1XGIA

Ampc beta-lactamase in complex with 3-(3-nitro-phenylsulfamoyl)-thiophene-2-carboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
342
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structure-based optimization of a non-beta-lactam lead results in inhibitors that do not up-regulate beta-lactamase expression in cell culture.
pubmed doi rcsb
source organism Escherichia coli
total genus 112
structure length 342
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xgiA00
1PYYA 4GB7A 2DCFA 1WYBA 1PI4A 4BJPA 2R9WA 5GHYA 4GDBA 4L0LA 2J8YA 3WS5A 5KZHA 3UE3A 4CPKA 1LHYA 3BFGA 5FSRA 4CJNA 3VMAA 2UWXA 4WMCA 3IF5A 2X01A 5AQ9A 2H0YA 2JE5A 3Q7ZA 4DRTA 4YINA 1W5DA 1I5QA 4RA7A 2XEPA 3LY3A 3DW0A 1XXMA 4UA7A 1RP5A 3WS4A 1CEGA 1EI5A 2JC7A 3IQAA 5F1FA 3GSGA 2B5RA 3IHAA 1JVJA 3MBZA 5AQAA 5EVIB 4LCLA 4DE0A 2ZJ9A 3TG9A 1RGYA 1PIOA 5CHUA 4PM9A 3UY6A 2V2FF 1JTDA 1MKIA 3MZEA 5FQIA 5TGFA 3BRMA 1GHPA 1MBLA 3W8KA 4S2OA 3IXHA 3S22A 1MWTA 1JWZA 3G34A 3P09A 3VP4A 1K55C 3GVBA 4JXSA 1ES5A 5CGWA 1AXBA 1KGGA 5CHJA 1DJBA 1K55A 2IWDA 2XQZA 3PAGA 4DXBA 3HLDA 1FCNA 1SHVA 4R4SA 5CXWA 4DE2A 5HX9A 2XFTA 2ZM2A 4PM7A 1ES2A 3NBLA 5FDHA 4IEDA 1XGIA 3DTMA 4KG2A 3VFHA 4WEKA 5E2FA 4ZTKA 2RL3A 3ZG9B 1PWDA 4LV2A 5I94A 1ES4A 4DE3A 1L0FA 1YMSA 2IWCA 3N8LA 4B4ZA 2IWBA 4E3IA 2WZZA 3HVFA 4E3JA 1FQGA 4KZ9A 5E2GA 2XD1A 2EFXA 4E6XA 2Y2JA 3RJUA 3V50A 3IH8A 2A3UA 4JF5A 3C4PA 1HD8A 3EQVA 1E3UA 1SDEA 1YLYA 1YLPA 3UNWA 2Q9MA 2XGNA 5CECA 3O86A 1JTGA 3BLMA 4ZAMA 3OPPA 4XUZA 3WWXA 2P9VA 3G31A 5F82A 3HBRA 2ZC6B 3HLCA 1LLBA 1LI9A 1M40A 3D4FA 5EVIA 4R4RA 4BENA 4ID4A 1FSWA 3GR2A 4ZDXA 3BEBA 4WZ5C 3C4OA 4N92A 5GLBA 5D3OA 5HW3A 3V5MA 4KZAA 1FCOA 4JBFA 3IF6A 1FSYA 1DJCA 4Y7PA 5FAQA 4UA9A 2HDUA 1MPLA 5CGSA 3LY4A 3WS1A 1YMXA 5E2HA 2H10A 1FR6A 4WYYA 1NY0A 4OPRA 5FA7A 1JWPA 2JBFA 4WELA 3QNCA 3CG5A 4IVIA 4X53A 2G2UA 2WGIA 3LO7A 3E2LA 5DVAA 4PPRA 1RCJA 4O7DA 3N7WA 4KG5A 3A3FA 3FV7A 3OCLA 1EROA 4JXVA 3HLBA 3N4IA 5GLAA 4DXCA 1DY6A 2Y4AA 5G18A 5GLCA 1O07A 5GHXA 5L2FA 2BLSA 2PU4A 3S4XA 1E4DA 5EECA 4OP5A 3IXDA 3UDXA 1W79A 4U0TA 2WGWB 4OH0A 2X71A 1K56D 4KZ6A 1U60A 1J9MA 2Y2IA 1WE4A 3G4PA 3LCEA 4P85A 4UA6A 1YT4A 1H8ZA 2ZC4B 1PZOA 4LV0A 1CI8A 3FKWA 4E3NA 4OPQA 4KZ5A 3AGEA 1ALQA 2ZQ9A 1PW8A 3NC8A 3ZG0A 1IELA 3ZG5A 5HAQA 2C6WB 1PZPA 1W8YA 1H8YA 2ZLYA 3OPLA 5GL9A 3CZDA 5DTSA 4OPZA 3RXWA 1NRFA 5HFOA 4GZBA 2A49A 2R9XA 4P87A 4QD4A 3GMWA 4JF4A 1YLJA 2OV5A 4EBPA 4QY5A 1BT5A 3IWQA 3ZHHA 5HAPA 1KDSA 4WMCD 5FI2A 5FASA 3NDEA 2XFSA 2DRWA 3MKFA 3B3XA 4UHUA 5CTNA 4EUZA 1Z6FA 3NIAA 4KQQA 4WM9A 2J9PA 3PBNA 2Y2NA 5EOEA 3W4OA 2Y91A 2ZMAA 3MXSA 3BYDA 1EWZA 3IWIA 3IH9A 3QHYA 2P9VB 1WYCA 4FH2A 4UAAA 3MZDA 3SS3A 3P98A 3VP0A 3A3JA 1BZAA 2WGWA 2JCHA 4PM8A 5CHMA 3ZFZA 1OMEA 3UE1A 5A91A 2CC1A 5AQBA 3V3SA 4X55A 3M6HA 1ZG6A 4E3LA 4EWFA 2Y55A 4MBFA 1BLPA 2QZ6A 3IF6B 5A93A 2OLUA 3QNBA 4WEJA 3GRJA 1IEMA 3G32A 2HPBA 1NYMA 1ONGA 3Q7VA 2HDRA 3SH9A 2ZC3B 4PMAA 4GKUA 5JYOA 4S2KA 4BQMA 3V39A 4OQ0A 5DTTA 5CEDA 1TDLA 2HP5A 1MWRA 3FKVA 1N9BA 4X56A 4OLDA 2GDNA 3NDGA 1ZG4A 4JF6A 2EX2A 4JXWA 4NK3A 4S2PA 4S2MA 4S2LA 1MWUA 5DF7A 3ZG8B 1L0EA 4M3KA 4R0QA 1NZUA 1HTZA 4IBXA 4X68A 4KZ8A 3UPNA 1PW1A 4JPMA 1KVLA 1ZKJA 1PI5A 2PBYA 3VP3A 3WS2A 3UPPA 1GHMA 1K54C 1K25A 4QU3A 5BOHA 1ES3A 1MXOA 2HP9A 1K54A 1GA9A 3MFDA 4Y0UA 3SH8A 1IKIA 1H5XA 1NZOA 1KGEA 3FZCA 4WBGA 4C6YA 3PBTA 1KE4A 1K57A 1CEFA 4N9LA 4GD6A 3O3VA 5A90A 1FOFA 2ZM0A 5EVIC 1HZOA 1NYYA 5HL1A 1YLZA 3N6IA 3ZVWA 2BG1A 1W8QA 2P74A 4NETA 1K4EA 4P6BA 2RCXA 4MBHA 2ZC7A 5DF9A 5A92A 3NY4A 4OVDA 1VQQA 1IYOA 3IF6C 3RXXA 3ZNTA 4DKIA 4OLGA 3SH7A 3E2KA 1ERQA 1S0WA 4LV1A 2J9OA 4S2NA 2ZQDA 3PAEA 2EX8A 3WRZA 2EXAA 2Y2MA 1SDNA 4QY6A 5FQQA 4C3QA 3IHBA 4BLMA 5EPHA 2WUQA 3Q82A 4IVKA 2H0TA 3HLFA 2WADA 2WYXA 3WRTA 1IYQA 2EXBA 3TOIA 3CJMA 4KQRA 2ZD8A 4OPYA 3VSKA 3WS0A 4JXGA 3SS4A 4KZ7A 1KDWA 4EV4A 3OPHA 4WZ4A 3HREA 5FAPA 3ZG7B 3HUNA 3IXGA 4KZ3A 4U3TA 3ZNYA 3BFCA 1XA1A 4A5RA 3FWLA 4PM5A 5FQ9A 3Q07A 4HESA 1FCMA 3MXRA 1NJ4A 1KVMA 2I72A 2ZQ7A 3UDIA 5CGXA 2XK1A 2WKIA 5TFQA 1PWGA 3N8SA 1XGJA 4OOMA 2ZM8A 2VGKA 1ONHA 3V3RA 2EX9A 3OPRA 2PU2A 2ZQAA 1Q2PA 4F94A 1CI9A 2XF3A 2Y2HA 5M18A 1S6RA 1TDGA 1GHIA 3Q7VB 4DDSA 4EBNA 3IXBA 1BSGA 2Y59A 3ZDJA 4U0XA 4E3KA 5CTMA 3SS5A 4KG6A 4LV3A 4RVAA 2EFUA 3G2ZA 4OP8A 2ZQ8A 5KSCA 1GA0A 1K6SA 4C75A 5FATA 1LL5A 1K56A 3I7JA 3ZVTA 4K91A 1C3BA 3M2JA 2XR0A 4OOYA 2XLNA 4MBKA 3AGFA 3BFFA 4R3JA 5EOOA 3G2YA 4ZJ2A 5EVLA 1TVFA 4GN2A 4S2IA 2Z2MB 1G6AA 4KZBA 4RX2A 1VM1A 2E8IA 3CMZA 1KE3A 1ESUA 2HP6A 3W4QA 1CK3A 5E43A 3Q1FA 4Q8IA 4R1GA 3EQUA 3GQZA 2QMIA 3GV9A 2FFFB 3OC2A 4RYEA 1ERMA 2FFYA 2Y2GA 1LI0A 5FQJA 4ZJ1A 4B88A 4R23A 2ZC5B 3IT9A 2HDSA 2WK0A 2Y2LA 3PBOA 1PWCA 3HLWA 3Q81A 3UN7A 4E3MA 4N1HA 5FQKA 4QB8A 3PTEA 1QMEA 5FI6A 5FAOA 4JLFA 1XKZA 4R3BA 2Y2QA 4Y0TA 2XD5A 3HUOA 1YLWA 2VGJA 1RGZA 5KSHA 3BECA 1FR1A 5FI7A 5KMWA 1XP4A 2ZQCA 3UO9A 4OOLA 3N8RA 3O87A 1L0GA 1HVBA 1BLSA 4N1XA 3A3IA 3VOYA 3TSGA 1ESIA 4E3OA 3BFDA 2WAFA 1KE0A 2Y2KA 4HBTA 4X69A 3VP1A 3JYIA 1NXYA 2G2WA 2WZXA 2Y2PA 4KENB 3A3EA 3C5AA 4OKPA 4N9KA 4BD1A 1QMFA 1E3UD 5JYPA 3VFFA 3HL9A 2WKEA 2HDQA 3PBSA 5EUAA 1Y54A 2V20A 2XH9A 5CERA 3IWOA 3UE0A 1Q2QA 1K57C 1ZC2A 1E25A 2H5SA 3G35A 5EVID 3ZGAB 2OSUA 1SKFA 4JKTA 1I2SA 3NCKA 4GDNA 1G68A 4LCMA 1K38A 5F83A 3BFEA 4MLLA 2DNSA 1TEMA 3VSLA 4DF6A 3ISGA 5DTKA 4K0XA 2EX6A 3VP2A 4H8RA 3LEZA 4S2NC 4ZBEA 4MNRA 5AQ7A 3UPOA 1IKGA 4S2JA 4BD0A 1M6KA 1JWVA 3OZHA 3C7UA 1LL9A 2WAEA 3PBRA 1BUEA 5M1AA 4XUXA 4X6TA 4LENA 5J8XA 2V1ZA 1I2WA 4KZ4A 4B4XA 3ZCZA 1GCEA 1W7FA 3C7VA 3DWKA 1N4OA 4Z9QA 2OLVA 4YFMA 5HAIA 3ITBA 5CRFA 4FH4A 2Z2LB 2C5WB 3FYZA 3HLGA 3HUMA 4WZ5A 4EQIA 1SCWA 1BLHA 4KQOA 4EBLA 2QPNA 5M19A 3O88A 5FQMA 1IYSA 1MY8A 4FD8A 4BL3A 5DF8A 3G30A 5HARA 3VOZA 1KGFA 1XPBA 4RX3A 2XDMA 1L2SA 3PBQA 5U47A 3S1YA 3DWZA 3NI9A 3ITAA 3OCNA 1YM1A 1DJAA 5IHVA 4PM6A 1L0DA 1O7EA 4XXRA 4GNUA 2Q9NA 3UDFA 4QJGA 1IYPA 4BL2A 4MEZA 4OONA 5F1GA 3AGDA 2J7VA 4QHCA 5E2EA 5GHZA 5GLDA 4D2OA 3MZFA 2X02A 3W4PA 4DE1A 1MWSA 3A3DA 4FCFA 4Y0OA 1BULA 5CEBA 1K4FA 3MKEA 4E6WA 4OQIA 1K6RA 2Y2OA 5TR7A 4P0MA 1YQSA 3BLSA 3M2KA 1BLCA 3GTCA 2WKHA 4FSFA 4GD8A 4IBRA 4K0WA 1YLTA 1XX2A 3M6BA 5EE8A 4ZJ3A 4DDYA 4OQHA 3BM6A 4HBUA 3HLEA 4HEFA 2WGVA 1XA7A 3SOIA 4OQGA 1BTLA 4GOGA
chains in the Genus database with same CATH superfamily
3CHWP 1NWZA 2JN7A 3WS5A 3BFGA 1D06A 4WMCA 3IF5A 2X01A 2R78A 3WS4A 1CEGA 1OTAA 2ZJ9A 5CHUA 1OTDA 2V2FF 1JTDA 5FQIA 3W8KA 1MBLA 4S2OA 3IXHA 1MWTA 3VP4A 1K55C 3H9WA 1K55A 2XQZA 4RQ9A 1T1AA 1PNEA 1FCNA 1SHVA 3H7WA 5CXWA 2XFTA 2ZM2A 4KG2A 5A8BA 4DE3A 4R6LA 2IWCA 3LIBA 4B4ZA 2P08A 1ODVA 3IX8A 3C4PA 3EQVA 1E3UA 5CECA 1ZHHB 1JTGA 3OPPA 5FL3A 3WWXA 3LFVA 3H82B 3HLCA 1M40A 3D4FA 5EVIA 4R4RA 3DAVA 4YWZA 2PYRA 3L9KA 5GLBA 4N92A 4BBTA 2VLGA 1FCOA 1FSYA 4WN5A 1DJCA 2ZMVA 1H8MA 2HDUA 1MPLA 1N9OA 5CGSA 3WS1A 1FR6A 5FA7A 2W27A 1JWPA 4X53A 1F9IA 3N7WA 3OCLA 4JXVA 2JKRM 1DY6A 2Y4AA 5KIZA 3A0SA 5EECA 4BWIA 4HHDA 3VOLA 1WE4A 4P85A 4LV0A 1PZOA 3UB8A 4UQIS 1PZPA 2FH5A 3H7WB 4O01A 2PR6A 2EWVA 4P87A 4QD4A 3GMWA 1H0MA 4GJ4A 1YLJA 3PHYA 2OV5A 4EBPA 3IWQA 3F1NA 2XFSA 3B3XA 4EUZA 1Z6FA 5HZHA 3NIAA 4KQQA 2Y2NA 2W3GA 1VEUB 3ULFA 1EWZA 4UAAA 2GJ3A 3A3JA 1XFQA 3T1RA 3TW8A 4GS9A 1OMEA 3UE1A 5A91A 2CC1A 5AQBA 3UE6A 3V3SA 3M6HA 1ZG6A 4E3LA 4EWFA 3KYZA 4NXBA 3QNBA 1NYMA 4DJ2A 2GX5A 2HDRA 2ZC3B 4D60A 4BQMA 1UGUA 2V8CA 2Y8HA 1OJ5A 5G4YA 3FKVA 4NK3A 3ZG8B 1L0EA 4M3KA 3W2ZA 4Q0JA 4EXOA 1NZUA 1LL8A 1YAXA 3UPNA 2WKRA 3F1OA 3SH8A 4WBGA 3LR0A 4MMNA 1CEFA 2H28A 1NYYA 4QWOA 1FIKA 3LIAA 4P6BA 2RCXA 4MBHA 3IF6C 1WA9A 2ZBBA 5FDSA 3SH7A 2UV0E 4EEUA 1F2KA 3PAEA 3UB5P 3IHBA 3QP2A 3GECA 2WUQA 1XFNA 3LR5A 3MXQA 2K2NA 3TOIA 2ZD8A 3WS0A 3OPHA 5FAPA 2EWWA 3ZG7B 3HUNA 4KZ3A 3FWLA 3K3CA 3MMHA 4HESA 4GW9A 3JVUA 1OJGA 2ZQ7A 2VGLS 5CX7A 1V9ZA 5CGXA 5TFQA 2ZM8A 1ONHA 4HY8A 2PU2A 3ZYTA 1Q2PA 5M18A 1CI9A 2Y2HA 2B18A 4EBNA 1BSGA 4R3AA 4U0XA 4KG6A 2EFUA 3G2ZA 5FATA 1LL5A 1C3BA 3M2JA 2XLNA 4MBKA 3AGFA 5EOOA 2OAQ1 4GN2A 3F1OB 2Z2MB 4EETB 1KE3A 2HP6A 3UB9A 2B02A 3EQUA 5TBMA 2QMIA 3GV9A 4ZJ1A 1ERMA 2FFYA 5FQJA 4B88A 3IT9A 1EW0A 3LGOA 4I5SA 4JGPA 5FQKA 4R3BA 2Y2QA 4Y0TA 3HUOA 3OOVA 2VGJA 4LFUA 3BECA 5FI7A 2ZQCA 4OOLA 1HVBA 5L10A 1BLSA 3VOYA 3A3IA 3BFDA 2WAFA 1KE0A 4G3VA 4KENB 3R7WB 1V9YA 3A3EA 2VV7A 2O9BA 2WKEA 2HDQA 2P7JA 4B9OA 5CERA 1K57C 1YSPA 1I2SA 3CAXA 4GDNA 1G68A 4LCMA 5F83A 3VSLA 4MLLA 3IS2A 2EX6A 1LSXA 4H8RA 3PXPA 4BD0A 1JWVA 4HJ4A 3PBRA 1BUEA 2JKTM 2V1ZA 3C7VA 2OLVA 5HAIA 3S7NA 3CUEC 3FYZA 4WZ5A 4EQIA 2W0NA 3U4LP 4HH3A 2W3EA 4EUVA 1IYSA 4FD8A 5F6AA 5DF8A 4ZRRA 2LB5A 3MQOA 4CLCC 1XPBA 3QP4A 2GNXA 3ITAA 5IHVA 1L0DA 2Q9NA 4QJGA 5DKKA 1TS0A 4OONA 5GHZA 2OWHA 5AVEA 3LIFA 3NHQA 1K4FA 3IX4A 3T4SA 3BW6A 4OQIA 4P0MA 5HARA 4IBRA 4FSFA 5L8MA 4K0WA 1XX2A 5EE8A 4OQHA 4HBUA 4HEFA 3NOTC 2WGVA 3SOIA 3E4PA 4OQGA 1PYYA 1PI4A 4BJPA 2R9WA 4GDBA 2J8YA 3E98A 1LHYA 1T1BA 5FSRA 3IS2B 2H0YA 3BQAA 3LICA 3Q7ZA 2A24A 1I5QA 3MSHA 3BQ8A 3PR6A 3DW0A 1XXMA 4MN5A 1OT6A 4HH2A 2Q0OA 2M7VA 1S4RA 4HP4A 4DE0A 5AQAA 4PM9A 1MKIA 3MZEA 5TGFA 1GHPA 4MDZA 3G34A 3P09A 4QPRA 3MQ0A 3GVBA 5CHJA 2IWDA 3S7PA 5HX9A 4PM7A 4G3WA 4DMZA 4IEDA 4WEKA 5E2FA 2RL3A 3CWFA 4E3IA 4KZ9A 4L9EA 2EFXA 3RJUA 3RTYA 4CQHA 2Q9MA 4ZAMA 2P9VA 5F68A 1LLBA 1LI9A 4ZDXA 3BEBA 4IUKA 5HW3A 5D3OA 3V5MA 4JBFA 2VKSA 4PHTA 4Y7PA 5C5KA 5FAQA 2H10A 4WYYA 2YKHA 1NY0A 1T1CA 3KSFA 3C2WA 3CG5A 2QJ7A 5HPFA 2JHEA 3LO7A 4PPRA 1RCJA 4O7DA 1S4SA 2A24B 2OAP1 5GLCA 1O07A 5FEFA 5L2FA 4JGRA 3IXDA 3B33A 3UDXA 2WGWB 4OH0A 2X71A 1K56D 1U60A 1J9MA 3G4PA 4UA6A 5F5YA 1H8ZA 1CI8A 4OPQA 3AGEA 3ZG5A 1IELA 5HAQA 3OPLA 2ZLYA 5GL9A 3CZDA 3RXWA 1DRMA 5HFOA 4QY5A 3ZHHA 5HAPA 4WMCD 5FI2A 2J9PA 3W4OA 5EOEA 3CI6A 4ETZA 2PAVP 1HLUP 3IH9A 2P9VB 3SS3A 3P98A 5L09A 3VP0A 2NUPC 2JCHA 2PR5A 5CHMA 3ZFZA 2KLIA 1VETB 4HQAA 1BLPA 2W3DA 2OLUA 3EEHA 1IEMA 3G32A 5HPIA 2D01A 2PD7A 1K0KA 3Q7VA 4PMAA 5JYOA 1S66L 3NOPC 2OOLA 3T4QA 2KX6A 1MWRA 1VHMA 4OLDA 3NDGA 4JXWA 2EX2A 2V0WA 3HJIA 4IBXA 4IHQA 4KZ8A 3UB6A 4NXEA 4JPMA 1ZKJA 3D9YA 3UPPA 1K54C 4QU3A 2J80A 1K54A 2J3WA 3MFDA 1IKIA 1VEUA 2BASA 3DBAA 4UQIM 1T19A 1SKOA 1IOUA 3O3VA 5A90A 1N9NA 5EVIC 3P7NA 3N6IA 2Y79A 2P74A 1K4EA 2PD8A 3UMEA 1TS7A 4DKIA 1ERQA 4HJ6A 2V0UA 4LV1A 2ZQDA 2JKGA 2FZ0A 2L4RA 2EXAA 4C3QA 4BLMA 4CLCE 5EPHA 2W1RA 2H0TA 4JXGA 1KDWA 4EV4A 3IXGA 4U3TA 4P6ZS 5FQ9A 3Q07A 1GSWA 1FCMA 1P9WA 3PYPA 1KVMA 3N8SA 2JKRI 3V3RA 3OPRA 2ZQAA 4UEYA 3UB7A 1GHIA 3Q7VB 3E4OA 2O0YA 5TJJA 4E3KA 4OP8A 2ZQ8A 5KSCA 4II7A 3NOUC 4KQDA 3FPVA 1CF0A 2XR0A 4WF0A 4HIAA 3G2YA 4S2IA 1VM1A 3KYQA 3W4QA 3Q1FA 3LI8A 1SKOB 4Y3IA 2Y2GA 1LI0A 2YKFA 2Y2LA 3Q81A 3UN7A 4FOFA 4QB8A 4ME4A 1YLWA 1RGZA 5KSHA 4HI4A 3UO9A 1L3LA 3O87A 4N1XA 3TSGA 1ESIA 2V1AA 4LGWA 3LYXA 4HBTA 4GLQA 3CITA 3C5AA 5JYPA 3HL9A 2V20A 2XH9A 2PYPA 1E25A 3G35A 2OSUA 3MFXA 1SKFA 4JKTA 3NCKA 3E4QA 4DF6A 4ARZB 3ISGA 3LEZA 4MNRA 5AQ7A 2XRNA 2V8FA 3ZQ5A 4O8GA 2M1CA 2WAEA 5HD5A 2MJ6A 1I2WA 4KZ4A 3ZCZA 1N4OA 1F5MA 3R4KA 4YFMA 2Z2LB 3R7WA 4KQOA 4XT2A 3BY8A 1G5UA 5G4ZA 4BL3A 2VJWA 4LRXC 5EV0A 2XDMA 2QJ5A 3EWKA 5U47A 4IJGA 3S1YA 4EESA 3NECA 1IYPA 4MN7A 4X25A 4BL2A 3AGDA 5E2EA 2OWJA 1OPXA 2X02A 3T4JA 3RFBA 4DE1A 3A3DA 1XJ4A 1PFLA 3MKEA 1LSVA 2Y2OA 4GD8A 1YLTA 3BWLA 2M7UA 1MC0A 4FUWA 4Y5FA 3KX0X 4GB7A 2DCFA 1WYBA 1OTBA 3QP5A 3QP1A 3UE3A 2W1TA 3VMAA 1F98A 2IA2A 2UWXA 3K2NA 4DRTA 1W5DA 4HJ3A 1NRJA 4RA7A 2XA7S 2XEPA 1DP6A 4HOIA 4UA7A 1A0KA 2JC7A 4Y13A 5F1FA 2PDRA 2B5RA 3IHAA 1JVJA 1RGYA 4XT2B 3KYEA 3S22A 1JWZA 5HWTA 5CGWA 1AXBA 2A2LA 3HCYA 3HLDA 1CJFA 2K7SA 4R4SA 1SZVA 5FDHA 1XGIA 4ZTKA 5F69A 5I94A 1XJ3A 1YMSA 2VV6A 5HDSA 3HVFA 3NJAA 1FQGA 2XD1A 2HV1A 2Y2JA 3V50A 2A3UA 4JF5A 1HD8A 3L7HA 1SDEA 1YLYA 1YLPA 5F82A 3G31A 3HBRA 4JGOA 4I38A 2VZWA 4BENA 1CQAA 4WZ5C 3C4OA 2VA0A 2CMNA 2Z6CA 4GHIA 4EEPA 2O9AA 1OT9A 4UA9A 3LY4A 4CLCD 1DP9A 3S7OA 5E2HA 2JKTI 2E8JA 3A0VA 4OPRA 2JBFA 3QNCA 4IVIA 4DN0A 2W1TB 2WGIA 3E2LA 5DVAA 3A3FA 3FV7A 3QP6A 3HLBA 4DXCA 2L0WA 5G18A 5GHXA 2BLSA 4K08A 2PU4A 2Z6DA 1W79A 4U0TA 3EGXC 1UWNX 2Y2IA 3LCEA 3JPUA 4E3NA 4KZ5A 2ZQ9A 3NC8A 3ZG0A 4LLOB 1NRFA 4GZBA 2R9XA 4LRZE 4LRYC 4JF4A 2INWA 3MS6A 1BT5A 3ICYA 5FASA 3A0RA 3NDEA 5CTNA 2DRWA 5HDDA 3PBNA 1YPRA 3G6OA 3MXSA 3BYDA 3IWIA 3QHYA 4FH2A 3MZDA 4G3KA 4GCZA 3KO6A 1BZAA 2WGWA 3B47A 4X55A 1GSVA 4GHIB 2QZ6A 4WEJA 3T4TA 5L07A 2QHKA 2HGVA 3SH9A 4GKUA 4S2KA 4OQ0A 5DTTA 5IS1A 4X56A 2GDNA 1TS8A 4S2PA 1ZG4A 4JF6A 1XJ6A 1MWUA 4EQ1A 4R0QA 1HTZA 1KVLA 1PI5A 2PBYA 2VEAA 3VP3A 5BOHA 1K25A 1ES3A 1MXOA 1ACFA 4H6JB 2KDKA 2DMWA 3PBTA 1KE4A 1TF1A 4N9LA 4GD6A 1HZOA 5HL1A 3ZVWA 2BG1A 1W8QA 4NETA 2ZC7A 2HJ9C 1VETA 5DF9A 4PKYG 5K5BA 3NY4A 4OVDA 3RXXA 5HL6A 4OLGA 3E2KA 1S0WA 4S2NA 3WRZA 4QY6A 1X0OA 4Q0HA 3HLFA 3WRTA 2J3TC 1IYQA 4EERA 3OLOA 4KQRA 4KZ7A 4L9FA 3HREA 3BFCA 1XA1A 4A5RA 4PM5A 1NJ4A 2I72A 5HWVA 1PWGA 1BYWA 2VGKA 1PRQA 2HJEA 1T18A 2EX9A 3LR4A 1S1ZA 5DJTA 4F94A 1TDGA 2HZ5A 4DDSA 3IXBA 3ZDJA 1W63Q 3SS5A 4LV3A 4RVAA 2ZOIA 1K6SA 3BJNA 3TE8A 1K56A 3ZVTA 4K91A 4R38A 4OOYA 3RH8B 4L9GA 1G6OA 3BFFA 4R3JA 4ZJ2A 1TVFA 4KZBA 4RX2A 3T1QB 4YOFA 3BY9A 4Q8IA 4R1GA 2FFFB 1ZTUA 4RYEA 3SZTA 4R23A 4I39A 4WUJA 2HDSA 4MCWA 1PWCA 3HLWA 3SW1A 4E3MA 5FI6A 2VK3A 4EW7A 5FAOA 1XKZA 2XD5A 1FR1A 5KMWA 1XP4A 4Q0IA 1P9RA 1FILA 1JNUA 1Y28A 5I5LA 3F1PB 4P6ZM 4E3OA 3FPWA 1G28A 3IBJA 2G2WA 5J7EA 5DJUA 1P97A 1VB6A 4OKPA 4N9KA 2QKPA 1W63M 4BD1A 1E3UD 1GSXA 3DTKA 1Z09A 1H3QA 5EUAA 1Y54A 3T50A 3UE0A 1ZC2A 2H5SA 5EVID 1K38A 3BFEA 1TEMA 1N9LA 5DTKA 3VP2A 2PT7A 2G7UA 4ZBEA 3UPOA 4ETXA 1IKGA 5DKLA 1M6KA 3C7UA 1LL9A 5M1AA 4XUXA 4LENA 4B4XA 1W7FA 1MKMA 3ITBA 5CRFA 4FH4A 2C5WB 3HJKA 3HLGA 3VE4A 1MZUA 5M19A 2QPNA 3O88A 1XJ2A 5FQMA 1MY8A 4I3JA 3G30A 3VOZA 4HP9A 3DWZA 3OCNA 1DJAA 4PM6A 1O7EA 4GNUA 3LIDA 3UDFA 4ARZA 3KSGA 1IFQA 4MEZA 3UMDA 5F1GA 4QHCA 4D2OA 5GLDA 3MZFA 2L1MA 4DJ3A 1MWSA 3JVVA 4Y0OA 5DFXA 1BULA 5CEBA 4I3IA 1YSQA 4E6WA 3QP8A 4ESPA 1YQSA 3BLSA 1BLCA 3GTCA 3M6BA 3BM6A 4F3LA 3TRCA 1XA7A 2ACGA 5GHYA 4L0LA 4X1MA 5HD3A 5KZHA 4CPKA 4CJNA 5J4EA 2QWSA 5AQ9A 2JE5A 2PRFA 4NXGA 4I3AA 4YINA 3T12B 3LY3A 1RP5A 1EI5A 3IQAA 4E04A 1TS6A 3GSGA 5EVIB 3MBZA 4LCLA 3EEAA 3LR3A 3TG9A 4KUKA 1PIOA 3UY6A 2NUTC 3BRMA 2VGLM 4JXSA 1ES5A 1KGGA 1DJBA 3PAGA 1TD5A 4DXBA 1D7EA 4DE2A 4Y17A 1ES2A 3NBLA 3DTMA 3VFHA 3ZG9B 1PWDA 4LV2A 1ES4A 3FG8A 1L0FA 3N8LA 2IWBA 2LB9A 1AWIA 2WZZA 4E3JA 5E2GA 4E6XA 1OTEA 2ZOHA 3IH8A 3E0YA 3UNWA 2XGNA 5J3WA 3O86A 3BLMA 4XUZA 2W3HA 2ZC6B 2B95A 4ID4A 1FSWA 3GR2A 1DP8A 4F3LB 4KZAA 3EOIA 4NEED 3IF6A 3D72A 1YMXA 3F1NB 4M4XA 4WELA 2XA7M 2ZMFA 2G2UA 3IBRA 4NG2A 3OBFA 4KG5A 1EROA 3LI9A 3N4IA 5GLAA 2WKQA 4AFIA 3S4XA 1E4DA 3VE3A 4OP5A 2HF6A 1J3WA 4KZ6A 4GS9B 3DTIA 1YT4A 4R70A 2VV8A 2ZC4B 3FKWA 5IU1A 1ALQA 1PW8A 2C6WB 1W8YA 1H8YA 3T4KA 5DTSA 4OPZA 3CLOA 2A49A 4PAUA 3MF0A 3P01A 3V67A 1NLYA 1KDSA 2V9AA 3MKFA 4UHUA 3LEQA 5AVFA 4WM9A 4BMWA 2Y91A 2ZMAA 1LSWA 1WYCA 4PM8A 2XSSA 2XROA 2Y55A 4MBFA 3IF6B 5A93A 3GRJA 3NULA 2HPBA 1ONGA 3V39A 4BBUA 5CEDA 1TDLA 2HP5A 1D1JA 1N9BA 2EA9A 4S2MA 4S2LA 5DF7A 3KSIA 5IT5A 4X68A 1PW1A 3WS2A 3GDIA 1GHMA 2HP9A 4Y0UA 1GA9A 4NXFA 1H5XA 1NZOA 1KGEA 3FZCA 4C6YA 4Y2FA 5HWWA 1K57A 1FOFA 2ZM0A 1YLZA 3T4LA 5A92A 1VQQA 1IYOA 3ZNTA 2J9OA 3B42A 2EX8A 2Y2MA 1SDNA 5FQQA 2JKFA 3Q82A 4IVKA 1OTIA 2WADA 2WYXA 2EXBA 3VSKA 3CJMA 4OPYA 3SS4A 3O5YA 4WZ4A 3CUEA 3ZNYA 4JGQA 5TBMB 3MR0A 3MXRA 5EVEA 3UDIA 2XK1A 2WKIA 4CLCA 4OOMA 1XGJA 4H6JA 2I9VA 2VX8A 2XF3A 1YKDA 1S6RA 2Y59A 2PBDP 1KOUA 5CTMA 4X1LA 4PKYA 1STZA 2O99A 1GA0A 3VV4A 1NLZA 4C75A 3T4OA 3I7JA 5MC7A 5EVLA 4B93A 5EM1A 1G6AA 1Y4OA 2E8IA 3CMZA 1ESUA 4LPZA 1CK3A 1P0ZA 5E43A 3GQZA 3OC2A 3CPTA 2QYBA 5HDCA 2ZC5B 2WK0A 3PBOA 4N1HA 5EM0A 3PTEA 1QMEA 2ZL1A 4JLFA 3T1SA 5HSQA 3U2AA 3N8RA 1L0GA 2AVXA 3D3OA 2Y2KA 4X69A 3VP1A 3JYIA 1NXYA 2WZXA 2Y2PA 2PHYA 4EU0A 5FEGA 1S1YA 5LBRA 1QMFA 3FC7A 3VFFA 4YNRA 3PBSA 3C38A 4MN6A 3K3DA 3IWOA 1S67L 4CLCB 5EFWA 1Q2QA 3DTEA 3ZGAB 5AJGA 2GZAA 2DNSA 3C8CA 3TJZC 4WLAA 4K0XA 4Z1WA 4S2NC 1UWPX 4S2JA 3LUQA 3OZHA 4NKPA 4Y15A 2J3TD 4X6TA 5J8XA 4BBVA 3F1PA 1LT0A 1GCEA 3DWKA 4Z9QA 3KSHA 3HUMA 1SCWA 1BLHA 4EBLA 3LIEA 4HNBA 4O0PA 3CPTB 4KUOA 2WKPA 1KGFA 4RX3A 2KOIA 1L2SA 3T1XA 3PBQA 2ZL1B 3NI9A 1YM1A 4XXRA 3S7QA 2J7VA 3C30A 2V1BA 2BTFP 3W4PA 5DFYA 3EGDC 4FCFA 3MJQA 1K6RA 3H82A 5TR7A 2W3FA 4IUHA 3IX3A 3M2KA 2WKHA 4DDYA 4ZJ3A 2P04A 3MQQA 3HLEA 2O9CA 4FTXA 4WL9A 2K31A 2D02A 1BTLA 4GOGA
chains in the Genus database with same CATH topology
1PYYA 4GB7A 2DCFA 1WYBA 1PI4A 4BJPA 2R9WA 5GHYA 4GDBA 4L0LA 2J8YA 3WS5A 5KZHA 3UE3A 4CPKA 1LHYA 3BFGA 5FSRA 4CJNA 3VMAA 2UWXA 4WMCA 3IF5A 2X01A 5AQ9A 2H0YA 2JE5A 3Q7ZA 4DRTA 4YINA 1W5DA 1I5QA 4RA7A 2XEPA 3LY3A 3DW0A 1XXMA 4UA7A 1RP5A 3WS4A 1CEGA 1EI5A 2JC7A 3IQAA 5F1FA 3GSGA 2B5RA 3IHAA 1JVJA 3MBZA 5AQAA 5EVIB 4LCLA 4DE0A 2ZJ9A 3TG9A 1RGYA 1PIOA 5CHUA 4PM9A 3UY6A 2V2FF 1JTDA 1MKIA 3MZEA 5FQIA 5TGFA 3BRMA 1GHPA 1MBLA 3W8KA 4S2OA 3IXHA 3S22A 1MWTA 1JWZA 3G34A 3P09A 3VP4A 1K55C 3GVBA 4JXSA 1ES5A 5CGWA 1AXBA 1KGGA 5CHJA 1DJBA 1K55A 2IWDA 2XQZA 3PAGA 4DXBA 3HLDA 1FCNA 1SHVA 4R4SA 5CXWA 4DE2A 5HX9A 2XFTA 2ZM2A 4PM7A 1ES2A 3NBLA 5FDHA 4IEDA 1XGIA 3DTMA 4KG2A 3VFHA 4WEKA 5E2FA 4ZTKA 2RL3A 3ZG9B 1PWDA 4LV2A 5I94A 1ES4A 4DE3A 1L0FA 1YMSA 2IWCA 3N8LA 4B4ZA 2IWBA 4E3IA 2WZZA 3HVFA 4E3JA 1FQGA 4KZ9A 5E2GA 2XD1A 2EFXA 4E6XA 2Y2JA 3RJUA 3V50A 3IH8A 2A3UA 4JF5A 3C4PA 1HD8A 3EQVA 1E3UA 1SDEA 1YLYA 1YLPA 3UNWA 2Q9MA 2XGNA 5CECA 3O86A 1JTGA 3BLMA 4ZAMA 3OPPA 4XUZA 3WWXA 2P9VA 3G31A 5F82A 3HBRA 2ZC6B 3HLCA 1LLBA 1LI9A 1M40A 3D4FA 5EVIA 4R4RA 4BENA 4ID4A 1FSWA 3GR2A 4ZDXA 3BEBA 4WZ5C 3C4OA 4N92A 5GLBA 5D3OA 5HW3A 3V5MA 4KZAA 1FCOA 4JBFA 3IF6A 1FSYA 1DJCA 4Y7PA 5FAQA 4UA9A 2HDUA 1MPLA 5CGSA 3LY4A 3WS1A 1YMXA 5E2HA 2H10A 1FR6A 4WYYA 1NY0A 4OPRA 5FA7A 1JWPA 2JBFA 4WELA 3QNCA 3CG5A 4IVIA 4X53A 2G2UA 2WGIA 3LO7A 3E2LA 5DVAA 4PPRA 1RCJA 4O7DA 3N7WA 4KG5A 3A3FA 3FV7A 3OCLA 1EROA 4JXVA 3HLBA 3N4IA 5GLAA 4DXCA 1DY6A 2Y4AA 5G18A 5GLCA 1O07A 5GHXA 5L2FA 2BLSA 2PU4A 3S4XA 1E4DA 5EECA 4OP5A 3IXDA 3UDXA 1W79A 4U0TA 2WGWB 4OH0A 2X71A 1K56D 4KZ6A 1U60A 1J9MA 2Y2IA 1WE4A 3G4PA 3LCEA 4P85A 4UA6A 1YT4A 1H8ZA 2ZC4B 1PZOA 4LV0A 1CI8A 3FKWA 4E3NA 4OPQA 4KZ5A 3AGEA 1ALQA 2ZQ9A 1PW8A 3NC8A 3ZG0A 1IELA 3ZG5A 5HAQA 2C6WB 1PZPA 1W8YA 1H8YA 2ZLYA 3OPLA 5GL9A 3CZDA 5DTSA 4OPZA 3RXWA 1NRFA 5HFOA 4GZBA 2A49A 2R9XA 4P87A 4QD4A 3GMWA 4JF4A 1YLJA 2OV5A 4EBPA 4QY5A 1BT5A 3IWQA 3ZHHA 5HAPA 1KDSA 4WMCD 5FI2A 5FASA 3NDEA 2XFSA 2DRWA 3MKFA 3B3XA 4UHUA 5CTNA 4EUZA 1Z6FA 3NIAA 4KQQA 4WM9A 2J9PA 3PBNA 2Y2NA 5EOEA 3W4OA 2Y91A 2ZMAA 3MXSA 3BYDA 1EWZA 3IWIA 3IH9A 3QHYA 2P9VB 1WYCA 4FH2A 4UAAA 3MZDA 3SS3A 3P98A 3VP0A 3A3JA 1BZAA 2WGWA 2JCHA 4PM8A 5CHMA 3ZFZA 1OMEA 3UE1A 5A91A 2CC1A 5AQBA 3V3SA 4X55A 3M6HA 1ZG6A 4E3LA 4EWFA 2Y55A 4MBFA 1BLPA 2QZ6A 3IF6B 5A93A 2OLUA 3QNBA 4WEJA 3GRJA 1IEMA 3G32A 2HPBA 1NYMA 1ONGA 3Q7VA 2HDRA 3SH9A 2ZC3B 4PMAA 4GKUA 5JYOA 4S2KA 4BQMA 3V39A 4OQ0A 5DTTA 5CEDA 1TDLA 2HP5A 1MWRA 3FKVA 1N9BA 4X56A 4OLDA 2GDNA 3NDGA 1ZG4A 4JF6A 2EX2A 4JXWA 4NK3A 4S2PA 4S2MA 4S2LA 1MWUA 5DF7A 3ZG8B 1L0EA 4M3KA 4R0QA 1NZUA 1HTZA 4IBXA 4X68A 4KZ8A 3UPNA 1PW1A 4JPMA 1KVLA 1ZKJA 1PI5A 2PBYA 3VP3A 3WS2A 3UPPA 1GHMA 1K54C 1K25A 4QU3A 5BOHA 1ES3A 1MXOA 2HP9A 1K54A 1GA9A 3MFDA 4Y0UA 3SH8A 1IKIA 1H5XA 1NZOA 1KGEA 3FZCA 4WBGA 4C6YA 3PBTA 1KE4A 1K57A 1CEFA 4N9LA 4GD6A 3O3VA 5A90A 1FOFA 2ZM0A 5EVIC 1HZOA 1NYYA 5HL1A 1YLZA 3N6IA 3ZVWA 2BG1A 1W8QA 2P74A 4NETA 1K4EA 4P6BA 2RCXA 4MBHA 2ZC7A 5DF9A 5A92A 3NY4A 4OVDA 1VQQA 1IYOA 3IF6C 3RXXA 3ZNTA 4DKIA 4OLGA 3SH7A 3E2KA 1ERQA 1S0WA 4LV1A 2J9OA 4S2NA 2ZQDA 3PAEA 2EX8A 3WRZA 2EXAA 2Y2MA 1SDNA 4QY6A 5FQQA 4C3QA 3IHBA 4BLMA 5EPHA 2WUQA 3Q82A 4IVKA 2H0TA 3HLFA 2WADA 2WYXA 3WRTA 1IYQA 2EXBA 3TOIA 3CJMA 4KQRA 2ZD8A 4OPYA 3VSKA 3WS0A 4JXGA 3SS4A 4KZ7A 1KDWA 4EV4A 3OPHA 4WZ4A 3HREA 5FAPA 3ZG7B 3HUNA 3IXGA 4KZ3A 4U3TA 3ZNYA 3BFCA 1XA1A 4A5RA 3FWLA 4PM5A 5FQ9A 3Q07A 4HESA 1FCMA 3MXRA 1NJ4A 1KVMA 2I72A 2ZQ7A 3UDIA 5CGXA 2XK1A 2WKIA 5TFQA 1PWGA 3N8SA 1XGJA 4OOMA 2ZM8A 2VGKA 1ONHA 3V3RA 2EX9A 3OPRA 2PU2A 2ZQAA 1Q2PA 4F94A 1CI9A 2XF3A 2Y2HA 5M18A 1S6RA 1TDGA 1GHIA 3Q7VB 4DDSA 4EBNA 3IXBA 1BSGA 2Y59A 3ZDJA 4U0XA 4E3KA 5CTMA 3SS5A 4KG6A 4LV3A 4RVAA 2EFUA 3G2ZA 4OP8A 2ZQ8A 5KSCA 1GA0A 1K6SA 4C75A 5FATA 1LL5A 1K56A 3I7JA 3ZVTA 4K91A 1C3BA 3M2JA 2XR0A 4OOYA 2XLNA 4MBKA 3AGFA 3BFFA 4R3JA 5EOOA 3G2YA 4ZJ2A 5EVLA 1TVFA 4GN2A 4S2IA 2Z2MB 1G6AA 4KZBA 4RX2A 1VM1A 2E8IA 3CMZA 1KE3A 1ESUA 2HP6A 3W4QA 1CK3A 5E43A 3Q1FA 4Q8IA 4R1GA 3EQUA 3GQZA 2QMIA 3GV9A 2FFFB 3OC2A 4RYEA 1ERMA 2FFYA 2Y2GA 1LI0A 5FQJA 4ZJ1A 4B88A 4R23A 2ZC5B 3IT9A 2HDSA 2WK0A 2Y2LA 3PBOA 1PWCA 3HLWA 3Q81A 3UN7A 4E3MA 4N1HA 5FQKA 4QB8A 3PTEA 1QMEA 5FI6A 5FAOA 4JLFA 1XKZA 4R3BA 2Y2QA 4Y0TA 2XD5A 3HUOA 1YLWA 2VGJA 1RGZA 5KSHA 3BECA 1FR1A 5FI7A 5KMWA 1XP4A 2ZQCA 3UO9A 4OOLA 3N8RA 3O87A 1L0GA 1HVBA 1BLSA 4N1XA 3A3IA 3VOYA 3TSGA 1ESIA 4E3OA 3BFDA 2WAFA 1KE0A 2Y2KA 4HBTA 4X69A 3VP1A 3JYIA 1NXYA 2G2WA 2WZXA 2Y2PA 4KENB 3A3EA 3C5AA 4OKPA 4N9KA 4BD1A 1QMFA 1E3UD 5JYPA 3VFFA 3HL9A 2WKEA 2HDQA 3PBSA 5EUAA 1Y54A 2V20A 2XH9A 5CERA 3IWOA 3UE0A 1Q2QA 1K57C 1ZC2A 1E25A 2H5SA 3G35A 5EVID 3ZGAB 2OSUA 1SKFA 4JKTA 1I2SA 3NCKA 4GDNA 1G68A 4LCMA 1K38A 5F83A 3BFEA 4MLLA 2DNSA 1TEMA 3VSLA 4DF6A 3ISGA 5DTKA 4K0XA 2EX6A 3VP2A 4H8RA 3LEZA 4S2NC 4ZBEA 4MNRA 5AQ7A 3UPOA 1IKGA 4S2JA 4BD0A 1M6KA 1JWVA 3OZHA 3C7UA 1LL9A 2WAEA 3PBRA 1BUEA 5M1AA 4XUXA 4X6TA 4LENA 5J8XA 2V1ZA 1I2WA 4KZ4A 4B4XA 3ZCZA 1GCEA 1W7FA 3C7VA 3DWKA 1N4OA 4Z9QA 2OLVA 4YFMA 5HAIA 3ITBA 5CRFA 4FH4A 2Z2LB 2C5WB 3FYZA 3HLGA 3HUMA 4WZ5A 4EQIA 1SCWA 1BLHA 4KQOA 4EBLA 2QPNA 5M19A 3O88A 5FQMA 1IYSA 1MY8A 4FD8A 4BL3A 5DF8A 3G30A 5HARA 3VOZA 1KGFA 1XPBA 4RX3A 2XDMA 1L2SA 3PBQA 5U47A 3S1YA 3DWZA 3NI9A 3ITAA 3OCNA 1YM1A 1DJAA 5IHVA 4PM6A 1L0DA 1O7EA 4XXRA 4GNUA 2Q9NA 3UDFA 4QJGA 1IYPA 4BL2A 4MEZA 4OONA 5F1GA 3AGDA 2J7VA 4QHCA 5E2EA 5GHZA 5GLDA 4D2OA 3MZFA 2X02A 3W4PA 4DE1A 1MWSA 3A3DA 4FCFA 4Y0OA 1BULA 5CEBA 1K4FA 3MKEA 4E6WA 4OQIA 1K6RA 2Y2OA 5TR7A 4P0MA 1YQSA 3BLSA 3M2KA 1BLCA 3GTCA 2WKHA 4FSFA 4GD8A 4IBRA 4K0WA 1YLTA 1XX2A 3M6BA 5EE8A 4ZJ3A 4DDYA 4OQHA 3BM6A 4HBUA 3HLEA 4HEFA 2WGVA 1XA7A 3SOIA 4OQGA 1BTLA 4GOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYY A;  4GB7 A;  2DCF A;  1WYB A;  1PI4 A;  4BJP A;  2R9W A;  5GHY A;  4GDB A;  4L0L A;  2J8Y A;  3WS5 A;  5KZH A;  3UE3 A;  4CPK A;  1LHY A;  3BFG A;  5FSR A;  4CJN A;  3VMA A;  2UWX A;  4WMC A;  3IF5 A;  2X01 A;  5AQ9 A;  2H0Y A;  2JE5 A;  3Q7Z A;  4DRT A;  4YIN A;  1W5D A;  1I5Q A;  4RA7 A;  2XEP A;  3LY3 A;  3DW0 A;  1XXM A;  4UA7 A;  1RP5 A;  3WS4 A;  1CEG A;  1EI5 A;  2JC7 A;  3IQA A;  5F1F A;  3GSG A;  2B5R A;  3IHA A;  1JVJ A;  3MBZ A;  5AQA A;  5EVI B;  4LCL A;  4DE0 A;  2ZJ9 A;  3TG9 A;  1RGY A;  1PIO A;  5CHU A;  4PM9 A;  3UY6 A;  2V2F F;  1JTD A;  1MKI A;  3MZE A;  5FQI A;  5TGF A;  3BRM A;  1GHP A;  1MBL A;  3W8K A;  4S2O A;  3IXH A;  3S22 A;  1MWT A;  1JWZ A;  3G34 A;  3P09 A;  3VP4 A;  1K55 C;  3GVB A;  4JXS A;  1ES5 A;  5CGW A;  1AXB A;  1KGG A;  5CHJ A;  1DJB A;  1K55 A;  2IWD A;  2XQZ A;  3PAG A;  4DXB A;  3HLD A;  1FCN A;  1SHV A;  4R4S A;  5CXW A;  4DE2 A;  5HX9 A;  2XFT A;  2ZM2 A;  4PM7 A;  1ES2 A;  3NBL A;  5FDH A;  4IED A;  1XGI A;  3DTM A;  4KG2 A;  3VFH A;  4WEK A;  5E2F A;  4ZTK A;  2RL3 A;  3ZG9 B;  1PWD A;  4LV2 A;  5I94 A;  1ES4 A;  4DE3 A;  1L0F A;  1YMS A;  2IWC A;  3N8L A;  4B4Z A;  2IWB A;  4E3I A;  2WZZ A;  3HVF A;  4E3J A;  1FQG A;  4KZ9 A;  5E2G A;  2XD1 A;  2EFX A;  4E6X A;  2Y2J A;  3RJU A;  3V50 A;  3IH8 A;  2A3U A;  4JF5 A;  3C4P A;  1HD8 A;  3EQV A;  1E3U A;  1SDE A;  1YLY A;  1YLP A;  3UNW A;  2Q9M A;  2XGN A;  5CEC A;  3O86 A;  1JTG A;  3BLM A;  4ZAM A;  3OPP A;  4XUZ A;  3WWX A;  2P9V A;  3G31 A;  5F82 A;  3HBR A;  2ZC6 B;  3HLC A;  1LLB A;  1LI9 A;  1M40 A;  3D4F A;  5EVI A;  4R4R A;  4BEN A;  4ID4 A;  1FSW A;  3GR2 A;  4ZDX A;  3BEB A;  4WZ5 C;  3C4O A;  4N92 A;  5GLB A;  5D3O A;  5HW3 A;  3V5M A;  4KZA A;  1FCO A;  4JBF A;  3IF6 A;  1FSY A;  1DJC A;  4Y7P A;  5FAQ A;  4UA9 A;  2HDU A;  1MPL A;  5CGS A;  3LY4 A;  3WS1 A;  1YMX A;  5E2H A;  2H10 A;  1FR6 A;  4WYY A;  1NY0 A;  4OPR A;  5FA7 A;  1JWP A;  2JBF A;  4WEL A;  3QNC A;  3CG5 A;  4IVI A;  4X53 A;  2G2U A;  2WGI A;  3LO7 A;  3E2L A;  5DVA A;  4PPR A;  1RCJ A;  4O7D A;  3N7W A;  4KG5 A;  3A3F A;  3FV7 A;  3OCL A;  1ERO A;  4JXV A;  3HLB A;  3N4I A;  5GLA A;  4DXC A;  1DY6 A;  2Y4A A;  5G18 A;  5GLC A;  1O07 A;  5GHX A;  5L2F A;  2BLS A;  2PU4 A;  3S4X A;  1E4D A;  5EEC A;  4OP5 A;  3IXD A;  3UDX A;  1W79 A;  4U0T A;  2WGW B;  4OH0 A;  2X71 A;  1K56 D;  4KZ6 A;  1U60 A;  1J9M A;  2Y2I A;  1WE4 A;  3G4P A;  3LCE A;  4P85 A;  4UA6 A;  1YT4 A;  1H8Z A;  2ZC4 B;  1PZO A;  4LV0 A;  1CI8 A;  3FKW A;  4E3N A;  4OPQ A;  4KZ5 A;  3AGE A;  1ALQ A;  2ZQ9 A;  1PW8 A;  3NC8 A;  3ZG0 A;  1IEL A;  3ZG5 A;  5HAQ A;  2C6W B;  1PZP A;  1W8Y A;  1H8Y A;  2ZLY A;  3OPL A;  5GL9 A;  3CZD A;  5DTS A;  4OPZ A;  3RXW A;  1NRF A;  5HFO A;  4GZB A;  2A49 A;  2R9X A;  4P87 A;  4QD4 A;  3GMW A;  4JF4 A;  1YLJ A;  2OV5 A;  4EBP A;  4QY5 A;  1BT5 A;  3IWQ A;  3ZHH A;  5HAP A;  1KDS A;  4WMC D;  5FI2 A;  5FAS A;  3NDE A;  2XFS A;  2DRW A;  3MKF A;  3B3X A;  4UHU A;  5CTN A;  4EUZ A;  1Z6F A;  3NIA A;  4KQQ A;  4WM9 A;  2J9P A;  3PBN A;  2Y2N A;  5EOE A;  3W4O A;  2Y91 A;  2ZMA A;  3MXS A;  3BYD A;  1EWZ A;  3IWI A;  3IH9 A;  3QHY A;  2P9V B;  1WYC A;  4FH2 A;  4UAA A;  3MZD A;  3SS3 A;  3P98 A;  3VP0 A;  3A3J A;  1BZA A;  2WGW A;  2JCH A;  4PM8 A;  5CHM A;  3ZFZ A;  1OME A;  3UE1 A;  5A91 A;  2CC1 A;  5AQB A;  3V3S A;  4X55 A;  3M6H A;  1ZG6 A;  4E3L A;  4EWF A;  2Y55 A;  4MBF A;  1BLP A;  2QZ6 A;  3IF6 B;  5A93 A;  2OLU A;  3QNB A;  4WEJ A;  3GRJ A;  1IEM A;  3G32 A;  2HPB A;  1NYM A;  1ONG A;  3Q7V A;  2HDR A;  3SH9 A;  2ZC3 B;  4PMA A;  4GKU A;  5JYO A;  4S2K A;  4BQM A;  3V39 A;  4OQ0 A;  5DTT A;  5CED A;  1TDL A;  2HP5 A;  1MWR A;  3FKV A;  1N9B A;  4X56 A;  4OLD A;  2GDN A;  3NDG A;  1ZG4 A;  4JF6 A;  2EX2 A;  4JXW A;  4NK3 A;  4S2P A;  4S2M A;  4S2L A;  1MWU A;  5DF7 A;  3ZG8 B;  1L0E A;  4M3K A;  4R0Q A;  1NZU A;  1HTZ A;  4IBX A;  4X68 A;  4KZ8 A;  3UPN A;  1PW1 A;  4JPM A;  1KVL A;  1ZKJ A;  1PI5 A;  2PBY A;  3VP3 A;  3WS2 A;  3UPP A;  1GHM A;  1K54 C;  1K25 A;  4QU3 A;  5BOH A;  1ES3 A;  1MXO A;  2HP9 A;  1K54 A;  1GA9 A;  3MFD A;  4Y0U A;  3SH8 A;  1IKI A;  1H5X A;  1NZO A;  1KGE A;  3FZC A;  4WBG A;  4C6Y A;  3PBT A;  1KE4 A;  1K57 A;  1CEF A;  4N9L A;  4GD6 A;  3O3V A;  5A90 A;  1FOF A;  2ZM0 A;  5EVI C;  1HZO A;  1NYY A;  5HL1 A;  1YLZ A;  3N6I A;  3ZVW A;  2BG1 A;  1W8Q A;  2P74 A;  4NET A;  1K4E A;  4P6B A;  2RCX A;  4MBH A;  2ZC7 A;  5DF9 A;  5A92 A;  3NY4 A;  4OVD A;  1VQQ A;  1IYO A;  3IF6 C;  3RXX A;  3ZNT A;  4DKI A;  4OLG A;  3SH7 A;  3E2K A;  1ERQ A;  1S0W A;  4LV1 A;  2J9O A;  4S2N A;  2ZQD A;  3PAE A;  2EX8 A;  3WRZ A;  2EXA A;  2Y2M A;  1SDN A;  4QY6 A;  5FQQ A;  4C3Q A;  3IHB A;  4BLM A;  5EPH A;  2WUQ A;  3Q82 A;  4IVK A;  2H0T A;  3HLF A;  2WAD A;  2WYX A;  3WRT A;  1IYQ A;  2EXB A;  3TOI A;  3CJM A;  4KQR A;  2ZD8 A;  4OPY A;  3VSK A;  3WS0 A;  4JXG A;  3SS4 A;  4KZ7 A;  1KDW A;  4EV4 A;  3OPH A;  4WZ4 A;  3HRE A;  5FAP A;  3ZG7 B;  3HUN A;  3IXG A;  4KZ3 A;  4U3T A;  3ZNY A;  3BFC A;  1XA1 A;  4A5R A;  3FWL A;  4PM5 A;  5FQ9 A;  3Q07 A;  4HES A;  1FCM A;  3MXR A;  1NJ4 A;  1KVM A;  2I72 A;  2ZQ7 A;  3UDI A;  5CGX A;  2XK1 A;  2WKI A;  5TFQ A;  1PWG A;  3N8S A;  1XGJ A;  4OOM A;  2ZM8 A;  2VGK A;  1ONH A;  3V3R A;  2EX9 A;  3OPR A;  2PU2 A;  2ZQA A;  1Q2P A;  4F94 A;  1CI9 A;  2XF3 A;  2Y2H A;  5M18 A;  1S6R A;  1TDG A;  1GHI A;  3Q7V B;  4DDS A;  4EBN A;  3IXB A;  1BSG A;  2Y59 A;  3ZDJ A;  4U0X A;  4E3K A;  5CTM A;  3SS5 A;  4KG6 A;  4LV3 A;  4RVA A;  2EFU A;  3G2Z A;  4OP8 A;  2ZQ8 A;  5KSC A;  1GA0 A;  1K6S A;  4C75 A;  5FAT A;  1LL5 A;  1K56 A;  3I7J A;  3ZVT A;  4K91 A;  1C3B A;  3M2J A;  2XR0 A;  4OOY A;  2XLN A;  4MBK A;  3AGF A;  3BFF A;  4R3J A;  5EOO A;  3G2Y A;  4ZJ2 A;  5EVL A;  1TVF A;  4GN2 A;  4S2I A;  2Z2M B;  1G6A A;  4KZB A;  4RX2 A;  1VM1 A;  2E8I A;  3CMZ A;  1KE3 A;  1ESU A;  2HP6 A;  3W4Q A;  1CK3 A;  5E43 A;  3Q1F A;  4Q8I A;  4R1G A;  3EQU A;  3GQZ A;  2QMI A;  3GV9 A;  2FFF B;  3OC2 A;  4RYE A;  1ERM A;  2FFY A;  2Y2G A;  1LI0 A;  5FQJ A;  4ZJ1 A;  4B88 A;  4R23 A;  2ZC5 B;  3IT9 A;  2HDS A;  2WK0 A;  2Y2L A;  3PBO A;  1PWC A;  3HLW A;  3Q81 A;  3UN7 A;  4E3M A;  4N1H A;  5FQK A;  4QB8 A;  3PTE A;  1QME A;  5FI6 A;  5FAO A;  4JLF A;  1XKZ A;  4R3B A;  2Y2Q A;  4Y0T A;  2XD5 A;  3HUO A;  1YLW A;  2VGJ A;  1RGZ A;  5KSH A;  3BEC A;  1FR1 A;  5FI7 A;  5KMW A;  1XP4 A;  2ZQC A;  3UO9 A;  4OOL A;  3N8R A;  3O87 A;  1L0G A;  1HVB A;  1BLS A;  4N1X A;  3A3I A;  3VOY A;  3TSG A;  1ESI A;  4E3O A;  3BFD A;  2WAF A;  1KE0 A;  2Y2K A;  4HBT A;  4X69 A;  3VP1 A;  3JYI A;  1NXY A;  2G2W A;  2WZX A;  2Y2P A;  4KEN B;  3A3E A;  3C5A A;  4OKP A;  4N9K A;  4BD1 A;  1QMF A;  1E3U D;  5JYP A;  3VFF A;  3HL9 A;  2WKE A;  2HDQ A;  3PBS A;  5EUA A;  1Y54 A;  2V20 A;  2XH9 A;  5CER A;  3IWO A;  3UE0 A;  1Q2Q A;  1K57 C;  1ZC2 A;  1E25 A;  2H5S A;  3G35 A;  5EVI D;  3ZGA B;  2OSU A;  1SKF A;  4JKT A;  1I2S A;  3NCK A;  4GDN A;  1G68 A;  4LCM A;  1K38 A;  5F83 A;  3BFE A;  4MLL A;  2DNS A;  1TEM A;  3VSL A;  4DF6 A;  3ISG A;  5DTK A;  4K0X A;  2EX6 A;  3VP2 A;  4H8R A;  3LEZ A;  4S2N C;  4ZBE A;  4MNR A;  5AQ7 A;  3UPO A;  1IKG A;  4S2J A;  4BD0 A;  1M6K A;  1JWV A;  3OZH A;  3C7U A;  1LL9 A;  2WAE A;  3PBR A;  1BUE A;  5M1A A;  4XUX A;  4X6T A;  4LEN A;  5J8X A;  2V1Z A;  1I2W A;  4KZ4 A;  4B4X A;  3ZCZ A;  1GCE A;  1W7F A;  3C7V A;  3DWK A;  1N4O A;  4Z9Q A;  2OLV A;  4YFM A;  5HAI A;  3ITB A;  5CRF A;  4FH4 A;  2Z2L B;  2C5W B;  3FYZ A;  3HLG A;  3HUM A;  4WZ5 A;  4EQI A;  1SCW A;  1BLH A;  4KQO A;  4EBL A;  2QPN A;  5M19 A;  3O88 A;  5FQM A;  1IYS A;  1MY8 A;  4FD8 A;  4BL3 A;  5DF8 A;  3G30 A;  5HAR A;  3VOZ A;  1KGF A;  1XPB A;  4RX3 A;  2XDM A;  1L2S A;  3PBQ A;  5U47 A;  3S1Y A;  3DWZ A;  3NI9 A;  3ITA A;  3OCN A;  1YM1 A;  1DJA A;  5IHV A;  4PM6 A;  1L0D A;  1O7E A;  4XXR A;  4GNU A;  2Q9N A;  3UDF A;  4QJG A;  1IYP A;  4BL2 A;  4MEZ A;  4OON A;  5F1G A;  3AGD A;  2J7V A;  4QHC A;  5E2E A;  5GHZ A;  5GLD A;  4D2O A;  3MZF A;  2X02 A;  3W4P A;  4DE1 A;  1MWS A;  3A3D A;  4FCF A;  4Y0O A;  1BUL A;  5CEB A;  1K4F A;  3MKE A;  4E6W A;  4OQI A;  1K6R A;  2Y2O A;  5TR7 A;  4P0M A;  1YQS A;  3BLS A;  3M2K A;  1BLC A;  3GTC A;  2WKH A;  4FSF A;  4GD8 A;  4IBR A;  4K0W A;  1YLT A;  1XX2 A;  3M6B A;  5EE8 A;  4ZJ3 A;  4DDY A;  4OQH A;  3BM6 A;  4HBU A;  3HLE A;  4HEF A;  2WGV A;  1XA7 A;  3SOI A;  4OQG A;  1BTL A;  4GOG A; 
#chains in the Genus database with same CATH topology
 3CHW P;  1NWZ A;  2JN7 A;  3WS5 A;  3BFG A;  1D06 A;  4WMC A;  3IF5 A;  2X01 A;  2R78 A;  3WS4 A;  1CEG A;  1OTA A;  2ZJ9 A;  5CHU A;  1OTD A;  2V2F F;  1JTD A;  5FQI A;  3W8K A;  1MBL A;  4S2O A;  3IXH A;  1MWT A;  3VP4 A;  1K55 C;  3H9W A;  1K55 A;  2XQZ A;  4RQ9 A;  1T1A A;  1PNE A;  1FCN A;  1SHV A;  3H7W A;  5CXW A;  2XFT A;  2ZM2 A;  4KG2 A;  5A8B A;  4DE3 A;  4R6L A;  2IWC A;  3LIB A;  4B4Z A;  2P08 A;  1ODV A;  3IX8 A;  3C4P A;  3EQV A;  1E3U A;  5CEC A;  1ZHH B;  1JTG A;  3OPP A;  5FL3 A;  3WWX A;  3LFV A;  3H82 B;  3HLC A;  1M40 A;  3D4F A;  5EVI A;  4R4R A;  3DAV A;  4YWZ A;  2PYR A;  3L9K A;  5GLB A;  4N92 A;  4BBT A;  2VLG A;  1FCO A;  1FSY A;  4WN5 A;  1DJC A;  2ZMV A;  1H8M A;  2HDU A;  1MPL A;  1N9O A;  5CGS A;  3WS1 A;  1FR6 A;  5FA7 A;  2W27 A;  1JWP A;  4X53 A;  1F9I A;  3N7W A;  3OCL A;  4JXV A;  2JKR M;  1DY6 A;  2Y4A A;  5KIZ A;  3A0S A;  5EEC A;  4BWI A;  4HHD A;  3VOL A;  1WE4 A;  4P85 A;  4LV0 A;  1PZO A;  3UB8 A;  4UQI S;  1PZP A;  2FH5 A;  3H7W B;  4O01 A;  2PR6 A;  2EWV A;  4P87 A;  4QD4 A;  3GMW A;  1H0M A;  4GJ4 A;  1YLJ A;  3PHY A;  2OV5 A;  4EBP A;  3IWQ A;  3F1N A;  2XFS A;  3B3X A;  4EUZ A;  1Z6F A;  5HZH A;  3NIA A;  4KQQ A;  2Y2N A;  2W3G A;  1VEU B;  3ULF A;  1EWZ A;  4UAA A;  2GJ3 A;  3A3J A;  1XFQ A;  3T1R A;  3TW8 A;  4GS9 A;  1OME A;  3UE1 A;  5A91 A;  2CC1 A;  5AQB A;  3UE6 A;  3V3S A;  3M6H A;  1ZG6 A;  4E3L A;  4EWF A;  3KYZ A;  4NXB A;  3QNB A;  1NYM A;  4DJ2 A;  2GX5 A;  2HDR A;  2ZC3 B;  4D60 A;  4BQM A;  1UGU A;  2V8C A;  2Y8H A;  1OJ5 A;  5G4Y A;  3FKV A;  4NK3 A;  3ZG8 B;  1L0E A;  4M3K A;  3W2Z A;  4Q0J A;  4EXO A;  1NZU A;  1LL8 A;  1YAX A;  3UPN A;  2WKR A;  3F1O A;  3SH8 A;  4WBG A;  3LR0 A;  4MMN A;  1CEF A;  2H28 A;  1NYY A;  4QWO A;  1FIK A;  3LIA A;  4P6B A;  2RCX A;  4MBH A;  3IF6 C;  1WA9 A;  2ZBB A;  5FDS A;  3SH7 A;  2UV0 E;  4EEU A;  1F2K A;  3PAE A;  3UB5 P;  3IHB A;  3QP2 A;  3GEC A;  2WUQ A;  1XFN A;  3LR5 A;  3MXQ A;  2K2N A;  3TOI A;  2ZD8 A;  3WS0 A;  3OPH A;  5FAP A;  2EWW A;  3ZG7 B;  3HUN A;  4KZ3 A;  3FWL A;  3K3C A;  3MMH A;  4HES A;  4GW9 A;  3JVU A;  1OJG A;  2ZQ7 A;  2VGL S;  5CX7 A;  1V9Z A;  5CGX A;  5TFQ A;  2ZM8 A;  1ONH A;  4HY8 A;  2PU2 A;  3ZYT A;  1Q2P A;  5M18 A;  1CI9 A;  2Y2H A;  2B18 A;  4EBN A;  1BSG A;  4R3A A;  4U0X A;  4KG6 A;  2EFU A;  3G2Z A;  5FAT A;  1LL5 A;  1C3B A;  3M2J A;  2XLN A;  4MBK A;  3AGF A;  5EOO A;  2OAQ 1;  4GN2 A;  3F1O B;  2Z2M B;  4EET B;  1KE3 A;  2HP6 A;  3UB9 A;  2B02 A;  3EQU A;  5TBM A;  2QMI A;  3GV9 A;  4ZJ1 A;  1ERM A;  2FFY A;  5FQJ A;  4B88 A;  3IT9 A;  1EW0 A;  3LGO A;  4I5S A;  4JGP A;  5FQK A;  4R3B A;  2Y2Q A;  4Y0T A;  3HUO A;  3OOV A;  2VGJ A;  4LFU A;  3BEC A;  5FI7 A;  2ZQC A;  4OOL A;  1HVB A;  5L10 A;  1BLS A;  3VOY A;  3A3I A;  3BFD A;  2WAF A;  1KE0 A;  4G3V A;  4KEN B;  3R7W B;  1V9Y A;  3A3E A;  2VV7 A;  2O9B A;  2WKE A;  2HDQ A;  2P7J A;  4B9O A;  5CER A;  1K57 C;  1YSP A;  1I2S A;  3CAX A;  4GDN A;  1G68 A;  4LCM A;  5F83 A;  3VSL A;  4MLL A;  3IS2 A;  2EX6 A;  1LSX A;  4H8R A;  3PXP A;  4BD0 A;  1JWV A;  4HJ4 A;  3PBR A;  1BUE A;  2JKT M;  2V1Z A;  3C7V A;  2OLV A;  5HAI A;  3S7N A;  3CUE C;  3FYZ A;  4WZ5 A;  4EQI A;  2W0N A;  3U4L P;  4HH3 A;  2W3E A;  4EUV A;  1IYS A;  4FD8 A;  5F6A A;  5DF8 A;  4ZRR A;  2LB5 A;  3MQO A;  4CLC C;  1XPB A;  3QP4 A;  2GNX A;  3ITA A;  5IHV A;  1L0D A;  2Q9N A;  4QJG A;  5DKK A;  1TS0 A;  4OON A;  5GHZ A;  2OWH A;  5AVE A;  3LIF A;  3NHQ A;  1K4F A;  3IX4 A;  3T4S A;  3BW6 A;  4OQI A;  4P0M A;  5HAR A;  4IBR A;  4FSF A;  5L8M A;  4K0W A;  1XX2 A;  5EE8 A;  4OQH A;  4HBU A;  4HEF A;  3NOT C;  2WGV A;  3SOI A;  3E4P A;  4OQG A;  1PYY A;  1PI4 A;  4BJP A;  2R9W A;  4GDB A;  2J8Y A;  3E98 A;  1LHY A;  1T1B A;  5FSR A;  3IS2 B;  2H0Y A;  3BQA A;  3LIC A;  3Q7Z A;  2A24 A;  1I5Q A;  3MSH A;  3BQ8 A;  3PR6 A;  3DW0 A;  1XXM A;  4MN5 A;  1OT6 A;  4HH2 A;  2Q0O A;  2M7V A;  1S4R A;  4HP4 A;  4DE0 A;  5AQA A;  4PM9 A;  1MKI A;  3MZE A;  5TGF A;  1GHP A;  4MDZ A;  3G34 A;  3P09 A;  4QPR A;  3MQ0 A;  3GVB A;  5CHJ A;  2IWD A;  3S7P A;  5HX9 A;  4PM7 A;  4G3W A;  4DMZ A;  4IED A;  4WEK A;  5E2F A;  2RL3 A;  3CWF A;  4E3I A;  4KZ9 A;  4L9E A;  2EFX A;  3RJU A;  3RTY A;  4CQH A;  2Q9M A;  4ZAM A;  2P9V A;  5F68 A;  1LLB A;  1LI9 A;  4ZDX A;  3BEB A;  4IUK A;  5HW3 A;  5D3O A;  3V5M A;  4JBF A;  2VKS A;  4PHT A;  4Y7P A;  5C5K A;  5FAQ A;  2H10 A;  4WYY A;  2YKH A;  1NY0 A;  1T1C A;  3KSF A;  3C2W A;  3CG5 A;  2QJ7 A;  5HPF A;  2JHE A;  3LO7 A;  4PPR A;  1RCJ A;  4O7D A;  1S4S A;  2A24 B;  2OAP 1;  5GLC A;  1O07 A;  5FEF A;  5L2F A;  4JGR A;  3IXD A;  3B33 A;  3UDX A;  2WGW B;  4OH0 A;  2X71 A;  1K56 D;  1U60 A;  1J9M A;  3G4P A;  4UA6 A;  5F5Y A;  1H8Z A;  1CI8 A;  4OPQ A;  3AGE A;  3ZG5 A;  1IEL A;  5HAQ A;  3OPL A;  2ZLY A;  5GL9 A;  3CZD A;  3RXW A;  1DRM A;  5HFO A;  4QY5 A;  3ZHH A;  5HAP A;  4WMC D;  5FI2 A;  2J9P A;  3W4O A;  5EOE A;  3CI6 A;  4ETZ A;  2PAV P;  1HLU P;  3IH9 A;  2P9V B;  3SS3 A;  3P98 A;  5L09 A;  3VP0 A;  2NUP C;  2JCH A;  2PR5 A;  5CHM A;  3ZFZ A;  2KLI A;  1VET B;  4HQA A;  1BLP A;  2W3D A;  2OLU A;  3EEH A;  1IEM A;  3G32 A;  5HPI A;  2D01 A;  2PD7 A;  1K0K A;  3Q7V A;  4PMA A;  5JYO A;  1S66 L;  3NOP C;  2OOL A;  3T4Q A;  2KX6 A;  1MWR A;  1VHM A;  4OLD A;  3NDG A;  4JXW A;  2EX2 A;  2V0W A;  3HJI A;  4IBX A;  4IHQ A;  4KZ8 A;  3UB6 A;  4NXE A;  4JPM A;  1ZKJ A;  3D9Y A;  3UPP A;  1K54 C;  4QU3 A;  2J80 A;  1K54 A;  2J3W A;  3MFD A;  1IKI A;  1VEU A;  2BAS A;  3DBA A;  4UQI M;  1T19 A;  1SKO A;  1IOU A;  3O3V A;  5A90 A;  1N9N A;  5EVI C;  3P7N A;  3N6I A;  2Y79 A;  2P74 A;  1K4E A;  2PD8 A;  3UME A;  1TS7 A;  4DKI A;  1ERQ A;  4HJ6 A;  2V0U A;  4LV1 A;  2ZQD A;  2JKG A;  2FZ0 A;  2L4R A;  2EXA A;  4C3Q A;  4BLM A;  4CLC E;  5EPH A;  2W1R A;  2H0T A;  4JXG A;  1KDW A;  4EV4 A;  3IXG A;  4U3T A;  4P6Z S;  5FQ9 A;  3Q07 A;  1GSW A;  1FCM A;  1P9W A;  3PYP A;  1KVM A;  3N8S A;  2JKR I;  3V3R A;  3OPR A;  2ZQA A;  4UEY A;  3UB7 A;  1GHI A;  3Q7V B;  3E4O A;  2O0Y A;  5TJJ A;  4E3K A;  4OP8 A;  2ZQ8 A;  5KSC A;  4II7 A;  3NOU C;  4KQD A;  3FPV A;  1CF0 A;  2XR0 A;  4WF0 A;  4HIA A;  3G2Y A;  4S2I A;  1VM1 A;  3KYQ A;  3W4Q A;  3Q1F A;  3LI8 A;  1SKO B;  4Y3I A;  2Y2G A;  1LI0 A;  2YKF A;  2Y2L A;  3Q81 A;  3UN7 A;  4FOF A;  4QB8 A;  4ME4 A;  1YLW A;  1RGZ A;  5KSH A;  4HI4 A;  3UO9 A;  1L3L A;  3O87 A;  4N1X A;  3TSG A;  1ESI A;  2V1A A;  4LGW A;  3LYX A;  4HBT A;  4GLQ A;  3CIT A;  3C5A A;  5JYP A;  3HL9 A;  2V20 A;  2XH9 A;  2PYP A;  1E25 A;  3G35 A;  2OSU A;  3MFX A;  1SKF A;  4JKT A;  3NCK A;  3E4Q A;  4DF6 A;  4ARZ B;  3ISG A;  3LEZ A;  4MNR A;  5AQ7 A;  2XRN A;  2V8F A;  3ZQ5 A;  4O8G A;  2M1C A;  2WAE A;  5HD5 A;  2MJ6 A;  1I2W A;  4KZ4 A;  3ZCZ A;  1N4O A;  1F5M A;  3R4K A;  4YFM A;  2Z2L B;  3R7W A;  4KQO A;  4XT2 A;  3BY8 A;  1G5U A;  5G4Z A;  4BL3 A;  2VJW A;  4LRX C;  5EV0 A;  2XDM A;  2QJ5 A;  3EWK A;  5U47 A;  4IJG A;  3S1Y A;  4EES A;  3NEC A;  1IYP A;  4MN7 A;  4X25 A;  4BL2 A;  3AGD A;  5E2E A;  2OWJ A;  1OPX A;  2X02 A;  3T4J A;  3RFB A;  4DE1 A;  3A3D A;  1XJ4 A;  1PFL A;  3MKE A;  1LSV A;  2Y2O A;  4GD8 A;  1YLT A;  3BWL A;  2M7U A;  1MC0 A;  4FUW A;  4Y5F A;  3KX0 X;  4GB7 A;  2DCF A;  1WYB A;  1OTB A;  3QP5 A;  3QP1 A;  3UE3 A;  2W1T A;  3VMA A;  1F98 A;  2IA2 A;  2UWX A;  3K2N A;  4DRT A;  1W5D A;  4HJ3 A;  1NRJ A;  4RA7 A;  2XA7 S;  2XEP A;  1DP6 A;  4HOI A;  4UA7 A;  1A0K A;  2JC7 A;  4Y13 A;  5F1F A;  2PDR A;  2B5R A;  3IHA A;  1JVJ A;  1RGY A;  4XT2 B;  3KYE A;  3S22 A;  1JWZ A;  5HWT A;  5CGW A;  1AXB A;  2A2L A;  3HCY A;  3HLD A;  1CJF A;  2K7S A;  4R4S A;  1SZV A;  5FDH A;  1XGI A;  4ZTK A;  5F69 A;  5I94 A;  1XJ3 A;  1YMS A;  2VV6 A;  5HDS A;  3HVF A;  3NJA A;  1FQG A;  2XD1 A;  2HV1 A;  2Y2J A;  3V50 A;  2A3U A;  4JF5 A;  1HD8 A;  3L7H A;  1SDE A;  1YLY A;  1YLP A;  5F82 A;  3G31 A;  3HBR A;  4JGO A;  4I38 A;  2VZW A;  4BEN A;  1CQA A;  4WZ5 C;  3C4O A;  2VA0 A;  2CMN A;  2Z6C A;  4GHI A;  4EEP A;  2O9A A;  1OT9 A;  4UA9 A;  3LY4 A;  4CLC D;  1DP9 A;  3S7O A;  5E2H A;  2JKT I;  2E8J A;  3A0V A;  4OPR A;  2JBF A;  3QNC A;  4IVI A;  4DN0 A;  2W1T B;  2WGI A;  3E2L A;  5DVA A;  3A3F A;  3FV7 A;  3QP6 A;  3HLB A;  4DXC A;  2L0W A;  5G18 A;  5GHX A;  2BLS A;  4K08 A;  2PU4 A;  2Z6D A;  1W79 A;  4U0T A;  3EGX C;  1UWN X;  2Y2I A;  3LCE A;  3JPU A;  4E3N A;  4KZ5 A;  2ZQ9 A;  3NC8 A;  3ZG0 A;  4LLO B;  1NRF A;  4GZB A;  2R9X A;  4LRZ E;  4LRY C;  4JF4 A;  2INW A;  3MS6 A;  1BT5 A;  3ICY A;  5FAS A;  3A0R A;  3NDE A;  5CTN A;  2DRW A;  5HDD A;  3PBN A;  1YPR A;  3G6O A;  3MXS A;  3BYD A;  3IWI A;  3QHY A;  4FH2 A;  3MZD A;  4G3K A;  4GCZ A;  3KO6 A;  1BZA A;  2WGW A;  3B47 A;  4X55 A;  1GSV A;  4GHI B;  2QZ6 A;  4WEJ A;  3T4T A;  5L07 A;  2QHK A;  2HGV A;  3SH9 A;  4GKU A;  4S2K A;  4OQ0 A;  5DTT A;  5IS1 A;  4X56 A;  2GDN A;  1TS8 A;  4S2P A;  1ZG4 A;  4JF6 A;  1XJ6 A;  1MWU A;  4EQ1 A;  4R0Q A;  1HTZ A;  1KVL A;  1PI5 A;  2PBY A;  2VEA A;  3VP3 A;  5BOH A;  1K25 A;  1ES3 A;  1MXO A;  1ACF A;  4H6J B;  2KDK A;  2DMW A;  3PBT A;  1KE4 A;  1TF1 A;  4N9L A;  4GD6 A;  1HZO A;  5HL1 A;  3ZVW A;  2BG1 A;  1W8Q A;  4NET A;  2ZC7 A;  2HJ9 C;  1VET A;  5DF9 A;  4PKY G;  5K5B A;  3NY4 A;  4OVD A;  3RXX A;  5HL6 A;  4OLG A;  3E2K A;  1S0W A;  4S2N A;  3WRZ A;  4QY6 A;  1X0O A;  4Q0H A;  3HLF A;  3WRT A;  2J3T C;  1IYQ A;  4EER A;  3OLO A;  4KQR A;  4KZ7 A;  4L9F A;  3HRE A;  3BFC A;  1XA1 A;  4A5R A;  4PM5 A;  1NJ4 A;  2I72 A;  5HWV A;  1PWG A;  1BYW A;  2VGK A;  1PRQ A;  2HJE A;  1T18 A;  2EX9 A;  3LR4 A;  1S1Z A;  5DJT A;  4F94 A;  1TDG A;  2HZ5 A;  4DDS A;  3IXB A;  3ZDJ A;  1W63 Q;  3SS5 A;  4LV3 A;  4RVA A;  2ZOI A;  1K6S A;  3BJN A;  3TE8 A;  1K56 A;  3ZVT A;  4K91 A;  4R38 A;  4OOY A;  3RH8 B;  4L9G A;  1G6O A;  3BFF A;  4R3J A;  4ZJ2 A;  1TVF A;  4KZB A;  4RX2 A;  3T1Q B;  4YOF A;  3BY9 A;  4Q8I A;  4R1G A;  2FFF B;  1ZTU A;  4RYE A;  3SZT A;  4R23 A;  4I39 A;  4WUJ A;  2HDS A;  4MCW A;  1PWC A;  3HLW A;  3SW1 A;  4E3M A;  5FI6 A;  2VK3 A;  4EW7 A;  5FAO A;  1XKZ A;  2XD5 A;  1FR1 A;  5KMW A;  1XP4 A;  4Q0I A;  1P9R A;  1FIL A;  1JNU A;  1Y28 A;  5I5L A;  3F1P B;  4P6Z M;  4E3O A;  3FPW A;  1G28 A;  3IBJ A;  2G2W A;  5J7E A;  5DJU A;  1P97 A;  1VB6 A;  4OKP A;  4N9K A;  2QKP A;  1W63 M;  4BD1 A;  1E3U D;  1GSX A;  3DTK A;  1Z09 A;  1H3Q A;  5EUA A;  1Y54 A;  3T50 A;  3UE0 A;  1ZC2 A;  2H5S A;  5EVI D;  1K38 A;  3BFE A;  1TEM A;  1N9L A;  5DTK A;  3VP2 A;  2PT7 A;  2G7U A;  4ZBE A;  3UPO A;  4ETX A;  1IKG A;  5DKL A;  1M6K A;  3C7U A;  1LL9 A;  5M1A A;  4XUX A;  4LEN A;  4B4X A;  1W7F A;  1MKM A;  3ITB A;  5CRF A;  4FH4 A;  2C5W B;  3HJK A;  3HLG A;  3VE4 A;  1MZU A;  5M19 A;  2QPN A;  3O88 A;  1XJ2 A;  5FQM A;  1MY8 A;  4I3J A;  3G30 A;  3VOZ A;  4HP9 A;  3DWZ A;  3OCN A;  1DJA A;  4PM6 A;  1O7E A;  4GNU A;  3LID A;  3UDF A;  4ARZ A;  3KSG A;  1IFQ A;  4MEZ A;  3UMD A;  5F1G A;  4QHC A;  4D2O A;  5GLD A;  3MZF A;  2L1M A;  4DJ3 A;  1MWS A;  3JVV A;  4Y0O A;  5DFX A;  1BUL A;  5CEB A;  4I3I A;  1YSQ A;  4E6W A;  3QP8 A;  4ESP A;  1YQS A;  3BLS A;  1BLC A;  3GTC A;  3M6B A;  3BM6 A;  4F3L A;  3TRC A;  1XA7 A;  2ACG A;  5GHY A;  4L0L A;  4X1M A;  5HD3 A;  5KZH A;  4CPK A;  4CJN A;  5J4E A;  2QWS A;  5AQ9 A;  2JE5 A;  2PRF A;  4NXG A;  4I3A A;  4YIN A;  3T12 B;  3LY3 A;  1RP5 A;  1EI5 A;  3IQA A;  4E04 A;  1TS6 A;  3GSG A;  5EVI B;  3MBZ A;  4LCL A;  3EEA A;  3LR3 A;  3TG9 A;  4KUK A;  1PIO A;  3UY6 A;  2NUT C;  3BRM A;  2VGL M;  4JXS A;  1ES5 A;  1KGG A;  1DJB A;  3PAG A;  1TD5 A;  4DXB A;  1D7E A;  4DE2 A;  4Y17 A;  1ES2 A;  3NBL A;  3DTM A;  3VFH A;  3ZG9 B;  1PWD A;  4LV2 A;  1ES4 A;  3FG8 A;  1L0F A;  3N8L A;  2IWB A;  2LB9 A;  1AWI A;  2WZZ A;  4E3J A;  5E2G A;  4E6X A;  1OTE A;  2ZOH A;  3IH8 A;  3E0Y A;  3UNW A;  2XGN A;  5J3W A;  3O86 A;  3BLM A;  4XUZ A;  2W3H A;  2ZC6 B;  2B95 A;  4ID4 A;  1FSW A;  3GR2 A;  1DP8 A;  4F3L B;  4KZA A;  3EOI A;  4NEE D;  3IF6 A;  3D72 A;  1YMX A;  3F1N B;  4M4X A;  4WEL A;  2XA7 M;  2ZMF A;  2G2U A;  3IBR A;  4NG2 A;  3OBF A;  4KG5 A;  1ERO A;  3LI9 A;  3N4I A;  5GLA A;  2WKQ A;  4AFI A;  3S4X A;  1E4D A;  3VE3 A;  4OP5 A;  2HF6 A;  1J3W A;  4KZ6 A;  4GS9 B;  3DTI A;  1YT4 A;  4R70 A;  2VV8 A;  2ZC4 B;  3FKW A;  5IU1 A;  1ALQ A;  1PW8 A;  2C6W B;  1W8Y A;  1H8Y A;  3T4K A;  5DTS A;  4OPZ A;  3CLO A;  2A49 A;  4PAU A;  3MF0 A;  3P01 A;  3V67 A;  1NLY A;  1KDS A;  2V9A A;  3MKF A;  4UHU A;  3LEQ A;  5AVF A;  4WM9 A;  4BMW A;  2Y91 A;  2ZMA A;  1LSW A;  1WYC A;  4PM8 A;  2XSS A;  2XRO A;  2Y55 A;  4MBF A;  3IF6 B;  5A93 A;  3GRJ A;  3NUL A;  2HPB A;  1ONG A;  3V39 A;  4BBU A;  5CED A;  1TDL A;  2HP5 A;  1D1J A;  1N9B A;  2EA9 A;  4S2M A;  4S2L A;  5DF7 A;  3KSI A;  5IT5 A;  4X68 A;  1PW1 A;  3WS2 A;  3GDI A;  1GHM A;  2HP9 A;  4Y0U A;  1GA9 A;  4NXF A;  1H5X A;  1NZO A;  1KGE A;  3FZC A;  4C6Y A;  4Y2F A;  5HWW A;  1K57 A;  1FOF A;  2ZM0 A;  1YLZ A;  3T4L A;  5A92 A;  1VQQ A;  1IYO A;  3ZNT A;  2J9O A;  3B42 A;  2EX8 A;  2Y2M A;  1SDN A;  5FQQ A;  2JKF A;  3Q82 A;  4IVK A;  1OTI A;  2WAD A;  2WYX A;  2EXB A;  3VSK A;  3CJM A;  4OPY A;  3SS4 A;  3O5Y A;  4WZ4 A;  3CUE A;  3ZNY A;  4JGQ A;  5TBM B;  3MR0 A;  3MXR A;  5EVE A;  3UDI A;  2XK1 A;  2WKI A;  4CLC A;  4OOM A;  1XGJ A;  4H6J A;  2I9V A;  2VX8 A;  2XF3 A;  1YKD A;  1S6R A;  2Y59 A;  2PBD P;  1KOU A;  5CTM A;  4X1L A;  4PKY A;  1STZ A;  2O99 A;  1GA0 A;  3VV4 A;  1NLZ A;  4C75 A;  3T4O A;  3I7J A;  5MC7 A;  5EVL A;  4B93 A;  5EM1 A;  1G6A A;  1Y4O A;  2E8I A;  3CMZ A;  1ESU A;  4LPZ A;  1CK3 A;  1P0Z A;  5E43 A;  3GQZ A;  3OC2 A;  3CPT A;  2QYB A;  5HDC A;  2ZC5 B;  2WK0 A;  3PBO A;  4N1H A;  5EM0 A;  3PTE A;  1QME A;  2ZL1 A;  4JLF A;  3T1S A;  5HSQ A;  3U2A A;  3N8R A;  1L0G A;  2AVX A;  3D3O A;  2Y2K A;  4X69 A;  3VP1 A;  3JYI A;  1NXY A;  2WZX A;  2Y2P A;  2PHY A;  4EU0 A;  5FEG A;  1S1Y A;  5LBR A;  1QMF A;  3FC7 A;  3VFF A;  4YNR A;  3PBS A;  3C38 A;  4MN6 A;  3K3D A;  3IWO A;  1S67 L;  4CLC B;  5EFW A;  1Q2Q A;  3DTE A;  3ZGA B;  5AJG A;  2GZA A;  2DNS A;  3C8C A;  3TJZ C;  4WLA A;  4K0X A;  4Z1W A;  4S2N C;  1UWP X;  4S2J A;  3LUQ A;  3OZH A;  4NKP A;  4Y15 A;  2J3T D;  4X6T A;  5J8X A;  4BBV A;  3F1P A;  1LT0 A;  1GCE A;  3DWK A;  4Z9Q A;  3KSH A;  3HUM A;  1SCW A;  1BLH A;  4EBL A;  3LIE A;  4HNB A;  4O0P A;  3CPT B;  4KUO A;  2WKP A;  1KGF A;  4RX3 A;  2KOI A;  1L2S A;  3T1X A;  3PBQ A;  2ZL1 B;  3NI9 A;  1YM1 A;  4XXR A;  3S7Q A;  2J7V A;  3C30 A;  2V1B A;  2BTF P;  3W4P A;  5DFY A;  3EGD C;  4FCF A;  3MJQ A;  1K6R A;  3H82 A;  5TR7 A;  2W3F A;  4IUH A;  3IX3 A;  3M2K A;  2WKH A;  4DDY A;  4ZJ3 A;  2P04 A;  3MQQ A;  3HLE A;  2O9C A;  4FTX A;  4WL9 A;  2K31 A;  2D02 A;  1BTL A;  4GOG A; 
#chains in the Genus database with same CATH homology
 1PYY A;  4GB7 A;  2DCF A;  1WYB A;  1PI4 A;  4BJP A;  2R9W A;  5GHY A;  4GDB A;  4L0L A;  2J8Y A;  3WS5 A;  5KZH A;  3UE3 A;  4CPK A;  1LHY A;  3BFG A;  5FSR A;  4CJN A;  3VMA A;  2UWX A;  4WMC A;  3IF5 A;  2X01 A;  5AQ9 A;  2H0Y A;  2JE5 A;  3Q7Z A;  4DRT A;  4YIN A;  1W5D A;  1I5Q A;  4RA7 A;  2XEP A;  3LY3 A;  3DW0 A;  1XXM A;  4UA7 A;  1RP5 A;  3WS4 A;  1CEG A;  1EI5 A;  2JC7 A;  3IQA A;  5F1F A;  3GSG A;  2B5R A;  3IHA A;  1JVJ A;  3MBZ A;  5AQA A;  5EVI B;  4LCL A;  4DE0 A;  2ZJ9 A;  3TG9 A;  1RGY A;  1PIO A;  5CHU A;  4PM9 A;  3UY6 A;  2V2F F;  1JTD A;  1MKI A;  3MZE A;  5FQI A;  5TGF A;  3BRM A;  1GHP A;  1MBL A;  3W8K A;  4S2O A;  3IXH A;  3S22 A;  1MWT A;  1JWZ A;  3G34 A;  3P09 A;  3VP4 A;  1K55 C;  3GVB A;  4JXS A;  1ES5 A;  5CGW A;  1AXB A;  1KGG A;  5CHJ A;  1DJB A;  1K55 A;  2IWD A;  2XQZ A;  3PAG A;  4DXB A;  3HLD A;  1FCN A;  1SHV A;  4R4S A;  5CXW A;  4DE2 A;  5HX9 A;  2XFT A;  2ZM2 A;  4PM7 A;  1ES2 A;  3NBL A;  5FDH A;  4IED A;  1XGI A;  3DTM A;  4KG2 A;  3VFH A;  4WEK A;  5E2F A;  4ZTK A;  2RL3 A;  3ZG9 B;  1PWD A;  4LV2 A;  5I94 A;  1ES4 A;  4DE3 A;  1L0F A;  1YMS A;  2IWC A;  3N8L A;  4B4Z A;  2IWB A;  4E3I A;  2WZZ A;  3HVF A;  4E3J A;  1FQG A;  4KZ9 A;  5E2G A;  2XD1 A;  2EFX A;  4E6X A;  2Y2J A;  3RJU A;  3V50 A;  3IH8 A;  2A3U A;  4JF5 A;  3C4P A;  1HD8 A;  3EQV A;  1E3U A;  1SDE A;  1YLY A;  1YLP A;  3UNW A;  2Q9M A;  2XGN A;  5CEC A;  3O86 A;  1JTG A;  3BLM A;  4ZAM A;  3OPP A;  4XUZ A;  3WWX A;  2P9V A;  3G31 A;  5F82 A;  3HBR A;  2ZC6 B;  3HLC A;  1LLB A;  1LI9 A;  1M40 A;  3D4F A;  5EVI A;  4R4R A;  4BEN A;  4ID4 A;  1FSW A;  3GR2 A;  4ZDX A;  3BEB A;  4WZ5 C;  3C4O A;  4N92 A;  5GLB A;  5D3O A;  5HW3 A;  3V5M A;  4KZA A;  1FCO A;  4JBF A;  3IF6 A;  1FSY A;  1DJC A;  4Y7P A;  5FAQ A;  4UA9 A;  2HDU A;  1MPL A;  5CGS A;  3LY4 A;  3WS1 A;  1YMX A;  5E2H A;  2H10 A;  1FR6 A;  4WYY A;  1NY0 A;  4OPR A;  5FA7 A;  1JWP A;  2JBF A;  4WEL A;  3QNC A;  3CG5 A;  4IVI A;  4X53 A;  2G2U A;  2WGI A;  3LO7 A;  3E2L A;  5DVA A;  4PPR A;  1RCJ A;  4O7D A;  3N7W A;  4KG5 A;  3A3F A;  3FV7 A;  3OCL A;  1ERO A;  4JXV A;  3HLB A;  3N4I A;  5GLA A;  4DXC A;  1DY6 A;  2Y4A A;  5G18 A;  5GLC A;  1O07 A;  5GHX A;  5L2F A;  2BLS A;  2PU4 A;  3S4X A;  1E4D A;  5EEC A;  4OP5 A;  3IXD A;  3UDX A;  1W79 A;  4U0T A;  2WGW B;  4OH0 A;  2X71 A;  1K56 D;  4KZ6 A;  1U60 A;  1J9M A;  2Y2I A;  1WE4 A;  3G4P A;  3LCE A;  4P85 A;  4UA6 A;  1YT4 A;  1H8Z A;  2ZC4 B;  1PZO A;  4LV0 A;  1CI8 A;  3FKW A;  4E3N A;  4OPQ A;  4KZ5 A;  3AGE A;  1ALQ A;  2ZQ9 A;  1PW8 A;  3NC8 A;  3ZG0 A;  1IEL A;  3ZG5 A;  5HAQ A;  2C6W B;  1PZP A;  1W8Y A;  1H8Y A;  2ZLY A;  3OPL A;  5GL9 A;  3CZD A;  5DTS A;  4OPZ A;  3RXW A;  1NRF A;  5HFO A;  4GZB A;  2A49 A;  2R9X A;  4P87 A;  4QD4 A;  3GMW A;  4JF4 A;  1YLJ A;  2OV5 A;  4EBP A;  4QY5 A;  1BT5 A;  3IWQ A;  3ZHH A;  5HAP A;  1KDS A;  4WMC D;  5FI2 A;  5FAS A;  3NDE A;  2XFS A;  2DRW A;  3MKF A;  3B3X A;  4UHU A;  5CTN A;  4EUZ A;  1Z6F A;  3NIA A;  4KQQ A;  4WM9 A;  2J9P A;  3PBN A;  2Y2N A;  5EOE A;  3W4O A;  2Y91 A;  2ZMA A;  3MXS A;  3BYD A;  1EWZ A;  3IWI A;  3IH9 A;  3QHY A;  2P9V B;  1WYC A;  4FH2 A;  4UAA A;  3MZD A;  3SS3 A;  3P98 A;  3VP0 A;  3A3J A;  1BZA A;  2WGW A;  2JCH A;  4PM8 A;  5CHM A;  3ZFZ A;  1OME A;  3UE1 A;  5A91 A;  2CC1 A;  5AQB A;  3V3S A;  4X55 A;  3M6H A;  1ZG6 A;  4E3L A;  4EWF A;  2Y55 A;  4MBF A;  1BLP A;  2QZ6 A;  3IF6 B;  5A93 A;  2OLU A;  3QNB A;  4WEJ A;  3GRJ A;  1IEM A;  3G32 A;  2HPB A;  1NYM A;  1ONG A;  3Q7V A;  2HDR A;  3SH9 A;  2ZC3 B;  4PMA A;  4GKU A;  5JYO A;  4S2K A;  4BQM A;  3V39 A;  4OQ0 A;  5DTT A;  5CED A;  1TDL A;  2HP5 A;  1MWR A;  3FKV A;  1N9B A;  4X56 A;  4OLD A;  2GDN A;  3NDG A;  1ZG4 A;  4JF6 A;  2EX2 A;  4JXW A;  4NK3 A;  4S2P A;  4S2M A;  4S2L A;  1MWU A;  5DF7 A;  3ZG8 B;  1L0E A;  4M3K A;  4R0Q A;  1NZU A;  1HTZ A;  4IBX A;  4X68 A;  4KZ8 A;  3UPN A;  1PW1 A;  4JPM A;  1KVL A;  1ZKJ A;  1PI5 A;  2PBY A;  3VP3 A;  3WS2 A;  3UPP A;  1GHM A;  1K54 C;  1K25 A;  4QU3 A;  5BOH A;  1ES3 A;  1MXO A;  2HP9 A;  1K54 A;  1GA9 A;  3MFD A;  4Y0U A;  3SH8 A;  1IKI A;  1H5X A;  1NZO A;  1KGE A;  3FZC A;  4WBG A;  4C6Y A;  3PBT A;  1KE4 A;  1K57 A;  1CEF A;  4N9L A;  4GD6 A;  3O3V A;  5A90 A;  1FOF A;  2ZM0 A;  5EVI C;  1HZO A;  1NYY A;  5HL1 A;  1YLZ A;  3N6I A;  3ZVW A;  2BG1 A;  1W8Q A;  2P74 A;  4NET A;  1K4E A;  4P6B A;  2RCX A;  4MBH A;  2ZC7 A;  5DF9 A;  5A92 A;  3NY4 A;  4OVD A;  1VQQ A;  1IYO A;  3IF6 C;  3RXX A;  3ZNT A;  4DKI A;  4OLG A;  3SH7 A;  3E2K A;  1ERQ A;  1S0W A;  4LV1 A;  2J9O A;  4S2N A;  2ZQD A;  3PAE A;  2EX8 A;  3WRZ A;  2EXA A;  2Y2M A;  1SDN A;  4QY6 A;  5FQQ A;  4C3Q A;  3IHB A;  4BLM A;  5EPH A;  2WUQ A;  3Q82 A;  4IVK A;  2H0T A;  3HLF A;  2WAD A;  2WYX A;  3WRT A;  1IYQ A;  2EXB A;  3TOI A;  3CJM A;  4KQR A;  2ZD8 A;  4OPY A;  3VSK A;  3WS0 A;  4JXG A;  3SS4 A;  4KZ7 A;  1KDW A;  4EV4 A;  3OPH A;  4WZ4 A;  3HRE A;  5FAP A;  3ZG7 B;  3HUN A;  3IXG A;  4KZ3 A;  4U3T A;  3ZNY A;  3BFC A;  1XA1 A;  4A5R A;  3FWL A;  4PM5 A;  5FQ9 A;  3Q07 A;  4HES A;  1FCM A;  3MXR A;  1NJ4 A;  1KVM A;  2I72 A;  2ZQ7 A;  3UDI A;  5CGX A;  2XK1 A;  2WKI A;  5TFQ A;  1PWG A;  3N8S A;  1XGJ A;  4OOM A;  2ZM8 A;  2VGK A;  1ONH A;  3V3R A;  2EX9 A;  3OPR A;  2PU2 A;  2ZQA A;  1Q2P A;  4F94 A;  1CI9 A;  2XF3 A;  2Y2H A;  5M18 A;  1S6R A;  1TDG A;  1GHI A;  3Q7V B;  4DDS A;  4EBN A;  3IXB A;  1BSG A;  2Y59 A;  3ZDJ A;  4U0X A;  4E3K A;  5CTM A;  3SS5 A;  4KG6 A;  4LV3 A;  4RVA A;  2EFU A;  3G2Z A;  4OP8 A;  2ZQ8 A;  5KSC A;  1GA0 A;  1K6S A;  4C75 A;  5FAT A;  1LL5 A;  1K56 A;  3I7J A;  3ZVT A;  4K91 A;  1C3B A;  3M2J A;  2XR0 A;  4OOY A;  2XLN A;  4MBK A;  3AGF A;  3BFF A;  4R3J A;  5EOO A;  3G2Y A;  4ZJ2 A;  5EVL A;  1TVF A;  4GN2 A;  4S2I A;  2Z2M B;  1G6A A;  4KZB A;  4RX2 A;  1VM1 A;  2E8I A;  3CMZ A;  1KE3 A;  1ESU A;  2HP6 A;  3W4Q A;  1CK3 A;  5E43 A;  3Q1F A;  4Q8I A;  4R1G A;  3EQU A;  3GQZ A;  2QMI A;  3GV9 A;  2FFF B;  3OC2 A;  4RYE A;  1ERM A;  2FFY A;  2Y2G A;  1LI0 A;  5FQJ A;  4ZJ1 A;  4B88 A;  4R23 A;  2ZC5 B;  3IT9 A;  2HDS A;  2WK0 A;  2Y2L A;  3PBO A;  1PWC A;  3HLW A;  3Q81 A;  3UN7 A;  4E3M A;  4N1H A;  5FQK A;  4QB8 A;  3PTE A;  1QME A;  5FI6 A;  5FAO A;  4JLF A;  1XKZ A;  4R3B A;  2Y2Q A;  4Y0T A;  2XD5 A;  3HUO A;  1YLW A;  2VGJ A;  1RGZ A;  5KSH A;  3BEC A;  1FR1 A;  5FI7 A;  5KMW A;  1XP4 A;  2ZQC A;  3UO9 A;  4OOL A;  3N8R A;  3O87 A;  1L0G A;  1HVB A;  1BLS A;  4N1X A;  3A3I A;  3VOY A;  3TSG A;  1ESI A;  4E3O A;  3BFD A;  2WAF A;  1KE0 A;  2Y2K A;  4HBT A;  4X69 A;  3VP1 A;  3JYI A;  1NXY A;  2G2W A;  2WZX A;  2Y2P A;  4KEN B;  3A3E A;  3C5A A;  4OKP A;  4N9K A;  4BD1 A;  1QMF A;  1E3U D;  5JYP A;  3VFF A;  3HL9 A;  2WKE A;  2HDQ A;  3PBS A;  5EUA A;  1Y54 A;  2V20 A;  2XH9 A;  5CER A;  3IWO A;  3UE0 A;  1Q2Q A;  1K57 C;  1ZC2 A;  1E25 A;  2H5S A;  3G35 A;  5EVI D;  3ZGA B;  2OSU A;  1SKF A;  4JKT A;  1I2S A;  3NCK A;  4GDN A;  1G68 A;  4LCM A;  1K38 A;  5F83 A;  3BFE A;  4MLL A;  2DNS A;  1TEM A;  3VSL A;  4DF6 A;  3ISG A;  5DTK A;  4K0X A;  2EX6 A;  3VP2 A;  4H8R A;  3LEZ A;  4S2N C;  4ZBE A;  4MNR A;  5AQ7 A;  3UPO A;  1IKG A;  4S2J A;  4BD0 A;  1M6K A;  1JWV A;  3OZH A;  3C7U A;  1LL9 A;  2WAE A;  3PBR A;  1BUE A;  5M1A A;  4XUX A;  4X6T A;  4LEN A;  5J8X A;  2V1Z A;  1I2W A;  4KZ4 A;  4B4X A;  3ZCZ A;  1GCE A;  1W7F A;  3C7V A;  3DWK A;  1N4O A;  4Z9Q A;  2OLV A;  4YFM A;  5HAI A;  3ITB A;  5CRF A;  4FH4 A;  2Z2L B;  2C5W B;  3FYZ A;  3HLG A;  3HUM A;  4WZ5 A;  4EQI A;  1SCW A;  1BLH A;  4KQO A;  4EBL A;  2QPN A;  5M19 A;  3O88 A;  5FQM A;  1IYS A;  1MY8 A;  4FD8 A;  4BL3 A;  5DF8 A;  3G30 A;  5HAR A;  3VOZ A;  1KGF A;  1XPB A;  4RX3 A;  2XDM A;  1L2S A;  3PBQ A;  5U47 A;  3S1Y A;  3DWZ A;  3NI9 A;  3ITA A;  3OCN A;  1YM1 A;  1DJA A;  5IHV A;  4PM6 A;  1L0D A;  1O7E A;  4XXR A;  4GNU A;  2Q9N A;  3UDF A;  4QJG A;  1IYP A;  4BL2 A;  4MEZ A;  4OON A;  5F1G A;  3AGD A;  2J7V A;  4QHC A;  5E2E A;  5GHZ A;  5GLD A;  4D2O A;  3MZF A;  2X02 A;  3W4P A;  4DE1 A;  1MWS A;  3A3D A;  4FCF A;  4Y0O A;  1BUL A;  5CEB A;  1K4F A;  3MKE A;  4E6W A;  4OQI A;  1K6R A;  2Y2O A;  5TR7 A;  4P0M A;  1YQS A;  3BLS A;  3M2K A;  1BLC A;  3GTC A;  2WKH A;  4FSF A;  4GD8 A;  4IBR A;  4K0W A;  1YLT A;  1XX2 A;  3M6B A;  5EE8 A;  4ZJ3 A;  4DDY A;  4OQH A;  3BM6 A;  4HBU A;  3HLE A;  4HEF A;  2WGV A;  1XA7 A;  3SOI A;  4OQG A;  1BTL A;  4GOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...