5E2FA

Crystal structure of beta-lactamase class d from bacillus subtilis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
237
structure length
236
Chain Sequence
HLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFVVNALIGLQVKAVRDEYDVKRWDGVKREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase YbxI
publication title Crystal Structure of Beta-lactamase class D from Bacillus subtilis
rcsb
source organism Bacillus subtilis (strain 168)
total genus 75
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e2fA00
1YLYA 1NZUA 4DE0A 4BL2A 2Q9MA 3Q7VB 5GHZA 4BJPA 4DXBA 1PW1A 2ZQ9A 3SH9A 3IF5A 5FAPA 1TVFA 2ZC3B 5CHMA 2XD1A 5GLCA 2WADA 1N4OA 3UNWA 2IWCA 3V5MA 3PAEA 1SHVA 2FFFB 4JKTA 3PBNA 1BLHA 2XLNA 1MWSA 1H8YA 4ZJ3A 3ISGA 1IKIA 1Y54A 4OQIA 3AGEA 1PYYA 2XH9A 2Y2IA 3ZNYA 5FI6A 2HDUA 5CTMA 1ES4A 1OMEA 5J8XA 4N9LA 1E4DA 3FKWA 3SS5A 1FSWA 2WGVA 3PAGA 4KZ8A 3HREA 5E2HA 4ZAMA 2XR0A 1J9MA 4X56A 4S2LA 1RGYA 4QD4A 3G2YA 5A93A 4S2IA 1MPLA 1S0WA 1E3UA 1M40A 4PM7A 5AQ9A 5FASA 1E3UD 1PI5A 1YM1A 5HX9A 4PM9A 5DF7A 2J7VA 3VSKA 1CI9A 1IEMA 2HP9A 2VGJA 2P9VA 3G4PA 4FSFA 1XX2A 4P0MA 4QY5A 1LLBA 1SKFA 3C7UA 3W4PA 3UE3A 2Y2QA 3ZG0A 5CXWA 1L0GA 2Y2KA 1C3BA 3IH9A 5G18A 2C5WB 3G2ZA 2BG1A 2P74A 5GHYA 4LCLA 1K54C 3HLDA 2XGNA 2Y59A 3IF6A 1H5XA 4JBFA 5F83A 2Y2LA 5FQJA 4Y0OA 3WS5A 1PZPA 3G31A 5HAQA 1W8YA 2G2UA 3G32A 4BENA 4X68A 1ZC2A 4S2NA 5FATA 2XFSA 3PBTA 2X02A 4OH0A 4WMCA 4HEFA 5DF8A 4WMCD 1FR1A 4JXWA 4WBGA 4KQOA 4FH2A 4JXVA 4MEZA 1KVMA 3MZDA 1XXMA 1S6RA 3ZG7B 1PZOA 4GB7A 1I2SA 3IH8A 3ZCZA 4BD1A 5GL9A 2HP6A 4OPQA 5HW3A 3ITBA 5CGWA 2WKHA 3Q81A 3BLSA 1LHYA 3HLEA 4OOMA 4RVAA 3VOZA 4B4ZA 4ZDXA 1SCWA 3BRMA 2WGWA 3Q7ZA 1NXYA 3MFDA 3LCEA 2V20A 3QHYA 4E6XA 3I7JA 1ZKJA 4QJGA 3MKFA 3SS4A 4WZ5C 3MKEA 4X69A 5CHUA 2EX2A 3OPHA 4OOYA 4R4SA 5A90A 3ZHHA 1K6SA 1FOFA 1VQQA 1ERMA 1FSYA 1ONGA 4JXGA 5HFOA 1Z6FA 4KQRA 3UN7A 1YQSA 3SH7A 4IVKA 3N7WA 5CECA 3BLMA 1U60A 3IT9A 5EVIB 4X55A 1WYBA 2WUQA 1EROA 4MNRA 2PBYA 4OVDA 5FQIA 1YLPA 3GSGA 4EV4A 1XA1A 1FR6A 1W5DA 4DRTA 4PM6A 3IXGA 2EXAA 2IWDA 4JF6A 2X71A 3FYZA 4E3OA 1W7FA 3IQAA 1IYSA 2Y2OA 3OC2A 5CEDA 1BUEA 3GVBA 4C3QA 4UA9A 4XUZA 2XD5A 5CTNA 3OPRA 3FKVA 4ID4A 3UE1A 3WRTA 5JYOA 1CEGA 4JF5A 2V2FF 3HBRA 1DJCA 1HZOA 1KE3A 4HESA 5GLAA 4UAAA 4S2MA 5CEBA 3FV7A 1O7EA 2J9PA 3OCNA 2PU2A 4KZ7A 1YLZA 3NDEA 4E3KA 4EBPA 2EX8A 1I2WA 1L0FA 1ONHA 1YMXA 1SDEA 2ZMAA 3IWIA 4LV3A 5HARA 4DDYA 5FI2A 1ESUA 3GRJA 3SOIA 2Y91A 2WGIA 3TSGA 3IWQA 4MBFA 2EFUA 2ZLYA 4DE3A 3UPPA 2JCHA 3TOIA 5KMWA 3SS3A 4LV1A 1BLSA 3IWOA 3MZFA 3ZG8B 3HLCA 3LY3A 1CEFA 1H8ZA 5U47A 1PW8A 2ZM2A 3VMAA 2DRWA 3CMZA 4YINA 4HBTA 4IEDA 2DNSA 3A3JA 2EFXA 4GD6A 3Q82A 3HL9A 3IHAA 3C7VA 5EVLA 3W4QA 1RGZA 1GA9A 1TDLA 2OSUA 3IHBA 2A49A 1YLTA 2QMIA 4BD0A 4F94A 4O7DA 5E43A 1QMEA 4OPRA 5F82A 5DTTA 3WS4A 2EX6A 2JC7A 2ZM0A 3NBLA 5FSRA 1JWPA 1GHPA 2Y2PA 3BFFA 5E2FA 3UY6A 1L2SA 2Z2LB 5EOEA 4KZ4A 4OLGA 1K38A 4Y0UA 4GDNA 1KDSA 3N8RA 2Y2HA 1XKZA 4KENB 1W79A 5EUAA 1NYYA 5HAPA 2EXBA 1BLPA 3OPLA 4N9KA 1KGGA 3QNBA 3RJUA 1YT4A 4WEJA 3PBRA 4KZ6A 5TFQA 2RCXA 2R9XA 5TR7A 3VP1A 5BOHA 4KG2A 1XPBA 4R1GA 5CHJA 3PBOA 4UA6A 3HLGA 5M19A 4X53A 2Y2JA 3BFGA 3W8KA 4E3NA 5E2EA 3G30A 3GTCA 3O3VA 4KG5A 4R4RA 1KDWA 4FH4A 3S22A 3V3SA 4LENA 1IKGA 5KSHA 1BTLA 2XEPA 3HUOA 4KZBA 1PWGA 2HPBA 2WYXA 4CJNA 1ZG6A 3DTMA 3O86A 4WZ4A 4OLDA 3A3DA 5A91A 3VP0A 4B88A 4BLMA 3OZHA 3HUMA 2OLVA 5F1FA 4KQQA 2XK1A 5DVAA 4ZJ1A 4BQMA 3ZDJA 4OOLA 5DF9A 5KZHA 3IXBA 2A3UA 4DF6A 3V39A 3VP4A 5FQQA 3VFFA 4H8RA 5FQKA 2H0TA 5M18A 2JE5A 3UDIA 4WELA 4E3MA 3JYIA 2JBFA 3NIAA 1K56A 3NC8A 3VP2A 4MLLA 5GHXA 1NYMA 4IBRA 4OQHA 4QU3A 1K56D 3WWXA 1NY0A 3MXRA 3ZG5A 1CK3A 3NI9A 5F1GA 3RXWA 4LV2A 3Q7VA 2RL3A 1ES2A 3DWZA 2P9VB 3C4PA 1FCOA 4QB8A 4CPKA 3LEZA 1GCEA 1O07A 5EPHA 2WAEA 3GV9A 1LI9A 1CI8A 4Y7PA 1JTGA 1Q2QA 2ZQ8A 5KSCA 3RXXA 1WE4A 3NCKA 2V1ZA 3N8LA 1DJAA 1N9BA 3UPNA 3ZVTA 3UPOA 5FQMA 1PIOA 2VGKA 3WS2A 5CRFA 1XP4A 4N92A 3VFHA 3ZG9B 1BSGA 1NZOA 5I94A 1MBLA 5EOOA 4PM5A 1YLWA 3HLWA 4GDBA 4K91A 1NRFA 4S2PA 2WK0A 4OPZA 4JF4A 5EVIC 1L0EA 3Q07A 3CG5A 4P87A 4RYEA 2G2WA 3A3IA 3BM6A 3MBZA 3CZDA 3DW0A 4P85A 2H10A 4JLFA 4P6BA 2ZM8A 1GHIA 3ZNTA 1DY6A 4U0XA 1HVBA 3N6IA 2J8YA 5IHVA 2OV5A 1K57C 4GOGA 3VSLA 1K54A 1E25A 4A5RA 4YFMA 5FAOA 3SH8A 4S2NC 2OLUA 2J9OA 3FZCA 3PBSA 1IYOA 2ZQDA 4FD8A 3BFEA 3AGDA 3BFDA 3S4XA 2ZC6B 4S2JA 4RX3A 3DWKA 3C4OA 2H0YA 1JWVA 4NETA 4E3IA 4PM8A 1JTDA 5CGSA 2WGWB 4KZ5A 4R23A 1AXBA 1DJBA 1K55C 4N1XA 2ZQCA 4OPYA 1KE4A 2Y2GA 3HVFA 1K4EA 2WKEA 4C75A 5FI7A 3E2LA 2X01A 1LL5A 3P09A 1IYQA 3WS1A 3Q1FA 5FAQA 3GMWA 4BL3A 4KZAA 4L0LA 1MY8A 5AQ7A 3N4IA 4LV0A 3V3RA 4B4XA 4DXCA 1MKIA 2C6WB 1GA0A 3N8SA 5FA7A 1BLCA 2B5RA 3HLBA 4PPRA 1ALQA 1YMSA 3G34A 2WAFA 3BFCA 4WYYA 3M2KA 4WZ5A 1LI0A 2XDMA 3A3EA 1XGJA 1MWRA 1HTZA 1RCJA 2ZC7A 3EQUA 5JYPA 2XF3A 1FCMA 3GR2A 2XQZA 2Q9NA 1TDGA 5GLBA 5GLDA 5DTSA 1JWZA 2BLSA 4DDSA 2HP5A 3UDXA 4E3JA 1I5QA 4DE1A 1KGFA 4OKPA 1G6AA 2XFTA 5E2GA 2ZC5B 1G68A 5A92A 2R9WA 1BZAA 1BT5A 4ZJ2A 4K0XA 3D4FA 2HDRA 4ZTKA 4K0WA 2FFYA 1XA7A 4ZBEA 3MZEA 5AQAA 4HBUA 3G35A 4OP8A 4DE2A 5EVIA 2ZC4B 1ES5A 3PTEA 3M6HA 1VM1A 4LCMA 1QMFA 5EVID 1MWTA 5HAIA 3ZGAB 4GKUA 1NJ4A 2H5SA 2ZQAA 3HUNA 1BULA 4FCFA 4D2OA 2WZZA 1KVLA 5CGXA 1EI5A 1RP5A 2Y2MA 3NY4A 2ZQ7A 1K57A 3LY4A 4U0TA 4WEKA 4N1HA 4Z9QA 3UDFA 1K4FA 4JXSA 2IWBA 2Z2MB 4UA7A 4QHCA 1ESIA 1M6KA 1XGIA 5DTKA 4Y0TA 3S1YA 3B3XA 1GHMA 1IYPA 4MBKA 5HL1A 1WYCA 1JVJA 1Q2PA 5AQBA 1ES3A 3NDGA 3UO9A 4DKIA 2WKIA 2HDSA 1YLJA 3UE0A 1FQGA 1K55A 5L2FA 4GN2A 2I72A 4S2OA 2ZJ9A 3GQZA 1L0DA 4KZ9A 2CC1A 3V50A 3VP3A 1KE0A 1PWDA 1K6RA 3BEBA 4M3KA 4PMAA 5TGFA 3C5AA 2HDQA 1KGEA 2PU4A 4UHUA 3OPPA 3IXHA 3LO7A 4OQGA 5FQ9A 3TG9A 1FCNA 3ITAA 3IF6B 3O88A 4GZBA 4WM9A 3FWLA 4KZ3A 5FDHA 3ZFZA 4JPMA 4OP5A 3WS0A 3AGFA 4S2KA 1EWZA 2QZ6A 3WRZA 3IXDA 4GD8A 4OQ0A 3ZVWA 1K25A 3PBQA 4C6YA 1PWCA 3CJMA 3BYDA 4KG6A 2GDNA 1PI4A 4GNUA 1SDNA 2EX9A 3QNCA 4XUXA 4EWFA 2UWXA 2ZD8A 4QY6A 2E8IA 3M6BA 3OCLA 4E6WA 3BECA 4EUZA 3MXSA 4U3TA 3W4OA 5M1AA 3IF6C 3O87A 4EBLA 4RA7A 2WZXA 1HD8A 4IVIA 1ERQA 3M2JA 3E2KA 4R3JA 5EECA 4EBNA 4MBHA 4E3LA 5CERA 2Y2NA 4R0QA 4RX2A 2QPNA 4R3BA 4Q8IA 1IELA 4NK3A 1MXOA 2Y4AA 1TEMA 4OONA 3HLFA 1ZG4A 1W8QA 1MWUA 2DCFA 4EQIA 3EQVA 3P98A 4X6TA 3VOYA 3A3FA 5D3OA 2Y55A 4IBXA 1LL9A 4XXRA 5EE8A
chains in the Genus database with same CATH superfamily
1YLYA 3Q7VB 5GHZA 2HJEA 3C30A 3IF5A 5FAPA 1TVFA 5GLCA 1N4OA 3UNWA 1SHVA 2FFFB 4JKTA 4LRZE 3PBNA 2XLNA 1MWSA 4H6JB 1UWNX 3IX4A 3FG8A 2XH9A 4HY8A 5J8XA 3FKWA 4ZAMA 3PAGA 1VETB 4S2LA 1CF0A 5FL3A 1M40A 1XFNA 5FASA 5HX9A 5DF7A 2J7VA 2VGJA 2P9VA 3G4PA 3G6OA 2L1MA 3VV4A 3C7UA 3W4PA 2Y2QA 1N9NA 2BG1A 3S7NA 1Y28A 1K54C 2Y2LA 1XFQA 2HJ9C 1PZPA 3NHQA 4BENA 4S2NA 4OH0A 4HEFA 3P01A 3QP8A 4WMCD 4WBGA 1KVMA 2O9AA 1XXMA 4MDZA 1PZOA 3F1NB 2CMNA 2HF6A 2PDRA 3MFDA 2V20A 3QHYA 3ZQ5A 5HPFA 4QJGA 4HJ3A 4X69A 5CHUA 3OPHA 2W1TA 3ZHHA 1ERMA 1FSYA 1F9IA 1G6OA 2W3EA 1Z6FA 3UN7A 4IVKA 1EROA 1GSVA 5FQIA 4EV4A 2WKPA 1XA1A 2XRNA 3IXGA 1W7FA 3OC2A 1IYSA 1BUEA 1SZVA 3GVBA 5CTNA 3FKVA 4ID4A 3RH8B 2KLIA 1KE3A 4HESA 4UAAA 1O7EA 2J9PA 2PU2A 4II7A 4NXGA 4BBVA 1SDEA 2WGIA 3TSGA 4HI4A 3H7WA 3FPWA 1JNUA 1BLSA 3CLOA 3UB7A 3HLCA 1CEFA 1H8ZA 3CMZA 4YINA 1F2KA 3A3JA 1LSXA 2EFXA 4GD6A 3H82B 3HL9A 1DP6A 1NWZA 3V67A 2QMIA 2VV6A 5E43A 5FSRA 3BFFA 5E2FA 2I9VA 3NOPC 3UY6A 2Z2LB 3CI6A 4OLGA 4GDNA 1KDSA 1W79A 4KUOA 1F98A 2O9BA 1KGGA 3QNBA 3RJUA 2RCXA 5BOHA 4R1GA 3PBOA 1OTDA 3S7PA 4E3NA 3G30A 3GTCA 1KDWA 4GS9A 2WYXA 4CJNA 3DTMA 4OLDA 5A91A 3UB8A 2OLVA 4KQQA 2XK1A 3TJZC 1S1YA 3VP4A 5FQQA 5M18A 1XJ2A 2JBFA 3NIAA 3VP2A 4OQHA 4QU3A 3CUEA 1NY0A 2HZ5A 5HWWA 4MMNA 2VGLS 1PFLA 1FCOA 1GCEA 3B33A 5DJUA 2WAEA 1LI9A 4Y7PA 2ZQ8A 1W63M 3ZVTA 1OTEA 5FQMA 2XSSA 5CRFA 3VFHA 3ZG9B 1MBLA 2XA7M 1T1CA 4PM5A 4GDBA 3DTKA 2PAVP 3VE3A 4RYEA 1VEUB 4P87A 2GX5A 3ZNTA 1HVBA 3N6IA 2J8YA 3LGOA 4GOGA 1K54A 4I39A 2VJWA 1OTIA 5G4YA 5DKKA 3BFEA 3BFDA 4RX3A 3C4OA 5CGSA 4Y15A 4KZ5A 4R23A 4N1XA 5G4ZA 1KE4A 2Y2GA 4C75A 5FI7A 5FAQA 5AQ7A 3N4IA 2A24A 5FA7A 1L3LA 2B5RA 4E04A 3MQQA 3W2ZA 3BFCA 5JYPA 1HTZA 3GR2A 3NJAA 1ACFA 1TDGA 2M7VA 4E3JA 3K3DA 2FH5A 1I5QA 4DE1A 1KGFA 1G6AA 2XFTA 3DBAA 2M7UA 1S66L 3MJQA 5A92A 4X1LA 4ZJ2A 2HDRA 4ZTKA 1NRJA 3FC7A 4Q0HA 2VLGA 2Q0OA 1VM1A 5HAIA 3T50A 3ZGAB 1NJ4A 2ZQAA 4FCFA 4D2OA 3HJKA 3R4KA 5CTMA 1EI5A 4I38A 4WEKA 1S4SA 2IWBA 1M6KA 2VX8A 5DTKA 4HOIA 3DAVA 4EETB 3CPTB 1ES3A 3LR0A 1UWPX 2D02A 3HJIA 1S4RA 5I5LA 3S7QA 2CC1A 3VP3A 1PWDA 5IU1A 5TGFA 1T19A 3IX3A 4UHUA 4MN5A 3LO7A 3IF6B 3FWLA 4FUWA 3AGFA 4S2KA 2JHEA 3WRZA 4GD8A 3PBQA 3BYDA 2H28A 3LIBA 4EWFA 4LGWA 2ZD8A 4E6WA 3OCLA 4JGPA 3BECA 3TRCA 2K31A 4EUZA 2P08A 4EBLA 3O87A 4RA7A 1HD8A 1ERQA 3M2JA 4R3JA 5EECA 2QPNA 4R3BA 1IELA 3EEHA 3T12B 2QKPA 2J3TD 4X6TA 3VOYA 3A3FA 5D3OA 4IBXA 3TE8A 2Q9MA 4BJPA 1STZA 1PW1A 2ZQ9A 4DXBA 3SH9A 2ZC3B 5CHMA 2IWCA 3V5MA 3PAEA 4YNRA 3CWFA 1H8YA 3AGEA 1PYYA 3ZNYA 5FI6A 3UB5P 5EV0A 1E4DA 3SS5A 4KZ8A 4X56A 4QD4A 3LYXA 2KOIA 2OAP1 4ME4A 1E3UA 4PM7A 2INWA 4ARZA 3DTIA 3T4LA 2L4RA 2HP9A 3MF0A 4P0MA 1XX2A 5HWTA 4CLCC 3ZG0A 5J7EA 5CXWA 3MQ0A 1L0GA 3IH9A 1ZHHB 2W0NA 4LCLA 2XGNA 4HH3A 1H5XA 3NULA 4Y0OA 2QHKA 5HAQA 4GHIA 1DRMA 5C5KA 1DP8A 1T18A 1OPXA 5DF8A 1FR1A 5EM0A 3LR5A 4JXVA 4MEZA 3KSGA 3ZG7B 3IH8A 5GL9A 1MC0A 5HW3A 2WKHA 3EEAA 3HLEA 3PHYA 4B4ZA 1SKOB 4E6XA 3BRMA 2WGWA 4G3VA 3LCEA 5L10A 1ZKJA 1TD5A 3MKFA 1EW0A 3SS4A 4WL9A 4WZ5C 5J4EA 2ZMFA 4EUVA 1LSVA 5L07A 1ONGA 4JXGA 5HFOA 3SH7A 1U60A 3IT9A 1TS7A 3IBRA 4X55A 1OT6A 4MNRA 1P9WA 1YLPA 3HCYA 1FR6A 4I5SA 4PM6A 3FYZA 4E3OA 3B42A 3CAXA 3P7NA 4UA9A 4XUZA 2XD5A 3D72A 3OPRA 3UE1A 2Z6CA 2FZ0A 5JYOA 3T4TA 4WUJA 4E3KA 1YMXA 3IWIA 1OJGA 3SOIA 3CHWP 3CUEC 3QP5A 2ZLYA 3UPPA 3KSIA 5FEFA 5HZHA 3VMAA 2DRWA 5IT5A 3S7OA 3Q82A 3UB6A 4LLOB 3W4QA 1GA9A 4I3IA 3LIFA 3IHBA 2A49A 4HQAA 3T4KA 4F94A 5F82A 3WS4A 2ZM0A 1JWPA 3MQOA 1GHPA 1K38A 4Y0UA 3B47A 3MFXA 4EESA 2Y2HA 4KENB 2HV1A 1BLPA 3OPLA 4N9KA 3GDIA 5HD5A 4WEJA 4Y3IA 5CHJA 2W3DA 3HLGA 3E4QA 5M19A 2Y2JA 3BFGA 3W8KA 3IS2A 4FH4A 3V3SA 4KZBA 2HPBA 3O86A 4BLMA 5F1FA 3MR0A 1YAXA 3ZDJA 5KZHA 3MMHA 3VFFA 4H8RA 3UDIA 3MSHA 2PR6A 3BQ8A 4IBRA 1DP9A 1K56D 1P9RA 3WWXA 3MXRA 3ZG5A 2OAQ1 2Z6DA 1GSWA 2QWSA 4LV2A 2RL3A 3DWZA 2P9VB 3C4PA 4QB8A 4FOFA 3JVVA 5EPHA 1CI8A 1YSQA 1Q2QA 5KSCA 2B95A 3UPNA 3EGXC 3UPOA 1PIOA 4O8GA 4HP9A 1GSXA 5A8BA 1NZOA 2VV8A 1NRFA 2VKSA 3F1PA 4S2PA 4IUHA 3RTYA 3JPUA 3Q07A 4HIAA 2G2WA 3A3IA 4CLCA 3MBZA 4P6BA 2ZM8A 1UGUA 5IHVA 2OV5A 4ETZA 4A5RA 5FAOA 2OLUA 2PRFA 4FD8A 2ZC6B 3T4SA 3DWKA 2H0YA 4NETA 2IA2A 5K5BA 4PM8A 1JTDA 4B93A 2XROA 2EA9A 4MN6A 2ZBBA 3C8CA 1K4EA 2QYBA 2W1TB 4WN5A 1IYQA 3WS1A 2D01A 3Q1FA 3GMWA 4JGOA 4BL3A 3T1XA 3BW6A 1MY8A 3V3RA 2V0UA 2B18A 5AVFA 1GA0A 5KIZA 1ALQA 1YMSA 3T4QA 2WAFA 2VEAA 2XA7S 4WZ5A 1LI0A 2XDMA 3A3EA 1XGJA 1RCJA 2ZC7A 2XF3A 2B02A 1OTBA 1S1ZA 2Q9NA 3UDXA 1VHMA 4OKPA 3UMDA 5E2GA 1G68A 1BT5A 1G5UA 4IUKA 4ZBEA 1H0MA 4OP8A 4DE2A 5EVIA 1ES5A 4XT2A 3H7WB 4LCMA 2AVXA 1A0KA 2JKRI 4EERA 4GKUA 3LFVA 2PD8A 1BULA 2WZZA 5CGXA 1KVLA 3NY4A 3LY4A 1K57A 5HL6A 4Z9QA 3U2AA 4UEYA 4UA7A 2W27A 1XGIA 1XJ6A 3S1YA 3B3XA 1GHMA 1IYPA 2L0WA 1WYCA 5AQBA 3T1SA 1ZTUA 3UO9A 3D9YA 2WKIA 4EQ1A 1IOUA 2HDSA 3UE0A 3KSFA 1K55A 5L2FA 4NXFA 4P6ZM 4GN2A 1D1JA 3GQZA 1KE0A 1IFQA 4GLQA 3BEBA 4HHDA 2ZOIA 3IXHA 5FQ9A 4OQGA 1FCNA 3ITAA 3ICYA 4KZ3A 2QZ6A 1YPRA 1PWCA 4GS9B 4KG6A 5F68A 3QNCA 4XUXA 4QY6A 2WZXA 4B9OA 2V8FA 4EBNA 4E3LA 5DFYA 5CERA 4RX2A 4NK3A 2Y79A 3HLFA 1W8QA 2DCFA 2JKTI 2QJ7A 2Y55A 2WKQA 1NZUA 4DE0A 4BL2A 4F3LA 3BWLA 2E8JA 4JGQA 4UQIM 2XD1A 2WADA 3LICA 1BYWA 3ISGA 1IKIA 1Y54A 4OQIA 3UMEA 2Y2IA 3T1QB 2J80A 2HDUA 2ZL1A 2ZMVA 1OMEA 4G3WA 1FSWA 3HREA 4WLAA 3SW1A 4EW7A 4K08A 5A93A 1PI5A 1YM1A 2BTFP 3E4PA 3VSKA 1CI9A 5TBMA 4Y2FA 4QY5A 1SKFA 5HDCA 1C3BA 5G18A 3IX8A 3G2ZA 2LB9A 2KDKA 1V9ZA 2P74A 5L8MA 4KUKA 4X1MA 2O0YA 1AWIA 2Y59A 3IF6A 5FQJA 4L9EA 3WS5A 4LRYC 4R6LA 4X68A 1ZC2A 2XFSA 2X02A 4MN7A 4WMCA 4JXWA 1MKMA 2A24B 4FH2A 1ODVA 3MZDA 3VE4A 1S6RA 3F1OA 2OOLA 1I2SA 3K2NA 4GCZA 3ZCZA 4YOFA 2HP6A 3ITBA 3L9KA 3Q81A 3BLSA 1LHYA 4OOMA 4ZDXA 3SZTA 1OT9A 1SCWA 1NXYA 5DJTA 2EX2A 2ACGA 4OOYA 4R4SA 5A90A 1K6SA 1FOFA 1J3WA 4KQRA 3N7WA 5CECA 4O01A 1WYBA 4Y5FA 2PBYA 4I3AA 1NLYA 3GSGA 1W5DA 2LB5A 1PRQA 3D3OA 2EXAA 2IWDA 4JF6A 2Y2OA 5CEDA 3R7WA 3OOVA 4C3QA 3WRTA 1CEGA 2V2FF 3HBRA 1DJCA 1HZOA 1D7EA 5CEBA 3FV7A 3DTEA 3OCNA 4KZ7A 1K0KA 2EX8A 5HARA 4DDYA 2ZMAA 5DFXA 3GRJA 2Y91A 3CITA 4DE3A 2JCHA 2P7JA 3QP6A 1WA9A 2KX6A 3PYPA 1PW8A 2ZM2A 1YSPA 2DNSA 4ETXA 3IHAA 3C7VA 5EVLA 1RGZA 3NOTC 1TDLA 1TS6A 4NG2A 2EX6A 3NBLA 2Y2PA 1L2SA 5F69A 4KZ4A 1XKZA 1NYYA 2JKTM 5HAPA 2EXBA 1CJFA 3PBRA 4KZ6A 2R9XA 5TR7A 1XPBA 1YKDA 2J3TC 4KG5A 4R4RA 4DMZA 3S22A 4LENA 5KSHA 1BTLA 4R3AA 2XEPA 3BY9A 1PWGA 5F6AA 4L9FA 3A3DA 2DMWA 5HPIA 2OWHA 3OZHA 5DVAA 2PR5A 4BQMA 5DF9A 4Y13A 3IXBA 4DF6A 3V39A 2PD7A 5FQKA 4E3MA 3JYIA 2VA0A 5EVEA 4MLLA 1NYMA 1LSWA 3TW8A 4ARZB 3RXWA 3Q7VA 1ES2A 4RQ9A 4CPKA 2QJ5A 4EU0A 1OTAA 4KQDA 4H6JA 1WE4A 2V1ZA 3QP1A 1N9BA 2VGKA 4EXOA 4N92A 1BSGA 3BQAA 5EOOA 3A0RA 1YLWA 4GHIB 5EVIC 1VETA 3CZDA 3DW0A 2H10A 4U0XA 1K57C 3VSLA 2V1BA 1E25A 3PR6A 3FZCA 1IYOA 3ULFA 2GJ3A 3AGDA 3S4XA 4BMWA 3PXPA 1JWVA 4E3IA 2V0WA 1PNEA 1X0OA 2WGWB 4CQHA 5AJGA 1AXBA 1DJBA 1K55C 4ESPA 2ZQCA 3O5YA 3E2LA 3P09A 4KZAA 3FPVA 4G3KA 3KX0X 3KYEA 4B4XA 4DXCA 1MKIA 4Q0JA 5LBRA 3BJNA 3HLBA 4PPRA 3G34A 4Y17A 3F1NA 4WYYA 3M2KA 4CLCE 1MWRA 3EQUA 4PKYG 5GLBA 5GLDA 1JWZA 2OWJA 2HP5A 4DDSA 3OLOA 3KYZA 2ZC5B 2R9WA 1BZAA 4K0XA 3D4FA 2V9AA 3E0YA 4K0WA 4GW9A 2FFYA 3BY8A 3MZEA 4O0PA 3M6HA 1G28A 2H5SA 4DN0A 4DJ3A 2Y2MA 1RP5A 2ZQ7A 3UDFA 1K4FA 2Z2MB 1ESIA 4NXBA 2PYPA 4MBKA 3EOIA 1Q2PA 1Y4OA 4PAUA 4DKIA 1YLJA 1FQGA 2G7UA 3JVUA 1H8MA 3C5AA 2HDQA 3TG9A 2P04A 4WM9A 5IS1A 1P97A 3WS0A 2ZOHA 4LFUA 1EWZA 3IS2B 2NUTC 3IXDA 4HJ6A 4OQ0A 1K25A 4C6YA 3CJMA 4HH2A 2GDNA 3H82A 4GNUA 1SDNA 2EX9A 2UWXA 3LR4A 2K2NA 5M1AA 3IF6C 4IVIA 3E2KA 4BWIA 3T1RA 4MBHA 3LR3A 2Y2NA 4R0QA 2Y4AA 1LL8A 1TEMA 4EQIA 1XJ3A 3EQVA 5AVEA 3P98A 2W1RA 4XXRA 3E98A 4JGRA 3NOUC 5CX7A 4P6ZS 2VZWA 4HNBA 4EEPA 4IJGA 1BLHA 2UV0E 4ZJ3A 1ES4A 4N9LA 4QPRA 2WGVA 3F1PB 5E2HA 3MS6A 2XR0A 4NXEA 1J9MA 4CLCB 1RGYA 3G2YA 4S2IA 1MPLA 1S0WA 3EGDC 5AQ9A 1E3UD 4PM9A 4IHQA 1IEMA 4FSFA 3H9WA 1LLBA 3UE3A 2Y2KA 2C5WB 3KSHA 3KYQA 4PKYA 5GHYA 1MZUA 3HLDA 3GECA 5F83A 4JBFA 3G31A 4UQIS 1W8YA 2G2UA 3G32A 5FATA 3PBTA 1VEUA 4KQOA 2VV7A 3L7HA 4GB7A 4BD1A 4OPQA 5CGWA 2K7SA 4RVAA 3VOZA 3Q7ZA 2V8CA 3I7JA 3MKEA 3A0VA 1HLUP 5HWVA 1VQQA 1YQSA 4HP4A 3BLMA 5EVIB 2WUQA 4XT2B 4Q0IA 2JN7A 4OVDA 3T4JA 4DRTA 2WKRA 2X71A 3IQAA 4M4XA 4JF5A 3LI8A 5EFWA 5F5YA 5GLAA 4S2MA 3IBJA 5HSQA 3LUQA 1YLZA 3NDEA 4EBPA 1I2WA 1L0FA 1ONHA 4LV3A 4WF0A 5FI2A 1ESUA 3IWQA 4QWOA 4MBFA 2EFUA 4I3JA 3TOIA 5KMWA 3A0SA 4LV1A 3SS3A 3IWOA 3MZFA 3ZG8B 3LY3A 5FEGA 5DKLA 5U47A 1CQAA 5FDSA 4HBTA 4IEDA 5HDDA 3LIDA 3MXQA 3C2WA 4MCWA 1W63Q 2OSUA 1YLTA 3CPTA 4BD0A 4O7DA 1QMEA 4OPRA 5DTTA 2VGLM 2JC7A 3T4OA 2GNXA 5EOEA 4NEED 1XJ4A 3N8RA 1TF1A 5EUAA 2HGVA 4BBUA 1YT4A 5TFQA 3VP1A 4KG2A 4F3LB 2PYRA 1VB6A 4UA6A 4R70A 4X53A 5E2EA 3O3VA 1S67L 1IKGA 1P0ZA 3HUOA 4HJ4A 1ZG6A 4WZ4A 4B88A 3VP0A 2J3WA 3K3CA 3HUMA 2ZL1B 1F5MA 4ZJ1A 1FIKA 4OOLA 2A3UA 1NLZA 2VK3A 2H0TA 2JE5A 3OBFA 4WELA 1K56A 2EWWA 3NC8A 5GHXA 3NECA 1CK3A 3NI9A 5F1GA 2PHYA 5TBMB 3LEZA 1O07A 1TS0A 3GV9A 1JTGA 3RXXA 5MC7A 3NCKA 3N8LA 1DJAA 4PHTA 5HDSA 4AFIA 2JKRM 3WS2A 1LT0A 1XP4A 4L9GA 5I94A 1N9LA 3HLWA 3RFBA 4K91A 4R38A 2WK0A 4YWZA 4OPZA 2MJ6A 4JF4A 1L0EA 3CG5A 3BM6A 4P85A 4CLCD 4JLFA 4ZRRA 1GHIA 1DY6A 4YFMA 3SH8A 3F1OB 2NUPC 4S2NC 2J9OA 2R78A 3C38A 3PBSA 2ZQDA 3LIAA 4S2JA 1T1BA 4FTXA 4OPYA 1TS8A 3HVFA 2WKEA 3LEQA 2X01A 1LL5A 4L0LA 4LV0A 1V9YA 4LPZA 2C6WB 3N8SA 1BLCA 4EEUA 4X25A 1FCMA 2XQZA 1N9OA 3R7WB 5DTSA 2BLSA 2PBDP 3UB9A 3LIEA 1SKOA 4BBTA 1H3QA 2PT7A 4GJ4A 2V1AA 2W3GA 5TJJA 3EWKA 1T1AA 5J3WA 2Y8HA 1XA7A 3ZYTA 5AQAA 4HBUA 3G35A 2ZC4B 3PTEA 2GZAA 1KOUA 1QMFA 5EVID 1MWTA 2YKFA 1OJ5A 3QP4A 3HUNA 3KO6A 4NKPA 2YKHA 4U0TA 5L09A 4N1HA 4JXSA 4QHCA 4DJ2A 2EWVA 4D60A 4Y0TA 5HL1A 1FILA 1JVJA 2W3HA 3E4OA 3NDGA 3VOLA 2JKFA 2I72A 4S2OA 2ZJ9A 2A2LA 1L0DA 4KZ9A 4Z1WA 3LI9A 3V50A 1K6RA 2M1CA 4M3KA 4PMAA 2O9CA 1KGEA 2O99A 2PU4A 1Z09A 1D06A 3OPPA 2JKGA 3O88A 4GZBA 3ZFZA 2BASA 5FDHA 4JPMA 4OP5A 3QP2A 3ZVWA 1PI4A 2E8IA 3M6BA 5EM1A 4LRXC 3MXSA 4U3TA 3W4OA 4Q8IA 1MXOA 4OONA 3UE6A 1ZG4A 5HD3A 1MWUA 2W3FA 3U4LP 1LL9A 5EE8A
chains in the Genus database with same CATH topology
1YLYA 1NZUA 4DE0A 4BL2A 2Q9MA 3Q7VB 5GHZA 4BJPA 4DXBA 1PW1A 2ZQ9A 3SH9A 3IF5A 5FAPA 1TVFA 2ZC3B 5CHMA 2XD1A 5GLCA 2WADA 1N4OA 3UNWA 2IWCA 3V5MA 3PAEA 1SHVA 2FFFB 4JKTA 3PBNA 1BLHA 2XLNA 1MWSA 1H8YA 4ZJ3A 3ISGA 1IKIA 1Y54A 4OQIA 3AGEA 1PYYA 2XH9A 2Y2IA 3ZNYA 5FI6A 2HDUA 5CTMA 1ES4A 1OMEA 5J8XA 4N9LA 1E4DA 3FKWA 3SS5A 1FSWA 2WGVA 3PAGA 4KZ8A 3HREA 5E2HA 4ZAMA 2XR0A 1J9MA 4X56A 4S2LA 1RGYA 4QD4A 3G2YA 5A93A 4S2IA 1MPLA 1S0WA 1E3UA 1M40A 4PM7A 5AQ9A 5FASA 1E3UD 1PI5A 1YM1A 5HX9A 4PM9A 5DF7A 2J7VA 3VSKA 1CI9A 1IEMA 2HP9A 2VGJA 2P9VA 3G4PA 4FSFA 1XX2A 4P0MA 4QY5A 1LLBA 1SKFA 3C7UA 3W4PA 3UE3A 2Y2QA 3ZG0A 5CXWA 1L0GA 2Y2KA 1C3BA 3IH9A 5G18A 2C5WB 3G2ZA 2BG1A 2P74A 5GHYA 4LCLA 1K54C 3HLDA 2XGNA 2Y59A 3IF6A 1H5XA 4JBFA 5F83A 2Y2LA 5FQJA 4Y0OA 3WS5A 1PZPA 3G31A 5HAQA 1W8YA 2G2UA 3G32A 4BENA 4X68A 1ZC2A 4S2NA 5FATA 2XFSA 3PBTA 2X02A 4OH0A 4WMCA 4HEFA 5DF8A 4WMCD 1FR1A 4JXWA 4WBGA 4KQOA 4FH2A 4JXVA 4MEZA 1KVMA 3MZDA 1XXMA 1S6RA 3ZG7B 1PZOA 4GB7A 1I2SA 3IH8A 3ZCZA 4BD1A 5GL9A 2HP6A 4OPQA 5HW3A 3ITBA 5CGWA 2WKHA 3Q81A 3BLSA 1LHYA 3HLEA 4OOMA 4RVAA 3VOZA 4B4ZA 4ZDXA 1SCWA 3BRMA 2WGWA 3Q7ZA 1NXYA 3MFDA 3LCEA 2V20A 3QHYA 4E6XA 3I7JA 1ZKJA 4QJGA 3MKFA 3SS4A 4WZ5C 3MKEA 4X69A 5CHUA 2EX2A 3OPHA 4OOYA 4R4SA 5A90A 3ZHHA 1K6SA 1FOFA 1VQQA 1ERMA 1FSYA 1ONGA 4JXGA 5HFOA 1Z6FA 4KQRA 3UN7A 1YQSA 3SH7A 4IVKA 3N7WA 5CECA 3BLMA 1U60A 3IT9A 5EVIB 4X55A 1WYBA 2WUQA 1EROA 4MNRA 2PBYA 4OVDA 5FQIA 1YLPA 3GSGA 4EV4A 1XA1A 1FR6A 1W5DA 4DRTA 4PM6A 3IXGA 2EXAA 2IWDA 4JF6A 2X71A 3FYZA 4E3OA 1W7FA 3IQAA 1IYSA 2Y2OA 3OC2A 5CEDA 1BUEA 3GVBA 4C3QA 4UA9A 4XUZA 2XD5A 5CTNA 3OPRA 3FKVA 4ID4A 3UE1A 3WRTA 5JYOA 1CEGA 4JF5A 2V2FF 3HBRA 1DJCA 1HZOA 1KE3A 4HESA 5GLAA 4UAAA 4S2MA 5CEBA 3FV7A 1O7EA 2J9PA 3OCNA 2PU2A 4KZ7A 1YLZA 3NDEA 4E3KA 4EBPA 2EX8A 1I2WA 1L0FA 1ONHA 1YMXA 1SDEA 2ZMAA 3IWIA 4LV3A 5HARA 4DDYA 5FI2A 1ESUA 3GRJA 3SOIA 2Y91A 2WGIA 3TSGA 3IWQA 4MBFA 2EFUA 2ZLYA 4DE3A 3UPPA 2JCHA 3TOIA 5KMWA 3SS3A 4LV1A 1BLSA 3IWOA 3MZFA 3ZG8B 3HLCA 3LY3A 1CEFA 1H8ZA 5U47A 1PW8A 2ZM2A 3VMAA 2DRWA 3CMZA 4YINA 4HBTA 4IEDA 2DNSA 3A3JA 2EFXA 4GD6A 3Q82A 3HL9A 3IHAA 3C7VA 5EVLA 3W4QA 1RGZA 1GA9A 1TDLA 2OSUA 3IHBA 2A49A 1YLTA 2QMIA 4BD0A 4F94A 4O7DA 5E43A 1QMEA 4OPRA 5F82A 5DTTA 3WS4A 2EX6A 2JC7A 2ZM0A 3NBLA 5FSRA 1JWPA 1GHPA 2Y2PA 3BFFA 5E2FA 3UY6A 1L2SA 2Z2LB 5EOEA 4KZ4A 4OLGA 1K38A 4Y0UA 4GDNA 1KDSA 3N8RA 2Y2HA 1XKZA 4KENB 1W79A 5EUAA 1NYYA 5HAPA 2EXBA 1BLPA 3OPLA 4N9KA 1KGGA 3QNBA 3RJUA 1YT4A 4WEJA 3PBRA 4KZ6A 5TFQA 2RCXA 2R9XA 5TR7A 3VP1A 5BOHA 4KG2A 1XPBA 4R1GA 5CHJA 3PBOA 4UA6A 3HLGA 5M19A 4X53A 2Y2JA 3BFGA 3W8KA 4E3NA 5E2EA 3G30A 3GTCA 3O3VA 4KG5A 4R4RA 1KDWA 4FH4A 3S22A 3V3SA 4LENA 1IKGA 5KSHA 1BTLA 2XEPA 3HUOA 4KZBA 1PWGA 2HPBA 2WYXA 4CJNA 1ZG6A 3DTMA 3O86A 4WZ4A 4OLDA 3A3DA 5A91A 3VP0A 4B88A 4BLMA 3OZHA 3HUMA 2OLVA 5F1FA 4KQQA 2XK1A 5DVAA 4ZJ1A 4BQMA 3ZDJA 4OOLA 5DF9A 5KZHA 3IXBA 2A3UA 4DF6A 3V39A 3VP4A 5FQQA 3VFFA 4H8RA 5FQKA 2H0TA 5M18A 2JE5A 3UDIA 4WELA 4E3MA 3JYIA 2JBFA 3NIAA 1K56A 3NC8A 3VP2A 4MLLA 5GHXA 1NYMA 4IBRA 4OQHA 4QU3A 1K56D 3WWXA 1NY0A 3MXRA 3ZG5A 1CK3A 3NI9A 5F1GA 3RXWA 4LV2A 3Q7VA 2RL3A 1ES2A 3DWZA 2P9VB 3C4PA 1FCOA 4QB8A 4CPKA 3LEZA 1GCEA 1O07A 5EPHA 2WAEA 3GV9A 1LI9A 1CI8A 4Y7PA 1JTGA 1Q2QA 2ZQ8A 5KSCA 3RXXA 1WE4A 3NCKA 2V1ZA 3N8LA 1DJAA 1N9BA 3UPNA 3ZVTA 3UPOA 5FQMA 1PIOA 2VGKA 3WS2A 5CRFA 1XP4A 4N92A 3VFHA 3ZG9B 1BSGA 1NZOA 5I94A 1MBLA 5EOOA 4PM5A 1YLWA 3HLWA 4GDBA 4K91A 1NRFA 4S2PA 2WK0A 4OPZA 4JF4A 5EVIC 1L0EA 3Q07A 3CG5A 4P87A 4RYEA 2G2WA 3A3IA 3BM6A 3MBZA 3CZDA 3DW0A 4P85A 2H10A 4JLFA 4P6BA 2ZM8A 1GHIA 3ZNTA 1DY6A 4U0XA 1HVBA 3N6IA 2J8YA 5IHVA 2OV5A 1K57C 4GOGA 3VSLA 1K54A 1E25A 4A5RA 4YFMA 5FAOA 3SH8A 4S2NC 2OLUA 2J9OA 3FZCA 3PBSA 1IYOA 2ZQDA 4FD8A 3BFEA 3AGDA 3BFDA 3S4XA 2ZC6B 4S2JA 4RX3A 3DWKA 3C4OA 2H0YA 1JWVA 4NETA 4E3IA 4PM8A 1JTDA 5CGSA 2WGWB 4KZ5A 4R23A 1AXBA 1DJBA 1K55C 4N1XA 2ZQCA 4OPYA 1KE4A 2Y2GA 3HVFA 1K4EA 2WKEA 4C75A 5FI7A 3E2LA 2X01A 1LL5A 3P09A 1IYQA 3WS1A 3Q1FA 5FAQA 3GMWA 4BL3A 4KZAA 4L0LA 1MY8A 5AQ7A 3N4IA 4LV0A 3V3RA 4B4XA 4DXCA 1MKIA 2C6WB 1GA0A 3N8SA 5FA7A 1BLCA 2B5RA 3HLBA 4PPRA 1ALQA 1YMSA 3G34A 2WAFA 3BFCA 4WYYA 3M2KA 4WZ5A 1LI0A 2XDMA 3A3EA 1XGJA 1MWRA 1HTZA 1RCJA 2ZC7A 3EQUA 5JYPA 2XF3A 1FCMA 3GR2A 2XQZA 2Q9NA 1TDGA 5GLBA 5GLDA 5DTSA 1JWZA 2BLSA 4DDSA 2HP5A 3UDXA 4E3JA 1I5QA 4DE1A 1KGFA 4OKPA 1G6AA 2XFTA 5E2GA 2ZC5B 1G68A 5A92A 2R9WA 1BZAA 1BT5A 4ZJ2A 4K0XA 3D4FA 2HDRA 4ZTKA 4K0WA 2FFYA 1XA7A 4ZBEA 3MZEA 5AQAA 4HBUA 3G35A 4OP8A 4DE2A 5EVIA 2ZC4B 1ES5A 3PTEA 3M6HA 1VM1A 4LCMA 1QMFA 5EVID 1MWTA 5HAIA 3ZGAB 4GKUA 1NJ4A 2H5SA 2ZQAA 3HUNA 1BULA 4FCFA 4D2OA 2WZZA 1KVLA 5CGXA 1EI5A 1RP5A 2Y2MA 3NY4A 2ZQ7A 1K57A 3LY4A 4U0TA 4WEKA 4N1HA 4Z9QA 3UDFA 1K4FA 4JXSA 2IWBA 2Z2MB 4UA7A 4QHCA 1ESIA 1M6KA 1XGIA 5DTKA 4Y0TA 3S1YA 3B3XA 1GHMA 1IYPA 4MBKA 5HL1A 1WYCA 1JVJA 1Q2PA 5AQBA 1ES3A 3NDGA 3UO9A 4DKIA 2WKIA 2HDSA 1YLJA 3UE0A 1FQGA 1K55A 5L2FA 4GN2A 2I72A 4S2OA 2ZJ9A 3GQZA 1L0DA 4KZ9A 2CC1A 3V50A 3VP3A 1KE0A 1PWDA 1K6RA 3BEBA 4M3KA 4PMAA 5TGFA 3C5AA 2HDQA 1KGEA 2PU4A 4UHUA 3OPPA 3IXHA 3LO7A 4OQGA 5FQ9A 3TG9A 1FCNA 3ITAA 3IF6B 3O88A 4GZBA 4WM9A 3FWLA 4KZ3A 5FDHA 3ZFZA 4JPMA 4OP5A 3WS0A 3AGFA 4S2KA 1EWZA 2QZ6A 3WRZA 3IXDA 4GD8A 4OQ0A 3ZVWA 1K25A 3PBQA 4C6YA 1PWCA 3CJMA 3BYDA 4KG6A 2GDNA 1PI4A 4GNUA 1SDNA 2EX9A 3QNCA 4XUXA 4EWFA 2UWXA 2ZD8A 4QY6A 2E8IA 3M6BA 3OCLA 4E6WA 3BECA 4EUZA 3MXSA 4U3TA 3W4OA 5M1AA 3IF6C 3O87A 4EBLA 4RA7A 2WZXA 1HD8A 4IVIA 1ERQA 3M2JA 3E2KA 4R3JA 5EECA 4EBNA 4MBHA 4E3LA 5CERA 2Y2NA 4R0QA 4RX2A 2QPNA 4R3BA 4Q8IA 1IELA 4NK3A 1MXOA 2Y4AA 1TEMA 4OONA 3HLFA 1ZG4A 1W8QA 1MWUA 2DCFA 4EQIA 3EQVA 3P98A 4X6TA 3VOYA 3A3FA 5D3OA 2Y55A 4IBXA 1LL9A 4XXRA 5EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLY A;  1NZU A;  4DE0 A;  4BL2 A;  2Q9M A;  3Q7V B;  5GHZ A;  4BJP A;  4DXB A;  1PW1 A;  2ZQ9 A;  3SH9 A;  3IF5 A;  5FAP A;  1TVF A;  2ZC3 B;  5CHM A;  2XD1 A;  5GLC A;  2WAD A;  1N4O A;  3UNW A;  2IWC A;  3V5M A;  3PAE A;  1SHV A;  2FFF B;  4JKT A;  3PBN A;  1BLH A;  2XLN A;  1MWS A;  1H8Y A;  4ZJ3 A;  3ISG A;  1IKI A;  1Y54 A;  4OQI A;  3AGE A;  1PYY A;  2XH9 A;  2Y2I A;  3ZNY A;  5FI6 A;  2HDU A;  5CTM A;  1ES4 A;  1OME A;  5J8X A;  4N9L A;  1E4D A;  3FKW A;  3SS5 A;  1FSW A;  2WGV A;  3PAG A;  4KZ8 A;  3HRE A;  5E2H A;  4ZAM A;  2XR0 A;  1J9M A;  4X56 A;  4S2L A;  1RGY A;  4QD4 A;  3G2Y A;  5A93 A;  4S2I A;  1MPL A;  1S0W A;  1E3U A;  1M40 A;  4PM7 A;  5AQ9 A;  5FAS A;  1E3U D;  1PI5 A;  1YM1 A;  5HX9 A;  4PM9 A;  5DF7 A;  2J7V A;  3VSK A;  1CI9 A;  1IEM A;  2HP9 A;  2VGJ A;  2P9V A;  3G4P A;  4FSF A;  1XX2 A;  4P0M A;  4QY5 A;  1LLB A;  1SKF A;  3C7U A;  3W4P A;  3UE3 A;  2Y2Q A;  3ZG0 A;  5CXW A;  1L0G A;  2Y2K A;  1C3B A;  3IH9 A;  5G18 A;  2C5W B;  3G2Z A;  2BG1 A;  2P74 A;  5GHY A;  4LCL A;  1K54 C;  3HLD A;  2XGN A;  2Y59 A;  3IF6 A;  1H5X A;  4JBF A;  5F83 A;  2Y2L A;  5FQJ A;  4Y0O A;  3WS5 A;  1PZP A;  3G31 A;  5HAQ A;  1W8Y A;  2G2U A;  3G32 A;  4BEN A;  4X68 A;  1ZC2 A;  4S2N A;  5FAT A;  2XFS A;  3PBT A;  2X02 A;  4OH0 A;  4WMC A;  4HEF A;  5DF8 A;  4WMC D;  1FR1 A;  4JXW A;  4WBG A;  4KQO A;  4FH2 A;  4JXV A;  4MEZ A;  1KVM A;  3MZD A;  1XXM A;  1S6R A;  3ZG7 B;  1PZO A;  4GB7 A;  1I2S A;  3IH8 A;  3ZCZ A;  4BD1 A;  5GL9 A;  2HP6 A;  4OPQ A;  5HW3 A;  3ITB A;  5CGW A;  2WKH A;  3Q81 A;  3BLS A;  1LHY A;  3HLE A;  4OOM A;  4RVA A;  3VOZ A;  4B4Z A;  4ZDX A;  1SCW A;  3BRM A;  2WGW A;  3Q7Z A;  1NXY A;  3MFD A;  3LCE A;  2V20 A;  3QHY A;  4E6X A;  3I7J A;  1ZKJ A;  4QJG A;  3MKF A;  3SS4 A;  4WZ5 C;  3MKE A;  4X69 A;  5CHU A;  2EX2 A;  3OPH A;  4OOY A;  4R4S A;  5A90 A;  3ZHH A;  1K6S A;  1FOF A;  1VQQ A;  1ERM A;  1FSY A;  1ONG A;  4JXG A;  5HFO A;  1Z6F A;  4KQR A;  3UN7 A;  1YQS A;  3SH7 A;  4IVK A;  3N7W A;  5CEC A;  3BLM A;  1U60 A;  3IT9 A;  5EVI B;  4X55 A;  1WYB A;  2WUQ A;  1ERO A;  4MNR A;  2PBY A;  4OVD A;  5FQI A;  1YLP A;  3GSG A;  4EV4 A;  1XA1 A;  1FR6 A;  1W5D A;  4DRT A;  4PM6 A;  3IXG A;  2EXA A;  2IWD A;  4JF6 A;  2X71 A;  3FYZ A;  4E3O A;  1W7F A;  3IQA A;  1IYS A;  2Y2O A;  3OC2 A;  5CED A;  1BUE A;  3GVB A;  4C3Q A;  4UA9 A;  4XUZ A;  2XD5 A;  5CTN A;  3OPR A;  3FKV A;  4ID4 A;  3UE1 A;  3WRT A;  5JYO A;  1CEG A;  4JF5 A;  2V2F F;  3HBR A;  1DJC A;  1HZO A;  1KE3 A;  4HES A;  5GLA A;  4UAA A;  4S2M A;  5CEB A;  3FV7 A;  1O7E A;  2J9P A;  3OCN A;  2PU2 A;  4KZ7 A;  1YLZ A;  3NDE A;  4E3K A;  4EBP A;  2EX8 A;  1I2W A;  1L0F A;  1ONH A;  1YMX A;  1SDE A;  2ZMA A;  3IWI A;  4LV3 A;  5HAR A;  4DDY A;  5FI2 A;  1ESU A;  3GRJ A;  3SOI A;  2Y91 A;  2WGI A;  3TSG A;  3IWQ A;  4MBF A;  2EFU A;  2ZLY A;  4DE3 A;  3UPP A;  2JCH A;  3TOI A;  5KMW A;  3SS3 A;  4LV1 A;  1BLS A;  3IWO A;  3MZF A;  3ZG8 B;  3HLC A;  3LY3 A;  1CEF A;  1H8Z A;  5U47 A;  1PW8 A;  2ZM2 A;  3VMA A;  2DRW A;  3CMZ A;  4YIN A;  4HBT A;  4IED A;  2DNS A;  3A3J A;  2EFX A;  4GD6 A;  3Q82 A;  3HL9 A;  3IHA A;  3C7V A;  5EVL A;  3W4Q A;  1RGZ A;  1GA9 A;  1TDL A;  2OSU A;  3IHB A;  2A49 A;  1YLT A;  2QMI A;  4BD0 A;  4F94 A;  4O7D A;  5E43 A;  1QME A;  4OPR A;  5F82 A;  5DTT A;  3WS4 A;  2EX6 A;  2JC7 A;  2ZM0 A;  3NBL A;  5FSR A;  1JWP A;  1GHP A;  2Y2P A;  3BFF A;  5E2F A;  3UY6 A;  1L2S A;  2Z2L B;  5EOE A;  4KZ4 A;  4OLG A;  1K38 A;  4Y0U A;  4GDN A;  1KDS A;  3N8R A;  2Y2H A;  1XKZ A;  4KEN B;  1W79 A;  5EUA A;  1NYY A;  5HAP A;  2EXB A;  1BLP A;  3OPL A;  4N9K A;  1KGG A;  3QNB A;  3RJU A;  1YT4 A;  4WEJ A;  3PBR A;  4KZ6 A;  5TFQ A;  2RCX A;  2R9X A;  5TR7 A;  3VP1 A;  5BOH A;  4KG2 A;  1XPB A;  4R1G A;  5CHJ A;  3PBO A;  4UA6 A;  3HLG A;  5M19 A;  4X53 A;  2Y2J A;  3BFG A;  3W8K A;  4E3N A;  5E2E A;  3G30 A;  3GTC A;  3O3V A;  4KG5 A;  4R4R A;  1KDW A;  4FH4 A;  3S22 A;  3V3S A;  4LEN A;  1IKG A;  5KSH A;  1BTL A;  2XEP A;  3HUO A;  4KZB A;  1PWG A;  2HPB A;  2WYX A;  4CJN A;  1ZG6 A;  3DTM A;  3O86 A;  4WZ4 A;  4OLD A;  3A3D A;  5A91 A;  3VP0 A;  4B88 A;  4BLM A;  3OZH A;  3HUM A;  2OLV A;  5F1F A;  4KQQ A;  2XK1 A;  5DVA A;  4ZJ1 A;  4BQM A;  3ZDJ A;  4OOL A;  5DF9 A;  5KZH A;  3IXB A;  2A3U A;  4DF6 A;  3V39 A;  3VP4 A;  5FQQ A;  3VFF A;  4H8R A;  5FQK A;  2H0T A;  5M18 A;  2JE5 A;  3UDI A;  4WEL A;  4E3M A;  3JYI A;  2JBF A;  3NIA A;  1K56 A;  3NC8 A;  3VP2 A;  4MLL A;  5GHX A;  1NYM A;  4IBR A;  4OQH A;  4QU3 A;  1K56 D;  3WWX A;  1NY0 A;  3MXR A;  3ZG5 A;  1CK3 A;  3NI9 A;  5F1G A;  3RXW A;  4LV2 A;  3Q7V A;  2RL3 A;  1ES2 A;  3DWZ A;  2P9V B;  3C4P A;  1FCO A;  4QB8 A;  4CPK A;  3LEZ A;  1GCE A;  1O07 A;  5EPH A;  2WAE A;  3GV9 A;  1LI9 A;  1CI8 A;  4Y7P A;  1JTG A;  1Q2Q A;  2ZQ8 A;  5KSC A;  3RXX A;  1WE4 A;  3NCK A;  2V1Z A;  3N8L A;  1DJA A;  1N9B A;  3UPN A;  3ZVT A;  3UPO A;  5FQM A;  1PIO A;  2VGK A;  3WS2 A;  5CRF A;  1XP4 A;  4N92 A;  3VFH A;  3ZG9 B;  1BSG A;  1NZO A;  5I94 A;  1MBL A;  5EOO A;  4PM5 A;  1YLW A;  3HLW A;  4GDB A;  4K91 A;  1NRF A;  4S2P A;  2WK0 A;  4OPZ A;  4JF4 A;  5EVI C;  1L0E A;  3Q07 A;  3CG5 A;  4P87 A;  4RYE A;  2G2W A;  3A3I A;  3BM6 A;  3MBZ A;  3CZD A;  3DW0 A;  4P85 A;  2H10 A;  4JLF A;  4P6B A;  2ZM8 A;  1GHI A;  3ZNT A;  1DY6 A;  4U0X A;  1HVB A;  3N6I A;  2J8Y A;  5IHV A;  2OV5 A;  1K57 C;  4GOG A;  3VSL A;  1K54 A;  1E25 A;  4A5R A;  4YFM A;  5FAO A;  3SH8 A;  4S2N C;  2OLU A;  2J9O A;  3FZC A;  3PBS A;  1IYO A;  2ZQD A;  4FD8 A;  3BFE A;  3AGD A;  3BFD A;  3S4X A;  2ZC6 B;  4S2J A;  4RX3 A;  3DWK A;  3C4O A;  2H0Y A;  1JWV A;  4NET A;  4E3I A;  4PM8 A;  1JTD A;  5CGS A;  2WGW B;  4KZ5 A;  4R23 A;  1AXB A;  1DJB A;  1K55 C;  4N1X A;  2ZQC A;  4OPY A;  1KE4 A;  2Y2G A;  3HVF A;  1K4E A;  2WKE A;  4C75 A;  5FI7 A;  3E2L A;  2X01 A;  1LL5 A;  3P09 A;  1IYQ A;  3WS1 A;  3Q1F A;  5FAQ A;  3GMW A;  4BL3 A;  4KZA A;  4L0L A;  1MY8 A;  5AQ7 A;  3N4I A;  4LV0 A;  3V3R A;  4B4X A;  4DXC A;  1MKI A;  2C6W B;  1GA0 A;  3N8S A;  5FA7 A;  1BLC A;  2B5R A;  3HLB A;  4PPR A;  1ALQ A;  1YMS A;  3G34 A;  2WAF A;  3BFC A;  4WYY A;  3M2K A;  4WZ5 A;  1LI0 A;  2XDM A;  3A3E A;  1XGJ A;  1MWR A;  1HTZ A;  1RCJ A;  2ZC7 A;  3EQU A;  5JYP A;  2XF3 A;  1FCM A;  3GR2 A;  2XQZ A;  2Q9N A;  1TDG A;  5GLB A;  5GLD A;  5DTS A;  1JWZ A;  2BLS A;  4DDS A;  2HP5 A;  3UDX A;  4E3J A;  1I5Q A;  4DE1 A;  1KGF A;  4OKP A;  1G6A A;  2XFT A;  5E2G A;  2ZC5 B;  1G68 A;  5A92 A;  2R9W A;  1BZA A;  1BT5 A;  4ZJ2 A;  4K0X A;  3D4F A;  2HDR A;  4ZTK A;  4K0W A;  2FFY A;  1XA7 A;  4ZBE A;  3MZE A;  5AQA A;  4HBU A;  3G35 A;  4OP8 A;  4DE2 A;  5EVI A;  2ZC4 B;  1ES5 A;  3PTE A;  3M6H A;  1VM1 A;  4LCM A;  1QMF A;  5EVI D;  1MWT A;  5HAI A;  3ZGA B;  4GKU A;  1NJ4 A;  2H5S A;  2ZQA A;  3HUN A;  1BUL A;  4FCF A;  4D2O A;  2WZZ A;  1KVL A;  5CGX A;  1EI5 A;  1RP5 A;  2Y2M A;  3NY4 A;  2ZQ7 A;  1K57 A;  3LY4 A;  4U0T A;  4WEK A;  4N1H A;  4Z9Q A;  3UDF A;  1K4F A;  4JXS A;  2IWB A;  2Z2M B;  4UA7 A;  4QHC A;  1ESI A;  1M6K A;  1XGI A;  5DTK A;  4Y0T A;  3S1Y A;  3B3X A;  1GHM A;  1IYP A;  4MBK A;  5HL1 A;  1WYC A;  1JVJ A;  1Q2P A;  5AQB A;  1ES3 A;  3NDG A;  3UO9 A;  4DKI A;  2WKI A;  2HDS A;  1YLJ A;  3UE0 A;  1FQG A;  1K55 A;  5L2F A;  4GN2 A;  2I72 A;  4S2O A;  2ZJ9 A;  3GQZ A;  1L0D A;  4KZ9 A;  2CC1 A;  3V50 A;  3VP3 A;  1KE0 A;  1PWD A;  1K6R A;  3BEB A;  4M3K A;  4PMA A;  5TGF A;  3C5A A;  2HDQ A;  1KGE A;  2PU4 A;  4UHU A;  3OPP A;  3IXH A;  3LO7 A;  4OQG A;  5FQ9 A;  3TG9 A;  1FCN A;  3ITA A;  3IF6 B;  3O88 A;  4GZB A;  4WM9 A;  3FWL A;  4KZ3 A;  5FDH A;  3ZFZ A;  4JPM A;  4OP5 A;  3WS0 A;  3AGF A;  4S2K A;  1EWZ A;  2QZ6 A;  3WRZ A;  3IXD A;  4GD8 A;  4OQ0 A;  3ZVW A;  1K25 A;  3PBQ A;  4C6Y A;  1PWC A;  3CJM A;  3BYD A;  4KG6 A;  2GDN A;  1PI4 A;  4GNU A;  1SDN A;  2EX9 A;  3QNC A;  4XUX A;  4EWF A;  2UWX A;  2ZD8 A;  4QY6 A;  2E8I A;  3M6B A;  3OCL A;  4E6W A;  3BEC A;  4EUZ A;  3MXS A;  4U3T A;  3W4O A;  5M1A A;  3IF6 C;  3O87 A;  4EBL A;  4RA7 A;  2WZX A;  1HD8 A;  4IVI A;  1ERQ A;  3M2J A;  3E2K A;  4R3J A;  5EEC A;  4EBN A;  4MBH A;  4E3L A;  5CER A;  2Y2N A;  4R0Q A;  4RX2 A;  2QPN A;  4R3B A;  4Q8I A;  1IEL A;  4NK3 A;  1MXO A;  2Y4A A;  1TEM A;  4OON A;  3HLF A;  1ZG4 A;  1W8Q A;  1MWU A;  2DCF A;  4EQI A;  3EQV A;  3P98 A;  4X6T A;  3VOY A;  3A3F A;  5D3O A;  2Y55 A;  4IBX A;  1LL9 A;  4XXR A;  5EE8 A; 
#chains in the Genus database with same CATH topology
 1YLY A;  3Q7V B;  5GHZ A;  2HJE A;  3C30 A;  3IF5 A;  5FAP A;  1TVF A;  5GLC A;  1N4O A;  3UNW A;  1SHV A;  2FFF B;  4JKT A;  4LRZ E;  3PBN A;  2XLN A;  1MWS A;  4H6J B;  1UWN X;  3IX4 A;  3FG8 A;  2XH9 A;  4HY8 A;  5J8X A;  3FKW A;  4ZAM A;  3PAG A;  1VET B;  4S2L A;  1CF0 A;  5FL3 A;  1M40 A;  1XFN A;  5FAS A;  5HX9 A;  5DF7 A;  2J7V A;  2VGJ A;  2P9V A;  3G4P A;  3G6O A;  2L1M A;  3VV4 A;  3C7U A;  3W4P A;  2Y2Q A;  1N9N A;  2BG1 A;  3S7N A;  1Y28 A;  1K54 C;  2Y2L A;  1XFQ A;  2HJ9 C;  1PZP A;  3NHQ A;  4BEN A;  4S2N A;  4OH0 A;  4HEF A;  3P01 A;  3QP8 A;  4WMC D;  4WBG A;  1KVM A;  2O9A A;  1XXM A;  4MDZ A;  1PZO A;  3F1N B;  2CMN A;  2HF6 A;  2PDR A;  3MFD A;  2V20 A;  3QHY A;  3ZQ5 A;  5HPF A;  4QJG A;  4HJ3 A;  4X69 A;  5CHU A;  3OPH A;  2W1T A;  3ZHH A;  1ERM A;  1FSY A;  1F9I A;  1G6O A;  2W3E A;  1Z6F A;  3UN7 A;  4IVK A;  1ERO A;  1GSV A;  5FQI A;  4EV4 A;  2WKP A;  1XA1 A;  2XRN A;  3IXG A;  1W7F A;  3OC2 A;  1IYS A;  1BUE A;  1SZV A;  3GVB A;  5CTN A;  3FKV A;  4ID4 A;  3RH8 B;  2KLI A;  1KE3 A;  4HES A;  4UAA A;  1O7E A;  2J9P A;  2PU2 A;  4II7 A;  4NXG A;  4BBV A;  1SDE A;  2WGI A;  3TSG A;  4HI4 A;  3H7W A;  3FPW A;  1JNU A;  1BLS A;  3CLO A;  3UB7 A;  3HLC A;  1CEF A;  1H8Z A;  3CMZ A;  4YIN A;  1F2K A;  3A3J A;  1LSX A;  2EFX A;  4GD6 A;  3H82 B;  3HL9 A;  1DP6 A;  1NWZ A;  3V67 A;  2QMI A;  2VV6 A;  5E43 A;  5FSR A;  3BFF A;  5E2F A;  2I9V A;  3NOP C;  3UY6 A;  2Z2L B;  3CI6 A;  4OLG A;  4GDN A;  1KDS A;  1W79 A;  4KUO A;  1F98 A;  2O9B A;  1KGG A;  3QNB A;  3RJU A;  2RCX A;  5BOH A;  4R1G A;  3PBO A;  1OTD A;  3S7P A;  4E3N A;  3G30 A;  3GTC A;  1KDW A;  4GS9 A;  2WYX A;  4CJN A;  3DTM A;  4OLD A;  5A91 A;  3UB8 A;  2OLV A;  4KQQ A;  2XK1 A;  3TJZ C;  1S1Y A;  3VP4 A;  5FQQ A;  5M18 A;  1XJ2 A;  2JBF A;  3NIA A;  3VP2 A;  4OQH A;  4QU3 A;  3CUE A;  1NY0 A;  2HZ5 A;  5HWW A;  4MMN A;  2VGL S;  1PFL A;  1FCO A;  1GCE A;  3B33 A;  5DJU A;  2WAE A;  1LI9 A;  4Y7P A;  2ZQ8 A;  1W63 M;  3ZVT A;  1OTE A;  5FQM A;  2XSS A;  5CRF A;  3VFH A;  3ZG9 B;  1MBL A;  2XA7 M;  1T1C A;  4PM5 A;  4GDB A;  3DTK A;  2PAV P;  3VE3 A;  4RYE A;  1VEU B;  4P87 A;  2GX5 A;  3ZNT A;  1HVB A;  3N6I A;  2J8Y A;  3LGO A;  4GOG A;  1K54 A;  4I39 A;  2VJW A;  1OTI A;  5G4Y A;  5DKK A;  3BFE A;  3BFD A;  4RX3 A;  3C4O A;  5CGS A;  4Y15 A;  4KZ5 A;  4R23 A;  4N1X A;  5G4Z A;  1KE4 A;  2Y2G A;  4C75 A;  5FI7 A;  5FAQ A;  5AQ7 A;  3N4I A;  2A24 A;  5FA7 A;  1L3L A;  2B5R A;  4E04 A;  3MQQ A;  3W2Z A;  3BFC A;  5JYP A;  1HTZ A;  3GR2 A;  3NJA A;  1ACF A;  1TDG A;  2M7V A;  4E3J A;  3K3D A;  2FH5 A;  1I5Q A;  4DE1 A;  1KGF A;  1G6A A;  2XFT A;  3DBA A;  2M7U A;  1S66 L;  3MJQ A;  5A92 A;  4X1L A;  4ZJ2 A;  2HDR A;  4ZTK A;  1NRJ A;  3FC7 A;  4Q0H A;  2VLG A;  2Q0O A;  1VM1 A;  5HAI A;  3T50 A;  3ZGA B;  1NJ4 A;  2ZQA A;  4FCF A;  4D2O A;  3HJK A;  3R4K A;  5CTM A;  1EI5 A;  4I38 A;  4WEK A;  1S4S A;  2IWB A;  1M6K A;  2VX8 A;  5DTK A;  4HOI A;  3DAV A;  4EET B;  3CPT B;  1ES3 A;  3LR0 A;  1UWP X;  2D02 A;  3HJI A;  1S4R A;  5I5L A;  3S7Q A;  2CC1 A;  3VP3 A;  1PWD A;  5IU1 A;  5TGF A;  1T19 A;  3IX3 A;  4UHU A;  4MN5 A;  3LO7 A;  3IF6 B;  3FWL A;  4FUW A;  3AGF A;  4S2K A;  2JHE A;  3WRZ A;  4GD8 A;  3PBQ A;  3BYD A;  2H28 A;  3LIB A;  4EWF A;  4LGW A;  2ZD8 A;  4E6W A;  3OCL A;  4JGP A;  3BEC A;  3TRC A;  2K31 A;  4EUZ A;  2P08 A;  4EBL A;  3O87 A;  4RA7 A;  1HD8 A;  1ERQ A;  3M2J A;  4R3J A;  5EEC A;  2QPN A;  4R3B A;  1IEL A;  3EEH A;  3T12 B;  2QKP A;  2J3T D;  4X6T A;  3VOY A;  3A3F A;  5D3O A;  4IBX A;  3TE8 A;  2Q9M A;  4BJP A;  1STZ A;  1PW1 A;  2ZQ9 A;  4DXB A;  3SH9 A;  2ZC3 B;  5CHM A;  2IWC A;  3V5M A;  3PAE A;  4YNR A;  3CWF A;  1H8Y A;  3AGE A;  1PYY A;  3ZNY A;  5FI6 A;  3UB5 P;  5EV0 A;  1E4D A;  3SS5 A;  4KZ8 A;  4X56 A;  4QD4 A;  3LYX A;  2KOI A;  2OAP 1;  4ME4 A;  1E3U A;  4PM7 A;  2INW A;  4ARZ A;  3DTI A;  3T4L A;  2L4R A;  2HP9 A;  3MF0 A;  4P0M A;  1XX2 A;  5HWT A;  4CLC C;  3ZG0 A;  5J7E A;  5CXW A;  3MQ0 A;  1L0G A;  3IH9 A;  1ZHH B;  2W0N A;  4LCL A;  2XGN A;  4HH3 A;  1H5X A;  3NUL A;  4Y0O A;  2QHK A;  5HAQ A;  4GHI A;  1DRM A;  5C5K A;  1DP8 A;  1T18 A;  1OPX A;  5DF8 A;  1FR1 A;  5EM0 A;  3LR5 A;  4JXV A;  4MEZ A;  3KSG A;  3ZG7 B;  3IH8 A;  5GL9 A;  1MC0 A;  5HW3 A;  2WKH A;  3EEA A;  3HLE A;  3PHY A;  4B4Z A;  1SKO B;  4E6X A;  3BRM A;  2WGW A;  4G3V A;  3LCE A;  5L10 A;  1ZKJ A;  1TD5 A;  3MKF A;  1EW0 A;  3SS4 A;  4WL9 A;  4WZ5 C;  5J4E A;  2ZMF A;  4EUV A;  1LSV A;  5L07 A;  1ONG A;  4JXG A;  5HFO A;  3SH7 A;  1U60 A;  3IT9 A;  1TS7 A;  3IBR A;  4X55 A;  1OT6 A;  4MNR A;  1P9W A;  1YLP A;  3HCY A;  1FR6 A;  4I5S A;  4PM6 A;  3FYZ A;  4E3O A;  3B42 A;  3CAX A;  3P7N A;  4UA9 A;  4XUZ A;  2XD5 A;  3D72 A;  3OPR A;  3UE1 A;  2Z6C A;  2FZ0 A;  5JYO A;  3T4T A;  4WUJ A;  4E3K A;  1YMX A;  3IWI A;  1OJG A;  3SOI A;  3CHW P;  3CUE C;  3QP5 A;  2ZLY A;  3UPP A;  3KSI A;  5FEF A;  5HZH A;  3VMA A;  2DRW A;  5IT5 A;  3S7O A;  3Q82 A;  3UB6 A;  4LLO B;  3W4Q A;  1GA9 A;  4I3I A;  3LIF A;  3IHB A;  2A49 A;  4HQA A;  3T4K A;  4F94 A;  5F82 A;  3WS4 A;  2ZM0 A;  1JWP A;  3MQO A;  1GHP A;  1K38 A;  4Y0U A;  3B47 A;  3MFX A;  4EES A;  2Y2H A;  4KEN B;  2HV1 A;  1BLP A;  3OPL A;  4N9K A;  3GDI A;  5HD5 A;  4WEJ A;  4Y3I A;  5CHJ A;  2W3D A;  3HLG A;  3E4Q A;  5M19 A;  2Y2J A;  3BFG A;  3W8K A;  3IS2 A;  4FH4 A;  3V3S A;  4KZB A;  2HPB A;  3O86 A;  4BLM A;  5F1F A;  3MR0 A;  1YAX A;  3ZDJ A;  5KZH A;  3MMH A;  3VFF A;  4H8R A;  3UDI A;  3MSH A;  2PR6 A;  3BQ8 A;  4IBR A;  1DP9 A;  1K56 D;  1P9R A;  3WWX A;  3MXR A;  3ZG5 A;  2OAQ 1;  2Z6D A;  1GSW A;  2QWS A;  4LV2 A;  2RL3 A;  3DWZ A;  2P9V B;  3C4P A;  4QB8 A;  4FOF A;  3JVV A;  5EPH A;  1CI8 A;  1YSQ A;  1Q2Q A;  5KSC A;  2B95 A;  3UPN A;  3EGX C;  3UPO A;  1PIO A;  4O8G A;  4HP9 A;  1GSX A;  5A8B A;  1NZO A;  2VV8 A;  1NRF A;  2VKS A;  3F1P A;  4S2P A;  4IUH A;  3RTY A;  3JPU A;  3Q07 A;  4HIA A;  2G2W A;  3A3I A;  4CLC A;  3MBZ A;  4P6B A;  2ZM8 A;  1UGU A;  5IHV A;  2OV5 A;  4ETZ A;  4A5R A;  5FAO A;  2OLU A;  2PRF A;  4FD8 A;  2ZC6 B;  3T4S A;  3DWK A;  2H0Y A;  4NET A;  2IA2 A;  5K5B A;  4PM8 A;  1JTD A;  4B93 A;  2XRO A;  2EA9 A;  4MN6 A;  2ZBB A;  3C8C A;  1K4E A;  2QYB A;  2W1T B;  4WN5 A;  1IYQ A;  3WS1 A;  2D01 A;  3Q1F A;  3GMW A;  4JGO A;  4BL3 A;  3T1X A;  3BW6 A;  1MY8 A;  3V3R A;  2V0U A;  2B18 A;  5AVF A;  1GA0 A;  5KIZ A;  1ALQ A;  1YMS A;  3T4Q A;  2WAF A;  2VEA A;  2XA7 S;  4WZ5 A;  1LI0 A;  2XDM A;  3A3E A;  1XGJ A;  1RCJ A;  2ZC7 A;  2XF3 A;  2B02 A;  1OTB A;  1S1Z A;  2Q9N A;  3UDX A;  1VHM A;  4OKP A;  3UMD A;  5E2G A;  1G68 A;  1BT5 A;  1G5U A;  4IUK A;  4ZBE A;  1H0M A;  4OP8 A;  4DE2 A;  5EVI A;  1ES5 A;  4XT2 A;  3H7W B;  4LCM A;  2AVX A;  1A0K A;  2JKR I;  4EER A;  4GKU A;  3LFV A;  2PD8 A;  1BUL A;  2WZZ A;  5CGX A;  1KVL A;  3NY4 A;  3LY4 A;  1K57 A;  5HL6 A;  4Z9Q A;  3U2A A;  4UEY A;  4UA7 A;  2W27 A;  1XGI A;  1XJ6 A;  3S1Y A;  3B3X A;  1GHM A;  1IYP A;  2L0W A;  1WYC A;  5AQB A;  3T1S A;  1ZTU A;  3UO9 A;  3D9Y A;  2WKI A;  4EQ1 A;  1IOU A;  2HDS A;  3UE0 A;  3KSF A;  1K55 A;  5L2F A;  4NXF A;  4P6Z M;  4GN2 A;  1D1J A;  3GQZ A;  1KE0 A;  1IFQ A;  4GLQ A;  3BEB A;  4HHD A;  2ZOI A;  3IXH A;  5FQ9 A;  4OQG A;  1FCN A;  3ITA A;  3ICY A;  4KZ3 A;  2QZ6 A;  1YPR A;  1PWC A;  4GS9 B;  4KG6 A;  5F68 A;  3QNC A;  4XUX A;  4QY6 A;  2WZX A;  4B9O A;  2V8F A;  4EBN A;  4E3L A;  5DFY A;  5CER A;  4RX2 A;  4NK3 A;  2Y79 A;  3HLF A;  1W8Q A;  2DCF A;  2JKT I;  2QJ7 A;  2Y55 A;  2WKQ A;  1NZU A;  4DE0 A;  4BL2 A;  4F3L A;  3BWL A;  2E8J A;  4JGQ A;  4UQI M;  2XD1 A;  2WAD A;  3LIC A;  1BYW A;  3ISG A;  1IKI A;  1Y54 A;  4OQI A;  3UME A;  2Y2I A;  3T1Q B;  2J80 A;  2HDU A;  2ZL1 A;  2ZMV A;  1OME A;  4G3W A;  1FSW A;  3HRE A;  4WLA A;  3SW1 A;  4EW7 A;  4K08 A;  5A93 A;  1PI5 A;  1YM1 A;  2BTF P;  3E4P A;  3VSK A;  1CI9 A;  5TBM A;  4Y2F A;  4QY5 A;  1SKF A;  5HDC A;  1C3B A;  5G18 A;  3IX8 A;  3G2Z A;  2LB9 A;  2KDK A;  1V9Z A;  2P74 A;  5L8M A;  4KUK A;  4X1M A;  2O0Y A;  1AWI A;  2Y59 A;  3IF6 A;  5FQJ A;  4L9E A;  3WS5 A;  4LRY C;  4R6L A;  4X68 A;  1ZC2 A;  2XFS A;  2X02 A;  4MN7 A;  4WMC A;  4JXW A;  1MKM A;  2A24 B;  4FH2 A;  1ODV A;  3MZD A;  3VE4 A;  1S6R A;  3F1O A;  2OOL A;  1I2S A;  3K2N A;  4GCZ A;  3ZCZ A;  4YOF A;  2HP6 A;  3ITB A;  3L9K A;  3Q81 A;  3BLS A;  1LHY A;  4OOM A;  4ZDX A;  3SZT A;  1OT9 A;  1SCW A;  1NXY A;  5DJT A;  2EX2 A;  2ACG A;  4OOY A;  4R4S A;  5A90 A;  1K6S A;  1FOF A;  1J3W A;  4KQR A;  3N7W A;  5CEC A;  4O01 A;  1WYB A;  4Y5F A;  2PBY A;  4I3A A;  1NLY A;  3GSG A;  1W5D A;  2LB5 A;  1PRQ A;  3D3O A;  2EXA A;  2IWD A;  4JF6 A;  2Y2O A;  5CED A;  3R7W A;  3OOV A;  4C3Q A;  3WRT A;  1CEG A;  2V2F F;  3HBR A;  1DJC A;  1HZO A;  1D7E A;  5CEB A;  3FV7 A;  3DTE A;  3OCN A;  4KZ7 A;  1K0K A;  2EX8 A;  5HAR A;  4DDY A;  2ZMA A;  5DFX A;  3GRJ A;  2Y91 A;  3CIT A;  4DE3 A;  2JCH A;  2P7J A;  3QP6 A;  1WA9 A;  2KX6 A;  3PYP A;  1PW8 A;  2ZM2 A;  1YSP A;  2DNS A;  4ETX A;  3IHA A;  3C7V A;  5EVL A;  1RGZ A;  3NOT C;  1TDL A;  1TS6 A;  4NG2 A;  2EX6 A;  3NBL A;  2Y2P A;  1L2S A;  5F69 A;  4KZ4 A;  1XKZ A;  1NYY A;  2JKT M;  5HAP A;  2EXB A;  1CJF A;  3PBR A;  4KZ6 A;  2R9X A;  5TR7 A;  1XPB A;  1YKD A;  2J3T C;  4KG5 A;  4R4R A;  4DMZ A;  3S22 A;  4LEN A;  5KSH A;  1BTL A;  4R3A A;  2XEP A;  3BY9 A;  1PWG A;  5F6A A;  4L9F A;  3A3D A;  2DMW A;  5HPI A;  2OWH A;  3OZH A;  5DVA A;  2PR5 A;  4BQM A;  5DF9 A;  4Y13 A;  3IXB A;  4DF6 A;  3V39 A;  2PD7 A;  5FQK A;  4E3M A;  3JYI A;  2VA0 A;  5EVE A;  4MLL A;  1NYM A;  1LSW A;  3TW8 A;  4ARZ B;  3RXW A;  3Q7V A;  1ES2 A;  4RQ9 A;  4CPK A;  2QJ5 A;  4EU0 A;  1OTA A;  4KQD A;  4H6J A;  1WE4 A;  2V1Z A;  3QP1 A;  1N9B A;  2VGK A;  4EXO A;  4N92 A;  1BSG A;  3BQA A;  5EOO A;  3A0R A;  1YLW A;  4GHI B;  5EVI C;  1VET A;  3CZD A;  3DW0 A;  2H10 A;  4U0X A;  1K57 C;  3VSL A;  2V1B A;  1E25 A;  3PR6 A;  3FZC A;  1IYO A;  3ULF A;  2GJ3 A;  3AGD A;  3S4X A;  4BMW A;  3PXP A;  1JWV A;  4E3I A;  2V0W A;  1PNE A;  1X0O A;  2WGW B;  4CQH A;  5AJG A;  1AXB A;  1DJB A;  1K55 C;  4ESP A;  2ZQC A;  3O5Y A;  3E2L A;  3P09 A;  4KZA A;  3FPV A;  4G3K A;  3KX0 X;  3KYE A;  4B4X A;  4DXC A;  1MKI A;  4Q0J A;  5LBR A;  3BJN A;  3HLB A;  4PPR A;  3G34 A;  4Y17 A;  3F1N A;  4WYY A;  3M2K A;  4CLC E;  1MWR A;  3EQU A;  4PKY G;  5GLB A;  5GLD A;  1JWZ A;  2OWJ A;  2HP5 A;  4DDS A;  3OLO A;  3KYZ A;  2ZC5 B;  2R9W A;  1BZA A;  4K0X A;  3D4F A;  2V9A A;  3E0Y A;  4K0W A;  4GW9 A;  2FFY A;  3BY8 A;  3MZE A;  4O0P A;  3M6H A;  1G28 A;  2H5S A;  4DN0 A;  4DJ3 A;  2Y2M A;  1RP5 A;  2ZQ7 A;  3UDF A;  1K4F A;  2Z2M B;  1ESI A;  4NXB A;  2PYP A;  4MBK A;  3EOI A;  1Q2P A;  1Y4O A;  4PAU A;  4DKI A;  1YLJ A;  1FQG A;  2G7U A;  3JVU A;  1H8M A;  3C5A A;  2HDQ A;  3TG9 A;  2P04 A;  4WM9 A;  5IS1 A;  1P97 A;  3WS0 A;  2ZOH A;  4LFU A;  1EWZ A;  3IS2 B;  2NUT C;  3IXD A;  4HJ6 A;  4OQ0 A;  1K25 A;  4C6Y A;  3CJM A;  4HH2 A;  2GDN A;  3H82 A;  4GNU A;  1SDN A;  2EX9 A;  2UWX A;  3LR4 A;  2K2N A;  5M1A A;  3IF6 C;  4IVI A;  3E2K A;  4BWI A;  3T1R A;  4MBH A;  3LR3 A;  2Y2N A;  4R0Q A;  2Y4A A;  1LL8 A;  1TEM A;  4EQI A;  1XJ3 A;  3EQV A;  5AVE A;  3P98 A;  2W1R A;  4XXR A;  3E98 A;  4JGR A;  3NOU C;  5CX7 A;  4P6Z S;  2VZW A;  4HNB A;  4EEP A;  4IJG A;  1BLH A;  2UV0 E;  4ZJ3 A;  1ES4 A;  4N9L A;  4QPR A;  2WGV A;  3F1P B;  5E2H A;  3MS6 A;  2XR0 A;  4NXE A;  1J9M A;  4CLC B;  1RGY A;  3G2Y A;  4S2I A;  1MPL A;  1S0W A;  3EGD C;  5AQ9 A;  1E3U D;  4PM9 A;  4IHQ A;  1IEM A;  4FSF A;  3H9W A;  1LLB A;  3UE3 A;  2Y2K A;  2C5W B;  3KSH A;  3KYQ A;  4PKY A;  5GHY A;  1MZU A;  3HLD A;  3GEC A;  5F83 A;  4JBF A;  3G31 A;  4UQI S;  1W8Y A;  2G2U A;  3G32 A;  5FAT A;  3PBT A;  1VEU A;  4KQO A;  2VV7 A;  3L7H A;  4GB7 A;  4BD1 A;  4OPQ A;  5CGW A;  2K7S A;  4RVA A;  3VOZ A;  3Q7Z A;  2V8C A;  3I7J A;  3MKE A;  3A0V A;  1HLU P;  5HWV A;  1VQQ A;  1YQS A;  4HP4 A;  3BLM A;  5EVI B;  2WUQ A;  4XT2 B;  4Q0I A;  2JN7 A;  4OVD A;  3T4J A;  4DRT A;  2WKR A;  2X71 A;  3IQA A;  4M4X A;  4JF5 A;  3LI8 A;  5EFW A;  5F5Y A;  5GLA A;  4S2M A;  3IBJ A;  5HSQ A;  3LUQ A;  1YLZ A;  3NDE A;  4EBP A;  1I2W A;  1L0F A;  1ONH A;  4LV3 A;  4WF0 A;  5FI2 A;  1ESU A;  3IWQ A;  4QWO A;  4MBF A;  2EFU A;  4I3J A;  3TOI A;  5KMW A;  3A0S A;  4LV1 A;  3SS3 A;  3IWO A;  3MZF A;  3ZG8 B;  3LY3 A;  5FEG A;  5DKL A;  5U47 A;  1CQA A;  5FDS A;  4HBT A;  4IED A;  5HDD A;  3LID A;  3MXQ A;  3C2W A;  4MCW A;  1W63 Q;  2OSU A;  1YLT A;  3CPT A;  4BD0 A;  4O7D A;  1QME A;  4OPR A;  5DTT A;  2VGL M;  2JC7 A;  3T4O A;  2GNX A;  5EOE A;  4NEE D;  1XJ4 A;  3N8R A;  1TF1 A;  5EUA A;  2HGV A;  4BBU A;  1YT4 A;  5TFQ A;  3VP1 A;  4KG2 A;  4F3L B;  2PYR A;  1VB6 A;  4UA6 A;  4R70 A;  4X53 A;  5E2E A;  3O3V A;  1S67 L;  1IKG A;  1P0Z A;  3HUO A;  4HJ4 A;  1ZG6 A;  4WZ4 A;  4B88 A;  3VP0 A;  2J3W A;  3K3C A;  3HUM A;  2ZL1 B;  1F5M A;  4ZJ1 A;  1FIK A;  4OOL A;  2A3U A;  1NLZ A;  2VK3 A;  2H0T A;  2JE5 A;  3OBF A;  4WEL A;  1K56 A;  2EWW A;  3NC8 A;  5GHX A;  3NEC A;  1CK3 A;  3NI9 A;  5F1G A;  2PHY A;  5TBM B;  3LEZ A;  1O07 A;  1TS0 A;  3GV9 A;  1JTG A;  3RXX A;  5MC7 A;  3NCK A;  3N8L A;  1DJA A;  4PHT A;  5HDS A;  4AFI A;  2JKR M;  3WS2 A;  1LT0 A;  1XP4 A;  4L9G A;  5I94 A;  1N9L A;  3HLW A;  3RFB A;  4K91 A;  4R38 A;  2WK0 A;  4YWZ A;  4OPZ A;  2MJ6 A;  4JF4 A;  1L0E A;  3CG5 A;  3BM6 A;  4P85 A;  4CLC D;  4JLF A;  4ZRR A;  1GHI A;  1DY6 A;  4YFM A;  3SH8 A;  3F1O B;  2NUP C;  4S2N C;  2J9O A;  2R78 A;  3C38 A;  3PBS A;  2ZQD A;  3LIA A;  4S2J A;  1T1B A;  4FTX A;  4OPY A;  1TS8 A;  3HVF A;  2WKE A;  3LEQ A;  2X01 A;  1LL5 A;  4L0L A;  4LV0 A;  1V9Y A;  4LPZ A;  2C6W B;  3N8S A;  1BLC A;  4EEU A;  4X25 A;  1FCM A;  2XQZ A;  1N9O A;  3R7W B;  5DTS A;  2BLS A;  2PBD P;  3UB9 A;  3LIE A;  1SKO A;  4BBT A;  1H3Q A;  2PT7 A;  4GJ4 A;  2V1A A;  2W3G A;  5TJJ A;  3EWK A;  1T1A A;  5J3W A;  2Y8H A;  1XA7 A;  3ZYT A;  5AQA A;  4HBU A;  3G35 A;  2ZC4 B;  3PTE A;  2GZA A;  1KOU A;  1QMF A;  5EVI D;  1MWT A;  2YKF A;  1OJ5 A;  3QP4 A;  3HUN A;  3KO6 A;  4NKP A;  2YKH A;  4U0T A;  5L09 A;  4N1H A;  4JXS A;  4QHC A;  4DJ2 A;  2EWV A;  4D60 A;  4Y0T A;  5HL1 A;  1FIL A;  1JVJ A;  2W3H A;  3E4O A;  3NDG A;  3VOL A;  2JKF A;  2I72 A;  4S2O A;  2ZJ9 A;  2A2L A;  1L0D A;  4KZ9 A;  4Z1W A;  3LI9 A;  3V50 A;  1K6R A;  2M1C A;  4M3K A;  4PMA A;  2O9C A;  1KGE A;  2O99 A;  2PU4 A;  1Z09 A;  1D06 A;  3OPP A;  2JKG A;  3O88 A;  4GZB A;  3ZFZ A;  2BAS A;  5FDH A;  4JPM A;  4OP5 A;  3QP2 A;  3ZVW A;  1PI4 A;  2E8I A;  3M6B A;  5EM1 A;  4LRX C;  3MXS A;  4U3T A;  3W4O A;  4Q8I A;  1MXO A;  4OON A;  3UE6 A;  1ZG4 A;  5HD3 A;  1MWU A;  2W3F A;  3U4L P;  1LL9 A;  5EE8 A; 
#chains in the Genus database with same CATH homology
 1YLY A;  1NZU A;  4DE0 A;  4BL2 A;  2Q9M A;  3Q7V B;  5GHZ A;  4BJP A;  4DXB A;  1PW1 A;  2ZQ9 A;  3SH9 A;  3IF5 A;  5FAP A;  1TVF A;  2ZC3 B;  5CHM A;  2XD1 A;  5GLC A;  2WAD A;  1N4O A;  3UNW A;  2IWC A;  3V5M A;  3PAE A;  1SHV A;  2FFF B;  4JKT A;  3PBN A;  1BLH A;  2XLN A;  1MWS A;  1H8Y A;  4ZJ3 A;  3ISG A;  1IKI A;  1Y54 A;  4OQI A;  3AGE A;  1PYY A;  2XH9 A;  2Y2I A;  3ZNY A;  5FI6 A;  2HDU A;  5CTM A;  1ES4 A;  1OME A;  5J8X A;  4N9L A;  1E4D A;  3FKW A;  3SS5 A;  1FSW A;  2WGV A;  3PAG A;  4KZ8 A;  3HRE A;  5E2H A;  4ZAM A;  2XR0 A;  1J9M A;  4X56 A;  4S2L A;  1RGY A;  4QD4 A;  3G2Y A;  5A93 A;  4S2I A;  1MPL A;  1S0W A;  1E3U A;  1M40 A;  4PM7 A;  5AQ9 A;  5FAS A;  1E3U D;  1PI5 A;  1YM1 A;  5HX9 A;  4PM9 A;  5DF7 A;  2J7V A;  3VSK A;  1CI9 A;  1IEM A;  2HP9 A;  2VGJ A;  2P9V A;  3G4P A;  4FSF A;  1XX2 A;  4P0M A;  4QY5 A;  1LLB A;  1SKF A;  3C7U A;  3W4P A;  3UE3 A;  2Y2Q A;  3ZG0 A;  5CXW A;  1L0G A;  2Y2K A;  1C3B A;  3IH9 A;  5G18 A;  2C5W B;  3G2Z A;  2BG1 A;  2P74 A;  5GHY A;  4LCL A;  1K54 C;  3HLD A;  2XGN A;  2Y59 A;  3IF6 A;  1H5X A;  4JBF A;  5F83 A;  2Y2L A;  5FQJ A;  4Y0O A;  3WS5 A;  1PZP A;  3G31 A;  5HAQ A;  1W8Y A;  2G2U A;  3G32 A;  4BEN A;  4X68 A;  1ZC2 A;  4S2N A;  5FAT A;  2XFS A;  3PBT A;  2X02 A;  4OH0 A;  4WMC A;  4HEF A;  5DF8 A;  4WMC D;  1FR1 A;  4JXW A;  4WBG A;  4KQO A;  4FH2 A;  4JXV A;  4MEZ A;  1KVM A;  3MZD A;  1XXM A;  1S6R A;  3ZG7 B;  1PZO A;  4GB7 A;  1I2S A;  3IH8 A;  3ZCZ A;  4BD1 A;  5GL9 A;  2HP6 A;  4OPQ A;  5HW3 A;  3ITB A;  5CGW A;  2WKH A;  3Q81 A;  3BLS A;  1LHY A;  3HLE A;  4OOM A;  4RVA A;  3VOZ A;  4B4Z A;  4ZDX A;  1SCW A;  3BRM A;  2WGW A;  3Q7Z A;  1NXY A;  3MFD A;  3LCE A;  2V20 A;  3QHY A;  4E6X A;  3I7J A;  1ZKJ A;  4QJG A;  3MKF A;  3SS4 A;  4WZ5 C;  3MKE A;  4X69 A;  5CHU A;  2EX2 A;  3OPH A;  4OOY A;  4R4S A;  5A90 A;  3ZHH A;  1K6S A;  1FOF A;  1VQQ A;  1ERM A;  1FSY A;  1ONG A;  4JXG A;  5HFO A;  1Z6F A;  4KQR A;  3UN7 A;  1YQS A;  3SH7 A;  4IVK A;  3N7W A;  5CEC A;  3BLM A;  1U60 A;  3IT9 A;  5EVI B;  4X55 A;  1WYB A;  2WUQ A;  1ERO A;  4MNR A;  2PBY A;  4OVD A;  5FQI A;  1YLP A;  3GSG A;  4EV4 A;  1XA1 A;  1FR6 A;  1W5D A;  4DRT A;  4PM6 A;  3IXG A;  2EXA A;  2IWD A;  4JF6 A;  2X71 A;  3FYZ A;  4E3O A;  1W7F A;  3IQA A;  1IYS A;  2Y2O A;  3OC2 A;  5CED A;  1BUE A;  3GVB A;  4C3Q A;  4UA9 A;  4XUZ A;  2XD5 A;  5CTN A;  3OPR A;  3FKV A;  4ID4 A;  3UE1 A;  3WRT A;  5JYO A;  1CEG A;  4JF5 A;  2V2F F;  3HBR A;  1DJC A;  1HZO A;  1KE3 A;  4HES A;  5GLA A;  4UAA A;  4S2M A;  5CEB A;  3FV7 A;  1O7E A;  2J9P A;  3OCN A;  2PU2 A;  4KZ7 A;  1YLZ A;  3NDE A;  4E3K A;  4EBP A;  2EX8 A;  1I2W A;  1L0F A;  1ONH A;  1YMX A;  1SDE A;  2ZMA A;  3IWI A;  4LV3 A;  5HAR A;  4DDY A;  5FI2 A;  1ESU A;  3GRJ A;  3SOI A;  2Y91 A;  2WGI A;  3TSG A;  3IWQ A;  4MBF A;  2EFU A;  2ZLY A;  4DE3 A;  3UPP A;  2JCH A;  3TOI A;  5KMW A;  3SS3 A;  4LV1 A;  1BLS A;  3IWO A;  3MZF A;  3ZG8 B;  3HLC A;  3LY3 A;  1CEF A;  1H8Z A;  5U47 A;  1PW8 A;  2ZM2 A;  3VMA A;  2DRW A;  3CMZ A;  4YIN A;  4HBT A;  4IED A;  2DNS A;  3A3J A;  2EFX A;  4GD6 A;  3Q82 A;  3HL9 A;  3IHA A;  3C7V A;  5EVL A;  3W4Q A;  1RGZ A;  1GA9 A;  1TDL A;  2OSU A;  3IHB A;  2A49 A;  1YLT A;  2QMI A;  4BD0 A;  4F94 A;  4O7D A;  5E43 A;  1QME A;  4OPR A;  5F82 A;  5DTT A;  3WS4 A;  2EX6 A;  2JC7 A;  2ZM0 A;  3NBL A;  5FSR A;  1JWP A;  1GHP A;  2Y2P A;  3BFF A;  5E2F A;  3UY6 A;  1L2S A;  2Z2L B;  5EOE A;  4KZ4 A;  4OLG A;  1K38 A;  4Y0U A;  4GDN A;  1KDS A;  3N8R A;  2Y2H A;  1XKZ A;  4KEN B;  1W79 A;  5EUA A;  1NYY A;  5HAP A;  2EXB A;  1BLP A;  3OPL A;  4N9K A;  1KGG A;  3QNB A;  3RJU A;  1YT4 A;  4WEJ A;  3PBR A;  4KZ6 A;  5TFQ A;  2RCX A;  2R9X A;  5TR7 A;  3VP1 A;  5BOH A;  4KG2 A;  1XPB A;  4R1G A;  5CHJ A;  3PBO A;  4UA6 A;  3HLG A;  5M19 A;  4X53 A;  2Y2J A;  3BFG A;  3W8K A;  4E3N A;  5E2E A;  3G30 A;  3GTC A;  3O3V A;  4KG5 A;  4R4R A;  1KDW A;  4FH4 A;  3S22 A;  3V3S A;  4LEN A;  1IKG A;  5KSH A;  1BTL A;  2XEP A;  3HUO A;  4KZB A;  1PWG A;  2HPB A;  2WYX A;  4CJN A;  1ZG6 A;  3DTM A;  3O86 A;  4WZ4 A;  4OLD A;  3A3D A;  5A91 A;  3VP0 A;  4B88 A;  4BLM A;  3OZH A;  3HUM A;  2OLV A;  5F1F A;  4KQQ A;  2XK1 A;  5DVA A;  4ZJ1 A;  4BQM A;  3ZDJ A;  4OOL A;  5DF9 A;  5KZH A;  3IXB A;  2A3U A;  4DF6 A;  3V39 A;  3VP4 A;  5FQQ A;  3VFF A;  4H8R A;  5FQK A;  2H0T A;  5M18 A;  2JE5 A;  3UDI A;  4WEL A;  4E3M A;  3JYI A;  2JBF A;  3NIA A;  1K56 A;  3NC8 A;  3VP2 A;  4MLL A;  5GHX A;  1NYM A;  4IBR A;  4OQH A;  4QU3 A;  1K56 D;  3WWX A;  1NY0 A;  3MXR A;  3ZG5 A;  1CK3 A;  3NI9 A;  5F1G A;  3RXW A;  4LV2 A;  3Q7V A;  2RL3 A;  1ES2 A;  3DWZ A;  2P9V B;  3C4P A;  1FCO A;  4QB8 A;  4CPK A;  3LEZ A;  1GCE A;  1O07 A;  5EPH A;  2WAE A;  3GV9 A;  1LI9 A;  1CI8 A;  4Y7P A;  1JTG A;  1Q2Q A;  2ZQ8 A;  5KSC A;  3RXX A;  1WE4 A;  3NCK A;  2V1Z A;  3N8L A;  1DJA A;  1N9B A;  3UPN A;  3ZVT A;  3UPO A;  5FQM A;  1PIO A;  2VGK A;  3WS2 A;  5CRF A;  1XP4 A;  4N92 A;  3VFH A;  3ZG9 B;  1BSG A;  1NZO A;  5I94 A;  1MBL A;  5EOO A;  4PM5 A;  1YLW A;  3HLW A;  4GDB A;  4K91 A;  1NRF A;  4S2P A;  2WK0 A;  4OPZ A;  4JF4 A;  5EVI C;  1L0E A;  3Q07 A;  3CG5 A;  4P87 A;  4RYE A;  2G2W A;  3A3I A;  3BM6 A;  3MBZ A;  3CZD A;  3DW0 A;  4P85 A;  2H10 A;  4JLF A;  4P6B A;  2ZM8 A;  1GHI A;  3ZNT A;  1DY6 A;  4U0X A;  1HVB A;  3N6I A;  2J8Y A;  5IHV A;  2OV5 A;  1K57 C;  4GOG A;  3VSL A;  1K54 A;  1E25 A;  4A5R A;  4YFM A;  5FAO A;  3SH8 A;  4S2N C;  2OLU A;  2J9O A;  3FZC A;  3PBS A;  1IYO A;  2ZQD A;  4FD8 A;  3BFE A;  3AGD A;  3BFD A;  3S4X A;  2ZC6 B;  4S2J A;  4RX3 A;  3DWK A;  3C4O A;  2H0Y A;  1JWV A;  4NET A;  4E3I A;  4PM8 A;  1JTD A;  5CGS A;  2WGW B;  4KZ5 A;  4R23 A;  1AXB A;  1DJB A;  1K55 C;  4N1X A;  2ZQC A;  4OPY A;  1KE4 A;  2Y2G A;  3HVF A;  1K4E A;  2WKE A;  4C75 A;  5FI7 A;  3E2L A;  2X01 A;  1LL5 A;  3P09 A;  1IYQ A;  3WS1 A;  3Q1F A;  5FAQ A;  3GMW A;  4BL3 A;  4KZA A;  4L0L A;  1MY8 A;  5AQ7 A;  3N4I A;  4LV0 A;  3V3R A;  4B4X A;  4DXC A;  1MKI A;  2C6W B;  1GA0 A;  3N8S A;  5FA7 A;  1BLC A;  2B5R A;  3HLB A;  4PPR A;  1ALQ A;  1YMS A;  3G34 A;  2WAF A;  3BFC A;  4WYY A;  3M2K A;  4WZ5 A;  1LI0 A;  2XDM A;  3A3E A;  1XGJ A;  1MWR A;  1HTZ A;  1RCJ A;  2ZC7 A;  3EQU A;  5JYP A;  2XF3 A;  1FCM A;  3GR2 A;  2XQZ A;  2Q9N A;  1TDG A;  5GLB A;  5GLD A;  5DTS A;  1JWZ A;  2BLS A;  4DDS A;  2HP5 A;  3UDX A;  4E3J A;  1I5Q A;  4DE1 A;  1KGF A;  4OKP A;  1G6A A;  2XFT A;  5E2G A;  2ZC5 B;  1G68 A;  5A92 A;  2R9W A;  1BZA A;  1BT5 A;  4ZJ2 A;  4K0X A;  3D4F A;  2HDR A;  4ZTK A;  4K0W A;  2FFY A;  1XA7 A;  4ZBE A;  3MZE A;  5AQA A;  4HBU A;  3G35 A;  4OP8 A;  4DE2 A;  5EVI A;  2ZC4 B;  1ES5 A;  3PTE A;  3M6H A;  1VM1 A;  4LCM A;  1QMF A;  5EVI D;  1MWT A;  5HAI A;  3ZGA B;  4GKU A;  1NJ4 A;  2H5S A;  2ZQA A;  3HUN A;  1BUL A;  4FCF A;  4D2O A;  2WZZ A;  1KVL A;  5CGX A;  1EI5 A;  1RP5 A;  2Y2M A;  3NY4 A;  2ZQ7 A;  1K57 A;  3LY4 A;  4U0T A;  4WEK A;  4N1H A;  4Z9Q A;  3UDF A;  1K4F A;  4JXS A;  2IWB A;  2Z2M B;  4UA7 A;  4QHC A;  1ESI A;  1M6K A;  1XGI A;  5DTK A;  4Y0T A;  3S1Y A;  3B3X A;  1GHM A;  1IYP A;  4MBK A;  5HL1 A;  1WYC A;  1JVJ A;  1Q2P A;  5AQB A;  1ES3 A;  3NDG A;  3UO9 A;  4DKI A;  2WKI A;  2HDS A;  1YLJ A;  3UE0 A;  1FQG A;  1K55 A;  5L2F A;  4GN2 A;  2I72 A;  4S2O A;  2ZJ9 A;  3GQZ A;  1L0D A;  4KZ9 A;  2CC1 A;  3V50 A;  3VP3 A;  1KE0 A;  1PWD A;  1K6R A;  3BEB A;  4M3K A;  4PMA A;  5TGF A;  3C5A A;  2HDQ A;  1KGE A;  2PU4 A;  4UHU A;  3OPP A;  3IXH A;  3LO7 A;  4OQG A;  5FQ9 A;  3TG9 A;  1FCN A;  3ITA A;  3IF6 B;  3O88 A;  4GZB A;  4WM9 A;  3FWL A;  4KZ3 A;  5FDH A;  3ZFZ A;  4JPM A;  4OP5 A;  3WS0 A;  3AGF A;  4S2K A;  1EWZ A;  2QZ6 A;  3WRZ A;  3IXD A;  4GD8 A;  4OQ0 A;  3ZVW A;  1K25 A;  3PBQ A;  4C6Y A;  1PWC A;  3CJM A;  3BYD A;  4KG6 A;  2GDN A;  1PI4 A;  4GNU A;  1SDN A;  2EX9 A;  3QNC A;  4XUX A;  4EWF A;  2UWX A;  2ZD8 A;  4QY6 A;  2E8I A;  3M6B A;  3OCL A;  4E6W A;  3BEC A;  4EUZ A;  3MXS A;  4U3T A;  3W4O A;  5M1A A;  3IF6 C;  3O87 A;  4EBL A;  4RA7 A;  2WZX A;  1HD8 A;  4IVI A;  1ERQ A;  3M2J A;  3E2K A;  4R3J A;  5EEC A;  4EBN A;  4MBH A;  4E3L A;  5CER A;  2Y2N A;  4R0Q A;  4RX2 A;  2QPN A;  4R3B A;  4Q8I A;  1IEL A;  4NK3 A;  1MXO A;  2Y4A A;  1TEM A;  4OON A;  3HLF A;  1ZG4 A;  1W8Q A;  1MWU A;  2DCF A;  4EQI A;  3EQV A;  3P98 A;  4X6T A;  3VOY A;  3A3F A;  5D3O A;  2Y55 A;  4IBX A;  1LL9 A;  4XXR A;  5EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...