5E2FA

Crystal structure of beta-lactamase class d from bacillus subtilis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
236
Chain Sequence
HLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase YbxI
publication title Crystal Structure of Beta-lactamase class D from Bacillus subtilis
rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Hydrolase
total genus 75
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e2fA00
1Y54A 3N8SA 2XD5A 5AQ9A 2Y2KA 1HVBA 3IWIA 1KDSA 5L2FA 4IVKA 4S2OA 4ZBEA 3SS5A 1XGIA 4N1XA 1VM1A 3UPNA 1IELA 4OQ0A 3D4FA 5CGSA 5DF7A 4EBNA 1L0EA 4IBRA 5EVIB 3IHBA 5FQJA 4GB7A 4N9KA 1RGYA 5FSRA 1DJBA 1O7EA 3QHYA 1U60A 1E3UA 2A49A 4PM6A 5HARA 2P9VA 2X71A 4S2PA 3SH8A 3NDEA 4DRTA 3CZDA 1E3UD 3DWKA 4UAAA 1PIOA 5JYPA 4KZ4A 3A3IA 3ITAA 2XD1A 1LI0A 5F82A 1RCJA 2Q9NA 3BFEA 1EROA 3IH8A 4OOMA 1PW1A 2ZM0A 3ZG7B 2XQZA 4S2IA 2EXAA 3HL9A 1WYBA 2ZQDA 5A90A 1BLSA 3G32A 1W8QA 2E8IA 4QJGA 1RGZA 3ZVWA 4ZJ2A 4ZJ3A 2EFUA 1ES2A 4LV0A 2XH9A 4M3KA 1PZOA 2WYXA 1MPLA 4X69A 4EBPA 1MWRA 4OPRA 3ZNTA 4S2MA 1K54C 3WRZA 5EOOA 3MKEA 5I94A 3UNWA 2Y2IA 3GSGA 5FI2A 3P09A 1PI5A 3IH9A 3P98A 4FD8A 4DE3A 4E3OA 3IHAA 4P87A 1LL9A 4X53A 3WS5A 1SCWA 4X6TA 1PW8A 4O7DA 4E3MA 5HL1A 4GOGA 4PM7A 4DXBA 2Y2GA 2DCFA 3SS4A 4OPQA 4ZTKA 1EI5A 2PBYA 3WS4A 1NY0A 3G4PA 1PWCA 1FCNA 3NY4A 1DJAA 1FCOA 1YLZA 3A3FA 3LCEA 4X68A 1L0DA 3VOYA 1MWTA 4UA7A 3Q82A 4FCFA 4QY5A 4RX2A 3HLFA 2XLNA 3WWXA 1PYYA 3VP3A 5DTSA 5AQ7A 1K56A 3GMWA 5GLBA 1WE4A 4KG5A 1JWPA 1XKZA 3ISGA 1K56D 3GR2A 4IVIA 5CECA 1BT5A 2GDNA 2I72A 3G30A 1LI9A 4Y0OA 2OSUA 1M6KA 2ZC6B 3QNBA 5DVAA 5E2FA 3AGDA 2IWBA 1JWVA 5CTNA 3UE1A 4UHUA 4Y7PA 4JF5A 1QMEA 3AGFA 3S4XA 4KG2A 1NZOA 5FI6A 4GDNA 5GLAA 3PTEA 2UWXA 4MEZA 5AQBA 3FKVA 4HEFA 4P85A 4E3IA 4KZ5A 5TGFA 4DDYA 3PBSA 4HESA 2VGJA 2WGVA 4K0WA 1K6SA 3BFDA 3S1YA 3UDFA 1XX2A 4KZBA 1MWUA 1K54A 5KMWA 2V20A 3HLCA 4KENB 3UPPA 1FSYA 3NBLA 4P0MA 1IKIA 1ES4A 3UDXA 3A3DA 3MZDA 1IKGA 4JKTA 1L2SA 4RA7A 3GTCA 3NIAA 1FR6A 1JVJA 2J8YA 2RL3A 3C7UA 3VP1A 2H0TA 4MLLA 4YINA 4B4XA 3VP2A 2WGIA 4QU3A 1ERQA 4LCMA 1ERMA 2H10A 3PBNA 2JBFA 3VP0A 3DTMA 1JTDA 3M6BA 2H0YA 3UE0A 3VSKA 1YLPA 3G35A 2C5WB 2VGKA 2ZC7A 1GCEA 3PBTA 1W7FA 2HP6A 4R4SA 2Y2OA 5E43A 3WRTA 1PI4A 3ZDJA 1K4FA 4RVAA 2ZC3B 3A3JA 3UE3A 5A93A 4YFMA 1IYQA 4C75A 1K55C 2OLVA 1KVLA 1ALQA 5M18A 5FQKA 4F94A 4E3NA 1MWSA 3GRJA 5HAQA 4WZ5C 2ZQ7A 3UN7A 1VQQA 3FV7A 2BLSA 4FH4A 3VP4A 2QMIA 2HP5A 3TG9A 4HBUA 5FA7A 1ES3A 2FFFB 1KE0A 4OP8A 1TDLA 3MZEA 3BECA 1CK3A 1GA9A 1FCMA 2JCHA 2WGWA 2XGNA 3FZCA 3HLGA 3ZFZA 1SDEA 1XPBA 5M1AA 2PU4A 1GHPA 5A91A 3VSLA 3BFCA 3HLEA 1KGEA 2Y55A 5FAOA 4KQQA 4WM9A 2QPNA 3Q1FA 5CERA 3UPOA 2XEPA 1NZUA 1W5DA 1IYOA 1LL5A 3G34A 3DW0A 3HBRA 4BD0A 5EUAA 4IEDA 3PBOA 2XR0A 4Z9QA 1HTZA 2ZQCA 3A3EA 2EX2A 4EQIA 3O3VA 1G6AA 3V50A 1W8YA 4WBGA 4R3JA 1TDGA 1JTGA 1S6RA 4KZ6A 3V5MA 1YT4A 1FOFA 4K91A 1L0GA 4DXCA 3OCNA 5DF9A 2FFYA 3PAEA 3ITBA 5G18A 4S2KA 3N8RA 4BLMA 2WGWB 1O07A 2WZZA 3I7JA 4OQHA 4Q8IA 3AGEA 5HAIA 4OPYA 2V1ZA 4LV3A 4E6XA 2P9VB 2HDQA 4IBXA 1LLBA 3Q81A 2J9PA 3V39A 4C6YA 1H8YA 1YMXA 3UO9A 1I2WA 4BQMA 4U3TA 2CC1A 4JXWA 1K55A 1Q2QA 4JLFA 3SOIA 2Y2MA 3N8LA 2Y4AA 3IT9A 1SDNA 1BULA 2ZC4B 4WZ5A 3Q7ZA 2HPBA 1KE4A 5EECA 3RXWA 1NYYA 5KSCA 1K25A 4PM8A 5CTMA 3OPPA 3HLWA 5DTTA 2WAEA 4KZ8A 3N7WA 2J9OA 1ESUA 5CHJA 3IXHA 4ZDXA 5E2GA 1K6RA 2HP9A 1KDWA 1SHVA 3CG5A 4S2JA 1YLWA 1XGJA 3ZGAB 4X55A 3IXGA 3ZG8B 3VOZA 1MBLA 5EOEA 1GA0A 3WS1A 1JWZA 3NC8A 4B4ZA 4D2OA 2X02A 4JBFA 5J8XA 3IXDA 5CEDA 3BYDA 5GL9A 3ZNYA 1BLCA 3W4PA 3HLBA 3HUMA 4NETA 1Q2PA 3BFFA 3N6IA 3IQAA 1CEFA 2WADA 3Q7VA 4EUZA 2WKEA 3N4IA 1J9MA 1C3BA 2WZXA 4E3KA 3E2LA 3ZG0A 3HLDA 3MBZA 2WKHA 3VFFA 2Y91A 3MKFA 3W8KA 4R0QA 3G31A 4MBHA 2ZC5B 1CEGA 1GHMA 1HZOA 1MXOA 1NXYA 5DTKA 4BL3A 3VMAA 4R3BA 4EV4A 4BENA 4KZ9A 3ZVTA 5FAQA 4A5RA 3W4OA 2OLUA 4P6BA 4PM9A 3SH9A 3BRMA 1MY8A 1M40A 1FR1A 3B3XA 2G2UA 3OPRA 4GD8A 2HDSA 5FI7A 5TR7A 1XP4A 3IWQA 3IWOA 5GHYA 4R1GA 2ZQAA 2ZM8A 3RXXA 4OOYA 5F83A 4OQIA 2Q9MA 1SKFA 4OPZA 3M2JA 4LCLA 4UA9A 4E3LA 1CI8A 2Y59A 1FSWA 1G68A 2WUQA 1GHIA 5F1GA 3Q07A 4PM5A 5CHUA 3HREA 3EQUA 4S2LA 4OLDA 3S22A 4EWFA 2G2WA 4X56A 4N92A 1NRFA 2DNSA 2ZM2A 4DE1A 2Y2PA 5FASA 4JXGA 2DRWA 2WAFA 2X01A 3PAGA 3VFHA 3ZG9B 1IYSA 4R23A 4QHCA 4DDSA 4C3QA 4XXRA 1XA7A 2XDMA 5FQIA 5CXWA 2EXBA 5EVIA 3IXBA 3C4PA 2P74A 1YLTA 1WYCA 5CEBA 3O87A 5EVID 3G2ZA 3PBRA 4ID4A 4N1HA 4OP5A 5GLDA 3CJMA 5EVLA 3V3SA 1KGFA 4PPRA 1L0FA 1IYPA 1TEMA 2EX9A 4WMCD 2V2FF 1NJ4A 4S2NC 4CJNA 1ZG6A 2XF3A 4H8RA 3GV9A 4MBFA 2EX6A 5GHZA 4RYEA 2ZMAA 5CGXA 1ESIA 3O86A 3UY6A 3G2YA 4OKPA 5M19A 1QMFA 2IWDA 2XK1A 1ZKJA 3MFDA 3MXSA 4DKIA 3OZHA 1PWDA 4BJPA 3GVBA 2EX8A 4OONA 2ZD8A 1KE3A 4JPMA 4GDBA 5F1FA 4R4RA 3HVFA 2Y2HA 3C5AA 4GZBA 3ZCZA 1H5XA 3IF6C 4U0XA 3FYZA 2J7VA 4NK3A 1PWGA 1CI9A 4Y0TA 2R9XA 4OQGA 4WYYA 3HUNA 4KZAA 5BOHA 5KZHA 2Z2MB 3SS3A 1BUEA 5GLCA 2OV5A 3LY3A 4Y0UA 5FAPA 1LHYA 1I2SA 2Y2QA 1W79A 1E25A 1EWZA 4HBTA 5AQAA 4BL2A 4WEJA 4ZAMA 4EBLA 4UA6A 1I5QA 2PU2A 5HX9A 1AXBA 4JXVA 1YQSA 3C7VA 4JF6A 2ZLYA 1PZPA 1ONGA 4GD6A 4L0LA 1NYMA 3LY4A 3IF5A 4JXSA 5FQMA 4S2NA 3FKWA 3DWZA 1ZC2A 4N9LA 3TSGA 3QNCA 5CHMA 1BTLA 1N4OA 3FWLA 3EQVA 4BD1A 5FQQA 5HW3A 5EVIC 3M6HA 5FATA 3OC2A 2XFSA 5TFQA 1XA1A 4MBKA 4CPKA 1K57C 5E2HA 5CRFA 3JYIA 4DE2A 3WS0A 4FH2A 3BFGA 2XFTA 5HAPA 1ES5A 4DE0A 5JYOA 3V3RA 4QY6A 1FQGA 5IHVA 1OMEA 3MXRA 3IF6A 1Z6FA 4QB8A 2HDUA 1RP5A 3RJUA 1BLHA 5EE8A 3BM6A 3WS2A 5DF8A 2C6WB 5FDHA 4WEKA 2BG1A 3C4OA 2ZQ8A 1K38A 1ONHA 2B5RA 1YMSA 3SH7A 2Y2LA 2Z2LB 4K0XA 5A92A 1YM1A 1ZG4A 3GQZA 3OPHA 4XUXA 4XUZA 5HFOA 4RX3A 3Q7VB 4OH0A 1TVFA 2WKIA 3NDGA 4U0TA 1DY6A 2JE5A 4B88A 3TOIA 1KVMA 3E2KA 4LV1A 3NCKA 5CGWA 2ZQ9A 4E6WA 4GKUA 3ZG5A 5KSHA 1HD8A 4GNUA 3IF6B 3CMZA 1BZAA 2WK0A 2QZ6A 2R9WA 4JF4A 4GN2A 1KGGA 4QD4A 4ZJ1A 1YLYA 2H5SA 3HUOA 2ZJ9A 4FSFA 2A3UA 5GHXA 3MZFA 2JC7A 5EPHA 1IEMA 4PMAA 3ZHHA 1BSGA 2EFXA 2Y2JA 1MKIA 4DF6A 3M2KA 4MNRA 3NI9A 4KQRA 3PBQA 1N9BA 3O88A 5D3OA 1YLJA 1BLPA 1H8ZA 3LEZA 3LO7A 1K57A 3BLSA 4OLGA 1S0WA 3OPLA 4OOLA 4WELA 4KZ7A 4WMCA 2RCXA 3W4QA 4LENA 3BLMA 4KQOA 1DJCA 4WZ4A 1XXMA 1E4DA 3BEBA 2HDRA 4KG6A 4LV2A 4OVDA 5E2EA 2Y2NA 5U47A 3UDIA 4E3JA 3OCLA 5FQ9A 2IWCA 4KZ3A 1K4EA
chains in the Genus database with same CATH superfamily
2V9AA 3N8SA 3IWIA 5L2FA 4IVKA 4GW9A 4EBNA 1L0EA 4HY8A 1E3UD 4UAAA 2V0UA 2VV6A 2OAQ1 2Q9NA 3IH8A 4OOMA 3O5YA 3ZG7B 2XQZA 5HSQA 4EETB 3F1PA 3HCYA 3ZVWA 4OPRA 4S2MA 4EXOA 5EOOA 5L8MA 5I94A 3P98A 3IHAA 3WS5A 2VZWA 4X53A 4GS9B 1SCWA 4E3MA 4PM7A 4XT2A 4ZTKA 1TS0A 1EI5A 2PBDP 3QP2A 2ZOIA 4F3LB 1MWTA 4QY5A 4RX2A 3HLFA 3C38A 3VP3A 1XFNA 5DTSA 1WE4A 3LIDA 1K56D 3SW1A 1LI9A 4Y0OA 1M6KA 5DVAA 3UE1A 3AGFA 2W0NA 3PTEA 4MEZA 3FKVA 4HEFA 4P85A 4DDYA 5F6AA 4HESA 3JPUA 1FILA 1K6SA 3UDFA 1XX2A 4KZBA 2W1TA 1MWUA 1H3QA 2V20A 3MSHA 1IKIA 4G3WA 3LGOA 3MZDA 3UDXA 1IKGA 4JKTA 4EESA 2JKGA 2RL3A 4UEYA 2H0TA 4YINA 2WGIA 1ERQA 2XSSA 3VSKA 3G35A 2C5WB 2VGKA 2ZC7A 4HHDA 5E43A 3WRTA 3ZDJA 2ZC3B 4C75A 3S7QA 1K55C 2V8CA 1ALQA 5M18A 2ZL1B 4GHIB 3E4OA 2ZQ7A 3UN7A 4P6ZM 3VP4A 2HP5A 5FA7A 4OP8A 3SZTA 2EA9A 2LB5A 3BECA 3B42A 3MJQA 4WM9A 1IYOA 1LL5A 4BD0A 1G28A 2XR0A 4H6JA 2EX2A 2KOIA 3OOVA 4EQIA 1G6AA 1JTGA 3HJIA 1FOFA 1YPRA 4K91A 1T1BA 5KIZA 3IBRA 1OTEA 3S7NA 3ITBA 4IUKA 1D7EA 4BLMA 2WGWB 3CI6A 3I7JA 5HAIA 5DKKA 1NLZA 4IBXA 4R3AA 4WF0A 1H8YA 1I2WA 4BQMA 1LT0A 1Q2QA 1F9IA 4Y15A 1JNUA 5DTTA 2VLGA 1KDWA 1YLWA 1MBLA 1GA0A 5J8XA 4ETZA 3R7WA 4XT2B 1BLCA 3PYPA 3IQAA 1Y28A 3Q7VA 3N4IA 1C3BA 1P9RA 4B93A 5IS1A 4I39A 2WKHA 3DTKA 1OTDA 3FPWA 2ZC5B 1CEGA 3KSHA 1MXOA 3P7NA 3IBJA 4EV4A 1Y4OA 3NECA 4YWZA 3W4OA 2OLUA 3BRMA 4X25A 1FR1A 3B3XA 5FI7A 3IWQA 4M4XA 5F83A 4OQIA 4OPZA 4UA9A 1GHIA 4QWOA 4OLDA 1DRMA 4D60A 5TBMA 4X56A 2EWVA 2DNSA 2G7UA 4DE1A 2UV0E 2WAFA 3G6OA 4DDSA 2V0WA 1XA7A 2XDMA 1X0OA 2W27A 4ESPA 4PAUA 3NOTC 5HL6A 2ZMVA 2INWA 3G2ZA 3PBRA 4OP5A 4N1HA 5GLDA 3EWKA 3LR0A 2AVXA 1TEMA 3H82B 4S2NC 1BYWA 4LPZA 5HPIA 2KLIA 2EX6A 3CITA 2H28A 4FOFA 1GSWA 5M19A 1QMFA 3KX0X 4HP9A 4OONA 1KE3A 4JPMA 3HVFA 4GCZA 4H6JB 4Y0TA 2R9XA 3T4SA 5KZHA 2HV1A 1S4SA 2Y2QA 5AQAA 4UA6A 4JXVA 1YQSA 1PZPA 3DAVA 1NYMA 4P6ZS 4JXSA 4N9LA 2PR5A 2GX5A 5K5BA 1VEUA 5EVIC 3M6HA 2W3EA 2B95A 3T4LA 1MKMA 3WS0A 5HAPA 2GZAA 1FQGA 1OMEA 3QP6A 1BLHA 1VETA 4I38A 5DF8A 2HGVA 5HPFA 2BG1A 1XFQA 3R7WB 3SH7A 2Z2LB 4K0XA 2V1AA 4AFIA 5A92A 5HFOA 4XUZA 3Q7VB 1TVFA 3NDGA 4U0TA 2JE5A 5EM0A 4Y3IA 4GKUA 3ZG5A 5KSHA 1G5UA 4GNUA 3A0SA 3IF6B 4GN2A 1KGGA 1YLYA 4HOIA 2JC7A 5EPHA 1IEMA 2EFXA 3M2KA 3NI9A 3PBQA 1ZHHB 1D06A 1LSXA 4HP4A 3LEZA 3W4QA 4LENA 1DJCA 2VK3A 5J7EA 4MCWA 1XJ2A 1YSPA 5AQ9A 1HVBA 1KDSA 3SS5A 4N1XA 1VM1A 1IELA 3D4FA 2M7VA 5AVFA 3IHBA 2L4RA 1DJBA 1OTIA 3QHYA 1E3UA 4PM6A 2X71A 3IS2B 3SH8A 2YKFA 4MDZA 3V67A 4KZ4A 3A3IA 1AWIA 4GS9A 2JKRI 2VX8A 2XD1A 1LI0A 1RCJA 1NWZA 1S67L 2BTFP 2EXAA 3HL9A 1OJGA 4F3LA 4ZJ2A 1ES2A 4M3KA 1PZOA 2WYXA 2W3GA 4I3IA 3TW8A 3E4QA 2Y2IA 5FI2A 4FD8A 4X6TA 4MN5A 2Y2GA 3SS4A 4WN5A 3PR6A 5MC7A 1NY0A 3LIFA 1FCNA 1DJAA 3A3FA 2V8FA 4FCFA 3BW6A 1PYYA 4NXEA 1K56A 3GMWA 3OLOA 3ISGA 2PRFA 2XA7M 4IVIA 2I72A 2QKPA 3MMHA 2V1BA 2IWBA 1JWVA 1OPXA 1QMEA 3F1OA 3S4XA 1VEUB 5FI6A 5GLAA 2B02A 4BWIA 3H7WA 4KZ5A 5HWVA 1N9NA 3UPPA 4P0MA 2ZL1A 4GHIA 2Z6CA 4RA7A 1TF1A 2J8YA 1L3LA 3C7UA 4HNBA 4KUKA 4B4XA 1H8MA 4HH3A 4NXBA 2P04A 1W63M 3NOUC 2J3WA 1GCEA 2Y2OA 3T12B 3T4QA 2KDKA 1K4FA 4RVAA 3A3JA 5A93A 4E04A 1XJ3A 2ZBBA 4F94A 1S4RA 3D9YA 4E3NA 3GRJA 1VQQA 2ACGA 2PHYA 4Y17A 3T1RA 5HDSA 1CK3A 3FZCA 2WGWA 3KO6A 2XGNA 3HLGA 3ZFZA 4GJ4A 2PU4A 5A91A 3HLEA 1KGEA 1ACFA 1DP8A 2XEPA 1W5DA 3G34A 1PFLA 3DW0A 2L0WA 3O3VA 4WBGA 3IX8A 1S6RA 3V5MA 1YT4A 1L0GA 2M7UA 2QYBA 3N8RA 1OT9A 4EUVA 3LFVA 4E6XA 2OWHA 1LLBA 3W2ZA 3LR3A 4EEUA 1MZUA 3V39A 1YMXA 1H0MA 2CC1A 3SOIA 5L10A 2Y2MA 4ARZA 1KE4A 3RXWA 1NYYA 5KSCA 5CTMA 3NHQA 5CHJA 4ZDXA 5E2GA 3D3OA 3JVVA 3T50A 3CG5A 1J3WA 3ZGAB 4X55A 3IXGA 3VOZA 5EOEA 1JWZA 4JBFA 2HF6A 5GL9A 3T4OA 3W4PA 3HLBA 4EERA 1Q2PA 3BFFA 4PKYG 2WKEA 5DFYA 4B9OA 2PAVP 4E3KA 2GNXA 3HLDA 5FDSA 3VFFA 4JGPA 1NXYA 3VMAA 4R3BA 4KZ9A 2J80A 5FAQA 5FL3A 4PM9A 4FUWA 3F1OB 1XP4A 3LYXA 3EGXC 4R1GA 4L9FA 2ZQAA 4Y5FA 2Q9MA 1DP9A 3H7WB 4KUOA 1CI8A 2Y59A 1FSWA 1G68A 5F1GA 3H82A 2JKTI 3NULA 5F5YA 4EWFA 4N92A 2E8JA 2ZM2A 4JXGA 3UB7A 4X1LA 5FEGA 5FQIA 4LGWA 2EXBA 3IXBA 2XA7S 2DMWA 5LBRA 4EW7A 1S1YA 5EVID 1KGFA 3CUEC 2EX9A 3QP4A 4WMCD 2OAP1 1ZG6A 4H8RA 4Z1WA 2ZMAA 5CGXA 1ESIA 4CQHA 4QPRA 1XJ4A 1IOUA 4DKIA 4O8GA 2EX8A 1UWPX 5F1FA 3LR5A 3C5AA 1H5XA 4IUHA 5HD5A 1CQAA 4NG2A 2J7VA 4NK3A 1PWGA 5BOHA 3SS3A 3LI8A 2OV5A 4Y0UA 4Y13A 1LHYA 1I2SA 5J3WA 1W63Q 4ZAMA 3T4TA 4EBLA 2K2NA 4HIAA 4DJ3A 4JF6A 1GSXA 2YKHA 3LY4A 2VJWA 4G3KA 3TSGA 4NXGA 5IT5A 3CHWP 3S7OA 3HJKA 1FIKA 2J3TC 4ARZB 3ZQ5A 5E2HA 4HJ4A 4HQAA 4FH2A 4WUJA 1ES5A 3MF0A 4CLCD 1KOUA 1NRJA 3IF6A 4WL9A 2HDUA 1RP5A 2JHEA 3WS2A 5FDHA 1LSWA 2ZQ8A 1YMSA 1ZG4A 1T1CA 3OPHA 4RX3A 3CAXA 2WKIA 4B88A 3VOLA 2L1MA 1HD8A 5AVEA 3UB8A 5CX7A 2VKSA 3CMZA 1BZAA 2QZ6A 4I3AA 4UQIM 2XRNA 3MZFA 4PMAA 1BSGA 4DF6A 1ODVA 4KQRA 2P7JA 3EEHA 1N9BA 5D3OA 1YLJA 1BLPA 1H8ZA 3LO7A 4OLGA 3IS2A 3CPTA 1S0WA 4OOLA 4KZ7A 2P08A 3BEBA 4KG6A 5I5LA 5FQ9A 1Y54A 5EM1A 2XD5A 2QJ5A 2Y2KA 4ZBEA 3UPNA 4OQ0A 5DF7A 5CGSA 4IBRA 4NXFA 2ZMFA 3H9WA 4GB7A 4N9KA 5FSRA 1O7EA 1U60A 4MMNA 2P9VA 4S2PA 4ME4A 4DRTA 1OTAA 3CZDA 1PIOA 4HJ3A 5JYPA 5G4ZA 3ITAA 2PT7A 5HDDA 1TS8A 3BFEA 2ZM0A 3VE4A 1WYBA 2ZQDA 5A90A 3G32A 3ZYTA 1W8QA 2E8IA 4QJGA 2EFUA 2XH9A 4EBPA 1T1AA 3MR0A 3MS6A 3KSGA 3WRZA 3UNWA 4DN0A 1UWNX 4DE3A 1LL9A 2DCFA 4OPQA 4IJGA 3WS4A 3G4PA 3NY4A 1FCOA 1YLZA 3LCEA 4X68A 1L0DA 3VOYA 2HJ9C 3Q82A 3LIEA 4KG5A 5EFWA 3GDIA 3GR2A 5CECA 1BT5A 2GDNA 3G30A 2OSUA 2LB9A 3E0YA 4PHTA 2ZC6B 2NUPC 3D72A 1TS6A 3AGDA 4Y7PA 4JGQA 4KG2A 1NZOA 4GDNA 1UGUA 4E3IA 4R38A 2VGJA 4K0WA 3BFDA 4I3JA 1K54A 5KMWA 3HLCA 4KENB 3NBLA 3A3DA 3QP8A 3GTCA 1JVJA 1G6OA 3LIAA 4QU3A 4LCMA 2H10A 2VV8A 2JBFA 2W3DA 4R70A 2K31A 3DTMA 1JTDA 3UE0A 2H0YA 2JN7A 3K2NA 3PBTA 4II7A 1PI4A 3UE3A 4YFMA 1IYQA 2OLVA 5HWTA 3L7HA 5L07A 5HAQA 3FV7A 2BLSA 4FH4A 1DP6A 2QMIA 1P9WA 3U2AA 4EU0A 2FFFB 1FCMA 2JCHA 1XPBA 5M1AA 2VEAA 1ZTUA 3VSLA 2Y55A 3CPTB 5CERA 3Q1FA 1NZUA 3HBRA 3PBOA 2XROA 4Z9QA 1HTZA 1PRQA 3V50A 1W8YA 4Q0IA 4R3JA 1TDGA 5HD3A 3OCNA 2FFYA 3PAEA 4Q8IA 3AGEA 4Y2FA 4OPYA 2V1ZA 1PNEA 2P9VB 5IU1A 2HDQA 3DTIA 4C6YA 2K7SA 4FTXA 3N8LA 2Y4AA 2ZC4B 4WZ5A 3OBFA 5EECA 1N9OA 3KSIA 1K25A 3OPPA 3HLWA 1T18A 2IA2A 2WAEA 4KZ8A 1ESUA 3IXHA 2VA0A 1K6RA 3DBAA 3WS1A 3NC8A 3IXDA 4MN6A 5CEDA 1D1JA 3TJZC 3HUMA 4NETA 5G4YA 4KQDA 1CEFA 2WADA 3MQ0A 1N9LA 3E2LA 3ZG0A 4MBHA 4BENA 3ZVTA 4A5RA 4DJ2A 4P6BA 3SH9A 1MY8A 4NKPA 5TR7A 4GD8A 3IWOA 2ZM8A 4OOYA 4HJ6A 1SKFA 2Z6DA 3M2JA 4LCLA 4E3LA 3T1XA 2O99A 1T19A 2WUQA 1SKOA 3HREA 4BMWA 2G2WA 3T1QB 1NRFA 2Y2PA 2X01A 1IYSA 5CXWA 5EVIA 1IFQA 1WYCA 5CEBA 3QP5A 2J3TD 5DJUA 1TS7A 1IYPA 4GLQA 4JGOA 4LRYC 2HZ5A 3LIBA 4CJNA 3LICA 5GHZA 3KSFA 3UY6A 4BBTA 4ETXA 5TJJA 3P01A 3VE3A 3MFDA 2OOLA 3MXSA 3GVBA 2ZD8A 2OWJA 4GDBA 4R4RA 3UB6A 3IF6C 5FEFA 3FYZA 4ZRRA 3U4LP 1LL8A 4OQGA 4WYYA 3HUNA 1BUEA 1F98A 1NLYA 3LY3A 5FAPA 1W79A 1E25A 1EWZA 3EOIA 4BL2A 1AXBA 3JVUA 5HZHA 5C5KA 1ONGA 5FQMA 3FKWA 3DWZA 1ZC2A 2MJ6A 3QNCA 5CHMA 3NOPC 1BTLA 1GSVA 3A0RA 3R4KA 3FWLA 4BD1A 5FQQA 3A0VA 5HW3A 3EEAA 2O9AA 5TFQA 4MBKA 5CRFA 4Q0HA 3LUQA 4CLCA 3V3RA 1YKDA 5IHVA 3MXRA 2O0YA 4QB8A 3IX3A 5EE8A 2C6WB 4MN7A 4WEKA 4LFUA 1YSQA 3C4OA 2EWWA 2B5RA 1EW0A 4G3VA 4CLCE 2CMNA 3B33A 4OH0A 5EVEA 4LLOB 1DY6A 3TOIA 2W1RA 3KYZA 5CGWA 2ZQ9A 5HWWA 4E6WA 2WK0A 3HUOA 2JKRM 3C30A 1CJFA 2QHKA 4MNRA 3O88A 2PYRA 3F1NA 1K57A 3C2WA 4WELA 3BLMA 4KQOA 1SKOB 1XXMA 5E2EA 4OVDA 2Y2NA 5U47A 3UDIA 4E3JA 3OCLA 2IWCA 4KZ3A 3E4PA 4S2OA 1XGIA 4YOFA 1TD5A 5EV0A 2D02A 5EVIB 5FQJA 1RGYA 3MXQA 2A49A 2NUTC 5HARA 4K08A 3NDEA 4PKYA 3DWKA 4HH2A 5F82A 2M1CA 1EROA 1HLUP 1PW1A 5DJTA 2QJ7A 4S2IA 3UMEA 1BLSA 2WKPA 1RGZA 3CLOA 4ZJ3A 5A8BA 4LV0A 4YNRA 4X69A 1MPLA 1MWRA 2Y79A 3ZNTA 1K54C 3MKEA 3GSGA 3P09A 1PI5A 3IH9A 4E3OA 4P87A 5HL1A 2D01A 1PW8A 4O7DA 3UE6A 4GOGA 4DXBA 2ZOHA 2PBYA 3LEQA 1PWCA 3F1PB 2PD7A 1CF0A 4UA7A 2R78A 3TE8A 4Q0JA 2XLNA 4BBUA 3WWXA 2W3FA 1OTBA 5AQ7A 3KYEA 3MQOA 5GLBA 2BASA 1JWPA 1XKZA 3BY8A 1SZVA 3QNBA 4IHQA 5E2FA 5CTNA 4UHUA 4JF5A 3CWFA 2WKQA 2UWXA 5AQBA 3B47A 5TGFA 3PBSA 2WGVA 4CLCB 3S1YA 3FPVA 1FSYA 4HI4A 1ES4A 2I9VA 3DTEA 2JKFA 1L2SA 1P0ZA 3NIAA 1FR6A 3VP1A 4MLLA 3S7PA 3VP2A 3L9KA 3VP0A 1ERMA 3PBNA 5L09A 3M6BA 1YLPA 4O0PA 2QWSA 1W7FA 2HP6A 4R4SA 2W1TB 1KVLA 5FQKA 1MWSA 1LSVA 4WZ5C 3NJAA 3BQAA 3T4KA 3TG9A 4HBUA 1ES3A 1KE0A 1TDLA 3MZEA 2W3HA 1GA9A 1SDEA 3F1NB 1GHPA 3BFCA 3T1SA 5FAOA 4KQQA 2QPNA 2O9CA 3UPOA 5EUAA 4IEDA 2A24A 5J4EA 2ZQCA 3A3EA 3UMDA 2PD8A 4KZ6A 4DXCA 5DF9A 1XJ6A 5G18A 4S2KA 2WZZA 1O07A 1OJ5A 1MC0A 3LI9A 4OQHA 4L9EA 4X1MA 4LV3A 3PXPA 3Q81A 3TRCA 2J9PA 3UO9A 3UB5P 4U3TA 4JXWA 1K55A 4JLFA 4BBVA 3IT9A 1SDNA 1BULA 4LRZE 3Q7ZA 4JGRA 2HPBA 1OT6A 2Q0OA 3MQQA 4PM8A 3ULFA 2VGLM 2J9OA 3N7WA 3CUEA 1P97A 2HP9A 1SHVA 4S2JA 1XGJA 4WLAA 3ZG8B 2JKTM 4B4ZA 4D2OA 2X02A 3BYDA 3ZNYA 2WKRA 4EQ1A 1K0KA 3N6IA 4EUZA 1J9MA 2WZXA 4O01A 2FH5A 3EGDC 3MBZA 1V9YA 2Y91A 4EEPA 3MKFA 3W8KA 4R0QA 3G31A 1GHMA 1HZOA 4BL3A 5DTKA 3ICYA 3BQ8A 2HJEA 3C8CA 1M40A 2G2UA 3OPRA 2HDSA 5GHYA 3RH8B 3RXXA 3UB9A 5AJGA 3Q07A 3T4JA 4PM5A 5CHUA 1STZA 3EQUA 4S2LA 3S22A 5FASA 2DRWA 3PAGA 3VFHA 3ZG9B 4R23A 4QHCA 4C3QA 4XXRA 3C4PA 2P74A 1YLTA 3O87A 4ID4A 3RTYA 3CJMA 5EVLA 3V3SA 4DMZA 4PPRA 1L0FA 2V2FF 1NJ4A 2XF3A 3GV9A 4MBFA 5HDCA 5TBMB 3MFXA 4RYEA 3O86A 3G2YA 4OKPA 2IWDA 2XK1A 1ZKJA 2Y8HA 3OZHA 1PWDA 4BJPA 4CLCC 2Y2HA 4GZBA 3ZCZA 4U0XA 4UQIS 1Z09A 5F68A 2A2LA 4LRXC 3VV4A 2A24B 1CI9A 3PHYA 2PDRA 4KZAA 2Z2MB 1S1ZA 5GLCA 3BY9A 4HBTA 1F2KA 4WEJA 1I5QA 2PU2A 5HX9A 1WA9A 3C7VA 2O9BA 2ZLYA 2KX6A 4GD6A 4L0LA 3FC7A 3IF5A 4S2NA 2FZ0A 3E98A 1N4OA 3EQVA 1S66L 5FATA 3OC2A 2XFSA 1XA1A 4CPKA 1K57C 3IX4A 3JYIA 4DE2A 4R6LA 1V9ZA 3BFGA 2XFTA 3RFBA 4DE0A 5JYOA 5F69A 4QY6A 3QP1A 1Z6FA 3K3DA 3RJUA 3BWLA 3BM6A 4NEED 2PYPA 1K38A 1ONHA 2Y2LA 1YM1A 3GQZA 4XUXA 1KVMA 1A0KA 2B18A 3E2KA 4LV1A 3NCKA 4L9GA 3LR4A 2GJ3A 5DFXA 2PR6A 3KYQA 2R9WA 1VETB 4JF4A 4QD4A 4ZJ1A 2H5SA 4FSFA 1VB6A 2ZJ9A 2A3UA 5GHXA 1YAXA 3ZHHA 2VGLS 2Y2JA 1MKIA 4RQ9A 1F5MA 3GECA 4I5SA 3FG8A 5DKLA 3BLSA 4WMCA 3OPLA 2RCXA 4WZ4A 1E4DA 2HDRA 3BJNA 4LV2A 1VHMA 3K3CA 2VV7A 1K4EA
chains in the Genus database with same CATH topology
1Y54A 3N8SA 2XD5A 5AQ9A 2Y2KA 1HVBA 3IWIA 1KDSA 5L2FA 4IVKA 4S2OA 4ZBEA 3SS5A 1XGIA 4N1XA 1VM1A 3UPNA 1IELA 4OQ0A 3D4FA 5CGSA 5DF7A 4EBNA 1L0EA 4IBRA 5EVIB 3IHBA 5FQJA 4GB7A 4N9KA 1RGYA 5FSRA 1DJBA 1O7EA 3QHYA 1U60A 1E3UA 2A49A 4PM6A 5HARA 2P9VA 2X71A 4S2PA 3SH8A 3NDEA 4DRTA 3CZDA 1E3UD 3DWKA 4UAAA 1PIOA 5JYPA 4KZ4A 3A3IA 3ITAA 2XD1A 1LI0A 5F82A 1RCJA 2Q9NA 3BFEA 1EROA 3IH8A 4OOMA 1PW1A 2ZM0A 3ZG7B 2XQZA 4S2IA 2EXAA 3HL9A 1WYBA 2ZQDA 5A90A 1BLSA 3G32A 1W8QA 2E8IA 4QJGA 1RGZA 3ZVWA 4ZJ2A 4ZJ3A 2EFUA 1ES2A 4LV0A 2XH9A 4M3KA 1PZOA 2WYXA 1MPLA 4X69A 4EBPA 1MWRA 4OPRA 3ZNTA 4S2MA 1K54C 3WRZA 5EOOA 3MKEA 5I94A 3UNWA 2Y2IA 3GSGA 5FI2A 3P09A 1PI5A 3IH9A 3P98A 4FD8A 4DE3A 4E3OA 3IHAA 4P87A 1LL9A 4X53A 3WS5A 1SCWA 4X6TA 1PW8A 4O7DA 4E3MA 5HL1A 4GOGA 4PM7A 4DXBA 2Y2GA 2DCFA 3SS4A 4OPQA 4ZTKA 1EI5A 2PBYA 3WS4A 1NY0A 3G4PA 1PWCA 1FCNA 3NY4A 1DJAA 1FCOA 1YLZA 3A3FA 3LCEA 4X68A 1L0DA 3VOYA 1MWTA 4UA7A 3Q82A 4FCFA 4QY5A 4RX2A 3HLFA 2XLNA 3WWXA 1PYYA 3VP3A 5DTSA 5AQ7A 1K56A 3GMWA 5GLBA 1WE4A 4KG5A 1JWPA 1XKZA 3ISGA 1K56D 3GR2A 4IVIA 5CECA 1BT5A 2GDNA 2I72A 3G30A 1LI9A 4Y0OA 2OSUA 1M6KA 2ZC6B 3QNBA 5DVAA 5E2FA 3AGDA 2IWBA 1JWVA 5CTNA 3UE1A 4UHUA 4Y7PA 4JF5A 1QMEA 3AGFA 3S4XA 4KG2A 1NZOA 5FI6A 4GDNA 5GLAA 3PTEA 2UWXA 4MEZA 5AQBA 3FKVA 4HEFA 4P85A 4E3IA 4KZ5A 5TGFA 4DDYA 3PBSA 4HESA 2VGJA 2WGVA 4K0WA 1K6SA 3BFDA 3S1YA 3UDFA 1XX2A 4KZBA 1MWUA 1K54A 5KMWA 2V20A 3HLCA 4KENB 3UPPA 1FSYA 3NBLA 4P0MA 1IKIA 1ES4A 3UDXA 3A3DA 3MZDA 1IKGA 4JKTA 1L2SA 4RA7A 3GTCA 3NIAA 1FR6A 1JVJA 2J8YA 2RL3A 3C7UA 3VP1A 2H0TA 4MLLA 4YINA 4B4XA 3VP2A 2WGIA 4QU3A 1ERQA 4LCMA 1ERMA 2H10A 3PBNA 2JBFA 3VP0A 3DTMA 1JTDA 3M6BA 2H0YA 3UE0A 3VSKA 1YLPA 3G35A 2C5WB 2VGKA 2ZC7A 1GCEA 3PBTA 1W7FA 2HP6A 4R4SA 2Y2OA 5E43A 3WRTA 1PI4A 3ZDJA 1K4FA 4RVAA 2ZC3B 3A3JA 3UE3A 5A93A 4YFMA 1IYQA 4C75A 1K55C 2OLVA 1KVLA 1ALQA 5M18A 5FQKA 4F94A 4E3NA 1MWSA 3GRJA 5HAQA 4WZ5C 2ZQ7A 3UN7A 1VQQA 3FV7A 2BLSA 4FH4A 3VP4A 2QMIA 2HP5A 3TG9A 4HBUA 5FA7A 1ES3A 2FFFB 1KE0A 4OP8A 1TDLA 3MZEA 3BECA 1CK3A 1GA9A 1FCMA 2JCHA 2WGWA 2XGNA 3FZCA 3HLGA 3ZFZA 1SDEA 1XPBA 5M1AA 2PU4A 1GHPA 5A91A 3VSLA 3BFCA 3HLEA 1KGEA 2Y55A 5FAOA 4KQQA 4WM9A 2QPNA 3Q1FA 5CERA 3UPOA 2XEPA 1NZUA 1W5DA 1IYOA 1LL5A 3G34A 3DW0A 3HBRA 4BD0A 5EUAA 4IEDA 3PBOA 2XR0A 4Z9QA 1HTZA 2ZQCA 3A3EA 2EX2A 4EQIA 3O3VA 1G6AA 3V50A 1W8YA 4WBGA 4R3JA 1TDGA 1JTGA 1S6RA 4KZ6A 3V5MA 1YT4A 1FOFA 4K91A 1L0GA 4DXCA 3OCNA 5DF9A 2FFYA 3PAEA 3ITBA 5G18A 4S2KA 3N8RA 4BLMA 2WGWB 1O07A 2WZZA 3I7JA 4OQHA 4Q8IA 3AGEA 5HAIA 4OPYA 2V1ZA 4LV3A 4E6XA 2P9VB 2HDQA 4IBXA 1LLBA 3Q81A 2J9PA 3V39A 4C6YA 1H8YA 1YMXA 3UO9A 1I2WA 4BQMA 4U3TA 2CC1A 4JXWA 1K55A 1Q2QA 4JLFA 3SOIA 2Y2MA 3N8LA 2Y4AA 3IT9A 1SDNA 1BULA 2ZC4B 4WZ5A 3Q7ZA 2HPBA 1KE4A 5EECA 3RXWA 1NYYA 5KSCA 1K25A 4PM8A 5CTMA 3OPPA 3HLWA 5DTTA 2WAEA 4KZ8A 3N7WA 2J9OA 1ESUA 5CHJA 3IXHA 4ZDXA 5E2GA 1K6RA 2HP9A 1KDWA 1SHVA 3CG5A 4S2JA 1YLWA 1XGJA 3ZGAB 4X55A 3IXGA 3ZG8B 3VOZA 1MBLA 5EOEA 1GA0A 3WS1A 1JWZA 3NC8A 4B4ZA 4D2OA 2X02A 4JBFA 5J8XA 3IXDA 5CEDA 3BYDA 5GL9A 3ZNYA 1BLCA 3W4PA 3HLBA 3HUMA 4NETA 1Q2PA 3BFFA 3N6IA 3IQAA 1CEFA 2WADA 3Q7VA 4EUZA 2WKEA 3N4IA 1J9MA 1C3BA 2WZXA 4E3KA 3E2LA 3ZG0A 3HLDA 3MBZA 2WKHA 3VFFA 2Y91A 3MKFA 3W8KA 4R0QA 3G31A 4MBHA 2ZC5B 1CEGA 1GHMA 1HZOA 1MXOA 1NXYA 5DTKA 4BL3A 3VMAA 4R3BA 4EV4A 4BENA 4KZ9A 3ZVTA 5FAQA 4A5RA 3W4OA 2OLUA 4P6BA 4PM9A 3SH9A 3BRMA 1MY8A 1M40A 1FR1A 3B3XA 2G2UA 3OPRA 4GD8A 2HDSA 5FI7A 5TR7A 1XP4A 3IWQA 3IWOA 5GHYA 4R1GA 2ZQAA 2ZM8A 3RXXA 4OOYA 5F83A 4OQIA 2Q9MA 1SKFA 4OPZA 3M2JA 4LCLA 4UA9A 4E3LA 1CI8A 2Y59A 1FSWA 1G68A 2WUQA 1GHIA 5F1GA 3Q07A 4PM5A 5CHUA 3HREA 3EQUA 4S2LA 4OLDA 3S22A 4EWFA 2G2WA 4X56A 4N92A 1NRFA 2DNSA 2ZM2A 4DE1A 2Y2PA 5FASA 4JXGA 2DRWA 2WAFA 2X01A 3PAGA 3VFHA 3ZG9B 1IYSA 4R23A 4QHCA 4DDSA 4C3QA 4XXRA 1XA7A 2XDMA 5FQIA 5CXWA 2EXBA 5EVIA 3IXBA 3C4PA 2P74A 1YLTA 1WYCA 5CEBA 3O87A 5EVID 3G2ZA 3PBRA 4ID4A 4N1HA 4OP5A 5GLDA 3CJMA 5EVLA 3V3SA 1KGFA 4PPRA 1L0FA 1IYPA 1TEMA 2EX9A 4WMCD 2V2FF 1NJ4A 4S2NC 4CJNA 1ZG6A 2XF3A 4H8RA 3GV9A 4MBFA 2EX6A 5GHZA 4RYEA 2ZMAA 5CGXA 1ESIA 3O86A 3UY6A 3G2YA 4OKPA 5M19A 1QMFA 2IWDA 2XK1A 1ZKJA 3MFDA 3MXSA 4DKIA 3OZHA 1PWDA 4BJPA 3GVBA 2EX8A 4OONA 2ZD8A 1KE3A 4JPMA 4GDBA 5F1FA 4R4RA 3HVFA 2Y2HA 3C5AA 4GZBA 3ZCZA 1H5XA 3IF6C 4U0XA 3FYZA 2J7VA 4NK3A 1PWGA 1CI9A 4Y0TA 2R9XA 4OQGA 4WYYA 3HUNA 4KZAA 5BOHA 5KZHA 2Z2MB 3SS3A 1BUEA 5GLCA 2OV5A 3LY3A 4Y0UA 5FAPA 1LHYA 1I2SA 2Y2QA 1W79A 1E25A 1EWZA 4HBTA 5AQAA 4BL2A 4WEJA 4ZAMA 4EBLA 4UA6A 1I5QA 2PU2A 5HX9A 1AXBA 4JXVA 1YQSA 3C7VA 4JF6A 2ZLYA 1PZPA 1ONGA 4GD6A 4L0LA 1NYMA 3LY4A 3IF5A 4JXSA 5FQMA 4S2NA 3FKWA 3DWZA 1ZC2A 4N9LA 3TSGA 3QNCA 5CHMA 1BTLA 1N4OA 3FWLA 3EQVA 4BD1A 5FQQA 5HW3A 5EVIC 3M6HA 5FATA 3OC2A 2XFSA 5TFQA 1XA1A 4MBKA 4CPKA 1K57C 5E2HA 5CRFA 3JYIA 4DE2A 3WS0A 4FH2A 3BFGA 2XFTA 5HAPA 1ES5A 4DE0A 5JYOA 3V3RA 4QY6A 1FQGA 5IHVA 1OMEA 3MXRA 3IF6A 1Z6FA 4QB8A 2HDUA 1RP5A 3RJUA 1BLHA 5EE8A 3BM6A 3WS2A 5DF8A 2C6WB 5FDHA 4WEKA 2BG1A 3C4OA 2ZQ8A 1K38A 1ONHA 2B5RA 1YMSA 3SH7A 2Y2LA 2Z2LB 4K0XA 5A92A 1YM1A 1ZG4A 3GQZA 3OPHA 4XUXA 4XUZA 5HFOA 4RX3A 3Q7VB 4OH0A 1TVFA 2WKIA 3NDGA 4U0TA 1DY6A 2JE5A 4B88A 3TOIA 1KVMA 3E2KA 4LV1A 3NCKA 5CGWA 2ZQ9A 4E6WA 4GKUA 3ZG5A 5KSHA 1HD8A 4GNUA 3IF6B 3CMZA 1BZAA 2WK0A 2QZ6A 2R9WA 4JF4A 4GN2A 1KGGA 4QD4A 4ZJ1A 1YLYA 2H5SA 3HUOA 2ZJ9A 4FSFA 2A3UA 5GHXA 3MZFA 2JC7A 5EPHA 1IEMA 4PMAA 3ZHHA 1BSGA 2EFXA 2Y2JA 1MKIA 4DF6A 3M2KA 4MNRA 3NI9A 4KQRA 3PBQA 1N9BA 3O88A 5D3OA 1YLJA 1BLPA 1H8ZA 3LEZA 3LO7A 1K57A 3BLSA 4OLGA 1S0WA 3OPLA 4OOLA 4WELA 4KZ7A 4WMCA 2RCXA 3W4QA 4LENA 3BLMA 4KQOA 1DJCA 4WZ4A 1XXMA 1E4DA 3BEBA 2HDRA 4KG6A 4LV2A 4OVDA 5E2EA 2Y2NA 5U47A 3UDIA 4E3JA 3OCLA 5FQ9A 2IWCA 4KZ3A 1K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y54 A;  3N8S A;  2XD5 A;  5AQ9 A;  2Y2K A;  1HVB A;  3IWI A;  1KDS A;  5L2F A;  4IVK A;  4S2O A;  4ZBE A;  3SS5 A;  1XGI A;  4N1X A;  1VM1 A;  3UPN A;  1IEL A;  4OQ0 A;  3D4F A;  5CGS A;  5DF7 A;  4EBN A;  1L0E A;  4IBR A;  5EVI B;  3IHB A;  5FQJ A;  4GB7 A;  4N9K A;  1RGY A;  5FSR A;  1DJB A;  1O7E A;  3QHY A;  1U60 A;  1E3U A;  2A49 A;  4PM6 A;  5HAR A;  2P9V A;  2X71 A;  4S2P A;  3SH8 A;  3NDE A;  4DRT A;  3CZD A;  1E3U D;  3DWK A;  4UAA A;  1PIO A;  5JYP A;  4KZ4 A;  3A3I A;  3ITA A;  2XD1 A;  1LI0 A;  5F82 A;  1RCJ A;  2Q9N A;  3BFE A;  1ERO A;  3IH8 A;  4OOM A;  1PW1 A;  2ZM0 A;  3ZG7 B;  2XQZ A;  4S2I A;  2EXA A;  3HL9 A;  1WYB A;  2ZQD A;  5A90 A;  1BLS A;  3G32 A;  1W8Q A;  2E8I A;  4QJG A;  1RGZ A;  3ZVW A;  4ZJ2 A;  4ZJ3 A;  2EFU A;  1ES2 A;  4LV0 A;  2XH9 A;  4M3K A;  1PZO A;  2WYX A;  1MPL A;  4X69 A;  4EBP A;  1MWR A;  4OPR A;  3ZNT A;  4S2M A;  1K54 C;  3WRZ A;  5EOO A;  3MKE A;  5I94 A;  3UNW A;  2Y2I A;  3GSG A;  5FI2 A;  3P09 A;  1PI5 A;  3IH9 A;  3P98 A;  4FD8 A;  4DE3 A;  4E3O A;  3IHA A;  4P87 A;  1LL9 A;  4X53 A;  3WS5 A;  1SCW A;  4X6T A;  1PW8 A;  4O7D A;  4E3M A;  5HL1 A;  4GOG A;  4PM7 A;  4DXB A;  2Y2G A;  2DCF A;  3SS4 A;  4OPQ A;  4ZTK A;  1EI5 A;  2PBY A;  3WS4 A;  1NY0 A;  3G4P A;  1PWC A;  1FCN A;  3NY4 A;  1DJA A;  1FCO A;  1YLZ A;  3A3F A;  3LCE A;  4X68 A;  1L0D A;  3VOY A;  1MWT A;  4UA7 A;  3Q82 A;  4FCF A;  4QY5 A;  4RX2 A;  3HLF A;  2XLN A;  3WWX A;  1PYY A;  3VP3 A;  5DTS A;  5AQ7 A;  1K56 A;  3GMW A;  5GLB A;  1WE4 A;  4KG5 A;  1JWP A;  1XKZ A;  3ISG A;  1K56 D;  3GR2 A;  4IVI A;  5CEC A;  1BT5 A;  2GDN A;  2I72 A;  3G30 A;  1LI9 A;  4Y0O A;  2OSU A;  1M6K A;  2ZC6 B;  3QNB A;  5DVA A;  5E2F A;  3AGD A;  2IWB A;  1JWV A;  5CTN A;  3UE1 A;  4UHU A;  4Y7P A;  4JF5 A;  1QME A;  3AGF A;  3S4X A;  4KG2 A;  1NZO A;  5FI6 A;  4GDN A;  5GLA A;  3PTE A;  2UWX A;  4MEZ A;  5AQB A;  3FKV A;  4HEF A;  4P85 A;  4E3I A;  4KZ5 A;  5TGF A;  4DDY A;  3PBS A;  4HES A;  2VGJ A;  2WGV A;  4K0W A;  1K6S A;  3BFD A;  3S1Y A;  3UDF A;  1XX2 A;  4KZB A;  1MWU A;  1K54 A;  5KMW A;  2V20 A;  3HLC A;  4KEN B;  3UPP A;  1FSY A;  3NBL A;  4P0M A;  1IKI A;  1ES4 A;  3UDX A;  3A3D A;  3MZD A;  1IKG A;  4JKT A;  1L2S A;  4RA7 A;  3GTC A;  3NIA A;  1FR6 A;  1JVJ A;  2J8Y A;  2RL3 A;  3C7U A;  3VP1 A;  2H0T A;  4MLL A;  4YIN A;  4B4X A;  3VP2 A;  2WGI A;  4QU3 A;  1ERQ A;  4LCM A;  1ERM A;  2H10 A;  3PBN A;  2JBF A;  3VP0 A;  3DTM A;  1JTD A;  3M6B A;  2H0Y A;  3UE0 A;  3VSK A;  1YLP A;  3G35 A;  2C5W B;  2VGK A;  2ZC7 A;  1GCE A;  3PBT A;  1W7F A;  2HP6 A;  4R4S A;  2Y2O A;  5E43 A;  3WRT A;  1PI4 A;  3ZDJ A;  1K4F A;  4RVA A;  2ZC3 B;  3A3J A;  3UE3 A;  5A93 A;  4YFM A;  1IYQ A;  4C75 A;  1K55 C;  2OLV A;  1KVL A;  1ALQ A;  5M18 A;  5FQK A;  4F94 A;  4E3N A;  1MWS A;  3GRJ A;  5HAQ A;  4WZ5 C;  2ZQ7 A;  3UN7 A;  1VQQ A;  3FV7 A;  2BLS A;  4FH4 A;  3VP4 A;  2QMI A;  2HP5 A;  3TG9 A;  4HBU A;  5FA7 A;  1ES3 A;  2FFF B;  1KE0 A;  4OP8 A;  1TDL A;  3MZE A;  3BEC A;  1CK3 A;  1GA9 A;  1FCM A;  2JCH A;  2WGW A;  2XGN A;  3FZC A;  3HLG A;  3ZFZ A;  1SDE A;  1XPB A;  5M1A A;  2PU4 A;  1GHP A;  5A91 A;  3VSL A;  3BFC A;  3HLE A;  1KGE A;  2Y55 A;  5FAO A;  4KQQ A;  4WM9 A;  2QPN A;  3Q1F A;  5CER A;  3UPO A;  2XEP A;  1NZU A;  1W5D A;  1IYO A;  1LL5 A;  3G34 A;  3DW0 A;  3HBR A;  4BD0 A;  5EUA A;  4IED A;  3PBO A;  2XR0 A;  4Z9Q A;  1HTZ A;  2ZQC A;  3A3E A;  2EX2 A;  4EQI A;  3O3V A;  1G6A A;  3V50 A;  1W8Y A;  4WBG A;  4R3J A;  1TDG A;  1JTG A;  1S6R A;  4KZ6 A;  3V5M A;  1YT4 A;  1FOF A;  4K91 A;  1L0G A;  4DXC A;  3OCN A;  5DF9 A;  2FFY A;  3PAE A;  3ITB A;  5G18 A;  4S2K A;  3N8R A;  4BLM A;  2WGW B;  1O07 A;  2WZZ A;  3I7J A;  4OQH A;  4Q8I A;  3AGE A;  5HAI A;  4OPY A;  2V1Z A;  4LV3 A;  4E6X A;  2P9V B;  2HDQ A;  4IBX A;  1LLB A;  3Q81 A;  2J9P A;  3V39 A;  4C6Y A;  1H8Y A;  1YMX A;  3UO9 A;  1I2W A;  4BQM A;  4U3T A;  2CC1 A;  4JXW A;  1K55 A;  1Q2Q A;  4JLF A;  3SOI A;  2Y2M A;  3N8L A;  2Y4A A;  3IT9 A;  1SDN A;  1BUL A;  2ZC4 B;  4WZ5 A;  3Q7Z A;  2HPB A;  1KE4 A;  5EEC A;  3RXW A;  1NYY A;  5KSC A;  1K25 A;  4PM8 A;  5CTM A;  3OPP A;  3HLW A;  5DTT A;  2WAE A;  4KZ8 A;  3N7W A;  2J9O A;  1ESU A;  5CHJ A;  3IXH A;  4ZDX A;  5E2G A;  1K6R A;  2HP9 A;  1KDW A;  1SHV A;  3CG5 A;  4S2J A;  1YLW A;  1XGJ A;  3ZGA B;  4X55 A;  3IXG A;  3ZG8 B;  3VOZ A;  1MBL A;  5EOE A;  1GA0 A;  3WS1 A;  1JWZ A;  3NC8 A;  4B4Z A;  4D2O A;  2X02 A;  4JBF A;  5J8X A;  3IXD A;  5CED A;  3BYD A;  5GL9 A;  3ZNY A;  1BLC A;  3W4P A;  3HLB A;  3HUM A;  4NET A;  1Q2P A;  3BFF A;  3N6I A;  3IQA A;  1CEF A;  2WAD A;  3Q7V A;  4EUZ A;  2WKE A;  3N4I A;  1J9M A;  1C3B A;  2WZX A;  4E3K A;  3E2L A;  3ZG0 A;  3HLD A;  3MBZ A;  2WKH A;  3VFF A;  2Y91 A;  3MKF A;  3W8K A;  4R0Q A;  3G31 A;  4MBH A;  2ZC5 B;  1CEG A;  1GHM A;  1HZO A;  1MXO A;  1NXY A;  5DTK A;  4BL3 A;  3VMA A;  4R3B A;  4EV4 A;  4BEN A;  4KZ9 A;  3ZVT A;  5FAQ A;  4A5R A;  3W4O A;  2OLU A;  4P6B A;  4PM9 A;  3SH9 A;  3BRM A;  1MY8 A;  1M40 A;  1FR1 A;  3B3X A;  2G2U A;  3OPR A;  4GD8 A;  2HDS A;  5FI7 A;  5TR7 A;  1XP4 A;  3IWQ A;  3IWO A;  5GHY A;  4R1G A;  2ZQA A;  2ZM8 A;  3RXX A;  4OOY A;  5F83 A;  4OQI A;  2Q9M A;  1SKF A;  4OPZ A;  3M2J A;  4LCL A;  4UA9 A;  4E3L A;  1CI8 A;  2Y59 A;  1FSW A;  1G68 A;  2WUQ A;  1GHI A;  5F1G A;  3Q07 A;  4PM5 A;  5CHU A;  3HRE A;  3EQU A;  4S2L A;  4OLD A;  3S22 A;  4EWF A;  2G2W A;  4X56 A;  4N92 A;  1NRF A;  2DNS A;  2ZM2 A;  4DE1 A;  2Y2P A;  5FAS A;  4JXG A;  2DRW A;  2WAF A;  2X01 A;  3PAG A;  3VFH A;  3ZG9 B;  1IYS A;  4R23 A;  4QHC A;  4DDS A;  4C3Q A;  4XXR A;  1XA7 A;  2XDM A;  5FQI A;  5CXW A;  2EXB A;  5EVI A;  3IXB A;  3C4P A;  2P74 A;  1YLT A;  1WYC A;  5CEB A;  3O87 A;  5EVI D;  3G2Z A;  3PBR A;  4ID4 A;  4N1H A;  4OP5 A;  5GLD A;  3CJM A;  5EVL A;  3V3S A;  1KGF A;  4PPR A;  1L0F A;  1IYP A;  1TEM A;  2EX9 A;  4WMC D;  2V2F F;  1NJ4 A;  4S2N C;  4CJN A;  1ZG6 A;  2XF3 A;  4H8R A;  3GV9 A;  4MBF A;  2EX6 A;  5GHZ A;  4RYE A;  2ZMA A;  5CGX A;  1ESI A;  3O86 A;  3UY6 A;  3G2Y A;  4OKP A;  5M19 A;  1QMF A;  2IWD A;  2XK1 A;  1ZKJ A;  3MFD A;  3MXS A;  4DKI A;  3OZH A;  1PWD A;  4BJP A;  3GVB A;  2EX8 A;  4OON A;  2ZD8 A;  1KE3 A;  4JPM A;  4GDB A;  5F1F A;  4R4R A;  3HVF A;  2Y2H A;  3C5A A;  4GZB A;  3ZCZ A;  1H5X A;  3IF6 C;  4U0X A;  3FYZ A;  2J7V A;  4NK3 A;  1PWG A;  1CI9 A;  4Y0T A;  2R9X A;  4OQG A;  4WYY A;  3HUN A;  4KZA A;  5BOH A;  5KZH A;  2Z2M B;  3SS3 A;  1BUE A;  5GLC A;  2OV5 A;  3LY3 A;  4Y0U A;  5FAP A;  1LHY A;  1I2S A;  2Y2Q A;  1W79 A;  1E25 A;  1EWZ A;  4HBT A;  5AQA A;  4BL2 A;  4WEJ A;  4ZAM A;  4EBL A;  4UA6 A;  1I5Q A;  2PU2 A;  5HX9 A;  1AXB A;  4JXV A;  1YQS A;  3C7V A;  4JF6 A;  2ZLY A;  1PZP A;  1ONG A;  4GD6 A;  4L0L A;  1NYM A;  3LY4 A;  3IF5 A;  4JXS A;  5FQM A;  4S2N A;  3FKW A;  3DWZ A;  1ZC2 A;  4N9L A;  3TSG A;  3QNC A;  5CHM A;  1BTL A;  1N4O A;  3FWL A;  3EQV A;  4BD1 A;  5FQQ A;  5HW3 A;  5EVI C;  3M6H A;  5FAT A;  3OC2 A;  2XFS A;  5TFQ A;  1XA1 A;  4MBK A;  4CPK A;  1K57 C;  5E2H A;  5CRF A;  3JYI A;  4DE2 A;  3WS0 A;  4FH2 A;  3BFG A;  2XFT A;  5HAP A;  1ES5 A;  4DE0 A;  5JYO A;  3V3R A;  4QY6 A;  1FQG A;  5IHV A;  1OME A;  3MXR A;  3IF6 A;  1Z6F A;  4QB8 A;  2HDU A;  1RP5 A;  3RJU A;  1BLH A;  5EE8 A;  3BM6 A;  3WS2 A;  5DF8 A;  2C6W B;  5FDH A;  4WEK A;  2BG1 A;  3C4O A;  2ZQ8 A;  1K38 A;  1ONH A;  2B5R A;  1YMS A;  3SH7 A;  2Y2L A;  2Z2L B;  4K0X A;  5A92 A;  1YM1 A;  1ZG4 A;  3GQZ A;  3OPH A;  4XUX A;  4XUZ A;  5HFO A;  4RX3 A;  3Q7V B;  4OH0 A;  1TVF A;  2WKI A;  3NDG A;  4U0T A;  1DY6 A;  2JE5 A;  4B88 A;  3TOI A;  1KVM A;  3E2K A;  4LV1 A;  3NCK A;  5CGW A;  2ZQ9 A;  4E6W A;  4GKU A;  3ZG5 A;  5KSH A;  1HD8 A;  4GNU A;  3IF6 B;  3CMZ A;  1BZA A;  2WK0 A;  2QZ6 A;  2R9W A;  4JF4 A;  4GN2 A;  1KGG A;  4QD4 A;  4ZJ1 A;  1YLY A;  2H5S A;  3HUO A;  2ZJ9 A;  4FSF A;  2A3U A;  5GHX A;  3MZF A;  2JC7 A;  5EPH A;  1IEM A;  4PMA A;  3ZHH A;  1BSG A;  2EFX A;  2Y2J A;  1MKI A;  4DF6 A;  3M2K A;  4MNR A;  3NI9 A;  4KQR A;  3PBQ A;  1N9B A;  3O88 A;  5D3O A;  1YLJ A;  1BLP A;  1H8Z A;  3LEZ A;  3LO7 A;  1K57 A;  3BLS A;  4OLG A;  1S0W A;  3OPL A;  4OOL A;  4WEL A;  4KZ7 A;  4WMC A;  2RCX A;  3W4Q A;  4LEN A;  3BLM A;  4KQO A;  1DJC A;  4WZ4 A;  1XXM A;  1E4D A;  3BEB A;  2HDR A;  4KG6 A;  4LV2 A;  4OVD A;  5E2E A;  2Y2N A;  5U47 A;  3UDI A;  4E3J A;  3OCL A;  5FQ9 A;  2IWC A;  4KZ3 A;  1K4E A; 
#chains in the Genus database with same CATH topology
 2V9A A;  3N8S A;  3IWI A;  5L2F A;  4IVK A;  4GW9 A;  4EBN A;  1L0E A;  4HY8 A;  1E3U D;  4UAA A;  2V0U A;  2VV6 A;  2OAQ 1;  2Q9N A;  3IH8 A;  4OOM A;  3O5Y A;  3ZG7 B;  2XQZ A;  5HSQ A;  4EET B;  3F1P A;  3HCY A;  3ZVW A;  4OPR A;  4S2M A;  4EXO A;  5EOO A;  5L8M A;  5I94 A;  3P98 A;  3IHA A;  3WS5 A;  2VZW A;  4X53 A;  4GS9 B;  1SCW A;  4E3M A;  4PM7 A;  4XT2 A;  4ZTK A;  1TS0 A;  1EI5 A;  2PBD P;  3QP2 A;  2ZOI A;  4F3L B;  1MWT A;  4QY5 A;  4RX2 A;  3HLF A;  3C38 A;  3VP3 A;  1XFN A;  5DTS A;  1WE4 A;  3LID A;  1K56 D;  3SW1 A;  1LI9 A;  4Y0O A;  1M6K A;  5DVA A;  3UE1 A;  3AGF A;  2W0N A;  3PTE A;  4MEZ A;  3FKV A;  4HEF A;  4P85 A;  4DDY A;  5F6A A;  4HES A;  3JPU A;  1FIL A;  1K6S A;  3UDF A;  1XX2 A;  4KZB A;  2W1T A;  1MWU A;  1H3Q A;  2V20 A;  3MSH A;  1IKI A;  4G3W A;  3LGO A;  3MZD A;  3UDX A;  1IKG A;  4JKT A;  4EES A;  2JKG A;  2RL3 A;  4UEY A;  2H0T A;  4YIN A;  2WGI A;  1ERQ A;  2XSS A;  3VSK A;  3G35 A;  2C5W B;  2VGK A;  2ZC7 A;  4HHD A;  5E43 A;  3WRT A;  3ZDJ A;  2ZC3 B;  4C75 A;  3S7Q A;  1K55 C;  2V8C A;  1ALQ A;  5M18 A;  2ZL1 B;  4GHI B;  3E4O A;  2ZQ7 A;  3UN7 A;  4P6Z M;  3VP4 A;  2HP5 A;  5FA7 A;  4OP8 A;  3SZT A;  2EA9 A;  2LB5 A;  3BEC A;  3B42 A;  3MJQ A;  4WM9 A;  1IYO A;  1LL5 A;  4BD0 A;  1G28 A;  2XR0 A;  4H6J A;  2EX2 A;  2KOI A;  3OOV A;  4EQI A;  1G6A A;  1JTG A;  3HJI A;  1FOF A;  1YPR A;  4K91 A;  1T1B A;  5KIZ A;  3IBR A;  1OTE A;  3S7N A;  3ITB A;  4IUK A;  1D7E A;  4BLM A;  2WGW B;  3CI6 A;  3I7J A;  5HAI A;  5DKK A;  1NLZ A;  4IBX A;  4R3A A;  4WF0 A;  1H8Y A;  1I2W A;  4BQM A;  1LT0 A;  1Q2Q A;  1F9I A;  4Y15 A;  1JNU A;  5DTT A;  2VLG A;  1KDW A;  1YLW A;  1MBL A;  1GA0 A;  5J8X A;  4ETZ A;  3R7W A;  4XT2 B;  1BLC A;  3PYP A;  3IQA A;  1Y28 A;  3Q7V A;  3N4I A;  1C3B A;  1P9R A;  4B93 A;  5IS1 A;  4I39 A;  2WKH A;  3DTK A;  1OTD A;  3FPW A;  2ZC5 B;  1CEG A;  3KSH A;  1MXO A;  3P7N A;  3IBJ A;  4EV4 A;  1Y4O A;  3NEC A;  4YWZ A;  3W4O A;  2OLU A;  3BRM A;  4X25 A;  1FR1 A;  3B3X A;  5FI7 A;  3IWQ A;  4M4X A;  5F83 A;  4OQI A;  4OPZ A;  4UA9 A;  1GHI A;  4QWO A;  4OLD A;  1DRM A;  4D60 A;  5TBM A;  4X56 A;  2EWV A;  2DNS A;  2G7U A;  4DE1 A;  2UV0 E;  2WAF A;  3G6O A;  4DDS A;  2V0W A;  1XA7 A;  2XDM A;  1X0O A;  2W27 A;  4ESP A;  4PAU A;  3NOT C;  5HL6 A;  2ZMV A;  2INW A;  3G2Z A;  3PBR A;  4OP5 A;  4N1H A;  5GLD A;  3EWK A;  3LR0 A;  2AVX A;  1TEM A;  3H82 B;  4S2N C;  1BYW A;  4LPZ A;  5HPI A;  2KLI A;  2EX6 A;  3CIT A;  2H28 A;  4FOF A;  1GSW A;  5M19 A;  1QMF A;  3KX0 X;  4HP9 A;  4OON A;  1KE3 A;  4JPM A;  3HVF A;  4GCZ A;  4H6J B;  4Y0T A;  2R9X A;  3T4S A;  5KZH A;  2HV1 A;  1S4S A;  2Y2Q A;  5AQA A;  4UA6 A;  4JXV A;  1YQS A;  1PZP A;  3DAV A;  1NYM A;  4P6Z S;  4JXS A;  4N9L A;  2PR5 A;  2GX5 A;  5K5B A;  1VEU A;  5EVI C;  3M6H A;  2W3E A;  2B95 A;  3T4L A;  1MKM A;  3WS0 A;  5HAP A;  2GZA A;  1FQG A;  1OME A;  3QP6 A;  1BLH A;  1VET A;  4I38 A;  5DF8 A;  2HGV A;  5HPF A;  2BG1 A;  1XFQ A;  3R7W B;  3SH7 A;  2Z2L B;  4K0X A;  2V1A A;  4AFI A;  5A92 A;  5HFO A;  4XUZ A;  3Q7V B;  1TVF A;  3NDG A;  4U0T A;  2JE5 A;  5EM0 A;  4Y3I A;  4GKU A;  3ZG5 A;  5KSH A;  1G5U A;  4GNU A;  3A0S A;  3IF6 B;  4GN2 A;  1KGG A;  1YLY A;  4HOI A;  2JC7 A;  5EPH A;  1IEM A;  2EFX A;  3M2K A;  3NI9 A;  3PBQ A;  1ZHH B;  1D06 A;  1LSX A;  4HP4 A;  3LEZ A;  3W4Q A;  4LEN A;  1DJC A;  2VK3 A;  5J7E A;  4MCW A;  1XJ2 A;  1YSP A;  5AQ9 A;  1HVB A;  1KDS A;  3SS5 A;  4N1X A;  1VM1 A;  1IEL A;  3D4F A;  2M7V A;  5AVF A;  3IHB A;  2L4R A;  1DJB A;  1OTI A;  3QHY A;  1E3U A;  4PM6 A;  2X71 A;  3IS2 B;  3SH8 A;  2YKF A;  4MDZ A;  3V67 A;  4KZ4 A;  3A3I A;  1AWI A;  4GS9 A;  2JKR I;  2VX8 A;  2XD1 A;  1LI0 A;  1RCJ A;  1NWZ A;  1S67 L;  2BTF P;  2EXA A;  3HL9 A;  1OJG A;  4F3L A;  4ZJ2 A;  1ES2 A;  4M3K A;  1PZO A;  2WYX A;  2W3G A;  4I3I A;  3TW8 A;  3E4Q A;  2Y2I A;  5FI2 A;  4FD8 A;  4X6T A;  4MN5 A;  2Y2G A;  3SS4 A;  4WN5 A;  3PR6 A;  5MC7 A;  1NY0 A;  3LIF A;  1FCN A;  1DJA A;  3A3F A;  2V8F A;  4FCF A;  3BW6 A;  1PYY A;  4NXE A;  1K56 A;  3GMW A;  3OLO A;  3ISG A;  2PRF A;  2XA7 M;  4IVI A;  2I72 A;  2QKP A;  3MMH A;  2V1B A;  2IWB A;  1JWV A;  1OPX A;  1QME A;  3F1O A;  3S4X A;  1VEU B;  5FI6 A;  5GLA A;  2B02 A;  4BWI A;  3H7W A;  4KZ5 A;  5HWV A;  1N9N A;  3UPP A;  4P0M A;  2ZL1 A;  4GHI A;  2Z6C A;  4RA7 A;  1TF1 A;  2J8Y A;  1L3L A;  3C7U A;  4HNB A;  4KUK A;  4B4X A;  1H8M A;  4HH3 A;  4NXB A;  2P04 A;  1W63 M;  3NOU C;  2J3W A;  1GCE A;  2Y2O A;  3T12 B;  3T4Q A;  2KDK A;  1K4F A;  4RVA A;  3A3J A;  5A93 A;  4E04 A;  1XJ3 A;  2ZBB A;  4F94 A;  1S4R A;  3D9Y A;  4E3N A;  3GRJ A;  1VQQ A;  2ACG A;  2PHY A;  4Y17 A;  3T1R A;  5HDS A;  1CK3 A;  3FZC A;  2WGW A;  3KO6 A;  2XGN A;  3HLG A;  3ZFZ A;  4GJ4 A;  2PU4 A;  5A91 A;  3HLE A;  1KGE A;  1ACF A;  1DP8 A;  2XEP A;  1W5D A;  3G34 A;  1PFL A;  3DW0 A;  2L0W A;  3O3V A;  4WBG A;  3IX8 A;  1S6R A;  3V5M A;  1YT4 A;  1L0G A;  2M7U A;  2QYB A;  3N8R A;  1OT9 A;  4EUV A;  3LFV A;  4E6X A;  2OWH A;  1LLB A;  3W2Z A;  3LR3 A;  4EEU A;  1MZU A;  3V39 A;  1YMX A;  1H0M A;  2CC1 A;  3SOI A;  5L10 A;  2Y2M A;  4ARZ A;  1KE4 A;  3RXW A;  1NYY A;  5KSC A;  5CTM A;  3NHQ A;  5CHJ A;  4ZDX A;  5E2G A;  3D3O A;  3JVV A;  3T50 A;  3CG5 A;  1J3W A;  3ZGA B;  4X55 A;  3IXG A;  3VOZ A;  5EOE A;  1JWZ A;  4JBF A;  2HF6 A;  5GL9 A;  3T4O A;  3W4P A;  3HLB A;  4EER A;  1Q2P A;  3BFF A;  4PKY G;  2WKE A;  5DFY A;  4B9O A;  2PAV P;  4E3K A;  2GNX A;  3HLD A;  5FDS A;  3VFF A;  4JGP A;  1NXY A;  3VMA A;  4R3B A;  4KZ9 A;  2J80 A;  5FAQ A;  5FL3 A;  4PM9 A;  4FUW A;  3F1O B;  1XP4 A;  3LYX A;  3EGX C;  4R1G A;  4L9F A;  2ZQA A;  4Y5F A;  2Q9M A;  1DP9 A;  3H7W B;  4KUO A;  1CI8 A;  2Y59 A;  1FSW A;  1G68 A;  5F1G A;  3H82 A;  2JKT I;  3NUL A;  5F5Y A;  4EWF A;  4N92 A;  2E8J A;  2ZM2 A;  4JXG A;  3UB7 A;  4X1L A;  5FEG A;  5FQI A;  4LGW A;  2EXB A;  3IXB A;  2XA7 S;  2DMW A;  5LBR A;  4EW7 A;  1S1Y A;  5EVI D;  1KGF A;  3CUE C;  2EX9 A;  3QP4 A;  4WMC D;  2OAP 1;  1ZG6 A;  4H8R A;  4Z1W A;  2ZMA A;  5CGX A;  1ESI A;  4CQH A;  4QPR A;  1XJ4 A;  1IOU A;  4DKI A;  4O8G A;  2EX8 A;  1UWP X;  5F1F A;  3LR5 A;  3C5A A;  1H5X A;  4IUH A;  5HD5 A;  1CQA A;  4NG2 A;  2J7V A;  4NK3 A;  1PWG A;  5BOH A;  3SS3 A;  3LI8 A;  2OV5 A;  4Y0U A;  4Y13 A;  1LHY A;  1I2S A;  5J3W A;  1W63 Q;  4ZAM A;  3T4T A;  4EBL A;  2K2N A;  4HIA A;  4DJ3 A;  4JF6 A;  1GSX A;  2YKH A;  3LY4 A;  2VJW A;  4G3K A;  3TSG A;  4NXG A;  5IT5 A;  3CHW P;  3S7O A;  3HJK A;  1FIK A;  2J3T C;  4ARZ B;  3ZQ5 A;  5E2H A;  4HJ4 A;  4HQA A;  4FH2 A;  4WUJ A;  1ES5 A;  3MF0 A;  4CLC D;  1KOU A;  1NRJ A;  3IF6 A;  4WL9 A;  2HDU A;  1RP5 A;  2JHE A;  3WS2 A;  5FDH A;  1LSW A;  2ZQ8 A;  1YMS A;  1ZG4 A;  1T1C A;  3OPH A;  4RX3 A;  3CAX A;  2WKI A;  4B88 A;  3VOL A;  2L1M A;  1HD8 A;  5AVE A;  3UB8 A;  5CX7 A;  2VKS A;  3CMZ A;  1BZA A;  2QZ6 A;  4I3A A;  4UQI M;  2XRN A;  3MZF A;  4PMA A;  1BSG A;  4DF6 A;  1ODV A;  4KQR A;  2P7J A;  3EEH A;  1N9B A;  5D3O A;  1YLJ A;  1BLP A;  1H8Z A;  3LO7 A;  4OLG A;  3IS2 A;  3CPT A;  1S0W A;  4OOL A;  4KZ7 A;  2P08 A;  3BEB A;  4KG6 A;  5I5L A;  5FQ9 A;  1Y54 A;  5EM1 A;  2XD5 A;  2QJ5 A;  2Y2K A;  4ZBE A;  3UPN A;  4OQ0 A;  5DF7 A;  5CGS A;  4IBR A;  4NXF A;  2ZMF A;  3H9W A;  4GB7 A;  4N9K A;  5FSR A;  1O7E A;  1U60 A;  4MMN A;  2P9V A;  4S2P A;  4ME4 A;  4DRT A;  1OTA A;  3CZD A;  1PIO A;  4HJ3 A;  5JYP A;  5G4Z A;  3ITA A;  2PT7 A;  5HDD A;  1TS8 A;  3BFE A;  2ZM0 A;  3VE4 A;  1WYB A;  2ZQD A;  5A90 A;  3G32 A;  3ZYT A;  1W8Q A;  2E8I A;  4QJG A;  2EFU A;  2XH9 A;  4EBP A;  1T1A A;  3MR0 A;  3MS6 A;  3KSG A;  3WRZ A;  3UNW A;  4DN0 A;  1UWN X;  4DE3 A;  1LL9 A;  2DCF A;  4OPQ A;  4IJG A;  3WS4 A;  3G4P A;  3NY4 A;  1FCO A;  1YLZ A;  3LCE A;  4X68 A;  1L0D A;  3VOY A;  2HJ9 C;  3Q82 A;  3LIE A;  4KG5 A;  5EFW A;  3GDI A;  3GR2 A;  5CEC A;  1BT5 A;  2GDN A;  3G30 A;  2OSU A;  2LB9 A;  3E0Y A;  4PHT A;  2ZC6 B;  2NUP C;  3D72 A;  1TS6 A;  3AGD A;  4Y7P A;  4JGQ A;  4KG2 A;  1NZO A;  4GDN A;  1UGU A;  4E3I A;  4R38 A;  2VGJ A;  4K0W A;  3BFD A;  4I3J A;  1K54 A;  5KMW A;  3HLC A;  4KEN B;  3NBL A;  3A3D A;  3QP8 A;  3GTC A;  1JVJ A;  1G6O A;  3LIA A;  4QU3 A;  4LCM A;  2H10 A;  2VV8 A;  2JBF A;  2W3D A;  4R70 A;  2K31 A;  3DTM A;  1JTD A;  3UE0 A;  2H0Y A;  2JN7 A;  3K2N A;  3PBT A;  4II7 A;  1PI4 A;  3UE3 A;  4YFM A;  1IYQ A;  2OLV A;  5HWT A;  3L7H A;  5L07 A;  5HAQ A;  3FV7 A;  2BLS A;  4FH4 A;  1DP6 A;  2QMI A;  1P9W A;  3U2A A;  4EU0 A;  2FFF B;  1FCM A;  2JCH A;  1XPB A;  5M1A A;  2VEA A;  1ZTU A;  3VSL A;  2Y55 A;  3CPT B;  5CER A;  3Q1F A;  1NZU A;  3HBR A;  3PBO A;  2XRO A;  4Z9Q A;  1HTZ A;  1PRQ A;  3V50 A;  1W8Y A;  4Q0I A;  4R3J A;  1TDG A;  5HD3 A;  3OCN A;  2FFY A;  3PAE A;  4Q8I A;  3AGE A;  4Y2F A;  4OPY A;  2V1Z A;  1PNE A;  2P9V B;  5IU1 A;  2HDQ A;  3DTI A;  4C6Y A;  2K7S A;  4FTX A;  3N8L A;  2Y4A A;  2ZC4 B;  4WZ5 A;  3OBF A;  5EEC A;  1N9O A;  3KSI A;  1K25 A;  3OPP A;  3HLW A;  1T18 A;  2IA2 A;  2WAE A;  4KZ8 A;  1ESU A;  3IXH A;  2VA0 A;  1K6R A;  3DBA A;  3WS1 A;  3NC8 A;  3IXD A;  4MN6 A;  5CED A;  1D1J A;  3TJZ C;  3HUM A;  4NET A;  5G4Y A;  4KQD A;  1CEF A;  2WAD A;  3MQ0 A;  1N9L A;  3E2L A;  3ZG0 A;  4MBH A;  4BEN A;  3ZVT A;  4A5R A;  4DJ2 A;  4P6B A;  3SH9 A;  1MY8 A;  4NKP A;  5TR7 A;  4GD8 A;  3IWO A;  2ZM8 A;  4OOY A;  4HJ6 A;  1SKF A;  2Z6D A;  3M2J A;  4LCL A;  4E3L A;  3T1X A;  2O99 A;  1T19 A;  2WUQ A;  1SKO A;  3HRE A;  4BMW A;  2G2W A;  3T1Q B;  1NRF A;  2Y2P A;  2X01 A;  1IYS A;  5CXW A;  5EVI A;  1IFQ A;  1WYC A;  5CEB A;  3QP5 A;  2J3T D;  5DJU A;  1TS7 A;  1IYP A;  4GLQ A;  4JGO A;  4LRY C;  2HZ5 A;  3LIB A;  4CJN A;  3LIC A;  5GHZ A;  3KSF A;  3UY6 A;  4BBT A;  4ETX A;  5TJJ A;  3P01 A;  3VE3 A;  3MFD A;  2OOL A;  3MXS A;  3GVB A;  2ZD8 A;  2OWJ A;  4GDB A;  4R4R A;  3UB6 A;  3IF6 C;  5FEF A;  3FYZ A;  4ZRR A;  3U4L P;  1LL8 A;  4OQG A;  4WYY A;  3HUN A;  1BUE A;  1F98 A;  1NLY A;  3LY3 A;  5FAP A;  1W79 A;  1E25 A;  1EWZ A;  3EOI A;  4BL2 A;  1AXB A;  3JVU A;  5HZH A;  5C5K A;  1ONG A;  5FQM A;  3FKW A;  3DWZ A;  1ZC2 A;  2MJ6 A;  3QNC A;  5CHM A;  3NOP C;  1BTL A;  1GSV A;  3A0R A;  3R4K A;  3FWL A;  4BD1 A;  5FQQ A;  3A0V A;  5HW3 A;  3EEA A;  2O9A A;  5TFQ A;  4MBK A;  5CRF A;  4Q0H A;  3LUQ A;  4CLC A;  3V3R A;  1YKD A;  5IHV A;  3MXR A;  2O0Y A;  4QB8 A;  3IX3 A;  5EE8 A;  2C6W B;  4MN7 A;  4WEK A;  4LFU A;  1YSQ A;  3C4O A;  2EWW A;  2B5R A;  1EW0 A;  4G3V A;  4CLC E;  2CMN A;  3B33 A;  4OH0 A;  5EVE A;  4LLO B;  1DY6 A;  3TOI A;  2W1R A;  3KYZ A;  5CGW A;  2ZQ9 A;  5HWW A;  4E6W A;  2WK0 A;  3HUO A;  2JKR M;  3C30 A;  1CJF A;  2QHK A;  4MNR A;  3O88 A;  2PYR A;  3F1N A;  1K57 A;  3C2W A;  4WEL A;  3BLM A;  4KQO A;  1SKO B;  1XXM A;  5E2E A;  4OVD A;  2Y2N A;  5U47 A;  3UDI A;  4E3J A;  3OCL A;  2IWC A;  4KZ3 A;  3E4P A;  4S2O A;  1XGI A;  4YOF A;  1TD5 A;  5EV0 A;  2D02 A;  5EVI B;  5FQJ A;  1RGY A;  3MXQ A;  2A49 A;  2NUT C;  5HAR A;  4K08 A;  3NDE A;  4PKY A;  3DWK A;  4HH2 A;  5F82 A;  2M1C A;  1ERO A;  1HLU P;  1PW1 A;  5DJT A;  2QJ7 A;  4S2I A;  3UME A;  1BLS A;  2WKP A;  1RGZ A;  3CLO A;  4ZJ3 A;  5A8B A;  4LV0 A;  4YNR A;  4X69 A;  1MPL A;  1MWR A;  2Y79 A;  3ZNT A;  1K54 C;  3MKE A;  3GSG A;  3P09 A;  1PI5 A;  3IH9 A;  4E3O A;  4P87 A;  5HL1 A;  2D01 A;  1PW8 A;  4O7D A;  3UE6 A;  4GOG A;  4DXB A;  2ZOH A;  2PBY A;  3LEQ A;  1PWC A;  3F1P B;  2PD7 A;  1CF0 A;  4UA7 A;  2R78 A;  3TE8 A;  4Q0J A;  2XLN A;  4BBU A;  3WWX A;  2W3F A;  1OTB A;  5AQ7 A;  3KYE A;  3MQO A;  5GLB A;  2BAS A;  1JWP A;  1XKZ A;  3BY8 A;  1SZV A;  3QNB A;  4IHQ A;  5E2F A;  5CTN A;  4UHU A;  4JF5 A;  3CWF A;  2WKQ A;  2UWX A;  5AQB A;  3B47 A;  5TGF A;  3PBS A;  2WGV A;  4CLC B;  3S1Y A;  3FPV A;  1FSY A;  4HI4 A;  1ES4 A;  2I9V A;  3DTE A;  2JKF A;  1L2S A;  1P0Z A;  3NIA A;  1FR6 A;  3VP1 A;  4MLL A;  3S7P A;  3VP2 A;  3L9K A;  3VP0 A;  1ERM A;  3PBN A;  5L09 A;  3M6B A;  1YLP A;  4O0P A;  2QWS A;  1W7F A;  2HP6 A;  4R4S A;  2W1T B;  1KVL A;  5FQK A;  1MWS A;  1LSV A;  4WZ5 C;  3NJA A;  3BQA A;  3T4K A;  3TG9 A;  4HBU A;  1ES3 A;  1KE0 A;  1TDL A;  3MZE A;  2W3H A;  1GA9 A;  1SDE A;  3F1N B;  1GHP A;  3BFC A;  3T1S A;  5FAO A;  4KQQ A;  2QPN A;  2O9C A;  3UPO A;  5EUA A;  4IED A;  2A24 A;  5J4E A;  2ZQC A;  3A3E A;  3UMD A;  2PD8 A;  4KZ6 A;  4DXC A;  5DF9 A;  1XJ6 A;  5G18 A;  4S2K A;  2WZZ A;  1O07 A;  1OJ5 A;  1MC0 A;  3LI9 A;  4OQH A;  4L9E A;  4X1M A;  4LV3 A;  3PXP A;  3Q81 A;  3TRC A;  2J9P A;  3UO9 A;  3UB5 P;  4U3T A;  4JXW A;  1K55 A;  4JLF A;  4BBV A;  3IT9 A;  1SDN A;  1BUL A;  4LRZ E;  3Q7Z A;  4JGR A;  2HPB A;  1OT6 A;  2Q0O A;  3MQQ A;  4PM8 A;  3ULF A;  2VGL M;  2J9O A;  3N7W A;  3CUE A;  1P97 A;  2HP9 A;  1SHV A;  4S2J A;  1XGJ A;  4WLA A;  3ZG8 B;  2JKT M;  4B4Z A;  4D2O A;  2X02 A;  3BYD A;  3ZNY A;  2WKR A;  4EQ1 A;  1K0K A;  3N6I A;  4EUZ A;  1J9M A;  2WZX A;  4O01 A;  2FH5 A;  3EGD C;  3MBZ A;  1V9Y A;  2Y91 A;  4EEP A;  3MKF A;  3W8K A;  4R0Q A;  3G31 A;  1GHM A;  1HZO A;  4BL3 A;  5DTK A;  3ICY A;  3BQ8 A;  2HJE A;  3C8C A;  1M40 A;  2G2U A;  3OPR A;  2HDS A;  5GHY A;  3RH8 B;  3RXX A;  3UB9 A;  5AJG A;  3Q07 A;  3T4J A;  4PM5 A;  5CHU A;  1STZ A;  3EQU A;  4S2L A;  3S22 A;  5FAS A;  2DRW A;  3PAG A;  3VFH A;  3ZG9 B;  4R23 A;  4QHC A;  4C3Q A;  4XXR A;  3C4P A;  2P74 A;  1YLT A;  3O87 A;  4ID4 A;  3RTY A;  3CJM A;  5EVL A;  3V3S A;  4DMZ A;  4PPR A;  1L0F A;  2V2F F;  1NJ4 A;  2XF3 A;  3GV9 A;  4MBF A;  5HDC A;  5TBM B;  3MFX A;  4RYE A;  3O86 A;  3G2Y A;  4OKP A;  2IWD A;  2XK1 A;  1ZKJ A;  2Y8H A;  3OZH A;  1PWD A;  4BJP A;  4CLC C;  2Y2H A;  4GZB A;  3ZCZ A;  4U0X A;  4UQI S;  1Z09 A;  5F68 A;  2A2L A;  4LRX C;  3VV4 A;  2A24 B;  1CI9 A;  3PHY A;  2PDR A;  4KZA A;  2Z2M B;  1S1Z A;  5GLC A;  3BY9 A;  4HBT A;  1F2K A;  4WEJ A;  1I5Q A;  2PU2 A;  5HX9 A;  1WA9 A;  3C7V A;  2O9B A;  2ZLY A;  2KX6 A;  4GD6 A;  4L0L A;  3FC7 A;  3IF5 A;  4S2N A;  2FZ0 A;  3E98 A;  1N4O A;  3EQV A;  1S66 L;  5FAT A;  3OC2 A;  2XFS A;  1XA1 A;  4CPK A;  1K57 C;  3IX4 A;  3JYI A;  4DE2 A;  4R6L A;  1V9Z A;  3BFG A;  2XFT A;  3RFB A;  4DE0 A;  5JYO A;  5F69 A;  4QY6 A;  3QP1 A;  1Z6F A;  3K3D A;  3RJU A;  3BWL A;  3BM6 A;  4NEE D;  2PYP A;  1K38 A;  1ONH A;  2Y2L A;  1YM1 A;  3GQZ A;  4XUX A;  1KVM A;  1A0K A;  2B18 A;  3E2K A;  4LV1 A;  3NCK A;  4L9G A;  3LR4 A;  2GJ3 A;  5DFX A;  2PR6 A;  3KYQ A;  2R9W A;  1VET B;  4JF4 A;  4QD4 A;  4ZJ1 A;  2H5S A;  4FSF A;  1VB6 A;  2ZJ9 A;  2A3U A;  5GHX A;  1YAX A;  3ZHH A;  2VGL S;  2Y2J A;  1MKI A;  4RQ9 A;  1F5M A;  3GEC A;  4I5S A;  3FG8 A;  5DKL A;  3BLS A;  4WMC A;  3OPL A;  2RCX A;  4WZ4 A;  1E4D A;  2HDR A;  3BJN A;  4LV2 A;  1VHM A;  3K3C A;  2VV7 A;  1K4E A; 
#chains in the Genus database with same CATH homology
 1Y54 A;  3N8S A;  2XD5 A;  5AQ9 A;  2Y2K A;  1HVB A;  3IWI A;  1KDS A;  5L2F A;  4IVK A;  4S2O A;  4ZBE A;  3SS5 A;  1XGI A;  4N1X A;  1VM1 A;  3UPN A;  1IEL A;  4OQ0 A;  3D4F A;  5CGS A;  5DF7 A;  4EBN A;  1L0E A;  4IBR A;  5EVI B;  3IHB A;  5FQJ A;  4GB7 A;  4N9K A;  1RGY A;  5FSR A;  1DJB A;  1O7E A;  3QHY A;  1U60 A;  1E3U A;  2A49 A;  4PM6 A;  5HAR A;  2P9V A;  2X71 A;  4S2P A;  3SH8 A;  3NDE A;  4DRT A;  3CZD A;  1E3U D;  3DWK A;  4UAA A;  1PIO A;  5JYP A;  4KZ4 A;  3A3I A;  3ITA A;  2XD1 A;  1LI0 A;  5F82 A;  1RCJ A;  2Q9N A;  3BFE A;  1ERO A;  3IH8 A;  4OOM A;  1PW1 A;  2ZM0 A;  3ZG7 B;  2XQZ A;  4S2I A;  2EXA A;  3HL9 A;  1WYB A;  2ZQD A;  5A90 A;  1BLS A;  3G32 A;  1W8Q A;  2E8I A;  4QJG A;  1RGZ A;  3ZVW A;  4ZJ2 A;  4ZJ3 A;  2EFU A;  1ES2 A;  4LV0 A;  2XH9 A;  4M3K A;  1PZO A;  2WYX A;  1MPL A;  4X69 A;  4EBP A;  1MWR A;  4OPR A;  3ZNT A;  4S2M A;  1K54 C;  3WRZ A;  5EOO A;  3MKE A;  5I94 A;  3UNW A;  2Y2I A;  3GSG A;  5FI2 A;  3P09 A;  1PI5 A;  3IH9 A;  3P98 A;  4FD8 A;  4DE3 A;  4E3O A;  3IHA A;  4P87 A;  1LL9 A;  4X53 A;  3WS5 A;  1SCW A;  4X6T A;  1PW8 A;  4O7D A;  4E3M A;  5HL1 A;  4GOG A;  4PM7 A;  4DXB A;  2Y2G A;  2DCF A;  3SS4 A;  4OPQ A;  4ZTK A;  1EI5 A;  2PBY A;  3WS4 A;  1NY0 A;  3G4P A;  1PWC A;  1FCN A;  3NY4 A;  1DJA A;  1FCO A;  1YLZ A;  3A3F A;  3LCE A;  4X68 A;  1L0D A;  3VOY A;  1MWT A;  4UA7 A;  3Q82 A;  4FCF A;  4QY5 A;  4RX2 A;  3HLF A;  2XLN A;  3WWX A;  1PYY A;  3VP3 A;  5DTS A;  5AQ7 A;  1K56 A;  3GMW A;  5GLB A;  1WE4 A;  4KG5 A;  1JWP A;  1XKZ A;  3ISG A;  1K56 D;  3GR2 A;  4IVI A;  5CEC A;  1BT5 A;  2GDN A;  2I72 A;  3G30 A;  1LI9 A;  4Y0O A;  2OSU A;  1M6K A;  2ZC6 B;  3QNB A;  5DVA A;  5E2F A;  3AGD A;  2IWB A;  1JWV A;  5CTN A;  3UE1 A;  4UHU A;  4Y7P A;  4JF5 A;  1QME A;  3AGF A;  3S4X A;  4KG2 A;  1NZO A;  5FI6 A;  4GDN A;  5GLA A;  3PTE A;  2UWX A;  4MEZ A;  5AQB A;  3FKV A;  4HEF A;  4P85 A;  4E3I A;  4KZ5 A;  5TGF A;  4DDY A;  3PBS A;  4HES A;  2VGJ A;  2WGV A;  4K0W A;  1K6S A;  3BFD A;  3S1Y A;  3UDF A;  1XX2 A;  4KZB A;  1MWU A;  1K54 A;  5KMW A;  2V20 A;  3HLC A;  4KEN B;  3UPP A;  1FSY A;  3NBL A;  4P0M A;  1IKI A;  1ES4 A;  3UDX A;  3A3D A;  3MZD A;  1IKG A;  4JKT A;  1L2S A;  4RA7 A;  3GTC A;  3NIA A;  1FR6 A;  1JVJ A;  2J8Y A;  2RL3 A;  3C7U A;  3VP1 A;  2H0T A;  4MLL A;  4YIN A;  4B4X A;  3VP2 A;  2WGI A;  4QU3 A;  1ERQ A;  4LCM A;  1ERM A;  2H10 A;  3PBN A;  2JBF A;  3VP0 A;  3DTM A;  1JTD A;  3M6B A;  2H0Y A;  3UE0 A;  3VSK A;  1YLP A;  3G35 A;  2C5W B;  2VGK A;  2ZC7 A;  1GCE A;  3PBT A;  1W7F A;  2HP6 A;  4R4S A;  2Y2O A;  5E43 A;  3WRT A;  1PI4 A;  3ZDJ A;  1K4F A;  4RVA A;  2ZC3 B;  3A3J A;  3UE3 A;  5A93 A;  4YFM A;  1IYQ A;  4C75 A;  1K55 C;  2OLV A;  1KVL A;  1ALQ A;  5M18 A;  5FQK A;  4F94 A;  4E3N A;  1MWS A;  3GRJ A;  5HAQ A;  4WZ5 C;  2ZQ7 A;  3UN7 A;  1VQQ A;  3FV7 A;  2BLS A;  4FH4 A;  3VP4 A;  2QMI A;  2HP5 A;  3TG9 A;  4HBU A;  5FA7 A;  1ES3 A;  2FFF B;  1KE0 A;  4OP8 A;  1TDL A;  3MZE A;  3BEC A;  1CK3 A;  1GA9 A;  1FCM A;  2JCH A;  2WGW A;  2XGN A;  3FZC A;  3HLG A;  3ZFZ A;  1SDE A;  1XPB A;  5M1A A;  2PU4 A;  1GHP A;  5A91 A;  3VSL A;  3BFC A;  3HLE A;  1KGE A;  2Y55 A;  5FAO A;  4KQQ A;  4WM9 A;  2QPN A;  3Q1F A;  5CER A;  3UPO A;  2XEP A;  1NZU A;  1W5D A;  1IYO A;  1LL5 A;  3G34 A;  3DW0 A;  3HBR A;  4BD0 A;  5EUA A;  4IED A;  3PBO A;  2XR0 A;  4Z9Q A;  1HTZ A;  2ZQC A;  3A3E A;  2EX2 A;  4EQI A;  3O3V A;  1G6A A;  3V50 A;  1W8Y A;  4WBG A;  4R3J A;  1TDG A;  1JTG A;  1S6R A;  4KZ6 A;  3V5M A;  1YT4 A;  1FOF A;  4K91 A;  1L0G A;  4DXC A;  3OCN A;  5DF9 A;  2FFY A;  3PAE A;  3ITB A;  5G18 A;  4S2K A;  3N8R A;  4BLM A;  2WGW B;  1O07 A;  2WZZ A;  3I7J A;  4OQH A;  4Q8I A;  3AGE A;  5HAI A;  4OPY A;  2V1Z A;  4LV3 A;  4E6X A;  2P9V B;  2HDQ A;  4IBX A;  1LLB A;  3Q81 A;  2J9P A;  3V39 A;  4C6Y A;  1H8Y A;  1YMX A;  3UO9 A;  1I2W A;  4BQM A;  4U3T A;  2CC1 A;  4JXW A;  1K55 A;  1Q2Q A;  4JLF A;  3SOI A;  2Y2M A;  3N8L A;  2Y4A A;  3IT9 A;  1SDN A;  1BUL A;  2ZC4 B;  4WZ5 A;  3Q7Z A;  2HPB A;  1KE4 A;  5EEC A;  3RXW A;  1NYY A;  5KSC A;  1K25 A;  4PM8 A;  5CTM A;  3OPP A;  3HLW A;  5DTT A;  2WAE A;  4KZ8 A;  3N7W A;  2J9O A;  1ESU A;  5CHJ A;  3IXH A;  4ZDX A;  5E2G A;  1K6R A;  2HP9 A;  1KDW A;  1SHV A;  3CG5 A;  4S2J A;  1YLW A;  1XGJ A;  3ZGA B;  4X55 A;  3IXG A;  3ZG8 B;  3VOZ A;  1MBL A;  5EOE A;  1GA0 A;  3WS1 A;  1JWZ A;  3NC8 A;  4B4Z A;  4D2O A;  2X02 A;  4JBF A;  5J8X A;  3IXD A;  5CED A;  3BYD A;  5GL9 A;  3ZNY A;  1BLC A;  3W4P A;  3HLB A;  3HUM A;  4NET A;  1Q2P A;  3BFF A;  3N6I A;  3IQA A;  1CEF A;  2WAD A;  3Q7V A;  4EUZ A;  2WKE A;  3N4I A;  1J9M A;  1C3B A;  2WZX A;  4E3K A;  3E2L A;  3ZG0 A;  3HLD A;  3MBZ A;  2WKH A;  3VFF A;  2Y91 A;  3MKF A;  3W8K A;  4R0Q A;  3G31 A;  4MBH A;  2ZC5 B;  1CEG A;  1GHM A;  1HZO A;  1MXO A;  1NXY A;  5DTK A;  4BL3 A;  3VMA A;  4R3B A;  4EV4 A;  4BEN A;  4KZ9 A;  3ZVT A;  5FAQ A;  4A5R A;  3W4O A;  2OLU A;  4P6B A;  4PM9 A;  3SH9 A;  3BRM A;  1MY8 A;  1M40 A;  1FR1 A;  3B3X A;  2G2U A;  3OPR A;  4GD8 A;  2HDS A;  5FI7 A;  5TR7 A;  1XP4 A;  3IWQ A;  3IWO A;  5GHY A;  4R1G A;  2ZQA A;  2ZM8 A;  3RXX A;  4OOY A;  5F83 A;  4OQI A;  2Q9M A;  1SKF A;  4OPZ A;  3M2J A;  4LCL A;  4UA9 A;  4E3L A;  1CI8 A;  2Y59 A;  1FSW A;  1G68 A;  2WUQ A;  1GHI A;  5F1G A;  3Q07 A;  4PM5 A;  5CHU A;  3HRE A;  3EQU A;  4S2L A;  4OLD A;  3S22 A;  4EWF A;  2G2W A;  4X56 A;  4N92 A;  1NRF A;  2DNS A;  2ZM2 A;  4DE1 A;  2Y2P A;  5FAS A;  4JXG A;  2DRW A;  2WAF A;  2X01 A;  3PAG A;  3VFH A;  3ZG9 B;  1IYS A;  4R23 A;  4QHC A;  4DDS A;  4C3Q A;  4XXR A;  1XA7 A;  2XDM A;  5FQI A;  5CXW A;  2EXB A;  5EVI A;  3IXB A;  3C4P A;  2P74 A;  1YLT A;  1WYC A;  5CEB A;  3O87 A;  5EVI D;  3G2Z A;  3PBR A;  4ID4 A;  4N1H A;  4OP5 A;  5GLD A;  3CJM A;  5EVL A;  3V3S A;  1KGF A;  4PPR A;  1L0F A;  1IYP A;  1TEM A;  2EX9 A;  4WMC D;  2V2F F;  1NJ4 A;  4S2N C;  4CJN A;  1ZG6 A;  2XF3 A;  4H8R A;  3GV9 A;  4MBF A;  2EX6 A;  5GHZ A;  4RYE A;  2ZMA A;  5CGX A;  1ESI A;  3O86 A;  3UY6 A;  3G2Y A;  4OKP A;  5M19 A;  1QMF A;  2IWD A;  2XK1 A;  1ZKJ A;  3MFD A;  3MXS A;  4DKI A;  3OZH A;  1PWD A;  4BJP A;  3GVB A;  2EX8 A;  4OON A;  2ZD8 A;  1KE3 A;  4JPM A;  4GDB A;  5F1F A;  4R4R A;  3HVF A;  2Y2H A;  3C5A A;  4GZB A;  3ZCZ A;  1H5X A;  3IF6 C;  4U0X A;  3FYZ A;  2J7V A;  4NK3 A;  1PWG A;  1CI9 A;  4Y0T A;  2R9X A;  4OQG A;  4WYY A;  3HUN A;  4KZA A;  5BOH A;  5KZH A;  2Z2M B;  3SS3 A;  1BUE A;  5GLC A;  2OV5 A;  3LY3 A;  4Y0U A;  5FAP A;  1LHY A;  1I2S A;  2Y2Q A;  1W79 A;  1E25 A;  1EWZ A;  4HBT A;  5AQA A;  4BL2 A;  4WEJ A;  4ZAM A;  4EBL A;  4UA6 A;  1I5Q A;  2PU2 A;  5HX9 A;  1AXB A;  4JXV A;  1YQS A;  3C7V A;  4JF6 A;  2ZLY A;  1PZP A;  1ONG A;  4GD6 A;  4L0L A;  1NYM A;  3LY4 A;  3IF5 A;  4JXS A;  5FQM A;  4S2N A;  3FKW A;  3DWZ A;  1ZC2 A;  4N9L A;  3TSG A;  3QNC A;  5CHM A;  1BTL A;  1N4O A;  3FWL A;  3EQV A;  4BD1 A;  5FQQ A;  5HW3 A;  5EVI C;  3M6H A;  5FAT A;  3OC2 A;  2XFS A;  5TFQ A;  1XA1 A;  4MBK A;  4CPK A;  1K57 C;  5E2H A;  5CRF A;  3JYI A;  4DE2 A;  3WS0 A;  4FH2 A;  3BFG A;  2XFT A;  5HAP A;  1ES5 A;  4DE0 A;  5JYO A;  3V3R A;  4QY6 A;  1FQG A;  5IHV A;  1OME A;  3MXR A;  3IF6 A;  1Z6F A;  4QB8 A;  2HDU A;  1RP5 A;  3RJU A;  1BLH A;  5EE8 A;  3BM6 A;  3WS2 A;  5DF8 A;  2C6W B;  5FDH A;  4WEK A;  2BG1 A;  3C4O A;  2ZQ8 A;  1K38 A;  1ONH A;  2B5R A;  1YMS A;  3SH7 A;  2Y2L A;  2Z2L B;  4K0X A;  5A92 A;  1YM1 A;  1ZG4 A;  3GQZ A;  3OPH A;  4XUX A;  4XUZ A;  5HFO A;  4RX3 A;  3Q7V B;  4OH0 A;  1TVF A;  2WKI A;  3NDG A;  4U0T A;  1DY6 A;  2JE5 A;  4B88 A;  3TOI A;  1KVM A;  3E2K A;  4LV1 A;  3NCK A;  5CGW A;  2ZQ9 A;  4E6W A;  4GKU A;  3ZG5 A;  5KSH A;  1HD8 A;  4GNU A;  3IF6 B;  3CMZ A;  1BZA A;  2WK0 A;  2QZ6 A;  2R9W A;  4JF4 A;  4GN2 A;  1KGG A;  4QD4 A;  4ZJ1 A;  1YLY A;  2H5S A;  3HUO A;  2ZJ9 A;  4FSF A;  2A3U A;  5GHX A;  3MZF A;  2JC7 A;  5EPH A;  1IEM A;  4PMA A;  3ZHH A;  1BSG A;  2EFX A;  2Y2J A;  1MKI A;  4DF6 A;  3M2K A;  4MNR A;  3NI9 A;  4KQR A;  3PBQ A;  1N9B A;  3O88 A;  5D3O A;  1YLJ A;  1BLP A;  1H8Z A;  3LEZ A;  3LO7 A;  1K57 A;  3BLS A;  4OLG A;  1S0W A;  3OPL A;  4OOL A;  4WEL A;  4KZ7 A;  4WMC A;  2RCX A;  3W4Q A;  4LEN A;  3BLM A;  4KQO A;  1DJC A;  4WZ4 A;  1XXM A;  1E4D A;  3BEB A;  2HDR A;  4KG6 A;  4LV2 A;  4OVD A;  5E2E A;  2Y2N A;  5U47 A;  3UDI A;  4E3J A;  3OCL A;  5FQ9 A;  2IWC A;  4KZ3 A;  1K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...