1XGIA

Ampc beta-lactamase in complex with 3-(3-nitro-phenylsulfamoyl)-thiophene-2-carboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
342
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-based optimization of a non-beta-lactam lead results in inhibitors that do not up-regulate beta-lactamase expression in cell culture.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 112
structure length 342
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xgiA00
3DWZA 3VP0A 5IHVA 2HDUA 3UE0A 3ISGA 3G35A 4OOMA 2PU2A 1PZPA 1FOFA 3N4IA 3MXRA 3MKFA 3VP2A 1E25A 4WM9A 1JWPA 4WYYA 4KQQA 3MXSA 1WYCA 2OLUA 4RVAA 5HL1A 1GHIA 4MBFA 5FQIA 4BJPA 3NC8A 3Q82A 3MZDA 4HBUA 5E43A 3IH9A 3ITAA 3UDXA 5CEDA 2FFFB 1MWRA 3OPRA 4MLLA 4XXRA 1E4DA 2WUQA 3VFHA 1FSWA 5AQBA 4OPRA 5KSCA 2WKIA 5FI2A 4E3IA 1U60A 1H5XA 4OOLA 2HDQA 5GHYA 1FR1A 4LV1A 4Y0OA 3UN7A 1K25A 1HTZA 1W8QA 1XGIA 1Y54A 4ZAMA 4S2OA 1RP5A 2BG1A 5GLCA 1C3BA 2JCHA 2ZC3B 1FR6A 4HBTA 2JC7A 4X56A 4KZ7A 2FFYA 4E6WA 1OMEA 2Y4AA 3MBZA 3DTMA 3HLWA 3FYZA 5EVIC 1KE4A 2XH9A 4OQIA 1IEMA 1HD8A 1GHMA 1MY8A 2ZC7A 3Q7ZA 3WS0A 4R0QA 5EVID 4PM5A 1O07A 4P87A 2PU4A 2PBYA 4WZ4A 3FKVA 3SH8A 3Q1FA 4OPYA 1XPBA 1PI5A 4WEKA 1M40A 1NY0A 4KZ6A 4MBKA 1YT4A 1K6SA 5G18A 1HZOA 2JE5A 3HLBA 3VSLA 1WYBA 4P85A 4GNUA 4LV0A 1N4OA 1PW8A 5EOEA 1PWCA 1DY6A 3UPNA 3GMWA 3EQVA 4N9KA 5FQJA 3TSGA 4KQOA 1BTLA 2WGIA 4C75A 3MZEA 2EFXA 4PM8A 4OLDA 5DF9A 2Q9NA 2WGVA 2BLSA 2WYXA 2X02A 4IBRA 5HAPA 1BLHA 1O7EA 1W7FA 1L0GA 3ZVWA 4DRTA 3NDGA 5FASA 5FDHA 1TEMA 1XX2A 1MWSA 3D4FA 3BECA 5AQ7A 1L0EA 5FAOA 4IVKA 1BULA 4OQ0A 1VQQA 3A3DA 3ITBA 3C7UA 4DDYA 5A90A 1K57C 5KMWA 2HP6A 3E2KA 1K56D 2OV5A 4WBGA 5F82A 2Y55A 4GKUA 3HLGA 3N6IA 4LENA 3HLFA 3BFEA 3FZCA 5E2GA 4JPMA 2DRWA 2EX8A 1K55C 2P74A 4UA7A 4WMCD 3WS1A 3JYIA 4P0MA 3UDIA 3BYDA 2XEPA 2H10A 4JF6A 1JWVA 1S6RA 4DDSA 5M1AA 1YM1A 1LL9A 4DF6A 3BLSA 3LY4A 2Y2IA 4GN2A 4PM9A 1XA1A 3M6BA 4N92A 4X69A 1YLZA 2WKEA 2ZLYA 3LY3A 5EVLA 1ONHA 4GD6A 3GSGA 3G31A 4Y7PA 5U47A 3VOYA 1ESUA 3HUNA 3M2JA 5CHMA 2Y59A 2Y2NA 4R4RA 4RX2A 3VMAA 3BRMA 3LCEA 4R3JA 1KGGA 3ZCZA 1ALQA 2WKHA 4N1XA 3EQUA 2ZQ8A 2R9XA 3V39A 3HLEA 4QD4A 5DTTA 3IXGA 2XD1A 3WS2A 3UY6A 4Y0TA 4EBNA 3AGDA 4KZ3A 1BLSA 4GD8A 4IEDA 3W4PA 4KZ4A 3WRTA 5HX9A 4OQHA 3O88A 2ZQAA 3HLDA 1XA7A 3A3IA 5HW3A 3M2KA 4MBHA 5D3OA 2Y2PA 3C4PA 3ZGAB 1K55A 3S4XA 3W4QA 4PM7A 2B5RA 3A3EA 4ZBEA 3OC2A 3UPPA 1YMSA 3CMZA 1MKIA 1XKZA 3GQZA 4E3JA 3UO9A 1IYQA 5EECA 5A92A 3QHYA 2VGJA 3HUMA 5FQ9A 2XK1A 5HAQA 3BFCA 3IXHA 4S2LA 1IKGA 3IHAA 1KDWA 4OVDA 3WS5A 5DF7A 4JLFA 4OKPA 4DE0A 1K38A 3NCKA 1LI9A 1XP4A 4HEFA 2V20A 2ZQ7A 3BM6A 2ZM0A 4DXCA 3OCLA 1MBLA 4UA9A 4JKTA 3FKWA 5FA7A 4B4ZA 5CHJA 4S2NA 3ZG7B 4DE2A 3IF5A 2J8YA 3GR2A 5F1FA 1DJCA 3O3VA 1K4FA 5M19A 4R3BA 1FQGA 2G2WA 5EOOA 2EX9A 2XF3A 4OP8A 5GL9A 2QPNA 1NZUA 2XFSA 3PBQA 1NYYA 1LI0A 4LCMA 2EX2A 1BLPA 1E3UA 1SCWA 1RGZA 4IVIA 3OPHA 1YQSA 2G2UA 1AXBA 2WAEA 1FCNA 3IT9A 2I72A 1ES3A 1NRFA 4JXVA 3V3SA 3VSKA 4XUZA 4OLGA 1MWTA 5CGSA 1PIOA 1W5DA 1Q2QA 2OSUA 1VM1A 4WEJA 5CGXA 2Q9MA 2C6WB 3VP1A 3V3RA 1G6AA 3G4PA 5HAIA 3SH7A 3N7WA 5FAPA 3UE1A 1EROA 2ZM2A 3M6HA 1BSGA 3HL9A 4JXWA 5E2EA 2ZQ9A 2WADA 1TDLA 1BT5A 1KGEA 3TG9A 3V50A 3Q7VA 4QB8A 2ZC6B 3G34A 1ES4A 2HP9A 5F1GA 1ZG6A 1K54A 3NI9A 1BZAA 2EXBA 1QMEA 4BL3A 4K91A 2JBFA 3C5AA 3NDEA 5CGWA 4OP5A 4DXBA 4GOGA 3SS3A 2EXAA 3N8RA 1NJ4A 4EQIA 4K0WA 2UWXA 4MNRA 3V5MA 4KZ8A 1K4EA 4JBFA 3Q7VB 3W8KA 2A3UA 2Y2QA 2ZM8A 3OCNA 2GDNA 2Y2KA 4ZJ2A 1PWGA 4BENA 2DNSA 1JTGA 1IYSA 2H0TA 2X01A 2H0YA 3OPPA 4P6BA 4E3LA 1SKFA 4DE3A 1EWZA 5DVAA 1JWZA 4LCLA 2P9VA 4FH2A 3ZG0A 1YLYA 4KQRA 3BLMA 3RXXA 4RYEA 3ZNTA 5GLAA 5FSRA 1PZOA 4C3QA 4M3KA 1IELA 3HBRA 2OLVA 4KZBA 2IWDA 3IXDA 3MKEA 4GDBA 4NETA 4QY6A 1GA9A 1LHYA 2Z2MB 2RCXA 2ZC5B 3PBNA 2P9VB 2VGKA 2XFTA 4FCFA 5JYOA 4WZ5A 3ZVTA 1DJBA 4PPRA 1L2SA 1IYPA 2WK0A 4KZAA 3VP4A 5BOHA 4S2NC 3P09A 3SOIA 4OQGA 3ZG5A 1GA0A 3IF6A 2EX6A 5GHZA 5HARA 2XQZA 3QNCA 1KE3A 4ZDXA 3VFFA 3BFGA 4KENB 5DTKA 4OPZA 2RL3A 3PAGA 1W8YA 2EFUA 3CG5A 4FH4A 4DE1A 3PBRA 4HESA 1EI5A 5A91A 3IF6B 1PI4A 1MWUA 3HLCA 4K0XA 3I7JA 3LEZA 3GV9A 2IWCA 4N1HA 4S2JA 4Z9QA 5A93A 4R23A 3IQAA 3ZNYA 4GB7A 2R9WA 4LV2A 1JVJA 3QNBA 3UPOA 1I2SA 4GZBA 4RX3A 5EE8A 3HVFA 2Y91A 1J9MA 3G2YA 4S2IA 3UDFA 4DKIA 1E3UD 4QHCA 3RXWA 3SS4A 1MPLA 3Q81A 5CRFA 5EUAA 3PTEA 3N8LA 2HDSA 3WWXA 2XLNA 3IH8A 5CHUA 1CK3A 1IKIA 4JF4A 3HUOA 1NYMA 1LL5A 2Y2HA 5CTNA 4UA6A 1I2WA 1L0FA 5J8XA 2HP5A 2WZXA 3VOZA 2ZC4B 4FD8A 3OPLA 5CERA 1K54C 3AGFA 4OONA 3PAEA 2ZMAA 1ES2A 5FATA 1YLJA 2H5SA 5FAQA 4FSFA 5M18A 5AQAA 5DTSA 4S2PA 2Z2LB 1CEGA 1ES5A 4YINA 4QJGA 5FQKA 3FV7A 2XR0A 1H8YA 3RJUA 3S1YA 4S2KA 1ONGA 1NZOA 3PBOA 4PMAA 2ZJ9A 3BEBA 4EWFA 4KG6A 5L2FA 1YLTA 3O86A 2X71A 4ZTKA 4XUXA 1I5QA 1QMFA 1ZC2A 1SDEA 2CC1A 3HREA 4JF5A 4RA7A 1M6KA 4A5RA 5GLDA 3C4OA 1NXYA 4QY5A 2E8IA 5CTMA 1KVMA 5FQQA 4NK3A 4BL2A 4D2OA 2Y2MA 4Y0UA 1WE4A 1H8ZA 4H8RA 1KGFA 1ZG4A 3GVBA 3S22A 2C5WB 2DCFA 2XDMA 4X68A 3CJMA 4OH0A 5AQ9A 4B4XA 1ERQA 3IXBA 5CEBA 1S0WA 1PWDA 4N9LA 4BLMA 3DW0A 1KVLA 1TDGA 1N9BA 3AGEA 3MZFA 4WZ5C 2QZ6A 5GHXA 4CPKA 1MXOA 2XGNA 3SS5A 3E2LA 3A3JA 2Y2GA 3PBSA 4X6TA 3NBLA 2V1ZA 4YFMA 5KSHA 5F83A 1PYYA 1TVFA 3ZG8B 4U0XA 1XGJA 4EBPA 3LO7A 4EV4A 4O7DA 5HFOA 4E6XA 3IF6C 2V2FF 5TR7A 1L0DA 3IWQA 1FSYA 1SDNA 4R1GA 5CXWA 4JXGA 4KZ9A 1BUEA 1CI9A 3G2ZA 1FCMA 3B3XA 2XD5A 5CECA 1RGYA 1YLWA 5JYPA 1SHVA 3UNWA 3O87A 4ZJ1A 3VP3A 4U0TA 4BD0A 2ZD8A 4E3NA 1IYOA 3P98A 5EVIA 4BQMA 1GHPA 4E3MA 4LV3A 4S2MA 5GLBA 5FI6A 5TFQA 1XXMA 3WS4A 1Q2PA 1RCJA 1W79A 3G32A 5FI7A 3N8SA 3ZG9B 5E2HA 3ZDJA 4KZ5A 4KG5A 1DJAA 2Y2OA 1KE0A 3IWOA 1FCOA 5EVIB 4QU3A 3ZFZA 4PM6A 3IWIA 2ZQDA 1Z6FA 1CI8A 4JXSA 4UAAA 1K6RA 3OZHA 2IWBA 1KDSA 1PW1A 3DWKA 5KZHA 4B88A 2WAFA 2J7VA 1ERMA 3MFDA 2A49A 2QMIA 3UE3A 4MEZA 1HVBA 1ESIA 1G68A 4R4SA 3WRZA 1BLCA 2J9PA 4CJNA 1CEFA 3Q07A 2Y2JA 4GDNA 5E2FA 5TGFA 4BD1A 3G30A 2J9OA 4EUZA 3GRJA 4ID4A 3TOIA 2WGWA 3PBTA 4OOYA 4X55A 1GCEA 4WELA 3SH9A 1YMXA 3GTCA 5FQMA 1JTDA 2HDRA 5EPHA 3W4OA 3NIAA 3A3FA 4E3KA 2WZZA 4U3TA 4UHUA 3IHBA 4OPQA 3NY4A 2Y2LA 1K56A 3BFFA 3ZHHA 3BFDA 3FWLA 1ZKJA 4ZJ3A 5I94A 2WGWB 4EBLA 1K57A 1YLPA 4F94A 4Q8IA 2ZQCA 2HPBA 4X53A 4WMCA 5DF8A 4E3OA 4KG2A 4C6YA 3C7VA 4IBXA 4L0LA 3CZDA 1LLBA
chains in the Genus database with same CATH superfamily
3MF0A 3KSFA 4OOMA 3UB6A 3FPWA 2XROA 4KQQA 4MBFA 3UDXA 4HBUA 2FFFB 3VFHA 5FI2A 2V0WA 2GJ3A 3MQOA 4GJ4A 1DP6A 1XGIA 4ZAMA 5HL6A 4EU0A 3E4QA 1FR6A 2JC7A 1W63Q 4Y2FA 3IX3A 4IUHA 2ZC7A 3WS0A 3MQ0A 3OBFA 5EVID 4PM5A 4LRYC 4P87A 3Q1FA 4NXEA 1XPBA 3UB8A 2V0UA 1PW8A 3HJIA 4BWIA 2W3DA 3GMWA 1YSPA 3EQVA 3TSGA 4KQOA 4C75A 1OT9A 3MZEA 1GSVA 3LI9A 2JKRI 4I39A 4I3IA 1TEMA 1L0EA 4HH3A 3T4SA 4OQ0A 5HDCA 3A3DA 3ITBA 5A90A 4DDYA 5KMWA 3CWFA 1OTIA 2QWSA 2OV5A 2QYBA 2Y55A 4GKUA 4ME4A 5E2GA 1D1JA 2EX8A 4UA7A 1T19A 3JYIA 4B93A 2XEPA 2H10A 4JF6A 4XT2A 3TE8A 4JGOA 2P08A 5M1AA 1AWIA 3DAVA 3BLSA 4GN2A 2VZWA 4O0PA 3GSGA 5DJTA 5I5LA 2D01A 4R4RA 3S7OA 3LCEA 5DTTA 2P04A 2XD1A 3UMDA 4KZ3A 3T1RA 3W4PA 3WRTA 3A3IA 4M4XA 4MBHA 4CLCC 5D3OA 3C4PA 1K55A 2Y8HA 3CMZA 3BQ8A 2QKPA 3QHYA 5FQ9A 5HAQA 4WF0A 3FPVA 3IXHA 1IKGA 4DE0A 2ZM0A 3F1OB 1MBLA 4UA9A 1IFQA 3ZG7B 4DE2A 3IF5A 4HIAA 1DP8A 1DJCA 5EFWA 2ZMVA 2H28A 1DP9A 2Y79A 1F9IA 4OP8A 5GL9A 2XFSA 1JNUA 1TS8A 1MC0A 2G2UA 1AXBA 2KX6A 2W0NA 1FCNA 2I72A 1NRFA 4XUZA 4OLGA 5K5BA 5L10A 4WEJA 1VM1A 2C6WB 2XA7M 5HAIA 1EROA 2ZOHA 3IBJA 3IX8A 3Q7VA 1ZG6A 1K54A 3E0YA 1D7EA 4K91A 3BY8A 2OAQ1 1D06A 4GOGA 4K0WA 4MNRA 3V5MA 3W8KA 2A3UA 2PRFA 4BENA 1N9LA 1EWZA 5MC7A 3BLMA 4RYEA 3UB5P 5AVEA 1PZOA 2NUPC 3MKEA 1GA9A 1S1YA 3MFXA 1OJ5A 2XFTA 4FCFA 4WZ5A 3ZVTA 4S2NC 3P09A 5HWVA 2FZ0A 1T18A 4ZDXA 4KENB 3R7WB 3PAGA 1J3WA 3PBRA 4HESA 2PD8A 3IF6B 2O0YA 3ULFA 3I7JA 4S2JA 4N1HA 3GECA 2HZ5A 3CHWP 4GB7A 3ZNYA 3UPOA 1JVJA 4H6JB 5EE8A 2EWVA 4S2IA 3KO6A 1E3UD 3NJAA 3SS4A 3Q81A 5EUAA 2XLNA 5HDDA 3HUOA 1OPXA 3T4QA 1NYMA 1I2WA 3VOZA 4CQHA 3AGFA 4FOFA 3PAEA 3VV4A 2G7UA 4ARZA 3RH8B 3NECA 4O01A 2PYRA 3FV7A 3S1YA 5L07A 2ZJ9A 4BBTA 3O86A 1I5QA 3T4TA 1EW0A 4HQAA 3HREA 2ZL1A 4JF5A 5GLDA 4QY5A 1WE4A 1H8ZA 1KGFA 1ZG4A 2PR6A 3S22A 2HJEA 2XDMA 4IUKA 5AQ9A 1G5UA 2CMNA 3AGEA 1TDGA 2J3TC 1YSQA 1SZVA 3U2AA 2L0WA 3K2NA 1A0KA 4YFMA 1TVFA 1V9YA 3OLOA 1XGJA 2OAP1 3LO7A 4EV4A 4O7DA 4NXGA 2V2FF 4BMWA 1TS0A 1FSYA 1SDNA 3S7QA 3B3XA 5JYPA 3UNWA 1UWNX 2WKQA 4BD0A 2ZD8A 3P98A 2NUTC 4GCZA 1GHPA 4UQIS 4LV3A 4S2MA 5GLBA 1Q2PA 3G32A 5FI7A 3N8SA 3ZG9B 5E2HA 1NWZA 1DJAA 2Y2OA 3H82A 3IWOA 1FCOA 4JGRA 1HLUP 3IWIA 2ZQDA 1Z6FA 1KDSA 3DWKA 3F1NA 3O5YA 4B88A 2A49A 2QMIA 1HVBA 3B47A 4BD1A 4EUZA 4HI4A 3QP1A 3TOIA 3PBTA 1IOUA 4OOYA 1GCEA 4WELA 4Q0JA 3NIAA 2V8CA 1YKDA 3IHBA 2Y2LA 3G6OA 2V9AA 4Q8IA 3BY9A 4YWZA 4WMCA 5DF8A 4E3OA 2VX8A 4WN5A 4R38A 3VP0A 2GZAA 5IHVA 3UE0A 2PU2A 2AVXA 5HZHA 3CITA 1JWPA 3DTEA 4UQIM 4DMZA 1WYCA 2OLUA 1LT0A 4RVAA 5HL1A 1GHIA 4BJPA 3NC8A 3MZDA 2PD7A 2WUQA 1DRMA 4OPRA 5F6AA 5KSCA 4E3IA 1H5XA 3QP2A 4OOLA 1KOUA 4LV1A 3T1XA 1W8QA 1RP5A 4NXBA 3PXPA 2ZC3B 2Y4AA 3MBZA 3FYZA 5EVIC 1KE4A 3LIBA 4OQIA 1IEMA 1HD8A 1OTEA 4MN7A 1GHMA 3Q7ZA 3UB7A 3HJKA 4CLCA 3CAXA 1XFNA 3FC7A 4MDZA 3FKVA 3SH8A 1M40A 2PT7A 4KZ6A 1YT4A 3W2ZA 2JE5A 3BJNA 1WYBA 4GNUA 1S1ZA 2J3TD 2J80A 3LYXA 1P97A 4FUWA 5HD5A 1BTLA 1CF0A 4OLDA 2Q9NA 4IBRA 2WYXA 5HAPA 1W7FA 1L0GA 3ZVWA 3NDGA 5AQ7A 1STZA 1BULA 1XJ2A 4EXOA 3PHYA 2HP6A 3E2KA 1K56D 4WBGA 4LENA 3QP5A 4JPMA 2DRWA 2LB9A 3WS1A 2QJ7A 1ZTUA 4DN0A 4DF6A 3LY4A 2Y2IA 4PM9A 3M6BA 3KX0X 1YLZA 3LY3A 4GD6A 5F69A 4XT2B 3VOYA 1ESUA 2V8FA 3HUNA 2BTFP 4EQ1A 2O9BA 3MJQA 3BRMA 3ZCZA 1OTDA 2JKTI 2WKHA 2ZQ8A 4QD4A 4ZRRA 3FG8A 4EBNA 1P9WA 4KZ4A 4OQHA 1XA7A 3M2KA 3ZGAB 2OWJA 1G6OA 3W4QA 4KUKA 4ZBEA 3OC2A 1YMSA 3UO9A 5A92A 2O9AA 2VGJA 1KDWA 3E98A 5DF7A 3LFVA 3S7PA 4OKPA 3NCKA 1LI9A 2V20A 3BM6A 4HHDA 2A2LA 2JKFA 4I3AA 3MSHA 4S2NA 3TRCA 1K4FA 2K7SA 4KQDA 4R3BA 5EOOA 1P9RA 4EERA 1NZUA 3PBQA 1NYYA 1SCWA 1RGZA 4IVIA 1YQSA 4LRZE 2W27A 2HJ9C 2KDKA 1MWTA 3F1PA 3V3RA 4DJ2A 3IBRA 3N7WA 2ZC6B 3G34A 5F1GA 3NI9A 2EXBA 3C5AA 3SZTA 3D9YA 2EWWA 4KZ8A 4JBFA 3Q7VB 3T50A 4R70A 2GDNA 2Y2KA 1PWGA 2M7UA 2DNSA 1JTGA 2H0TA 2A24A 1SKFA 4DE3A 3ZG0A 1YLYA 5GLAA 4C3QA 2W3FA 1F2KA 4KZBA 2IWDA 1WA9A 3NOPC 2ZC5B 2RCXA 2VGKA 5JYOA 1DJBA 1IYPA 3VP4A 3ZG5A 1GA0A 1VETA 1XFQA 2EX6A 3VE3A 1KE3A 5DTKA 2EFUA 4FH4A 3RFBA 2XA7S 4PHTA 1EI5A 4Z9QA 4R23A 3IQAA 2R9WA 4LV2A 3QNBA 1I2SA 4GZBA 5CX7A 2Y91A 3UDFA 3VE4A 4QHCA 3CUEC 4EEPA 2HDSA 3WWXA 2JHEA 1CK3A 4LLOB 1LL5A 4UA6A 3D72A 2HP5A 2QHKA 3OPLA 1FIKA 4GHIA 2ZMAA 2GX5A 1ES2A 3V67A 4S2PA 2HF6A 1TS6A 5FQKA 3LIDA 4ARZB 1LL8A 3PBOA 2J3WA 3BEBA 1YLTA 4ZTKA 2X71A 5HD3A 3H7WA 1M6KA 4A5RA 5DFXA 4BL2A 4Y0UA 1H3QA 3GVBA 1Y4OA 3KSHA 4X68A 2MJ6A 3EGXC 4EUVA 4B4XA 5CEBA 3IXBA 2ZL1B 1PWDA 4BLMA 1KVLA 4CPKA 3E2LA 3A3JA 3PBSA 4X6TA 3NBLA 5KSHA 5F83A 1CQAA 5TR7A 1L0DA 3IWQA 4D60A 4GS9A 1BUEA 5CECA 1YLWA 1SHVA 3O87A 3VP3A 1VEUA 1S67L 1IYOA 1OTAA 5EVIA 4E3MA 4G3VA 1T1CA 3WS4A 1RCJA 5L09A 2V1AA 4Q0HA 2B02A 3B42A 4WUJA 1CI8A 4JXSA 2ACGA 3PR6A 4UAAA 3OZHA 4PKYA 5IU1A 1G28A 2WAFA 3H82B 1G68A 4CJNA 4GDNA 3Q07A 5EVEA 4ID4A 3F1NB 3L9KA 5AVFA 3W4OA 1YMXA 3GTCA 5EPHA 3P7NA 2GNXA 3A3FA 2WZZA 4UHUA 3ZHHA 3BFDA 3FWLA 1ZKJA 4ZJ3A 3DTIA 1YLPA 4NG2A 3LICA 4KG2A 3CZDA 2WKRA 3DWZA 4WL9A 2HDUA 3ISGA 3G35A 1N9NA 1FOFA 3MXRA 3MKFA 3VP2A 4WYYA 3TJZC 5J7EA 5CEDA 3IH9A 3ITAA 4LRXC 1MWRA 2IA2A 3JPUA 1MZUA 1FSWA 5AQBA 2WKIA 2HDQA 3UN7A 1HTZA 2BG1A 1C3BA 4X56A 4HBTA 2FFYA 4JGQA 3HLWA 2XH9A 3BQAA 4LFUA 4KUOA 2B95A 5DFYA 1NLYA 4OPYA 2Z6CA 4WEKA 1NY0A 1K6SA 5G18A 2OWHA 4CLCB 3HLBA 5TBMA 1FILA 1H8MA 1N4OA 1PWCA 1VB6A 1PFLA 2L1MA 4N9KA 2WGIA 2EFXA 2JKTM 4PM8A 4HOIA 5FASA 3D4FA 3BECA 3NULA 1UGUA 4IVKA 3C7UA 5F82A 4PAUA 5DKLA 3BFEA 3FZCA 5G4ZA 2VLGA 1K55C 1TD5A 4FTXA 5J3WA 1JWVA 1S6RA 1YM1A 4Z1WA 3ZQ5A 4DJ3A 1XA1A 4N92A 5EVLA 3G31A 1NRJA 4Y7PA 4ESPA 2Y59A 1KGGA 4GLQA 1ALQA 3EQUA 2R9XA 3V39A 3C38A 3MR0A 2ZOIA 4G3KA 4Y0TA 3KSIA 2HGVA 5HX9A 3EEHA 3O88A 3HLDA 5AJGA 2VV6A 4WLAA 1OJGA 4PM7A 1N9OA 3A3EA 3UPPA 4CLCE 1XKZA 4L9FA 3GQZA 3QP6A 3EOIA 5TJJA 4HY8A 4Q0IA 1IYQA 5EECA 3HUMA 2XK1A 3BFCA 3IHAA 2VJWA 2JKRM 1K38A 5HWWA 4Y13A 4HEFA 2ZQ7A 4DXCA 3OCLA 1T1AA 3MXQA 2O99A 3FKWA 4JKTA 4B4ZA 5CHJA 3LR4A 2J8YA 2KOIA 2VV8A 5M19A 5IS1A 3T1SA 3E4PA 4JGPA 4Y15A 1BLPA 4QPRA 1E3UA 5J4EA 1S4RA 3T12B 4JXVA 1ES3A 3V3SA 4E04A 5IT5A 1PNEA 3CUEA 5CGSA 1W5DA 1Q2QA 3VP1A 1G6AA 3G4PA 3JVUA 3CPTA 2ZM2A 3M6HA 1BSGA 5A8BA 2ZQ9A 1LSXA 1TDLA 1BT5A 2WADA 3TG9A 3V50A 4QB8A 1QMEA 3F1PB 4OP5A 4DXBA 3NOTC 3N8RA 4RQ9A 4HJ4A 1F98A 1K0KA 4F3LA 2Y2QA 3OCNA 4NKPA 4ZJ2A 1MKMA 1IYSA 4HH2A 2M1CA 2H0YA 3T1QB 5DVAA 1JWZA 2P9VA 4KQRA 3JVVA 3OOVA 2P7JA 4M3KA 2A24B 3IXDA 4GDBA 4NETA 2Z2MB 3PBNA 3QP4A 3KYEA 4PPRA 1L2SA 5HDSA 2W3EA 3NOUC 5GHZA 4L9EA 5HARA 3VFFA 4ETXA 1ODVA 3BFGA 4OPZA 1VETB 5A91A 1PI4A 3LEZA 3GV9A 4P6ZS 4NEED 1YAXA 4HNBA 4RX3A 4X25A 2VEAA 3HVFA 5L8MA 3G2YA 3RXWA 3IS2A 4EETB 3E4OA 5CRFA 3IX4A 3ICYA 3PTEA 3LUQA 3N8LA 5CHUA 4JF4A 2Y2HA 1TF1A 1L0FA 1OTBA 2PBDP 5J8XA 2WZXA 2ZC4B 4FD8A 2W3HA 4Y5FA 5CERA 4OONA 5FATA 2H5SA 5AQAA 5DTSA 4LPZA 1ES5A 4QJGA 4MCWA 4GHIB 4S2KA 1NZOA 4EWFA 5L2FA 2VV7A 1XJ4A 4XUXA 2CC1A 1ZC2A 1SDEA 3C4OA 1NXYA 5CTMA 2E8IA 1KVMA 4D2OA 2Y2MA 4H8RA 4OH0A 1ERQA 3H7WB 4P6ZM 1S0WA 2K31A 3DW0A 1N9BA 1SKOA 4HJ6A 3SS5A 3KYQA 3ZG8B 2EA9A 4U0XA 4EBPA 5HFOA 4E6XA 3IF6C 2V1BA 2VGLM 4R1GA 2W1TA 4G3WA 3T4KA 1FCMA 2XD5A 1RGYA 4U0TA 4EESA 1X0OA 3DTKA 4GS9B 5TFQA 2XRNA 4YNRA 2E8JA 3ZDJA 1VEUB 3LIEA 4KG5A 5EVIB 3ZFZA 3RTYA 2INWA 3QP8A 2IWBA 1PW1A 2J7VA 1ERMA 1TS7A 3KSGA 3UE3A 4MEZA 1YPRA 1CEFA 2Y2JA 5TGFA 1LSVA 1GSXA 2J9OA 3GRJA 2WGWA 3A0SA 3TW8A 5I94A 2Q0OA 4E3KA 5FQMA 1JTDA 2HDRA 1GSWA 4U3TA 1K56A 3LIAA 2JKGA 5FEFA 3T4JA 2ZQCA 4X53A 1F5MA 3C7VA 4IBXA 3CLOA 1LLBA 2OOLA 3DBAA 1PZPA 3N4IA 1E25A 4WM9A 2ZBBA 3MXSA 3BWLA 5FQIA 3Q82A 5E43A 5FDSA 3OPRA 4MLLA 4XXRA 1E4DA 4MN6A 1U60A 1UWPX 5GHYA 1FR1A 4Y0OA 1K25A 1Y54A 2XSSA 4S2OA 5FEGA 5GLCA 2JCHA 4KZ7A 4E6WA 1OMEA 3EWKA 3T4LA 3DTMA 1OT6A 4EW7A 3ZYTA 1W63M 1MY8A 5EM0A 2I9VA 4R0QA 1O07A 5HWTA 5HPFA 2PU4A 3R4KA 2PBYA 3MQQA 4WZ4A 1PI5A 4I38A 2UV0E 4MBKA 1HZOA 2VK3A 3VSLA 2VKSA 4LV0A 4P85A 5EOEA 1DY6A 3UPNA 4BBVA 5FQJA 4Y17A 3C30A 5TBMB 5DF9A 2WGVA 2BLSA 2X02A 1BLHA 3UB9A 1O7EA 4DRTA 5FDHA 1XX2A 3K3CA 1MWSA 3S7NA 5FAOA 1VQQA 3B33A 1K57C 5C5KA 3D3OA 4BBUA 4II7A 3HLGA 3N6IA 3HLFA 3T4OA 3EGDC 2B18A 2P74A 4WMCD 4I3JA 4P0MA 3UDIA 3BYDA 3LGOA 3UE6A 4MMNA 4DDSA 2HV1A 1LL9A 4X69A 4K08A 2WKEA 2ZLYA 1ONHA 5U47A 3UMEA 3M2JA 5CHMA 1T1BA 2Y2NA 4RX2A 3VMAA 4R3JA 3PYPA 4N1XA 2QJ5A 3U4LP 3HLEA 3IXGA 3WS2A 3UY6A 4R3AA 3AGDA 1BLSA 4GD8A 4IEDA 2BASA 1XJ3A 2ZQAA 5HW3A 4B9OA 2Y2PA 2JN7A 3S4XA 2Z6DA 4YOFA 2B5RA 2R78A 1MKIA 4CLCD 4E3JA 3KYZA 4UEYA 3F1OA 4IJGA 3SW1A 4S2LA 4OVDA 3H9WA 3WS5A 4JLFA 3GDIA 1XP4A 2PHYA 1NLZA 5FA7A 2L4RA 3GR2A 5F1FA 3O3VA 5KIZA 1FQGA 2O9CA 2G2WA 1L3LA 2EX9A 2XF3A 2QPNA 2YKHA 1LI0A 4LCMA 2EX2A 4X1LA 4EEUA 3OPHA 2WAEA 2FH5A 3IT9A 3VSKA 1PIOA 2OSUA 4MN5A 5CGXA 2Q9MA 3SH7A 5FAPA 3UE1A 3HL9A 4JXWA 5E2EA 4X1MA 1KGEA 1ES4A 2HP9A 3MMHA 1BZAA 4BL3A 2W1RA 2JBFA 3NDEA 5CGWA 3C8CA 3CPTB 3SS3A 2EXAA 1NJ4A 4EQIA 2UWXA 1K4EA 4HJ3A 2ZM8A 2PDRA 2X01A 2D02A 5G4YA 3OPPA 4P6BA 3MS6A 4E3LA 1LSWA 4F3LB 4LCLA 4FH2A 3RXXA 3ZNTA 5FSRA 1IELA 3HBRA 2OLVA 5F68A 4QY6A 2KLIA 1LHYA 2P9VB 4ETZA 2WK0A 4KZAA 5EV0A 3R7WA 5BOHA 3SOIA 4OQGA 2W3GA 3IF6A 3P01A 2XQZA 3QNCA 4GW9A 4O8GA 1PRQA 2RL3A 1W8YA 3CG5A 4H6JA 3A0RA 4I5SA 4L9GA 4QWOA 4DE1A 2PYPA 1MWUA 1S4SA 3HLCA 4K0XA 2IWCA 5A93A 5EM1A 4R6LA 4Y3IA 1J9MA 4IHQA 4DKIA 1MPLA 4HP9A 3LR0A 1ACFA 3IH8A 1IKIA 1CJFA 5HPIA 5CTNA 3IS2B 1K54C 1YLJA 5FAQA 4FSFA 5M18A 2Z2LB 1CEGA 4AFIA 4YINA 5HSQA 1BYWA 2XR0A 1H8YA 3LIFA 3RJUA 1ONGA 4PMAA 3LR5A 4KG6A 1QMFA 4RA7A 5FQQA 3BW6A 4NK3A 3LI8A 5F5YA 3A0VA 4HP4A 3EEAA 2C5WB 5DJUA 2DCFA 3CJMA 3VOLA 4N9LA 3MZFA 4WZ5C 2QZ6A 5GHXA 1MXOA 1Z09A 2XGNA 1ZHHB 2Y2GA 2V1ZA 4NXFA 2YKFA 1PYYA 2WKPA 1H0MA 1S66L 1SKOB 5CXWA 4JXGA 4KZ9A 3NHQA 1CI9A 3G2ZA 4LGWA 1V9ZA 4ZJ1A 4E3NA 2W1TB 4BQMA 3LEQA 1VHMA 2M7VA 2PR5A 5FI6A 1XXMA 2VA0A 1W79A 4KZ5A 3CI6A 1KE0A 4QU3A 1Y28A 1XJ6A 2LB5A 4PM6A 3K3DA 2PAVP 1K6RA 2K2NA 5KZHA 2ZMFA 3MFDA 1ESIA 4R4SA 3WRZA 1BLCA 2J9PA 5E2FA 3G30A 5DKKA 4X55A 3SH9A 5LBRA 4OPQA 3NY4A 3C2WA 3BFFA 4PKYG 2WGWB 4EBLA 1K57A 5FL3A 4F94A 2DMWA 2HPBA 3LR3A 4C6YA 1P0ZA 3L7HA 3HCYA 2VGLS 4L0LA
chains in the Genus database with same CATH topology
3DWZA 3VP0A 5IHVA 2HDUA 3UE0A 3ISGA 3G35A 4OOMA 2PU2A 1PZPA 1FOFA 3N4IA 3MXRA 3MKFA 3VP2A 1E25A 4WM9A 1JWPA 4WYYA 4KQQA 3MXSA 1WYCA 2OLUA 4RVAA 5HL1A 1GHIA 4MBFA 5FQIA 4BJPA 3NC8A 3Q82A 3MZDA 4HBUA 5E43A 3IH9A 3ITAA 3UDXA 5CEDA 2FFFB 1MWRA 3OPRA 4MLLA 4XXRA 1E4DA 2WUQA 3VFHA 1FSWA 5AQBA 4OPRA 5KSCA 2WKIA 5FI2A 4E3IA 1U60A 1H5XA 4OOLA 2HDQA 5GHYA 1FR1A 4LV1A 4Y0OA 3UN7A 1K25A 1HTZA 1W8QA 1XGIA 1Y54A 4ZAMA 4S2OA 1RP5A 2BG1A 5GLCA 1C3BA 2JCHA 2ZC3B 1FR6A 4HBTA 2JC7A 4X56A 4KZ7A 2FFYA 4E6WA 1OMEA 2Y4AA 3MBZA 3DTMA 3HLWA 3FYZA 5EVIC 1KE4A 2XH9A 4OQIA 1IEMA 1HD8A 1GHMA 1MY8A 2ZC7A 3Q7ZA 3WS0A 4R0QA 5EVID 4PM5A 1O07A 4P87A 2PU4A 2PBYA 4WZ4A 3FKVA 3SH8A 3Q1FA 4OPYA 1XPBA 1PI5A 4WEKA 1M40A 1NY0A 4KZ6A 4MBKA 1YT4A 1K6SA 5G18A 1HZOA 2JE5A 3HLBA 3VSLA 1WYBA 4P85A 4GNUA 4LV0A 1N4OA 1PW8A 5EOEA 1PWCA 1DY6A 3UPNA 3GMWA 3EQVA 4N9KA 5FQJA 3TSGA 4KQOA 1BTLA 2WGIA 4C75A 3MZEA 2EFXA 4PM8A 4OLDA 5DF9A 2Q9NA 2WGVA 2BLSA 2WYXA 2X02A 4IBRA 5HAPA 1BLHA 1O7EA 1W7FA 1L0GA 3ZVWA 4DRTA 3NDGA 5FASA 5FDHA 1TEMA 1XX2A 1MWSA 3D4FA 3BECA 5AQ7A 1L0EA 5FAOA 4IVKA 1BULA 4OQ0A 1VQQA 3A3DA 3ITBA 3C7UA 4DDYA 5A90A 1K57C 5KMWA 2HP6A 3E2KA 1K56D 2OV5A 4WBGA 5F82A 2Y55A 4GKUA 3HLGA 3N6IA 4LENA 3HLFA 3BFEA 3FZCA 5E2GA 4JPMA 2DRWA 2EX8A 1K55C 2P74A 4UA7A 4WMCD 3WS1A 3JYIA 4P0MA 3UDIA 3BYDA 2XEPA 2H10A 4JF6A 1JWVA 1S6RA 4DDSA 5M1AA 1YM1A 1LL9A 4DF6A 3BLSA 3LY4A 2Y2IA 4GN2A 4PM9A 1XA1A 3M6BA 4N92A 4X69A 1YLZA 2WKEA 2ZLYA 3LY3A 5EVLA 1ONHA 4GD6A 3GSGA 3G31A 4Y7PA 5U47A 3VOYA 1ESUA 3HUNA 3M2JA 5CHMA 2Y59A 2Y2NA 4R4RA 4RX2A 3VMAA 3BRMA 3LCEA 4R3JA 1KGGA 3ZCZA 1ALQA 2WKHA 4N1XA 3EQUA 2ZQ8A 2R9XA 3V39A 3HLEA 4QD4A 5DTTA 3IXGA 2XD1A 3WS2A 3UY6A 4Y0TA 4EBNA 3AGDA 4KZ3A 1BLSA 4GD8A 4IEDA 3W4PA 4KZ4A 3WRTA 5HX9A 4OQHA 3O88A 2ZQAA 3HLDA 1XA7A 3A3IA 5HW3A 3M2KA 4MBHA 5D3OA 2Y2PA 3C4PA 3ZGAB 1K55A 3S4XA 3W4QA 4PM7A 2B5RA 3A3EA 4ZBEA 3OC2A 3UPPA 1YMSA 3CMZA 1MKIA 1XKZA 3GQZA 4E3JA 3UO9A 1IYQA 5EECA 5A92A 3QHYA 2VGJA 3HUMA 5FQ9A 2XK1A 5HAQA 3BFCA 3IXHA 4S2LA 1IKGA 3IHAA 1KDWA 4OVDA 3WS5A 5DF7A 4JLFA 4OKPA 4DE0A 1K38A 3NCKA 1LI9A 1XP4A 4HEFA 2V20A 2ZQ7A 3BM6A 2ZM0A 4DXCA 3OCLA 1MBLA 4UA9A 4JKTA 3FKWA 5FA7A 4B4ZA 5CHJA 4S2NA 3ZG7B 4DE2A 3IF5A 2J8YA 3GR2A 5F1FA 1DJCA 3O3VA 1K4FA 5M19A 4R3BA 1FQGA 2G2WA 5EOOA 2EX9A 2XF3A 4OP8A 5GL9A 2QPNA 1NZUA 2XFSA 3PBQA 1NYYA 1LI0A 4LCMA 2EX2A 1BLPA 1E3UA 1SCWA 1RGZA 4IVIA 3OPHA 1YQSA 2G2UA 1AXBA 2WAEA 1FCNA 3IT9A 2I72A 1ES3A 1NRFA 4JXVA 3V3SA 3VSKA 4XUZA 4OLGA 1MWTA 5CGSA 1PIOA 1W5DA 1Q2QA 2OSUA 1VM1A 4WEJA 5CGXA 2Q9MA 2C6WB 3VP1A 3V3RA 1G6AA 3G4PA 5HAIA 3SH7A 3N7WA 5FAPA 3UE1A 1EROA 2ZM2A 3M6HA 1BSGA 3HL9A 4JXWA 5E2EA 2ZQ9A 2WADA 1TDLA 1BT5A 1KGEA 3TG9A 3V50A 3Q7VA 4QB8A 2ZC6B 3G34A 1ES4A 2HP9A 5F1GA 1ZG6A 1K54A 3NI9A 1BZAA 2EXBA 1QMEA 4BL3A 4K91A 2JBFA 3C5AA 3NDEA 5CGWA 4OP5A 4DXBA 4GOGA 3SS3A 2EXAA 3N8RA 1NJ4A 4EQIA 4K0WA 2UWXA 4MNRA 3V5MA 4KZ8A 1K4EA 4JBFA 3Q7VB 3W8KA 2A3UA 2Y2QA 2ZM8A 3OCNA 2GDNA 2Y2KA 4ZJ2A 1PWGA 4BENA 2DNSA 1JTGA 1IYSA 2H0TA 2X01A 2H0YA 3OPPA 4P6BA 4E3LA 1SKFA 4DE3A 1EWZA 5DVAA 1JWZA 4LCLA 2P9VA 4FH2A 3ZG0A 1YLYA 4KQRA 3BLMA 3RXXA 4RYEA 3ZNTA 5GLAA 5FSRA 1PZOA 4C3QA 4M3KA 1IELA 3HBRA 2OLVA 4KZBA 2IWDA 3IXDA 3MKEA 4GDBA 4NETA 4QY6A 1GA9A 1LHYA 2Z2MB 2RCXA 2ZC5B 3PBNA 2P9VB 2VGKA 2XFTA 4FCFA 5JYOA 4WZ5A 3ZVTA 1DJBA 4PPRA 1L2SA 1IYPA 2WK0A 4KZAA 3VP4A 5BOHA 4S2NC 3P09A 3SOIA 4OQGA 3ZG5A 1GA0A 3IF6A 2EX6A 5GHZA 5HARA 2XQZA 3QNCA 1KE3A 4ZDXA 3VFFA 3BFGA 4KENB 5DTKA 4OPZA 2RL3A 3PAGA 1W8YA 2EFUA 3CG5A 4FH4A 4DE1A 3PBRA 4HESA 1EI5A 5A91A 3IF6B 1PI4A 1MWUA 3HLCA 4K0XA 3I7JA 3LEZA 3GV9A 2IWCA 4N1HA 4S2JA 4Z9QA 5A93A 4R23A 3IQAA 3ZNYA 4GB7A 2R9WA 4LV2A 1JVJA 3QNBA 3UPOA 1I2SA 4GZBA 4RX3A 5EE8A 3HVFA 2Y91A 1J9MA 3G2YA 4S2IA 3UDFA 4DKIA 1E3UD 4QHCA 3RXWA 3SS4A 1MPLA 3Q81A 5CRFA 5EUAA 3PTEA 3N8LA 2HDSA 3WWXA 2XLNA 3IH8A 5CHUA 1CK3A 1IKIA 4JF4A 3HUOA 1NYMA 1LL5A 2Y2HA 5CTNA 4UA6A 1I2WA 1L0FA 5J8XA 2HP5A 2WZXA 3VOZA 2ZC4B 4FD8A 3OPLA 5CERA 1K54C 3AGFA 4OONA 3PAEA 2ZMAA 1ES2A 5FATA 1YLJA 2H5SA 5FAQA 4FSFA 5M18A 5AQAA 5DTSA 4S2PA 2Z2LB 1CEGA 1ES5A 4YINA 4QJGA 5FQKA 3FV7A 2XR0A 1H8YA 3RJUA 3S1YA 4S2KA 1ONGA 1NZOA 3PBOA 4PMAA 2ZJ9A 3BEBA 4EWFA 4KG6A 5L2FA 1YLTA 3O86A 2X71A 4ZTKA 4XUXA 1I5QA 1QMFA 1ZC2A 1SDEA 2CC1A 3HREA 4JF5A 4RA7A 1M6KA 4A5RA 5GLDA 3C4OA 1NXYA 4QY5A 2E8IA 5CTMA 1KVMA 5FQQA 4NK3A 4BL2A 4D2OA 2Y2MA 4Y0UA 1WE4A 1H8ZA 4H8RA 1KGFA 1ZG4A 3GVBA 3S22A 2C5WB 2DCFA 2XDMA 4X68A 3CJMA 4OH0A 5AQ9A 4B4XA 1ERQA 3IXBA 5CEBA 1S0WA 1PWDA 4N9LA 4BLMA 3DW0A 1KVLA 1TDGA 1N9BA 3AGEA 3MZFA 4WZ5C 2QZ6A 5GHXA 4CPKA 1MXOA 2XGNA 3SS5A 3E2LA 3A3JA 2Y2GA 3PBSA 4X6TA 3NBLA 2V1ZA 4YFMA 5KSHA 5F83A 1PYYA 1TVFA 3ZG8B 4U0XA 1XGJA 4EBPA 3LO7A 4EV4A 4O7DA 5HFOA 4E6XA 3IF6C 2V2FF 5TR7A 1L0DA 3IWQA 1FSYA 1SDNA 4R1GA 5CXWA 4JXGA 4KZ9A 1BUEA 1CI9A 3G2ZA 1FCMA 3B3XA 2XD5A 5CECA 1RGYA 1YLWA 5JYPA 1SHVA 3UNWA 3O87A 4ZJ1A 3VP3A 4U0TA 4BD0A 2ZD8A 4E3NA 1IYOA 3P98A 5EVIA 4BQMA 1GHPA 4E3MA 4LV3A 4S2MA 5GLBA 5FI6A 5TFQA 1XXMA 3WS4A 1Q2PA 1RCJA 1W79A 3G32A 5FI7A 3N8SA 3ZG9B 5E2HA 3ZDJA 4KZ5A 4KG5A 1DJAA 2Y2OA 1KE0A 3IWOA 1FCOA 5EVIB 4QU3A 3ZFZA 4PM6A 3IWIA 2ZQDA 1Z6FA 1CI8A 4JXSA 4UAAA 1K6RA 3OZHA 2IWBA 1KDSA 1PW1A 3DWKA 5KZHA 4B88A 2WAFA 2J7VA 1ERMA 3MFDA 2A49A 2QMIA 3UE3A 4MEZA 1HVBA 1ESIA 1G68A 4R4SA 3WRZA 1BLCA 2J9PA 4CJNA 1CEFA 3Q07A 2Y2JA 4GDNA 5E2FA 5TGFA 4BD1A 3G30A 2J9OA 4EUZA 3GRJA 4ID4A 3TOIA 2WGWA 3PBTA 4OOYA 4X55A 1GCEA 4WELA 3SH9A 1YMXA 3GTCA 5FQMA 1JTDA 2HDRA 5EPHA 3W4OA 3NIAA 3A3FA 4E3KA 2WZZA 4U3TA 4UHUA 3IHBA 4OPQA 3NY4A 2Y2LA 1K56A 3BFFA 3ZHHA 3BFDA 3FWLA 1ZKJA 4ZJ3A 5I94A 2WGWB 4EBLA 1K57A 1YLPA 4F94A 4Q8IA 2ZQCA 2HPBA 4X53A 4WMCA 5DF8A 4E3OA 4KG2A 4C6YA 3C7VA 4IBXA 4L0LA 3CZDA 1LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWZ A;  3VP0 A;  5IHV A;  2HDU A;  3UE0 A;  3ISG A;  3G35 A;  4OOM A;  2PU2 A;  1PZP A;  1FOF A;  3N4I A;  3MXR A;  3MKF A;  3VP2 A;  1E25 A;  4WM9 A;  1JWP A;  4WYY A;  4KQQ A;  3MXS A;  1WYC A;  2OLU A;  4RVA A;  5HL1 A;  1GHI A;  4MBF A;  5FQI A;  4BJP A;  3NC8 A;  3Q82 A;  3MZD A;  4HBU A;  5E43 A;  3IH9 A;  3ITA A;  3UDX A;  5CED A;  2FFF B;  1MWR A;  3OPR A;  4MLL A;  4XXR A;  1E4D A;  2WUQ A;  3VFH A;  1FSW A;  5AQB A;  4OPR A;  5KSC A;  2WKI A;  5FI2 A;  4E3I A;  1U60 A;  1H5X A;  4OOL A;  2HDQ A;  5GHY A;  1FR1 A;  4LV1 A;  4Y0O A;  3UN7 A;  1K25 A;  1HTZ A;  1W8Q A;  1XGI A;  1Y54 A;  4ZAM A;  4S2O A;  1RP5 A;  2BG1 A;  5GLC A;  1C3B A;  2JCH A;  2ZC3 B;  1FR6 A;  4HBT A;  2JC7 A;  4X56 A;  4KZ7 A;  2FFY A;  4E6W A;  1OME A;  2Y4A A;  3MBZ A;  3DTM A;  3HLW A;  3FYZ A;  5EVI C;  1KE4 A;  2XH9 A;  4OQI A;  1IEM A;  1HD8 A;  1GHM A;  1MY8 A;  2ZC7 A;  3Q7Z A;  3WS0 A;  4R0Q A;  5EVI D;  4PM5 A;  1O07 A;  4P87 A;  2PU4 A;  2PBY A;  4WZ4 A;  3FKV A;  3SH8 A;  3Q1F A;  4OPY A;  1XPB A;  1PI5 A;  4WEK A;  1M40 A;  1NY0 A;  4KZ6 A;  4MBK A;  1YT4 A;  1K6S A;  5G18 A;  1HZO A;  2JE5 A;  3HLB A;  3VSL A;  1WYB A;  4P85 A;  4GNU A;  4LV0 A;  1N4O A;  1PW8 A;  5EOE A;  1PWC A;  1DY6 A;  3UPN A;  3GMW A;  3EQV A;  4N9K A;  5FQJ A;  3TSG A;  4KQO A;  1BTL A;  2WGI A;  4C75 A;  3MZE A;  2EFX A;  4PM8 A;  4OLD A;  5DF9 A;  2Q9N A;  2WGV A;  2BLS A;  2WYX A;  2X02 A;  4IBR A;  5HAP A;  1BLH A;  1O7E A;  1W7F A;  1L0G A;  3ZVW A;  4DRT A;  3NDG A;  5FAS A;  5FDH A;  1TEM A;  1XX2 A;  1MWS A;  3D4F A;  3BEC A;  5AQ7 A;  1L0E A;  5FAO A;  4IVK A;  1BUL A;  4OQ0 A;  1VQQ A;  3A3D A;  3ITB A;  3C7U A;  4DDY A;  5A90 A;  1K57 C;  5KMW A;  2HP6 A;  3E2K A;  1K56 D;  2OV5 A;  4WBG A;  5F82 A;  2Y55 A;  4GKU A;  3HLG A;  3N6I A;  4LEN A;  3HLF A;  3BFE A;  3FZC A;  5E2G A;  4JPM A;  2DRW A;  2EX8 A;  1K55 C;  2P74 A;  4UA7 A;  4WMC D;  3WS1 A;  3JYI A;  4P0M A;  3UDI A;  3BYD A;  2XEP A;  2H10 A;  4JF6 A;  1JWV A;  1S6R A;  4DDS A;  5M1A A;  1YM1 A;  1LL9 A;  4DF6 A;  3BLS A;  3LY4 A;  2Y2I A;  4GN2 A;  4PM9 A;  1XA1 A;  3M6B A;  4N92 A;  4X69 A;  1YLZ A;  2WKE A;  2ZLY A;  3LY3 A;  5EVL A;  1ONH A;  4GD6 A;  3GSG A;  3G31 A;  4Y7P A;  5U47 A;  3VOY A;  1ESU A;  3HUN A;  3M2J A;  5CHM A;  2Y59 A;  2Y2N A;  4R4R A;  4RX2 A;  3VMA A;  3BRM A;  3LCE A;  4R3J A;  1KGG A;  3ZCZ A;  1ALQ A;  2WKH A;  4N1X A;  3EQU A;  2ZQ8 A;  2R9X A;  3V39 A;  3HLE A;  4QD4 A;  5DTT A;  3IXG A;  2XD1 A;  3WS2 A;  3UY6 A;  4Y0T A;  4EBN A;  3AGD A;  4KZ3 A;  1BLS A;  4GD8 A;  4IED A;  3W4P A;  4KZ4 A;  3WRT A;  5HX9 A;  4OQH A;  3O88 A;  2ZQA A;  3HLD A;  1XA7 A;  3A3I A;  5HW3 A;  3M2K A;  4MBH A;  5D3O A;  2Y2P A;  3C4P A;  3ZGA B;  1K55 A;  3S4X A;  3W4Q A;  4PM7 A;  2B5R A;  3A3E A;  4ZBE A;  3OC2 A;  3UPP A;  1YMS A;  3CMZ A;  1MKI A;  1XKZ A;  3GQZ A;  4E3J A;  3UO9 A;  1IYQ A;  5EEC A;  5A92 A;  3QHY A;  2VGJ A;  3HUM A;  5FQ9 A;  2XK1 A;  5HAQ A;  3BFC A;  3IXH A;  4S2L A;  1IKG A;  3IHA A;  1KDW A;  4OVD A;  3WS5 A;  5DF7 A;  4JLF A;  4OKP A;  4DE0 A;  1K38 A;  3NCK A;  1LI9 A;  1XP4 A;  4HEF A;  2V20 A;  2ZQ7 A;  3BM6 A;  2ZM0 A;  4DXC A;  3OCL A;  1MBL A;  4UA9 A;  4JKT A;  3FKW A;  5FA7 A;  4B4Z A;  5CHJ A;  4S2N A;  3ZG7 B;  4DE2 A;  3IF5 A;  2J8Y A;  3GR2 A;  5F1F A;  1DJC A;  3O3V A;  1K4F A;  5M19 A;  4R3B A;  1FQG A;  2G2W A;  5EOO A;  2EX9 A;  2XF3 A;  4OP8 A;  5GL9 A;  2QPN A;  1NZU A;  2XFS A;  3PBQ A;  1NYY A;  1LI0 A;  4LCM A;  2EX2 A;  1BLP A;  1E3U A;  1SCW A;  1RGZ A;  4IVI A;  3OPH A;  1YQS A;  2G2U A;  1AXB A;  2WAE A;  1FCN A;  3IT9 A;  2I72 A;  1ES3 A;  1NRF A;  4JXV A;  3V3S A;  3VSK A;  4XUZ A;  4OLG A;  1MWT A;  5CGS A;  1PIO A;  1W5D A;  1Q2Q A;  2OSU A;  1VM1 A;  4WEJ A;  5CGX A;  2Q9M A;  2C6W B;  3VP1 A;  3V3R A;  1G6A A;  3G4P A;  5HAI A;  3SH7 A;  3N7W A;  5FAP A;  3UE1 A;  1ERO A;  2ZM2 A;  3M6H A;  1BSG A;  3HL9 A;  4JXW A;  5E2E A;  2ZQ9 A;  2WAD A;  1TDL A;  1BT5 A;  1KGE A;  3TG9 A;  3V50 A;  3Q7V A;  4QB8 A;  2ZC6 B;  3G34 A;  1ES4 A;  2HP9 A;  5F1G A;  1ZG6 A;  1K54 A;  3NI9 A;  1BZA A;  2EXB A;  1QME A;  4BL3 A;  4K91 A;  2JBF A;  3C5A A;  3NDE A;  5CGW A;  4OP5 A;  4DXB A;  4GOG A;  3SS3 A;  2EXA A;  3N8R A;  1NJ4 A;  4EQI A;  4K0W A;  2UWX A;  4MNR A;  3V5M A;  4KZ8 A;  1K4E A;  4JBF A;  3Q7V B;  3W8K A;  2A3U A;  2Y2Q A;  2ZM8 A;  3OCN A;  2GDN A;  2Y2K A;  4ZJ2 A;  1PWG A;  4BEN A;  2DNS A;  1JTG A;  1IYS A;  2H0T A;  2X01 A;  2H0Y A;  3OPP A;  4P6B A;  4E3L A;  1SKF A;  4DE3 A;  1EWZ A;  5DVA A;  1JWZ A;  4LCL A;  2P9V A;  4FH2 A;  3ZG0 A;  1YLY A;  4KQR A;  3BLM A;  3RXX A;  4RYE A;  3ZNT A;  5GLA A;  5FSR A;  1PZO A;  4C3Q A;  4M3K A;  1IEL A;  3HBR A;  2OLV A;  4KZB A;  2IWD A;  3IXD A;  3MKE A;  4GDB A;  4NET A;  4QY6 A;  1GA9 A;  1LHY A;  2Z2M B;  2RCX A;  2ZC5 B;  3PBN A;  2P9V B;  2VGK A;  2XFT A;  4FCF A;  5JYO A;  4WZ5 A;  3ZVT A;  1DJB A;  4PPR A;  1L2S A;  1IYP A;  2WK0 A;  4KZA A;  3VP4 A;  5BOH A;  4S2N C;  3P09 A;  3SOI A;  4OQG A;  3ZG5 A;  1GA0 A;  3IF6 A;  2EX6 A;  5GHZ A;  5HAR A;  2XQZ A;  3QNC A;  1KE3 A;  4ZDX A;  3VFF A;  3BFG A;  4KEN B;  5DTK A;  4OPZ A;  2RL3 A;  3PAG A;  1W8Y A;  2EFU A;  3CG5 A;  4FH4 A;  4DE1 A;  3PBR A;  4HES A;  1EI5 A;  5A91 A;  3IF6 B;  1PI4 A;  1MWU A;  3HLC A;  4K0X A;  3I7J A;  3LEZ A;  3GV9 A;  2IWC A;  4N1H A;  4S2J A;  4Z9Q A;  5A93 A;  4R23 A;  3IQA A;  3ZNY A;  4GB7 A;  2R9W A;  4LV2 A;  1JVJ A;  3QNB A;  3UPO A;  1I2S A;  4GZB A;  4RX3 A;  5EE8 A;  3HVF A;  2Y91 A;  1J9M A;  3G2Y A;  4S2I A;  3UDF A;  4DKI A;  1E3U D;  4QHC A;  3RXW A;  3SS4 A;  1MPL A;  3Q81 A;  5CRF A;  5EUA A;  3PTE A;  3N8L A;  2HDS A;  3WWX A;  2XLN A;  3IH8 A;  5CHU A;  1CK3 A;  1IKI A;  4JF4 A;  3HUO A;  1NYM A;  1LL5 A;  2Y2H A;  5CTN A;  4UA6 A;  1I2W A;  1L0F A;  5J8X A;  2HP5 A;  2WZX A;  3VOZ A;  2ZC4 B;  4FD8 A;  3OPL A;  5CER A;  1K54 C;  3AGF A;  4OON A;  3PAE A;  2ZMA A;  1ES2 A;  5FAT A;  1YLJ A;  2H5S A;  5FAQ A;  4FSF A;  5M18 A;  5AQA A;  5DTS A;  4S2P A;  2Z2L B;  1CEG A;  1ES5 A;  4YIN A;  4QJG A;  5FQK A;  3FV7 A;  2XR0 A;  1H8Y A;  3RJU A;  3S1Y A;  4S2K A;  1ONG A;  1NZO A;  3PBO A;  4PMA A;  2ZJ9 A;  3BEB A;  4EWF A;  4KG6 A;  5L2F A;  1YLT A;  3O86 A;  2X71 A;  4ZTK A;  4XUX A;  1I5Q A;  1QMF A;  1ZC2 A;  1SDE A;  2CC1 A;  3HRE A;  4JF5 A;  4RA7 A;  1M6K A;  4A5R A;  5GLD A;  3C4O A;  1NXY A;  4QY5 A;  2E8I A;  5CTM A;  1KVM A;  5FQQ A;  4NK3 A;  4BL2 A;  4D2O A;  2Y2M A;  4Y0U A;  1WE4 A;  1H8Z A;  4H8R A;  1KGF A;  1ZG4 A;  3GVB A;  3S22 A;  2C5W B;  2DCF A;  2XDM A;  4X68 A;  3CJM A;  4OH0 A;  5AQ9 A;  4B4X A;  1ERQ A;  3IXB A;  5CEB A;  1S0W A;  1PWD A;  4N9L A;  4BLM A;  3DW0 A;  1KVL A;  1TDG A;  1N9B A;  3AGE A;  3MZF A;  4WZ5 C;  2QZ6 A;  5GHX A;  4CPK A;  1MXO A;  2XGN A;  3SS5 A;  3E2L A;  3A3J A;  2Y2G A;  3PBS A;  4X6T A;  3NBL A;  2V1Z A;  4YFM A;  5KSH A;  5F83 A;  1PYY A;  1TVF A;  3ZG8 B;  4U0X A;  1XGJ A;  4EBP A;  3LO7 A;  4EV4 A;  4O7D A;  5HFO A;  4E6X A;  3IF6 C;  2V2F F;  5TR7 A;  1L0D A;  3IWQ A;  1FSY A;  1SDN A;  4R1G A;  5CXW A;  4JXG A;  4KZ9 A;  1BUE A;  1CI9 A;  3G2Z A;  1FCM A;  3B3X A;  2XD5 A;  5CEC A;  1RGY A;  1YLW A;  5JYP A;  1SHV A;  3UNW A;  3O87 A;  4ZJ1 A;  3VP3 A;  4U0T A;  4BD0 A;  2ZD8 A;  4E3N A;  1IYO A;  3P98 A;  5EVI A;  4BQM A;  1GHP A;  4E3M A;  4LV3 A;  4S2M A;  5GLB A;  5FI6 A;  5TFQ A;  1XXM A;  3WS4 A;  1Q2P A;  1RCJ A;  1W79 A;  3G32 A;  5FI7 A;  3N8S A;  3ZG9 B;  5E2H A;  3ZDJ A;  4KZ5 A;  4KG5 A;  1DJA A;  2Y2O A;  1KE0 A;  3IWO A;  1FCO A;  5EVI B;  4QU3 A;  3ZFZ A;  4PM6 A;  3IWI A;  2ZQD A;  1Z6F A;  1CI8 A;  4JXS A;  4UAA A;  1K6R A;  3OZH A;  2IWB A;  1KDS A;  1PW1 A;  3DWK A;  5KZH A;  4B88 A;  2WAF A;  2J7V A;  1ERM A;  3MFD A;  2A49 A;  2QMI A;  3UE3 A;  4MEZ A;  1HVB A;  1ESI A;  1G68 A;  4R4S A;  3WRZ A;  1BLC A;  2J9P A;  4CJN A;  1CEF A;  3Q07 A;  2Y2J A;  4GDN A;  5E2F A;  5TGF A;  4BD1 A;  3G30 A;  2J9O A;  4EUZ A;  3GRJ A;  4ID4 A;  3TOI A;  2WGW A;  3PBT A;  4OOY A;  4X55 A;  1GCE A;  4WEL A;  3SH9 A;  1YMX A;  3GTC A;  5FQM A;  1JTD A;  2HDR A;  5EPH A;  3W4O A;  3NIA A;  3A3F A;  4E3K A;  2WZZ A;  4U3T A;  4UHU A;  3IHB A;  4OPQ A;  3NY4 A;  2Y2L A;  1K56 A;  3BFF A;  3ZHH A;  3BFD A;  3FWL A;  1ZKJ A;  4ZJ3 A;  5I94 A;  2WGW B;  4EBL A;  1K57 A;  1YLP A;  4F94 A;  4Q8I A;  2ZQC A;  2HPB A;  4X53 A;  4WMC A;  5DF8 A;  4E3O A;  4KG2 A;  4C6Y A;  3C7V A;  4IBX A;  4L0L A;  3CZD A;  1LLB A; 
#chains in the Genus database with same CATH topology
 3MF0 A;  3KSF A;  4OOM A;  3UB6 A;  3FPW A;  2XRO A;  4KQQ A;  4MBF A;  3UDX A;  4HBU A;  2FFF B;  3VFH A;  5FI2 A;  2V0W A;  2GJ3 A;  3MQO A;  4GJ4 A;  1DP6 A;  1XGI A;  4ZAM A;  5HL6 A;  4EU0 A;  3E4Q A;  1FR6 A;  2JC7 A;  1W63 Q;  4Y2F A;  3IX3 A;  4IUH A;  2ZC7 A;  3WS0 A;  3MQ0 A;  3OBF A;  5EVI D;  4PM5 A;  4LRY C;  4P87 A;  3Q1F A;  4NXE A;  1XPB A;  3UB8 A;  2V0U A;  1PW8 A;  3HJI A;  4BWI A;  2W3D A;  3GMW A;  1YSP A;  3EQV A;  3TSG A;  4KQO A;  4C75 A;  1OT9 A;  3MZE A;  1GSV A;  3LI9 A;  2JKR I;  4I39 A;  4I3I A;  1TEM A;  1L0E A;  4HH3 A;  3T4S A;  4OQ0 A;  5HDC A;  3A3D A;  3ITB A;  5A90 A;  4DDY A;  5KMW A;  3CWF A;  1OTI A;  2QWS A;  2OV5 A;  2QYB A;  2Y55 A;  4GKU A;  4ME4 A;  5E2G A;  1D1J A;  2EX8 A;  4UA7 A;  1T19 A;  3JYI A;  4B93 A;  2XEP A;  2H10 A;  4JF6 A;  4XT2 A;  3TE8 A;  4JGO A;  2P08 A;  5M1A A;  1AWI A;  3DAV A;  3BLS A;  4GN2 A;  2VZW A;  4O0P A;  3GSG A;  5DJT A;  5I5L A;  2D01 A;  4R4R A;  3S7O A;  3LCE A;  5DTT A;  2P04 A;  2XD1 A;  3UMD A;  4KZ3 A;  3T1R A;  3W4P A;  3WRT A;  3A3I A;  4M4X A;  4MBH A;  4CLC C;  5D3O A;  3C4P A;  1K55 A;  2Y8H A;  3CMZ A;  3BQ8 A;  2QKP A;  3QHY A;  5FQ9 A;  5HAQ A;  4WF0 A;  3FPV A;  3IXH A;  1IKG A;  4DE0 A;  2ZM0 A;  3F1O B;  1MBL A;  4UA9 A;  1IFQ A;  3ZG7 B;  4DE2 A;  3IF5 A;  4HIA A;  1DP8 A;  1DJC A;  5EFW A;  2ZMV A;  2H28 A;  1DP9 A;  2Y79 A;  1F9I A;  4OP8 A;  5GL9 A;  2XFS A;  1JNU A;  1TS8 A;  1MC0 A;  2G2U A;  1AXB A;  2KX6 A;  2W0N A;  1FCN A;  2I72 A;  1NRF A;  4XUZ A;  4OLG A;  5K5B A;  5L10 A;  4WEJ A;  1VM1 A;  2C6W B;  2XA7 M;  5HAI A;  1ERO A;  2ZOH A;  3IBJ A;  3IX8 A;  3Q7V A;  1ZG6 A;  1K54 A;  3E0Y A;  1D7E A;  4K91 A;  3BY8 A;  2OAQ 1;  1D06 A;  4GOG A;  4K0W A;  4MNR A;  3V5M A;  3W8K A;  2A3U A;  2PRF A;  4BEN A;  1N9L A;  1EWZ A;  5MC7 A;  3BLM A;  4RYE A;  3UB5 P;  5AVE A;  1PZO A;  2NUP C;  3MKE A;  1GA9 A;  1S1Y A;  3MFX A;  1OJ5 A;  2XFT A;  4FCF A;  4WZ5 A;  3ZVT A;  4S2N C;  3P09 A;  5HWV A;  2FZ0 A;  1T18 A;  4ZDX A;  4KEN B;  3R7W B;  3PAG A;  1J3W A;  3PBR A;  4HES A;  2PD8 A;  3IF6 B;  2O0Y A;  3ULF A;  3I7J A;  4S2J A;  4N1H A;  3GEC A;  2HZ5 A;  3CHW P;  4GB7 A;  3ZNY A;  3UPO A;  1JVJ A;  4H6J B;  5EE8 A;  2EWV A;  4S2I A;  3KO6 A;  1E3U D;  3NJA A;  3SS4 A;  3Q81 A;  5EUA A;  2XLN A;  5HDD A;  3HUO A;  1OPX A;  3T4Q A;  1NYM A;  1I2W A;  3VOZ A;  4CQH A;  3AGF A;  4FOF A;  3PAE A;  3VV4 A;  2G7U A;  4ARZ A;  3RH8 B;  3NEC A;  4O01 A;  2PYR A;  3FV7 A;  3S1Y A;  5L07 A;  2ZJ9 A;  4BBT A;  3O86 A;  1I5Q A;  3T4T A;  1EW0 A;  4HQA A;  3HRE A;  2ZL1 A;  4JF5 A;  5GLD A;  4QY5 A;  1WE4 A;  1H8Z A;  1KGF A;  1ZG4 A;  2PR6 A;  3S22 A;  2HJE A;  2XDM A;  4IUK A;  5AQ9 A;  1G5U A;  2CMN A;  3AGE A;  1TDG A;  2J3T C;  1YSQ A;  1SZV A;  3U2A A;  2L0W A;  3K2N A;  1A0K A;  4YFM A;  1TVF A;  1V9Y A;  3OLO A;  1XGJ A;  2OAP 1;  3LO7 A;  4EV4 A;  4O7D A;  4NXG A;  2V2F F;  4BMW A;  1TS0 A;  1FSY A;  1SDN A;  3S7Q A;  3B3X A;  5JYP A;  3UNW A;  1UWN X;  2WKQ A;  4BD0 A;  2ZD8 A;  3P98 A;  2NUT C;  4GCZ A;  1GHP A;  4UQI S;  4LV3 A;  4S2M A;  5GLB A;  1Q2P A;  3G32 A;  5FI7 A;  3N8S A;  3ZG9 B;  5E2H A;  1NWZ A;  1DJA A;  2Y2O A;  3H82 A;  3IWO A;  1FCO A;  4JGR A;  1HLU P;  3IWI A;  2ZQD A;  1Z6F A;  1KDS A;  3DWK A;  3F1N A;  3O5Y A;  4B88 A;  2A49 A;  2QMI A;  1HVB A;  3B47 A;  4BD1 A;  4EUZ A;  4HI4 A;  3QP1 A;  3TOI A;  3PBT A;  1IOU A;  4OOY A;  1GCE A;  4WEL A;  4Q0J A;  3NIA A;  2V8C A;  1YKD A;  3IHB A;  2Y2L A;  3G6O A;  2V9A A;  4Q8I A;  3BY9 A;  4YWZ A;  4WMC A;  5DF8 A;  4E3O A;  2VX8 A;  4WN5 A;  4R38 A;  3VP0 A;  2GZA A;  5IHV A;  3UE0 A;  2PU2 A;  2AVX A;  5HZH A;  3CIT A;  1JWP A;  3DTE A;  4UQI M;  4DMZ A;  1WYC A;  2OLU A;  1LT0 A;  4RVA A;  5HL1 A;  1GHI A;  4BJP A;  3NC8 A;  3MZD A;  2PD7 A;  2WUQ A;  1DRM A;  4OPR A;  5F6A A;  5KSC A;  4E3I A;  1H5X A;  3QP2 A;  4OOL A;  1KOU A;  4LV1 A;  3T1X A;  1W8Q A;  1RP5 A;  4NXB A;  3PXP A;  2ZC3 B;  2Y4A A;  3MBZ A;  3FYZ A;  5EVI C;  1KE4 A;  3LIB A;  4OQI A;  1IEM A;  1HD8 A;  1OTE A;  4MN7 A;  1GHM A;  3Q7Z A;  3UB7 A;  3HJK A;  4CLC A;  3CAX A;  1XFN A;  3FC7 A;  4MDZ A;  3FKV A;  3SH8 A;  1M40 A;  2PT7 A;  4KZ6 A;  1YT4 A;  3W2Z A;  2JE5 A;  3BJN A;  1WYB A;  4GNU A;  1S1Z A;  2J3T D;  2J80 A;  3LYX A;  1P97 A;  4FUW A;  5HD5 A;  1BTL A;  1CF0 A;  4OLD A;  2Q9N A;  4IBR A;  2WYX A;  5HAP A;  1W7F A;  1L0G A;  3ZVW A;  3NDG A;  5AQ7 A;  1STZ A;  1BUL A;  1XJ2 A;  4EXO A;  3PHY A;  2HP6 A;  3E2K A;  1K56 D;  4WBG A;  4LEN A;  3QP5 A;  4JPM A;  2DRW A;  2LB9 A;  3WS1 A;  2QJ7 A;  1ZTU A;  4DN0 A;  4DF6 A;  3LY4 A;  2Y2I A;  4PM9 A;  3M6B A;  3KX0 X;  1YLZ A;  3LY3 A;  4GD6 A;  5F69 A;  4XT2 B;  3VOY A;  1ESU A;  2V8F A;  3HUN A;  2BTF P;  4EQ1 A;  2O9B A;  3MJQ A;  3BRM A;  3ZCZ A;  1OTD A;  2JKT I;  2WKH A;  2ZQ8 A;  4QD4 A;  4ZRR A;  3FG8 A;  4EBN A;  1P9W A;  4KZ4 A;  4OQH A;  1XA7 A;  3M2K A;  3ZGA B;  2OWJ A;  1G6O A;  3W4Q A;  4KUK A;  4ZBE A;  3OC2 A;  1YMS A;  3UO9 A;  5A92 A;  2O9A A;  2VGJ A;  1KDW A;  3E98 A;  5DF7 A;  3LFV A;  3S7P A;  4OKP A;  3NCK A;  1LI9 A;  2V20 A;  3BM6 A;  4HHD A;  2A2L A;  2JKF A;  4I3A A;  3MSH A;  4S2N A;  3TRC A;  1K4F A;  2K7S A;  4KQD A;  4R3B A;  5EOO A;  1P9R A;  4EER A;  1NZU A;  3PBQ A;  1NYY A;  1SCW A;  1RGZ A;  4IVI A;  1YQS A;  4LRZ E;  2W27 A;  2HJ9 C;  2KDK A;  1MWT A;  3F1P A;  3V3R A;  4DJ2 A;  3IBR A;  3N7W A;  2ZC6 B;  3G34 A;  5F1G A;  3NI9 A;  2EXB A;  3C5A A;  3SZT A;  3D9Y A;  2EWW A;  4KZ8 A;  4JBF A;  3Q7V B;  3T50 A;  4R70 A;  2GDN A;  2Y2K A;  1PWG A;  2M7U A;  2DNS A;  1JTG A;  2H0T A;  2A24 A;  1SKF A;  4DE3 A;  3ZG0 A;  1YLY A;  5GLA A;  4C3Q A;  2W3F A;  1F2K A;  4KZB A;  2IWD A;  1WA9 A;  3NOP C;  2ZC5 B;  2RCX A;  2VGK A;  5JYO A;  1DJB A;  1IYP A;  3VP4 A;  3ZG5 A;  1GA0 A;  1VET A;  1XFQ A;  2EX6 A;  3VE3 A;  1KE3 A;  5DTK A;  2EFU A;  4FH4 A;  3RFB A;  2XA7 S;  4PHT A;  1EI5 A;  4Z9Q A;  4R23 A;  3IQA A;  2R9W A;  4LV2 A;  3QNB A;  1I2S A;  4GZB A;  5CX7 A;  2Y91 A;  3UDF A;  3VE4 A;  4QHC A;  3CUE C;  4EEP A;  2HDS A;  3WWX A;  2JHE A;  1CK3 A;  4LLO B;  1LL5 A;  4UA6 A;  3D72 A;  2HP5 A;  2QHK A;  3OPL A;  1FIK A;  4GHI A;  2ZMA A;  2GX5 A;  1ES2 A;  3V67 A;  4S2P A;  2HF6 A;  1TS6 A;  5FQK A;  3LID A;  4ARZ B;  1LL8 A;  3PBO A;  2J3W A;  3BEB A;  1YLT A;  4ZTK A;  2X71 A;  5HD3 A;  3H7W A;  1M6K A;  4A5R A;  5DFX A;  4BL2 A;  4Y0U A;  1H3Q A;  3GVB A;  1Y4O A;  3KSH A;  4X68 A;  2MJ6 A;  3EGX C;  4EUV A;  4B4X A;  5CEB A;  3IXB A;  2ZL1 B;  1PWD A;  4BLM A;  1KVL A;  4CPK A;  3E2L A;  3A3J A;  3PBS A;  4X6T A;  3NBL A;  5KSH A;  5F83 A;  1CQA A;  5TR7 A;  1L0D A;  3IWQ A;  4D60 A;  4GS9 A;  1BUE A;  5CEC A;  1YLW A;  1SHV A;  3O87 A;  3VP3 A;  1VEU A;  1S67 L;  1IYO A;  1OTA A;  5EVI A;  4E3M A;  4G3V A;  1T1C A;  3WS4 A;  1RCJ A;  5L09 A;  2V1A A;  4Q0H A;  2B02 A;  3B42 A;  4WUJ A;  1CI8 A;  4JXS A;  2ACG A;  3PR6 A;  4UAA A;  3OZH A;  4PKY A;  5IU1 A;  1G28 A;  2WAF A;  3H82 B;  1G68 A;  4CJN A;  4GDN A;  3Q07 A;  5EVE A;  4ID4 A;  3F1N B;  3L9K A;  5AVF A;  3W4O A;  1YMX A;  3GTC A;  5EPH A;  3P7N A;  2GNX A;  3A3F A;  2WZZ A;  4UHU A;  3ZHH A;  3BFD A;  3FWL A;  1ZKJ A;  4ZJ3 A;  3DTI A;  1YLP A;  4NG2 A;  3LIC A;  4KG2 A;  3CZD A;  2WKR A;  3DWZ A;  4WL9 A;  2HDU A;  3ISG A;  3G35 A;  1N9N A;  1FOF A;  3MXR A;  3MKF A;  3VP2 A;  4WYY A;  3TJZ C;  5J7E A;  5CED A;  3IH9 A;  3ITA A;  4LRX C;  1MWR A;  2IA2 A;  3JPU A;  1MZU A;  1FSW A;  5AQB A;  2WKI A;  2HDQ A;  3UN7 A;  1HTZ A;  2BG1 A;  1C3B A;  4X56 A;  4HBT A;  2FFY A;  4JGQ A;  3HLW A;  2XH9 A;  3BQA A;  4LFU A;  4KUO A;  2B95 A;  5DFY A;  1NLY A;  4OPY A;  2Z6C A;  4WEK A;  1NY0 A;  1K6S A;  5G18 A;  2OWH A;  4CLC B;  3HLB A;  5TBM A;  1FIL A;  1H8M A;  1N4O A;  1PWC A;  1VB6 A;  1PFL A;  2L1M A;  4N9K A;  2WGI A;  2EFX A;  2JKT M;  4PM8 A;  4HOI A;  5FAS A;  3D4F A;  3BEC A;  3NUL A;  1UGU A;  4IVK A;  3C7U A;  5F82 A;  4PAU A;  5DKL A;  3BFE A;  3FZC A;  5G4Z A;  2VLG A;  1K55 C;  1TD5 A;  4FTX A;  5J3W A;  1JWV A;  1S6R A;  1YM1 A;  4Z1W A;  3ZQ5 A;  4DJ3 A;  1XA1 A;  4N92 A;  5EVL A;  3G31 A;  1NRJ A;  4Y7P A;  4ESP A;  2Y59 A;  1KGG A;  4GLQ A;  1ALQ A;  3EQU A;  2R9X A;  3V39 A;  3C38 A;  3MR0 A;  2ZOI A;  4G3K A;  4Y0T A;  3KSI A;  2HGV A;  5HX9 A;  3EEH A;  3O88 A;  3HLD A;  5AJG A;  2VV6 A;  4WLA A;  1OJG A;  4PM7 A;  1N9O A;  3A3E A;  3UPP A;  4CLC E;  1XKZ A;  4L9F A;  3GQZ A;  3QP6 A;  3EOI A;  5TJJ A;  4HY8 A;  4Q0I A;  1IYQ A;  5EEC A;  3HUM A;  2XK1 A;  3BFC A;  3IHA A;  2VJW A;  2JKR M;  1K38 A;  5HWW A;  4Y13 A;  4HEF A;  2ZQ7 A;  4DXC A;  3OCL A;  1T1A A;  3MXQ A;  2O99 A;  3FKW A;  4JKT A;  4B4Z A;  5CHJ A;  3LR4 A;  2J8Y A;  2KOI A;  2VV8 A;  5M19 A;  5IS1 A;  3T1S A;  3E4P A;  4JGP A;  4Y15 A;  1BLP A;  4QPR A;  1E3U A;  5J4E A;  1S4R A;  3T12 B;  4JXV A;  1ES3 A;  3V3S A;  4E04 A;  5IT5 A;  1PNE A;  3CUE A;  5CGS A;  1W5D A;  1Q2Q A;  3VP1 A;  1G6A A;  3G4P A;  3JVU A;  3CPT A;  2ZM2 A;  3M6H A;  1BSG A;  5A8B A;  2ZQ9 A;  1LSX A;  1TDL A;  1BT5 A;  2WAD A;  3TG9 A;  3V50 A;  4QB8 A;  1QME A;  3F1P B;  4OP5 A;  4DXB A;  3NOT C;  3N8R A;  4RQ9 A;  4HJ4 A;  1F98 A;  1K0K A;  4F3L A;  2Y2Q A;  3OCN A;  4NKP A;  4ZJ2 A;  1MKM A;  1IYS A;  4HH2 A;  2M1C A;  2H0Y A;  3T1Q B;  5DVA A;  1JWZ A;  2P9V A;  4KQR A;  3JVV A;  3OOV A;  2P7J A;  4M3K A;  2A24 B;  3IXD A;  4GDB A;  4NET A;  2Z2M B;  3PBN A;  3QP4 A;  3KYE A;  4PPR A;  1L2S A;  5HDS A;  2W3E A;  3NOU C;  5GHZ A;  4L9E A;  5HAR A;  3VFF A;  4ETX A;  1ODV A;  3BFG A;  4OPZ A;  1VET B;  5A91 A;  1PI4 A;  3LEZ A;  3GV9 A;  4P6Z S;  4NEE D;  1YAX A;  4HNB A;  4RX3 A;  4X25 A;  2VEA A;  3HVF A;  5L8M A;  3G2Y A;  3RXW A;  3IS2 A;  4EET B;  3E4O A;  5CRF A;  3IX4 A;  3ICY A;  3PTE A;  3LUQ A;  3N8L A;  5CHU A;  4JF4 A;  2Y2H A;  1TF1 A;  1L0F A;  1OTB A;  2PBD P;  5J8X A;  2WZX A;  2ZC4 B;  4FD8 A;  2W3H A;  4Y5F A;  5CER A;  4OON A;  5FAT A;  2H5S A;  5AQA A;  5DTS A;  4LPZ A;  1ES5 A;  4QJG A;  4MCW A;  4GHI B;  4S2K A;  1NZO A;  4EWF A;  5L2F A;  2VV7 A;  1XJ4 A;  4XUX A;  2CC1 A;  1ZC2 A;  1SDE A;  3C4O A;  1NXY A;  5CTM A;  2E8I A;  1KVM A;  4D2O A;  2Y2M A;  4H8R A;  4OH0 A;  1ERQ A;  3H7W B;  4P6Z M;  1S0W A;  2K31 A;  3DW0 A;  1N9B A;  1SKO A;  4HJ6 A;  3SS5 A;  3KYQ A;  3ZG8 B;  2EA9 A;  4U0X A;  4EBP A;  5HFO A;  4E6X A;  3IF6 C;  2V1B A;  2VGL M;  4R1G A;  2W1T A;  4G3W A;  3T4K A;  1FCM A;  2XD5 A;  1RGY A;  4U0T A;  4EES A;  1X0O A;  3DTK A;  4GS9 B;  5TFQ A;  2XRN A;  4YNR A;  2E8J A;  3ZDJ A;  1VEU B;  3LIE A;  4KG5 A;  5EVI B;  3ZFZ A;  3RTY A;  2INW A;  3QP8 A;  2IWB A;  1PW1 A;  2J7V A;  1ERM A;  1TS7 A;  3KSG A;  3UE3 A;  4MEZ A;  1YPR A;  1CEF A;  2Y2J A;  5TGF A;  1LSV A;  1GSX A;  2J9O A;  3GRJ A;  2WGW A;  3A0S A;  3TW8 A;  5I94 A;  2Q0O A;  4E3K A;  5FQM A;  1JTD A;  2HDR A;  1GSW A;  4U3T A;  1K56 A;  3LIA A;  2JKG A;  5FEF A;  3T4J A;  2ZQC A;  4X53 A;  1F5M A;  3C7V A;  4IBX A;  3CLO A;  1LLB A;  2OOL A;  3DBA A;  1PZP A;  3N4I A;  1E25 A;  4WM9 A;  2ZBB A;  3MXS A;  3BWL A;  5FQI A;  3Q82 A;  5E43 A;  5FDS A;  3OPR A;  4MLL A;  4XXR A;  1E4D A;  4MN6 A;  1U60 A;  1UWP X;  5GHY A;  1FR1 A;  4Y0O A;  1K25 A;  1Y54 A;  2XSS A;  4S2O A;  5FEG A;  5GLC A;  2JCH A;  4KZ7 A;  4E6W A;  1OME A;  3EWK A;  3T4L A;  3DTM A;  1OT6 A;  4EW7 A;  3ZYT A;  1W63 M;  1MY8 A;  5EM0 A;  2I9V A;  4R0Q A;  1O07 A;  5HWT A;  5HPF A;  2PU4 A;  3R4K A;  2PBY A;  3MQQ A;  4WZ4 A;  1PI5 A;  4I38 A;  2UV0 E;  4MBK A;  1HZO A;  2VK3 A;  3VSL A;  2VKS A;  4LV0 A;  4P85 A;  5EOE A;  1DY6 A;  3UPN A;  4BBV A;  5FQJ A;  4Y17 A;  3C30 A;  5TBM B;  5DF9 A;  2WGV A;  2BLS A;  2X02 A;  1BLH A;  3UB9 A;  1O7E A;  4DRT A;  5FDH A;  1XX2 A;  3K3C A;  1MWS A;  3S7N A;  5FAO A;  1VQQ A;  3B33 A;  1K57 C;  5C5K A;  3D3O A;  4BBU A;  4II7 A;  3HLG A;  3N6I A;  3HLF A;  3T4O A;  3EGD C;  2B18 A;  2P74 A;  4WMC D;  4I3J A;  4P0M A;  3UDI A;  3BYD A;  3LGO A;  3UE6 A;  4MMN A;  4DDS A;  2HV1 A;  1LL9 A;  4X69 A;  4K08 A;  2WKE A;  2ZLY A;  1ONH A;  5U47 A;  3UME A;  3M2J A;  5CHM A;  1T1B A;  2Y2N A;  4RX2 A;  3VMA A;  4R3J A;  3PYP A;  4N1X A;  2QJ5 A;  3U4L P;  3HLE A;  3IXG A;  3WS2 A;  3UY6 A;  4R3A A;  3AGD A;  1BLS A;  4GD8 A;  4IED A;  2BAS A;  1XJ3 A;  2ZQA A;  5HW3 A;  4B9O A;  2Y2P A;  2JN7 A;  3S4X A;  2Z6D A;  4YOF A;  2B5R A;  2R78 A;  1MKI A;  4CLC D;  4E3J A;  3KYZ A;  4UEY A;  3F1O A;  4IJG A;  3SW1 A;  4S2L A;  4OVD A;  3H9W A;  3WS5 A;  4JLF A;  3GDI A;  1XP4 A;  2PHY A;  1NLZ A;  5FA7 A;  2L4R A;  3GR2 A;  5F1F A;  3O3V A;  5KIZ A;  1FQG A;  2O9C A;  2G2W A;  1L3L A;  2EX9 A;  2XF3 A;  2QPN A;  2YKH A;  1LI0 A;  4LCM A;  2EX2 A;  4X1L A;  4EEU A;  3OPH A;  2WAE A;  2FH5 A;  3IT9 A;  3VSK A;  1PIO A;  2OSU A;  4MN5 A;  5CGX A;  2Q9M A;  3SH7 A;  5FAP A;  3UE1 A;  3HL9 A;  4JXW A;  5E2E A;  4X1M A;  1KGE A;  1ES4 A;  2HP9 A;  3MMH A;  1BZA A;  4BL3 A;  2W1R A;  2JBF A;  3NDE A;  5CGW A;  3C8C A;  3CPT B;  3SS3 A;  2EXA A;  1NJ4 A;  4EQI A;  2UWX A;  1K4E A;  4HJ3 A;  2ZM8 A;  2PDR A;  2X01 A;  2D02 A;  5G4Y A;  3OPP A;  4P6B A;  3MS6 A;  4E3L A;  1LSW A;  4F3L B;  4LCL A;  4FH2 A;  3RXX A;  3ZNT A;  5FSR A;  1IEL A;  3HBR A;  2OLV A;  5F68 A;  4QY6 A;  2KLI A;  1LHY A;  2P9V B;  4ETZ A;  2WK0 A;  4KZA A;  5EV0 A;  3R7W A;  5BOH A;  3SOI A;  4OQG A;  2W3G A;  3IF6 A;  3P01 A;  2XQZ A;  3QNC A;  4GW9 A;  4O8G A;  1PRQ A;  2RL3 A;  1W8Y A;  3CG5 A;  4H6J A;  3A0R A;  4I5S A;  4L9G A;  4QWO A;  4DE1 A;  2PYP A;  1MWU A;  1S4S A;  3HLC A;  4K0X A;  2IWC A;  5A93 A;  5EM1 A;  4R6L A;  4Y3I A;  1J9M A;  4IHQ A;  4DKI A;  1MPL A;  4HP9 A;  3LR0 A;  1ACF A;  3IH8 A;  1IKI A;  1CJF A;  5HPI A;  5CTN A;  3IS2 B;  1K54 C;  1YLJ A;  5FAQ A;  4FSF A;  5M18 A;  2Z2L B;  1CEG A;  4AFI A;  4YIN A;  5HSQ A;  1BYW A;  2XR0 A;  1H8Y A;  3LIF A;  3RJU A;  1ONG A;  4PMA A;  3LR5 A;  4KG6 A;  1QMF A;  4RA7 A;  5FQQ A;  3BW6 A;  4NK3 A;  3LI8 A;  5F5Y A;  3A0V A;  4HP4 A;  3EEA A;  2C5W B;  5DJU A;  2DCF A;  3CJM A;  3VOL A;  4N9L A;  3MZF A;  4WZ5 C;  2QZ6 A;  5GHX A;  1MXO A;  1Z09 A;  2XGN A;  1ZHH B;  2Y2G A;  2V1Z A;  4NXF A;  2YKF A;  1PYY A;  2WKP A;  1H0M A;  1S66 L;  1SKO B;  5CXW A;  4JXG A;  4KZ9 A;  3NHQ A;  1CI9 A;  3G2Z A;  4LGW A;  1V9Z A;  4ZJ1 A;  4E3N A;  2W1T B;  4BQM A;  3LEQ A;  1VHM A;  2M7V A;  2PR5 A;  5FI6 A;  1XXM A;  2VA0 A;  1W79 A;  4KZ5 A;  3CI6 A;  1KE0 A;  4QU3 A;  1Y28 A;  1XJ6 A;  2LB5 A;  4PM6 A;  3K3D A;  2PAV P;  1K6R A;  2K2N A;  5KZH A;  2ZMF A;  3MFD A;  1ESI A;  4R4S A;  3WRZ A;  1BLC A;  2J9P A;  5E2F A;  3G30 A;  5DKK A;  4X55 A;  3SH9 A;  5LBR A;  4OPQ A;  3NY4 A;  3C2W A;  3BFF A;  4PKY G;  2WGW B;  4EBL A;  1K57 A;  5FL3 A;  4F94 A;  2DMW A;  2HPB A;  3LR3 A;  4C6Y A;  1P0Z A;  3L7H A;  3HCY A;  2VGL S;  4L0L A; 
#chains in the Genus database with same CATH homology
 3DWZ A;  3VP0 A;  5IHV A;  2HDU A;  3UE0 A;  3ISG A;  3G35 A;  4OOM A;  2PU2 A;  1PZP A;  1FOF A;  3N4I A;  3MXR A;  3MKF A;  3VP2 A;  1E25 A;  4WM9 A;  1JWP A;  4WYY A;  4KQQ A;  3MXS A;  1WYC A;  2OLU A;  4RVA A;  5HL1 A;  1GHI A;  4MBF A;  5FQI A;  4BJP A;  3NC8 A;  3Q82 A;  3MZD A;  4HBU A;  5E43 A;  3IH9 A;  3ITA A;  3UDX A;  5CED A;  2FFF B;  1MWR A;  3OPR A;  4MLL A;  4XXR A;  1E4D A;  2WUQ A;  3VFH A;  1FSW A;  5AQB A;  4OPR A;  5KSC A;  2WKI A;  5FI2 A;  4E3I A;  1U60 A;  1H5X A;  4OOL A;  2HDQ A;  5GHY A;  1FR1 A;  4LV1 A;  4Y0O A;  3UN7 A;  1K25 A;  1HTZ A;  1W8Q A;  1XGI A;  1Y54 A;  4ZAM A;  4S2O A;  1RP5 A;  2BG1 A;  5GLC A;  1C3B A;  2JCH A;  2ZC3 B;  1FR6 A;  4HBT A;  2JC7 A;  4X56 A;  4KZ7 A;  2FFY A;  4E6W A;  1OME A;  2Y4A A;  3MBZ A;  3DTM A;  3HLW A;  3FYZ A;  5EVI C;  1KE4 A;  2XH9 A;  4OQI A;  1IEM A;  1HD8 A;  1GHM A;  1MY8 A;  2ZC7 A;  3Q7Z A;  3WS0 A;  4R0Q A;  5EVI D;  4PM5 A;  1O07 A;  4P87 A;  2PU4 A;  2PBY A;  4WZ4 A;  3FKV A;  3SH8 A;  3Q1F A;  4OPY A;  1XPB A;  1PI5 A;  4WEK A;  1M40 A;  1NY0 A;  4KZ6 A;  4MBK A;  1YT4 A;  1K6S A;  5G18 A;  1HZO A;  2JE5 A;  3HLB A;  3VSL A;  1WYB A;  4P85 A;  4GNU A;  4LV0 A;  1N4O A;  1PW8 A;  5EOE A;  1PWC A;  1DY6 A;  3UPN A;  3GMW A;  3EQV A;  4N9K A;  5FQJ A;  3TSG A;  4KQO A;  1BTL A;  2WGI A;  4C75 A;  3MZE A;  2EFX A;  4PM8 A;  4OLD A;  5DF9 A;  2Q9N A;  2WGV A;  2BLS A;  2WYX A;  2X02 A;  4IBR A;  5HAP A;  1BLH A;  1O7E A;  1W7F A;  1L0G A;  3ZVW A;  4DRT A;  3NDG A;  5FAS A;  5FDH A;  1TEM A;  1XX2 A;  1MWS A;  3D4F A;  3BEC A;  5AQ7 A;  1L0E A;  5FAO A;  4IVK A;  1BUL A;  4OQ0 A;  1VQQ A;  3A3D A;  3ITB A;  3C7U A;  4DDY A;  5A90 A;  1K57 C;  5KMW A;  2HP6 A;  3E2K A;  1K56 D;  2OV5 A;  4WBG A;  5F82 A;  2Y55 A;  4GKU A;  3HLG A;  3N6I A;  4LEN A;  3HLF A;  3BFE A;  3FZC A;  5E2G A;  4JPM A;  2DRW A;  2EX8 A;  1K55 C;  2P74 A;  4UA7 A;  4WMC D;  3WS1 A;  3JYI A;  4P0M A;  3UDI A;  3BYD A;  2XEP A;  2H10 A;  4JF6 A;  1JWV A;  1S6R A;  4DDS A;  5M1A A;  1YM1 A;  1LL9 A;  4DF6 A;  3BLS A;  3LY4 A;  2Y2I A;  4GN2 A;  4PM9 A;  1XA1 A;  3M6B A;  4N92 A;  4X69 A;  1YLZ A;  2WKE A;  2ZLY A;  3LY3 A;  5EVL A;  1ONH A;  4GD6 A;  3GSG A;  3G31 A;  4Y7P A;  5U47 A;  3VOY A;  1ESU A;  3HUN A;  3M2J A;  5CHM A;  2Y59 A;  2Y2N A;  4R4R A;  4RX2 A;  3VMA A;  3BRM A;  3LCE A;  4R3J A;  1KGG A;  3ZCZ A;  1ALQ A;  2WKH A;  4N1X A;  3EQU A;  2ZQ8 A;  2R9X A;  3V39 A;  3HLE A;  4QD4 A;  5DTT A;  3IXG A;  2XD1 A;  3WS2 A;  3UY6 A;  4Y0T A;  4EBN A;  3AGD A;  4KZ3 A;  1BLS A;  4GD8 A;  4IED A;  3W4P A;  4KZ4 A;  3WRT A;  5HX9 A;  4OQH A;  3O88 A;  2ZQA A;  3HLD A;  1XA7 A;  3A3I A;  5HW3 A;  3M2K A;  4MBH A;  5D3O A;  2Y2P A;  3C4P A;  3ZGA B;  1K55 A;  3S4X A;  3W4Q A;  4PM7 A;  2B5R A;  3A3E A;  4ZBE A;  3OC2 A;  3UPP A;  1YMS A;  3CMZ A;  1MKI A;  1XKZ A;  3GQZ A;  4E3J A;  3UO9 A;  1IYQ A;  5EEC A;  5A92 A;  3QHY A;  2VGJ A;  3HUM A;  5FQ9 A;  2XK1 A;  5HAQ A;  3BFC A;  3IXH A;  4S2L A;  1IKG A;  3IHA A;  1KDW A;  4OVD A;  3WS5 A;  5DF7 A;  4JLF A;  4OKP A;  4DE0 A;  1K38 A;  3NCK A;  1LI9 A;  1XP4 A;  4HEF A;  2V20 A;  2ZQ7 A;  3BM6 A;  2ZM0 A;  4DXC A;  3OCL A;  1MBL A;  4UA9 A;  4JKT A;  3FKW A;  5FA7 A;  4B4Z A;  5CHJ A;  4S2N A;  3ZG7 B;  4DE2 A;  3IF5 A;  2J8Y A;  3GR2 A;  5F1F A;  1DJC A;  3O3V A;  1K4F A;  5M19 A;  4R3B A;  1FQG A;  2G2W A;  5EOO A;  2EX9 A;  2XF3 A;  4OP8 A;  5GL9 A;  2QPN A;  1NZU A;  2XFS A;  3PBQ A;  1NYY A;  1LI0 A;  4LCM A;  2EX2 A;  1BLP A;  1E3U A;  1SCW A;  1RGZ A;  4IVI A;  3OPH A;  1YQS A;  2G2U A;  1AXB A;  2WAE A;  1FCN A;  3IT9 A;  2I72 A;  1ES3 A;  1NRF A;  4JXV A;  3V3S A;  3VSK A;  4XUZ A;  4OLG A;  1MWT A;  5CGS A;  1PIO A;  1W5D A;  1Q2Q A;  2OSU A;  1VM1 A;  4WEJ A;  5CGX A;  2Q9M A;  2C6W B;  3VP1 A;  3V3R A;  1G6A A;  3G4P A;  5HAI A;  3SH7 A;  3N7W A;  5FAP A;  3UE1 A;  1ERO A;  2ZM2 A;  3M6H A;  1BSG A;  3HL9 A;  4JXW A;  5E2E A;  2ZQ9 A;  2WAD A;  1TDL A;  1BT5 A;  1KGE A;  3TG9 A;  3V50 A;  3Q7V A;  4QB8 A;  2ZC6 B;  3G34 A;  1ES4 A;  2HP9 A;  5F1G A;  1ZG6 A;  1K54 A;  3NI9 A;  1BZA A;  2EXB A;  1QME A;  4BL3 A;  4K91 A;  2JBF A;  3C5A A;  3NDE A;  5CGW A;  4OP5 A;  4DXB A;  4GOG A;  3SS3 A;  2EXA A;  3N8R A;  1NJ4 A;  4EQI A;  4K0W A;  2UWX A;  4MNR A;  3V5M A;  4KZ8 A;  1K4E A;  4JBF A;  3Q7V B;  3W8K A;  2A3U A;  2Y2Q A;  2ZM8 A;  3OCN A;  2GDN A;  2Y2K A;  4ZJ2 A;  1PWG A;  4BEN A;  2DNS A;  1JTG A;  1IYS A;  2H0T A;  2X01 A;  2H0Y A;  3OPP A;  4P6B A;  4E3L A;  1SKF A;  4DE3 A;  1EWZ A;  5DVA A;  1JWZ A;  4LCL A;  2P9V A;  4FH2 A;  3ZG0 A;  1YLY A;  4KQR A;  3BLM A;  3RXX A;  4RYE A;  3ZNT A;  5GLA A;  5FSR A;  1PZO A;  4C3Q A;  4M3K A;  1IEL A;  3HBR A;  2OLV A;  4KZB A;  2IWD A;  3IXD A;  3MKE A;  4GDB A;  4NET A;  4QY6 A;  1GA9 A;  1LHY A;  2Z2M B;  2RCX A;  2ZC5 B;  3PBN A;  2P9V B;  2VGK A;  2XFT A;  4FCF A;  5JYO A;  4WZ5 A;  3ZVT A;  1DJB A;  4PPR A;  1L2S A;  1IYP A;  2WK0 A;  4KZA A;  3VP4 A;  5BOH A;  4S2N C;  3P09 A;  3SOI A;  4OQG A;  3ZG5 A;  1GA0 A;  3IF6 A;  2EX6 A;  5GHZ A;  5HAR A;  2XQZ A;  3QNC A;  1KE3 A;  4ZDX A;  3VFF A;  3BFG A;  4KEN B;  5DTK A;  4OPZ A;  2RL3 A;  3PAG A;  1W8Y A;  2EFU A;  3CG5 A;  4FH4 A;  4DE1 A;  3PBR A;  4HES A;  1EI5 A;  5A91 A;  3IF6 B;  1PI4 A;  1MWU A;  3HLC A;  4K0X A;  3I7J A;  3LEZ A;  3GV9 A;  2IWC A;  4N1H A;  4S2J A;  4Z9Q A;  5A93 A;  4R23 A;  3IQA A;  3ZNY A;  4GB7 A;  2R9W A;  4LV2 A;  1JVJ A;  3QNB A;  3UPO A;  1I2S A;  4GZB A;  4RX3 A;  5EE8 A;  3HVF A;  2Y91 A;  1J9M A;  3G2Y A;  4S2I A;  3UDF A;  4DKI A;  1E3U D;  4QHC A;  3RXW A;  3SS4 A;  1MPL A;  3Q81 A;  5CRF A;  5EUA A;  3PTE A;  3N8L A;  2HDS A;  3WWX A;  2XLN A;  3IH8 A;  5CHU A;  1CK3 A;  1IKI A;  4JF4 A;  3HUO A;  1NYM A;  1LL5 A;  2Y2H A;  5CTN A;  4UA6 A;  1I2W A;  1L0F A;  5J8X A;  2HP5 A;  2WZX A;  3VOZ A;  2ZC4 B;  4FD8 A;  3OPL A;  5CER A;  1K54 C;  3AGF A;  4OON A;  3PAE A;  2ZMA A;  1ES2 A;  5FAT A;  1YLJ A;  2H5S A;  5FAQ A;  4FSF A;  5M18 A;  5AQA A;  5DTS A;  4S2P A;  2Z2L B;  1CEG A;  1ES5 A;  4YIN A;  4QJG A;  5FQK A;  3FV7 A;  2XR0 A;  1H8Y A;  3RJU A;  3S1Y A;  4S2K A;  1ONG A;  1NZO A;  3PBO A;  4PMA A;  2ZJ9 A;  3BEB A;  4EWF A;  4KG6 A;  5L2F A;  1YLT A;  3O86 A;  2X71 A;  4ZTK A;  4XUX A;  1I5Q A;  1QMF A;  1ZC2 A;  1SDE A;  2CC1 A;  3HRE A;  4JF5 A;  4RA7 A;  1M6K A;  4A5R A;  5GLD A;  3C4O A;  1NXY A;  4QY5 A;  2E8I A;  5CTM A;  1KVM A;  5FQQ A;  4NK3 A;  4BL2 A;  4D2O A;  2Y2M A;  4Y0U A;  1WE4 A;  1H8Z A;  4H8R A;  1KGF A;  1ZG4 A;  3GVB A;  3S22 A;  2C5W B;  2DCF A;  2XDM A;  4X68 A;  3CJM A;  4OH0 A;  5AQ9 A;  4B4X A;  1ERQ A;  3IXB A;  5CEB A;  1S0W A;  1PWD A;  4N9L A;  4BLM A;  3DW0 A;  1KVL A;  1TDG A;  1N9B A;  3AGE A;  3MZF A;  4WZ5 C;  2QZ6 A;  5GHX A;  4CPK A;  1MXO A;  2XGN A;  3SS5 A;  3E2L A;  3A3J A;  2Y2G A;  3PBS A;  4X6T A;  3NBL A;  2V1Z A;  4YFM A;  5KSH A;  5F83 A;  1PYY A;  1TVF A;  3ZG8 B;  4U0X A;  1XGJ A;  4EBP A;  3LO7 A;  4EV4 A;  4O7D A;  5HFO A;  4E6X A;  3IF6 C;  2V2F F;  5TR7 A;  1L0D A;  3IWQ A;  1FSY A;  1SDN A;  4R1G A;  5CXW A;  4JXG A;  4KZ9 A;  1BUE A;  1CI9 A;  3G2Z A;  1FCM A;  3B3X A;  2XD5 A;  5CEC A;  1RGY A;  1YLW A;  5JYP A;  1SHV A;  3UNW A;  3O87 A;  4ZJ1 A;  3VP3 A;  4U0T A;  4BD0 A;  2ZD8 A;  4E3N A;  1IYO A;  3P98 A;  5EVI A;  4BQM A;  1GHP A;  4E3M A;  4LV3 A;  4S2M A;  5GLB A;  5FI6 A;  5TFQ A;  1XXM A;  3WS4 A;  1Q2P A;  1RCJ A;  1W79 A;  3G32 A;  5FI7 A;  3N8S A;  3ZG9 B;  5E2H A;  3ZDJ A;  4KZ5 A;  4KG5 A;  1DJA A;  2Y2O A;  1KE0 A;  3IWO A;  1FCO A;  5EVI B;  4QU3 A;  3ZFZ A;  4PM6 A;  3IWI A;  2ZQD A;  1Z6F A;  1CI8 A;  4JXS A;  4UAA A;  1K6R A;  3OZH A;  2IWB A;  1KDS A;  1PW1 A;  3DWK A;  5KZH A;  4B88 A;  2WAF A;  2J7V A;  1ERM A;  3MFD A;  2A49 A;  2QMI A;  3UE3 A;  4MEZ A;  1HVB A;  1ESI A;  1G68 A;  4R4S A;  3WRZ A;  1BLC A;  2J9P A;  4CJN A;  1CEF A;  3Q07 A;  2Y2J A;  4GDN A;  5E2F A;  5TGF A;  4BD1 A;  3G30 A;  2J9O A;  4EUZ A;  3GRJ A;  4ID4 A;  3TOI A;  2WGW A;  3PBT A;  4OOY A;  4X55 A;  1GCE A;  4WEL A;  3SH9 A;  1YMX A;  3GTC A;  5FQM A;  1JTD A;  2HDR A;  5EPH A;  3W4O A;  3NIA A;  3A3F A;  4E3K A;  2WZZ A;  4U3T A;  4UHU A;  3IHB A;  4OPQ A;  3NY4 A;  2Y2L A;  1K56 A;  3BFF A;  3ZHH A;  3BFD A;  3FWL A;  1ZKJ A;  4ZJ3 A;  5I94 A;  2WGW B;  4EBL A;  1K57 A;  1YLP A;  4F94 A;  4Q8I A;  2ZQC A;  2HPB A;  4X53 A;  4WMC A;  5DF8 A;  4E3O A;  4KG2 A;  4C6Y A;  3C7V A;  4IBX A;  4L0L A;  3CZD A;  1LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...