WA 5AQ9A 1MWRA 3HLGA 2BTFP 1VHMA 4MNRA 3M2JA 1I5QA 4KZ6A 4LV2A 2Q0OA 1YMSA 2PR5A 3A0RA 2ZC5B 5A92A 4IBXA 5FDSA 5HDSA 4BBVA 3T4OA 3MZDA 3ZDJA 4N9LA 5HL1A 2QKPA 4Y2FA 4ZRRA 3WRZA 3WRTA 3BM6A 3QP2A 1RGZA 2HJ9C 5GLCA 2L4RA 4EETB 4BENA 4R3BA 3NC8A 1NY0A 4LENA 4RA7A 5IT5A 3W8KA 1G6OA 4IBRA 4F3LA 1D06A 1CK3A 1SZVA 2W1RA 4WZ5A 5EECA 1PWDA 1H8MA 3FZCA 4QJGA 2VGLS 4XUXA 1TS7A 4H6JA 3WS0A 4L0LA 1GSWA 2J80A 4F94A 4WMCD 5DTKA 3F1PA 1TS6A 4RYEA 2Y55A 3IX3A 2VGLM 3RTYA 5CEDA 2ZOHA 4M4XA 1S1ZA 1ERQA 4B4XA 1ESIA 4IVIA 3KO6A 3Q7ZA 5G4ZA 4KG2A 1T18A 2A24A 1MZUA 1S6RA 4EXOA 5F5YA 1CQAA 3N7WA 1PW1A 3UY6A 4OPRA 3LIEA 4HJ3A 4QD4A 4NG2A 4DJ3A 4KQDA 5EUAA 2K2NA 1W7FA 4YWZA 2EX6A 3C7UA 3EGDC 3HJKA 5TGFA 5L09A 2P9VA 3GR2A 2ZQ7A 3KYEA 4EV4A 2Y59A 3K3DA 4JLFA 1LSVA 4PM6A 3G31A 4KUOA 3EWKA 1LLBA 4KZ7A 4DMZA 5M19A 1O7EA 1FOFA 4S2IA 1BTLA 5A93A 2Y2HA 4OP5A 1N9OA 2HDSA 1FQGA 2P04A 3HREA 1YSQA 3KYQA 4HESA 4BQMA 3ZG0A 2OV5A 1KE4A 3C4OA 1A0KA 3MKEA 3S7QA 4O01A 1GA9A 4R4SA 1XPBA 4I3AA 2PBYA 1TVFA 3GDIA 5TFQA 4KG6A 5EFWA 3GQZA 3N8SA 1DY6A 3BW6A 5HW3A 5HWWA 2Y91A 4GD6A 5G18A 1PWGA 2JCHA 4PM7A 4OH0A 3DTEA 4FUWA 1K0KA 1NXYA 3C8CA 4FCFA 2PD8A 2ZD8A 1C3BA 2H10A 1YPRA 4CQHA 3G6OA 1YLZA 1XP4A 2Y2IA 4NXFA 4E3KA 4LRXC 3UE3A 2Y2KA 2O99A 1SDEA 4EWFA 4IUKA 4NXBA 1L0EA 1PW8A 3W4OA 4GW9A 3F1OA 1FSYA 1PZPA 4JBFA 4Z9QA 3B42A 3HLBA 2Y2QA 1W63M 5L10A 5A8BA 3VFHA 4CPKA 1MKIA 3VP3A 2V8FA 3Q7VB 2J3WA 3UB7A 5EVEA 3FG8A 3GV9A 2HF6A 4RX3A 2B02A 4DXCA 2GDNA 4P6BA 2LB5A 1K6RA 5E2FA 3HUMA 4ZAMA 2V1BA 5BOHA 2GX5A 4QY5A 3C5AA 2W0NA 4LPZA 1Q2QA 2O0YA 1ZC2A 3VOZA 2ZM0A 4Y17A 3QNBA 5FAQA 1V9YA 2PHYA 4UA6A 1HVBA 1BYWA 4MDZA 4WUJA 4D2OA 2OWJA 5EV0A 3MBZA 3E4PA 1YLJA 2KDKA 1FR6A 3LUQA 3UB6A 3CAXA 4OVDA 1IELA 1W63Q 4OQIA 5AJGA 5TBMA 1YLTA 3EEHA 5F68A 3IS2A 3PHYA 1P97A 2B5RA 4LRYC 2QZ6A 3U2AA 3IHBA 2D02A 5CXWA 3A0SA 4NETA 4CLCB 4X55A 1XFNA 3A0VA 1ALQA 3CUEC 1JWPA 1WYCA 5F1FA 1SKOA 3G2YA 4R1GA 4WMCA 4G3KA 4BLMA 1DP6A 1CJFA 3OPPA 4LV0A 4ZJ1A 2Y4AA 1VEUB 2QJ5A 1X0OA 1YLYA 3C30A 1K54A 3DTKA 1Z09A 2J3TC 1H5XA 4S2LA 3FV7A 1BULA 1BSGA 3S7PA 2W1TB 4IHQA 2R9WA 1JWVA 3HCYA 3SS3A 1PI5A 2IA2A 2QWSA 3WS1A 4GS9B 3CJMA 2L0WA 1IEMA 4YOFA 1DJCA 3NDGA 3E4OA 2NUPC 5KIZA 2FFFB 1LHYA 2C5WB 4OQGA 1W79A 5F69A 1K56D 3LIFA 4NXGA 4DRTA 1KOUA 5KMWA 5FA7A 5HD5A 5M18A 3T1XA 4R70A 3UDFA 3O88A 3ZNYA 1OJ5A 4ARZB 1T19A 4OOLA 1OJGA 3PBSA 5C5KA 1VETA 2UV0E 2ZC7A 4NKPA 2VZWA 3UB8A 1MC0A 2XD1A 1N4OA 4BJPA 2J8YA 4EBPA 1ODVA 2DRWA 2M1CA 2PU2A 3IBJA 3C38A 4NXEA 5HDDA 3M6BA 1LL9A 3QP6A 1L3LA 5CRFA 3MQ0A 5EE8A 1ESUA 4WLAA 5JYOA 2QMIA 2XRNA 1HLUP 3HJIA 3QP5A 5FL3A 4DDYA 1KVMA 3UE0A 2XFTA 4EBNA 2ZMFA 4PPRA 4WM9A 3N8RA 4WEJA 2ZL1A 1K57C 3IWIA 3GRJA 4OOMA 4M3KA 2AVXA 4P85A 2HDRA 2P7JA 3MFDA 2XFSA 2PYPA 4KUKA 5FQMA 2KOIA 5EVLA 3LR3A 3IX8A 2PT7A 3MFXA 3LIAA 1OTDA 1RP5A 3P09A 3PBNA 4CLCC 4FH4A
chains in the Genus database with same CATH topology
4IBRA 3A3DA 1H8ZA 2IWDA 4ZDXA 1CK3A 1L2SA 4H8RA 3ZCZA 4JF5A 5E43A 5CGWA 1BT5A 3O87A 1MWUA 5CHUA 1DJBA 4WZ5A 5EECA 3DW0A 3OCNA 4ZJ3A 4EBLA 1PWDA 3FZCA 1E3UD 2Y2LA 4QJGA 4GD8A 1CEFA 4PM8A 4ZTKA 5FATA 3Q81A 5U47A 3VFFA 4XUXA 1YMXA 4N1XA 2WK0A 3RJUA 3WS0A 5A91A 2ZC3B 2EX9A 4L0LA 4QY6A 1K55C 4KZ5A 5FQKA 5FI6A 4F94A 4WMCD 5DTKA 4PM5A 1HTZA 4RYEA 4ZJ2A 4CJNA 2ZC6B 2Y55A 1Y54A 1WE4A 1DJAA 4A5RA 3B3XA 3UO9A 4N9KA 5CEDA 2A3UA 2BG1A 2DNSA 1ES4A 3G35A 1ERQA 4B4XA 4E3IA 1ESIA 1ES3A 3P98A 4S2MA 4S2PA 4EUZA 4IVIA 5FQQA 3N6IA 1I2SA 2Z2MB 3HL9A 5CEBA 4MBHA 3Q7ZA 4DXBA 4XUZA 4KG2A 2WKHA 4UHUA 2Q9MA 2XR0A 4K91A 2X02A 3IF6B 5FI7A 3PBRA 1S6RA 3ZG8B 1W8QA 3IHAA 4BD0A 5L2FA 2C6WB 1TEMA 3IT9A 3N7WA 4KZ8A 2WAFA 4ID4A 1PW1A 3UY6A 4OPRA 2ZLYA 4K0XA 5HAIA 2HP6A 3ZNTA 2J9OA 3BLMA 1CI9A 3PBOA 3VSLA 1J9MA 4QD4A 3IWQA 1KDWA 5HARA 5EUAA 4KQRA 2WADA 1W7FA 3M2KA 4JXGA 4JXVA 4DF6A 1MPLA 1PIOA 1SDNA 1K57A 2EX6A 2EX2A 3C7UA 4WEKA 2JBFA 5TGFA 4Y7PA 4X68A 4S2NC 2P9VA 2V2FF 2ZQ7A 3GR2A 4EV4A 3JYIA 1I2WA 3N8LA 2Y59A 1G68A 4JLFA 1RCJA 4PM6A 4UA9A 3IWOA 4WZ4A 1FCMA 1GA0A 2IWCA 2WYXA 2ZQ8A 4GKUA 3LO7A 3FKVA 3ITBA 5M1AA 5I94A 3TSGA 2Y2NA 3G31A 4KZ4A 1ERMA 2XK1A 4GOGA 1LLBA 1YT4A 4C75A 3A3IA 1IYQA 4KZ7A 3IXBA 5M19A 2A49A 2EXAA 4LCLA 4E3NA 3HUOA 1O7EA 1BZAA 4ZBEA 1FOFA 3SH8A 3UE1A 4E3JA 3EQVA 3NBLA 2XD5A 5EVIA 5A90A 4S2IA 2Y2JA 1BTLA 5FI2A 4GB7A 4R0QA 3E2LA 5AQBA 5A93A 1KE3A 1EROA 1L0FA 2Y2HA 2XDMA 3OC2A 4OP5A 2HDSA 1ONGA 1Q2PA 1OMEA 5EOEA 1FQGA 4DE3A 5F83A 5FSRA 2P9VB 4QB8A 4HBTA 3V50A 1NYYA 3HREA 1ZG4A 3PAEA 5DF8A 1YLWA 3CG5A 1XA1A 5EOOA 4HESA 3GSGA 2Z2LB 3MXRA 4N1HA 4BQMA 1LL5A 3Q1FA 3ZG0A 3AGFA 2OV5A 1KE4A 3C4OA 3MKEA 3SH7A 1KVLA 4XXRA 2EXBA 3G2ZA 1GA9A 3RXXA 4R4SA 2XLNA 3HLWA 1XPBA 1K55A 2PBYA 3HLCA 1TVFA 1XGJA 5TFQA 1MWSA 5D3OA 1ZG6A 4KG6A 5GLAA 1ES5A 3AGEA 1W8YA 4LV1A 1MXOA 3GQZA 4C6YA 3BRMA 3N8SA 1DY6A 3DWZA 5HW3A 3RXWA 4JKTA 2Y91A 3PBQA 2E8IA 3DTMA 4GD6A 5G18A 3D4FA 1PWGA 1NJ4A 1MY8A 5DVAA 2JCHA 4PM7A 4BL3A 5E2HA 2ZC4B 4OH0A 5CHMA 5GLBA 1L0DA 2PU4A 1K4EA 4GZBA 3M6HA 1NXYA 4LV3A 2WKEA 4FCFA 4RVAA 1K56A 2ZD8A 1SCWA 1XX2A 1KE0A 3BFCA 1C3BA 1EI5A 2H10A 3IQAA 5CGXA 3GTCA 3MXSA 1YLZA 4UA7A 2QPNA 1XP4A 2OLVA 4GNUA 3OPRA 1RGYA 4GDBA 1KGFA 2Y2PA 2Y2IA 4HBUA 4OPZA 2ZM2A 1FSWA 3Q82A 1MWTA 3VOYA 2HP5A 1HZOA 4E3KA 1ZKJA 3QHYA 5HFOA 3UE3A 2VGKA 2Y2KA 4S2NA 1SKFA 1VM1A 3VP1A 3C4PA 3Q7VA 2H5SA 2WKIA 3QNCA 1FR1A 4HEFA 2H0YA 4IVKA 3S4XA 1SDEA 4EWFA 1IYPA 2WZZA 2EFXA 1L0EA 1EWZA 1PW8A 2HP9A 2WAEA 3ISGA 3W4OA 1FSYA 4BD1A 1PZPA 4JBFA 4DE2A 4OP8A 3UPNA 2HPBA 1K54C 1BUEA 4Z9QA 3PBTA 1BLSA 2XGNA 3VMAA 5CERA 3HLBA 3SS5A 3OPHA 4OQ0A 5FAOA 1K38A 2Y2QA 3PTEA 3BFDA 5HX9A 3MKFA 4R4RA 1NZOA 4Y0OA 1PZOA 1ES2A 1H8YA 3E2KA 1E4DA 3CZDA 3VFHA 1W5DA 4CPKA 1MKIA 4B4ZA 1XKZA 3ITAA 1IYSA 3VP3A 2Y2GA 3I7JA 3S1YA 3Q7VB 2JC7A 2V1ZA 3W4PA 1IKIA 5FDHA 3GV9A 3IF6C 4E6XA 1TDLA 2Y2OA 4Y0UA 4MBKA 4DKIA 1K6SA 4RX3A 1SHVA 4DXCA 2GDNA 4P6BA 2P74A 4GDNA 4JXWA 4R23A 1K6RA 3WS2A 5F1GA 2Q9NA 5E2FA 5JYPA 3HUMA 3IXDA 4KQOA 4ZAMA 3A3JA 5FASA 1HD8A 3HLEA 5BOHA 4WYYA 4QY5A 5CECA 2G2WA 3C5AA 5GHZA 2J7VA 1IKGA 1Q2QA 4MLLA 2WGWA 3V39A 3SOIA 1ZC2A 2WZXA 3A3EA 5FQJA 5GHYA 3VOZA 3N4IA 3FYZA 2ZM0A 2CC1A 1M40A 3QNBA 5FAQA 4EQIA 2R9XA 5HAPA 3BYDA 4UA6A 3IXGA 1HVBA 4X6TA 3ZG9B 3OPLA 2JE5A 3NDEA 4D2OA 2XEPA 3IF5A 4GN2A 2OSUA 3G4PA 3MBZA 4C3QA 3TOIA 1YLJA 4S2OA 1FR6A 5F82A 2X71A 3OZHA 4JF6A 4OKPA 4OVDA 1IELA 2ZM8A 1O07A 5DTTA 4OQIA 4U0TA 1YLTA 3V3SA 4E3OA 5KZHA 3SS4A 4WBGA 5DF7A 4KENB 1QMFA 3IH9A 1PYYA 2B5RA 2QZ6A 3IHBA 1KGGA 5CHJA 4YINA 5EVIB 2I72A 4UAAA 5CXWA 3BFFA 3LY3A 4X69A 1GCEA 1AXBA 3NI9A 4OPQA 4LCMA 4R3JA 4NETA 4JF4A 1E3UA 4X55A 4IEDA 2HDUA 4S2KA 1U60A 4O7DA 2WGVA 2RL3A 1ONHA 5EVID 5KSHA 1ALQA 1XA7A 3UDXA 1JWPA 1WYCA 4DE1A 3UN7A 5F1FA 1JVJA 3G2YA 4R1GA 5FQIA 5DF9A 3FWLA 3IXHA 4WMCA 4KG5A 5CTMA 1K25A 4BLMA 3DWKA 3UDIA 1QMEA 3FKWA 5AQAA 3OPPA 4LV0A 4ZJ1A 2ZMAA 4RX2A 3NY4A 3GMWA 1GHMA 2Y4AA 5CTNA 3UPOA 1YLYA 1Z6FA 3SH9A 4Y0TA 3HLDA 1K54A 2XH9A 3NCKA 1K4FA 1H5XA 4S2LA 3LCEA 3FV7A 3ZVTA 1BULA 1BSGA 2ZQCA 1JTGA 3O3VA 4E3LA 3G30A 4OQHA 5E2EA 2R9WA 1JWVA 3SS3A 4QHCA 1PI5A 1CI8A 3VP2A 4OOYA 1L0GA 3WS1A 3WWXA 3HLFA 3CJMA 5FAPA 4Q8IA 1BLPA 3IF6A 2ZQAA 3OCLA 1IEMA 1KDSA 1DJCA 3NDGA 5GLDA 2DCFA 3C7VA 5IHVA 3TG9A 2G2UA 5DTSA 4KQQA 4U3TA 1KGEA 1XGIA 1CEGA 2FFFB 1LHYA 3HUNA 2C5WB 3LEZA 3WS4A 4OQGA 5GL9A 1FCNA 1W79A 3EQUA 1K56D 3ZG7B 2BLSA 4DRTA 3ZFZA 5TR7A 5KMWA 2X01A 1XXMA 3CMZA 5FA7A 5M18A 4KZAA 1GHIA 1IYOA 4P0MA 3UDFA 4E3MA 4OONA 3G34A 3O88A 3ZNYA 4WZ5C 3BEBA 3HBRA 2ZQ9A 1N9BA 2UWXA 3W4QA 4OOLA 1YM1A 1G6AA 2RCXA 3PBSA 3BECA 3Q07A 1BLHA 4NK3A 3A3FA 3GVBA 3BFGA 2ZC7A 1PI4A 3MZFA 1S0WA 2WGIA 1WYBA 4JXSA 2WUQA 4FD8A 3G32A 4WELA 4YFMA 4PMAA 3MZEA 2XD1A 3IH8A 3BFEA 1N4OA 3ZHHA 4BJPA 2IWBA 2J8YA 4FH2A 4BL2A 4EBPA 3ZGAB 2DRWA 2PU2A 1JTDA 1YQSA 3ZG5A 4OLGA 4PM9A 3M6BA 2ZJ9A 3PAGA 1LL9A 1E25A 2XF3A 5CRFA 2EFUA 4KZ9A 4N92A 1M6KA 5E2GA 3S22A 5HAQA 4E6WA 5EE8A 1ESUA 1GHPA 1NZUA 2QMIA 4P87A 5JYOA 5AQ9A 2OLUA 1MWRA 3BLSA 5AQ7A 1LI9A 3VSKA 1JWZA 4QU3A 1TDGA 3HLGA 1FCOA 3NIAA 1KVMA 4DDYA 5FQ9A 4MNRA 3M2JA 1I5QA 4KZ6A 4LV2A 2J9PA 4U0XA 3UE0A 2XFTA 4EBNA 3V3RA 1YMSA 1NRFA 4PPRA 2ZC5B 2ZQDA 4WM9A 5A92A 3AGDA 3N8RA 4WEJA 5EPHA 4MBFA 4FSFA 3ZVWA 4DDSA 1K57C 3IWIA 3GRJA 2V20A 4IBXA 3LY4A 4OOMA 5GHXA 3V5MA 2WGWB 4M3KA 5KSCA 1MBLA 4P85A 2HDRA 3MFDA 3MZDA 3VP0A 2EX8A 3ZDJA 2XFSA 2XQZA 1YLPA 4N9LA 5FQMA 1PWCA 1LI0A 4X56A 5HL1A 2H0TA 4S2JA 2HDQA 5EVLA 4K0WA 3VP4A 3WRZA 4B88A 3WRTA 4MEZA 3BM6A 1RGZA 3WS5A 5GLCA 2VGJA 1RP5A 4KZ3A 4BENA 1NYMA 2FFYA 3UNWA 4X53A 2Y2MA 5J8XA 4R3BA 3NC8A 1VQQA 3P09A 3O86A 3PBNA 4KZBA 5CGSA 5EVIC 4DE0A 3HVFA 4JPMA 3UPPA 1NY0A 4OPYA 4LENA 4RA7A 4OLDA 3W8KA 4FH4A 1BLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBR A;  3A3D A;  1H8Z A;  2IWD A;  4ZDX A;  1CK3 A;  1L2S A;  4H8R A;  3ZCZ A;  4JF5 A;  5E43 A;  5CGW A;  1BT5 A;  3O87 A;  1MWU A;  5CHU A;  1DJB A;  4WZ5 A;  5EEC A;  3DW0 A;  3OCN A;  4ZJ3 A;  4EBL A;  1PWD A;  3FZC A;  1E3U D;  2Y2L A;  4QJG A;  4GD8 A;  1CEF A;  4PM8 A;  4ZTK A;  5FAT A;  3Q81 A;  5U47 A;  3VFF A;  4XUX A;  1YMX A;  4N1X A;  2WK0 A;  3RJU A;  3WS0 A;  5A91 A;  2ZC3 B;  2EX9 A;  4L0L A;  4QY6 A;  1K55 C;  4KZ5 A;  5FQK A;  5FI6 A;  4F94 A;  4WMC D;  5DTK A;  4PM5 A;  1HTZ A;  4RYE A;  4ZJ2 A;  4CJN A;  2ZC6 B;  2Y55 A;  1Y54 A;  1WE4 A;  1DJA A;  4A5R A;  3B3X A;  3UO9 A;  4N9K A;  5CED A;  2A3U A;  2BG1 A;  2DNS A;  1ES4 A;  3G35 A;  1ERQ A;  4B4X A;  4E3I A;  1ESI A;  1ES3 A;  3P98 A;  4S2M A;  4S2P A;  4EUZ A;  4IVI A;  5FQQ A;  3N6I A;  1I2S A;  2Z2M B;  3HL9 A;  5CEB A;  4MBH A;  3Q7Z A;  4DXB A;  4XUZ A;  4KG2 A;  2WKH A;  4UHU A;  2Q9M A;  2XR0 A;  4K91 A;  2X02 A;  3IF6 B;  5FI7 A;  3PBR A;  1S6R A;  3ZG8 B;  1W8Q A;  3IHA A;  4BD0 A;  5L2F A;  2C6W B;  1TEM A;  3IT9 A;  3N7W A;  4KZ8 A;  2WAF A;  4ID4 A;  1PW1 A;  3UY6 A;  4OPR A;  2ZLY A;  4K0X A;  5HAI A;  2HP6 A;  3ZNT A;  2J9O A;  3BLM A;  1CI9 A;  3PBO A;  3VSL A;  1J9M A;  4QD4 A;  3IWQ A;  1KDW A;  5HAR A;  5EUA A;  4KQR A;  2WAD A;  1W7F A;  3M2K A;  4JXG A;  4JXV A;  4DF6 A;  1MPL A;  1PIO A;  1SDN A;  1K57 A;  2EX6 A;  2EX2 A;  3C7U A;  4WEK A;  2JBF A;  5TGF A;  4Y7P A;  4X68 A;  4S2N C;  2P9V A;  2V2F F;  2ZQ7 A;  3GR2 A;  4EV4 A;  3JYI A;  1I2W A;  3N8L A;  2Y59 A;  1G68 A;  4JLF A;  1RCJ A;  4PM6 A;  4UA9 A;  3IWO A;  4WZ4 A;  1FCM A;  1GA0 A;  2IWC A;  2WYX A;  2ZQ8 A;  4GKU A;  3LO7 A;  3FKV A;  3ITB A;  5M1A A;  5I94 A;  3TSG A;  2Y2N A;  3G31 A;  4KZ4 A;  1ERM A;  2XK1 A;  4GOG A;  1LLB A;  1YT4 A;  4C75 A;  3A3I A;  1IYQ A;  4KZ7 A;  3IXB A;  5M19 A;  2A49 A;  2EXA A;  4LCL A;  4E3N A;  3HUO A;  1O7E A;  1BZA A;  4ZBE A;  1FOF A;  3SH8 A;  3UE1 A;  4E3J A;  3EQV A;  3NBL A;  2XD5 A;  5EVI A;  5A90 A;  4S2I A;  2Y2J A;  1BTL A;  5FI2 A;  4GB7 A;  4R0Q A;  3E2L A;  5AQB A;  5A93 A;  1KE3 A;  1ERO A;  1L0F A;  2Y2H A;  2XDM A;  3OC2 A;  4OP5 A;  2HDS A;  1ONG A;  1Q2P A;  1OME A;  5EOE A;  1FQG A;  4DE3 A;  5F83 A;  5FSR A;  2P9V B;  4QB8 A;  4HBT A;  3V50 A;  1NYY A;  3HRE A;  1ZG4 A;  3PAE A;  5DF8 A;  1YLW A;  3CG5 A;  1XA1 A;  5EOO A;  4HES A;  3GSG A;  2Z2L B;  3MXR A;  4N1H A;  4BQM A;  1LL5 A;  3Q1F A;  3ZG0 A;  3AGF A;  2OV5 A;  1KE4 A;  3C4O A;  3MKE A;  3SH7 A;  1KVL A;  4XXR A;  2EXB A;  3G2Z A;  1GA9 A;  3RXX A;  4R4S A;  2XLN A;  3HLW A;  1XPB A;  1K55 A;  2PBY A;  3HLC A;  1TVF A;  1XGJ A;  5TFQ A;  1MWS A;  5D3O A;  1ZG6 A;  4KG6 A;  5GLA A;  1ES5 A;  3AGE A;  1W8Y A;  4LV1 A;  1MXO A;  3GQZ A;  4C6Y A;  3BRM A;  3N8S A;  1DY6 A;  3DWZ A;  5HW3 A;  3RXW A;  4JKT A;  2Y91 A;  3PBQ A;  2E8I A;  3DTM A;  4GD6 A;  5G18 A;  3D4F A;  1PWG A;  1NJ4 A;  1MY8 A;  5DVA A;  2JCH A;  4PM7 A;  4BL3 A;  5E2H A;  2ZC4 B;  4OH0 A;  5CHM A;  5GLB A;  1L0D A;  2PU4 A;  1K4E A;  4GZB A;  3M6H A;  1NXY A;  4LV3 A;  2WKE A;  4FCF A;  4RVA A;  1K56 A;  2ZD8 A;  1SCW A;  1XX2 A;  1KE0 A;  3BFC A;  1C3B A;  1EI5 A;  2H10 A;  3IQA A;  5CGX A;  3GTC A;  3MXS A;  1YLZ A;  4UA7 A;  2QPN A;  1XP4 A;  2OLV A;  4GNU A;  3OPR A;  1RGY A;  4GDB A;  1KGF A;  2Y2P A;  2Y2I A;  4HBU A;  4OPZ A;  2ZM2 A;  1FSW A;  3Q82 A;  1MWT A;  3VOY A;  2HP5 A;  1HZO A;  4E3K A;  1ZKJ A;  3QHY A;  5HFO A;  3UE3 A;  2VGK A;  2Y2K A;  4S2N A;  1SKF A;  1VM1 A;  3VP1 A;  3C4P A;  3Q7V A;  2H5S A;  2WKI A;  3QNC A;  1FR1 A;  4HEF A;  2H0Y A;  4IVK A;  3S4X A;  1SDE A;  4EWF A;  1IYP A;  2WZZ A;  2EFX A;  1L0E A;  1EWZ A;  1PW8 A;  2HP9 A;  2WAE A;  3ISG A;  3W4O A;  1FSY A;  4BD1 A;  1PZP A;  4JBF A;  4DE2 A;  4OP8 A;  3UPN A;  2HPB A;  1K54 C;  1BUE A;  4Z9Q A;  3PBT A;  1BLS A;  2XGN A;  3VMA A;  5CER A;  3HLB A;  3SS5 A;  3OPH A;  4OQ0 A;  5FAO A;  1K38 A;  2Y2Q A;  3PTE A;  3BFD A;  5HX9 A;  3MKF A;  4R4R A;  1NZO A;  4Y0O A;  1PZO A;  1ES2 A;  1H8Y A;  3E2K A;  1E4D A;  3CZD A;  3VFH A;  1W5D A;  4CPK A;  1MKI A;  4B4Z A;  1XKZ A;  3ITA A;  1IYS A;  3VP3 A;  2Y2G A;  3I7J A;  3S1Y A;  3Q7V B;  2JC7 A;  2V1Z A;  3W4P A;  1IKI A;  5FDH A;  3GV9 A;  3IF6 C;  4E6X A;  1TDL A;  2Y2O A;  4Y0U A;  4MBK A;  4DKI A;  1K6S A;  4RX3 A;  1SHV A;  4DXC A;  2GDN A;  4P6B A;  2P74 A;  4GDN A;  4JXW A;  4R23 A;  1K6R A;  3WS2 A;  5F1G A;  2Q9N A;  5E2F A;  5JYP A;  3HUM A;  3IXD A;  4KQO A;  4ZAM A;  3A3J A;  5FAS A;  1HD8 A;  3HLE A;  5BOH A;  4WYY A;  4QY5 A;  5CEC A;  2G2W A;  3C5A A;  5GHZ A;  2J7V A;  1IKG A;  1Q2Q A;  4MLL A;  2WGW A;  3V39 A;  3SOI A;  1ZC2 A;  2WZX A;  3A3E A;  5FQJ A;  5GHY A;  3VOZ A;  3N4I A;  3FYZ A;  2ZM0 A;  2CC1 A;  1M40 A;  3QNB A;  5FAQ A;  4EQI A;  2R9X A;  5HAP A;  3BYD A;  4UA6 A;  3IXG A;  1HVB A;  4X6T A;  3ZG9 B;  3OPL A;  2JE5 A;  3NDE A;  4D2O A;  2XEP A;  3IF5 A;  4GN2 A;  2OSU A;  3G4P A;  3MBZ A;  4C3Q A;  3TOI A;  1YLJ A;  4S2O A;  1FR6 A;  5F82 A;  2X71 A;  3OZH A;  4JF6 A;  4OKP A;  4OVD A;  1IEL A;  2ZM8 A;  1O07 A;  5DTT A;  4OQI A;  4U0T A;  1YLT A;  3V3S A;  4E3O A;  5KZH A;  3SS4 A;  4WBG A;  5DF7 A;  4KEN B;  1QMF A;  3IH9 A;  1PYY A;  2B5R A;  2QZ6 A;  3IHB A;  1KGG A;  5CHJ A;  4YIN A;  5EVI B;  2I72 A;  4UAA A;  5CXW A;  3BFF A;  3LY3 A;  4X69 A;  1GCE A;  1AXB A;  3NI9 A;  4OPQ A;  4LCM A;  4R3J A;  4NET A;  4JF4 A;  1E3U A;  4X55 A;  4IED A;  2HDU A;  4S2K A;  1U60 A;  4O7D A;  2WGV A;  2RL3 A;  1ONH A;  5EVI D;  5KSH A;  1ALQ A;  1XA7 A;  3UDX A;  1JWP A;  1WYC A;  4DE1 A;  3UN7 A;  5F1F A;  1JVJ A;  3G2Y A;  4R1G A;  5FQI A;  5DF9 A;  3FWL A;  3IXH A;  4WMC A;  4KG5 A;  5CTM A;  1K25 A;  4BLM A;  3DWK A;  3UDI A;  1QME A;  3FKW A;  5AQA A;  3OPP A;  4LV0 A;  4ZJ1 A;  2ZMA A;  4RX2 A;  3NY4 A;  3GMW A;  1GHM A;  2Y4A A;  5CTN A;  3UPO A;  1YLY A;  1Z6F A;  3SH9 A;  4Y0T A;  3HLD A;  1K54 A;  2XH9 A;  3NCK A;  1K4F A;  1H5X A;  4S2L A;  3LCE A;  3FV7 A;  3ZVT A;  1BUL A;  1BSG A;  2ZQC A;  1JTG A;  3O3V A;  4E3L A;  3G30 A;  4OQH A;  5E2E A;  2R9W A;  1JWV A;  3SS3 A;  4QHC A;  1PI5 A;  1CI8 A;  3VP2 A;  4OOY A;  1L0G A;  3WS1 A;  3WWX A;  3HLF A;  3CJM A;  5FAP A;  4Q8I A;  1BLP A;  3IF6 A;  2ZQA A;  3OCL A;  1IEM A;  1KDS A;  1DJC A;  3NDG A;  5GLD A;  2DCF A;  3C7V A;  5IHV A;  3TG9 A;  2G2U A;  5DTS A;  4KQQ A;  4U3T A;  1KGE A;  1XGI A;  1CEG A;  2FFF B;  1LHY A;  3HUN A;  2C5W B;  3LEZ A;  3WS4 A;  4OQG A;  5GL9 A;  1FCN A;  1W79 A;  3EQU A;  1K56 D;  3ZG7 B;  2BLS A;  4DRT A;  3ZFZ A;  5TR7 A;  5KMW A;  2X01 A;  1XXM A;  3CMZ A;  5FA7 A;  5M18 A;  4KZA A;  1GHI A;  1IYO A;  4P0M A;  3UDF A;  4E3M A;  4OON A;  3G34 A;  3O88 A;  3ZNY A;  4WZ5 C;  3BEB A;  3HBR A;  2ZQ9 A;  1N9B A;  2UWX A;  3W4Q A;  4OOL A;  1YM1 A;  1G6A A;  2RCX A;  3PBS A;  3BEC A;  3Q07 A;  1BLH A;  4NK3 A;  3A3F A;  3GVB A;  3BFG A;  2ZC7 A;  1PI4 A;  3MZF A;  1S0W A;  2WGI A;  1WYB A;  4JXS A;  2WUQ A;  4FD8 A;  3G32 A;  4WEL A;  4YFM A;  4PMA A;  3MZE A;  2XD1 A;  3IH8 A;  3BFE A;  1N4O A;  3ZHH A;  4BJP A;  2IWB A;  2J8Y A;  4FH2 A;  4BL2 A;  4EBP A;  3ZGA B;  2DRW A;  2PU2 A;  1JTD A;  1YQS A;  3ZG5 A;  4OLG A;  4PM9 A;  3M6B A;  2ZJ9 A;  3PAG A;  1LL9 A;  1E25 A;  2XF3 A;  5CRF A;  2EFU A;  4KZ9 A;  4N92 A;  1M6K A;  5E2G A;  3S22 A;  5HAQ A;  4E6W A;  5EE8 A;  1ESU A;  1GHP A;  1NZU A;  2QMI A;  4P87 A;  5JYO A;  5AQ9 A;  2OLU A;  1MWR A;  3BLS A;  5AQ7 A;  1LI9 A;  3VSK A;  1JWZ A;  4QU3 A;  1TDG A;  3HLG A;  1FCO A;  3NIA A;  1KVM A;  4DDY A;  5FQ9 A;  4MNR A;  3M2J A;  1I5Q A;  4KZ6 A;  4LV2 A;  2J9P A;  4U0X A;  3UE0 A;  2XFT A;  4EBN A;  3V3R A;  1YMS A;  1NRF A;  4PPR A;  2ZC5 B;  2ZQD A;  4WM9 A;  5A92 A;  3AGD A;  3N8R A;  4WEJ A;  5EPH A;  4MBF A;  4FSF A;  3ZVW A;  4DDS A;  1K57 C;  3IWI A;  3GRJ A;  2V20 A;  4IBX A;  3LY4 A;  4OOM A;  5GHX A;  3V5M A;  2WGW B;  4M3K A;  5KSC A;  1MBL A;  4P85 A;  2HDR A;  3MFD A;  3MZD A;  3VP0 A;  2EX8 A;  3ZDJ A;  2XFS A;  2XQZ A;  1YLP A;  4N9L A;  5FQM A;  1PWC A;  1LI0 A;  4X56 A;  5HL1 A;  2H0T A;  4S2J A;  2HDQ A;  5EVL A;  4K0W A;  3VP4 A;  3WRZ A;  4B88 A;  3WRT A;  4MEZ A;  3BM6 A;  1RGZ A;  3WS5 A;  5GLC A;  2VGJ A;  1RP5 A;  4KZ3 A;  4BEN A;  1NYM A;  2FFY A;  3UNW A;  4X53 A;  2Y2M A;  5J8X A;  4R3B A;  3NC8 A;  1VQQ A;  3P09 A;  3O86 A;  3PBN A;  4KZB A;  5CGS A;  5EVI C;  4DE0 A;  3HVF A;  4JPM A;  3UPP A;  1NY0 A;  4OPY A;  4LEN A;  4RA7 A;  4OLD A;  3W8K A;  4FH4 A;  1BLC A; 
#chains in the Genus database with same CATH topology
 2QJ7 A;  1H8Z A;  5IU1 A;  2ACG A;  2INW A;  4ZDX A;  2M7U A;  4H8R A;  3T12 B;  1DJB A;  1OTA A;  3DW0 A;  5DFX A;  4R6L A;  1E3U D;  2Y2L A;  5L8M A;  1GSV A;  1CEF A;  3Q81 A;  3VFF A;  5J7E A;  1YMX A;  5A91 A;  3KSI A;  1N9L A;  2EX9 A;  4QY6 A;  1K55 C;  5FQK A;  4PM5 A;  1HTZ A;  4ZJ2 A;  2ZC6 B;  1WE4 A;  3UO9 A;  4N9K A;  3CWF A;  4B9O A;  3G35 A;  3ZQ5 A;  4E3I A;  1ES3 A;  3P98 A;  4S2M A;  4S2P A;  4EUZ A;  3E98 A;  2Z2M B;  2WKH A;  4UHU A;  4K91 A;  3IF6 B;  3T4J A;  3QP1 A;  4BD0 A;  4H6J B;  1TEM A;  2WAF A;  1D7E A;  5HAI A;  3ZNT A;  2J9O A;  3BLM A;  3F1P B;  4MN5 A;  4Q0J A;  1J9M A;  1KDW A;  4Y15 A;  5HAR A;  4KQR A;  2WAD A;  4JXG A;  1SDN A;  3NUL A;  1WA9 A;  2VV6 A;  1T1A A;  3IWO A;  2IWC A;  3LO7 A;  3FKV A;  3CPT A;  5I94 A;  2Y2N A;  4KZ4 A;  4GOG A;  1YT4 A;  3A3I A;  4HNB A;  1STZ A;  4LCL A;  1LL8 A;  2JHE A;  3UE1 A;  4E3N A;  1BZA A;  2XD5 A;  4R0Q A;  4L9F A;  5AQB A;  1ERO A;  2XDM A;  1ONG A;  3R7W A;  1Q2P A;  1OME A;  5F83 A;  5FSR A;  2P9V B;  4HBT A;  3V50 A;  1NYY A;  4ETX A;  3CG5 A;  5EOO A;  3AGF A;  1KVL A;  1XFQ A;  1EW0 A;  2HV1 A;  1ZG6 A;  5GLA A;  1ES5 A;  4LV1 A;  1MXO A;  3EEA A;  2HJE A;  3RXW A;  2J3T D;  1MY8 A;  4BL3 A;  5GLB A;  2PU4 A;  3MQO A;  2WKE A;  3E4Q A;  4RVA A;  1K56 A;  1XX2 A;  1P9W A;  1F2K A;  2VLG A;  1EI5 A;  3GTC A;  3MXS A;  3LR5 A;  3PYP A;  3TRC A;  3OPR A;  4GDB A;  2Y2P A;  2PYR A;  3Q82 A;  3ULF A;  3PXP A;  3T4T A;  3L7H A;  4HH3 A;  3OLO A;  3C4P A;  2WKI A;  2O9C A;  2EFX A;  4RQ9 A;  1EWZ A;  2HP9 A;  4OP8 A;  1S67 L;  1BLS A;  2K7S A;  3VE4 A;  4EES A;  3OPH A;  5FAO A;  1GSX A;  3BJN A;  3MKF A;  3LIC A;  1ES2 A;  1H8Y A;  3E2K A;  4B4Z A;  1XKZ A;  2V1Z A;  3BY9 A;  5FDH A;  3LI8 A;  3IF6 C;  4E6X A;  4Y0U A;  1DP9 A;  1SHV A;  4R23 A;  3WS2 A;  2Q9N A;  4KQO A;  1UWN X;  2QYB A;  5I5L A;  1HD8 A;  2J7V A;  1IKG A;  3JVV A;  3SOI A;  2WZX A;  3A3E A;  1F98 A;  5FQJ A;  5GHY A;  1M40 A;  4PKY G;  4R38 A;  4FTX A;  5HAP A;  3BYD A;  4HJ4 A;  4L9E A;  2JE5 A;  3NDE A;  4EW7 A;  2XEP A;  3IF5 A;  4WF0 A;  1OT6 A;  3OZH A;  4OKP A;  5DTT A;  4U0T A;  1YAX A;  4KEN B;  1D1J A;  1QMF A;  3T4K A;  2PD7 A;  5CHJ A;  4YIN A;  5EVI B;  3NEC A;  4UAA A;  3BFF A;  3LY3 A;  1AXB A;  1ACF A;  3W2Z A;  4JF4 A;  1E3U A;  2I9V A;  5AVF A;  4IED A;  2HDU A;  4QPR A;  1U60 A;  4S2K A;  2RL3 A;  4CLC D;  5FQI A;  4PHT A;  3FWL A;  1G28 A;  5CTM A;  3DWK A;  3UDI A;  1CF0 A;  5AQA A;  2ZMA A;  3GMW A;  5CTN A;  3K2N A;  3GEC A;  1K4F A;  3ZVT A;  4G3V A;  5E2E A;  4OQH A;  2W3G A;  3MS6 A;  3NOT C;  3VP2 A;  4JGO A;  4OOY A;  4IJG A;  3FPV A;  4Q8I A;  4BBU A;  2EA9 A;  1LT0 A;  3C7V A;  3TG9 A;  4U3T A;  1KGE A;  3EQU A;  4MN7 A;  3ZG7 B;  5TR7 A;  3B33 A;  1DRM A;  2X01 A;  3CMZ A;  4KZA A;  2DMW A;  4P0M A;  4OON A;  3E0Y A;  4EUV A;  3G34 A;  2FH5 A;  2JKG A;  1N9B A;  3W4Q A;  1FIK A;  1YM1 A;  3Q07 A;  1BLH A;  1JNU A;  4GHI B;  3A3F A;  2JN7 A;  3GVB A;  4NK3 A;  3BFG A;  1S0W A;  1WYB A;  4FD8 A;  3FPW A;  3G32 A;  4YFM A;  3C2W A;  3MZE A;  3BY8 A;  3RH8 B;  1F9I A;  3BFE A;  2W3H A;  2Z6D A;  4BL2 A;  2IWB A;  4FH2 A;  1MKM A;  3ZG5 A;  2ZJ9 A;  3PAG A;  4L9G A;  1IFQ A;  4KZ9 A;  1M6K A;  5E2G A;  5HAQ A;  4HI4 A;  2KX6 A;  3CUE A;  4Y3I A;  2OLU A;  1F5M A;  5AQ7 A;  1LI9 A;  3L9K A;  4MN6 A;  3VSK A;  3IX4 A;  4QU3 A;  1TDG A;  4G3W A;  4I5S A;  5FQ9 A;  4EEU A;  3V3R A;  1NRF A;  2ZQD A;  1NRJ A;  2V0U A;  5EPH A;  4MBF A;  4FSF A;  3ZVW A;  3LY4 A;  3V5M A;  2M7V A;  2WGW B;  5KSC A;  3BWL A;  3VE3 A;  4P6Z S;  2EX8 A;  2EWV A;  2XQZ A;  1YLP A;  3KSH A;  4HHD A;  1LI0 A;  2H0T A;  4S2J A;  4Y13 A;  2JKR I;  4K0W A;  3VP4 A;  4B88 A;  1S66 L;  1XJ2 A;  3UNW A;  4P6Z M;  4X53 A;  2Y2M A;  2Y79 A;  5J8X A;  1VQQ A;  4II7 A;  5EVI C;  3LYX A;  5CGS A;  4HOI A;  4JPM A;  3VV4 A;  1LSX A;  3A3D A;  3H82 B;  1L2S A;  5E43 A;  5CGW A;  3O87 A;  2NUT C;  3UME A;  4HQA A;  5FAT A;  3DAV A;  3LGO A;  2WK0 A;  2ZC3 B;  1UWP X;  2EWW A;  4KZ5 A;  1H3Q A;  5MC7 A;  1Y54 A;  3B3X A;  2A3U A;  4BBT A;  2DNS A;  1ES4 A;  5FQQ A;  3HL9 A;  5CEB A;  4O0P A;  4DXB A;  3IBR A;  2Q9M A;  2X02 A;  5FI7 A;  4DN0 A;  3PBR A;  1W8Q A;  3F1N A;  4KZ8 A;  2ZLY A;  4K0X A;  2HP6 A;  1YSP A;  3PBO A;  3IWQ A;  3QP4 A;  4LFU A;  3T1R A;  4I39 A;  4XT2 B;  1PIO A;  1K57 A;  4WEK A;  4Y7P A;  4X68 A;  2K31 A;  4S2N C;  1N9N A;  5CX7 A;  1NWZ A;  1I2W A;  1RCJ A;  3LID A;  2GNX A;  2WYX A;  3MSH A;  2JKT I;  4GJ4 A;  1ERM A;  2XK1 A;  4C75 A;  3IXB A;  1PNE A;  2A49 A;  3SH8 A;  4ZBE A;  3UB9 A;  4E3J A;  3EQV A;  2Y2J A;  3E2L A;  3D3O A;  3T1S A;  1L0F A;  2G7U A;  4CLC A;  3H7W B;  3K3C A;  5EOE A;  5AVE A;  2H28 A;  4QB8 A;  1UGU A;  3T4S A;  1ZG4 A;  3PAE A;  1YLW A;  1XA1 A;  5HSQ A;  3MXR A;  1LL5 A;  3LFV A;  3Q1F A;  5HL6 A;  3SH7 A;  1VEU A;  2VX8 A;  4XXR A;  3G2Z A;  4E04 A;  3RXX A;  2XLN A;  2VV7 A;  3HLW A;  1K55 A;  3HLC A;  5D3O A;  2W1T A;  3AGE A;  2CMN A;  3BRM A;  3R7W B;  3JPU A;  1S4S A;  4GS9 A;  2E8I A;  3DTM A;  5HPF A;  3D4F A;  3NOP C;  5DJU A;  1NJ4 A;  5DVA A;  3BQ8 A;  1G5U A;  1DP8 A;  2W3F A;  5CHM A;  3TE8 A;  2A2L A;  1K4E A;  4GZB A;  3M6H A;  1OTE A;  4LV3 A;  1SCW A;  1KE0 A;  1OTI A;  5CGX A;  3T1Q B;  2FZ0 A;  4Q0I A;  2QPN A;  4GNU A;  4HBU A;  4OPZ A;  1XJ3 A;  1FSW A;  1HZO A;  4CLC E;  5HFO A;  2VGK A;  4ARZ A;  4F3L B;  3LEQ A;  1SKF A;  2H5S A;  4HEF A;  2H0Y A;  2WZZ A;  2WAE A;  1P0Z A;  4BD1 A;  4QWO A;  2HPB A;  1OTB A;  4Z1W A;  3KX0 X;  3VMA A;  3T4Q A;  1K38 A;  5HX9 A;  3BFD A;  4GCZ A;  4Y0O A;  1E4D A;  1TS8 A;  1W5D A;  2Z6C A;  1XJ6 A;  2JC7 A;  1IKI A;  2Y2O A;  4MBK A;  4DKI A;  1K6S A;  5EM0 A;  2P74 A;  4GDN A;  2A24 B;  4JXW A;  5F1G A;  5JYP A;  2E8J A;  3IXD A;  2WKQ A;  3LIB A;  3A3J A;  2ZOI A;  5FAS A;  3HLE A;  3FC7 A;  4WYY A;  2G2W A;  5GHZ A;  2L1M A;  1NLY A;  2R78 A;  3FYZ A;  2CC1 A;  4Y5F A;  4EQI A;  2R9X A;  3MQQ A;  4X6T A;  4FOF A;  4LGW A;  5EM1 A;  4GN2 A;  2OSU A;  3G4P A;  2PAV P;  3TOI A;  4S2O A;  1TD5 A;  3D72 A;  1O07 A;  2Y8H A;  4GLQ A;  4E3O A;  3QP8 A;  4WBG A;  4I38 A;  5HDC A;  4BMW A;  4R3A A;  1KGG A;  3MJQ A;  2I72 A;  1ZTU A;  3NI9 A;  4OPQ A;  5HWV A;  5DJT A;  5EVI D;  4O7D A;  1ONH A;  5KSH A;  1XA7 A;  2O9B A;  4DE1 A;  3UN7 A;  3CI6 A;  2OAQ 1;  3ICY A;  4KG5 A;  1K25 A;  4UQI S;  5IS1 A;  1AWI A;  4RX2 A;  3NY4 A;  5L07 A;  3SH9 A;  3HLD A;  2XH9 A;  2PR6 A;  3MR0 A;  3O3V A;  4E3L A;  1P9R A;  4QHC A;  4UQI M;  2BAS A;  1CI8 A;  2OAP 1;  5LBR A;  3IF6 A;  2ZQA A;  1KDS A;  5HPI A;  5GLD A;  2DCF A;  1FIL A;  2QHK A;  1XGI A;  1CEG A;  3HUN A;  3WS4 A;  4BWI A;  2W3E A;  2WKR A;  4JGR A;  4ME4 A;  2BLS A;  3B47 A;  1XXM A;  3MMH A;  5J3W A;  4WZ5 C;  3BEB A;  2ZQ9 A;  1LSW A;  1G6A A;  2RCX A;  3BEC A;  4Q0H A;  3F1O B;  2WGI A;  2WUQ A;  4K08 A;  4PMA A;  5HD3 A;  3ZHH A;  3SZT A;  4MMN A;  4OLG A;  4PM9 A;  1TF1 A;  2GJ3 A;  3NOU C;  1E25 A;  2XF3 A;  2ZBB A;  4N92 A;  1GHP A;  1NZU A;  4P87 A;  3BLS A;  2ZMV A;  1JWZ A;  4WN5 A;  1FCO A;  3NIA A;  5G4Y A;  3H9W A;  3BQA A;  2J9P A;  2OOL A;  4U0X A;  4PKY A;  4HIA A;  2LB9 A;  3AGD A;  3TW8 A;  4DDS A;  3T4L A;  2KLI A;  2V20 A;  2YKF A;  5GHX A;  4NEE D;  2VJW A;  1MBL A;  3UB5 P;  3VP0 A;  1PWC A;  4X56 A;  2HDQ A;  4ESP A;  3UMD A;  4EEP A;  5DFY A;  4MEZ A;  1OPX A;  3WS5 A;  4EU0 A;  2VGJ A;  4KZ3 A;  1NYM A;  2FFY A;  1VB6 A;  4DE0 A;  3O86 A;  4KZB A;  5TBM B;  3HVF A;  3UPP A;  3IS2 B;  4OPY A;  3LR0 A;  1H0M A;  4OLD A;  1BLC A;  3UPN A;  4LLO B;  2IWD A;  2VA0 A;  2VKS A;  3ZCZ A;  2V8C A;  4JF5 A;  4O8G A;  1BT5 A;  1MWU A;  2B95 A;  5CHU A;  3OCN A;  4ZJ3 A;  4EBL A;  4GD8 A;  4PM8 A;  4ZTK A;  1SKO B;  5U47 A;  1YKD A;  4N1X A;  3RJU A;  4I3I A;  1PRQ A;  5J4E A;  3O5Y A;  3VOL A;  4D60 A;  2XSS A;  5FI6 A;  3DTI A;  3T50 A;  2YKH A;  4CJN A;  5HWT A;  1DJA A;  4A5R A;  2BG1 A;  2PDR A;  3N6I A;  1I2S A;  4EER A;  4MBH A;  4XUZ A;  2XR0 A;  3ZG8 B;  2V9A A;  3IHA A;  5L2F A;  2C6W B;  3IT9 A;  3KYZ A;  4ID4 A;  1CI9 A;  3VSL A;  2XA7 S;  3EGX C;  3M2K A;  4DF6 A;  4JXV A;  1MPL A;  2EX2 A;  2JBF A;  2V2F F;  3MXQ A;  4PAU A;  3JYI A;  3N8L A;  1G68 A;  2GZA A;  4UA9 A;  1T1B A;  4DJ2 A;  2XA7 M;  4WZ4 A;  1FCM A;  1GA0 A;  3U4L P;  2ZQ8 A;  4GKU A;  3ITB A;  5M1A A;  3TSG A;  3F1N B;  4WL9 A;  1VET B;  1IYQ A;  1Y28 A;  1S4R A;  2EXA A;  1Y4O A;  1ZHH B;  3HUO A;  4IUH A;  5DKK A;  3NBL A;  5EVI A;  4HJ6 A;  5A90 A;  5FI2 A;  2B18 A;  4GB7 A;  1KE3 A;  3OC2 A;  4DE3 A;  5DF8 A;  2V0W A;  3CIT A;  3GSG A;  2Z2L B;  3LR4 A;  4N1H A;  3LI9 A;  2JKR M;  4EQ1 A;  3DBA A;  2EXB A;  2PBD P;  1XGJ A;  3UE6 A;  1MWS A;  1W8Y A;  4C6Y A;  2ZL1 B;  3DWZ A;  4JKT A;  3PBQ A;  1XJ4 A;  2XRO A;  3JVU A;  3V67 A;  4JGP A;  2ZC4 B;  5E2H A;  4LRZ E;  1L0D A;  3MF0 A;  3D9Y A;  3KSF A;  3BFC A;  3TJZ C;  3IQA A;  4X25 A;  1NLZ A;  2W3D A;  4UA7 A;  2VEA A;  4X1L A;  2OLV A;  1RGY A;  1KGF A;  2ZM2 A;  1MWT A;  3VOY A;  2HP5 A;  1ZKJ A;  3QHY A;  4UEY A;  4S2N A;  1VM1 A;  3VP1 A;  4I3J A;  3Q7V A;  1IOU A;  3QNC A;  3S4X A;  1FR1 A;  4IVK A;  1IYP A;  3R4K A;  1PFL A;  3ISG A;  4GHI A;  2W27 A;  2PRF A;  4DE2 A;  3NJA A;  1K54 C;  1BUE A;  3PBT A;  2XGN A;  3P7N A;  5CER A;  2WKP A;  3SS5 A;  4OQ0 A;  4JGQ A;  3PTE A;  4R4R A;  1NZO A;  1PZO A;  1J3W A;  3CZD A;  5F6A A;  3ITA A;  1IYS A;  3CHW P;  2Y2G A;  3I7J A;  3S1Y A;  2JKF A;  3W4P A;  1TDL A;  3OBF A;  4HP4 A;  2JKT M;  1V9Z A;  4X1M A;  3RFB A;  3KSG A;  5CEC A;  4MLL A;  2HGV A;  2WGW A;  3V39 A;  3ZYT A;  3N4I A;  3IXG A;  3ZG9 B;  3OPL A;  2VK3 A;  5FEF A;  4C3Q A;  1T1C A;  5K5B A;  5F82 A;  2X71 A;  3CPT B;  4JF6 A;  2ZM8 A;  3V3S A;  5KZH A;  3SS4 A;  5DF7 A;  4HH2 A;  3IH9 A;  1PYY A;  2MJ6 A;  1S1Y A;  3H82 A;  4X69 A;  1GCE A;  4R3J A;  4LCM A;  3S7O A;  2WGV A;  3UDX A;  1JVJ A;  5DF9 A;  3IXH A;  1QME A;  3FKW A;  4AFI A;  2OWH A;  1GHM A;  3UPO A;  1Z6F A;  4Y0T A;  3NCK A;  3NHQ A;  2D01 A;  3LCE A;  2ZQC A;  5FEG A;  2O9A A;  1JTG A;  3G30 A;  3EOI A;  4B93 A;  1L0G A;  3WWX A;  3HLF A;  5FAP A;  1BLP A;  3OCL A;  3SW1 A;  5DKL A;  5IHV A;  4YNR A;  2G2U A;  5DTS A;  4KQQ A;  3S7N A;  5HZH A;  3P01 A;  3LEZ A;  5GL9 A;  1FCN A;  4XT2 A;  3ZFZ A;  1TS0 A;  1GHI A;  1IYO A;  4HP9 A;  4E3M A;  3PR6 A;  3HBR A;  1OT9 A;  2VV8 A;  2UWX A;  4ETZ A;  1PI4 A;  3MZF A;  2P08 A;  4JXS A;  2V1A A;  4WEL A;  2HZ5 A;  3IH8 A;  4HY8 A;  3ZGA B;  3H7W A;  1JTD A;  4MCW A;  1YQS A;  5TJJ A;  3CLO A;  2EFU A;  3OOV A;  3S22 A;  4E6W A;  5AQ9 A;  1MWR A;  3HLG A;  2BTF P;  1VHM A;  4MNR A;  3M2J A;  1I5Q A;  4KZ6 A;  4LV2 A;  2Q0O A;  1YMS A;  2PR5 A;  3A0R A;  2ZC5 B;  5A92 A;  4IBX A;  5FDS A;  5HDS A;  4BBV A;  3T4O A;  3MZD A;  3ZDJ A;  4N9L A;  5HL1 A;  2QKP A;  4Y2F A;  4ZRR A;  3WRZ A;  3WRT A;  3BM6 A;  3QP2 A;  1RGZ A;  2HJ9 C;  5GLC A;  2L4R A;  4EET B;  4BEN A;  4R3B A;  3NC8 A;  1NY0 A;  4LEN A;  4RA7 A;  5IT5 A;  3W8K A;  1G6O A;  4IBR A;  4F3L A;  1D06 A;  1CK3 A;  1SZV A;  2W1R A;  4WZ5 A;  5EEC A;  1PWD A;  1H8M A;  3FZC A;  4QJG A;  2VGL S;  4XUX A;  1TS7 A;  4H6J A;  3WS0 A;  4L0L A;  1GSW A;  2J80 A;  4F94 A;  4WMC D;  5DTK A;  3F1P A;  1TS6 A;  4RYE A;  2Y55 A;  3IX3 A;  2VGL M;  3RTY A;  5CED A;  2ZOH A;  4M4X A;  1S1Z A;  1ERQ A;  4B4X A;  1ESI A;  4IVI A;  3KO6 A;  3Q7Z A;  5G4Z A;  4KG2 A;  1T18 A;  2A24 A;  1MZU A;  1S6R A;  4EXO A;  5F5Y A;  1CQA A;  3N7W A;  1PW1 A;  3UY6 A;  4OPR A;  3LIE A;  4HJ3 A;  4QD4 A;  4NG2 A;  4DJ3 A;  4KQD A;  5EUA A;  2K2N A;  1W7F A;  4YWZ A;  2EX6 A;  3C7U A;  3EGD C;  3HJK A;  5TGF A;  5L09 A;  2P9V A;  3GR2 A;  2ZQ7 A;  3KYE A;  4EV4 A;  2Y59 A;  3K3D A;  4JLF A;  1LSV A;  4PM6 A;  3G31 A;  4KUO A;  3EWK A;  1LLB A;  4KZ7 A;  4DMZ A;  5M19 A;  1O7E A;  1FOF A;  4S2I A;  1BTL A;  5A93 A;  2Y2H A;  4OP5 A;  1N9O A;  2HDS A;  1FQG A;  2P04 A;  3HRE A;  1YSQ A;  3KYQ A;  4HES A;  4BQM A;  3ZG0 A;  2OV5 A;  1KE4 A;  3C4O A;  1A0K A;  3MKE A;  3S7Q A;  4O01 A;  1GA9 A;  4R4S A;  1XPB A;  4I3A A;  2PBY A;  1TVF A;  3GDI A;  5TFQ A;  4KG6 A;  5EFW A;  3GQZ A;  3N8S A;  1DY6 A;  3BW6 A;  5HW3 A;  5HWW A;  2Y91 A;  4GD6 A;  5G18 A;  1PWG A;  2JCH A;  4PM7 A;  4OH0 A;  3DTE A;  4FUW A;  1K0K A;  1NXY A;  3C8C A;  4FCF A;  2PD8 A;  2ZD8 A;  1C3B A;  2H10 A;  1YPR A;  4CQH A;  3G6O A;  1YLZ A;  1XP4 A;  2Y2I A;  4NXF A;  4E3K A;  4LRX C;  3UE3 A;  2Y2K A;  2O99 A;  1SDE A;  4EWF A;  4IUK A;  4NXB A;  1L0E A;  1PW8 A;  3W4O A;  4GW9 A;  3F1O A;  1FSY A;  1PZP A;  4JBF A;  4Z9Q A;  3B42 A;  3HLB A;  2Y2Q A;  1W63 M;  5L10 A;  5A8B A;  3VFH A;  4CPK A;  1MKI A;  3VP3 A;  2V8F A;  3Q7V B;  2J3W A;  3UB7 A;  5EVE A;  3FG8 A;  3GV9 A;  2HF6 A;  4RX3 A;  2B02 A;  4DXC A;  2GDN A;  4P6B A;  2LB5 A;  1K6R A;  5E2F A;  3HUM A;  4ZAM A;  2V1B A;  5BOH A;  2GX5 A;  4QY5 A;  3C5A A;  2W0N A;  4LPZ A;  1Q2Q A;  2O0Y A;  1ZC2 A;  3VOZ A;  2ZM0 A;  4Y17 A;  3QNB A;  5FAQ A;  1V9Y A;  2PHY A;  4UA6 A;  1HVB A;  1BYW A;  4MDZ A;  4WUJ A;  4D2O A;  2OWJ A;  5EV0 A;  3MBZ A;  3E4P A;  1YLJ A;  2KDK A;  1FR6 A;  3LUQ A;  3UB6 A;  3CAX A;  4OVD A;  1IEL A;  1W63 Q;  4OQI A;  5AJG A;  5TBM A;  1YLT A;  3EEH A;  5F68 A;  3IS2 A;  3PHY A;  1P97 A;  2B5R A;  4LRY C;  2QZ6 A;  3U2A A;  3IHB A;  2D02 A;  5CXW A;  3A0S A;  4NET A;  4CLC B;  4X55 A;  1XFN A;  3A0V A;  1ALQ A;  3CUE C;  1JWP A;  1WYC A;  5F1F A;  1SKO A;  3G2Y A;  4R1G A;  4WMC A;  4G3K A;  4BLM A;  1DP6 A;  1CJF A;  3OPP A;  4LV0 A;  4ZJ1 A;  2Y4A A;  1VEU B;  2QJ5 A;  1X0O A;  1YLY A;  3C30 A;  1K54 A;  3DTK A;  1Z09 A;  2J3T C;  1H5X A;  4S2L A;  3FV7 A;  1BUL A;  1BSG A;  3S7P A;  2W1T B;  4IHQ A;  2R9W A;  1JWV A;  3HCY A;  3SS3 A;  1PI5 A;  2IA2 A;  2QWS A;  3WS1 A;  4GS9 B;  3CJM A;  2L0W A;  1IEM A;  4YOF A;  1DJC A;  3NDG A;  3E4O A;  2NUP C;  5KIZ A;  2FFF B;  1LHY A;  2C5W B;  4OQG A;  1W79 A;  5F69 A;  1K56 D;  3LIF A;  4NXG A;  4DRT A;  1KOU A;  5KMW A;  5FA7 A;  5HD5 A;  5M18 A;  3T1X A;  4R70 A;  3UDF A;  3O88 A;  3ZNY A;  1OJ5 A;  4ARZ B;  1T19 A;  4OOL A;  1OJG A;  3PBS A;  5C5K A;  1VET A;  2UV0 E;  2ZC7 A;  4NKP A;  2VZW A;  3UB8 A;  1MC0 A;  2XD1 A;  1N4O A;  4BJP A;  2J8Y A;  4EBP A;  1ODV A;  2DRW A;  2M1C A;  2PU2 A;  3IBJ A;  3C38 A;  4NXE A;  5HDD A;  3M6B A;  1LL9 A;  3QP6 A;  1L3L A;  5CRF A;  3MQ0 A;  5EE8 A;  1ESU A;  4WLA A;  5JYO A;  2QMI A;  2XRN A;  1HLU P;  3HJI A;  3QP5 A;  5FL3 A;  4DDY A;  1KVM A;  3UE0 A;  2XFT A;  4EBN A;  2ZMF A;  4PPR A;  4WM9 A;  3N8R A;  4WEJ A;  2ZL1 A;  1K57 C;  3IWI A;  3GRJ A;  4OOM A;  4M3K A;  2AVX A;  4P85 A;  2HDR A;  2P7J A;  3MFD A;  2XFS A;  2PYP A;  4KUK A;  5FQM A;  2KOI A;  5EVL A;  3LR3 A;  3IX8 A;  2PT7 A;  3MFX A;  3LIA A;  1OTD A;  1RP5 A;  3P09 A;  3PBN A;  4CLC C;  4FH4 A; 
#chains in the Genus database with same CATH homology
 4IBR A;  3A3D A;  1H8Z A;  2IWD A;  4ZDX A;  1CK3 A;  1L2S A;  4H8R A;  3ZCZ A;  4JF5 A;  5E43 A;  5CGW A;  1BT5 A;  3O87 A;  1MWU A;  5CHU A;  1DJB A;  4WZ5 A;  5EEC A;  3DW0 A;  3OCN A;  4ZJ3 A;  4EBL A;  1PWD A;  3FZC A;  1E3U D;  2Y2L A;  4QJG A;  4GD8 A;  1CEF A;  4PM8 A;  4ZTK A;  5FAT A;  3Q81 A;  5U47 A;  3VFF A;  4XUX A;  1YMX A;  4N1X A;  2WK0 A;  3RJU A;  3WS0 A;  5A91 A;  2ZC3 B;  2EX9 A;  4L0L A;  4QY6 A;  1K55 C;  4KZ5 A;  5FQK A;  5FI6 A;  4F94 A;  4WMC D;  5DTK A;  4PM5 A;  1HTZ A;  4RYE A;  4ZJ2 A;  4CJN A;  2ZC6 B;  2Y55 A;  1Y54 A;  1WE4 A;  1DJA A;  4A5R A;  3B3X A;  3UO9 A;  4N9K A;  5CED A;  2A3U A;  2BG1 A;  2DNS A;  1ES4 A;  3G35 A;  1ERQ A;  4B4X A;  4E3I A;  1ESI A;  1ES3 A;  3P98 A;  4S2M A;  4S2P A;  4EUZ A;  4IVI A;  5FQQ A;  3N6I A;  1I2S A;  2Z2M B;  3HL9 A;  5CEB A;  4MBH A;  3Q7Z A;  4DXB A;  4XUZ A;  4KG2 A;  2WKH A;  4UHU A;  2Q9M A;  2XR0 A;  4K91 A;  2X02 A;  3IF6 B;  5FI7 A;  3PBR A;  1S6R A;  3ZG8 B;  1W8Q A;  3IHA A;  4BD0 A;  5L2F A;  2C6W B;  1TEM A;  3IT9 A;  3N7W A;  4KZ8 A;  2WAF A;  4ID4 A;  1PW1 A;  3UY6 A;  4OPR A;  2ZLY A;  4K0X A;  5HAI A;  2HP6 A;  3ZNT A;  2J9O A;  3BLM A;  1CI9 A;  3PBO A;  3VSL A;  1J9M A;  4QD4 A;  3IWQ A;  1KDW A;  5HAR A;  5EUA A;  4KQR A;  2WAD A;  1W7F A;  3M2K A;  4JXG A;  4JXV A;  4DF6 A;  1MPL A;  1PIO A;  1SDN A;  1K57 A;  2EX6 A;  2EX2 A;  3C7U A;  4WEK A;  2JBF A;  5TGF A;  4Y7P A;  4X68 A;  4S2N C;  2P9V A;  2V2F F;  2ZQ7 A;  3GR2 A;  4EV4 A;  3JYI A;  1I2W A;  3N8L A;  2Y59 A;  1G68 A;  4JLF A;  1RCJ A;  4PM6 A;  4UA9 A;  3IWO A;  4WZ4 A;  1FCM A;  1GA0 A;  2IWC A;  2WYX A;  2ZQ8 A;  4GKU A;  3LO7 A;  3FKV A;  3ITB A;  5M1A A;  5I94 A;  3TSG A;  2Y2N A;  3G31 A;  4KZ4 A;  1ERM A;  2XK1 A;  4GOG A;  1LLB A;  1YT4 A;  4C75 A;  3A3I A;  1IYQ A;  4KZ7 A;  3IXB A;  5M19 A;  2A49 A;  2EXA A;  4LCL A;  4E3N A;  3HUO A;  1O7E A;  1BZA A;  4ZBE A;  1FOF A;  3SH8 A;  3UE1 A;  4E3J A;  3EQV A;  3NBL A;  2XD5 A;  5EVI A;  5A90 A;  4S2I A;  2Y2J A;  1BTL A;  5FI2 A;  4GB7 A;  4R0Q A;  3E2L A;  5AQB A;  5A93 A;  1KE3 A;  1ERO A;  1L0F A;  2Y2H A;  2XDM A;  3OC2 A;  4OP5 A;  2HDS A;  1ONG A;  1Q2P A;  1OME A;  5EOE A;  1FQG A;  4DE3 A;  5F83 A;  5FSR A;  2P9V B;  4QB8 A;  4HBT A;  3V50 A;  1NYY A;  3HRE A;  1ZG4 A;  3PAE A;  5DF8 A;  1YLW A;  3CG5 A;  1XA1 A;  5EOO A;  4HES A;  3GSG A;  2Z2L B;  3MXR A;  4N1H A;  4BQM A;  1LL5 A;  3Q1F A;  3ZG0 A;  3AGF A;  2OV5 A;  1KE4 A;  3C4O A;  3MKE A;  3SH7 A;  1KVL A;  4XXR A;  2EXB A;  3G2Z A;  1GA9 A;  3RXX A;  4R4S A;  2XLN A;  3HLW A;  1XPB A;  1K55 A;  2PBY A;  3HLC A;  1TVF A;  1XGJ A;  5TFQ A;  1MWS A;  5D3O A;  1ZG6 A;  4KG6 A;  5GLA A;  1ES5 A;  3AGE A;  1W8Y A;  4LV1 A;  1MXO A;  3GQZ A;  4C6Y A;  3BRM A;  3N8S A;  1DY6 A;  3DWZ A;  5HW3 A;  3RXW A;  4JKT A;  2Y91 A;  3PBQ A;  2E8I A;  3DTM A;  4GD6 A;  5G18 A;  3D4F A;  1PWG A;  1NJ4 A;  1MY8 A;  5DVA A;  2JCH A;  4PM7 A;  4BL3 A;  5E2H A;  2ZC4 B;  4OH0 A;  5CHM A;  5GLB A;  1L0D A;  2PU4 A;  1K4E A;  4GZB A;  3M6H A;  1NXY A;  4LV3 A;  2WKE A;  4FCF A;  4RVA A;  1K56 A;  2ZD8 A;  1SCW A;  1XX2 A;  1KE0 A;  3BFC A;  1C3B A;  1EI5 A;  2H10 A;  3IQA A;  5CGX A;  3GTC A;  3MXS A;  1YLZ A;  4UA7 A;  2QPN A;  1XP4 A;  2OLV A;  4GNU A;  3OPR A;  1RGY A;  4GDB A;  1KGF A;  2Y2P A;  2Y2I A;  4HBU A;  4OPZ A;  2ZM2 A;  1FSW A;  3Q82 A;  1MWT A;  3VOY A;  2HP5 A;  1HZO A;  4E3K A;  1ZKJ A;  3QHY A;  5HFO A;  3UE3 A;  2VGK A;  2Y2K A;  4S2N A;  1SKF A;  1VM1 A;  3VP1 A;  3C4P A;  3Q7V A;  2H5S A;  2WKI A;  3QNC A;  1FR1 A;  4HEF A;  2H0Y A;  4IVK A;  3S4X A;  1SDE A;  4EWF A;  1IYP A;  2WZZ A;  2EFX A;  1L0E A;  1EWZ A;  1PW8 A;  2HP9 A;  2WAE A;  3ISG A;  3W4O A;  1FSY A;  4BD1 A;  1PZP A;  4JBF A;  4DE2 A;  4OP8 A;  3UPN A;  2HPB A;  1K54 C;  1BUE A;  4Z9Q A;  3PBT A;  1BLS A;  2XGN A;  3VMA A;  5CER A;  3HLB A;  3SS5 A;  3OPH A;  4OQ0 A;  5FAO A;  1K38 A;  2Y2Q A;  3PTE A;  3BFD A;  5HX9 A;  3MKF A;  4R4R A;  1NZO A;  4Y0O A;  1PZO A;  1ES2 A;  1H8Y A;  3E2K A;  1E4D A;  3CZD A;  3VFH A;  1W5D A;  4CPK A;  1MKI A;  4B4Z A;  1XKZ A;  3ITA A;  1IYS A;  3VP3 A;  2Y2G A;  3I7J A;  3S1Y A;  3Q7V B;  2JC7 A;  2V1Z A;  3W4P A;  1IKI A;  5FDH A;  3GV9 A;  3IF6 C;  4E6X A;  1TDL A;  2Y2O A;  4Y0U A;  4MBK A;  4DKI A;  1K6S A;  4RX3 A;  1SHV A;  4DXC A;  2GDN A;  4P6B A;  2P74 A;  4GDN A;  4JXW A;  4R23 A;  1K6R A;  3WS2 A;  5F1G A;  2Q9N A;  5E2F A;  5JYP A;  3HUM A;  3IXD A;  4KQO A;  4ZAM A;  3A3J A;  5FAS A;  1HD8 A;  3HLE A;  5BOH A;  4WYY A;  4QY5 A;  5CEC A;  2G2W A;  3C5A A;  5GHZ A;  2J7V A;  1IKG A;  1Q2Q A;  4MLL A;  2WGW A;  3V39 A;  3SOI A;  1ZC2 A;  2WZX A;  3A3E A;  5FQJ A;  5GHY A;  3VOZ A;  3N4I A;  3FYZ A;  2ZM0 A;  2CC1 A;  1M40 A;  3QNB A;  5FAQ A;  4EQI A;  2R9X A;  5HAP A;  3BYD A;  4UA6 A;  3IXG A;  1HVB A;  4X6T A;  3ZG9 B;  3OPL A;  2JE5 A;  3NDE A;  4D2O A;  2XEP A;  3IF5 A;  4GN2 A;  2OSU A;  3G4P A;  3MBZ A;  4C3Q A;  3TOI A;  1YLJ A;  4S2O A;  1FR6 A;  5F82 A;  2X71 A;  3OZH A;  4JF6 A;  4OKP A;  4OVD A;  1IEL A;  2ZM8 A;  1O07 A;  5DTT A;  4OQI A;  4U0T A;  1YLT A;  3V3S A;  4E3O A;  5KZH A;  3SS4 A;  4WBG A;  5DF7 A;  4KEN B;  1QMF A;  3IH9 A;  1PYY A;  2B5R A;  2QZ6 A;  3IHB A;  1KGG A;  5CHJ A;  4YIN A;  5EVI B;  2I72 A;  4UAA A;  5CXW A;  3BFF A;  3LY3 A;  4X69 A;  1GCE A;  1AXB A;  3NI9 A;  4OPQ A;  4LCM A;  4R3J A;  4NET A;  4JF4 A;  1E3U A;  4X55 A;  4IED A;  2HDU A;  4S2K A;  1U60 A;  4O7D A;  2WGV A;  2RL3 A;  1ONH A;  5EVI D;  5KSH A;  1ALQ A;  1XA7 A;  3UDX A;  1JWP A;  1WYC A;  4DE1 A;  3UN7 A;  5F1F A;  1JVJ A;  3G2Y A;  4R1G A;  5FQI A;  5DF9 A;  3FWL A;  3IXH A;  4WMC A;  4KG5 A;  5CTM A;  1K25 A;  4BLM A;  3DWK A;  3UDI A;  1QME A;  3FKW A;  5AQA A;  3OPP A;  4LV0 A;  4ZJ1 A;  2ZMA A;  4RX2 A;  3NY4 A;  3GMW A;  1GHM A;  2Y4A A;  5CTN A;  3UPO A;  1YLY A;  1Z6F A;  3SH9 A;  4Y0T A;  3HLD A;  1K54 A;  2XH9 A;  3NCK A;  1K4F A;  1H5X A;  4S2L A;  3LCE A;  3FV7 A;  3ZVT A;  1BUL A;  1BSG A;  2ZQC A;  1JTG A;  3O3V A;  4E3L A;  3G30 A;  4OQH A;  5E2E A;  2R9W A;  1JWV A;  3SS3 A;  4QHC A;  1PI5 A;  1CI8 A;  3VP2 A;  4OOY A;  1L0G A;  3WS1 A;  3WWX A;  3HLF A;  3CJM A;  5FAP A;  4Q8I A;  1BLP A;  3IF6 A;  2ZQA A;  3OCL A;  1IEM A;  1KDS A;  1DJC A;  3NDG A;  5GLD A;  2DCF A;  3C7V A;  5IHV A;  3TG9 A;  2G2U A;  5DTS A;  4KQQ A;  4U3T A;  1KGE A;  1XGI A;  1CEG A;  2FFF B;  1LHY A;  3HUN A;  2C5W B;  3LEZ A;  3WS4 A;  4OQG A;  5GL9 A;  1FCN A;  1W79 A;  3EQU A;  1K56 D;  3ZG7 B;  2BLS A;  4DRT A;  3ZFZ A;  5TR7 A;  5KMW A;  2X01 A;  1XXM A;  3CMZ A;  5FA7 A;  5M18 A;  4KZA A;  1GHI A;  1IYO A;  4P0M A;  3UDF A;  4E3M A;  4OON A;  3G34 A;  3O88 A;  3ZNY A;  4WZ5 C;  3BEB A;  3HBR A;  2ZQ9 A;  1N9B A;  2UWX A;  3W4Q A;  4OOL A;  1YM1 A;  1G6A A;  2RCX A;  3PBS A;  3BEC A;  3Q07 A;  1BLH A;  4NK3 A;  3A3F A;  3GVB A;  3BFG A;  2ZC7 A;  1PI4 A;  3MZF A;  1S0W A;  2WGI A;  1WYB A;  4JXS A;  2WUQ A;  4FD8 A;  3G32 A;  4WEL A;  4YFM A;  4PMA A;  3MZE A;  2XD1 A;  3IH8 A;  3BFE A;  1N4O A;  3ZHH A;  4BJP A;  2IWB A;  2J8Y A;  4FH2 A;  4BL2 A;  4EBP A;  3ZGA B;  2DRW A;  2PU2 A;  1JTD A;  1YQS A;  3ZG5 A;  4OLG A;  4PM9 A;  3M6B A;  2ZJ9 A;  3PAG A;  1LL9 A;  1E25 A;  2XF3 A;  5CRF A;  2EFU A;  4KZ9 A;  4N92 A;  1M6K A;  5E2G A;  3S22 A;  5HAQ A;  4E6W A;  5EE8 A;  1ESU A;  1GHP A;  1NZU A;  2QMI A;  4P87 A;  5JYO A;  5AQ9 A;  2OLU A;  1MWR A;  3BLS A;  5AQ7 A;  1LI9 A;  3VSK A;  1JWZ A;  4QU3 A;  1TDG A;  3HLG A;  1FCO A;  3NIA A;  1KVM A;  4DDY A;  5FQ9 A;  4MNR A;  3M2J A;  1I5Q A;  4KZ6 A;  4LV2 A;  2J9P A;  4U0X A;  3UE0 A;  2XFT A;  4EBN A;  3V3R A;  1YMS A;  1NRF A;  4PPR A;  2ZC5 B;  2ZQD A;  4WM9 A;  5A92 A;  3AGD A;  3N8R A;  4WEJ A;  5EPH A;  4MBF A;  4FSF A;  3ZVW A;  4DDS A;  1K57 C;  3IWI A;  3GRJ A;  2V20 A;  4IBX A;  3LY4 A;  4OOM A;  5GHX A;  3V5M A;  2WGW B;  4M3K A;  5KSC A;  1MBL A;  4P85 A;  2HDR A;  3MFD A;  3MZD A;  3VP0 A;  2EX8 A;  3ZDJ A;  2XFS A;  2XQZ A;  1YLP A;  4N9L A;  5FQM A;  1PWC A;  1LI0 A;  4X56 A;  5HL1 A;  2H0T A;  4S2J A;  2HDQ A;  5EVL A;  4K0W A;  3VP4 A;  3WRZ A;  4B88 A;  3WRT A;  4MEZ A;  3BM6 A;  1RGZ A;  3WS5 A;  5GLC A;  2VGJ A;  1RP5 A;  4KZ3 A;  4BEN A;  1NYM A;  2FFY A;  3UNW A;  4X53 A;  2Y2M A;  5J8X A;  4R3B A;  3NC8 A;  1VQQ A;  3P09 A;  3O86 A;  3PBN A;  4KZB A;  5CGS A;  5EVI C;  4DE0 A;  3HVF A;  4JPM A;  3UPP A;  1NY0 A;  4OPY A;  4LEN A;  4RA7 A;  4OLD A;  3W8K A;  4FH4 A;  1BLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...