5EECA

Crystal structure of kpc-2 beta-lactamase in complex with the s02030 boronic acid inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
265
structure length
265
Chain Sequence
LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of KPC-2 and SHV-1 beta-Lactamases in Complex with the Boronic Acid Transition State Analog S02030.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carbapenem-hydrolyzing beta-lactamase KPC
total genus 95
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5eecA00
4E3IA 4LV3A 1CI9A 4Y7PA 2A3UA 3PAEA 5HAIA 4EBNA 2IWDA 5A93A 2Y2KA 5HX9A 2XR0A 3PTEA 5M1AA 5FAOA 5TFQA 1S0WA 4HBUA 3V50A 3V3RA 5FSRA 3IXGA 1YMXA 1BT5A 3I7JA 2XK1A 1NZOA 1NXYA 2R9XA 3CJMA 4DE0A 4R3BA 4JXGA 5DTKA 1K56D 1ERMA 3HLBA 3O87A 5FA7A 3ZNYA 1J9MA 2ZM0A 2XGNA 4QHCA 5EVIC 1MBLA 1K25A 2QMIA 3PBTA 4ID4A 4S2IA 4OQIA 5FQQA 4E3NA 1L0FA 1W8YA 2XF3A 3NIAA 3A3IA 2Q9NA 4B4ZA 5CRFA 2J9OA 4N9KA 3PBNA 1FCNA 2H0TA 3VMAA 1W79A 3WS5A 4KZ6A 3N8SA 1FQGA 3BRMA 1E4DA 3PBOA 1NYYA 4Y0TA 4WELA 5FDHA 4HEFA 3UE0A 3Q07A 3FV7A 2X01A 3N8LA 3NDGA 3TG9A 1SCWA 4RYEA 1YLYA 4WMCA 3HL9A 3IWQA 3IT9A 1EWZA 1BULA 4UA7A 5FQKA 4ZJ3A 3NDEA 3BLSA 5FATA 3SH8A 5FI7A 4QY5A 4DE1A 2P9VA 3GTCA 1PWGA 2WGIA 1W8QA 3A3FA 1MY8A 2EX8A 3ZGAB 3LEZA 1KE3A 1MWUA 1HTZA 1PI5A 2WADA 1RP5A 1I2WA 3HLWA 3OCLA 4MBKA 5JYPA 4CJNA 3BEBA 1K57A 5DF9A 1ESUA 2H5SA 3IXBA 3ZG7B 2WUQA 4E6XA 3O86A 2EFUA 4P87A 4QU3A 4O7DA 4IVKA 3MXRA 2Y2JA 4QD4A 1K6SA 3VP1A 1K38A 4ZTKA 1LLBA 1AXBA 4OH0A 4BLMA 5KSCA 4B88A 5J8XA 1EI5A 2HDRA 3IF6B 4OP5A 1KGGA 4S2KA 1NZUA 1U60A 1GHPA 1C3BA 1GHMA 2X71A 1XGJA 4XUZA 3S1YA 3N6IA 5EOOA 4HBTA 1FR6A 4S2LA 5HAPA 5DF8A 4EUZA 3DW0A 2X02A 3FYZA 4X56A 3CMZA 5FQIA 4FH4A 2HPBA 5E2HA 2J7VA 2ZQAA 5CGXA 5I94A 3QNBA 1PI4A 3OPPA 4IBRA 5JYOA 2OLVA 3C4PA 3N7WA 3NCKA 4PM5A 3WRTA 3Q7VA 3SH9A 2ZQ8A 1K57C 3N8RA 4ZJ2A 2HP6A 1XPBA 3HBRA 3WS1A 2ZQCA 2A49A 3SS3A 4JF6A 4GD6A 3ZNTA 3N4IA 2ZC3B 2P9VB 2VGKA 3PBRA 2Y2OA 1H5XA 5TGFA 1QMFA 3NY4A 4OQGA 3VP0A 4FSFA 4S2JA 2RCXA 3BLMA 4DXCA 4DXBA 2I72A 1NRFA 3HLDA 1Q2QA 1VM1A 3VOYA 1IYSA 4OOYA 2BLSA 3UDXA 1YMSA 5GHYA 5EUAA 4E6WA 3P09A 1FSYA 4UA9A 3BFDA 5FASA 4S2OA 1Q2PA 2WGVA 1O07A 1YLWA 3GV9A 1JWZA 1FSWA 2DNSA 5CTNA 3SS5A 5EE8A 5A90A 1SDNA 1MXOA 3EQVA 3BFCA 4GN2A 4KENB 4OLGA 2QPNA 4R4RA 2GDNA 3RXXA 2ZM8A 3OPLA 3SH7A 1BZAA 4DDSA 4Q8IA 2XD5A 2Y91A 3M6HA 4JLFA 4K0WA 1O7EA 3UPNA 1YLZA 5KSHA 5KZHA 2FFFB 2R9WA 3UE1A 3S22A 1KVLA 3E2LA 1Z6FA 3VSLA 4XXRA 2J9PA 5FAPA 1IKGA 2E8IA 3PBQA 1TDGA 3UNWA 1CEFA 4UHUA 3VP3A 4E3OA 1K4EA 2FFYA 5CECA 1XA1A 5CTMA 5EVIB 3ITAA 2WZZA 4KZ3A 4DDYA 3UPOA 2JBFA 3IWIA 3OPHA 3Q7ZA 5D3OA 1HD8A 3VSKA 4N1XA 1XP4A 1IYQA 1ESIA 2Z2LB 4RX3A 1YQSA 3MXSA 4MBHA 3D4FA 3GR2A 3SOIA 3ZVTA 4UA6A 3IF5A 3Q81A 4WEJA 1DY6A 2JC7A 3MZFA 3HLFA 4LV2A 3VOZA 3LCEA 1DJAA 2ZJ9A 2P74A 2ZM2A 5F1FA 4U0XA 2XLNA 4WYYA 3Q1FA 4JF5A 4K91A 3FKWA 3RXWA 5GLAA 3GQZA 3IHAA 4OQHA 4QJGA 3UDIA 1MWRA 3HVFA 4JF4A 5E2EA 1BLCA 4E3LA 4GOGA 3IQAA 3ZG8B 3V39A 1YLTA 2QZ6A 3NBLA 1KGFA 4JBFA 5GHZA 2V1ZA 4C6YA 4KZ7A 3OZHA 4ZJ1A 5KMWA 5FQMA 3HREA 4LENA 3FZCA 1K54A 3IF6C 2XFTA 2DCFA 5CGSA 1YLJA 2PU4A 2Y2QA 4X6TA 1PW1A 2EX6A 4LCLA 5EVID 1I2SA 3Q82A 1K56A 3WRZA 4FH2A 1KE4A 5FQJA 4YINA 2ZMAA 1K55A 3DWKA 1ALQA 3DTMA 3FWLA 1ES3A 2Y55A 2ZC6B 2ZQDA 1BLPA 4KZ9A 4NK3A 2OV5A 3W4PA 4BL2A 2IWCA 1G6AA 3A3DA 1L2SA 5EOEA 3A3EA 2IWBA 1KE0A 1E25A 4MBFA 3OC2A 4GB7A 3V3SA 2C5WB 1NJ4A 3ISGA 4JXWA 3MBZA 1TDLA 5E2GA 3ZG0A 4KG2A 3MZDA 4WMCD 5GLCA 3CG5A 4OLDA 1JTDA 1KVMA 4BD0A 1ES5A 5F83A 1W7FA 1RGYA 3GRJA 4EBPA 4H8RA 4B4XA 1JVJA 1ZC2A 4BENA 4P6BA 1BSGA 3G2ZA 4IEDA 1BLSA 4OOLA 1JTGA 5HW3A 2Y2LA 1ES4A 5FQ9A 1MPLA 1SHVA 2ZC7A 3RJUA 1G68A 5DF7A 3ZFZA 2V20A 4M3KA 4PPRA 1FCMA 3MKEA 4OKPA 1IKIA 1ES2A 4NETA 5HAQA 3GVBA 1K54C 1JWPA 3G35A 2EXAA 1OMEA 2Y2HA 1BUEA 3AGEA 4OONA 5CHJA 1HVBA 5DTTA 2XDMA 4DF6A 1H8ZA 4KZ8A 4A5RA 2OLUA 5DVAA 3CZDA 3TOIA 2ZC4B 5G18A 4DKIA 5HL1A 5EVIA 2Y2PA 1XA7A 3G32A 4LCMA 3UE3A 3EQUA 4R23A 2Y4AA 1GA0A 4KZAA 1H8YA 2WKIA 4K0XA 2VGJA 4F94A 5EECA 1MWSA 5AQBA 3VFFA 3G2YA 3LY3A 1MKIA 4HESA 3HUMA 4X68A 4GD8A 3M2JA 3B3XA 3BFGA 4QB8A 4C75A 2XH9A 4R1GA 3ZG5A 1FR1A 4EWFA 3LY4A 1DJBA 1L0EA 3M2KA 5GL9A 1N4OA 2EXBA 4JKTA 5FI6A 1JWVA 4RX2A 4Y0UA 1IYOA 1YT4A 1S6RA 5CERA 4IBXA 1NY0A 1LI0A 3M6BA 2PBYA 2XEPA 2HDUA 3TSGA 4S2MA 3BFEA 1KGEA 1L0GA 4LV1A 3A3JA 1M6KA 3HLEA 2G2UA 2C6WB 3QHYA 3WWXA 4KQRA 4YFMA 2WZXA 3JYIA 4IVIA 3UN7A 2G2WA 5AQ7A 1CI8A 4DRTA 1HZOA 5CEBA 3OCNA 1CEGA 4P0MA 4EBLA 4BQMA 5A92A 1K55C 4KQOA 1PYYA 4C3QA 3AGFA 3MZEA 4R4SA 4BD1A 4KZ5A 4OPYA 3W8KA 4EQIA 1PW8A 4CPKA 3IXDA 4OOMA 5M19A 3G34A 3Q7VB 1PWCA 1ZG4A 1ZKJA 4ZAMA 2XQZA 1KDWA 1Y54A 2WKHA 2ZC5B 3FKVA 4Z9QA 5GHXA 4WZ5C 2WYXA 4E3MA 1ERQA 1XGIA 4KQQA 1YM1A 1WYCA 2HP5A 1PIOA 1RCJA 1K4FA 1WYBA 4PM8A 5E43A 1W5DA 1ZG6A 1IEMA 5FAQA 4P85A 4WM9A 3UPPA 4R3JA 4FD8A 3GSGA 3QNCA 4PM9A 4DE2A 4WBGA 2UWXA 3HLCA 3IF6A 3MFDA 4KZBA 3IXHA 1WE4A 4MNRA 4ZDXA 4EV4A 5CEDA 4MLLA 1BLHA 3LO7A 2Y2NA 3W4QA 4OPQA 2V2FF 3C4OA 1IELA 2WAFA 3G31A 5FI2A 5EPHA 2Y59A 3GMWA 3S4XA 1DJCA 4JXVA 1LHYA 5DTSA 4GDNA 5A91A 3WS4A 1IYPA 4FCFA 4OPRA 3HUOA 1LL5A 1BTLA 4WEKA 3SS4A 3V5MA 1K6RA 2CC1A 2JCHA 1MWTA 5AQ9A 5L2FA 4MEZA 2JE5A 2Q9MA 4PM7A 1E3UD 1RGZA 3NC8A 3W4OA 4S2PA 3ZDJA 4RVAA 4E3KA 2Z2MB 4U3TA 4ZBEA 4GKUA 1NYMA 3ZVWA 1GCEA 1ONGA 1E3UA 3G4PA 2H0YA 3BM6A 1XX2A 4LV0A 3C7UA 3IH8A 4S2NC 3O3VA 5M18A 3VP2A 5AQAA 2EFXA 5U47A 4WZ4A 4GNUA 5IHVA 2PU2A 4DE3A 3ZG9B 3BECA 3G30A 3ZHHA 4X69A 2HDSA 3HLGA 4L0LA 1VQQA 1ONHA 4E3JA 4X55A 2Y2IA 3BYDA 5CHMA 3MKFA 4RA7A 4OP8A 2WAEA 4OPZA 1PZOA 4BJPA 4N1HA 3IWOA 5GLBA 3PAGA 4S2NA 1QMEA 4N9LA 1I5QA 3C7VA 1XXMA 5CXWA 2WK0A 2ZQ9A 4KZ4A 2Y2GA 3BFFA 3IHBA 2ZQ7A 3VFHA 5EVLA 3E2KA 1YLPA 1LI9A 3PBSA 5HFOA 4OQ0A 3VP4A 4XUXA 3UY6A 4JPMA 1GA9A 1L0DA 3ITBA 3C5AA 4KG5A 1TEMA 2B5RA 2H10A 2OSUA 3DWZA 3WS2A 1EROA 3HUNA 3P98A 4WZ5A 2EX2A 1GHIA 4GZBA 4GDBA 1XKZA 2HP9A 3O88A 2XFSA 4JXSA 4PM6A 3AGDA 3NI9A 1PZPA 5CHUA 2EX9A 4PMAA 1FCOA 5E2FA 2Y2MA 1LL9A 3UO9A 1FOFA 1SKFA 1N9BA 4X53A 1SDEA 4N92A 3OPRA 2ZLYA 5CGWA 2BG1A 1KDSA 2WGWB 2WGWA 5HARA 5F82A 2J8YA 4R0QA 4U0TA 4KG6A 2DRWA 4OVDA 1TVFA 4QY6A 4BL3A 5BOHA 2XD1A 1M40A 5TR7A 2HDQA 4D2OA 4UAAA 3UDFA 2ZD8A 5GLDA 3IH9A 4Y0OA 2RL3A 3WS0A 1CK3A 2WKEA 1PWDA 3ZCZA 5F1GA
chains in the Genus database with same CATH superfamily
4Y7PA 4Y15A 4EBNA 5A93A 4R6LA 3B47A 3V50A 2IA2A 3FG8A 4G3VA 2XK1A 1NZOA 3T4SA 1TS8A 3O87A 5FA7A 1S4RA 4QHCA 1K25A 3PBTA 4ID4A 4S2IA 3MQ0A 2Q9NA 4B4ZA 5CRFA 3HCYA 4HP9A 3N8SA 1TF1A 3BRMA 3VV4A 2ACGA 2V0WA 2X01A 3N8LA 3VE3A 3T4JA 3IWQA 3TE8A 4PKYA 3NDEA 3BLSA 5FATA 2P9VA 2R78A 3A3FA 2JKTM 1MY8A 2Z6CA 3LEZA 1PI5A 1I2WA 4MBKA 3BEBA 1K57A 1ESUA 2W1TB 1UWPX 4QU3A 4IVKA 4QD4A 1K6SA 4OH0A 5IU1A 3IF6B 4OP5A 2JKTI 1Y4OA 1STZA 1C3BA 3N6IA 1G5UA 2NUPC 3BQAA 1VHMA 4HJ3A 3PR6A 2W27A 3DW0A 2X02A 3A0RA 3QP5A 3NOPC 4FH4A 5E2HA 2J7VA 2ZQAA 3C2WA 4IBRA 4PM5A 3C4PA 3WS1A 1LSWA 4KUOA 1CF0A 2QJ7A 4GD6A 3MFXA 5I5LA 4HHDA 2P9VB 5TGFA 1H5XA 2HJEA 4E04A 4S2JA 1Q2QA 1VM1A 2O9BA 1IYSA 3UDXA 1FSYA 4UA9A 5FASA 2WGVA 3GV9A 1FSWA 1JWZA 4NKPA 1MXOA 2E8JA 3DTKA 4GN2A 4OLGA 4R4RA 2GDNA 1BZAA 2EWWA 3QP4A 3M6HA 3UPNA 1O7EA 4ETZA 5KSHA 2R9WA 4GS9B 3UE1A 3S22A 3T50A 1IKGA 3PBQA 1TDGA 3E4OA 3UB8A 4GCZA 1K4EA 5CECA 4DDYA 3CPTB 1XP4A 2Y79A 3ZVTA 1G28A 2QWSA 3IF5A 2D01A 2JC7A 3EGDC 2P74A 5F1FA 3KSHA 2XLNA 4WYYA 1XFNA 4K91A 2QJ5A 2L1MA 5GLAA 4OQHA 4QWOA 4JF4A 1TD5A 5HWTA 3V39A 1NLYA 5HDCA 2V1ZA 1F2KA 4FUWA 4KZ7A 4I5SA 2DCFA 1YLJA 1DP8A 4X6TA 4LCLA 5EVID 2W3GA 3DWKA 3DTMA 4BL2A 1H0MA 2IWCA 2JHEA 4M4XA 1E25A 4MDZA 5KIZA 1UWNX 1JTDA 4BD0A 4K08A 4H6JB 4H8RA 4R3AA 3LIFA 5L09A 1S67L 4BENA 4IEDA 3G2ZA 1XJ2A 4I3JA 1ES4A 5FQ9A 1MPLA 1SHVA 3RJUA 2V20A 4PPRA 3MKEA 2OAQ1 1ES2A 3JPUA 4NETA 5HAQA 4OONA 3AGEA 5CHJA 4A5RA 3CPTA 3MQQA 4LCMA 4G3WA 2Y4AA 3QP8A 1GA0A 4O8GA 4K0XA 2W1RA 4UQIS 4HESA 4GD8A 3M2JA 4QB8A 3G6OA 1L0EA 3M2KA 5GL9A 3H7WA 2EXBA 4RX2A 1A0KA 4NEED 4QPRA 1FIKA 3BJNA 3TSGA 2HDUA 4S2MA 3BFEA 4KQRA 4HOIA 5CEBA 5DFYA 3T4TA 1YKDA 1OTIA 5A92A 1K55C 4XT2B 1OT6A 3MZEA 4KZ5A 4OPYA 5TBMB 4OOMA 1ZG4A 5GHXA 3FKVA 4E3MA 1XGIA 5TBMA 1YM1A 1WYBA 4PM8A 2M7UA 5FAQA 3NECA 4YNRA 4WM9A 3CITA 3GSGA 3QNCA 2K31A 4PM9A 2VZWA 5CEDA 4IUKA 4MLLA 1BLHA 3UMDA 3LO7A 4NXFA 4OPQA 2NUTC 3G31A 2EWVA 3KO6A 2Y59A 2VEAA 1YSQA 3S4XA 5C5KA 1KOUA 2W1TA 3KYEA 4FCFA 3HUOA 4WEKA 3V5MA 4WL9A 1VB6A 3L9KA 2XSSA 1E3UD 1RGZA 5AJGA 4E3KA 4R38A 3GECA 3OBFA 4ZBEA 1NYMA 1ONGA 4UEYA 1E3UA 4EQ1A 5G4ZA 3BM6A 3O3VA 3LR5A 1D06A 4HJ4A 5AQAA 2DMWA 5U47A 2JKRM 2PU2A 4DE3A 3EOIA 4E3JA 4LRXC 4X55A 2Y2IA 3BYDA 5CHMA 4OPZA 2PD8A 1XXMA 2ZQ9A 2KX6A 5HFOA 3UY6A 1L0DA 4KG5A 1CJFA 2H10A 3DWZA 1W63M 4LFUA 4GZBA 3O88A 3AGDA 3NI9A 4PMAA 2JKFA 2Y2MA 3UO9A 1FOFA 1N9BA 2OWHA 1SDEA 2ZLYA 2J3TC 3BQ8A 3H82B 2B18A 3R4KA 2WGWB 3T1QB 4U0TA 5TR7A 4UAAA 5GLDA 5AVEA 1HLUP 1VEUA 3S7PA 1PWDA 3ZCZA 3IX8A 2A3UA 4JGOA 5HX9A 2XR0A 3V3RA 3IXGA 1BT5A 3T12B 4DE0A 4R3BA 1K56D 1ERMA 4I38A 1J9MA 5L10A 1F98A 5EVIC 1MBLA 1P9RA 3CUEA 3OLOA 4OQIA 5FQQA 4E3NA 1L0FA 3NIAA 2XF3A 3S7QA 1P0ZA 2J9OA 3VMAA 2H0TA 1W79A 3CHWP 4Y0TA 4WELA 5FDHA 3UE0A 4GLQA 5J4EA 5EFWA 1SCWA 4RYEA 4DN0A 4UA7A 4WF0A 3P01A 3T4LA 1W8QA 2QYBA 2WADA 5CX7A 1P97A 3OCLA 4E6XA 1NRJA 1IFQA 1K38A 4B88A 2J3TD 5J8XA 3S7NA 1EI5A 4HI4A 1KGGA 4II7A 4P6ZM 1F9IA 1AWIA 4JGPA 4XUZA 3S1YA 1GHMA 1XGJA 2JKGA 3LR0A 4S2LA 5HAPA 5A8BA 3FYZA 4D60A 5HD3A 2HPBA 3C38A 3CAXA 2YKFA 3QNBA 3OPPA 2ZMVA 3WRTA 3Q7VA 1PRQA 1K57C 2ZQ8A 3N8RA 4ZJ2A 3HBRA 1XPBA 3DBAA 3DTIA 4JF6A 1J3WA 3ZNTA 4DJ3A 2Y2OA 1D7EA 3NY4A 4FSFA 2RCXA 3BLMA 4ARZB 4B9OA 2BLSA 5HPFA 2V9AA 5EUAA 3BFDA 2PDRA 1O07A 5CTNA 3SS5A 2DNSA 1SDNA 2ZBBA 2QPNA 3RXXA 3LR4A 3B33A 4DJ2A 3E2LA 3MF0A 1Z6FA 2J9PA 5J7EA 1UGUA 2E8IA 1ACFA 3A0SA 5HZHA 4UHUA 3UB7A 3EWKA 2FFYA 1XA1A 5EVIB 2WZZA 4KZ3A 1ODVA 2PYPA 3NHQA 3OPHA 3UPOA 3Q7ZA 5HWWA 3VSKA 4N1XA 1ESIA 4MBHA 3F1OA 3D4FA 3SOIA 4UA6A 1FILA 4CLCA 3FKWA 3RXWA 3IBRA 4MN7A 1MWRA 3HVFA 2MJ6A 1BLCA 4E3LA 3LGOA 1N9LA 2INWA 3ZG8B 1YLTA 4JBFA 2PD7A 3OZHA 2PAVP 4L9FA 2Y2QA 1I2SA 1K56A 5FQJA 5FEGA 3FWLA 2L0WA 5A90A 3W4PA 2OV5A 3CUEC 3A3DA 5EOEA 3A3EA 1V9ZA 2C5WB 1NJ4A 3OOVA 1OPXA 3MBZA 1TDLA 3K3CA 1KVMA 3LFVA 5F83A 3KYZA 2QKPA 4EBPA 4FTXA 1JVJA 1ZC2A 4P6BA 4Z1WA 2Y2LA 1G68A 4M3KA 2O99A 3G35A 1OMEA 1BUEA 1HVBA 4DF6A 4LRYC 5HDDA 3HJIA 4L9GA 3TOIA 2ZC4B 4DKIA 5EVIA 1XA7A 3G32A 3EQUA 1DP6A 4KZAA 1H8YA 2VGJA 4F94A 5EECA 5AQBA 2V8CA 3B3XA 4R1GA 3ZG5A 4EWFA 4GW9A 5FI6A 4Y0UA 1IOUA 3K3DA 5FL3A 5CERA 4IBXA 1NY0A 4EXOA 2XEPA 4UQIM 3A3JA 1M6KA 2P7JA 3WWXA 3TW8A 3UN7A 1HZOA 1TS6A 1CEGA 2Y8HA 4P0MA 4EBLA 4EU0A 1CQAA 3KSGA 4C3QA 3LIEA 2W0NA 1V9YA 2V1AA 4EQIA 1PW8A 5HPIA 4B93A 5M19A 3G34A 3Q7VB 1PWCA 1ZKJA 1KDWA 2XQZA 4Z9QA 3V67A 2WYXA 1RCJA 1K4FA 4XT2A 1ZG6A 4FD8A 3ZQ5A 1SZVA 4WBGA 2UWXA 3UMEA 1DRMA 4MNRA 4ZDXA 1H8MA 4CLCE 5EPHA 4HJ6A 1T19A 3KYQA 3D72A 3T1SA 5DTSA 4GDNA 5A91A 2ZOHA 1S1YA 1IYPA 4YOFA 2CC1A 5L2FA 4MEZA 2JE5A 4PM7A 2W3DA 5F5YA 3NC8A 4S2PA 4RVAA 2Z2MB 4U3TA 4GKUA 3ZVWA 5F68A 1XX2A 2HJ9C 3C7UA 3F1PA 2B95A 3F1NB 2XROA 1GSXA 4GNUA 3IX3A 3GDIA 3G30A 2VK3A 3ZHHA 4X69A 2LB9A 3LI8A 3MKFA 4RA7A 4OP8A 2WAEA 4N1HA 5GLBA 1QMEA 2PR6A 1EW0A 4N9LA 3C7VA 3SZTA 4Y5FA 2OWJA 5LBRA 5EVLA 1YLPA 1LI9A 1T1AA 3PBSA 3EEAA 3VP4A 4XUXA 3HUNA 2EX2A 2LB5A 2B02A 5IT5A 1YSPA 2GJ3A 1NLZA 1LL9A 2OOLA 1ZHHB 2ZL1A 5CGWA 2FZ0A 2M7VA 1X0OA 1PFLA 3H82A 1TVFA 4BL3A 4EW7A 5BOHA 1M40A 2ZL1B 4ZRRA 3IH9A 3WS0A 2WKEA 2VLGA 2J3WA 4LV3A 1CI9A 3RFBA 4E3IA 2GZAA 3PAEA 2IWDA 2Y2KA 5FAOA 1YMXA 2R9XA 1G6OA 3HLBA 3ZNYA 2ZM0A 1DP9A 2XGNA 2VJWA 2QMIA 3PYPA 3R7WB 1W8YA 2VV8A 2VKSA 3P7NA 4KZ6A 2UV0E 1P9WA 1E4DA 1MKMA 3PBOA 3E4QA 2WKQA 4HEFA 3Q07A 5DFXA 5L07A 2GNXA 2FH5A 4BBUA 3IT9A 4GHIB 3SH8A 2HGVA 4QY5A 4DE1A 4G3KA 2P04A 1PWGA 3MXQA 3JVVA 2VV7A 3UB9A 4BWIA 2H28A 2EX8A 3IX4A 1KE3A 1MWUA 3HJKA 1LSVA 2JKRI 5JYPA 2XRNA 3MR0A 3IXBA 3ZG7B 2WUQA 4P87A 3QP6A 3VP1A 4EUVA 3IS2A 1LLBA 3MJQA 2HDRA 4S2KA 4WLAA 1U60A 1OTAA 1GHPA 2X71A 3O5YA 4HY8A 4GJ4A 1N9NA 4PHTA 2P08A 3LIAA 4HBTA 5EM0A 5AVFA 3KX0X 5CGXA 2OLVA 3PHYA 5EV0A 3SH9A 5EVEA 2A49A 3DAVA 4AFIA 3A0VA 3PBRA 3VP0A 1QMFA 4OQGA 4DXCA 4DXBA 2O9CA 1F5MA 3HLDA 3VOYA 4NXEA 3T1RA 5GHYA 3BWLA 3P09A 4S2OA 1Q2PA 1YLWA 5EE8A 1T1CA 3BFCA 4DMZA 1OTEA 3OPLA 3SH7A 2Y91A 2V1BA 4K0WA 1YLZA 5KZHA 3SW1A 1KVLA 3VSLA 4XXRA 3T1XA 1L3LA 3K2NA 4ESPA 4WN5A 3UNWA 1CEFA 1K0KA 3ITAA 2JBFA 5D3OA 2YKHA 1LT0A 2Z2LB 1YQSA 3GR2A 2PT7A 2Q0OA 3Q81A 4WEJA 1DY6A 3MZFA 2J80A 3HLFA 3LCEA 2ZJ9A 2ZM2A 4ETXA 2HZ5A 3GQZA 2O0YA 4GOGA 3IQAA 3LIDA 2QZ6A 5GHZA 1KGFA 3U4LP 4NXGA 5KMWA 5FQMA 3HREA 3DTEA 1GSVA 1PW1A 2EX6A 3CI6A 1LL8A 4LPZA 3PXPA 4EEPA 4FH2A 4YINA 3JVUA 4O01A 3T4KA 1ES3A 1BLPA 3UE6A 4PKYG 2M1CA 1KE0A 3OC2A 2D02A 4JXWA 4KG2A 3MZDA 1ZTUA 4WMCD 5GLCA 3CG5A 2W3HA 4X1LA 1RGYA 5DJTA 3UB5P 4ME4A 4B4XA 1BSGA 2VGLS 3LEQA 5HW3A 2ZC7A 3VOLA 3ZFZA 1FCMA 4OKPA 2ZMFA 3GVBA 1K54C 2Y2HA 3F1OB 2XDMA 1H8ZA 2Z6DA 4KZ8A 2OLUA 3CLOA 5DVAA 3CZDA 2Y2PA 4JGRA 3UE3A 4R23A 4BBVA 2W3EA 4I3IA 3MMHA 3VFFA 3G2YA 3LY3A 1MKIA 4GS9A 2XH9A 4LGWA 4JKTA 1JWVA 1IYOA 1YT4A 1S6RA 5K5BA 3FPWA 1LI0A 3M6BA 2PBYA 3W2ZA 4RQ9A 3HLEA 1OTDA 2WZXA 3JYIA 4IVIA 2G2WA 2KLIA 5F6AA 4CQHA 4KQOA 1PYYA 4CPKA 4ZAMA 5HL1A 2WKHA 4WZ5C 1ERQA 4KQQA 1WYCA 3T4OA 1PIOA 4HIAA 4JGQA 2WKRA 3UPPA 4R3JA 4DE2A 3HLCA 3IF6A 3MFDA 3IXHA 1WE4A 2Y2NA 3IS2B 1N9OA 5FI2A 4EESA 4JXVA 1DJCA 1VETB 1LHYA 1OTBA 3WS4A 2G7UA 3SS4A 2JCHA 5AQ9A 2Q9MA 2V0UA 3W4OA 3ZDJA 5HSQA 1GCEA 5IS1A 2H0YA 2AVXA 3IH8A 2XA7M 5M18A 2CMNA 4LRZE 4Q0JA 3KSFA 4L9EA 2A24B 3QP1A 2VV6A 3IWOA 3PAGA 5CXWA 4H6JA 2WK0A 4KZ4A 3BFFA 2GX5A 3IHBA 2ZQ7A 4OQ0A 4NG2A 4JPMA 1GA9A 4KQDA 1PNEA 3ITBA 3C5AA 5HL6A 4IJGA 5FEFA 3C8CA 1JNUA 1GHIA 1XKZA 2HP9A 2V8FA 2XFSA 4JXSA 4KUKA 4P6ZS 5CHUA 2EX9A 5FDSA 2BG1A 4Y13A 2K2NA 5F82A 4R0QA 2DRWA 4OVDA 2XD1A 2HDQA 4D2OA 2O9AA 2ZD8A 3IBJA 4Y0OA 1CK3A 4PAUA 3LUQA 4CLCB 5HAIA 5M1AA 3PTEA 5TFQA 1S0WA 4HBUA 5FSRA 3LI9A 3E98A 3I7JA 2BTFP 1SKOA 1NXYA 1T18A 3CJMA 4JXGA 5DTKA 3S7OA 4Y3IA 1S1ZA 3KSIA 2PBDP 3A3IA 2WKPA 3LIBA 3TRCA 4N9KA 3PBNA 1FCNA 3WS5A 1FQGA 1NYYA 3QP2A 3MQOA 3NJAA 3FV7A 3NDGA 3TG9A 3F1NA 1YLYA 4WMCA 3HL9A 1EWZA 1BULA 5FQKA 4ZJ3A 2W3FA 5FI7A 3GTCA 2WGIA 2PRFA 2PYRA 3ZGAB 5HDSA 4CLCD 1HTZA 1RP5A 3HLWA 4CJNA 5DF9A 2H5SA 3O86A 2EFUA 4O7DA 1VETA 3MXRA 2Y2JA 4ZTKA 5HWVA 1AXBA 5KSCA 4BLMA 1TS7A 5DKLA 4MCWA 4O0PA 4LLOB 1NZUA 1D1JA 3NULA 4MMNA 3H9WA 5EOOA 1BYWA 1FR6A 3D9YA 4HH3A 5J3WA 5DF8A 2HF6A 4EUZA 4X56A 3CMZA 1YPRA 5FQIA 5I94A 1PI4A 5JYOA 3N7WA 3NCKA 5G4YA 2HP6A 2ZQCA 3SS3A 3N4IA 2ZC3B 2VGKA 4HP4A 1Z09A 2I72A 1NRFA 3U2AA 4OOYA 2A2LA 1YMSA 4E6WA 4YWZA 1S4SA 3EQVA 4KENB 3RH8B 3H7WB 2ZM8A 3E4PA 4DDSA 4Q8IA 2XD5A 4JLFA 2FFFB 4X1MA 4BBTA 4EERA 2BASA 5FAPA 3E0YA 3BY8A 3VP3A 4E3OA 3LICA 2HV1A 5CTMA 3LYXA 4X25A 3IWIA 1HD8A 1IYQA 4RX3A 3MXSA 3UB6A 1LSXA 3ULFA 4LV2A 3VOZA 1DJAA 4U0XA 3Q1FA 4JF5A 3IHAA 4QJGA 2K7SA 3UDIA 5E2EA 5DJUA 3NBLA 4C6YA 4ZJ1A 4FOFA 4LENA 3FZCA 1K54A 2KDKA 4CLCC 3IF6C 2XFTA 5CGSA 2PU4A 2VA0A 2I9VA 3Q82A 3WRZA 1KE4A 2ZMAA 1K55A 1ALQA 2Y55A 2ZC6B 2ZQDA 4KZ9A 4NK3A 1G6AA 2ZOIA 1L2SA 4I39A 5F69A 3D3OA 2IWBA 4MBFA 4GB7A 3V3SA 3ISGA 5E2GA 3ZG0A 5EM1A 4OLDA 2QHKA 1ES5A 3FC7A 1W7FA 3GRJA 5TJJA 4F3LB 1BLSA 4OOLA 1JTGA 2A24A 5DF7A 2XA7S 1IKIA 3EEHA 1MZUA 1JWPA 2EXAA 4Y17A 1MC0A 3F1PB 5DTTA 2PHYA 2KOIA 5G18A 3ZYTA 1T1BA 3MS6A 2WKIA 1GSWA 3NOTC 1MWSA 3HUMA 4X68A 4C75A 1FR1A 3LY4A 1DJBA 4HNBA 1N4OA 3NOUC 4Q0IA 4EEUA 3MSHA 2VX8A 3B42A 1KGEA 1L0GA 4LV1A 2G2UA 2C6WB 3QHYA 2EA9A 4YFMA 1XJ4A 4ARZA 5AQ7A 1CI8A 4DRTA 5L8MA 3OCNA 4BQMA 2OAP1 3AGFA 4R4SA 4BD1A 3W8KA 3BW6A 1W63Q 3IXDA 2L4RA 4WUJA 3VE4A 1Y54A 2ZC5B 3ICYA 1Y28A 5MC7A 1XJ6A 2HP5A 5E43A 1W5DA 4NXBA 1IEMA 5HD5A 4P85A 1OJ5A 4KZBA 4MN6A 4EV4A 3T4QA 3W4QA 2V2FF 1YAXA 3C4OA 1IELA 2WAFA 1NWZA 3GMWA 1XJ3A 4EETB 4OPRA 1LL5A 1BTLA 1K6RA 3BY9A 1MWTA 4IUHA 3G4PA 4LV0A 4Q0HA 4S2NC 4GHIA 3C30A 3VP2A 4R70A 2EFXA 3LR3A 3RTYA 4MN5A 4WZ4A 5IHVA 3ZG9B 3BECA 3L7HA 4I3AA 2HDSA 3HLGA 4L0LA 1VQQA 1ONHA 4IHQA 4BJPA 1PZOA 1OT9A 4F3LA 4S2NA 1XFQA 1I5QA 1OJGA 2Y2GA 3R7WA 3VFHA 1S66L 3E2KA 1TS0A 2VGLM 1TEMA 2B5RA 4Y2FA 2OSUA 4HQAA 3WS2A 1EROA 3P98A 4HH2A 4WZ5A 5DKKA 1SKOB 4GDBA 4PM6A 1PZPA 1H3QA 1FCOA 5E2FA 1WA9A 2JN7A 3TJZC 3FPVA 1VEUB 1SKFA 4X53A 4N92A 3CWFA 3OPRA 2PR5A 1KDSA 2WGWA 3EGXC 5HARA 2J8YA 4KG6A 4QY6A 3UDFA 2RL3A 3BFGA 4BMWA 5F1GA
chains in the Genus database with same CATH topology
4E3IA 4LV3A 1CI9A 4Y7PA 2A3UA 3PAEA 5HAIA 4EBNA 2IWDA 5A93A 2Y2KA 5HX9A 2XR0A 3PTEA 5M1AA 5FAOA 5TFQA 1S0WA 4HBUA 3V50A 3V3RA 5FSRA 3IXGA 1YMXA 1BT5A 3I7JA 2XK1A 1NZOA 1NXYA 2R9XA 3CJMA 4DE0A 4R3BA 4JXGA 5DTKA 1K56D 1ERMA 3HLBA 3O87A 5FA7A 3ZNYA 1J9MA 2ZM0A 2XGNA 4QHCA 5EVIC 1MBLA 1K25A 2QMIA 3PBTA 4ID4A 4S2IA 4OQIA 5FQQA 4E3NA 1L0FA 1W8YA 2XF3A 3NIAA 3A3IA 2Q9NA 4B4ZA 5CRFA 2J9OA 4N9KA 3PBNA 1FCNA 2H0TA 3VMAA 1W79A 3WS5A 4KZ6A 3N8SA 1FQGA 3BRMA 1E4DA 3PBOA 1NYYA 4Y0TA 4WELA 5FDHA 4HEFA 3UE0A 3Q07A 3FV7A 2X01A 3N8LA 3NDGA 3TG9A 1SCWA 4RYEA 1YLYA 4WMCA 3HL9A 3IWQA 3IT9A 1EWZA 1BULA 4UA7A 5FQKA 4ZJ3A 3NDEA 3BLSA 5FATA 3SH8A 5FI7A 4QY5A 4DE1A 2P9VA 3GTCA 1PWGA 2WGIA 1W8QA 3A3FA 1MY8A 2EX8A 3ZGAB 3LEZA 1KE3A 1MWUA 1HTZA 1PI5A 2WADA 1RP5A 1I2WA 3HLWA 3OCLA 4MBKA 5JYPA 4CJNA 3BEBA 1K57A 5DF9A 1ESUA 2H5SA 3IXBA 3ZG7B 2WUQA 4E6XA 3O86A 2EFUA 4P87A 4QU3A 4O7DA 4IVKA 3MXRA 2Y2JA 4QD4A 1K6SA 3VP1A 1K38A 4ZTKA 1LLBA 1AXBA 4OH0A 4BLMA 5KSCA 4B88A 5J8XA 1EI5A 2HDRA 3IF6B 4OP5A 1KGGA 4S2KA 1NZUA 1U60A 1GHPA 1C3BA 1GHMA 2X71A 1XGJA 4XUZA 3S1YA 3N6IA 5EOOA 4HBTA 1FR6A 4S2LA 5HAPA 5DF8A 4EUZA 3DW0A 2X02A 3FYZA 4X56A 3CMZA 5FQIA 4FH4A 2HPBA 5E2HA 2J7VA 2ZQAA 5CGXA 5I94A 3QNBA 1PI4A 3OPPA 4IBRA 5JYOA 2OLVA 3C4PA 3N7WA 3NCKA 4PM5A 3WRTA 3Q7VA 3SH9A 2ZQ8A 1K57C 3N8RA 4ZJ2A 2HP6A 1XPBA 3HBRA 3WS1A 2ZQCA 2A49A 3SS3A 4JF6A 4GD6A 3ZNTA 3N4IA 2ZC3B 2P9VB 2VGKA 3PBRA 2Y2OA 1H5XA 5TGFA 1QMFA 3NY4A 4OQGA 3VP0A 4FSFA 4S2JA 2RCXA 3BLMA 4DXCA 4DXBA 2I72A 1NRFA 3HLDA 1Q2QA 1VM1A 3VOYA 1IYSA 4OOYA 2BLSA 3UDXA 1YMSA 5GHYA 5EUAA 4E6WA 3P09A 1FSYA 4UA9A 3BFDA 5FASA 4S2OA 1Q2PA 2WGVA 1O07A 1YLWA 3GV9A 1JWZA 1FSWA 2DNSA 5CTNA 3SS5A 5EE8A 5A90A 1SDNA 1MXOA 3EQVA 3BFCA 4GN2A 4KENB 4OLGA 2QPNA 4R4RA 2GDNA 3RXXA 2ZM8A 3OPLA 3SH7A 1BZAA 4DDSA 4Q8IA 2XD5A 2Y91A 3M6HA 4JLFA 4K0WA 1O7EA 3UPNA 1YLZA 5KSHA 5KZHA 2FFFB 2R9WA 3UE1A 3S22A 1KVLA 3E2LA 1Z6FA 3VSLA 4XXRA 2J9PA 5FAPA 1IKGA 2E8IA 3PBQA 1TDGA 3UNWA 1CEFA 4UHUA 3VP3A 4E3OA 1K4EA 2FFYA 5CECA 1XA1A 5CTMA 5EVIB 3ITAA 2WZZA 4KZ3A 4DDYA 3UPOA 2JBFA 3IWIA 3OPHA 3Q7ZA 5D3OA 1HD8A 3VSKA 4N1XA 1XP4A 1IYQA 1ESIA 2Z2LB 4RX3A 1YQSA 3MXSA 4MBHA 3D4FA 3GR2A 3SOIA 3ZVTA 4UA6A 3IF5A 3Q81A 4WEJA 1DY6A 2JC7A 3MZFA 3HLFA 4LV2A 3VOZA 3LCEA 1DJAA 2ZJ9A 2P74A 2ZM2A 5F1FA 4U0XA 2XLNA 4WYYA 3Q1FA 4JF5A 4K91A 3FKWA 3RXWA 5GLAA 3GQZA 3IHAA 4OQHA 4QJGA 3UDIA 1MWRA 3HVFA 4JF4A 5E2EA 1BLCA 4E3LA 4GOGA 3IQAA 3ZG8B 3V39A 1YLTA 2QZ6A 3NBLA 1KGFA 4JBFA 5GHZA 2V1ZA 4C6YA 4KZ7A 3OZHA 4ZJ1A 5KMWA 5FQMA 3HREA 4LENA 3FZCA 1K54A 3IF6C 2XFTA 2DCFA 5CGSA 1YLJA 2PU4A 2Y2QA 4X6TA 1PW1A 2EX6A 4LCLA 5EVID 1I2SA 3Q82A 1K56A 3WRZA 4FH2A 1KE4A 5FQJA 4YINA 2ZMAA 1K55A 3DWKA 1ALQA 3DTMA 3FWLA 1ES3A 2Y55A 2ZC6B 2ZQDA 1BLPA 4KZ9A 4NK3A 2OV5A 3W4PA 4BL2A 2IWCA 1G6AA 3A3DA 1L2SA 5EOEA 3A3EA 2IWBA 1KE0A 1E25A 4MBFA 3OC2A 4GB7A 3V3SA 2C5WB 1NJ4A 3ISGA 4JXWA 3MBZA 1TDLA 5E2GA 3ZG0A 4KG2A 3MZDA 4WMCD 5GLCA 3CG5A 4OLDA 1JTDA 1KVMA 4BD0A 1ES5A 5F83A 1W7FA 1RGYA 3GRJA 4EBPA 4H8RA 4B4XA 1JVJA 1ZC2A 4BENA 4P6BA 1BSGA 3G2ZA 4IEDA 1BLSA 4OOLA 1JTGA 5HW3A 2Y2LA 1ES4A 5FQ9A 1MPLA 1SHVA 2ZC7A 3RJUA 1G68A 5DF7A 3ZFZA 2V20A 4M3KA 4PPRA 1FCMA 3MKEA 4OKPA 1IKIA 1ES2A 4NETA 5HAQA 3GVBA 1K54C 1JWPA 3G35A 2EXAA 1OMEA 2Y2HA 1BUEA 3AGEA 4OONA 5CHJA 1HVBA 5DTTA 2XDMA 4DF6A 1H8ZA 4KZ8A 4A5RA 2OLUA 5DVAA 3CZDA 3TOIA 2ZC4B 5G18A 4DKIA 5HL1A 5EVIA 2Y2PA 1XA7A 3G32A 4LCMA 3UE3A 3EQUA 4R23A 2Y4AA 1GA0A 4KZAA 1H8YA 2WKIA 4K0XA 2VGJA 4F94A 5EECA 1MWSA 5AQBA 3VFFA 3G2YA 3LY3A 1MKIA 4HESA 3HUMA 4X68A 4GD8A 3M2JA 3B3XA 3BFGA 4QB8A 4C75A 2XH9A 4R1GA 3ZG5A 1FR1A 4EWFA 3LY4A 1DJBA 1L0EA 3M2KA 5GL9A 1N4OA 2EXBA 4JKTA 5FI6A 1JWVA 4RX2A 4Y0UA 1IYOA 1YT4A 1S6RA 5CERA 4IBXA 1NY0A 1LI0A 3M6BA 2PBYA 2XEPA 2HDUA 3TSGA 4S2MA 3BFEA 1KGEA 1L0GA 4LV1A 3A3JA 1M6KA 3HLEA 2G2UA 2C6WB 3QHYA 3WWXA 4KQRA 4YFMA 2WZXA 3JYIA 4IVIA 3UN7A 2G2WA 5AQ7A 1CI8A 4DRTA 1HZOA 5CEBA 3OCNA 1CEGA 4P0MA 4EBLA 4BQMA 5A92A 1K55C 4KQOA 1PYYA 4C3QA 3AGFA 3MZEA 4R4SA 4BD1A 4KZ5A 4OPYA 3W8KA 4EQIA 1PW8A 4CPKA 3IXDA 4OOMA 5M19A 3G34A 3Q7VB 1PWCA 1ZG4A 1ZKJA 4ZAMA 2XQZA 1KDWA 1Y54A 2WKHA 2ZC5B 3FKVA 4Z9QA 5GHXA 4WZ5C 2WYXA 4E3MA 1ERQA 1XGIA 4KQQA 1YM1A 1WYCA 2HP5A 1PIOA 1RCJA 1K4FA 1WYBA 4PM8A 5E43A 1W5DA 1ZG6A 1IEMA 5FAQA 4P85A 4WM9A 3UPPA 4R3JA 4FD8A 3GSGA 3QNCA 4PM9A 4DE2A 4WBGA 2UWXA 3HLCA 3IF6A 3MFDA 4KZBA 3IXHA 1WE4A 4MNRA 4ZDXA 4EV4A 5CEDA 4MLLA 1BLHA 3LO7A 2Y2NA 3W4QA 4OPQA 2V2FF 3C4OA 1IELA 2WAFA 3G31A 5FI2A 5EPHA 2Y59A 3GMWA 3S4XA 1DJCA 4JXVA 1LHYA 5DTSA 4GDNA 5A91A 3WS4A 1IYPA 4FCFA 4OPRA 3HUOA 1LL5A 1BTLA 4WEKA 3SS4A 3V5MA 1K6RA 2CC1A 2JCHA 1MWTA 5AQ9A 5L2FA 4MEZA 2JE5A 2Q9MA 4PM7A 1E3UD 1RGZA 3NC8A 3W4OA 4S2PA 3ZDJA 4RVAA 4E3KA 2Z2MB 4U3TA 4ZBEA 4GKUA 1NYMA 3ZVWA 1GCEA 1ONGA 1E3UA 3G4PA 2H0YA 3BM6A 1XX2A 4LV0A 3C7UA 3IH8A 4S2NC 3O3VA 5M18A 3VP2A 5AQAA 2EFXA 5U47A 4WZ4A 4GNUA 5IHVA 2PU2A 4DE3A 3ZG9B 3BECA 3G30A 3ZHHA 4X69A 2HDSA 3HLGA 4L0LA 1VQQA 1ONHA 4E3JA 4X55A 2Y2IA 3BYDA 5CHMA 3MKFA 4RA7A 4OP8A 2WAEA 4OPZA 1PZOA 4BJPA 4N1HA 3IWOA 5GLBA 3PAGA 4S2NA 1QMEA 4N9LA 1I5QA 3C7VA 1XXMA 5CXWA 2WK0A 2ZQ9A 4KZ4A 2Y2GA 3BFFA 3IHBA 2ZQ7A 3VFHA 5EVLA 3E2KA 1YLPA 1LI9A 3PBSA 5HFOA 4OQ0A 3VP4A 4XUXA 3UY6A 4JPMA 1GA9A 1L0DA 3ITBA 3C5AA 4KG5A 1TEMA 2B5RA 2H10A 2OSUA 3DWZA 3WS2A 1EROA 3HUNA 3P98A 4WZ5A 2EX2A 1GHIA 4GZBA 4GDBA 1XKZA 2HP9A 3O88A 2XFSA 4JXSA 4PM6A 3AGDA 3NI9A 1PZPA 5CHUA 2EX9A 4PMAA 1FCOA 5E2FA 2Y2MA 1LL9A 3UO9A 1FOFA 1SKFA 1N9BA 4X53A 1SDEA 4N92A 3OPRA 2ZLYA 5CGWA 2BG1A 1KDSA 2WGWB 2WGWA 5HARA 5F82A 2J8YA 4R0QA 4U0TA 4KG6A 2DRWA 4OVDA 1TVFA 4QY6A 4BL3A 5BOHA 2XD1A 1M40A 5TR7A 2HDQA 4D2OA 4UAAA 3UDFA 2ZD8A 5GLDA 3IH9A 4Y0OA 2RL3A 3WS0A 1CK3A 2WKEA 1PWDA 3ZCZA 5F1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3I A;  4LV3 A;  1CI9 A;  4Y7P A;  2A3U A;  3PAE A;  5HAI A;  4EBN A;  2IWD A;  5A93 A;  2Y2K A;  5HX9 A;  2XR0 A;  3PTE A;  5M1A A;  5FAO A;  5TFQ A;  1S0W A;  4HBU A;  3V50 A;  3V3R A;  5FSR A;  3IXG A;  1YMX A;  1BT5 A;  3I7J A;  2XK1 A;  1NZO A;  1NXY A;  2R9X A;  3CJM A;  4DE0 A;  4R3B A;  4JXG A;  5DTK A;  1K56 D;  1ERM A;  3HLB A;  3O87 A;  5FA7 A;  3ZNY A;  1J9M A;  2ZM0 A;  2XGN A;  4QHC A;  5EVI C;  1MBL A;  1K25 A;  2QMI A;  3PBT A;  4ID4 A;  4S2I A;  4OQI A;  5FQQ A;  4E3N A;  1L0F A;  1W8Y A;  2XF3 A;  3NIA A;  3A3I A;  2Q9N A;  4B4Z A;  5CRF A;  2J9O A;  4N9K A;  3PBN A;  1FCN A;  2H0T A;  3VMA A;  1W79 A;  3WS5 A;  4KZ6 A;  3N8S A;  1FQG A;  3BRM A;  1E4D A;  3PBO A;  1NYY A;  4Y0T A;  4WEL A;  5FDH A;  4HEF A;  3UE0 A;  3Q07 A;  3FV7 A;  2X01 A;  3N8L A;  3NDG A;  3TG9 A;  1SCW A;  4RYE A;  1YLY A;  4WMC A;  3HL9 A;  3IWQ A;  3IT9 A;  1EWZ A;  1BUL A;  4UA7 A;  5FQK A;  4ZJ3 A;  3NDE A;  3BLS A;  5FAT A;  3SH8 A;  5FI7 A;  4QY5 A;  4DE1 A;  2P9V A;  3GTC A;  1PWG A;  2WGI A;  1W8Q A;  3A3F A;  1MY8 A;  2EX8 A;  3ZGA B;  3LEZ A;  1KE3 A;  1MWU A;  1HTZ A;  1PI5 A;  2WAD A;  1RP5 A;  1I2W A;  3HLW A;  3OCL A;  4MBK A;  5JYP A;  4CJN A;  3BEB A;  1K57 A;  5DF9 A;  1ESU A;  2H5S A;  3IXB A;  3ZG7 B;  2WUQ A;  4E6X A;  3O86 A;  2EFU A;  4P87 A;  4QU3 A;  4O7D A;  4IVK A;  3MXR A;  2Y2J A;  4QD4 A;  1K6S A;  3VP1 A;  1K38 A;  4ZTK A;  1LLB A;  1AXB A;  4OH0 A;  4BLM A;  5KSC A;  4B88 A;  5J8X A;  1EI5 A;  2HDR A;  3IF6 B;  4OP5 A;  1KGG A;  4S2K A;  1NZU A;  1U60 A;  1GHP A;  1C3B A;  1GHM A;  2X71 A;  1XGJ A;  4XUZ A;  3S1Y A;  3N6I A;  5EOO A;  4HBT A;  1FR6 A;  4S2L A;  5HAP A;  5DF8 A;  4EUZ A;  3DW0 A;  2X02 A;  3FYZ A;  4X56 A;  3CMZ A;  5FQI A;  4FH4 A;  2HPB A;  5E2H A;  2J7V A;  2ZQA A;  5CGX A;  5I94 A;  3QNB A;  1PI4 A;  3OPP A;  4IBR A;  5JYO A;  2OLV A;  3C4P A;  3N7W A;  3NCK A;  4PM5 A;  3WRT A;  3Q7V A;  3SH9 A;  2ZQ8 A;  1K57 C;  3N8R A;  4ZJ2 A;  2HP6 A;  1XPB A;  3HBR A;  3WS1 A;  2ZQC A;  2A49 A;  3SS3 A;  4JF6 A;  4GD6 A;  3ZNT A;  3N4I A;  2ZC3 B;  2P9V B;  2VGK A;  3PBR A;  2Y2O A;  1H5X A;  5TGF A;  1QMF A;  3NY4 A;  4OQG A;  3VP0 A;  4FSF A;  4S2J A;  2RCX A;  3BLM A;  4DXC A;  4DXB A;  2I72 A;  1NRF A;  3HLD A;  1Q2Q A;  1VM1 A;  3VOY A;  1IYS A;  4OOY A;  2BLS A;  3UDX A;  1YMS A;  5GHY A;  5EUA A;  4E6W A;  3P09 A;  1FSY A;  4UA9 A;  3BFD A;  5FAS A;  4S2O A;  1Q2P A;  2WGV A;  1O07 A;  1YLW A;  3GV9 A;  1JWZ A;  1FSW A;  2DNS A;  5CTN A;  3SS5 A;  5EE8 A;  5A90 A;  1SDN A;  1MXO A;  3EQV A;  3BFC A;  4GN2 A;  4KEN B;  4OLG A;  2QPN A;  4R4R A;  2GDN A;  3RXX A;  2ZM8 A;  3OPL A;  3SH7 A;  1BZA A;  4DDS A;  4Q8I A;  2XD5 A;  2Y91 A;  3M6H A;  4JLF A;  4K0W A;  1O7E A;  3UPN A;  1YLZ A;  5KSH A;  5KZH A;  2FFF B;  2R9W A;  3UE1 A;  3S22 A;  1KVL A;  3E2L A;  1Z6F A;  3VSL A;  4XXR A;  2J9P A;  5FAP A;  1IKG A;  2E8I A;  3PBQ A;  1TDG A;  3UNW A;  1CEF A;  4UHU A;  3VP3 A;  4E3O A;  1K4E A;  2FFY A;  5CEC A;  1XA1 A;  5CTM A;  5EVI B;  3ITA A;  2WZZ A;  4KZ3 A;  4DDY A;  3UPO A;  2JBF A;  3IWI A;  3OPH A;  3Q7Z A;  5D3O A;  1HD8 A;  3VSK A;  4N1X A;  1XP4 A;  1IYQ A;  1ESI A;  2Z2L B;  4RX3 A;  1YQS A;  3MXS A;  4MBH A;  3D4F A;  3GR2 A;  3SOI A;  3ZVT A;  4UA6 A;  3IF5 A;  3Q81 A;  4WEJ A;  1DY6 A;  2JC7 A;  3MZF A;  3HLF A;  4LV2 A;  3VOZ A;  3LCE A;  1DJA A;  2ZJ9 A;  2P74 A;  2ZM2 A;  5F1F A;  4U0X A;  2XLN A;  4WYY A;  3Q1F A;  4JF5 A;  4K91 A;  3FKW A;  3RXW A;  5GLA A;  3GQZ A;  3IHA A;  4OQH A;  4QJG A;  3UDI A;  1MWR A;  3HVF A;  4JF4 A;  5E2E A;  1BLC A;  4E3L A;  4GOG A;  3IQA A;  3ZG8 B;  3V39 A;  1YLT A;  2QZ6 A;  3NBL A;  1KGF A;  4JBF A;  5GHZ A;  2V1Z A;  4C6Y A;  4KZ7 A;  3OZH A;  4ZJ1 A;  5KMW A;  5FQM A;  3HRE A;  4LEN A;  3FZC A;  1K54 A;  3IF6 C;  2XFT A;  2DCF A;  5CGS A;  1YLJ A;  2PU4 A;  2Y2Q A;  4X6T A;  1PW1 A;  2EX6 A;  4LCL A;  5EVI D;  1I2S A;  3Q82 A;  1K56 A;  3WRZ A;  4FH2 A;  1KE4 A;  5FQJ A;  4YIN A;  2ZMA A;  1K55 A;  3DWK A;  1ALQ A;  3DTM A;  3FWL A;  1ES3 A;  2Y55 A;  2ZC6 B;  2ZQD A;  1BLP A;  4KZ9 A;  4NK3 A;  2OV5 A;  3W4P A;  4BL2 A;  2IWC A;  1G6A A;  3A3D A;  1L2S A;  5EOE A;  3A3E A;  2IWB A;  1KE0 A;  1E25 A;  4MBF A;  3OC2 A;  4GB7 A;  3V3S A;  2C5W B;  1NJ4 A;  3ISG A;  4JXW A;  3MBZ A;  1TDL A;  5E2G A;  3ZG0 A;  4KG2 A;  3MZD A;  4WMC D;  5GLC A;  3CG5 A;  4OLD A;  1JTD A;  1KVM A;  4BD0 A;  1ES5 A;  5F83 A;  1W7F A;  1RGY A;  3GRJ A;  4EBP A;  4H8R A;  4B4X A;  1JVJ A;  1ZC2 A;  4BEN A;  4P6B A;  1BSG A;  3G2Z A;  4IED A;  1BLS A;  4OOL A;  1JTG A;  5HW3 A;  2Y2L A;  1ES4 A;  5FQ9 A;  1MPL A;  1SHV A;  2ZC7 A;  3RJU A;  1G68 A;  5DF7 A;  3ZFZ A;  2V20 A;  4M3K A;  4PPR A;  1FCM A;  3MKE A;  4OKP A;  1IKI A;  1ES2 A;  4NET A;  5HAQ A;  3GVB A;  1K54 C;  1JWP A;  3G35 A;  2EXA A;  1OME A;  2Y2H A;  1BUE A;  3AGE A;  4OON A;  5CHJ A;  1HVB A;  5DTT A;  2XDM A;  4DF6 A;  1H8Z A;  4KZ8 A;  4A5R A;  2OLU A;  5DVA A;  3CZD A;  3TOI A;  2ZC4 B;  5G18 A;  4DKI A;  5HL1 A;  5EVI A;  2Y2P A;  1XA7 A;  3G32 A;  4LCM A;  3UE3 A;  3EQU A;  4R23 A;  2Y4A A;  1GA0 A;  4KZA A;  1H8Y A;  2WKI A;  4K0X A;  2VGJ A;  4F94 A;  5EEC A;  1MWS A;  5AQB A;  3VFF A;  3G2Y A;  3LY3 A;  1MKI A;  4HES A;  3HUM A;  4X68 A;  4GD8 A;  3M2J A;  3B3X A;  3BFG A;  4QB8 A;  4C75 A;  2XH9 A;  4R1G A;  3ZG5 A;  1FR1 A;  4EWF A;  3LY4 A;  1DJB A;  1L0E A;  3M2K A;  5GL9 A;  1N4O A;  2EXB A;  4JKT A;  5FI6 A;  1JWV A;  4RX2 A;  4Y0U A;  1IYO A;  1YT4 A;  1S6R A;  5CER A;  4IBX A;  1NY0 A;  1LI0 A;  3M6B A;  2PBY A;  2XEP A;  2HDU A;  3TSG A;  4S2M A;  3BFE A;  1KGE A;  1L0G A;  4LV1 A;  3A3J A;  1M6K A;  3HLE A;  2G2U A;  2C6W B;  3QHY A;  3WWX A;  4KQR A;  4YFM A;  2WZX A;  3JYI A;  4IVI A;  3UN7 A;  2G2W A;  5AQ7 A;  1CI8 A;  4DRT A;  1HZO A;  5CEB A;  3OCN A;  1CEG A;  4P0M A;  4EBL A;  4BQM A;  5A92 A;  1K55 C;  4KQO A;  1PYY A;  4C3Q A;  3AGF A;  3MZE A;  4R4S A;  4BD1 A;  4KZ5 A;  4OPY A;  3W8K A;  4EQI A;  1PW8 A;  4CPK A;  3IXD A;  4OOM A;  5M19 A;  3G34 A;  3Q7V B;  1PWC A;  1ZG4 A;  1ZKJ A;  4ZAM A;  2XQZ A;  1KDW A;  1Y54 A;  2WKH A;  2ZC5 B;  3FKV A;  4Z9Q A;  5GHX A;  4WZ5 C;  2WYX A;  4E3M A;  1ERQ A;  1XGI A;  4KQQ A;  1YM1 A;  1WYC A;  2HP5 A;  1PIO A;  1RCJ A;  1K4F A;  1WYB A;  4PM8 A;  5E43 A;  1W5D A;  1ZG6 A;  1IEM A;  5FAQ A;  4P85 A;  4WM9 A;  3UPP A;  4R3J A;  4FD8 A;  3GSG A;  3QNC A;  4PM9 A;  4DE2 A;  4WBG A;  2UWX A;  3HLC A;  3IF6 A;  3MFD A;  4KZB A;  3IXH A;  1WE4 A;  4MNR A;  4ZDX A;  4EV4 A;  5CED A;  4MLL A;  1BLH A;  3LO7 A;  2Y2N A;  3W4Q A;  4OPQ A;  2V2F F;  3C4O A;  1IEL A;  2WAF A;  3G31 A;  5FI2 A;  5EPH A;  2Y59 A;  3GMW A;  3S4X A;  1DJC A;  4JXV A;  1LHY A;  5DTS A;  4GDN A;  5A91 A;  3WS4 A;  1IYP A;  4FCF A;  4OPR A;  3HUO A;  1LL5 A;  1BTL A;  4WEK A;  3SS4 A;  3V5M A;  1K6R A;  2CC1 A;  2JCH A;  1MWT A;  5AQ9 A;  5L2F A;  4MEZ A;  2JE5 A;  2Q9M A;  4PM7 A;  1E3U D;  1RGZ A;  3NC8 A;  3W4O A;  4S2P A;  3ZDJ A;  4RVA A;  4E3K A;  2Z2M B;  4U3T A;  4ZBE A;  4GKU A;  1NYM A;  3ZVW A;  1GCE A;  1ONG A;  1E3U A;  3G4P A;  2H0Y A;  3BM6 A;  1XX2 A;  4LV0 A;  3C7U A;  3IH8 A;  4S2N C;  3O3V A;  5M18 A;  3VP2 A;  5AQA A;  2EFX A;  5U47 A;  4WZ4 A;  4GNU A;  5IHV A;  2PU2 A;  4DE3 A;  3ZG9 B;  3BEC A;  3G30 A;  3ZHH A;  4X69 A;  2HDS A;  3HLG A;  4L0L A;  1VQQ A;  1ONH A;  4E3J A;  4X55 A;  2Y2I A;  3BYD A;  5CHM A;  3MKF A;  4RA7 A;  4OP8 A;  2WAE A;  4OPZ A;  1PZO A;  4BJP A;  4N1H A;  3IWO A;  5GLB A;  3PAG A;  4S2N A;  1QME A;  4N9L A;  1I5Q A;  3C7V A;  1XXM A;  5CXW A;  2WK0 A;  2ZQ9 A;  4KZ4 A;  2Y2G A;  3BFF A;  3IHB A;  2ZQ7 A;  3VFH A;  5EVL A;  3E2K A;  1YLP A;  1LI9 A;  3PBS A;  5HFO A;  4OQ0 A;  3VP4 A;  4XUX A;  3UY6 A;  4JPM A;  1GA9 A;  1L0D A;  3ITB A;  3C5A A;  4KG5 A;  1TEM A;  2B5R A;  2H10 A;  2OSU A;  3DWZ A;  3WS2 A;  1ERO A;  3HUN A;  3P98 A;  4WZ5 A;  2EX2 A;  1GHI A;  4GZB A;  4GDB A;  1XKZ A;  2HP9 A;  3O88 A;  2XFS A;  4JXS A;  4PM6 A;  3AGD A;  3NI9 A;  1PZP A;  5CHU A;  2EX9 A;  4PMA A;  1FCO A;  5E2F A;  2Y2M A;  1LL9 A;  3UO9 A;  1FOF A;  1SKF A;  1N9B A;  4X53 A;  1SDE A;  4N92 A;  3OPR A;  2ZLY A;  5CGW A;  2BG1 A;  1KDS A;  2WGW B;  2WGW A;  5HAR A;  5F82 A;  2J8Y A;  4R0Q A;  4U0T A;  4KG6 A;  2DRW A;  4OVD A;  1TVF A;  4QY6 A;  4BL3 A;  5BOH A;  2XD1 A;  1M40 A;  5TR7 A;  2HDQ A;  4D2O A;  4UAA A;  3UDF A;  2ZD8 A;  5GLD A;  3IH9 A;  4Y0O A;  2RL3 A;  3WS0 A;  1CK3 A;  2WKE A;  1PWD A;  3ZCZ A;  5F1G A; 
#chains in the Genus database with same CATH topology
 4Y7P A;  4Y15 A;  4EBN A;  5A93 A;  4R6L A;  3B47 A;  3V50 A;  2IA2 A;  3FG8 A;  4G3V A;  2XK1 A;  1NZO A;  3T4S A;  1TS8 A;  3O87 A;  5FA7 A;  1S4R A;  4QHC A;  1K25 A;  3PBT A;  4ID4 A;  4S2I A;  3MQ0 A;  2Q9N A;  4B4Z A;  5CRF A;  3HCY A;  4HP9 A;  3N8S A;  1TF1 A;  3BRM A;  3VV4 A;  2ACG A;  2V0W A;  2X01 A;  3N8L A;  3VE3 A;  3T4J A;  3IWQ A;  3TE8 A;  4PKY A;  3NDE A;  3BLS A;  5FAT A;  2P9V A;  2R78 A;  3A3F A;  2JKT M;  1MY8 A;  2Z6C A;  3LEZ A;  1PI5 A;  1I2W A;  4MBK A;  3BEB A;  1K57 A;  1ESU A;  2W1T B;  1UWP X;  4QU3 A;  4IVK A;  4QD4 A;  1K6S A;  4OH0 A;  5IU1 A;  3IF6 B;  4OP5 A;  2JKT I;  1Y4O A;  1STZ A;  1C3B A;  3N6I A;  1G5U A;  2NUP C;  3BQA A;  1VHM A;  4HJ3 A;  3PR6 A;  2W27 A;  3DW0 A;  2X02 A;  3A0R A;  3QP5 A;  3NOP C;  4FH4 A;  5E2H A;  2J7V A;  2ZQA A;  3C2W A;  4IBR A;  4PM5 A;  3C4P A;  3WS1 A;  1LSW A;  4KUO A;  1CF0 A;  2QJ7 A;  4GD6 A;  3MFX A;  5I5L A;  4HHD A;  2P9V B;  5TGF A;  1H5X A;  2HJE A;  4E04 A;  4S2J A;  1Q2Q A;  1VM1 A;  2O9B A;  1IYS A;  3UDX A;  1FSY A;  4UA9 A;  5FAS A;  2WGV A;  3GV9 A;  1FSW A;  1JWZ A;  4NKP A;  1MXO A;  2E8J A;  3DTK A;  4GN2 A;  4OLG A;  4R4R A;  2GDN A;  1BZA A;  2EWW A;  3QP4 A;  3M6H A;  3UPN A;  1O7E A;  4ETZ A;  5KSH A;  2R9W A;  4GS9 B;  3UE1 A;  3S22 A;  3T50 A;  1IKG A;  3PBQ A;  1TDG A;  3E4O A;  3UB8 A;  4GCZ A;  1K4E A;  5CEC A;  4DDY A;  3CPT B;  1XP4 A;  2Y79 A;  3ZVT A;  1G28 A;  2QWS A;  3IF5 A;  2D01 A;  2JC7 A;  3EGD C;  2P74 A;  5F1F A;  3KSH A;  2XLN A;  4WYY A;  1XFN A;  4K91 A;  2QJ5 A;  2L1M A;  5GLA A;  4OQH A;  4QWO A;  4JF4 A;  1TD5 A;  5HWT A;  3V39 A;  1NLY A;  5HDC A;  2V1Z A;  1F2K A;  4FUW A;  4KZ7 A;  4I5S A;  2DCF A;  1YLJ A;  1DP8 A;  4X6T A;  4LCL A;  5EVI D;  2W3G A;  3DWK A;  3DTM A;  4BL2 A;  1H0M A;  2IWC A;  2JHE A;  4M4X A;  1E25 A;  4MDZ A;  5KIZ A;  1UWN X;  1JTD A;  4BD0 A;  4K08 A;  4H6J B;  4H8R A;  4R3A A;  3LIF A;  5L09 A;  1S67 L;  4BEN A;  4IED A;  3G2Z A;  1XJ2 A;  4I3J A;  1ES4 A;  5FQ9 A;  1MPL A;  1SHV A;  3RJU A;  2V20 A;  4PPR A;  3MKE A;  2OAQ 1;  1ES2 A;  3JPU A;  4NET A;  5HAQ A;  4OON A;  3AGE A;  5CHJ A;  4A5R A;  3CPT A;  3MQQ A;  4LCM A;  4G3W A;  2Y4A A;  3QP8 A;  1GA0 A;  4O8G A;  4K0X A;  2W1R A;  4UQI S;  4HES A;  4GD8 A;  3M2J A;  4QB8 A;  3G6O A;  1L0E A;  3M2K A;  5GL9 A;  3H7W A;  2EXB A;  4RX2 A;  1A0K A;  4NEE D;  4QPR A;  1FIK A;  3BJN A;  3TSG A;  2HDU A;  4S2M A;  3BFE A;  4KQR A;  4HOI A;  5CEB A;  5DFY A;  3T4T A;  1YKD A;  1OTI A;  5A92 A;  1K55 C;  4XT2 B;  1OT6 A;  3MZE A;  4KZ5 A;  4OPY A;  5TBM B;  4OOM A;  1ZG4 A;  5GHX A;  3FKV A;  4E3M A;  1XGI A;  5TBM A;  1YM1 A;  1WYB A;  4PM8 A;  2M7U A;  5FAQ A;  3NEC A;  4YNR A;  4WM9 A;  3CIT A;  3GSG A;  3QNC A;  2K31 A;  4PM9 A;  2VZW A;  5CED A;  4IUK A;  4MLL A;  1BLH A;  3UMD A;  3LO7 A;  4NXF A;  4OPQ A;  2NUT C;  3G31 A;  2EWV A;  3KO6 A;  2Y59 A;  2VEA A;  1YSQ A;  3S4X A;  5C5K A;  1KOU A;  2W1T A;  3KYE A;  4FCF A;  3HUO A;  4WEK A;  3V5M A;  4WL9 A;  1VB6 A;  3L9K A;  2XSS A;  1E3U D;  1RGZ A;  5AJG A;  4E3K A;  4R38 A;  3GEC A;  3OBF A;  4ZBE A;  1NYM A;  1ONG A;  4UEY A;  1E3U A;  4EQ1 A;  5G4Z A;  3BM6 A;  3O3V A;  3LR5 A;  1D06 A;  4HJ4 A;  5AQA A;  2DMW A;  5U47 A;  2JKR M;  2PU2 A;  4DE3 A;  3EOI A;  4E3J A;  4LRX C;  4X55 A;  2Y2I A;  3BYD A;  5CHM A;  4OPZ A;  2PD8 A;  1XXM A;  2ZQ9 A;  2KX6 A;  5HFO A;  3UY6 A;  1L0D A;  4KG5 A;  1CJF A;  2H10 A;  3DWZ A;  1W63 M;  4LFU A;  4GZB A;  3O88 A;  3AGD A;  3NI9 A;  4PMA A;  2JKF A;  2Y2M A;  3UO9 A;  1FOF A;  1N9B A;  2OWH A;  1SDE A;  2ZLY A;  2J3T C;  3BQ8 A;  3H82 B;  2B18 A;  3R4K A;  2WGW B;  3T1Q B;  4U0T A;  5TR7 A;  4UAA A;  5GLD A;  5AVE A;  1HLU P;  1VEU A;  3S7P A;  1PWD A;  3ZCZ A;  3IX8 A;  2A3U A;  4JGO A;  5HX9 A;  2XR0 A;  3V3R A;  3IXG A;  1BT5 A;  3T12 B;  4DE0 A;  4R3B A;  1K56 D;  1ERM A;  4I38 A;  1J9M A;  5L10 A;  1F98 A;  5EVI C;  1MBL A;  1P9R A;  3CUE A;  3OLO A;  4OQI A;  5FQQ A;  4E3N A;  1L0F A;  3NIA A;  2XF3 A;  3S7Q A;  1P0Z A;  2J9O A;  3VMA A;  2H0T A;  1W79 A;  3CHW P;  4Y0T A;  4WEL A;  5FDH A;  3UE0 A;  4GLQ A;  5J4E A;  5EFW A;  1SCW A;  4RYE A;  4DN0 A;  4UA7 A;  4WF0 A;  3P01 A;  3T4L A;  1W8Q A;  2QYB A;  2WAD A;  5CX7 A;  1P97 A;  3OCL A;  4E6X A;  1NRJ A;  1IFQ A;  1K38 A;  4B88 A;  2J3T D;  5J8X A;  3S7N A;  1EI5 A;  4HI4 A;  1KGG A;  4II7 A;  4P6Z M;  1F9I A;  1AWI A;  4JGP A;  4XUZ A;  3S1Y A;  1GHM A;  1XGJ A;  2JKG A;  3LR0 A;  4S2L A;  5HAP A;  5A8B A;  3FYZ A;  4D60 A;  5HD3 A;  2HPB A;  3C38 A;  3CAX A;  2YKF A;  3QNB A;  3OPP A;  2ZMV A;  3WRT A;  3Q7V A;  1PRQ A;  1K57 C;  2ZQ8 A;  3N8R A;  4ZJ2 A;  3HBR A;  1XPB A;  3DBA A;  3DTI A;  4JF6 A;  1J3W A;  3ZNT A;  4DJ3 A;  2Y2O A;  1D7E A;  3NY4 A;  4FSF A;  2RCX A;  3BLM A;  4ARZ B;  4B9O A;  2BLS A;  5HPF A;  2V9A A;  5EUA A;  3BFD A;  2PDR A;  1O07 A;  5CTN A;  3SS5 A;  2DNS A;  1SDN A;  2ZBB A;  2QPN A;  3RXX A;  3LR4 A;  3B33 A;  4DJ2 A;  3E2L A;  3MF0 A;  1Z6F A;  2J9P A;  5J7E A;  1UGU A;  2E8I A;  1ACF A;  3A0S A;  5HZH A;  4UHU A;  3UB7 A;  3EWK A;  2FFY A;  1XA1 A;  5EVI B;  2WZZ A;  4KZ3 A;  1ODV A;  2PYP A;  3NHQ A;  3OPH A;  3UPO A;  3Q7Z A;  5HWW A;  3VSK A;  4N1X A;  1ESI A;  4MBH A;  3F1O A;  3D4F A;  3SOI A;  4UA6 A;  1FIL A;  4CLC A;  3FKW A;  3RXW A;  3IBR A;  4MN7 A;  1MWR A;  3HVF A;  2MJ6 A;  1BLC A;  4E3L A;  3LGO A;  1N9L A;  2INW A;  3ZG8 B;  1YLT A;  4JBF A;  2PD7 A;  3OZH A;  2PAV P;  4L9F A;  2Y2Q A;  1I2S A;  1K56 A;  5FQJ A;  5FEG A;  3FWL A;  2L0W A;  5A90 A;  3W4P A;  2OV5 A;  3CUE C;  3A3D A;  5EOE A;  3A3E A;  1V9Z A;  2C5W B;  1NJ4 A;  3OOV A;  1OPX A;  3MBZ A;  1TDL A;  3K3C A;  1KVM A;  3LFV A;  5F83 A;  3KYZ A;  2QKP A;  4EBP A;  4FTX A;  1JVJ A;  1ZC2 A;  4P6B A;  4Z1W A;  2Y2L A;  1G68 A;  4M3K A;  2O99 A;  3G35 A;  1OME A;  1BUE A;  1HVB A;  4DF6 A;  4LRY C;  5HDD A;  3HJI A;  4L9G A;  3TOI A;  2ZC4 B;  4DKI A;  5EVI A;  1XA7 A;  3G32 A;  3EQU A;  1DP6 A;  4KZA A;  1H8Y A;  2VGJ A;  4F94 A;  5EEC A;  5AQB A;  2V8C A;  3B3X A;  4R1G A;  3ZG5 A;  4EWF A;  4GW9 A;  5FI6 A;  4Y0U A;  1IOU A;  3K3D A;  5FL3 A;  5CER A;  4IBX A;  1NY0 A;  4EXO A;  2XEP A;  4UQI M;  3A3J A;  1M6K A;  2P7J A;  3WWX A;  3TW8 A;  3UN7 A;  1HZO A;  1TS6 A;  1CEG A;  2Y8H A;  4P0M A;  4EBL A;  4EU0 A;  1CQA A;  3KSG A;  4C3Q A;  3LIE A;  2W0N A;  1V9Y A;  2V1A A;  4EQI A;  1PW8 A;  5HPI A;  4B93 A;  5M19 A;  3G34 A;  3Q7V B;  1PWC A;  1ZKJ A;  1KDW A;  2XQZ A;  4Z9Q A;  3V67 A;  2WYX A;  1RCJ A;  1K4F A;  4XT2 A;  1ZG6 A;  4FD8 A;  3ZQ5 A;  1SZV A;  4WBG A;  2UWX A;  3UME A;  1DRM A;  4MNR A;  4ZDX A;  1H8M A;  4CLC E;  5EPH A;  4HJ6 A;  1T19 A;  3KYQ A;  3D72 A;  3T1S A;  5DTS A;  4GDN A;  5A91 A;  2ZOH A;  1S1Y A;  1IYP A;  4YOF A;  2CC1 A;  5L2F A;  4MEZ A;  2JE5 A;  4PM7 A;  2W3D A;  5F5Y A;  3NC8 A;  4S2P A;  4RVA A;  2Z2M B;  4U3T A;  4GKU A;  3ZVW A;  5F68 A;  1XX2 A;  2HJ9 C;  3C7U A;  3F1P A;  2B95 A;  3F1N B;  2XRO A;  1GSX A;  4GNU A;  3IX3 A;  3GDI A;  3G30 A;  2VK3 A;  3ZHH A;  4X69 A;  2LB9 A;  3LI8 A;  3MKF A;  4RA7 A;  4OP8 A;  2WAE A;  4N1H A;  5GLB A;  1QME A;  2PR6 A;  1EW0 A;  4N9L A;  3C7V A;  3SZT A;  4Y5F A;  2OWJ A;  5LBR A;  5EVL A;  1YLP A;  1LI9 A;  1T1A A;  3PBS A;  3EEA A;  3VP4 A;  4XUX A;  3HUN A;  2EX2 A;  2LB5 A;  2B02 A;  5IT5 A;  1YSP A;  2GJ3 A;  1NLZ A;  1LL9 A;  2OOL A;  1ZHH B;  2ZL1 A;  5CGW A;  2FZ0 A;  2M7V A;  1X0O A;  1PFL A;  3H82 A;  1TVF A;  4BL3 A;  4EW7 A;  5BOH A;  1M40 A;  2ZL1 B;  4ZRR A;  3IH9 A;  3WS0 A;  2WKE A;  2VLG A;  2J3W A;  4LV3 A;  1CI9 A;  3RFB A;  4E3I A;  2GZA A;  3PAE A;  2IWD A;  2Y2K A;  5FAO A;  1YMX A;  2R9X A;  1G6O A;  3HLB A;  3ZNY A;  2ZM0 A;  1DP9 A;  2XGN A;  2VJW A;  2QMI A;  3PYP A;  3R7W B;  1W8Y A;  2VV8 A;  2VKS A;  3P7N A;  4KZ6 A;  2UV0 E;  1P9W A;  1E4D A;  1MKM A;  3PBO A;  3E4Q A;  2WKQ A;  4HEF A;  3Q07 A;  5DFX A;  5L07 A;  2GNX A;  2FH5 A;  4BBU A;  3IT9 A;  4GHI B;  3SH8 A;  2HGV A;  4QY5 A;  4DE1 A;  4G3K A;  2P04 A;  1PWG A;  3MXQ A;  3JVV A;  2VV7 A;  3UB9 A;  4BWI A;  2H28 A;  2EX8 A;  3IX4 A;  1KE3 A;  1MWU A;  3HJK A;  1LSV A;  2JKR I;  5JYP A;  2XRN A;  3MR0 A;  3IXB A;  3ZG7 B;  2WUQ A;  4P87 A;  3QP6 A;  3VP1 A;  4EUV A;  3IS2 A;  1LLB A;  3MJQ A;  2HDR A;  4S2K A;  4WLA A;  1U60 A;  1OTA A;  1GHP A;  2X71 A;  3O5Y A;  4HY8 A;  4GJ4 A;  1N9N A;  4PHT A;  2P08 A;  3LIA A;  4HBT A;  5EM0 A;  5AVF A;  3KX0 X;  5CGX A;  2OLV A;  3PHY A;  5EV0 A;  3SH9 A;  5EVE A;  2A49 A;  3DAV A;  4AFI A;  3A0V A;  3PBR A;  3VP0 A;  1QMF A;  4OQG A;  4DXC A;  4DXB A;  2O9C A;  1F5M A;  3HLD A;  3VOY A;  4NXE A;  3T1R A;  5GHY A;  3BWL A;  3P09 A;  4S2O A;  1Q2P A;  1YLW A;  5EE8 A;  1T1C A;  3BFC A;  4DMZ A;  1OTE A;  3OPL A;  3SH7 A;  2Y91 A;  2V1B A;  4K0W A;  1YLZ A;  5KZH A;  3SW1 A;  1KVL A;  3VSL A;  4XXR A;  3T1X A;  1L3L A;  3K2N A;  4ESP A;  4WN5 A;  3UNW A;  1CEF A;  1K0K A;  3ITA A;  2JBF A;  5D3O A;  2YKH A;  1LT0 A;  2Z2L B;  1YQS A;  3GR2 A;  2PT7 A;  2Q0O A;  3Q81 A;  4WEJ A;  1DY6 A;  3MZF A;  2J80 A;  3HLF A;  3LCE A;  2ZJ9 A;  2ZM2 A;  4ETX A;  2HZ5 A;  3GQZ A;  2O0Y A;  4GOG A;  3IQA A;  3LID A;  2QZ6 A;  5GHZ A;  1KGF A;  3U4L P;  4NXG A;  5KMW A;  5FQM A;  3HRE A;  3DTE A;  1GSV A;  1PW1 A;  2EX6 A;  3CI6 A;  1LL8 A;  4LPZ A;  3PXP A;  4EEP A;  4FH2 A;  4YIN A;  3JVU A;  4O01 A;  3T4K A;  1ES3 A;  1BLP A;  3UE6 A;  4PKY G;  2M1C A;  1KE0 A;  3OC2 A;  2D02 A;  4JXW A;  4KG2 A;  3MZD A;  1ZTU A;  4WMC D;  5GLC A;  3CG5 A;  2W3H A;  4X1L A;  1RGY A;  5DJT A;  3UB5 P;  4ME4 A;  4B4X A;  1BSG A;  2VGL S;  3LEQ A;  5HW3 A;  2ZC7 A;  3VOL A;  3ZFZ A;  1FCM A;  4OKP A;  2ZMF A;  3GVB A;  1K54 C;  2Y2H A;  3F1O B;  2XDM A;  1H8Z A;  2Z6D A;  4KZ8 A;  2OLU A;  3CLO A;  5DVA A;  3CZD A;  2Y2P A;  4JGR A;  3UE3 A;  4R23 A;  4BBV A;  2W3E A;  4I3I A;  3MMH A;  3VFF A;  3G2Y A;  3LY3 A;  1MKI A;  4GS9 A;  2XH9 A;  4LGW A;  4JKT A;  1JWV A;  1IYO A;  1YT4 A;  1S6R A;  5K5B A;  3FPW A;  1LI0 A;  3M6B A;  2PBY A;  3W2Z A;  4RQ9 A;  3HLE A;  1OTD A;  2WZX A;  3JYI A;  4IVI A;  2G2W A;  2KLI A;  5F6A A;  4CQH A;  4KQO A;  1PYY A;  4CPK A;  4ZAM A;  5HL1 A;  2WKH A;  4WZ5 C;  1ERQ A;  4KQQ A;  1WYC A;  3T4O A;  1PIO A;  4HIA A;  4JGQ A;  2WKR A;  3UPP A;  4R3J A;  4DE2 A;  3HLC A;  3IF6 A;  3MFD A;  3IXH A;  1WE4 A;  2Y2N A;  3IS2 B;  1N9O A;  5FI2 A;  4EES A;  4JXV A;  1DJC A;  1VET B;  1LHY A;  1OTB A;  3WS4 A;  2G7U A;  3SS4 A;  2JCH A;  5AQ9 A;  2Q9M A;  2V0U A;  3W4O A;  3ZDJ A;  5HSQ A;  1GCE A;  5IS1 A;  2H0Y A;  2AVX A;  3IH8 A;  2XA7 M;  5M18 A;  2CMN A;  4LRZ E;  4Q0J A;  3KSF A;  4L9E A;  2A24 B;  3QP1 A;  2VV6 A;  3IWO A;  3PAG A;  5CXW A;  4H6J A;  2WK0 A;  4KZ4 A;  3BFF A;  2GX5 A;  3IHB A;  2ZQ7 A;  4OQ0 A;  4NG2 A;  4JPM A;  1GA9 A;  4KQD A;  1PNE A;  3ITB A;  3C5A A;  5HL6 A;  4IJG A;  5FEF A;  3C8C A;  1JNU A;  1GHI A;  1XKZ A;  2HP9 A;  2V8F A;  2XFS A;  4JXS A;  4KUK A;  4P6Z S;  5CHU A;  2EX9 A;  5FDS A;  2BG1 A;  4Y13 A;  2K2N A;  5F82 A;  4R0Q A;  2DRW A;  4OVD A;  2XD1 A;  2HDQ A;  4D2O A;  2O9A A;  2ZD8 A;  3IBJ A;  4Y0O A;  1CK3 A;  4PAU A;  3LUQ A;  4CLC B;  5HAI A;  5M1A A;  3PTE A;  5TFQ A;  1S0W A;  4HBU A;  5FSR A;  3LI9 A;  3E98 A;  3I7J A;  2BTF P;  1SKO A;  1NXY A;  1T18 A;  3CJM A;  4JXG A;  5DTK A;  3S7O A;  4Y3I A;  1S1Z A;  3KSI A;  2PBD P;  3A3I A;  2WKP A;  3LIB A;  3TRC A;  4N9K A;  3PBN A;  1FCN A;  3WS5 A;  1FQG A;  1NYY A;  3QP2 A;  3MQO A;  3NJA A;  3FV7 A;  3NDG A;  3TG9 A;  3F1N A;  1YLY A;  4WMC A;  3HL9 A;  1EWZ A;  1BUL A;  5FQK A;  4ZJ3 A;  2W3F A;  5FI7 A;  3GTC A;  2WGI A;  2PRF A;  2PYR A;  3ZGA B;  5HDS A;  4CLC D;  1HTZ A;  1RP5 A;  3HLW A;  4CJN A;  5DF9 A;  2H5S A;  3O86 A;  2EFU A;  4O7D A;  1VET A;  3MXR A;  2Y2J A;  4ZTK A;  5HWV A;  1AXB A;  5KSC A;  4BLM A;  1TS7 A;  5DKL A;  4MCW A;  4O0P A;  4LLO B;  1NZU A;  1D1J A;  3NUL A;  4MMN A;  3H9W A;  5EOO A;  1BYW A;  1FR6 A;  3D9Y A;  4HH3 A;  5J3W A;  5DF8 A;  2HF6 A;  4EUZ A;  4X56 A;  3CMZ A;  1YPR A;  5FQI A;  5I94 A;  1PI4 A;  5JYO A;  3N7W A;  3NCK A;  5G4Y A;  2HP6 A;  2ZQC A;  3SS3 A;  3N4I A;  2ZC3 B;  2VGK A;  4HP4 A;  1Z09 A;  2I72 A;  1NRF A;  3U2A A;  4OOY A;  2A2L A;  1YMS A;  4E6W A;  4YWZ A;  1S4S A;  3EQV A;  4KEN B;  3RH8 B;  3H7W B;  2ZM8 A;  3E4P A;  4DDS A;  4Q8I A;  2XD5 A;  4JLF A;  2FFF B;  4X1M A;  4BBT A;  4EER A;  2BAS A;  5FAP A;  3E0Y A;  3BY8 A;  3VP3 A;  4E3O A;  3LIC A;  2HV1 A;  5CTM A;  3LYX A;  4X25 A;  3IWI A;  1HD8 A;  1IYQ A;  4RX3 A;  3MXS A;  3UB6 A;  1LSX A;  3ULF A;  4LV2 A;  3VOZ A;  1DJA A;  4U0X A;  3Q1F A;  4JF5 A;  3IHA A;  4QJG A;  2K7S A;  3UDI A;  5E2E A;  5DJU A;  3NBL A;  4C6Y A;  4ZJ1 A;  4FOF A;  4LEN A;  3FZC A;  1K54 A;  2KDK A;  4CLC C;  3IF6 C;  2XFT A;  5CGS A;  2PU4 A;  2VA0 A;  2I9V A;  3Q82 A;  3WRZ A;  1KE4 A;  2ZMA A;  1K55 A;  1ALQ A;  2Y55 A;  2ZC6 B;  2ZQD A;  4KZ9 A;  4NK3 A;  1G6A A;  2ZOI A;  1L2S A;  4I39 A;  5F69 A;  3D3O A;  2IWB A;  4MBF A;  4GB7 A;  3V3S A;  3ISG A;  5E2G A;  3ZG0 A;  5EM1 A;  4OLD A;  2QHK A;  1ES5 A;  3FC7 A;  1W7F A;  3GRJ A;  5TJJ A;  4F3L B;  1BLS A;  4OOL A;  1JTG A;  2A24 A;  5DF7 A;  2XA7 S;  1IKI A;  3EEH A;  1MZU A;  1JWP A;  2EXA A;  4Y17 A;  1MC0 A;  3F1P B;  5DTT A;  2PHY A;  2KOI A;  5G18 A;  3ZYT A;  1T1B A;  3MS6 A;  2WKI A;  1GSW A;  3NOT C;  1MWS A;  3HUM A;  4X68 A;  4C75 A;  1FR1 A;  3LY4 A;  1DJB A;  4HNB A;  1N4O A;  3NOU C;  4Q0I A;  4EEU A;  3MSH A;  2VX8 A;  3B42 A;  1KGE A;  1L0G A;  4LV1 A;  2G2U A;  2C6W B;  3QHY A;  2EA9 A;  4YFM A;  1XJ4 A;  4ARZ A;  5AQ7 A;  1CI8 A;  4DRT A;  5L8M A;  3OCN A;  4BQM A;  2OAP 1;  3AGF A;  4R4S A;  4BD1 A;  3W8K A;  3BW6 A;  1W63 Q;  3IXD A;  2L4R A;  4WUJ A;  3VE4 A;  1Y54 A;  2ZC5 B;  3ICY A;  1Y28 A;  5MC7 A;  1XJ6 A;  2HP5 A;  5E43 A;  1W5D A;  4NXB A;  1IEM A;  5HD5 A;  4P85 A;  1OJ5 A;  4KZB A;  4MN6 A;  4EV4 A;  3T4Q A;  3W4Q A;  2V2F F;  1YAX A;  3C4O A;  1IEL A;  2WAF A;  1NWZ A;  3GMW A;  1XJ3 A;  4EET B;  4OPR A;  1LL5 A;  1BTL A;  1K6R A;  3BY9 A;  1MWT A;  4IUH A;  3G4P A;  4LV0 A;  4Q0H A;  4S2N C;  4GHI A;  3C30 A;  3VP2 A;  4R70 A;  2EFX A;  3LR3 A;  3RTY A;  4MN5 A;  4WZ4 A;  5IHV A;  3ZG9 B;  3BEC A;  3L7H A;  4I3A A;  2HDS A;  3HLG A;  4L0L A;  1VQQ A;  1ONH A;  4IHQ A;  4BJP A;  1PZO A;  1OT9 A;  4F3L A;  4S2N A;  1XFQ A;  1I5Q A;  1OJG A;  2Y2G A;  3R7W A;  3VFH A;  1S66 L;  3E2K A;  1TS0 A;  2VGL M;  1TEM A;  2B5R A;  4Y2F A;  2OSU A;  4HQA A;  3WS2 A;  1ERO A;  3P98 A;  4HH2 A;  4WZ5 A;  5DKK A;  1SKO B;  4GDB A;  4PM6 A;  1PZP A;  1H3Q A;  1FCO A;  5E2F A;  1WA9 A;  2JN7 A;  3TJZ C;  3FPV A;  1VEU B;  1SKF A;  4X53 A;  4N92 A;  3CWF A;  3OPR A;  2PR5 A;  1KDS A;  2WGW A;  3EGX C;  5HAR A;  2J8Y A;  4KG6 A;  4QY6 A;  3UDF A;  2RL3 A;  3BFG A;  4BMW A;  5F1G A; 
#chains in the Genus database with same CATH homology
 4E3I A;  4LV3 A;  1CI9 A;  4Y7P A;  2A3U A;  3PAE A;  5HAI A;  4EBN A;  2IWD A;  5A93 A;  2Y2K A;  5HX9 A;  2XR0 A;  3PTE A;  5M1A A;  5FAO A;  5TFQ A;  1S0W A;  4HBU A;  3V50 A;  3V3R A;  5FSR A;  3IXG A;  1YMX A;  1BT5 A;  3I7J A;  2XK1 A;  1NZO A;  1NXY A;  2R9X A;  3CJM A;  4DE0 A;  4R3B A;  4JXG A;  5DTK A;  1K56 D;  1ERM A;  3HLB A;  3O87 A;  5FA7 A;  3ZNY A;  1J9M A;  2ZM0 A;  2XGN A;  4QHC A;  5EVI C;  1MBL A;  1K25 A;  2QMI A;  3PBT A;  4ID4 A;  4S2I A;  4OQI A;  5FQQ A;  4E3N A;  1L0F A;  1W8Y A;  2XF3 A;  3NIA A;  3A3I A;  2Q9N A;  4B4Z A;  5CRF A;  2J9O A;  4N9K A;  3PBN A;  1FCN A;  2H0T A;  3VMA A;  1W79 A;  3WS5 A;  4KZ6 A;  3N8S A;  1FQG A;  3BRM A;  1E4D A;  3PBO A;  1NYY A;  4Y0T A;  4WEL A;  5FDH A;  4HEF A;  3UE0 A;  3Q07 A;  3FV7 A;  2X01 A;  3N8L A;  3NDG A;  3TG9 A;  1SCW A;  4RYE A;  1YLY A;  4WMC A;  3HL9 A;  3IWQ A;  3IT9 A;  1EWZ A;  1BUL A;  4UA7 A;  5FQK A;  4ZJ3 A;  3NDE A;  3BLS A;  5FAT A;  3SH8 A;  5FI7 A;  4QY5 A;  4DE1 A;  2P9V A;  3GTC A;  1PWG A;  2WGI A;  1W8Q A;  3A3F A;  1MY8 A;  2EX8 A;  3ZGA B;  3LEZ A;  1KE3 A;  1MWU A;  1HTZ A;  1PI5 A;  2WAD A;  1RP5 A;  1I2W A;  3HLW A;  3OCL A;  4MBK A;  5JYP A;  4CJN A;  3BEB A;  1K57 A;  5DF9 A;  1ESU A;  2H5S A;  3IXB A;  3ZG7 B;  2WUQ A;  4E6X A;  3O86 A;  2EFU A;  4P87 A;  4QU3 A;  4O7D A;  4IVK A;  3MXR A;  2Y2J A;  4QD4 A;  1K6S A;  3VP1 A;  1K38 A;  4ZTK A;  1LLB A;  1AXB A;  4OH0 A;  4BLM A;  5KSC A;  4B88 A;  5J8X A;  1EI5 A;  2HDR A;  3IF6 B;  4OP5 A;  1KGG A;  4S2K A;  1NZU A;  1U60 A;  1GHP A;  1C3B A;  1GHM A;  2X71 A;  1XGJ A;  4XUZ A;  3S1Y A;  3N6I A;  5EOO A;  4HBT A;  1FR6 A;  4S2L A;  5HAP A;  5DF8 A;  4EUZ A;  3DW0 A;  2X02 A;  3FYZ A;  4X56 A;  3CMZ A;  5FQI A;  4FH4 A;  2HPB A;  5E2H A;  2J7V A;  2ZQA A;  5CGX A;  5I94 A;  3QNB A;  1PI4 A;  3OPP A;  4IBR A;  5JYO A;  2OLV A;  3C4P A;  3N7W A;  3NCK A;  4PM5 A;  3WRT A;  3Q7V A;  3SH9 A;  2ZQ8 A;  1K57 C;  3N8R A;  4ZJ2 A;  2HP6 A;  1XPB A;  3HBR A;  3WS1 A;  2ZQC A;  2A49 A;  3SS3 A;  4JF6 A;  4GD6 A;  3ZNT A;  3N4I A;  2ZC3 B;  2P9V B;  2VGK A;  3PBR A;  2Y2O A;  1H5X A;  5TGF A;  1QMF A;  3NY4 A;  4OQG A;  3VP0 A;  4FSF A;  4S2J A;  2RCX A;  3BLM A;  4DXC A;  4DXB A;  2I72 A;  1NRF A;  3HLD A;  1Q2Q A;  1VM1 A;  3VOY A;  1IYS A;  4OOY A;  2BLS A;  3UDX A;  1YMS A;  5GHY A;  5EUA A;  4E6W A;  3P09 A;  1FSY A;  4UA9 A;  3BFD A;  5FAS A;  4S2O A;  1Q2P A;  2WGV A;  1O07 A;  1YLW A;  3GV9 A;  1JWZ A;  1FSW A;  2DNS A;  5CTN A;  3SS5 A;  5EE8 A;  5A90 A;  1SDN A;  1MXO A;  3EQV A;  3BFC A;  4GN2 A;  4KEN B;  4OLG A;  2QPN A;  4R4R A;  2GDN A;  3RXX A;  2ZM8 A;  3OPL A;  3SH7 A;  1BZA A;  4DDS A;  4Q8I A;  2XD5 A;  2Y91 A;  3M6H A;  4JLF A;  4K0W A;  1O7E A;  3UPN A;  1YLZ A;  5KSH A;  5KZH A;  2FFF B;  2R9W A;  3UE1 A;  3S22 A;  1KVL A;  3E2L A;  1Z6F A;  3VSL A;  4XXR A;  2J9P A;  5FAP A;  1IKG A;  2E8I A;  3PBQ A;  1TDG A;  3UNW A;  1CEF A;  4UHU A;  3VP3 A;  4E3O A;  1K4E A;  2FFY A;  5CEC A;  1XA1 A;  5CTM A;  5EVI B;  3ITA A;  2WZZ A;  4KZ3 A;  4DDY A;  3UPO A;  2JBF A;  3IWI A;  3OPH A;  3Q7Z A;  5D3O A;  1HD8 A;  3VSK A;  4N1X A;  1XP4 A;  1IYQ A;  1ESI A;  2Z2L B;  4RX3 A;  1YQS A;  3MXS A;  4MBH A;  3D4F A;  3GR2 A;  3SOI A;  3ZVT A;  4UA6 A;  3IF5 A;  3Q81 A;  4WEJ A;  1DY6 A;  2JC7 A;  3MZF A;  3HLF A;  4LV2 A;  3VOZ A;  3LCE A;  1DJA A;  2ZJ9 A;  2P74 A;  2ZM2 A;  5F1F A;  4U0X A;  2XLN A;  4WYY A;  3Q1F A;  4JF5 A;  4K91 A;  3FKW A;  3RXW A;  5GLA A;  3GQZ A;  3IHA A;  4OQH A;  4QJG A;  3UDI A;  1MWR A;  3HVF A;  4JF4 A;  5E2E A;  1BLC A;  4E3L A;  4GOG A;  3IQA A;  3ZG8 B;  3V39 A;  1YLT A;  2QZ6 A;  3NBL A;  1KGF A;  4JBF A;  5GHZ A;  2V1Z A;  4C6Y A;  4KZ7 A;  3OZH A;  4ZJ1 A;  5KMW A;  5FQM A;  3HRE A;  4LEN A;  3FZC A;  1K54 A;  3IF6 C;  2XFT A;  2DCF A;  5CGS A;  1YLJ A;  2PU4 A;  2Y2Q A;  4X6T A;  1PW1 A;  2EX6 A;  4LCL A;  5EVI D;  1I2S A;  3Q82 A;  1K56 A;  3WRZ A;  4FH2 A;  1KE4 A;  5FQJ A;  4YIN A;  2ZMA A;  1K55 A;  3DWK A;  1ALQ A;  3DTM A;  3FWL A;  1ES3 A;  2Y55 A;  2ZC6 B;  2ZQD A;  1BLP A;  4KZ9 A;  4NK3 A;  2OV5 A;  3W4P A;  4BL2 A;  2IWC A;  1G6A A;  3A3D A;  1L2S A;  5EOE A;  3A3E A;  2IWB A;  1KE0 A;  1E25 A;  4MBF A;  3OC2 A;  4GB7 A;  3V3S A;  2C5W B;  1NJ4 A;  3ISG A;  4JXW A;  3MBZ A;  1TDL A;  5E2G A;  3ZG0 A;  4KG2 A;  3MZD A;  4WMC D;  5GLC A;  3CG5 A;  4OLD A;  1JTD A;  1KVM A;  4BD0 A;  1ES5 A;  5F83 A;  1W7F A;  1RGY A;  3GRJ A;  4EBP A;  4H8R A;  4B4X A;  1JVJ A;  1ZC2 A;  4BEN A;  4P6B A;  1BSG A;  3G2Z A;  4IED A;  1BLS A;  4OOL A;  1JTG A;  5HW3 A;  2Y2L A;  1ES4 A;  5FQ9 A;  1MPL A;  1SHV A;  2ZC7 A;  3RJU A;  1G68 A;  5DF7 A;  3ZFZ A;  2V20 A;  4M3K A;  4PPR A;  1FCM A;  3MKE A;  4OKP A;  1IKI A;  1ES2 A;  4NET A;  5HAQ A;  3GVB A;  1K54 C;  1JWP A;  3G35 A;  2EXA A;  1OME A;  2Y2H A;  1BUE A;  3AGE A;  4OON A;  5CHJ A;  1HVB A;  5DTT A;  2XDM A;  4DF6 A;  1H8Z A;  4KZ8 A;  4A5R A;  2OLU A;  5DVA A;  3CZD A;  3TOI A;  2ZC4 B;  5G18 A;  4DKI A;  5HL1 A;  5EVI A;  2Y2P A;  1XA7 A;  3G32 A;  4LCM A;  3UE3 A;  3EQU A;  4R23 A;  2Y4A A;  1GA0 A;  4KZA A;  1H8Y A;  2WKI A;  4K0X A;  2VGJ A;  4F94 A;  5EEC A;  1MWS A;  5AQB A;  3VFF A;  3G2Y A;  3LY3 A;  1MKI A;  4HES A;  3HUM A;  4X68 A;  4GD8 A;  3M2J A;  3B3X A;  3BFG A;  4QB8 A;  4C75 A;  2XH9 A;  4R1G A;  3ZG5 A;  1FR1 A;  4EWF A;  3LY4 A;  1DJB A;  1L0E A;  3M2K A;  5GL9 A;  1N4O A;  2EXB A;  4JKT A;  5FI6 A;  1JWV A;  4RX2 A;  4Y0U A;  1IYO A;  1YT4 A;  1S6R A;  5CER A;  4IBX A;  1NY0 A;  1LI0 A;  3M6B A;  2PBY A;  2XEP A;  2HDU A;  3TSG A;  4S2M A;  3BFE A;  1KGE A;  1L0G A;  4LV1 A;  3A3J A;  1M6K A;  3HLE A;  2G2U A;  2C6W B;  3QHY A;  3WWX A;  4KQR A;  4YFM A;  2WZX A;  3JYI A;  4IVI A;  3UN7 A;  2G2W A;  5AQ7 A;  1CI8 A;  4DRT A;  1HZO A;  5CEB A;  3OCN A;  1CEG A;  4P0M A;  4EBL A;  4BQM A;  5A92 A;  1K55 C;  4KQO A;  1PYY A;  4C3Q A;  3AGF A;  3MZE A;  4R4S A;  4BD1 A;  4KZ5 A;  4OPY A;  3W8K A;  4EQI A;  1PW8 A;  4CPK A;  3IXD A;  4OOM A;  5M19 A;  3G34 A;  3Q7V B;  1PWC A;  1ZG4 A;  1ZKJ A;  4ZAM A;  2XQZ A;  1KDW A;  1Y54 A;  2WKH A;  2ZC5 B;  3FKV A;  4Z9Q A;  5GHX A;  4WZ5 C;  2WYX A;  4E3M A;  1ERQ A;  1XGI A;  4KQQ A;  1YM1 A;  1WYC A;  2HP5 A;  1PIO A;  1RCJ A;  1K4F A;  1WYB A;  4PM8 A;  5E43 A;  1W5D A;  1ZG6 A;  1IEM A;  5FAQ A;  4P85 A;  4WM9 A;  3UPP A;  4R3J A;  4FD8 A;  3GSG A;  3QNC A;  4PM9 A;  4DE2 A;  4WBG A;  2UWX A;  3HLC A;  3IF6 A;  3MFD A;  4KZB A;  3IXH A;  1WE4 A;  4MNR A;  4ZDX A;  4EV4 A;  5CED A;  4MLL A;  1BLH A;  3LO7 A;  2Y2N A;  3W4Q A;  4OPQ A;  2V2F F;  3C4O A;  1IEL A;  2WAF A;  3G31 A;  5FI2 A;  5EPH A;  2Y59 A;  3GMW A;  3S4X A;  1DJC A;  4JXV A;  1LHY A;  5DTS A;  4GDN A;  5A91 A;  3WS4 A;  1IYP A;  4FCF A;  4OPR A;  3HUO A;  1LL5 A;  1BTL A;  4WEK A;  3SS4 A;  3V5M A;  1K6R A;  2CC1 A;  2JCH A;  1MWT A;  5AQ9 A;  5L2F A;  4MEZ A;  2JE5 A;  2Q9M A;  4PM7 A;  1E3U D;  1RGZ A;  3NC8 A;  3W4O A;  4S2P A;  3ZDJ A;  4RVA A;  4E3K A;  2Z2M B;  4U3T A;  4ZBE A;  4GKU A;  1NYM A;  3ZVW A;  1GCE A;  1ONG A;  1E3U A;  3G4P A;  2H0Y A;  3BM6 A;  1XX2 A;  4LV0 A;  3C7U A;  3IH8 A;  4S2N C;  3O3V A;  5M18 A;  3VP2 A;  5AQA A;  2EFX A;  5U47 A;  4WZ4 A;  4GNU A;  5IHV A;  2PU2 A;  4DE3 A;  3ZG9 B;  3BEC A;  3G30 A;  3ZHH A;  4X69 A;  2HDS A;  3HLG A;  4L0L A;  1VQQ A;  1ONH A;  4E3J A;  4X55 A;  2Y2I A;  3BYD A;  5CHM A;  3MKF A;  4RA7 A;  4OP8 A;  2WAE A;  4OPZ A;  1PZO A;  4BJP A;  4N1H A;  3IWO A;  5GLB A;  3PAG A;  4S2N A;  1QME A;  4N9L A;  1I5Q A;  3C7V A;  1XXM A;  5CXW A;  2WK0 A;  2ZQ9 A;  4KZ4 A;  2Y2G A;  3BFF A;  3IHB A;  2ZQ7 A;  3VFH A;  5EVL A;  3E2K A;  1YLP A;  1LI9 A;  3PBS A;  5HFO A;  4OQ0 A;  3VP4 A;  4XUX A;  3UY6 A;  4JPM A;  1GA9 A;  1L0D A;  3ITB A;  3C5A A;  4KG5 A;  1TEM A;  2B5R A;  2H10 A;  2OSU A;  3DWZ A;  3WS2 A;  1ERO A;  3HUN A;  3P98 A;  4WZ5 A;  2EX2 A;  1GHI A;  4GZB A;  4GDB A;  1XKZ A;  2HP9 A;  3O88 A;  2XFS A;  4JXS A;  4PM6 A;  3AGD A;  3NI9 A;  1PZP A;  5CHU A;  2EX9 A;  4PMA A;  1FCO A;  5E2F A;  2Y2M A;  1LL9 A;  3UO9 A;  1FOF A;  1SKF A;  1N9B A;  4X53 A;  1SDE A;  4N92 A;  3OPR A;  2ZLY A;  5CGW A;  2BG1 A;  1KDS A;  2WGW B;  2WGW A;  5HAR A;  5F82 A;  2J8Y A;  4R0Q A;  4U0T A;  4KG6 A;  2DRW A;  4OVD A;  1TVF A;  4QY6 A;  4BL3 A;  5BOH A;  2XD1 A;  1M40 A;  5TR7 A;  2HDQ A;  4D2O A;  4UAA A;  3UDF A;  2ZD8 A;  5GLD A;  3IH9 A;  4Y0O A;  2RL3 A;  3WS0 A;  1CK3 A;  2WKE A;  1PWD A;  3ZCZ A;  5F1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...