1XGIA

Ampc beta-lactamase in complex with 3-(3-nitro-phenylsulfamoyl)-thiophene-2-carboxylic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
342
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-based optimization of a non-beta-lactam lead results in inhibitors that do not up-regulate beta-lactamase expression in cell culture.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 112
structure length 342
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xgiA00
4KG2A 2A49A 5FA7A 2G2WA 3UY6A 2ZQCA 4P0MA 2DRWA 1XA7A 5CTMA 3Q82A 4MEZA 1ES4A 1SDEA 2I72A 4P85A 1ONGA 5GLAA 4GD8A 3ZG7B 4EV4A 3FV7A 1FSYA 3A3FA 4JF5A 2ZM2A 1KDWA 2H10A 3W4OA 2EFXA 2ZMAA 1CK3A 1DJBA 2JE5A 2Y2HA 1YMXA 1CI8A 2Y2MA 3O3VA 4H8RA 1ZG4A 4PM8A 4WMCA 5DF7A 1K56A 4BL2A 5HL1A 3OZHA 4KQQA 2Z2LB 2XF3A 1YLYA 3Q7VB 4WELA 1BUEA 2BG1A 1VM1A 3NC8A 5GHZA 1I5QA 1ES5A 1YLJA 3IHAA 3IF6B 2X01A 4RA7A 2PU2A 2WKEA 3PBTA 3FKWA 2P9VA 4S2LA 4OLGA 3WS5A 5A92A 1K4EA 4CPKA 1K25A 4GOGA 2XH9A 4R1GA 5CGSA 3V50A 1J9MA 3BFEA 2Y4AA 3UE1A 4LV1A 2XR0A 4L0LA 1KGFA 4ZJ2A 5A93A 5E2HA 3W4QA 3HBRA 3PBSA 4KZ4A 5CGXA 3EQUA 5CERA 1XKZA 3EQVA 1PZOA 2HP6A 5DF9A 4JLFA 3NDEA 1YQSA 4WEJA 3ZG8B 2Y2KA 3FKVA 1ALQA 3G32A 3IWOA 5M19A 1W8YA 5KSHA 5CEBA 4B4ZA 3D4FA 5FAOA 3V39A 5CXWA 3HLEA 2OLUA 5GL9A 5CTNA 1SDNA 2HDSA 2ZC5B 4WMCD 1EI5A 1PIOA 1K56D 5EVLA 1PWDA 3GQZA 5HARA 2Y2QA 3HUMA 4FH2A 5DF8A 4Z9QA 1IEMA 1K57A 4E3JA 1MY8A 3VP2A 4Y0TA 4E3OA 2B5RA 4S2NA 2ZM0A 4EQIA 1MWRA 1W79A 5AQAA 3BLMA 1WE4A 1DJCA 4R4SA 1YLTA 5FSRA 4WYYA 3SOIA 2IWCA 4OQ0A 4PM6A 4Y0UA 4BD1A 2RCXA 3LO7A 1MWSA 4E3IA 3ZDJA 1IYSA 2Y59A 5FASA 1K6SA 3IF5A 3IWIA 1H5XA 3MBZA 4P6BA 3UO9A 2J8YA 4FSFA 5CECA 5TFQA 2WAEA 4BL3A 2OLVA 3V5MA 1MWUA 1HZOA 1E3UA 4GKUA 2P74A 1XXMA 2Y2GA 5FQQA 2ZC7A 5E2GA 5FQKA 2QPNA 1W7FA 1ERMA 4K0XA 2C6WB 4U0XA 5EVIA 4C6YA 1O7EA 4S2OA 3ITAA 5EUAA 4JF6A 1FR1A 2WGIA 4KG6A 5FQMA 3HLBA 1K54C 3I7JA 1XPBA 4K0WA 5FI2A 2H0YA 4FD8A 2IWBA 3BECA 5F1GA 1GA9A 3Q7ZA 4OPRA 1GHIA 3E2LA 3G30A 4KZ8A 3RXXA 1S0WA 1FSWA 5EE8A 2V20A 4PPRA 3N8SA 4DE1A 3TOIA 3IH8A 5AQ7A 3VP0A 2WYXA 1MWTA 1MBLA 4KZ3A 2WGWB 4UA7A 1JTDA 1KGEA 4PM7A 1MKIA 1PW1A 4ZTKA 5M1AA 4IBRA 1RCJA 2HDUA 2JCHA 3UPOA 5HAIA 4KQOA 1XGIA 4N92A 4LV2A 1E3UD 4WM9A 1NYMA 3SH9A 5FDHA 3IF6C 1JTGA 2J9PA 2WUQA 4S2PA 2OSUA 1Y54A 5KSCA 3CZDA 1K6RA 4GDBA 5EECA 1IELA 3FYZA 2XEPA 5HW3A 5DVAA 5EVID 3OPPA 3HREA 2WADA 1JWVA 1L0DA 5CRFA 1W8QA 3A3EA 3BFFA 3TG9A 3B3XA 2WKIA 1BLHA 3VOZA 1AXBA 3UDXA 4RX3A 4BQMA 5CGWA 3IWQA 3SS3A 1BULA 2XD1A 1JVJA 1W5DA 2FFYA 1KVMA 4KQRA 2XK1A 2XQZA 2JBFA 1DY6A 2FFFB 3LY4A 2VGKA 3OPHA 4YINA 4PMAA 5BOHA 4S2IA 1M6KA 2EXAA 2ZC4B 4QJGA 1EROA 5TR7A 5CHUA 4K91A 2Y55A 4QY5A 3ZNYA 2QMIA 1QMFA 1ERQA 2WK0A 3O87A 3RJUA 2ZM8A 2RL3A 3Q81A 1ONHA 3BEBA 4OVDA 3WRZA 2IWDA 5FATA 5A90A 4LCLA 4KENB 3DWZA 3G2ZA 2J7VA 4DE2A 5HFOA 2WGVA 1TDGA 2ZQ8A 5JYPA 3HLDA 1XP4A 1TVFA 1QMEA 2A3UA 3BLSA 5A91A 3VFFA 1FCOA 2P9VB 1PZPA 1ESIA 3CMZA 1BLCA 4OP5A 4C3QA 4E3NA 3HUNA 4OH0A 2EX8A 5DTKA 2BLSA 2Y2LA 2ZQAA 3GTCA 4Y0OA 5E43A 3GV9A 5M18A 3G2YA 4ZJ3A 3UPNA 2G2UA 2ZLYA 3N8LA 4QY6A 4E3LA 1KDSA 1S6RA 5U47A 2XDMA 4GB7A 4E6XA 1G6AA 3HLWA 2WZXA 3C4PA 3M2KA 3N8RA 2HDQA 3ZCZA 3VP3A 3PBRA 1TEMA 1LI0A 3UDFA 5DTTA 4DRTA 1GA0A 1O07A 2ZD8A 3JYIA 4JKTA 1NYYA 4OQIA 3ZHHA 3C7VA 3IXGA 5FQIA 3OPLA 1IYPA 4N1HA 2CC1A 2XFTA 4X55A 3S4XA 4HBTA 3NI9A 4KG5A 1NRFA 3G4PA 5CHJA 1ESUA 3MFDA 1CEFA 4UAAA 5EOEA 3ZVTA 4A5RA 2WZZA 4R23A 1H8YA 4S2MA 4B4XA 5AQ9A 2Y2IA 3ZGAB 1DJAA 4FCFA 1MPLA 4X68A 1KE3A 3IQAA 4DE3A 3P98A 3AGFA 5F1FA 5GHYA 1NY0A 3BFDA 1RP5A 4KZBA 1LI9A 4KZ7A 3WWXA 3C4OA 2ZQDA 3LEZA 3UNWA 4DDYA 2J9OA 4OPZA 4DXBA 3OC2A 3AGEA 4RVAA 1VQQA 3OCNA 4OPYA 3DWKA 3G34A 4WZ5C 3PBOA 4Y7PA 1NZUA 3W8KA 5F82A 3G35A 1K38A 4RX2A 3FWLA 1GHMA 4GD6A 5JYOA 2R9WA 1K54A 3C5AA 3DW0A 4MBKA 4OQHA 1BSGA 3IXDA 3Q07A 4OQGA 1KVLA 3V3RA 4DKIA 3M2JA 3VP4A 3WS4A 3GSGA 4X69A 5GLBA 1LL9A 5FQ9A 4KZ5A 1YT4A 4DXCA 3OPRA 3MZFA 4EBPA 3HVFA 1K55C 2HP5A 2E8IA 1PWGA 3UE0A 3DTMA 5EVIB 1YMSA 4U3TA 3GRJA 3OCLA 2XD5A 2OV5A 3PAEA 4R0QA 4E3KA 4WZ4A 3MZDA 2EX9A 4HEFA 2ZC3B 3Q7VA 2JC7A 3GVBA 3SH7A 5L2FA 4RYEA 3SH8A 3LCEA 4DF6A 1L0FA 3IF6A 4OOMA 5E2EA 1BT5A 1SCWA 3VMAA 4X6TA 4XUXA 5FAPA 3NIAA 2EXBA 3BFGA 4X56A 4OP8A 3VP1A 2V1ZA 3HLGA 4UA9A 4WBGA 5DTSA 4D2OA 3CG5A 2H0TA 4LENA 3MXRA 3QNCA 2C5WB 5EOOA 3IXBA 4KZ6A 3VFHA 3N7WA 4BD0A 4IVKA 4GZBA 4MLLA 1IYOA 3O86A 4R4RA 5D3OA 3IT9A 3WRTA 2HPBA 4QB8A 3RXWA 3QHYA 1ZC2A 1BLPA 3C7UA 4N1XA 4QHCA 5E2FA 3ZVWA 3SS5A 5IHVA 5GHXA 3G31A 4MNRA 2Y2PA 1IKGA 1LLBA 2Y2NA 4ID4A 1PW8A 1XGJA 1PI4A 3IH9A 3PBNA 4OOYA 4CJNA 4S2KA 1L0EA 4N9KA 1JWPA 1GHPA 2XFSA 3BYDA 4OONA 4XUZA 5CEDA 3S22A 1KE0A 3A3IA 3HLFA 5FQJA 3UPPA 3MXSA 5AQBA 3BM6A 2WKHA 4BJPA 2X02A 1XA1A 1YLZA 3PAGA 5FAQA 5GLCA 2ZQ7A 1FR6A 3UE3A 2H5SA 1KGGA 2Z2MB 4GN2A 4YFMA 4S2JA 4P87A 5TGFA 4B88A 4JPMA 4KZAA 4R3BA 3UN7A 4XXRA 1Q2PA 5G18A 3MKFA 2GDNA 4MBFA 4X53A 2Y2OA 4U0TA 1ZKJA 1Z6FA 1BTLA 1WYCA 4WEKA 4ZAMA 4Q8IA 3NDGA 4IBXA 5EPHA 3TSGA 1WYBA 2PU4A 1BZAA 4GDNA 1K4FA 1FCMA 4KZ9A 5HAQA 4OLDA 4EUZA 4F94A 4QD4A 2DCFA 1HVBA 1ES3A 2PBYA 2Q9MA 2XGNA 3ZNTA 4DE0A 4E3MA 1K57C 5FI6A 1SHVA 4OOLA 3A3DA 4S2NC 1KE4A 1I2WA 3V3SA 4ZDXA 4BLMA 1YM1A 3M6BA 4EWFA 2HP9A 2VGJA 2Q9NA 2XLNA 1CI9A 1U60A 3S1YA 4JXVA 3VSKA 4LCMA 5FI7A 1OMEA 3GMWA 4C75A 1FOFA 1Q2QA 2EX6A 4FH4A 4UA6A 3ZG9B 3O88A 1JWZA 4HESA 1E25A 1FCNA 5GLDA 5I94A 1N4OA 1HTZA 1SKFA 3UDIA 3W4PA 1NJ4A 3N6IA 3P09A 1YLPA 4IEDA 1L0GA 3IHBA 4IVIA 3ZG5A 1H8ZA 1PWCA 4JXWA 1GCEA 3PBQA 1L2SA 2Y91A 4DDSA 4R3JA 4NETA 4ZJ1A 2EX2A 3MZEA 1XX2A 2X71A 4OKPA 1I2SA 1C3BA 2DNSA 3ISGA 3Q1FA 4WZ5A 3WS0A 4N9LA 2WGWA 4NK3A 5EVIC 1M40A 4E6WA 5J8XA 3E2KA 1ES2A 3SS4A 4ZBEA 3ZFZA 2ZJ9A 1G68A 5HAPA 3A3JA 3CJMA 3MKEA 5KZHA 2WAFA 3IXHA 3VSLA 1BLSA 2EFUA 1CEGA 1RGZA 3M6HA 4JBFA 4O7DA 5HX9A 2Y2JA 2V2FF 4M3KA 4UHUA 1K55A 4LV0A 3QNBA 1ZG6A 3NY4A 1RGYA 1YLWA 1IKIA 2ZQ9A 3BFCA 1N9BA 1TDLA 2ZC6B 1LHYA 4GNUA 2UWXA 3GR2A 2HDRA 4EBNA 1E4DA 4PM5A 4JXGA 3ZG0A 4JXSA 4JF4A 3N4IA 1PYYA 3AGDA 3FZCA 3WS1A 4BENA 1MXOA 1LL5A 1NXYA 4LV3A 1IYQA 3WS2A 2R9XA 3PTEA 5KMWA 3BRMA 1NZOA 3NCKA 3HUOA 1FQGA 3ITBA 4QU3A 3HLCA 4OPQA 3NBLA 1PI5A 5CHMA 4EBLA 3HL9A 1EWZA 3VOYA 5F83A 3LY3A 1HD8A 4PM9A 2QZ6A 4MBHA 4HBUA
chains in the Genus database with same CATH superfamily
5FA7A 2G2WA 3F1OA 2ZQCA 2DRWA 1V9ZA 2V0UA 5CTMA 4F94A 1ES4A 1SDEA 3FV7A 1EW0A 1CK3A 2Y2HA 1CI8A 4WMCA 5HL1A 1XFQA 3Q7VB 1YLYA 2BG1A 1I5QA 3LYXA 1YLJA 4B93A 3IF6B 2X01A 2HF6A 2PBDP 3F1PA 4S2LA 4R1GA 5CGSA 5EV0A 2XR0A 4I38A 5CGXA 3EQVA 2LB5A 5DF9A 3CPTA 4JLFA 1YQSA 4JGQA 2Y2KA 3FKVA 1W8YA 5KSHA 1XFNA 3D4FA 3V39A 2JHEA 3HLEA 2OLUA 2CMNA 1SDNA 2HDSA 2ZC5B 1EI5A 1PIOA 1K56D 1KOUA 1G6OA 2JKRM 2Y8HA 5HSQA 2Y2QA 3HUMA 4E3JA 4Y0TA 2W3HA 5HWWA 4IUHA 5L8MA 3SOIA 1VB6A 2QWSA 2V9AA 2B95A 3ZDJA 1P9WA 1IYSA 5FASA 4P6BA 1TS7A 5HDSA 2WAEA 3JVVA 3C30A 1XXMA 3T4QA 1MKMA 1ERMA 2VV6A 4BBTA 4K0XA 1ACFA 3MQOA 2C6WB 4JF6A 1K54C 1XPBA 2IWBA 4KZ8A 1S0WA 4PPRA 5AQ7A 2WYXA 1MWTA 1MBLA 2WGWB 4UA7A 5HDCA 1OTDA 4PM7A 4ETZA 4IBRA 5HAIA 4WM9A 1NYMA 1MZUA 2WUQA 2VGLS 1Y54A 3CZDA 5HW3A 4P6ZS 2XEPA 4CLCD 3OPPA 4HY8A 3HREA 2W1TB 2WADA 1JWVA 4EXOA 1W8QA 2WKIA 4X1MA 4RX3A 1BULA 4ZRRA 5FEFA 1LT0A 5F69A 3LR0A 2JKRI 2XQZA 2W3FA 4PMAA 1M6KA 5CHUA 3RJUA 2ZM8A 3Q81A 1ONHA 3WRZA 2IWDA 2OAP1 2ZQ8A 4MN7A 1YSPA 1BLCA 5KIZA 1OT6A 4C3QA 5DTKA 2QHKA 2Y2LA 3GV9A 2J3TC 4WLAA 3MR0A 2GZAA 2G2UA 4QY6A 3DBAA 3LIDA 1G6AA 2WZXA 2HDQA 1TEMA 1LI0A 3UDFA 4JGPA 4DRTA 1GA0A 1O07A 2ZD8A 4OQIA 1YSQA 3ZHHA 3C7VA 5FQIA 5J3WA 1IYPA 4HBTA 2W3EA 3UB7A 1ESUA 3ZVTA 1DP9A 1H8YA 5AQ9A 2Y2IA 1DJAA 4FCFA 1BYWA 2O9AA 3C8CA 4DE3A 3AGFA 5GHYA 1NY0A 4KZBA 3C4OA 4DDYA 2XA7M 3QP2A 4OPZA 4RVAA 1VQQA 3LR3A 5F82A 3G35A 3FWLA 4GD6A 5JYOA 4EQ1A 4MBKA 2B02A 3V3RA 4DKIA 3GSGA 3MF0A 1OTBA 3DAVA 2VLGA 2ZBBA 4PKYG 5FQ9A 3LUQA 3DTMA 4O0PA 4CLCB 3GRJA 2OV5A 3PAEA 4E3KA 1YKDA 3MZDA 2EX9A 3DTIA 1NRJA 2ZC3B 1L0FA 1BT5A 4ESPA 3HLGA 5FDSA 4WBGA 5DTSA 3D9YA 2H0TA 4NKPA 3MXRA 5EOOA 4KZ6A 3N7WA 1Y4OA 3CUEA 4MLLA 3LIAA 2HPBA 1BLPA 3C7UA 5IHVA 5GHXA 3FPWA 1XGJA 3PBNA 4HOIA 1FIKA 3BYDA 4DJ2A 1TS0A 3A3IA 4HJ4A 5FQJA 3MJQA 3UPPA 3MXSA 5AQBA 3IX3A 2WKHA 5F68A 4QWOA 2H5SA 4I3AA 3ICYA 4GLQA 4L9FA 3BWLA 2GDNA 4U0TA 1BTLA 2AVXA 1AWIA 2W1RA 3TSGA 1WYBA 2PU4A 1BZAA 4GDNA 1JNUA 3QP5A 5HAQA 4EUZA 4HJ3A 2DCFA 1Y28A 3PYPA 4OOLA 3A3DA 4R3AA 1I2WA 2JKTI 4BLMA 3M6BA 4EWFA 2VGJA 2XLNA 1CI9A 2W3GA 3CAXA 4HIAA 4JXVA 3VSKA 1IOUA 3K3DA 1JWZA 1SKFA 1NJ4A 3P09A 1YLPA 1L0GA 3IHBA 1H8ZA 3T4JA 3PBQA 4HP9A 4ZJ1A 3MZEA 4OKPA 1SKOA 3SW1A 2PT7A 4WZ5A 4NK3A 1M40A 2QYBA 2J3TD 3E2KA 3H9WA 2GJ3A 2WAFA 2EFUA 1HLUP 3SZTA 4M3KA 3FG8A 1IKIA 2ZC6B 1D06A 2HDRA 4EBNA 3ZQ5A 3ZG0A 1PYYA 2HJEA 1NXYA 2HZ5A 2R9XA 3BRMA 3HUOA 3ITBA 3NULA 1PI5A 3HL9A 1EWZA 2KOIA 4KG2A 1XA7A 2HJ9C 4MEZA 5GLAA 3ZG7B 3T1QB 4WL9A 3A3FA 3W4OA 3O3VA 2OWJA 4BL2A 1BUEA 3C2WA 1ES5A 3IHAA 3PBTA 4OLGA 3RFBA 2P04A 4CPKA 1K25A 3V50A 3UE1A 5TBMA 4HP4A 1DP6A 1KGFA 4ZJ2A 4O8GA 3BQAA 3MXQA 4HI4A 4MCWA 3EQUA 3D72A 3F1NA 5CERA 1XKZA 3E0YA 2PHYA 2HGVA 1W63Q 1XJ2A 2M7UA 1D1JA 4WUJA 5CTNA 3TRCA 4WMCD 5DF8A 4Z9QA 3S7PA 3T50A 1K57A 2B5RA 4EQIA 1W79A 1YLTA 2EWVA 4WYYA 4OQ0A 4XT2B 4PM6A 4UQIM 2ZMFA 4E3IA 4B9OA 4Y15A 2Q0OA 3A0RA 5I5LA 3BY9A 2J8YA 3T1SA 5TFQA 4BL3A 3V5MA 1E3UA 2P74A 5FQQA 5E2GA 2VX8A 1VEUB 3MQ0A 4U0XA 1O7EA 2ZOHA 1VETB 4BMWA 3ITAA 1FR1A 3I7JA 1L3LA 3BECA 5F1GA 3Q7ZA 1FSWA 2J3WA 3T4LA 4DE1A 3VOLA 4Q0IA 4ETXA 1SZVA 1NLZA 1JTDA 1KGEA 2L1MA 1OTEA 1PW1A 1RCJA 2JCHA 4N92A 1N9OA 3SH9A 5FDHA 3VV4A 2K2NA 4GHIA 3T4SA 2QJ7A 3UE6A 1PRQA 1IELA 2EA9A 3BFFA 5DKKA 3PHYA 3VOZA 3CUEC 5CGWA 2O0YA 3LI9A 1F2KA 2O9CA 2XK1A 2J80A 2JBFA 1DY6A 5L10A 3UMDA 4S2IA 3F1OB 2EXAA 5TR7A 5J4EA 3ZNYA 1ERQA 1IFQA 3KO6A 3NOUC 4OVDA 5FATA 4LPZA 3DWZA 2J7VA 5F6AA 2WGVA 3HLDA 1XP4A 3KX0X 3VFFA 3F1PB 1FCOA 5HWTA 3VE3A 1ESIA 3NOPC 4E3NA 2KDKA 1NLYA 4OH0A 1CJFA 2EX8A 3GTCA 3G2YA 1F5MA 2K7SA 2ZLYA 4E3LA 2V8FA 1S6RA 2V1AA 2XDMA 4GB7A 3CPTB 3N8RA 3ZCZA 2YKHA 5DTTA 3JYIA 4JKTA 4MMNA 4II7A 4X55A 3NI9A 1NRFA 5EOEA 1CEFA 4A5RA 4X68A 1KE3A 3P98A 3NECA 3BFDA 1RP5A 4KZ7A 4EW7A 2J9OA 3LIFA 3OCNA 4QPRA 4WZ5C 3PBOA 4Y7PA 1NZUA 3W8KA 2PD8A 1K38A 1GHMA 4HJ6A 3C5AA 4OQHA 4LGWA 3NHQA 3ULFA 5GLBA 1F98A 2QJ5A 4KZ5A 1YT4A 3MSHA 3ZYTA 2E8IA 4LRXC 3KYQA 4U3TA 3OCLA 2XD5A 4R0QA 3U2AA 2IA2A 3HJKA 4FOFA 2A24A 5L2FA 2L4RA 3LCEA 4DF6A 3T4OA 1SCWA 4XUXA 3NIAA 2BASA 3BFGA 3IX8A 2V1ZA 4D2OA 4MN6A 2PAVP 4O01A 4G3VA 2EWWA 3IXBA 3VFHA 4H6JA 4BD0A 3O86A 4R4RA 3P7NA 4QB8A 3KSFA 1ZC2A 4MNRA 1IKGA 2Y2NA 1PW8A 3IH9A 2R78A 1S1ZA 2PYPA 4EETB 2X02A 1XA1A 1FR6A 3U4LP 4YWZA 1KGGA 2Z2MB 4YFMA 4S2JA 4JPMA 4KUKA 4YNRA 1OJGA 1Q2PA 4MBFA 4PHTA 1ZKJA 2W3DA 3FC7A 1WYCA 4ZAMA 4Q8IA 1FCMA 4KZ9A 4OLDA 1OPXA 2VEAA 1Z09A 1HVBA 2PBYA 4L9GA 1K57C 1SHVA 1S4RA 2Q9NA 4LCMA 4LLOB 3BJNA 3D3OA 3MMHA 1FOFA 4EUVA 4RQ9A 3ZG9B 4LRYC 1V9YA 2ZL1A 2FH5A 5I94A 1H8MA 1HTZA 3H82A 3UDIA 5EM0A 4PAUA 4IVIA 4FUWA 1GCEA 1L2SA 3T1RA 2PR6A 4R3JA 2X71A 3Q1FA 2V0WA 1NWZA 4N9LA 4EEUA 1H0MA 3ZFZA 3GECA 3UB8A 2JKTM 1OT9A 5HAPA 3CJMA 2VGLM 5DKLA 5KZHA 1TS6A 1CEGA 3M6HA 4O7DA 4P6ZM 5HX9A 2MJ6A 4LV0A 1ZG6A 1RGYA 2ZQ9A 1N9BA 1LHYA 2UWXA 4WN5A 4HNBA 5MC7A 3N4IA 3WS1A 5KMWA 4LV3A 3WS2A 4QU3A 1NZOA 2JKGA 4OPQA 3NBLA 3VOYA 4FTXA 5G4YA 4HBUA 3UY6A 1S67L 4DMZA 3Q82A 2I72A 4EV4A 2I9VA 4GD8A 4JF5A 2ZM2A 2ZMAA 1DJBA 2JE5A 4PM8A 5DFXA 5DF7A 1N9NA 3GDIA 4GCZA 4WELA 1VHMA 2Z2LB 2P08A 2XF3A 3NC8A 5GHZA 3KSGA 2WKEA 3FKWA 2P9VA 1J3WA 4GOGA 3KYEA 3L9KA 4L0LA 4Y2FA 3HBRA 1A0KA 3PBSA 4KZ4A 3CLOA 1PZOA 5DJUA 4WEJA 5DJTA 3H7WA 1XJ3A 3FPVA 3G32A 3IWOA 4MN5A 3EEAA 5CXWA 5GL9A 1ODVA 4EU0A 4DJ3A 4YOFA 2W27A 3IX4A 3GQZA 4FH2A 2NUPC 2ZOIA 1MY8A 4E3OA 4S2NA 5AQAA 3BLMA 5FSRA 2IWCA 2V1BA 3RTYA 4BD1A 1K6SA 4X25A 3S7QA 4FSFA 5CECA 2OLVA 4EESA 1MWUA 2Y2GA 2HV1A 4G3KA 2ZC7A 2PD7A 3EGXC 2QPNA 3CITA 4I3JA 4ARZA 4C6YA 5EVIA 4BBVA 4S2OA 1G28A 4KG6A 5FI2A 3LFVA 3UB5P 1GHIA 3E2LA 5TJJA 4PKYA 1SKOB 3C38A 3K2NA 1MKIA 4KUOA 2HDUA 3UPOA 3S7NA 3NJAA 4NXBA 4HH3A 1E3UD 3LGOA 1JTGA 4LFUA 2J9PA 4S2PA 4GS9A 3QP6A 1UWNX 3FYZA 3JVUA 5DVAA 3BW6A 1T1AA 1S66L 3SS3A 1JVJA 1W5DA 1KVMA 2VGKA 5BOHA 3T12B 4F3LA 2FZ0A 4QJGA 4I5SA 4K91A 2Y55A 4QY5A 2WK0A 1QMFA 1T18A 1H3QA 5A90A 4LCLA 4KENB 2VK3A 4DE2A 5HFOA 2B18A 1TVFA 3T4TA 1QMEA 3BLSA 2YKFA 5A91A 1CF0A 1PZPA 3CMZA 4OP5A 4CLCE 3HUNA 5TBMB 2BLSA 2ZQAA 5M18A 3IBRA 2A2LA 3O5YA 5IU1A 1T19A 4E04A 3N8LA 3B33A 3F1NB 4NXEA 3IS2A 3HLWA 4NEED 3C4PA 3VP3A 3PBRA 2DMWA 5IT5A 3P01A 1NYYA 4JGRA 4N1HA 2XFTA 3S4XA 3E98A 4KG5A 3G4PA 5CHJA 4UAAA 4B4XA 2WZZA 4S2MA 1MPLA 3IQAA 3CHWP 1LSVA 1ZTUA 3WWXA 1LI9A 4D60A 4Q0HA 3UNWA 2WKRA 1TD5A 3OC2A 3AGEA 4HHDA 2R9WA 3DW0A 1BSGA 2LB9A 4OQGA 3A0VA 4I3IA 2WKPA 3M2JA 3LIBA 1LL9A 3OPRA 3MZFA 2QKPA 1PWGA 3HJIA 1YMSA 4Y5FA 3T4KA 3S7OA 1LSXA 3R4KA 4HEFA 3Q7VA 3GVBA 3SH8A 3IF6A 5E2EA 5FAPA 2EXBA 4OP8A 4UA9A 1OTIA 1K0KA 3QNCA 2P7JA 5D3OA 2GX5A 3IT9A 3WRTA 2Z6CA 1P9RA 4GHIB 2JKFA 3G31A 2Y2PA 1LLBA 1PI4A 4I39A 4OOYA 1L0EA 5HWVA 2XFSA 1GHPA 4OONA 5CEDA 2D01A 2XSSA 3QP1A 4BJPA 1YLZA 3PAGA 4NG2A 2ZQ7A 2W0NA 3UE3A 4R6LA 5TGFA 2O9BA 4X53A 2Y2OA 5LBRA 5DFYA 4WEKA 5EFWA 4GW9A 4IBXA 1TS8A 5AVFA 1CQAA 2KLIA 2XGNA 3ZNTA 4DE0A 4E3MA 1PFLA 5FI6A 5HL6A 4S2NC 1KE4A 4ZDXA 2BTFP 3K3CA 2VV7A 1U60A 3S1YA 4C75A 5FI7A 3GMWA 1Q2QA 4FH4A 1W63M 4HESA 4UEYA 5GLDA 5HD5A 3W4PA 3N6IA 3TE8A 1XJ6A 2M7VA 1DRMA 2L0WA 4NXFA 4NETA 2EX2A 1I2SA 1C3BA 2WGWA 5EVIC 4R38A 5J8XA 2VKSA 4LRZE 1ES2A 3SS4A 4ZBEA 2ZJ9A 3V67A 3A3JA 2V8CA 3VSLA 4JBFA 1RGZA 1X0OA 1P97A 4UHUA 1K55A 3UMEA 3QNBA 3NY4A 4L9EA 1YPRA 1TDLA 1UWPX 2W1TA 4PM5A 4JXSA 4JF4A 4BENA 3AGDA 3FZCA 1MXOA 2XA7S 1IYQA 1FQGA 3HLCA 5CHMA 1PNEA 4PM9A 2UV0E 2QZ6A 1D7EA 2A49A 3TW8A 4P0MA 4GJ4A 4P85A 1ONGA 1FSYA 1TF1A 3OOVA 1KDWA 2H10A 2EFXA 1YMXA 1OTAA 2Y2MA 4H8RA 1ZG4A 2JN7A 3BQ8A 1K56A 3OZHA 4KQQA 2A24B 1VM1A 1GSXA 4RA7A 2PU2A 3TJZC 4Y3IA 3WS5A 5A92A 1K4EA 3UB6A 3QP8A 2XH9A 1J9MA 3BFEA 1T1BA 2Y4AA 4LV1A 5AVEA 5A93A 4H6JB 5E2HA 3W4QA 1WA9A 5C5KA 2HP6A 3NDEA 1FILA 1ALQA 2OOLA 5M19A 1LL8A 2K31A 1P0ZA 4Z1WA 5CEBA 4B4ZA 5FAOA 4BWIA 3OBFA 2NUTC 4AFIA 3LEQA 5HARA 5EVLA 1PWDA 1GSVA 2O99A 4IHQA 2M1CA 5L07A 4M4XA 1IEMA 5EVEA 4WF0A 3VP2A 2ZM0A 4BBUA 1MWRA 3UB9A 1WE4A 2E8JA 2OWHA 1DJCA 4IJGA 4R4SA 4Y0UA 3LIEA 2VV8A 2RCXA 3LO7A 1MWSA 2Y59A 3IWIA 3IF5A 1H5XA 3MBZA 3UO9A 4R70A 2XROA 2OAQ1 4JGOA 1HZOA 4GKUA 5EM1A 3MFXA 1MC0A 5FQKA 1W7FA 2PRFA 5FL3A 5G4ZA 4CLCA 5EUAA 3EEHA 2WGIA 5FQMA 2ZL1B 3HLBA 1N9LA 2Y79A 5CX7A 3H82B 3EGDC 4K0WA 2H0YA 4FD8A 1GA9A 4OPRA 3G30A 3RXXA 4IUKA 4X1LA 1S4SA 5EE8A 2V20A 3N8SA 2PR5A 3TOIA 3IH8A 3KSHA 3VP0A 3L7HA 4KZ3A 2ACGA 4ZTKA 5M1AA 4Y17A 4KQOA 1XGIA 4LV2A 3OLOA 3IF6C 5IS1A 3CI6A 2INWA 3PR6A 2OSUA 4NXGA 5KSCA 3E4PA 1K6RA 4GDBA 5EECA 4EERA 5EVID 1L0DA 5CRFA 3A3EA 3B47A 3TG9A 5HPIA 3B3XA 1BLHA 1AXBA 3UDXA 4BQMA 3IWQA 2XD1A 2FFYA 4KQRA 3LR5A 2H28A 3LY4A 4KQDA 2FFFB 3OPHA 4YINA 2ZC4B 1EROA 2QMIA 3O87A 2RL3A 1GSWA 3BEBA 3A0SA 3G2ZA 1TDGA 5JYPA 2A3UA 1DP8A 1S1YA 2P9VB 1ZHHB 5A8BA 5FEGA 4CQHA 3NOTC 4Y0OA 5E43A 4ME4A 4ZJ3A 3UPNA 1KDSA 5U47A 4E6XA 3M2KA 3H7WB 3IXGA 3OPLA 4Y13A 2CC1A 5K5BA 3PXPA 3BY8A 3MFDA 4R23A 1UGUA 1OJ5A 3ZGAB 2ZMVA 2WKQA 3LI8A 5F1FA 3DTEA 3G6OA 2PDRA 2ZQDA 3LEZA 4DXBA 4OPYA 3EWKA 3DWKA 3G34A 4RX2A 3HCYA 1K54A 4UQIS 3IXDA 3Q07A 1KVLA 3VP4A 4G3WA 3WS4A 4X69A 3VE4A 1XJ4A 4DXCA 3QP4A 4EBPA 3HVFA 1K55C 2HP5A 3UE0A 4HQAA 4ARZB 5EVIB 1STZA 5HPFA 4WZ4A 2Z6DA 5F5YA 3IBJA 2VZWA 4Q0JA 3KSIA 2JC7A 3SH7A 2G7UA 4RYEA 3MQQA 4OOMA 3VMAA 4X6TA 4X56A 3MS6A 3VP1A 3CG5A 3LICA 4LENA 5AJGA 2C5WB 4IVKA 4GZBA 1IYOA 1YAXA 3EOIA 3RXWA 2VJWA 3CWFA 3E4QA 3QHYA 1T1CA 4N1XA 4QHCA 5E2FA 3ZVWA 5HZHA 3SS5A 4GS9B 4ID4A 4HH2A 3W2ZA 4CJNA 4S2KA 4N9KA 1JWPA 3DTKA 3LR4A 4K08A 3E4OA 4XUZA 2KX6A 3S22A 1KE0A 3HLFA 3BM6A 5GLCA 5FAQA 4GN2A 4P87A 4F3LB 4B88A 4KZAA 4R3BA 3UN7A 4XXRA 5G18A 4XT2A 3MKFA 1LSWA 4EEPA 1Z6FA 2VA0A 3JPUA 3NDGA 5EPHA 1K4FA 4QD4A 1ES3A 1G5UA 2Q9MA 1F9IA 5HD3A 3V3SA 1YM1A 2PYRA 3R7WA 1VEUA 2HP9A 2XRNA 1VETA 1OMEA 4UA6A 2EX6A 3O88A 2GNXA 1E25A 1FCNA 1N4OA 3IS2B 5L09A 4IEDA 4MDZA 3ZG5A 1PWCA 4JXWA 5HDDA 3T1XA 3KYZA 2Y91A 4DDSA 1XX2A 3ISGA 2DNSA 3WS0A 3RH8B 4CLCC 4E6WA 3R7WB 1G68A 3MKEA 3IXHA 2D02A 1BLSA 2Y2JA 2V2FF 1YLWA 3BFCA 5J7EA 4GNUA 3GR2A 4DN0A 1E4DA 4JXGA 1LL5A 3PTEA 3NCKA 4EBLA 3B42A 5F83A 3LY3A 1HD8A 3ZG8B 4MBHA
chains in the Genus database with same CATH topology
4KG2A 2A49A 5FA7A 2G2WA 3UY6A 2ZQCA 4P0MA 2DRWA 1XA7A 5CTMA 3Q82A 4MEZA 1ES4A 1SDEA 2I72A 4P85A 1ONGA 5GLAA 4GD8A 3ZG7B 4EV4A 3FV7A 1FSYA 3A3FA 4JF5A 2ZM2A 1KDWA 2H10A 3W4OA 2EFXA 2ZMAA 1CK3A 1DJBA 2JE5A 2Y2HA 1YMXA 1CI8A 2Y2MA 3O3VA 4H8RA 1ZG4A 4PM8A 4WMCA 5DF7A 1K56A 4BL2A 5HL1A 3OZHA 4KQQA 2Z2LB 2XF3A 1YLYA 3Q7VB 4WELA 1BUEA 2BG1A 1VM1A 3NC8A 5GHZA 1I5QA 1ES5A 1YLJA 3IHAA 3IF6B 2X01A 4RA7A 2PU2A 2WKEA 3PBTA 3FKWA 2P9VA 4S2LA 4OLGA 3WS5A 5A92A 1K4EA 4CPKA 1K25A 4GOGA 2XH9A 4R1GA 5CGSA 3V50A 1J9MA 3BFEA 2Y4AA 3UE1A 4LV1A 2XR0A 4L0LA 1KGFA 4ZJ2A 5A93A 5E2HA 3W4QA 3HBRA 3PBSA 4KZ4A 5CGXA 3EQUA 5CERA 1XKZA 3EQVA 1PZOA 2HP6A 5DF9A 4JLFA 3NDEA 1YQSA 4WEJA 3ZG8B 2Y2KA 3FKVA 1ALQA 3G32A 3IWOA 5M19A 1W8YA 5KSHA 5CEBA 4B4ZA 3D4FA 5FAOA 3V39A 5CXWA 3HLEA 2OLUA 5GL9A 5CTNA 1SDNA 2HDSA 2ZC5B 4WMCD 1EI5A 1PIOA 1K56D 5EVLA 1PWDA 3GQZA 5HARA 2Y2QA 3HUMA 4FH2A 5DF8A 4Z9QA 1IEMA 1K57A 4E3JA 1MY8A 3VP2A 4Y0TA 4E3OA 2B5RA 4S2NA 2ZM0A 4EQIA 1MWRA 1W79A 5AQAA 3BLMA 1WE4A 1DJCA 4R4SA 1YLTA 5FSRA 4WYYA 3SOIA 2IWCA 4OQ0A 4PM6A 4Y0UA 4BD1A 2RCXA 3LO7A 1MWSA 4E3IA 3ZDJA 1IYSA 2Y59A 5FASA 1K6SA 3IF5A 3IWIA 1H5XA 3MBZA 4P6BA 3UO9A 2J8YA 4FSFA 5CECA 5TFQA 2WAEA 4BL3A 2OLVA 3V5MA 1MWUA 1HZOA 1E3UA 4GKUA 2P74A 1XXMA 2Y2GA 5FQQA 2ZC7A 5E2GA 5FQKA 2QPNA 1W7FA 1ERMA 4K0XA 2C6WB 4U0XA 5EVIA 4C6YA 1O7EA 4S2OA 3ITAA 5EUAA 4JF6A 1FR1A 2WGIA 4KG6A 5FQMA 3HLBA 1K54C 3I7JA 1XPBA 4K0WA 5FI2A 2H0YA 4FD8A 2IWBA 3BECA 5F1GA 1GA9A 3Q7ZA 4OPRA 1GHIA 3E2LA 3G30A 4KZ8A 3RXXA 1S0WA 1FSWA 5EE8A 2V20A 4PPRA 3N8SA 4DE1A 3TOIA 3IH8A 5AQ7A 3VP0A 2WYXA 1MWTA 1MBLA 4KZ3A 2WGWB 4UA7A 1JTDA 1KGEA 4PM7A 1MKIA 1PW1A 4ZTKA 5M1AA 4IBRA 1RCJA 2HDUA 2JCHA 3UPOA 5HAIA 4KQOA 1XGIA 4N92A 4LV2A 1E3UD 4WM9A 1NYMA 3SH9A 5FDHA 3IF6C 1JTGA 2J9PA 2WUQA 4S2PA 2OSUA 1Y54A 5KSCA 3CZDA 1K6RA 4GDBA 5EECA 1IELA 3FYZA 2XEPA 5HW3A 5DVAA 5EVID 3OPPA 3HREA 2WADA 1JWVA 1L0DA 5CRFA 1W8QA 3A3EA 3BFFA 3TG9A 3B3XA 2WKIA 1BLHA 3VOZA 1AXBA 3UDXA 4RX3A 4BQMA 5CGWA 3IWQA 3SS3A 1BULA 2XD1A 1JVJA 1W5DA 2FFYA 1KVMA 4KQRA 2XK1A 2XQZA 2JBFA 1DY6A 2FFFB 3LY4A 2VGKA 3OPHA 4YINA 4PMAA 5BOHA 4S2IA 1M6KA 2EXAA 2ZC4B 4QJGA 1EROA 5TR7A 5CHUA 4K91A 2Y55A 4QY5A 3ZNYA 2QMIA 1QMFA 1ERQA 2WK0A 3O87A 3RJUA 2ZM8A 2RL3A 3Q81A 1ONHA 3BEBA 4OVDA 3WRZA 2IWDA 5FATA 5A90A 4LCLA 4KENB 3DWZA 3G2ZA 2J7VA 4DE2A 5HFOA 2WGVA 1TDGA 2ZQ8A 5JYPA 3HLDA 1XP4A 1TVFA 1QMEA 2A3UA 3BLSA 5A91A 3VFFA 1FCOA 2P9VB 1PZPA 1ESIA 3CMZA 1BLCA 4OP5A 4C3QA 4E3NA 3HUNA 4OH0A 2EX8A 5DTKA 2BLSA 2Y2LA 2ZQAA 3GTCA 4Y0OA 5E43A 3GV9A 5M18A 3G2YA 4ZJ3A 3UPNA 2G2UA 2ZLYA 3N8LA 4QY6A 4E3LA 1KDSA 1S6RA 5U47A 2XDMA 4GB7A 4E6XA 1G6AA 3HLWA 2WZXA 3C4PA 3M2KA 3N8RA 2HDQA 3ZCZA 3VP3A 3PBRA 1TEMA 1LI0A 3UDFA 5DTTA 4DRTA 1GA0A 1O07A 2ZD8A 3JYIA 4JKTA 1NYYA 4OQIA 3ZHHA 3C7VA 3IXGA 5FQIA 3OPLA 1IYPA 4N1HA 2CC1A 2XFTA 4X55A 3S4XA 4HBTA 3NI9A 4KG5A 1NRFA 3G4PA 5CHJA 1ESUA 3MFDA 1CEFA 4UAAA 5EOEA 3ZVTA 4A5RA 2WZZA 4R23A 1H8YA 4S2MA 4B4XA 5AQ9A 2Y2IA 3ZGAB 1DJAA 4FCFA 1MPLA 4X68A 1KE3A 3IQAA 4DE3A 3P98A 3AGFA 5F1FA 5GHYA 1NY0A 3BFDA 1RP5A 4KZBA 1LI9A 4KZ7A 3WWXA 3C4OA 2ZQDA 3LEZA 3UNWA 4DDYA 2J9OA 4OPZA 4DXBA 3OC2A 3AGEA 4RVAA 1VQQA 3OCNA 4OPYA 3DWKA 3G34A 4WZ5C 3PBOA 4Y7PA 1NZUA 3W8KA 5F82A 3G35A 1K38A 4RX2A 3FWLA 1GHMA 4GD6A 5JYOA 2R9WA 1K54A 3C5AA 3DW0A 4MBKA 4OQHA 1BSGA 3IXDA 3Q07A 4OQGA 1KVLA 3V3RA 4DKIA 3M2JA 3VP4A 3WS4A 3GSGA 4X69A 5GLBA 1LL9A 5FQ9A 4KZ5A 1YT4A 4DXCA 3OPRA 3MZFA 4EBPA 3HVFA 1K55C 2HP5A 2E8IA 1PWGA 3UE0A 3DTMA 5EVIB 1YMSA 4U3TA 3GRJA 3OCLA 2XD5A 2OV5A 3PAEA 4R0QA 4E3KA 4WZ4A 3MZDA 2EX9A 4HEFA 2ZC3B 3Q7VA 2JC7A 3GVBA 3SH7A 5L2FA 4RYEA 3SH8A 3LCEA 4DF6A 1L0FA 3IF6A 4OOMA 5E2EA 1BT5A 1SCWA 3VMAA 4X6TA 4XUXA 5FAPA 3NIAA 2EXBA 3BFGA 4X56A 4OP8A 3VP1A 2V1ZA 3HLGA 4UA9A 4WBGA 5DTSA 4D2OA 3CG5A 2H0TA 4LENA 3MXRA 3QNCA 2C5WB 5EOOA 3IXBA 4KZ6A 3VFHA 3N7WA 4BD0A 4IVKA 4GZBA 4MLLA 1IYOA 3O86A 4R4RA 5D3OA 3IT9A 3WRTA 2HPBA 4QB8A 3RXWA 3QHYA 1ZC2A 1BLPA 3C7UA 4N1XA 4QHCA 5E2FA 3ZVWA 3SS5A 5IHVA 5GHXA 3G31A 4MNRA 2Y2PA 1IKGA 1LLBA 2Y2NA 4ID4A 1PW8A 1XGJA 1PI4A 3IH9A 3PBNA 4OOYA 4CJNA 4S2KA 1L0EA 4N9KA 1JWPA 1GHPA 2XFSA 3BYDA 4OONA 4XUZA 5CEDA 3S22A 1KE0A 3A3IA 3HLFA 5FQJA 3UPPA 3MXSA 5AQBA 3BM6A 2WKHA 4BJPA 2X02A 1XA1A 1YLZA 3PAGA 5FAQA 5GLCA 2ZQ7A 1FR6A 3UE3A 2H5SA 1KGGA 2Z2MB 4GN2A 4YFMA 4S2JA 4P87A 5TGFA 4B88A 4JPMA 4KZAA 4R3BA 3UN7A 4XXRA 1Q2PA 5G18A 3MKFA 2GDNA 4MBFA 4X53A 2Y2OA 4U0TA 1ZKJA 1Z6FA 1BTLA 1WYCA 4WEKA 4ZAMA 4Q8IA 3NDGA 4IBXA 5EPHA 3TSGA 1WYBA 2PU4A 1BZAA 4GDNA 1K4FA 1FCMA 4KZ9A 5HAQA 4OLDA 4EUZA 4F94A 4QD4A 2DCFA 1HVBA 1ES3A 2PBYA 2Q9MA 2XGNA 3ZNTA 4DE0A 4E3MA 1K57C 5FI6A 1SHVA 4OOLA 3A3DA 4S2NC 1KE4A 1I2WA 3V3SA 4ZDXA 4BLMA 1YM1A 3M6BA 4EWFA 2HP9A 2VGJA 2Q9NA 2XLNA 1CI9A 1U60A 3S1YA 4JXVA 3VSKA 4LCMA 5FI7A 1OMEA 3GMWA 4C75A 1FOFA 1Q2QA 2EX6A 4FH4A 4UA6A 3ZG9B 3O88A 1JWZA 4HESA 1E25A 1FCNA 5GLDA 5I94A 1N4OA 1HTZA 1SKFA 3UDIA 3W4PA 1NJ4A 3N6IA 3P09A 1YLPA 4IEDA 1L0GA 3IHBA 4IVIA 3ZG5A 1H8ZA 1PWCA 4JXWA 1GCEA 3PBQA 1L2SA 2Y91A 4DDSA 4R3JA 4NETA 4ZJ1A 2EX2A 3MZEA 1XX2A 2X71A 4OKPA 1I2SA 1C3BA 2DNSA 3ISGA 3Q1FA 4WZ5A 3WS0A 4N9LA 2WGWA 4NK3A 5EVIC 1M40A 4E6WA 5J8XA 3E2KA 1ES2A 3SS4A 4ZBEA 3ZFZA 2ZJ9A 1G68A 5HAPA 3A3JA 3CJMA 3MKEA 5KZHA 2WAFA 3IXHA 3VSLA 1BLSA 2EFUA 1CEGA 1RGZA 3M6HA 4JBFA 4O7DA 5HX9A 2Y2JA 2V2FF 4M3KA 4UHUA 1K55A 4LV0A 3QNBA 1ZG6A 3NY4A 1RGYA 1YLWA 1IKIA 2ZQ9A 3BFCA 1N9BA 1TDLA 2ZC6B 1LHYA 4GNUA 2UWXA 3GR2A 2HDRA 4EBNA 1E4DA 4PM5A 4JXGA 3ZG0A 4JXSA 4JF4A 3N4IA 1PYYA 3AGDA 3FZCA 3WS1A 4BENA 1MXOA 1LL5A 1NXYA 4LV3A 1IYQA 3WS2A 2R9XA 3PTEA 5KMWA 3BRMA 1NZOA 3NCKA 3HUOA 1FQGA 3ITBA 4QU3A 3HLCA 4OPQA 3NBLA 1PI5A 5CHMA 4EBLA 3HL9A 1EWZA 3VOYA 5F83A 3LY3A 1HD8A 4PM9A 2QZ6A 4MBHA 4HBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KG2 A;  2A49 A;  5FA7 A;  2G2W A;  3UY6 A;  2ZQC A;  4P0M A;  2DRW A;  1XA7 A;  5CTM A;  3Q82 A;  4MEZ A;  1ES4 A;  1SDE A;  2I72 A;  4P85 A;  1ONG A;  5GLA A;  4GD8 A;  3ZG7 B;  4EV4 A;  3FV7 A;  1FSY A;  3A3F A;  4JF5 A;  2ZM2 A;  1KDW A;  2H10 A;  3W4O A;  2EFX A;  2ZMA A;  1CK3 A;  1DJB A;  2JE5 A;  2Y2H A;  1YMX A;  1CI8 A;  2Y2M A;  3O3V A;  4H8R A;  1ZG4 A;  4PM8 A;  4WMC A;  5DF7 A;  1K56 A;  4BL2 A;  5HL1 A;  3OZH A;  4KQQ A;  2Z2L B;  2XF3 A;  1YLY A;  3Q7V B;  4WEL A;  1BUE A;  2BG1 A;  1VM1 A;  3NC8 A;  5GHZ A;  1I5Q A;  1ES5 A;  1YLJ A;  3IHA A;  3IF6 B;  2X01 A;  4RA7 A;  2PU2 A;  2WKE A;  3PBT A;  3FKW A;  2P9V A;  4S2L A;  4OLG A;  3WS5 A;  5A92 A;  1K4E A;  4CPK A;  1K25 A;  4GOG A;  2XH9 A;  4R1G A;  5CGS A;  3V50 A;  1J9M A;  3BFE A;  2Y4A A;  3UE1 A;  4LV1 A;  2XR0 A;  4L0L A;  1KGF A;  4ZJ2 A;  5A93 A;  5E2H A;  3W4Q A;  3HBR A;  3PBS A;  4KZ4 A;  5CGX A;  3EQU A;  5CER A;  1XKZ A;  3EQV A;  1PZO A;  2HP6 A;  5DF9 A;  4JLF A;  3NDE A;  1YQS A;  4WEJ A;  3ZG8 B;  2Y2K A;  3FKV A;  1ALQ A;  3G32 A;  3IWO A;  5M19 A;  1W8Y A;  5KSH A;  5CEB A;  4B4Z A;  3D4F A;  5FAO A;  3V39 A;  5CXW A;  3HLE A;  2OLU A;  5GL9 A;  5CTN A;  1SDN A;  2HDS A;  2ZC5 B;  4WMC D;  1EI5 A;  1PIO A;  1K56 D;  5EVL A;  1PWD A;  3GQZ A;  5HAR A;  2Y2Q A;  3HUM A;  4FH2 A;  5DF8 A;  4Z9Q A;  1IEM A;  1K57 A;  4E3J A;  1MY8 A;  3VP2 A;  4Y0T A;  4E3O A;  2B5R A;  4S2N A;  2ZM0 A;  4EQI A;  1MWR A;  1W79 A;  5AQA A;  3BLM A;  1WE4 A;  1DJC A;  4R4S A;  1YLT A;  5FSR A;  4WYY A;  3SOI A;  2IWC A;  4OQ0 A;  4PM6 A;  4Y0U A;  4BD1 A;  2RCX A;  3LO7 A;  1MWS A;  4E3I A;  3ZDJ A;  1IYS A;  2Y59 A;  5FAS A;  1K6S A;  3IF5 A;  3IWI A;  1H5X A;  3MBZ A;  4P6B A;  3UO9 A;  2J8Y A;  4FSF A;  5CEC A;  5TFQ A;  2WAE A;  4BL3 A;  2OLV A;  3V5M A;  1MWU A;  1HZO A;  1E3U A;  4GKU A;  2P74 A;  1XXM A;  2Y2G A;  5FQQ A;  2ZC7 A;  5E2G A;  5FQK A;  2QPN A;  1W7F A;  1ERM A;  4K0X A;  2C6W B;  4U0X A;  5EVI A;  4C6Y A;  1O7E A;  4S2O A;  3ITA A;  5EUA A;  4JF6 A;  1FR1 A;  2WGI A;  4KG6 A;  5FQM A;  3HLB A;  1K54 C;  3I7J A;  1XPB A;  4K0W A;  5FI2 A;  2H0Y A;  4FD8 A;  2IWB A;  3BEC A;  5F1G A;  1GA9 A;  3Q7Z A;  4OPR A;  1GHI A;  3E2L A;  3G30 A;  4KZ8 A;  3RXX A;  1S0W A;  1FSW A;  5EE8 A;  2V20 A;  4PPR A;  3N8S A;  4DE1 A;  3TOI A;  3IH8 A;  5AQ7 A;  3VP0 A;  2WYX A;  1MWT A;  1MBL A;  4KZ3 A;  2WGW B;  4UA7 A;  1JTD A;  1KGE A;  4PM7 A;  1MKI A;  1PW1 A;  4ZTK A;  5M1A A;  4IBR A;  1RCJ A;  2HDU A;  2JCH A;  3UPO A;  5HAI A;  4KQO A;  1XGI A;  4N92 A;  4LV2 A;  1E3U D;  4WM9 A;  1NYM A;  3SH9 A;  5FDH A;  3IF6 C;  1JTG A;  2J9P A;  2WUQ A;  4S2P A;  2OSU A;  1Y54 A;  5KSC A;  3CZD A;  1K6R A;  4GDB A;  5EEC A;  1IEL A;  3FYZ A;  2XEP A;  5HW3 A;  5DVA A;  5EVI D;  3OPP A;  3HRE A;  2WAD A;  1JWV A;  1L0D A;  5CRF A;  1W8Q A;  3A3E A;  3BFF A;  3TG9 A;  3B3X A;  2WKI A;  1BLH A;  3VOZ A;  1AXB A;  3UDX A;  4RX3 A;  4BQM A;  5CGW A;  3IWQ A;  3SS3 A;  1BUL A;  2XD1 A;  1JVJ A;  1W5D A;  2FFY A;  1KVM A;  4KQR A;  2XK1 A;  2XQZ A;  2JBF A;  1DY6 A;  2FFF B;  3LY4 A;  2VGK A;  3OPH A;  4YIN A;  4PMA A;  5BOH A;  4S2I A;  1M6K A;  2EXA A;  2ZC4 B;  4QJG A;  1ERO A;  5TR7 A;  5CHU A;  4K91 A;  2Y55 A;  4QY5 A;  3ZNY A;  2QMI A;  1QMF A;  1ERQ A;  2WK0 A;  3O87 A;  3RJU A;  2ZM8 A;  2RL3 A;  3Q81 A;  1ONH A;  3BEB A;  4OVD A;  3WRZ A;  2IWD A;  5FAT A;  5A90 A;  4LCL A;  4KEN B;  3DWZ A;  3G2Z A;  2J7V A;  4DE2 A;  5HFO A;  2WGV A;  1TDG A;  2ZQ8 A;  5JYP A;  3HLD A;  1XP4 A;  1TVF A;  1QME A;  2A3U A;  3BLS A;  5A91 A;  3VFF A;  1FCO A;  2P9V B;  1PZP A;  1ESI A;  3CMZ A;  1BLC A;  4OP5 A;  4C3Q A;  4E3N A;  3HUN A;  4OH0 A;  2EX8 A;  5DTK A;  2BLS A;  2Y2L A;  2ZQA A;  3GTC A;  4Y0O A;  5E43 A;  3GV9 A;  5M18 A;  3G2Y A;  4ZJ3 A;  3UPN A;  2G2U A;  2ZLY A;  3N8L A;  4QY6 A;  4E3L A;  1KDS A;  1S6R A;  5U47 A;  2XDM A;  4GB7 A;  4E6X A;  1G6A A;  3HLW A;  2WZX A;  3C4P A;  3M2K A;  3N8R A;  2HDQ A;  3ZCZ A;  3VP3 A;  3PBR A;  1TEM A;  1LI0 A;  3UDF A;  5DTT A;  4DRT A;  1GA0 A;  1O07 A;  2ZD8 A;  3JYI A;  4JKT A;  1NYY A;  4OQI A;  3ZHH A;  3C7V A;  3IXG A;  5FQI A;  3OPL A;  1IYP A;  4N1H A;  2CC1 A;  2XFT A;  4X55 A;  3S4X A;  4HBT A;  3NI9 A;  4KG5 A;  1NRF A;  3G4P A;  5CHJ A;  1ESU A;  3MFD A;  1CEF A;  4UAA A;  5EOE A;  3ZVT A;  4A5R A;  2WZZ A;  4R23 A;  1H8Y A;  4S2M A;  4B4X A;  5AQ9 A;  2Y2I A;  3ZGA B;  1DJA A;  4FCF A;  1MPL A;  4X68 A;  1KE3 A;  3IQA A;  4DE3 A;  3P98 A;  3AGF A;  5F1F A;  5GHY A;  1NY0 A;  3BFD A;  1RP5 A;  4KZB A;  1LI9 A;  4KZ7 A;  3WWX A;  3C4O A;  2ZQD A;  3LEZ A;  3UNW A;  4DDY A;  2J9O A;  4OPZ A;  4DXB A;  3OC2 A;  3AGE A;  4RVA A;  1VQQ A;  3OCN A;  4OPY A;  3DWK A;  3G34 A;  4WZ5 C;  3PBO A;  4Y7P A;  1NZU A;  3W8K A;  5F82 A;  3G35 A;  1K38 A;  4RX2 A;  3FWL A;  1GHM A;  4GD6 A;  5JYO A;  2R9W A;  1K54 A;  3C5A A;  3DW0 A;  4MBK A;  4OQH A;  1BSG A;  3IXD A;  3Q07 A;  4OQG A;  1KVL A;  3V3R A;  4DKI A;  3M2J A;  3VP4 A;  3WS4 A;  3GSG A;  4X69 A;  5GLB A;  1LL9 A;  5FQ9 A;  4KZ5 A;  1YT4 A;  4DXC A;  3OPR A;  3MZF A;  4EBP A;  3HVF A;  1K55 C;  2HP5 A;  2E8I A;  1PWG A;  3UE0 A;  3DTM A;  5EVI B;  1YMS A;  4U3T A;  3GRJ A;  3OCL A;  2XD5 A;  2OV5 A;  3PAE A;  4R0Q A;  4E3K A;  4WZ4 A;  3MZD A;  2EX9 A;  4HEF A;  2ZC3 B;  3Q7V A;  2JC7 A;  3GVB A;  3SH7 A;  5L2F A;  4RYE A;  3SH8 A;  3LCE A;  4DF6 A;  1L0F A;  3IF6 A;  4OOM A;  5E2E A;  1BT5 A;  1SCW A;  3VMA A;  4X6T A;  4XUX A;  5FAP A;  3NIA A;  2EXB A;  3BFG A;  4X56 A;  4OP8 A;  3VP1 A;  2V1Z A;  3HLG A;  4UA9 A;  4WBG A;  5DTS A;  4D2O A;  3CG5 A;  2H0T A;  4LEN A;  3MXR A;  3QNC A;  2C5W B;  5EOO A;  3IXB A;  4KZ6 A;  3VFH A;  3N7W A;  4BD0 A;  4IVK A;  4GZB A;  4MLL A;  1IYO A;  3O86 A;  4R4R A;  5D3O A;  3IT9 A;  3WRT A;  2HPB A;  4QB8 A;  3RXW A;  3QHY A;  1ZC2 A;  1BLP A;  3C7U A;  4N1X A;  4QHC A;  5E2F A;  3ZVW A;  3SS5 A;  5IHV A;  5GHX A;  3G31 A;  4MNR A;  2Y2P A;  1IKG A;  1LLB A;  2Y2N A;  4ID4 A;  1PW8 A;  1XGJ A;  1PI4 A;  3IH9 A;  3PBN A;  4OOY A;  4CJN A;  4S2K A;  1L0E A;  4N9K A;  1JWP A;  1GHP A;  2XFS A;  3BYD A;  4OON A;  4XUZ A;  5CED A;  3S22 A;  1KE0 A;  3A3I A;  3HLF A;  5FQJ A;  3UPP A;  3MXS A;  5AQB A;  3BM6 A;  2WKH A;  4BJP A;  2X02 A;  1XA1 A;  1YLZ A;  3PAG A;  5FAQ A;  5GLC A;  2ZQ7 A;  1FR6 A;  3UE3 A;  2H5S A;  1KGG A;  2Z2M B;  4GN2 A;  4YFM A;  4S2J A;  4P87 A;  5TGF A;  4B88 A;  4JPM A;  4KZA A;  4R3B A;  3UN7 A;  4XXR A;  1Q2P A;  5G18 A;  3MKF A;  2GDN A;  4MBF A;  4X53 A;  2Y2O A;  4U0T A;  1ZKJ A;  1Z6F A;  1BTL A;  1WYC A;  4WEK A;  4ZAM A;  4Q8I A;  3NDG A;  4IBX A;  5EPH A;  3TSG A;  1WYB A;  2PU4 A;  1BZA A;  4GDN A;  1K4F A;  1FCM A;  4KZ9 A;  5HAQ A;  4OLD A;  4EUZ A;  4F94 A;  4QD4 A;  2DCF A;  1HVB A;  1ES3 A;  2PBY A;  2Q9M A;  2XGN A;  3ZNT A;  4DE0 A;  4E3M A;  1K57 C;  5FI6 A;  1SHV A;  4OOL A;  3A3D A;  4S2N C;  1KE4 A;  1I2W A;  3V3S A;  4ZDX A;  4BLM A;  1YM1 A;  3M6B A;  4EWF A;  2HP9 A;  2VGJ A;  2Q9N A;  2XLN A;  1CI9 A;  1U60 A;  3S1Y A;  4JXV A;  3VSK A;  4LCM A;  5FI7 A;  1OME A;  3GMW A;  4C75 A;  1FOF A;  1Q2Q A;  2EX6 A;  4FH4 A;  4UA6 A;  3ZG9 B;  3O88 A;  1JWZ A;  4HES A;  1E25 A;  1FCN A;  5GLD A;  5I94 A;  1N4O A;  1HTZ A;  1SKF A;  3UDI A;  3W4P A;  1NJ4 A;  3N6I A;  3P09 A;  1YLP A;  4IED A;  1L0G A;  3IHB A;  4IVI A;  3ZG5 A;  1H8Z A;  1PWC A;  4JXW A;  1GCE A;  3PBQ A;  1L2S A;  2Y91 A;  4DDS A;  4R3J A;  4NET A;  4ZJ1 A;  2EX2 A;  3MZE A;  1XX2 A;  2X71 A;  4OKP A;  1I2S A;  1C3B A;  2DNS A;  3ISG A;  3Q1F A;  4WZ5 A;  3WS0 A;  4N9L A;  2WGW A;  4NK3 A;  5EVI C;  1M40 A;  4E6W A;  5J8X A;  3E2K A;  1ES2 A;  3SS4 A;  4ZBE A;  3ZFZ A;  2ZJ9 A;  1G68 A;  5HAP A;  3A3J A;  3CJM A;  3MKE A;  5KZH A;  2WAF A;  3IXH A;  3VSL A;  1BLS A;  2EFU A;  1CEG A;  1RGZ A;  3M6H A;  4JBF A;  4O7D A;  5HX9 A;  2Y2J A;  2V2F F;  4M3K A;  4UHU A;  1K55 A;  4LV0 A;  3QNB A;  1ZG6 A;  3NY4 A;  1RGY A;  1YLW A;  1IKI A;  2ZQ9 A;  3BFC A;  1N9B A;  1TDL A;  2ZC6 B;  1LHY A;  4GNU A;  2UWX A;  3GR2 A;  2HDR A;  4EBN A;  1E4D A;  4PM5 A;  4JXG A;  3ZG0 A;  4JXS A;  4JF4 A;  3N4I A;  1PYY A;  3AGD A;  3FZC A;  3WS1 A;  4BEN A;  1MXO A;  1LL5 A;  1NXY A;  4LV3 A;  1IYQ A;  3WS2 A;  2R9X A;  3PTE A;  5KMW A;  3BRM A;  1NZO A;  3NCK A;  3HUO A;  1FQG A;  3ITB A;  4QU3 A;  3HLC A;  4OPQ A;  3NBL A;  1PI5 A;  5CHM A;  4EBL A;  3HL9 A;  1EWZ A;  3VOY A;  5F83 A;  3LY3 A;  1HD8 A;  4PM9 A;  2QZ6 A;  4MBH A;  4HBU A; 
#chains in the Genus database with same CATH topology
 5FA7 A;  2G2W A;  3F1O A;  2ZQC A;  2DRW A;  1V9Z A;  2V0U A;  5CTM A;  4F94 A;  1ES4 A;  1SDE A;  3FV7 A;  1EW0 A;  1CK3 A;  2Y2H A;  1CI8 A;  4WMC A;  5HL1 A;  1XFQ A;  3Q7V B;  1YLY A;  2BG1 A;  1I5Q A;  3LYX A;  1YLJ A;  4B93 A;  3IF6 B;  2X01 A;  2HF6 A;  2PBD P;  3F1P A;  4S2L A;  4R1G A;  5CGS A;  5EV0 A;  2XR0 A;  4I38 A;  5CGX A;  3EQV A;  2LB5 A;  5DF9 A;  3CPT A;  4JLF A;  1YQS A;  4JGQ A;  2Y2K A;  3FKV A;  1W8Y A;  5KSH A;  1XFN A;  3D4F A;  3V39 A;  2JHE A;  3HLE A;  2OLU A;  2CMN A;  1SDN A;  2HDS A;  2ZC5 B;  1EI5 A;  1PIO A;  1K56 D;  1KOU A;  1G6O A;  2JKR M;  2Y8H A;  5HSQ A;  2Y2Q A;  3HUM A;  4E3J A;  4Y0T A;  2W3H A;  5HWW A;  4IUH A;  5L8M A;  3SOI A;  1VB6 A;  2QWS A;  2V9A A;  2B95 A;  3ZDJ A;  1P9W A;  1IYS A;  5FAS A;  4P6B A;  1TS7 A;  5HDS A;  2WAE A;  3JVV A;  3C30 A;  1XXM A;  3T4Q A;  1MKM A;  1ERM A;  2VV6 A;  4BBT A;  4K0X A;  1ACF A;  3MQO A;  2C6W B;  4JF6 A;  1K54 C;  1XPB A;  2IWB A;  4KZ8 A;  1S0W A;  4PPR A;  5AQ7 A;  2WYX A;  1MWT A;  1MBL A;  2WGW B;  4UA7 A;  5HDC A;  1OTD A;  4PM7 A;  4ETZ A;  4IBR A;  5HAI A;  4WM9 A;  1NYM A;  1MZU A;  2WUQ A;  2VGL S;  1Y54 A;  3CZD A;  5HW3 A;  4P6Z S;  2XEP A;  4CLC D;  3OPP A;  4HY8 A;  3HRE A;  2W1T B;  2WAD A;  1JWV A;  4EXO A;  1W8Q A;  2WKI A;  4X1M A;  4RX3 A;  1BUL A;  4ZRR A;  5FEF A;  1LT0 A;  5F69 A;  3LR0 A;  2JKR I;  2XQZ A;  2W3F A;  4PMA A;  1M6K A;  5CHU A;  3RJU A;  2ZM8 A;  3Q81 A;  1ONH A;  3WRZ A;  2IWD A;  2OAP 1;  2ZQ8 A;  4MN7 A;  1YSP A;  1BLC A;  5KIZ A;  1OT6 A;  4C3Q A;  5DTK A;  2QHK A;  2Y2L A;  3GV9 A;  2J3T C;  4WLA A;  3MR0 A;  2GZA A;  2G2U A;  4QY6 A;  3DBA A;  3LID A;  1G6A A;  2WZX A;  2HDQ A;  1TEM A;  1LI0 A;  3UDF A;  4JGP A;  4DRT A;  1GA0 A;  1O07 A;  2ZD8 A;  4OQI A;  1YSQ A;  3ZHH A;  3C7V A;  5FQI A;  5J3W A;  1IYP A;  4HBT A;  2W3E A;  3UB7 A;  1ESU A;  3ZVT A;  1DP9 A;  1H8Y A;  5AQ9 A;  2Y2I A;  1DJA A;  4FCF A;  1BYW A;  2O9A A;  3C8C A;  4DE3 A;  3AGF A;  5GHY A;  1NY0 A;  4KZB A;  3C4O A;  4DDY A;  2XA7 M;  3QP2 A;  4OPZ A;  4RVA A;  1VQQ A;  3LR3 A;  5F82 A;  3G35 A;  3FWL A;  4GD6 A;  5JYO A;  4EQ1 A;  4MBK A;  2B02 A;  3V3R A;  4DKI A;  3GSG A;  3MF0 A;  1OTB A;  3DAV A;  2VLG A;  2ZBB A;  4PKY G;  5FQ9 A;  3LUQ A;  3DTM A;  4O0P A;  4CLC B;  3GRJ A;  2OV5 A;  3PAE A;  4E3K A;  1YKD A;  3MZD A;  2EX9 A;  3DTI A;  1NRJ A;  2ZC3 B;  1L0F A;  1BT5 A;  4ESP A;  3HLG A;  5FDS A;  4WBG A;  5DTS A;  3D9Y A;  2H0T A;  4NKP A;  3MXR A;  5EOO A;  4KZ6 A;  3N7W A;  1Y4O A;  3CUE A;  4MLL A;  3LIA A;  2HPB A;  1BLP A;  3C7U A;  5IHV A;  5GHX A;  3FPW A;  1XGJ A;  3PBN A;  4HOI A;  1FIK A;  3BYD A;  4DJ2 A;  1TS0 A;  3A3I A;  4HJ4 A;  5FQJ A;  3MJQ A;  3UPP A;  3MXS A;  5AQB A;  3IX3 A;  2WKH A;  5F68 A;  4QWO A;  2H5S A;  4I3A A;  3ICY A;  4GLQ A;  4L9F A;  3BWL A;  2GDN A;  4U0T A;  1BTL A;  2AVX A;  1AWI A;  2W1R A;  3TSG A;  1WYB A;  2PU4 A;  1BZA A;  4GDN A;  1JNU A;  3QP5 A;  5HAQ A;  4EUZ A;  4HJ3 A;  2DCF A;  1Y28 A;  3PYP A;  4OOL A;  3A3D A;  4R3A A;  1I2W A;  2JKT I;  4BLM A;  3M6B A;  4EWF A;  2VGJ A;  2XLN A;  1CI9 A;  2W3G A;  3CAX A;  4HIA A;  4JXV A;  3VSK A;  1IOU A;  3K3D A;  1JWZ A;  1SKF A;  1NJ4 A;  3P09 A;  1YLP A;  1L0G A;  3IHB A;  1H8Z A;  3T4J A;  3PBQ A;  4HP9 A;  4ZJ1 A;  3MZE A;  4OKP A;  1SKO A;  3SW1 A;  2PT7 A;  4WZ5 A;  4NK3 A;  1M40 A;  2QYB A;  2J3T D;  3E2K A;  3H9W A;  2GJ3 A;  2WAF A;  2EFU A;  1HLU P;  3SZT A;  4M3K A;  3FG8 A;  1IKI A;  2ZC6 B;  1D06 A;  2HDR A;  4EBN A;  3ZQ5 A;  3ZG0 A;  1PYY A;  2HJE A;  1NXY A;  2HZ5 A;  2R9X A;  3BRM A;  3HUO A;  3ITB A;  3NUL A;  1PI5 A;  3HL9 A;  1EWZ A;  2KOI A;  4KG2 A;  1XA7 A;  2HJ9 C;  4MEZ A;  5GLA A;  3ZG7 B;  3T1Q B;  4WL9 A;  3A3F A;  3W4O A;  3O3V A;  2OWJ A;  4BL2 A;  1BUE A;  3C2W A;  1ES5 A;  3IHA A;  3PBT A;  4OLG A;  3RFB A;  2P04 A;  4CPK A;  1K25 A;  3V50 A;  3UE1 A;  5TBM A;  4HP4 A;  1DP6 A;  1KGF A;  4ZJ2 A;  4O8G A;  3BQA A;  3MXQ A;  4HI4 A;  4MCW A;  3EQU A;  3D72 A;  3F1N A;  5CER A;  1XKZ A;  3E0Y A;  2PHY A;  2HGV A;  1W63 Q;  1XJ2 A;  2M7U A;  1D1J A;  4WUJ A;  5CTN A;  3TRC A;  4WMC D;  5DF8 A;  4Z9Q A;  3S7P A;  3T50 A;  1K57 A;  2B5R A;  4EQI A;  1W79 A;  1YLT A;  2EWV A;  4WYY A;  4OQ0 A;  4XT2 B;  4PM6 A;  4UQI M;  2ZMF A;  4E3I A;  4B9O A;  4Y15 A;  2Q0O A;  3A0R A;  5I5L A;  3BY9 A;  2J8Y A;  3T1S A;  5TFQ A;  4BL3 A;  3V5M A;  1E3U A;  2P74 A;  5FQQ A;  5E2G A;  2VX8 A;  1VEU B;  3MQ0 A;  4U0X A;  1O7E A;  2ZOH A;  1VET B;  4BMW A;  3ITA A;  1FR1 A;  3I7J A;  1L3L A;  3BEC A;  5F1G A;  3Q7Z A;  1FSW A;  2J3W A;  3T4L A;  4DE1 A;  3VOL A;  4Q0I A;  4ETX A;  1SZV A;  1NLZ A;  1JTD A;  1KGE A;  2L1M A;  1OTE A;  1PW1 A;  1RCJ A;  2JCH A;  4N92 A;  1N9O A;  3SH9 A;  5FDH A;  3VV4 A;  2K2N A;  4GHI A;  3T4S A;  2QJ7 A;  3UE6 A;  1PRQ A;  1IEL A;  2EA9 A;  3BFF A;  5DKK A;  3PHY A;  3VOZ A;  3CUE C;  5CGW A;  2O0Y A;  3LI9 A;  1F2K A;  2O9C A;  2XK1 A;  2J80 A;  2JBF A;  1DY6 A;  5L10 A;  3UMD A;  4S2I A;  3F1O B;  2EXA A;  5TR7 A;  5J4E A;  3ZNY A;  1ERQ A;  1IFQ A;  3KO6 A;  3NOU C;  4OVD A;  5FAT A;  4LPZ A;  3DWZ A;  2J7V A;  5F6A A;  2WGV A;  3HLD A;  1XP4 A;  3KX0 X;  3VFF A;  3F1P B;  1FCO A;  5HWT A;  3VE3 A;  1ESI A;  3NOP C;  4E3N A;  2KDK A;  1NLY A;  4OH0 A;  1CJF A;  2EX8 A;  3GTC A;  3G2Y A;  1F5M A;  2K7S A;  2ZLY A;  4E3L A;  2V8F A;  1S6R A;  2V1A A;  2XDM A;  4GB7 A;  3CPT B;  3N8R A;  3ZCZ A;  2YKH A;  5DTT A;  3JYI A;  4JKT A;  4MMN A;  4II7 A;  4X55 A;  3NI9 A;  1NRF A;  5EOE A;  1CEF A;  4A5R A;  4X68 A;  1KE3 A;  3P98 A;  3NEC A;  3BFD A;  1RP5 A;  4KZ7 A;  4EW7 A;  2J9O A;  3LIF A;  3OCN A;  4QPR A;  4WZ5 C;  3PBO A;  4Y7P A;  1NZU A;  3W8K A;  2PD8 A;  1K38 A;  1GHM A;  4HJ6 A;  3C5A A;  4OQH A;  4LGW A;  3NHQ A;  3ULF A;  5GLB A;  1F98 A;  2QJ5 A;  4KZ5 A;  1YT4 A;  3MSH A;  3ZYT A;  2E8I A;  4LRX C;  3KYQ A;  4U3T A;  3OCL A;  2XD5 A;  4R0Q A;  3U2A A;  2IA2 A;  3HJK A;  4FOF A;  2A24 A;  5L2F A;  2L4R A;  3LCE A;  4DF6 A;  3T4O A;  1SCW A;  4XUX A;  3NIA A;  2BAS A;  3BFG A;  3IX8 A;  2V1Z A;  4D2O A;  4MN6 A;  2PAV P;  4O01 A;  4G3V A;  2EWW A;  3IXB A;  3VFH A;  4H6J A;  4BD0 A;  3O86 A;  4R4R A;  3P7N A;  4QB8 A;  3KSF A;  1ZC2 A;  4MNR A;  1IKG A;  2Y2N A;  1PW8 A;  3IH9 A;  2R78 A;  1S1Z A;  2PYP A;  4EET B;  2X02 A;  1XA1 A;  1FR6 A;  3U4L P;  4YWZ A;  1KGG A;  2Z2M B;  4YFM A;  4S2J A;  4JPM A;  4KUK A;  4YNR A;  1OJG A;  1Q2P A;  4MBF A;  4PHT A;  1ZKJ A;  2W3D A;  3FC7 A;  1WYC A;  4ZAM A;  4Q8I A;  1FCM A;  4KZ9 A;  4OLD A;  1OPX A;  2VEA A;  1Z09 A;  1HVB A;  2PBY A;  4L9G A;  1K57 C;  1SHV A;  1S4R A;  2Q9N A;  4LCM A;  4LLO B;  3BJN A;  3D3O A;  3MMH A;  1FOF A;  4EUV A;  4RQ9 A;  3ZG9 B;  4LRY C;  1V9Y A;  2ZL1 A;  2FH5 A;  5I94 A;  1H8M A;  1HTZ A;  3H82 A;  3UDI A;  5EM0 A;  4PAU A;  4IVI A;  4FUW A;  1GCE A;  1L2S A;  3T1R A;  2PR6 A;  4R3J A;  2X71 A;  3Q1F A;  2V0W A;  1NWZ A;  4N9L A;  4EEU A;  1H0M A;  3ZFZ A;  3GEC A;  3UB8 A;  2JKT M;  1OT9 A;  5HAP A;  3CJM A;  2VGL M;  5DKL A;  5KZH A;  1TS6 A;  1CEG A;  3M6H A;  4O7D A;  4P6Z M;  5HX9 A;  2MJ6 A;  4LV0 A;  1ZG6 A;  1RGY A;  2ZQ9 A;  1N9B A;  1LHY A;  2UWX A;  4WN5 A;  4HNB A;  5MC7 A;  3N4I A;  3WS1 A;  5KMW A;  4LV3 A;  3WS2 A;  4QU3 A;  1NZO A;  2JKG A;  4OPQ A;  3NBL A;  3VOY A;  4FTX A;  5G4Y A;  4HBU A;  3UY6 A;  1S67 L;  4DMZ A;  3Q82 A;  2I72 A;  4EV4 A;  2I9V A;  4GD8 A;  4JF5 A;  2ZM2 A;  2ZMA A;  1DJB A;  2JE5 A;  4PM8 A;  5DFX A;  5DF7 A;  1N9N A;  3GDI A;  4GCZ A;  4WEL A;  1VHM A;  2Z2L B;  2P08 A;  2XF3 A;  3NC8 A;  5GHZ A;  3KSG A;  2WKE A;  3FKW A;  2P9V A;  1J3W A;  4GOG A;  3KYE A;  3L9K A;  4L0L A;  4Y2F A;  3HBR A;  1A0K A;  3PBS A;  4KZ4 A;  3CLO A;  1PZO A;  5DJU A;  4WEJ A;  5DJT A;  3H7W A;  1XJ3 A;  3FPV A;  3G32 A;  3IWO A;  4MN5 A;  3EEA A;  5CXW A;  5GL9 A;  1ODV A;  4EU0 A;  4DJ3 A;  4YOF A;  2W27 A;  3IX4 A;  3GQZ A;  4FH2 A;  2NUP C;  2ZOI A;  1MY8 A;  4E3O A;  4S2N A;  5AQA A;  3BLM A;  5FSR A;  2IWC A;  2V1B A;  3RTY A;  4BD1 A;  1K6S A;  4X25 A;  3S7Q A;  4FSF A;  5CEC A;  2OLV A;  4EES A;  1MWU A;  2Y2G A;  2HV1 A;  4G3K A;  2ZC7 A;  2PD7 A;  3EGX C;  2QPN A;  3CIT A;  4I3J A;  4ARZ A;  4C6Y A;  5EVI A;  4BBV A;  4S2O A;  1G28 A;  4KG6 A;  5FI2 A;  3LFV A;  3UB5 P;  1GHI A;  3E2L A;  5TJJ A;  4PKY A;  1SKO B;  3C38 A;  3K2N A;  1MKI A;  4KUO A;  2HDU A;  3UPO A;  3S7N A;  3NJA A;  4NXB A;  4HH3 A;  1E3U D;  3LGO A;  1JTG A;  4LFU A;  2J9P A;  4S2P A;  4GS9 A;  3QP6 A;  1UWN X;  3FYZ A;  3JVU A;  5DVA A;  3BW6 A;  1T1A A;  1S66 L;  3SS3 A;  1JVJ A;  1W5D A;  1KVM A;  2VGK A;  5BOH A;  3T12 B;  4F3L A;  2FZ0 A;  4QJG A;  4I5S A;  4K91 A;  2Y55 A;  4QY5 A;  2WK0 A;  1QMF A;  1T18 A;  1H3Q A;  5A90 A;  4LCL A;  4KEN B;  2VK3 A;  4DE2 A;  5HFO A;  2B18 A;  1TVF A;  3T4T A;  1QME A;  3BLS A;  2YKF A;  5A91 A;  1CF0 A;  1PZP A;  3CMZ A;  4OP5 A;  4CLC E;  3HUN A;  5TBM B;  2BLS A;  2ZQA A;  5M18 A;  3IBR A;  2A2L A;  3O5Y A;  5IU1 A;  1T19 A;  4E04 A;  3N8L A;  3B33 A;  3F1N B;  4NXE A;  3IS2 A;  3HLW A;  4NEE D;  3C4P A;  3VP3 A;  3PBR A;  2DMW A;  5IT5 A;  3P01 A;  1NYY A;  4JGR A;  4N1H A;  2XFT A;  3S4X A;  3E98 A;  4KG5 A;  3G4P A;  5CHJ A;  4UAA A;  4B4X A;  2WZZ A;  4S2M A;  1MPL A;  3IQA A;  3CHW P;  1LSV A;  1ZTU A;  3WWX A;  1LI9 A;  4D60 A;  4Q0H A;  3UNW A;  2WKR A;  1TD5 A;  3OC2 A;  3AGE A;  4HHD A;  2R9W A;  3DW0 A;  1BSG A;  2LB9 A;  4OQG A;  3A0V A;  4I3I A;  2WKP A;  3M2J A;  3LIB A;  1LL9 A;  3OPR A;  3MZF A;  2QKP A;  1PWG A;  3HJI A;  1YMS A;  4Y5F A;  3T4K A;  3S7O A;  1LSX A;  3R4K A;  4HEF A;  3Q7V A;  3GVB A;  3SH8 A;  3IF6 A;  5E2E A;  5FAP A;  2EXB A;  4OP8 A;  4UA9 A;  1OTI A;  1K0K A;  3QNC A;  2P7J A;  5D3O A;  2GX5 A;  3IT9 A;  3WRT A;  2Z6C A;  1P9R A;  4GHI B;  2JKF A;  3G31 A;  2Y2P A;  1LLB A;  1PI4 A;  4I39 A;  4OOY A;  1L0E A;  5HWV A;  2XFS A;  1GHP A;  4OON A;  5CED A;  2D01 A;  2XSS A;  3QP1 A;  4BJP A;  1YLZ A;  3PAG A;  4NG2 A;  2ZQ7 A;  2W0N A;  3UE3 A;  4R6L A;  5TGF A;  2O9B A;  4X53 A;  2Y2O A;  5LBR A;  5DFY A;  4WEK A;  5EFW A;  4GW9 A;  4IBX A;  1TS8 A;  5AVF A;  1CQA A;  2KLI A;  2XGN A;  3ZNT A;  4DE0 A;  4E3M A;  1PFL A;  5FI6 A;  5HL6 A;  4S2N C;  1KE4 A;  4ZDX A;  2BTF P;  3K3C A;  2VV7 A;  1U60 A;  3S1Y A;  4C75 A;  5FI7 A;  3GMW A;  1Q2Q A;  4FH4 A;  1W63 M;  4HES A;  4UEY A;  5GLD A;  5HD5 A;  3W4P A;  3N6I A;  3TE8 A;  1XJ6 A;  2M7V A;  1DRM A;  2L0W A;  4NXF A;  4NET A;  2EX2 A;  1I2S A;  1C3B A;  2WGW A;  5EVI C;  4R38 A;  5J8X A;  2VKS A;  4LRZ E;  1ES2 A;  3SS4 A;  4ZBE A;  2ZJ9 A;  3V67 A;  3A3J A;  2V8C A;  3VSL A;  4JBF A;  1RGZ A;  1X0O A;  1P97 A;  4UHU A;  1K55 A;  3UME A;  3QNB A;  3NY4 A;  4L9E A;  1YPR A;  1TDL A;  1UWP X;  2W1T A;  4PM5 A;  4JXS A;  4JF4 A;  4BEN A;  3AGD A;  3FZC A;  1MXO A;  2XA7 S;  1IYQ A;  1FQG A;  3HLC A;  5CHM A;  1PNE A;  4PM9 A;  2UV0 E;  2QZ6 A;  1D7E A;  2A49 A;  3TW8 A;  4P0M A;  4GJ4 A;  4P85 A;  1ONG A;  1FSY A;  1TF1 A;  3OOV A;  1KDW A;  2H10 A;  2EFX A;  1YMX A;  1OTA A;  2Y2M A;  4H8R A;  1ZG4 A;  2JN7 A;  3BQ8 A;  1K56 A;  3OZH A;  4KQQ A;  2A24 B;  1VM1 A;  1GSX A;  4RA7 A;  2PU2 A;  3TJZ C;  4Y3I A;  3WS5 A;  5A92 A;  1K4E A;  3UB6 A;  3QP8 A;  2XH9 A;  1J9M A;  3BFE A;  1T1B A;  2Y4A A;  4LV1 A;  5AVE A;  5A93 A;  4H6J B;  5E2H A;  3W4Q A;  1WA9 A;  5C5K A;  2HP6 A;  3NDE A;  1FIL A;  1ALQ A;  2OOL A;  5M19 A;  1LL8 A;  2K31 A;  1P0Z A;  4Z1W A;  5CEB A;  4B4Z A;  5FAO A;  4BWI A;  3OBF A;  2NUT C;  4AFI A;  3LEQ A;  5HAR A;  5EVL A;  1PWD A;  1GSV A;  2O99 A;  4IHQ A;  2M1C A;  5L07 A;  4M4X A;  1IEM A;  5EVE A;  4WF0 A;  3VP2 A;  2ZM0 A;  4BBU A;  1MWR A;  3UB9 A;  1WE4 A;  2E8J A;  2OWH A;  1DJC A;  4IJG A;  4R4S A;  4Y0U A;  3LIE A;  2VV8 A;  2RCX A;  3LO7 A;  1MWS A;  2Y59 A;  3IWI A;  3IF5 A;  1H5X A;  3MBZ A;  3UO9 A;  4R70 A;  2XRO A;  2OAQ 1;  4JGO A;  1HZO A;  4GKU A;  5EM1 A;  3MFX A;  1MC0 A;  5FQK A;  1W7F A;  2PRF A;  5FL3 A;  5G4Z A;  4CLC A;  5EUA A;  3EEH A;  2WGI A;  5FQM A;  2ZL1 B;  3HLB A;  1N9L A;  2Y79 A;  5CX7 A;  3H82 B;  3EGD C;  4K0W A;  2H0Y A;  4FD8 A;  1GA9 A;  4OPR A;  3G30 A;  3RXX A;  4IUK A;  4X1L A;  1S4S A;  5EE8 A;  2V20 A;  3N8S A;  2PR5 A;  3TOI A;  3IH8 A;  3KSH A;  3VP0 A;  3L7H A;  4KZ3 A;  2ACG A;  4ZTK A;  5M1A A;  4Y17 A;  4KQO A;  1XGI A;  4LV2 A;  3OLO A;  3IF6 C;  5IS1 A;  3CI6 A;  2INW A;  3PR6 A;  2OSU A;  4NXG A;  5KSC A;  3E4P A;  1K6R A;  4GDB A;  5EEC A;  4EER A;  5EVI D;  1L0D A;  5CRF A;  3A3E A;  3B47 A;  3TG9 A;  5HPI A;  3B3X A;  1BLH A;  1AXB A;  3UDX A;  4BQM A;  3IWQ A;  2XD1 A;  2FFY A;  4KQR A;  3LR5 A;  2H28 A;  3LY4 A;  4KQD A;  2FFF B;  3OPH A;  4YIN A;  2ZC4 B;  1ERO A;  2QMI A;  3O87 A;  2RL3 A;  1GSW A;  3BEB A;  3A0S A;  3G2Z A;  1TDG A;  5JYP A;  2A3U A;  1DP8 A;  1S1Y A;  2P9V B;  1ZHH B;  5A8B A;  5FEG A;  4CQH A;  3NOT C;  4Y0O A;  5E43 A;  4ME4 A;  4ZJ3 A;  3UPN A;  1KDS A;  5U47 A;  4E6X A;  3M2K A;  3H7W B;  3IXG A;  3OPL A;  4Y13 A;  2CC1 A;  5K5B A;  3PXP A;  3BY8 A;  3MFD A;  4R23 A;  1UGU A;  1OJ5 A;  3ZGA B;  2ZMV A;  2WKQ A;  3LI8 A;  5F1F A;  3DTE A;  3G6O A;  2PDR A;  2ZQD A;  3LEZ A;  4DXB A;  4OPY A;  3EWK A;  3DWK A;  3G34 A;  4RX2 A;  3HCY A;  1K54 A;  4UQI S;  3IXD A;  3Q07 A;  1KVL A;  3VP4 A;  4G3W A;  3WS4 A;  4X69 A;  3VE4 A;  1XJ4 A;  4DXC A;  3QP4 A;  4EBP A;  3HVF A;  1K55 C;  2HP5 A;  3UE0 A;  4HQA A;  4ARZ B;  5EVI B;  1STZ A;  5HPF A;  4WZ4 A;  2Z6D A;  5F5Y A;  3IBJ A;  2VZW A;  4Q0J A;  3KSI A;  2JC7 A;  3SH7 A;  2G7U A;  4RYE A;  3MQQ A;  4OOM A;  3VMA A;  4X6T A;  4X56 A;  3MS6 A;  3VP1 A;  3CG5 A;  3LIC A;  4LEN A;  5AJG A;  2C5W B;  4IVK A;  4GZB A;  1IYO A;  1YAX A;  3EOI A;  3RXW A;  2VJW A;  3CWF A;  3E4Q A;  3QHY A;  1T1C A;  4N1X A;  4QHC A;  5E2F A;  3ZVW A;  5HZH A;  3SS5 A;  4GS9 B;  4ID4 A;  4HH2 A;  3W2Z A;  4CJN A;  4S2K A;  4N9K A;  1JWP A;  3DTK A;  3LR4 A;  4K08 A;  3E4O A;  4XUZ A;  2KX6 A;  3S22 A;  1KE0 A;  3HLF A;  3BM6 A;  5GLC A;  5FAQ A;  4GN2 A;  4P87 A;  4F3L B;  4B88 A;  4KZA A;  4R3B A;  3UN7 A;  4XXR A;  5G18 A;  4XT2 A;  3MKF A;  1LSW A;  4EEP A;  1Z6F A;  2VA0 A;  3JPU A;  3NDG A;  5EPH A;  1K4F A;  4QD4 A;  1ES3 A;  1G5U A;  2Q9M A;  1F9I A;  5HD3 A;  3V3S A;  1YM1 A;  2PYR A;  3R7W A;  1VEU A;  2HP9 A;  2XRN A;  1VET A;  1OME A;  4UA6 A;  2EX6 A;  3O88 A;  2GNX A;  1E25 A;  1FCN A;  1N4O A;  3IS2 B;  5L09 A;  4IED A;  4MDZ A;  3ZG5 A;  1PWC A;  4JXW A;  5HDD A;  3T1X A;  3KYZ A;  2Y91 A;  4DDS A;  1XX2 A;  3ISG A;  2DNS A;  3WS0 A;  3RH8 B;  4CLC C;  4E6W A;  3R7W B;  1G68 A;  3MKE A;  3IXH A;  2D02 A;  1BLS A;  2Y2J A;  2V2F F;  1YLW A;  3BFC A;  5J7E A;  4GNU A;  3GR2 A;  4DN0 A;  1E4D A;  4JXG A;  1LL5 A;  3PTE A;  3NCK A;  4EBL A;  3B42 A;  5F83 A;  3LY3 A;  1HD8 A;  3ZG8 B;  4MBH A; 
#chains in the Genus database with same CATH homology
 4KG2 A;  2A49 A;  5FA7 A;  2G2W A;  3UY6 A;  2ZQC A;  4P0M A;  2DRW A;  1XA7 A;  5CTM A;  3Q82 A;  4MEZ A;  1ES4 A;  1SDE A;  2I72 A;  4P85 A;  1ONG A;  5GLA A;  4GD8 A;  3ZG7 B;  4EV4 A;  3FV7 A;  1FSY A;  3A3F A;  4JF5 A;  2ZM2 A;  1KDW A;  2H10 A;  3W4O A;  2EFX A;  2ZMA A;  1CK3 A;  1DJB A;  2JE5 A;  2Y2H A;  1YMX A;  1CI8 A;  2Y2M A;  3O3V A;  4H8R A;  1ZG4 A;  4PM8 A;  4WMC A;  5DF7 A;  1K56 A;  4BL2 A;  5HL1 A;  3OZH A;  4KQQ A;  2Z2L B;  2XF3 A;  1YLY A;  3Q7V B;  4WEL A;  1BUE A;  2BG1 A;  1VM1 A;  3NC8 A;  5GHZ A;  1I5Q A;  1ES5 A;  1YLJ A;  3IHA A;  3IF6 B;  2X01 A;  4RA7 A;  2PU2 A;  2WKE A;  3PBT A;  3FKW A;  2P9V A;  4S2L A;  4OLG A;  3WS5 A;  5A92 A;  1K4E A;  4CPK A;  1K25 A;  4GOG A;  2XH9 A;  4R1G A;  5CGS A;  3V50 A;  1J9M A;  3BFE A;  2Y4A A;  3UE1 A;  4LV1 A;  2XR0 A;  4L0L A;  1KGF A;  4ZJ2 A;  5A93 A;  5E2H A;  3W4Q A;  3HBR A;  3PBS A;  4KZ4 A;  5CGX A;  3EQU A;  5CER A;  1XKZ A;  3EQV A;  1PZO A;  2HP6 A;  5DF9 A;  4JLF A;  3NDE A;  1YQS A;  4WEJ A;  3ZG8 B;  2Y2K A;  3FKV A;  1ALQ A;  3G32 A;  3IWO A;  5M19 A;  1W8Y A;  5KSH A;  5CEB A;  4B4Z A;  3D4F A;  5FAO A;  3V39 A;  5CXW A;  3HLE A;  2OLU A;  5GL9 A;  5CTN A;  1SDN A;  2HDS A;  2ZC5 B;  4WMC D;  1EI5 A;  1PIO A;  1K56 D;  5EVL A;  1PWD A;  3GQZ A;  5HAR A;  2Y2Q A;  3HUM A;  4FH2 A;  5DF8 A;  4Z9Q A;  1IEM A;  1K57 A;  4E3J A;  1MY8 A;  3VP2 A;  4Y0T A;  4E3O A;  2B5R A;  4S2N A;  2ZM0 A;  4EQI A;  1MWR A;  1W79 A;  5AQA A;  3BLM A;  1WE4 A;  1DJC A;  4R4S A;  1YLT A;  5FSR A;  4WYY A;  3SOI A;  2IWC A;  4OQ0 A;  4PM6 A;  4Y0U A;  4BD1 A;  2RCX A;  3LO7 A;  1MWS A;  4E3I A;  3ZDJ A;  1IYS A;  2Y59 A;  5FAS A;  1K6S A;  3IF5 A;  3IWI A;  1H5X A;  3MBZ A;  4P6B A;  3UO9 A;  2J8Y A;  4FSF A;  5CEC A;  5TFQ A;  2WAE A;  4BL3 A;  2OLV A;  3V5M A;  1MWU A;  1HZO A;  1E3U A;  4GKU A;  2P74 A;  1XXM A;  2Y2G A;  5FQQ A;  2ZC7 A;  5E2G A;  5FQK A;  2QPN A;  1W7F A;  1ERM A;  4K0X A;  2C6W B;  4U0X A;  5EVI A;  4C6Y A;  1O7E A;  4S2O A;  3ITA A;  5EUA A;  4JF6 A;  1FR1 A;  2WGI A;  4KG6 A;  5FQM A;  3HLB A;  1K54 C;  3I7J A;  1XPB A;  4K0W A;  5FI2 A;  2H0Y A;  4FD8 A;  2IWB A;  3BEC A;  5F1G A;  1GA9 A;  3Q7Z A;  4OPR A;  1GHI A;  3E2L A;  3G30 A;  4KZ8 A;  3RXX A;  1S0W A;  1FSW A;  5EE8 A;  2V20 A;  4PPR A;  3N8S A;  4DE1 A;  3TOI A;  3IH8 A;  5AQ7 A;  3VP0 A;  2WYX A;  1MWT A;  1MBL A;  4KZ3 A;  2WGW B;  4UA7 A;  1JTD A;  1KGE A;  4PM7 A;  1MKI A;  1PW1 A;  4ZTK A;  5M1A A;  4IBR A;  1RCJ A;  2HDU A;  2JCH A;  3UPO A;  5HAI A;  4KQO A;  1XGI A;  4N92 A;  4LV2 A;  1E3U D;  4WM9 A;  1NYM A;  3SH9 A;  5FDH A;  3IF6 C;  1JTG A;  2J9P A;  2WUQ A;  4S2P A;  2OSU A;  1Y54 A;  5KSC A;  3CZD A;  1K6R A;  4GDB A;  5EEC A;  1IEL A;  3FYZ A;  2XEP A;  5HW3 A;  5DVA A;  5EVI D;  3OPP A;  3HRE A;  2WAD A;  1JWV A;  1L0D A;  5CRF A;  1W8Q A;  3A3E A;  3BFF A;  3TG9 A;  3B3X A;  2WKI A;  1BLH A;  3VOZ A;  1AXB A;  3UDX A;  4RX3 A;  4BQM A;  5CGW A;  3IWQ A;  3SS3 A;  1BUL A;  2XD1 A;  1JVJ A;  1W5D A;  2FFY A;  1KVM A;  4KQR A;  2XK1 A;  2XQZ A;  2JBF A;  1DY6 A;  2FFF B;  3LY4 A;  2VGK A;  3OPH A;  4YIN A;  4PMA A;  5BOH A;  4S2I A;  1M6K A;  2EXA A;  2ZC4 B;  4QJG A;  1ERO A;  5TR7 A;  5CHU A;  4K91 A;  2Y55 A;  4QY5 A;  3ZNY A;  2QMI A;  1QMF A;  1ERQ A;  2WK0 A;  3O87 A;  3RJU A;  2ZM8 A;  2RL3 A;  3Q81 A;  1ONH A;  3BEB A;  4OVD A;  3WRZ A;  2IWD A;  5FAT A;  5A90 A;  4LCL A;  4KEN B;  3DWZ A;  3G2Z A;  2J7V A;  4DE2 A;  5HFO A;  2WGV A;  1TDG A;  2ZQ8 A;  5JYP A;  3HLD A;  1XP4 A;  1TVF A;  1QME A;  2A3U A;  3BLS A;  5A91 A;  3VFF A;  1FCO A;  2P9V B;  1PZP A;  1ESI A;  3CMZ A;  1BLC A;  4OP5 A;  4C3Q A;  4E3N A;  3HUN A;  4OH0 A;  2EX8 A;  5DTK A;  2BLS A;  2Y2L A;  2ZQA A;  3GTC A;  4Y0O A;  5E43 A;  3GV9 A;  5M18 A;  3G2Y A;  4ZJ3 A;  3UPN A;  2G2U A;  2ZLY A;  3N8L A;  4QY6 A;  4E3L A;  1KDS A;  1S6R A;  5U47 A;  2XDM A;  4GB7 A;  4E6X A;  1G6A A;  3HLW A;  2WZX A;  3C4P A;  3M2K A;  3N8R A;  2HDQ A;  3ZCZ A;  3VP3 A;  3PBR A;  1TEM A;  1LI0 A;  3UDF A;  5DTT A;  4DRT A;  1GA0 A;  1O07 A;  2ZD8 A;  3JYI A;  4JKT A;  1NYY A;  4OQI A;  3ZHH A;  3C7V A;  3IXG A;  5FQI A;  3OPL A;  1IYP A;  4N1H A;  2CC1 A;  2XFT A;  4X55 A;  3S4X A;  4HBT A;  3NI9 A;  4KG5 A;  1NRF A;  3G4P A;  5CHJ A;  1ESU A;  3MFD A;  1CEF A;  4UAA A;  5EOE A;  3ZVT A;  4A5R A;  2WZZ A;  4R23 A;  1H8Y A;  4S2M A;  4B4X A;  5AQ9 A;  2Y2I A;  3ZGA B;  1DJA A;  4FCF A;  1MPL A;  4X68 A;  1KE3 A;  3IQA A;  4DE3 A;  3P98 A;  3AGF A;  5F1F A;  5GHY A;  1NY0 A;  3BFD A;  1RP5 A;  4KZB A;  1LI9 A;  4KZ7 A;  3WWX A;  3C4O A;  2ZQD A;  3LEZ A;  3UNW A;  4DDY A;  2J9O A;  4OPZ A;  4DXB A;  3OC2 A;  3AGE A;  4RVA A;  1VQQ A;  3OCN A;  4OPY A;  3DWK A;  3G34 A;  4WZ5 C;  3PBO A;  4Y7P A;  1NZU A;  3W8K A;  5F82 A;  3G35 A;  1K38 A;  4RX2 A;  3FWL A;  1GHM A;  4GD6 A;  5JYO A;  2R9W A;  1K54 A;  3C5A A;  3DW0 A;  4MBK A;  4OQH A;  1BSG A;  3IXD A;  3Q07 A;  4OQG A;  1KVL A;  3V3R A;  4DKI A;  3M2J A;  3VP4 A;  3WS4 A;  3GSG A;  4X69 A;  5GLB A;  1LL9 A;  5FQ9 A;  4KZ5 A;  1YT4 A;  4DXC A;  3OPR A;  3MZF A;  4EBP A;  3HVF A;  1K55 C;  2HP5 A;  2E8I A;  1PWG A;  3UE0 A;  3DTM A;  5EVI B;  1YMS A;  4U3T A;  3GRJ A;  3OCL A;  2XD5 A;  2OV5 A;  3PAE A;  4R0Q A;  4E3K A;  4WZ4 A;  3MZD A;  2EX9 A;  4HEF A;  2ZC3 B;  3Q7V A;  2JC7 A;  3GVB A;  3SH7 A;  5L2F A;  4RYE A;  3SH8 A;  3LCE A;  4DF6 A;  1L0F A;  3IF6 A;  4OOM A;  5E2E A;  1BT5 A;  1SCW A;  3VMA A;  4X6T A;  4XUX A;  5FAP A;  3NIA A;  2EXB A;  3BFG A;  4X56 A;  4OP8 A;  3VP1 A;  2V1Z A;  3HLG A;  4UA9 A;  4WBG A;  5DTS A;  4D2O A;  3CG5 A;  2H0T A;  4LEN A;  3MXR A;  3QNC A;  2C5W B;  5EOO A;  3IXB A;  4KZ6 A;  3VFH A;  3N7W A;  4BD0 A;  4IVK A;  4GZB A;  4MLL A;  1IYO A;  3O86 A;  4R4R A;  5D3O A;  3IT9 A;  3WRT A;  2HPB A;  4QB8 A;  3RXW A;  3QHY A;  1ZC2 A;  1BLP A;  3C7U A;  4N1X A;  4QHC A;  5E2F A;  3ZVW A;  3SS5 A;  5IHV A;  5GHX A;  3G31 A;  4MNR A;  2Y2P A;  1IKG A;  1LLB A;  2Y2N A;  4ID4 A;  1PW8 A;  1XGJ A;  1PI4 A;  3IH9 A;  3PBN A;  4OOY A;  4CJN A;  4S2K A;  1L0E A;  4N9K A;  1JWP A;  1GHP A;  2XFS A;  3BYD A;  4OON A;  4XUZ A;  5CED A;  3S22 A;  1KE0 A;  3A3I A;  3HLF A;  5FQJ A;  3UPP A;  3MXS A;  5AQB A;  3BM6 A;  2WKH A;  4BJP A;  2X02 A;  1XA1 A;  1YLZ A;  3PAG A;  5FAQ A;  5GLC A;  2ZQ7 A;  1FR6 A;  3UE3 A;  2H5S A;  1KGG A;  2Z2M B;  4GN2 A;  4YFM A;  4S2J A;  4P87 A;  5TGF A;  4B88 A;  4JPM A;  4KZA A;  4R3B A;  3UN7 A;  4XXR A;  1Q2P A;  5G18 A;  3MKF A;  2GDN A;  4MBF A;  4X53 A;  2Y2O A;  4U0T A;  1ZKJ A;  1Z6F A;  1BTL A;  1WYC A;  4WEK A;  4ZAM A;  4Q8I A;  3NDG A;  4IBX A;  5EPH A;  3TSG A;  1WYB A;  2PU4 A;  1BZA A;  4GDN A;  1K4F A;  1FCM A;  4KZ9 A;  5HAQ A;  4OLD A;  4EUZ A;  4F94 A;  4QD4 A;  2DCF A;  1HVB A;  1ES3 A;  2PBY A;  2Q9M A;  2XGN A;  3ZNT A;  4DE0 A;  4E3M A;  1K57 C;  5FI6 A;  1SHV A;  4OOL A;  3A3D A;  4S2N C;  1KE4 A;  1I2W A;  3V3S A;  4ZDX A;  4BLM A;  1YM1 A;  3M6B A;  4EWF A;  2HP9 A;  2VGJ A;  2Q9N A;  2XLN A;  1CI9 A;  1U60 A;  3S1Y A;  4JXV A;  3VSK A;  4LCM A;  5FI7 A;  1OME A;  3GMW A;  4C75 A;  1FOF A;  1Q2Q A;  2EX6 A;  4FH4 A;  4UA6 A;  3ZG9 B;  3O88 A;  1JWZ A;  4HES A;  1E25 A;  1FCN A;  5GLD A;  5I94 A;  1N4O A;  1HTZ A;  1SKF A;  3UDI A;  3W4P A;  1NJ4 A;  3N6I A;  3P09 A;  1YLP A;  4IED A;  1L0G A;  3IHB A;  4IVI A;  3ZG5 A;  1H8Z A;  1PWC A;  4JXW A;  1GCE A;  3PBQ A;  1L2S A;  2Y91 A;  4DDS A;  4R3J A;  4NET A;  4ZJ1 A;  2EX2 A;  3MZE A;  1XX2 A;  2X71 A;  4OKP A;  1I2S A;  1C3B A;  2DNS A;  3ISG A;  3Q1F A;  4WZ5 A;  3WS0 A;  4N9L A;  2WGW A;  4NK3 A;  5EVI C;  1M40 A;  4E6W A;  5J8X A;  3E2K A;  1ES2 A;  3SS4 A;  4ZBE A;  3ZFZ A;  2ZJ9 A;  1G68 A;  5HAP A;  3A3J A;  3CJM A;  3MKE A;  5KZH A;  2WAF A;  3IXH A;  3VSL A;  1BLS A;  2EFU A;  1CEG A;  1RGZ A;  3M6H A;  4JBF A;  4O7D A;  5HX9 A;  2Y2J A;  2V2F F;  4M3K A;  4UHU A;  1K55 A;  4LV0 A;  3QNB A;  1ZG6 A;  3NY4 A;  1RGY A;  1YLW A;  1IKI A;  2ZQ9 A;  3BFC A;  1N9B A;  1TDL A;  2ZC6 B;  1LHY A;  4GNU A;  2UWX A;  3GR2 A;  2HDR A;  4EBN A;  1E4D A;  4PM5 A;  4JXG A;  3ZG0 A;  4JXS A;  4JF4 A;  3N4I A;  1PYY A;  3AGD A;  3FZC A;  3WS1 A;  4BEN A;  1MXO A;  1LL5 A;  1NXY A;  4LV3 A;  1IYQ A;  3WS2 A;  2R9X A;  3PTE A;  5KMW A;  3BRM A;  1NZO A;  3NCK A;  3HUO A;  1FQG A;  3ITB A;  4QU3 A;  3HLC A;  4OPQ A;  3NBL A;  1PI5 A;  5CHM A;  4EBL A;  3HL9 A;  1EWZ A;  3VOY A;  5F83 A;  3LY3 A;  1HD8 A;  4PM9 A;  2QZ6 A;  4MBH A;  4HBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...