1YLYA

X-ray crystallographic structure of ctx-m-9 beta-lactamase complexed with ceftazidime-like boronic acid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-9
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylyA00
4Y7PA 1IKGA 2Z2LB 2H0YA 3P09A 1NY0A 2XLNA 4X53A 4GD6A 3JYIA 1VM1A 4KG2A 3PBTA 3N8RA 1FSWA 4DE2A 3O3VA 4Z9QA 3AGEA 4Y0TA 1YMXA 4OQHA 3IF6C 5CGWA 4ZJ1A 1GHIA 5FQ9A 2ZM8A 1XKZA 4WMCD 4MBKA 4JXVA 3V3SA 3EQVA 4GNUA 1YLZA 4R0QA 5CGXA 3V5MA 1EWZA 2FFYA 3A3EA 3ZDJA 1XXMA 3GV9A 3VSLA 4PM7A 3M6HA 3ZG8B 1JTDA 2WGWA 3MXRA 5HFOA 1NZUA 3WRTA 5CEDA 3IWOA 4N1HA 4NETA 1YM1A 2Y2NA 3IXHA 3BLMA 4OP5A 3G2YA 4KG6A 3NY4A 1GCEA 4YINA 4BD0A 1DJCA 3MBZA 4P85A 4OP8A 5EVIA 4E6WA 3HLWA 2WZXA 4U0TA 1KDSA 4S2OA 3AGFA 2HP6A 2Y2MA 5EVLA 5GLCA 1ES5A 1KDWA 5FA7A 3WS2A 5CHJA 5E2GA 3VFFA 1GA0A 3TSGA 1L0EA 1BSGA 1CK3A 1NRFA 3PBRA 3BFCA 2EX8A 4FCFA 1ONGA 2ZQ7A 4RVAA 1N9BA 5A92A 1K6SA 5FI2A 1S6RA 3UE1A 2Y2PA 1ESIA 4R3JA 4R1GA 4S2JA 2ZM2A 3W8KA 2R9WA 4X68A 3NDEA 5CHUA 4EBPA 4EV4A 2ZQDA 2J8YA 2C6WB 4OPZA 1I5QA 3IXGA 4LENA 3SS5A 4EBLA 1NYMA 3IXDA 2QMIA 2BG1A 3GVBA 3ZVTA 2HP5A 3ZFZA 1MKIA 2E8IA 2JC7A 4DF6A 1K4EA 2Y2OA 3G32A 5M1AA 1PI5A 1K57C 1ALQA 3ZG0A 3ZG5A 5E2EA 4B88A 4MLLA 2JCHA 2OLVA 4RX2A 1HVBA 4HESA 3IWQA 4WZ5A 2HP9A 4RA7A 1RGZA 4A5RA 3BRMA 2EX2A 3FV7A 3MXSA 1W8YA 5TFQA 3Q07A 1MWRA 2R9XA 2XH9A 2P9VA 1K38A 1MXOA 4IBRA 4DKIA 5A93A 4ID4A 1SDEA 1TEMA 1TDLA 1FCOA 3ZVWA 4P0MA 5CTNA 1M6KA 2WGWB 4GDBA 2BLSA 3TG9A 1W7FA 1CI8A 1YQSA 3GSGA 3Q81A 1XGJA 2ZC5B 3DWZA 4OPQA 1ES4A 2G2UA 4ZJ3A 3ZNTA 1PYYA 4KZBA 4OQ0A 4IEDA 1FR6A 1BZAA 3HLEA 3HUMA 1XA1A 5FQQA 2XF3A 1GA9A 1N4OA 2QPNA 1K6RA 3GQZA 5EE8A 3RXXA 3OCNA 3A3JA 3WS1A 4X56A 1YT4A 4E3JA 1MY8A 1IKIA 2HDUA 3IHBA 5HAPA 1Y54A 3QHYA 4KZAA 4PM6A 3VP1A 3BFGA 4Y0OA 1TVFA 4DDYA 1JWPA 4U3TA 1CEGA 1KE4A 4E3KA 3MZDA 1BLHA 3VP3A 2Y59A 3PAEA 4QB8A 4BD1A 1KGEA 3OPHA 4X55A 4KQQA 3ITAA 5IHVA 4X69A 5TR7A 1JWZA 4JLFA 5GHYA 4DRTA 4FH4A 1H8YA 1XPBA 1BULA 2OSUA 1YLWA 1ZC2A 2ZQCA 4LV0A 5AQBA 2UWXA 5FAOA 5KSHA 1YLPA 4S2NC 3UY6A 3N8LA 3NBLA 4JXWA 5E2FA 4JF6A 2JBFA 3OPRA 1Z6FA 2ZQ9A 2WADA 1PZOA 3LEZA 5M19A 3HLGA 2FFFB 1JTGA 3C4PA 4OLGA 1G68A 2Y2LA 2ZMAA 5CECA 1LLBA 4CJNA 3IF5A 2Y2GA 2I72A 2Y2HA 1SDNA 4EUZA 1XA7A 3BFDA 1SKFA 3WWXA 4JXSA 3CZDA 4D2OA 4R4RA 4HBUA 3DW0A 1PWDA 4QHCA 4BQMA 1KVLA 5EPHA 1IELA 4LCMA 4QD4A 4JXGA 3S4XA 3OZHA 4KZ4A 1FCNA 1ONHA 1L0DA 1MBLA 2WGIA 3WS5A 1IEMA 2Y55A 3MFDA 3P98A 5DF8A 3NI9A 3VSKA 4N9KA 1K54A 3A3DA 1NZOA 1Q2QA 2XD5A 5CHMA 4XXRA 1KGGA 2XGNA 5BOHA 3BYDA 3Q1FA 1HTZA 5AQ7A 1K56A 1FR1A 2P9VB 3BFEA 4XUZA 4KZ9A 3M2KA 1RCJA 4WEJA 3PBNA 2H5SA 4BLMA 4GZBA 5CEBA 4Y0UA 2EX6A 5EVID 2PU4A 1JWVA 3UDXA 3WS4A 4UA9A 3UDFA 5F82A 3HLCA 1EI5A 3BLSA 2IWBA 4OONA 5FAPA 2EFUA 4BL2A 1MPLA 4GB7A 3BECA 3G4PA 4MBFA 4S2PA 2CC1A 3UE3A 3ZNYA 3IWIA 3PBQA 4RX3A 3NDGA 1CI9A 4C3QA 5F1GA 3N6IA 4OLDA 5U47A 4PMAA 3HBRA 2WGVA 5L2FA 4U0XA 5AQAA 2Y2IA 5EUAA 3HLFA 3SH9A 3A3IA 1WYCA 1K54C 2ZLYA 3IF6B 2XR0A 2X71A 4N9LA 2Y4AA 3IT9A 4BJPA 1MWSA 4GOGA 5FSRA 1BT5A 5DTKA 4EQIA 3DTMA 4R4SA 2G2WA 1Q2PA 3IH8A 5HX9A 5FQJA 5FATA 1E3UA 5F83A 4Q8IA 3FKVA 3B3XA 3O86A 4JF4A 3HREA 1IYSA 5DF7A 3GRJA 4ZTKA 5EVIC 2WAEA 3M2JA 4KZ3A 1NXYA 3MZFA 3VOYA 1G6AA 2QZ6A 2GDNA 4LV3A 3LY3A 1ERMA 3EQUA 3GTCA 4X6TA 4M3KA 3N8SA 3G34A 2PBYA 1K55A 3O88A 5CXWA 1NYYA 3NIAA 3PBOA 1KE3A 3G31A 5FQIA 2XK1A 1GHMA 1ES3A 5G18A 1O07A 4C6YA 5DVAA 3TOIA 2WUQA 4K0WA 1GHPA 2HDQA 1XGIA 2XFTA 2Y91A 3HLBA 5FQKA 5CERA 3IH9A 2WKIA 1PI4A 1JVJA 4HBTA 2WK0A 2ZC6B 4S2KA 3BFFA 1IYPA 3PBSA 1QMFA 4KENB 5GL9A 5HW3A 4MNRA 4UAAA 2XQZA 4E3IA 5GHZA 5KZHA 4O7DA 2Y2KA 4QY5A 3W4PA 1ES2A 3LCEA 3VP4A 4WBGA 4CPKA 1K25A 2A3UA 2RCXA 2IWCA 3G30A 1L0GA 4FD8A 5GLBA 1LI0A 2RL3A 2J9OA 3VOZA 3SH7A 3IHAA 3ZG7B 2JE5A 3OC2A 4E3NA 3RJUA 1LL5A 4YFMA 1BLSA 4L0LA 1BUEA 5HAIA 2EXBA 2Y2JA 2ZM0A 4GN2A 2DRWA 3HUOA 4DXCA 2X02A 3G2ZA 4DE0A 4E6XA 3BEBA 4WZ5C 3IF6A 3OPLA 1MWTA 3CJMA 4JPMA 2WYXA 2V1ZA 3Q7VB 3ZHHA 4LCLA 4OOLA 2OV5A 1M40A 1ERQA 2HPBA 4XUXA 4GDNA 1C3BA 4S2IA 5E43A 3C7UA 3E2KA 5E2HA 5EOOA 5AQ9A 2XEPA 2WKHA 4E3OA 1I2SA 1HD8A 1NJ4A 4OQGA 4R23A 4C75A 4QJGA 4OQIA 4BL3A 2IWDA 1LI9A 1I2WA 2ZC3B 5CGSA 2ZJ9A 1E25A 2DCFA 2ZQ8A 2J7VA 4LV2A 4K91A 1FSYA 3M6BA 4NK3A 2EX9A 5FQMA 4JBFA 4MEZA 3I7JA 4P6BA 4GD8A 1ESUA 1ZKJA 1RGYA 2V20A 3IQAA 1W79A 5A91A 5HAQA 3PTEA 2DNSA 5EECA 3C5AA 2EFXA 5I94A 1PW1A 1PWCA 3NCKA 5GHXA 4UA7A 2V2FF 3SH8A 1K56D 1H8ZA 1XP4A 5D3OA 2VGJA 1K4FA 5FAQA 5EOEA 3OPPA 4KQOA 4LV1A 3SS4A 3V3RA 4EBNA 4ZDXA 1VQQA 3VFHA 4WMCA 3ZGAB 4DDSA 5JYOA 1KGFA 2VGKA 3MKFA 5J8XA 1KVMA 1E4DA 2H10A 4OOYA 1WE4A 3E2LA 2P74A 3PAGA 2WAFA 4H8RA 2C5WB 2HDRA 4KG5A 4QU3A 3MKEA 4WYYA 3RXWA 3C7VA 4R3BA 1O7EA 4PM9A 5M18A 4OKPA 3QNCA 4K0XA 2Z2MB 1AXBA 4OVDA 4QY6A 1TDGA 1YMSA 3CG5A 3SOIA 3Q7VA 4MBHA 3A3FA 3Q82A 1W8QA 2WZZA 3CMZA 3NC8A 5CTMA 1J9MA 4GKUA 3G35A 4IBXA 4ZAMA 3S22A 1K57A 4RYEA 4N1XA 3LO7A 1OMEA 1ZG4A 3HVFA 4KZ5A 3OCLA 1DY6A 3ZCZA 4DXBA 1EROA 3WS0A 4F94A 1KE0A 3N7WA 4ZJ2A 1L2SA 3FZCA 3DWKA 5F1FA 1CEFA 2ZD8A 2Q9MA 5HARA 4DE1A 3N4IA 4UHUA 3V50A 1E3UD 3UDIA 1PZPA 3FWLA 4HEFA 2Y2QA 1DJBA 1QMEA 3LY4A 4OPRA 1IYQA 4P87A 4PM8A 3HL9A 1MWUA 1PIOA 5DTSA 4E3LA 4N92A 2X01A 4FSFA 4S2LA 1H5XA 3UE0A 2EXAA 2B5RA 1HZOA 1IYOA 5JYPA 1YLJA 2J9PA 4EWFA 2WKEA 1FOFA 3FKWA 2XD1A 4UA6A 2HDSA 3UN7A 1LL9A 3FYZA 3QNBA 4B4ZA 4IVIA 1DJAA 3VP0A 1YLTA 4JKTA 4PM5A 5FI6A 3UPOA 1LHYA 4OPYA 1ZG6A 1SHVA 5HL1A 5FI7A 4KZ6A 4WEKA 4WM9A 4ZBEA 4B4XA 1FCMA 4S2NA 5CRFA 2ZC4B 4WZ4A 3W4QA 3VP2A 4DE3A 2PU2A 3Q7ZA 3HUNA 3MZEA 3ZG9B 1SCWA 1BLPA 5A90A 3GMWA 1S0WA 2XFSA 5GLAA 5TGFA 4BENA 4E3MA 1WYBA 4WELA 3C4OA 3ITBA 1BLCA 3VMAA 2H0TA 1FQGA 2A49A 2OLUA 3GR2A 4KZ8A 1W5DA 3O87A 1XX2A 1K55C 1BTLA 1PWGA 3UPNA 3UO9A 3AGDA 1U60A 3BM6A 1L0FA 5KSCA 3WRZA 3W4OA 4PPRA 3V39A 2ZQAA 5EVIB 3D4FA 3ISGA 2ZC7A 3SS3A 3UNWA 5FASA 4JF5A 5DF9A 3UPPA 5DTTA 1YLYA 2Q9NA 4OH0A 4IVKA 5FDHA 3IXBA 3S1YA 2XDMA 1PW8A 3HLDA 4KZ7A 4S2MA 5KMWA 4OOMA 5GLDA 1RP5A 4FH2A 4KQRA
chains in the Genus database with same CATH superfamily
2XRNA 2Z2LB 3MFXA 4NEED 3BJNA 4EU0A 2ZMVA 2V9AA 4DE2A 3DAVA 4Z9QA 4Y0TA 4H6JA 5FQ9A 3VE4A 2ZM8A 1HLUP 1N9LA 3CI6A 3LICA 2QJ7A 3V3SA 4R0QA 2FFYA 3A3EA 3ZDJA 5LBRA 4PM7A 3ZG8B 5FDSA 1JTDA 5HFOA 1OTEA 3F1NA 4N1HA 3BLMA 1UWNX 2J80A 3NY4A 4YINA 3MBZA 4OP8A 3PXPA 3K3CA 4Y13A 1KDSA 2HP6A 5L8MA 5HWTA 5CHJA 3TSGA 1P9RA 2OOLA 2EX8A 4FCFA 1JNUA 3UE1A 1ESIA 2ZM2A 5C5KA 4X68A 4DJ2A 3MQOA 3IS2A 4OPZA 1I5QA 4EBLA 1NYMA 2BG1A 4LRYC 3QP6A 3ZFZA 2JC7A 3G32A 5M1AA 4HIAA 1H0MA 5E2EA 4B88A 4H6JB 4MLLA 2JCHA 4HESA 3IWQA 2HP9A 4MDZA 3BRMA 2EX2A 3FV7A 1W8YA 2HZ5A 5TFQA 3H82A 3Q07A 4JGPA 3MQ0A 1TDLA 1VB6A 5CTNA 2L4RA 2BLSA 5CX7A 3BQAA 3F1NB 4LLOB 1XA1A 2XF3A 2QPNA 2UV0E 3EGDC 3WS1A 2HDUA 3IHBA 3TJZC 4KZAA 3BFGA 4DDYA 1JWPA 1CEGA 4E3KA 3MZDA 2EA9A 3PAEA 1KGEA 3OPHA 4KQQA 2HGVA 4X69A 4JLFA 1H8YA 1XPBA 2ZQCA 2UWXA 3N8LA 2JBFA 4JGQA 1PZOA 4Y2FA 1JTGA 3C4PA 1OTBA 5CECA 1NWZA 3IS2B 4CJNA 2Y2GA 2I72A 2W3GA 1SKFA 3WWXA 3NOPC 4JXSA 3T1SA 2ZMFA 5EPHA 1IELA 3HJIA 4LCMA 1ONHA 1L0DA 1MBLA 2Y55A 3MFDA 3T4OA 3MSHA 4HP4A 4N9KA 4UQIS 3A3DA 4E04A 1NZOA 3DTKA 5CHMA 4EEPA 3UB6A 2Q0OA 4XXRA 3W2ZA 1KGGA 1FR1A 4KZ9A 5CEBA 4LRXC 2EX6A 3WS4A 4EETB 4G3KA 5F82A 3HLCA 5EFWA 2AVXA 3UMEA 3CITA 5FAPA 3FC7A 4YOFA 2EWWA 3G4PA 4MBFA 4WL9A 3PR6A 3PBQA 3NDGA 1CI9A 1ACFA 5U47A 3HBRA 2WGVA 3CWFA 4U0XA 2MJ6A 5EUAA 1T1BA 3CUEA 1WYCA 2ZLYA 4GW9A 4GS9A 4R3AA 4HI4A 4GOGA 1BT5A 4R4SA 1Q2PA 5F83A 1IYSA 5DF7A 2WAEA 3M2JA 1NXYA 3VOYA 4LV3A 3B47A 4X6TA 4Q0IA 2B95A 1K55A 4BMWA 2XK1A 1GHMA 4C6YA 1GHPA 4B93A 1IYPA 3PBSA 5HW3A 1YPRA 5EVEA 5KZHA 3W4PA 3LCEA 2M1CA 5F68A 2IWCA 1T1CA 4FD8A 3R7WA 2O99A 4YFMA 2DRWA 3HUOA 4DXCA 2D01A 3BEBA 1T19A 3OPLA 4ZRRA 2WYXA 1LT0A 3EEAA 5DJUA 3EOIA 3E2KA 5EOOA 1I2SA 1HD8A 1NJ4A 4GS9B 4BL3A 1LI9A 5F6AA 2ZC3B 3D3OA 3PYPA 2ZQ8A 1FSYA 3MS6A 2EX9A 4JBFA 3I7JA 3SZTA 4DMZA 4Y15A 5HWWA 4QPRA 5D3OA 3BW6A 3ZGAB 5JYOA 1KGFA 3T4JA 4CLCA 5J8XA 4FOFA 1WE4A 3LIFA 4I3AA 3PAGA 4KG5A 4WYYA 2M7UA 2OWJA 4K0XA 2Z2MB 1YSPA 1TDGA 1XJ6A 3Q7VA 4MBHA 3Q82A 1W8QA 5CTMA 1J9MA 4IBXA 1G5UA 4ZAMA 3S22A 1S4SA 2OWHA 4N1XA 3HVFA 1LL8A 4F94A 3N7WA 1VEUA 3T4SA 3UDIA 3H7WA 1DP8A 4ETZA 4P87A 1PIOA 1PNEA 4S2LA 1H5XA 4MCWA 2KOIA 2J9PA 2KX6A 4EWFA 1FOFA 3IBRA 4I5SA 2HDSA 1LL9A 3LR5A 1MZUA 3VP0A 1YLTA 3OOVA 3CUEC 5DFXA 4O8GA 1ZG6A 1SHVA 5HL1A 5FI7A 5MC7A 4CQHA 4S2NA 4WZ4A 1EW0A 4CLCB 3W4QA 3U2AA 2PU2A 3Q7ZA 3HUNA 5A90A 5TGFA 3ITBA 5IS1A 1BLCA 1FQGA 3GR2A 1W5DA 3O87A 1XX2A 1K55C 2PHYA 1PWGA 3WRZA 2B18A 4KQDA 1TF1A 2ZQAA 5EVIB 4K08A 3ISGA 4HP9A 3A0RA 2W0NA 2W1RA 4OH0A 3T4KA 4IVKA 3H7WB 4S2MA 4ZJ1A 4Y7PA 3W8KA 1ZTUA 1IKGA 2H0YA 3GECA 1VM1A 3NHQA 3PBTA 3N8RA 1FSWA 3AGEA 3P7NA 1YMXA 4OQHA 5CGWA 1GHIA 2PT7A 4IUHA 4MBKA 2JHEA 4CLCD 4JXVA 1YLZA 3V5MA 1NLYA 2PYPA 1XXMA 4WUJA 2WGWA 3MXRA 5DFYA 5CEDA 1YM1A 2Y2NA 3EWKA 3G2YA 4KG6A 1DJCA 1S1ZA 4S2OA 4YNRA 5EVLA 1ES5A 4MMNA 1GA0A 1L0EA 1CK3A 2K7SA 1NRFA 3MXQA 3PBRA 4WN5A 1DRMA 5HDSA 3T4QA 3JPUA 4RVAA 3UE6A 1N9BA 1K6SA 4CLCC 1GSWA 5K5BA 5CHUA 4EV4A 2ZQDA 2J8YA 4XT2A 3IXGA 3CLOA 4LENA 2Y8HA 1K0KA 3GVBA 1MKIA 2E8IA 3KSGA 1AWIA 3LR3A 1TD5A 1ALQA 4ETXA 4RX2A 3CAXA 1RGZA 2XH9A 2V1AA 3A0SA 4IBRA 1SDEA 2BASA 3ZVWA 1M6KA 2WGWB 3TG9A 2ZC5B 1ES4A 4OQ0A 4DJ3A 3HLEA 5FQQA 1N4OA 3GQZA 3OCNA 4X56A 1YT4A 1IKIA 3UB9A 4BBUA 1KE4A 4R70A 1BLHA 2H28A 5TR7A 4DRTA 1JWZA 1PFLA 1BULA 5HD5A 5KSHA 4S2NC 3UY6A 2P08A 4JF6A 5L10A 2FFFB 2ZMAA 1LLBA 5A8BA 4XT2B 1SDNA 4D2OA 3RFBA 4BQMA 4FUWA 3EEHA 3ULFA 3S4XA 4KZ4A 1Y28A 1F5MA 3WS5A 1IEMA 2W3FA 1Q2QA 2FZ0A 3BYDA 3Q1FA 5AQ7A 1K56A 3M2KA 1RCJA 3PBNA 2PU4A 3QP8A 3UDFA 5AVEA 4S2PA 3UE3A 3LYXA 1F9IA 2JKTI 4RX3A 5F1GA 3MR0A 4PMAA 3SH9A 3A3IA 1TS0A 3IF6B 2XR0A 2PD8A 3ZQ5A 3IX8A 4PAUA 5FSRA 2VV7A 1E3UA 5L07A 4AFIA 3UB7A 4KZ3A 1G6AA 3LY3A 1ERMA 3N8SA 3G34A 2PBYA 3O88A 3L9KA 1D7EA 5CXWA 3PBOA 1D1JA 3VV4A 1O07A 2WUQA 1XGIA 5FQKA 1PI4A 4ME4A 1JVJA 4HBTA 4S2KA 3T50A 5IU1A 5GL9A 1QMFA 4KENB 2VGLM 4MNRA 2Z6CA 1CF0A 4O7DA 4QY5A 3SW1A 1K25A 1L0GA 2CMNA 1LI0A 2RL3A 2J9OA 3IHAA 3ZG7B 2JE5A 4L0LA 5HAIA 1FILA 4DE0A 3C8CA 2K31A 4E6XA 3F1OB 1MWTA 3CJMA 2V1ZA 4L9FA 2V1BA 1M40A 3V67A 1ERQA 5HPIA 4S2IA 1C3BA 5AQ9A 3C7UA 3LR0A 1WA9A 4C75A 4QJGA 1OJ5A 3E4OA 2DCFA 2J7VA 3LGOA 4K91A 4LV2A 1MKMA 5FQMA 4MEZA 5HWVA 4P6BA 4GD8A 5A91A 3PTEA 3C5AA 4R38A 5I94A 1PWCA 1KOUA 1K56D 1XP4A 3KSHA 1K4FA 5EOEA 5HD3A 4PKYG 4ZDXA 4WMCA 3TRCA 2WKQA 4OOYA 2P74A 4H8RA 3RXWA 2C5WB 4QU3A 3T1QB 3C7VA 3HCYA 3D72A 4R3BA 3T4LA 4PM9A 2L1MA 3QNCA 2JKRM 4FTXA 1AXBA 4QY6A 3CG5A 4Y17A 2QKPA 3BY9A 4D60A 2VV8A 4IJGA 4I3JA 3LO7A 1ZG4A 2ZOIA 3ZCZA 5HL6A 4DXBA 5HDDA 1KE0A 1L2SA 1NRJA 3DWKA 1CEFA 2XROA 3F1PA 2JKRI 4DE1A 4HQAA 3N4IA 3IBJA 1E3UD 5FEGA 3FWLA 1QMEA 2QJ5A 4OPRA 1ODVA 1MWUA 5DTSA 4E3LA 4FSFA 3LIBA 5JYPA 4IUKA 4G3VA 2WKEA 3FKWA 3FYZA 3QNBA 4PM5A 5FI6A 1LHYA 4OPYA 4WM9A 4WEKA 4B4XA 1FCMA 5CRFA 4DE3A 1SKOB 1BLPA 2A49A 4KZ8A 4KUOA 3BM6A 1L0FA 1J3WA 3T12B 4PPRA 2A2LA 5FL3A 1YAXA 3C38A 2ZC7A 3SS3A 4JF5A 3UPPA 3NECA 5DTTA 2QYBA 2Q9NA 3F1PB 2VJWA 2NUPC 1S1YA 2PR6A 3S1YA 3HLDA 2O0YA 4LGWA 5KMWA 4OOMA 3MF0A 4P6ZM 3LUQA 2D02A 1NY0A 4X53A 1OT9A 4GD6A 3VE3A 3LI8A 3LFVA 4EQ1A 3NJAA 1Z09A 4WMCD 3C30A 2PDRA 3DTIA 5CGXA 1EWZA 3GV9A 3VSLA 3ICYA 5G4ZA 3K2NA 2DMWA 3IWOA 4NETA 3IXHA 3T1XA 4OP5A 2WKPA 4P85A 5EVIA 1DP9A 4E6WA 3HLWA 2WZXA 4U0TA 3E0YA 5HZHA 3E4QA 1IOUA 2Y2MA 2KLIA 1KDWA 5FA7A 1YSQA 4MN7A 4YWZA 2ZOHA 2EWVA 2L0WA 1V9ZA 2ZQ7A 4R3JA 2HJEA 3NDEA 2C6WB 1ZHHB 3SS5A 4WLAA 2QMIA 2VGLS 2Y2OA 3ZG5A 2W27A 3R4KA 2OLVA 4EUVA 2E8JA 1HVBA 4WZ5A 4A5RA 5G4YA 5HPFA 5TJJA 4EERA 2XA7S 2R9XA 1K38A 5A93A 2VEAA 4ID4A 1FCOA 4GDBA 1W7FA 3Q81A 4BWIA 4ZJ3A 1XGJA 1PYYA 3G6OA 2PD7A 1BZAA 4MN5A 4M4XA 3HUMA 4EXOA 1GA9A 5EE8A 5EM0A 3A3JA 2V8CA 2A24A 5HAPA 1Y54A 4PM6A 3VP1A 4U3TA 3VP3A 2Y59A 4BD1A 4X55A 3UB8A 3ITAA 5GHYA 4FH4A 2O9CA 1VETA 5AQBA 5J4EA 1YLWA 1ZC2A 1YLPA 4IHQA 3NBLA 3OPRA 1Z6FA 3LEZA 3HLGA 4OLGA 2O9AA 3NOTC 4EUZA 3BFDA 3CZDA 4HBUA 3DW0A 1KVLA 5TBMB 4QD4A 2V8FA 1FCNA 4NXGA 3P98A 5DF8A 3VSKA 2P7JA 1W63Q 4HH2A 2XGNA 5BOHA 4XUZA 3BFEA 4HHDA 3LIDA 2H5SA 1S4RA 4GZBA 2W3DA 4Y0UA 5EVID 3UDXA 1JWVA 4UA9A 1EI5A 3BLSA 3KSIA 5HDCA 2XSSA 3BECA 2CC1A 1XJ3A 2GZAA 4BBTA 2A24B 3ZNYA 3IWIA 1H3QA 3N6IA 1XFNA 5L2FA 4ARZB 5AQAA 4F3LA 3HLFA 2OAP1 1K54C 1GSVA 1VETB 1L3LA 2Y4AA 4BJPA 1MWSA 1DP6A 4EQIA 4X1LA 1H8MA 2G2WA 3IH8A 5FQJA 3FKVA 4JF4A 3GRJA 4ZTKA 5EVIC 4O0PA 3EQUA 3GTCA 2LB5A 1G6OA 4EESA 1NYYA 2V0WA 4NXEA 2PBDP 3U4LP 5G18A 3TOIA 5FEFA 4K0WA 3O5YA 2XFTA 2Y91A 2WKIA 4GHIB 3HJKA 2VX8A 2XQZA 1VHMA 4JGRA 1ES2A 3LIAA 4WBGA 2A3UA 2RCXA 3VOZA 3T1RA 4HH3A 4E3NA 3KYQA 3RJUA 1LL5A 4ESPA 2VKSA 2PYRA 2EXBA 3TW8A 2ZM0A 2X02A 1X0OA 4P6ZS 4WZ5C 3IF6A 4JPMA 3UB5P 4OOLA 5J3WA 4HOIA 4F3LB 5IT5A 5E43A 5E2HA 1OPXA 2XEPA 1OTDA 4OQGA 4R23A 2IWDA 5I5LA 4HY8A 2ZL1A 3VOLA 1GSXA 5CGSA 1E25A 1N9OA 2M7VA 2J3WA 4NK3A 2V20A 3IQAA 1W79A 5HAQA 4G3WA 1OTAA 2DNSA 2JKGA 2EFXA 1PW1A 4UA7A 1H8ZA 2VGJA 4B9OA 4Y3IA 5FAQA 2JKTM 3OPPA 4KQOA 3SS4A 3V3RA 1VQQA 3VFHA 4DDSA 5AVFA 3S7NA 1KVMA 1E4DA 2H10A 2YKFA 3E2LA 2WAFA 3MKEA 1PRQA 4X25A 1O7EA 2ACGA 1P0ZA 5M18A 3KSFA 4OVDA 3F1OA 3NOUC 4EW7A 3A3FA 2WZZA 3CMZA 3QP2A 4PHTA 1V9YA 3NC8A 4GKUA 1F98A 3G35A 3KO6A 1K57A 4RYEA 4KZ5A 1DY6A 3MMHA 3WS0A 4ZJ2A 3FZCA 5F1FA 2ZD8A 4GJ4A 4UHUA 1PZPA 4HEFA 1DJBA 1IYQA 3HL9A 2ZL1B 3FPVA 3IX4A 2B5RA 1IYOA 3BQ8A 5L09A 4MN6A 4EEUA 1DJAA 4JKTA 1NLZA 3UPOA 4GCZA 3C2WA 1F2KA 2J3TD 3S7OA 3VP2A 4HJ3A 1S67L 3MZEA 3ZG9B 3GMWA 2XA7M 4E3MA 1WYBA 4WELA 1D06A 3VMAA 2OLUA 2IA2A 2JKFA 3AGDA 5KSCA 4LPZA 3V39A 3D4FA 5FASA 5DF9A 1YKDA 1YLYA 1XJ2A 2QWSA 2LB9A 3MQQA 3EGXC 2XDMA 2HJ9C 4L9EA 4FH2A 2J3TC 4UEYA 2HF6A 4Y5FA 4R6LA 4KQRA 3P09A 2XLNA 3JYIA 4X1MA 4BBVA 3QP4A 4KG2A 3KYZA 2Z6DA 5DKKA 3O3VA 4PKYA 3IF6C 2K2NA 3E4PA 1XKZA 2Y79A 2PAVP 3EQVA 4GNUA 4I38A 1SKOA 3RTYA 4KUKA 3P01A 3M6HA 4DN0A 3RH8B 1NZUA 3H82B 3WRTA 3LEQA 3QP1A 2G7UA 3IX3A 1GCEA 4BD0A 3MJQA 1SZVA 3AGFA 2VZWA 5GLCA 3WS2A 3VFFA 5E2GA 1IFQA 1BSGA 4LFUA 3T4TA 3BFCA 2VK3A 1ONGA 5A92A 3KX0X 5FI2A 1S6RA 1UWPX 2Y2PA 4R1GA 3H9WA 4S2JA 2R9WA 4EBPA 3IXDA 2VLGA 3B42A 3LIEA 1LSWA 5DJTA 2HP5A 2WKRA 3ZVTA 1XJ4A 4DF6A 1K4EA 3BWLA 3JVUA 1PI5A 1K57C 1T1AA 3ZG0A 1OTIA 4RA7A 3MXSA 2GJ3A 1MWRA 2P9VA 1G28A 2GX5A 1MXOA 4DKIA 3ZYTA 1TEMA 4P0MA 3B33A 3GSGA 1CI8A 1YQSA 4OPQA 3DWZA 3ZNTA 2G2UA 4KZBA 4IEDA 1FR6A 1K6RA 3RXXA 2GNXA 4E3JA 1MY8A 3QHYA 4Y0OA 1TVFA 4QB8A 5IHVA 2VA0A 2OSUA 3GDIA 4LV0A 5FAOA 4JXWA 5E2FA 2ZQ9A 2WADA 5M19A 1G68A 2Y2LA 3IF5A 2Y2HA 4JGOA 1XA7A 4Q0HA 4R4RA 4QHCA 1PWDA 3JVVA 4JXGA 4NXFA 3OZHA 3LI9A 2PR5A 2WGIA 2YKHA 3NI9A 1K54A 4WF0A 2XD5A 1STZA 4NG2A 1HTZA 2P9VB 1OJGA 1LSVA 4WEJA 4BLMA 3S7PA 2IWBA 4OONA 2B02A 2EFUA 4BL2A 1P97A 1MPLA 4GB7A 4CLCE 4HJ6A 1LSXA 4C3QA 3FG8A 3R7WB 4L9GA 4OLDA 3CPTA 2Y2IA 4HJ4A 2X71A 4HNBA 4N9LA 3IT9A 3LR4A 5DTKA 3DTMA 5F69A 1P9WA 5HX9A 4GLQA 5FATA 5TBMA 4Q8IA 3B3XA 3O86A 3HREA 4I39A 3MZFA 2QZ6A 4I3IA 2GDNA 2W3EA 4M3KA 3OLOA 3NIAA 1KE3A 3G31A 5FQIA 1ES3A 5DVAA 5CERA 2HDQA 3HLBA 2HV1A 3IH9A 2PRFA 3A0VA 2WK0A 2ZC6B 3BFFA 1TS6A 4UAAA 4E3IA 5GHZA 2Y2KA 1CQAA 3VP4A 4CPKA 3G30A 5F5YA 5GLBA 3SH7A 2NUTC 3TE8A 3OC2A 3E98A 2FH5A 1BLSA 5AJGA 1BUEA 2W1TA 2Y2JA 4ARZA 4GN2A 5KIZA 3G2ZA 5J7EA 3Q7VB 3ZHHA 3CPTB 4LCLA 2OV5A 2HPBA 4XUXA 4GDNA 2WKHA 4E3OA 3BY8A 4OQIA 2ZBBA 1VEUB 1I2WA 2ZJ9A 1N9NA 5HSQA 3M6BA 1T18A 1XFQA 1ESUA 1ZKJA 1RGYA 1OT6A 5EECA 4GHIA 3UMDA 3NCKA 5GHXA 3SH8A 2V2FF 2V0UA 5EV0A 4NKPA 5EM1A 4EBNA 4LV1A 2VGKA 4RQ9A 4II7A 3MKFA 2QHKA 2HDRA 3CHWP 2KDKA 4Z1WA 2JN7A 4O01A 4OKPA 4UQIM 4Q0JA 1YMSA 1UGUA 1W63M 3SOIA 3FPWA 3L7HA 2W1TB 4QWOA 3DTEA 3NULA 2P04A 1OMEA 3QP5A 3OCLA 1EROA 5DKLA 1A0KA 2Q9MA 5HARA 2INWA 3S7QA 3V50A 3K3DA 3D9YA 3DBAA 1MC0A 2Y2QA 1FIKA 3LY4A 2OAQ1 4PM8A 2W3HA 4N92A 2X01A 2VV6A 3UE0A 2EXAA 1HZOA 3KYEA 1YLJA 2O9BA 2XD1A 4UA6A 3UN7A 4B4ZA 4IVIA 3PHYA 4LRZE 4KZ6A 4ZBEA 2ZC4B 1Y4OA 2R78A 1SCWA 1S0WA 2XFSA 3OBFA 5GLAA 4BENA 1S66L 3C4OA 1TS7A 2H0TA 2BTFP 1TS8A 1BTLA 3UPNA 1CJFA 3UO9A 1U60A 4NXBA 3W4OA 2I9VA 1BYWA 3UNWA 5FDHA 3IXBA 1PW8A 4KZ7A 5GLDA 1RP5A
chains in the Genus database with same CATH topology
4Y7PA 1IKGA 2Z2LB 2H0YA 3P09A 1NY0A 2XLNA 4X53A 4GD6A 3JYIA 1VM1A 4KG2A 3PBTA 3N8RA 1FSWA 4DE2A 3O3VA 4Z9QA 3AGEA 4Y0TA 1YMXA 4OQHA 3IF6C 5CGWA 4ZJ1A 1GHIA 5FQ9A 2ZM8A 1XKZA 4WMCD 4MBKA 4JXVA 3V3SA 3EQVA 4GNUA 1YLZA 4R0QA 5CGXA 3V5MA 1EWZA 2FFYA 3A3EA 3ZDJA 1XXMA 3GV9A 3VSLA 4PM7A 3M6HA 3ZG8B 1JTDA 2WGWA 3MXRA 5HFOA 1NZUA 3WRTA 5CEDA 3IWOA 4N1HA 4NETA 1YM1A 2Y2NA 3IXHA 3BLMA 4OP5A 3G2YA 4KG6A 3NY4A 1GCEA 4YINA 4BD0A 1DJCA 3MBZA 4P85A 4OP8A 5EVIA 4E6WA 3HLWA 2WZXA 4U0TA 1KDSA 4S2OA 3AGFA 2HP6A 2Y2MA 5EVLA 5GLCA 1ES5A 1KDWA 5FA7A 3WS2A 5CHJA 5E2GA 3VFFA 1GA0A 3TSGA 1L0EA 1BSGA 1CK3A 1NRFA 3PBRA 3BFCA 2EX8A 4FCFA 1ONGA 2ZQ7A 4RVAA 1N9BA 5A92A 1K6SA 5FI2A 1S6RA 3UE1A 2Y2PA 1ESIA 4R3JA 4R1GA 4S2JA 2ZM2A 3W8KA 2R9WA 4X68A 3NDEA 5CHUA 4EBPA 4EV4A 2ZQDA 2J8YA 2C6WB 4OPZA 1I5QA 3IXGA 4LENA 3SS5A 4EBLA 1NYMA 3IXDA 2QMIA 2BG1A 3GVBA 3ZVTA 2HP5A 3ZFZA 1MKIA 2E8IA 2JC7A 4DF6A 1K4EA 2Y2OA 3G32A 5M1AA 1PI5A 1K57C 1ALQA 3ZG0A 3ZG5A 5E2EA 4B88A 4MLLA 2JCHA 2OLVA 4RX2A 1HVBA 4HESA 3IWQA 4WZ5A 2HP9A 4RA7A 1RGZA 4A5RA 3BRMA 2EX2A 3FV7A 3MXSA 1W8YA 5TFQA 3Q07A 1MWRA 2R9XA 2XH9A 2P9VA 1K38A 1MXOA 4IBRA 4DKIA 5A93A 4ID4A 1SDEA 1TEMA 1TDLA 1FCOA 3ZVWA 4P0MA 5CTNA 1M6KA 2WGWB 4GDBA 2BLSA 3TG9A 1W7FA 1CI8A 1YQSA 3GSGA 3Q81A 1XGJA 2ZC5B 3DWZA 4OPQA 1ES4A 2G2UA 4ZJ3A 3ZNTA 1PYYA 4KZBA 4OQ0A 4IEDA 1FR6A 1BZAA 3HLEA 3HUMA 1XA1A 5FQQA 2XF3A 1GA9A 1N4OA 2QPNA 1K6RA 3GQZA 5EE8A 3RXXA 3OCNA 3A3JA 3WS1A 4X56A 1YT4A 4E3JA 1MY8A 1IKIA 2HDUA 3IHBA 5HAPA 1Y54A 3QHYA 4KZAA 4PM6A 3VP1A 3BFGA 4Y0OA 1TVFA 4DDYA 1JWPA 4U3TA 1CEGA 1KE4A 4E3KA 3MZDA 1BLHA 3VP3A 2Y59A 3PAEA 4QB8A 4BD1A 1KGEA 3OPHA 4X55A 4KQQA 3ITAA 5IHVA 4X69A 5TR7A 1JWZA 4JLFA 5GHYA 4DRTA 4FH4A 1H8YA 1XPBA 1BULA 2OSUA 1YLWA 1ZC2A 2ZQCA 4LV0A 5AQBA 2UWXA 5FAOA 5KSHA 1YLPA 4S2NC 3UY6A 3N8LA 3NBLA 4JXWA 5E2FA 4JF6A 2JBFA 3OPRA 1Z6FA 2ZQ9A 2WADA 1PZOA 3LEZA 5M19A 3HLGA 2FFFB 1JTGA 3C4PA 4OLGA 1G68A 2Y2LA 2ZMAA 5CECA 1LLBA 4CJNA 3IF5A 2Y2GA 2I72A 2Y2HA 1SDNA 4EUZA 1XA7A 3BFDA 1SKFA 3WWXA 4JXSA 3CZDA 4D2OA 4R4RA 4HBUA 3DW0A 1PWDA 4QHCA 4BQMA 1KVLA 5EPHA 1IELA 4LCMA 4QD4A 4JXGA 3S4XA 3OZHA 4KZ4A 1FCNA 1ONHA 1L0DA 1MBLA 2WGIA 3WS5A 1IEMA 2Y55A 3MFDA 3P98A 5DF8A 3NI9A 3VSKA 4N9KA 1K54A 3A3DA 1NZOA 1Q2QA 2XD5A 5CHMA 4XXRA 1KGGA 2XGNA 5BOHA 3BYDA 3Q1FA 1HTZA 5AQ7A 1K56A 1FR1A 2P9VB 3BFEA 4XUZA 4KZ9A 3M2KA 1RCJA 4WEJA 3PBNA 2H5SA 4BLMA 4GZBA 5CEBA 4Y0UA 2EX6A 5EVID 2PU4A 1JWVA 3UDXA 3WS4A 4UA9A 3UDFA 5F82A 3HLCA 1EI5A 3BLSA 2IWBA 4OONA 5FAPA 2EFUA 4BL2A 1MPLA 4GB7A 3BECA 3G4PA 4MBFA 4S2PA 2CC1A 3UE3A 3ZNYA 3IWIA 3PBQA 4RX3A 3NDGA 1CI9A 4C3QA 5F1GA 3N6IA 4OLDA 5U47A 4PMAA 3HBRA 2WGVA 5L2FA 4U0XA 5AQAA 2Y2IA 5EUAA 3HLFA 3SH9A 3A3IA 1WYCA 1K54C 2ZLYA 3IF6B 2XR0A 2X71A 4N9LA 2Y4AA 3IT9A 4BJPA 1MWSA 4GOGA 5FSRA 1BT5A 5DTKA 4EQIA 3DTMA 4R4SA 2G2WA 1Q2PA 3IH8A 5HX9A 5FQJA 5FATA 1E3UA 5F83A 4Q8IA 3FKVA 3B3XA 3O86A 4JF4A 3HREA 1IYSA 5DF7A 3GRJA 4ZTKA 5EVIC 2WAEA 3M2JA 4KZ3A 1NXYA 3MZFA 3VOYA 1G6AA 2QZ6A 2GDNA 4LV3A 3LY3A 1ERMA 3EQUA 3GTCA 4X6TA 4M3KA 3N8SA 3G34A 2PBYA 1K55A 3O88A 5CXWA 1NYYA 3NIAA 3PBOA 1KE3A 3G31A 5FQIA 2XK1A 1GHMA 1ES3A 5G18A 1O07A 4C6YA 5DVAA 3TOIA 2WUQA 4K0WA 1GHPA 2HDQA 1XGIA 2XFTA 2Y91A 3HLBA 5FQKA 5CERA 3IH9A 2WKIA 1PI4A 1JVJA 4HBTA 2WK0A 2ZC6B 4S2KA 3BFFA 1IYPA 3PBSA 1QMFA 4KENB 5GL9A 5HW3A 4MNRA 4UAAA 2XQZA 4E3IA 5GHZA 5KZHA 4O7DA 2Y2KA 4QY5A 3W4PA 1ES2A 3LCEA 3VP4A 4WBGA 4CPKA 1K25A 2A3UA 2RCXA 2IWCA 3G30A 1L0GA 4FD8A 5GLBA 1LI0A 2RL3A 2J9OA 3VOZA 3SH7A 3IHAA 3ZG7B 2JE5A 3OC2A 4E3NA 3RJUA 1LL5A 4YFMA 1BLSA 4L0LA 1BUEA 5HAIA 2EXBA 2Y2JA 2ZM0A 4GN2A 2DRWA 3HUOA 4DXCA 2X02A 3G2ZA 4DE0A 4E6XA 3BEBA 4WZ5C 3IF6A 3OPLA 1MWTA 3CJMA 4JPMA 2WYXA 2V1ZA 3Q7VB 3ZHHA 4LCLA 4OOLA 2OV5A 1M40A 1ERQA 2HPBA 4XUXA 4GDNA 1C3BA 4S2IA 5E43A 3C7UA 3E2KA 5E2HA 5EOOA 5AQ9A 2XEPA 2WKHA 4E3OA 1I2SA 1HD8A 1NJ4A 4OQGA 4R23A 4C75A 4QJGA 4OQIA 4BL3A 2IWDA 1LI9A 1I2WA 2ZC3B 5CGSA 2ZJ9A 1E25A 2DCFA 2ZQ8A 2J7VA 4LV2A 4K91A 1FSYA 3M6BA 4NK3A 2EX9A 5FQMA 4JBFA 4MEZA 3I7JA 4P6BA 4GD8A 1ESUA 1ZKJA 1RGYA 2V20A 3IQAA 1W79A 5A91A 5HAQA 3PTEA 2DNSA 5EECA 3C5AA 2EFXA 5I94A 1PW1A 1PWCA 3NCKA 5GHXA 4UA7A 2V2FF 3SH8A 1K56D 1H8ZA 1XP4A 5D3OA 2VGJA 1K4FA 5FAQA 5EOEA 3OPPA 4KQOA 4LV1A 3SS4A 3V3RA 4EBNA 4ZDXA 1VQQA 3VFHA 4WMCA 3ZGAB 4DDSA 5JYOA 1KGFA 2VGKA 3MKFA 5J8XA 1KVMA 1E4DA 2H10A 4OOYA 1WE4A 3E2LA 2P74A 3PAGA 2WAFA 4H8RA 2C5WB 2HDRA 4KG5A 4QU3A 3MKEA 4WYYA 3RXWA 3C7VA 4R3BA 1O7EA 4PM9A 5M18A 4OKPA 3QNCA 4K0XA 2Z2MB 1AXBA 4OVDA 4QY6A 1TDGA 1YMSA 3CG5A 3SOIA 3Q7VA 4MBHA 3A3FA 3Q82A 1W8QA 2WZZA 3CMZA 3NC8A 5CTMA 1J9MA 4GKUA 3G35A 4IBXA 4ZAMA 3S22A 1K57A 4RYEA 4N1XA 3LO7A 1OMEA 1ZG4A 3HVFA 4KZ5A 3OCLA 1DY6A 3ZCZA 4DXBA 1EROA 3WS0A 4F94A 1KE0A 3N7WA 4ZJ2A 1L2SA 3FZCA 3DWKA 5F1FA 1CEFA 2ZD8A 2Q9MA 5HARA 4DE1A 3N4IA 4UHUA 3V50A 1E3UD 3UDIA 1PZPA 3FWLA 4HEFA 2Y2QA 1DJBA 1QMEA 3LY4A 4OPRA 1IYQA 4P87A 4PM8A 3HL9A 1MWUA 1PIOA 5DTSA 4E3LA 4N92A 2X01A 4FSFA 4S2LA 1H5XA 3UE0A 2EXAA 2B5RA 1HZOA 1IYOA 5JYPA 1YLJA 2J9PA 4EWFA 2WKEA 1FOFA 3FKWA 2XD1A 4UA6A 2HDSA 3UN7A 1LL9A 3FYZA 3QNBA 4B4ZA 4IVIA 1DJAA 3VP0A 1YLTA 4JKTA 4PM5A 5FI6A 3UPOA 1LHYA 4OPYA 1ZG6A 1SHVA 5HL1A 5FI7A 4KZ6A 4WEKA 4WM9A 4ZBEA 4B4XA 1FCMA 4S2NA 5CRFA 2ZC4B 4WZ4A 3W4QA 3VP2A 4DE3A 2PU2A 3Q7ZA 3HUNA 3MZEA 3ZG9B 1SCWA 1BLPA 5A90A 3GMWA 1S0WA 2XFSA 5GLAA 5TGFA 4BENA 4E3MA 1WYBA 4WELA 3C4OA 3ITBA 1BLCA 3VMAA 2H0TA 1FQGA 2A49A 2OLUA 3GR2A 4KZ8A 1W5DA 3O87A 1XX2A 1K55C 1BTLA 1PWGA 3UPNA 3UO9A 3AGDA 1U60A 3BM6A 1L0FA 5KSCA 3WRZA 3W4OA 4PPRA 3V39A 2ZQAA 5EVIB 3D4FA 3ISGA 2ZC7A 3SS3A 3UNWA 5FASA 4JF5A 5DF9A 3UPPA 5DTTA 1YLYA 2Q9NA 4OH0A 4IVKA 5FDHA 3IXBA 3S1YA 2XDMA 1PW8A 3HLDA 4KZ7A 4S2MA 5KMWA 4OOMA 5GLDA 1RP5A 4FH2A 4KQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7P A;  1IKG A;  2Z2L B;  2H0Y A;  3P09 A;  1NY0 A;  2XLN A;  4X53 A;  4GD6 A;  3JYI A;  1VM1 A;  4KG2 A;  3PBT A;  3N8R A;  1FSW A;  4DE2 A;  3O3V A;  4Z9Q A;  3AGE A;  4Y0T A;  1YMX A;  4OQH A;  3IF6 C;  5CGW A;  4ZJ1 A;  1GHI A;  5FQ9 A;  2ZM8 A;  1XKZ A;  4WMC D;  4MBK A;  4JXV A;  3V3S A;  3EQV A;  4GNU A;  1YLZ A;  4R0Q A;  5CGX A;  3V5M A;  1EWZ A;  2FFY A;  3A3E A;  3ZDJ A;  1XXM A;  3GV9 A;  3VSL A;  4PM7 A;  3M6H A;  3ZG8 B;  1JTD A;  2WGW A;  3MXR A;  5HFO A;  1NZU A;  3WRT A;  5CED A;  3IWO A;  4N1H A;  4NET A;  1YM1 A;  2Y2N A;  3IXH A;  3BLM A;  4OP5 A;  3G2Y A;  4KG6 A;  3NY4 A;  1GCE A;  4YIN A;  4BD0 A;  1DJC A;  3MBZ A;  4P85 A;  4OP8 A;  5EVI A;  4E6W A;  3HLW A;  2WZX A;  4U0T A;  1KDS A;  4S2O A;  3AGF A;  2HP6 A;  2Y2M A;  5EVL A;  5GLC A;  1ES5 A;  1KDW A;  5FA7 A;  3WS2 A;  5CHJ A;  5E2G A;  3VFF A;  1GA0 A;  3TSG A;  1L0E A;  1BSG A;  1CK3 A;  1NRF A;  3PBR A;  3BFC A;  2EX8 A;  4FCF A;  1ONG A;  2ZQ7 A;  4RVA A;  1N9B A;  5A92 A;  1K6S A;  5FI2 A;  1S6R A;  3UE1 A;  2Y2P A;  1ESI A;  4R3J A;  4R1G A;  4S2J A;  2ZM2 A;  3W8K A;  2R9W A;  4X68 A;  3NDE A;  5CHU A;  4EBP A;  4EV4 A;  2ZQD A;  2J8Y A;  2C6W B;  4OPZ A;  1I5Q A;  3IXG A;  4LEN A;  3SS5 A;  4EBL A;  1NYM A;  3IXD A;  2QMI A;  2BG1 A;  3GVB A;  3ZVT A;  2HP5 A;  3ZFZ A;  1MKI A;  2E8I A;  2JC7 A;  4DF6 A;  1K4E A;  2Y2O A;  3G32 A;  5M1A A;  1PI5 A;  1K57 C;  1ALQ A;  3ZG0 A;  3ZG5 A;  5E2E A;  4B88 A;  4MLL A;  2JCH A;  2OLV A;  4RX2 A;  1HVB A;  4HES A;  3IWQ A;  4WZ5 A;  2HP9 A;  4RA7 A;  1RGZ A;  4A5R A;  3BRM A;  2EX2 A;  3FV7 A;  3MXS A;  1W8Y A;  5TFQ A;  3Q07 A;  1MWR A;  2R9X A;  2XH9 A;  2P9V A;  1K38 A;  1MXO A;  4IBR A;  4DKI A;  5A93 A;  4ID4 A;  1SDE A;  1TEM A;  1TDL A;  1FCO A;  3ZVW A;  4P0M A;  5CTN A;  1M6K A;  2WGW B;  4GDB A;  2BLS A;  3TG9 A;  1W7F A;  1CI8 A;  1YQS A;  3GSG A;  3Q81 A;  1XGJ A;  2ZC5 B;  3DWZ A;  4OPQ A;  1ES4 A;  2G2U A;  4ZJ3 A;  3ZNT A;  1PYY A;  4KZB A;  4OQ0 A;  4IED A;  1FR6 A;  1BZA A;  3HLE A;  3HUM A;  1XA1 A;  5FQQ A;  2XF3 A;  1GA9 A;  1N4O A;  2QPN A;  1K6R A;  3GQZ A;  5EE8 A;  3RXX A;  3OCN A;  3A3J A;  3WS1 A;  4X56 A;  1YT4 A;  4E3J A;  1MY8 A;  1IKI A;  2HDU A;  3IHB A;  5HAP A;  1Y54 A;  3QHY A;  4KZA A;  4PM6 A;  3VP1 A;  3BFG A;  4Y0O A;  1TVF A;  4DDY A;  1JWP A;  4U3T A;  1CEG A;  1KE4 A;  4E3K A;  3MZD A;  1BLH A;  3VP3 A;  2Y59 A;  3PAE A;  4QB8 A;  4BD1 A;  1KGE A;  3OPH A;  4X55 A;  4KQQ A;  3ITA A;  5IHV A;  4X69 A;  5TR7 A;  1JWZ A;  4JLF A;  5GHY A;  4DRT A;  4FH4 A;  1H8Y A;  1XPB A;  1BUL A;  2OSU A;  1YLW A;  1ZC2 A;  2ZQC A;  4LV0 A;  5AQB A;  2UWX A;  5FAO A;  5KSH A;  1YLP A;  4S2N C;  3UY6 A;  3N8L A;  3NBL A;  4JXW A;  5E2F A;  4JF6 A;  2JBF A;  3OPR A;  1Z6F A;  2ZQ9 A;  2WAD A;  1PZO A;  3LEZ A;  5M19 A;  3HLG A;  2FFF B;  1JTG A;  3C4P A;  4OLG A;  1G68 A;  2Y2L A;  2ZMA A;  5CEC A;  1LLB A;  4CJN A;  3IF5 A;  2Y2G A;  2I72 A;  2Y2H A;  1SDN A;  4EUZ A;  1XA7 A;  3BFD A;  1SKF A;  3WWX A;  4JXS A;  3CZD A;  4D2O A;  4R4R A;  4HBU A;  3DW0 A;  1PWD A;  4QHC A;  4BQM A;  1KVL A;  5EPH A;  1IEL A;  4LCM A;  4QD4 A;  4JXG A;  3S4X A;  3OZH A;  4KZ4 A;  1FCN A;  1ONH A;  1L0D A;  1MBL A;  2WGI A;  3WS5 A;  1IEM A;  2Y55 A;  3MFD A;  3P98 A;  5DF8 A;  3NI9 A;  3VSK A;  4N9K A;  1K54 A;  3A3D A;  1NZO A;  1Q2Q A;  2XD5 A;  5CHM A;  4XXR A;  1KGG A;  2XGN A;  5BOH A;  3BYD A;  3Q1F A;  1HTZ A;  5AQ7 A;  1K56 A;  1FR1 A;  2P9V B;  3BFE A;  4XUZ A;  4KZ9 A;  3M2K A;  1RCJ A;  4WEJ A;  3PBN A;  2H5S A;  4BLM A;  4GZB A;  5CEB A;  4Y0U A;  2EX6 A;  5EVI D;  2PU4 A;  1JWV A;  3UDX A;  3WS4 A;  4UA9 A;  3UDF A;  5F82 A;  3HLC A;  1EI5 A;  3BLS A;  2IWB A;  4OON A;  5FAP A;  2EFU A;  4BL2 A;  1MPL A;  4GB7 A;  3BEC A;  3G4P A;  4MBF A;  4S2P A;  2CC1 A;  3UE3 A;  3ZNY A;  3IWI A;  3PBQ A;  4RX3 A;  3NDG A;  1CI9 A;  4C3Q A;  5F1G A;  3N6I A;  4OLD A;  5U47 A;  4PMA A;  3HBR A;  2WGV A;  5L2F A;  4U0X A;  5AQA A;  2Y2I A;  5EUA A;  3HLF A;  3SH9 A;  3A3I A;  1WYC A;  1K54 C;  2ZLY A;  3IF6 B;  2XR0 A;  2X71 A;  4N9L A;  2Y4A A;  3IT9 A;  4BJP A;  1MWS A;  4GOG A;  5FSR A;  1BT5 A;  5DTK A;  4EQI A;  3DTM A;  4R4S A;  2G2W A;  1Q2P A;  3IH8 A;  5HX9 A;  5FQJ A;  5FAT A;  1E3U A;  5F83 A;  4Q8I A;  3FKV A;  3B3X A;  3O86 A;  4JF4 A;  3HRE A;  1IYS A;  5DF7 A;  3GRJ A;  4ZTK A;  5EVI C;  2WAE A;  3M2J A;  4KZ3 A;  1NXY A;  3MZF A;  3VOY A;  1G6A A;  2QZ6 A;  2GDN A;  4LV3 A;  3LY3 A;  1ERM A;  3EQU A;  3GTC A;  4X6T A;  4M3K A;  3N8S A;  3G34 A;  2PBY A;  1K55 A;  3O88 A;  5CXW A;  1NYY A;  3NIA A;  3PBO A;  1KE3 A;  3G31 A;  5FQI A;  2XK1 A;  1GHM A;  1ES3 A;  5G18 A;  1O07 A;  4C6Y A;  5DVA A;  3TOI A;  2WUQ A;  4K0W A;  1GHP A;  2HDQ A;  1XGI A;  2XFT A;  2Y91 A;  3HLB A;  5FQK A;  5CER A;  3IH9 A;  2WKI A;  1PI4 A;  1JVJ A;  4HBT A;  2WK0 A;  2ZC6 B;  4S2K A;  3BFF A;  1IYP A;  3PBS A;  1QMF A;  4KEN B;  5GL9 A;  5HW3 A;  4MNR A;  4UAA A;  2XQZ A;  4E3I A;  5GHZ A;  5KZH A;  4O7D A;  2Y2K A;  4QY5 A;  3W4P A;  1ES2 A;  3LCE A;  3VP4 A;  4WBG A;  4CPK A;  1K25 A;  2A3U A;  2RCX A;  2IWC A;  3G30 A;  1L0G A;  4FD8 A;  5GLB A;  1LI0 A;  2RL3 A;  2J9O A;  3VOZ A;  3SH7 A;  3IHA A;  3ZG7 B;  2JE5 A;  3OC2 A;  4E3N A;  3RJU A;  1LL5 A;  4YFM A;  1BLS A;  4L0L A;  1BUE A;  5HAI A;  2EXB A;  2Y2J A;  2ZM0 A;  4GN2 A;  2DRW A;  3HUO A;  4DXC A;  2X02 A;  3G2Z A;  4DE0 A;  4E6X A;  3BEB A;  4WZ5 C;  3IF6 A;  3OPL A;  1MWT A;  3CJM A;  4JPM A;  2WYX A;  2V1Z A;  3Q7V B;  3ZHH A;  4LCL A;  4OOL A;  2OV5 A;  1M40 A;  1ERQ A;  2HPB A;  4XUX A;  4GDN A;  1C3B A;  4S2I A;  5E43 A;  3C7U A;  3E2K A;  5E2H A;  5EOO A;  5AQ9 A;  2XEP A;  2WKH A;  4E3O A;  1I2S A;  1HD8 A;  1NJ4 A;  4OQG A;  4R23 A;  4C75 A;  4QJG A;  4OQI A;  4BL3 A;  2IWD A;  1LI9 A;  1I2W A;  2ZC3 B;  5CGS A;  2ZJ9 A;  1E25 A;  2DCF A;  2ZQ8 A;  2J7V A;  4LV2 A;  4K91 A;  1FSY A;  3M6B A;  4NK3 A;  2EX9 A;  5FQM A;  4JBF A;  4MEZ A;  3I7J A;  4P6B A;  4GD8 A;  1ESU A;  1ZKJ A;  1RGY A;  2V20 A;  3IQA A;  1W79 A;  5A91 A;  5HAQ A;  3PTE A;  2DNS A;  5EEC A;  3C5A A;  2EFX A;  5I94 A;  1PW1 A;  1PWC A;  3NCK A;  5GHX A;  4UA7 A;  2V2F F;  3SH8 A;  1K56 D;  1H8Z A;  1XP4 A;  5D3O A;  2VGJ A;  1K4F A;  5FAQ A;  5EOE A;  3OPP A;  4KQO A;  4LV1 A;  3SS4 A;  3V3R A;  4EBN A;  4ZDX A;  1VQQ A;  3VFH A;  4WMC A;  3ZGA B;  4DDS A;  5JYO A;  1KGF A;  2VGK A;  3MKF A;  5J8X A;  1KVM A;  1E4D A;  2H10 A;  4OOY A;  1WE4 A;  3E2L A;  2P74 A;  3PAG A;  2WAF A;  4H8R A;  2C5W B;  2HDR A;  4KG5 A;  4QU3 A;  3MKE A;  4WYY A;  3RXW A;  3C7V A;  4R3B A;  1O7E A;  4PM9 A;  5M18 A;  4OKP A;  3QNC A;  4K0X A;  2Z2M B;  1AXB A;  4OVD A;  4QY6 A;  1TDG A;  1YMS A;  3CG5 A;  3SOI A;  3Q7V A;  4MBH A;  3A3F A;  3Q82 A;  1W8Q A;  2WZZ A;  3CMZ A;  3NC8 A;  5CTM A;  1J9M A;  4GKU A;  3G35 A;  4IBX A;  4ZAM A;  3S22 A;  1K57 A;  4RYE A;  4N1X A;  3LO7 A;  1OME A;  1ZG4 A;  3HVF A;  4KZ5 A;  3OCL A;  1DY6 A;  3ZCZ A;  4DXB A;  1ERO A;  3WS0 A;  4F94 A;  1KE0 A;  3N7W A;  4ZJ2 A;  1L2S A;  3FZC A;  3DWK A;  5F1F A;  1CEF A;  2ZD8 A;  2Q9M A;  5HAR A;  4DE1 A;  3N4I A;  4UHU A;  3V50 A;  1E3U D;  3UDI A;  1PZP A;  3FWL A;  4HEF A;  2Y2Q A;  1DJB A;  1QME A;  3LY4 A;  4OPR A;  1IYQ A;  4P87 A;  4PM8 A;  3HL9 A;  1MWU A;  1PIO A;  5DTS A;  4E3L A;  4N92 A;  2X01 A;  4FSF A;  4S2L A;  1H5X A;  3UE0 A;  2EXA A;  2B5R A;  1HZO A;  1IYO A;  5JYP A;  1YLJ A;  2J9P A;  4EWF A;  2WKE A;  1FOF A;  3FKW A;  2XD1 A;  4UA6 A;  2HDS A;  3UN7 A;  1LL9 A;  3FYZ A;  3QNB A;  4B4Z A;  4IVI A;  1DJA A;  3VP0 A;  1YLT A;  4JKT A;  4PM5 A;  5FI6 A;  3UPO A;  1LHY A;  4OPY A;  1ZG6 A;  1SHV A;  5HL1 A;  5FI7 A;  4KZ6 A;  4WEK A;  4WM9 A;  4ZBE A;  4B4X A;  1FCM A;  4S2N A;  5CRF A;  2ZC4 B;  4WZ4 A;  3W4Q A;  3VP2 A;  4DE3 A;  2PU2 A;  3Q7Z A;  3HUN A;  3MZE A;  3ZG9 B;  1SCW A;  1BLP A;  5A90 A;  3GMW A;  1S0W A;  2XFS A;  5GLA A;  5TGF A;  4BEN A;  4E3M A;  1WYB A;  4WEL A;  3C4O A;  3ITB A;  1BLC A;  3VMA A;  2H0T A;  1FQG A;  2A49 A;  2OLU A;  3GR2 A;  4KZ8 A;  1W5D A;  3O87 A;  1XX2 A;  1K55 C;  1BTL A;  1PWG A;  3UPN A;  3UO9 A;  3AGD A;  1U60 A;  3BM6 A;  1L0F A;  5KSC A;  3WRZ A;  3W4O A;  4PPR A;  3V39 A;  2ZQA A;  5EVI B;  3D4F A;  3ISG A;  2ZC7 A;  3SS3 A;  3UNW A;  5FAS A;  4JF5 A;  5DF9 A;  3UPP A;  5DTT A;  1YLY A;  2Q9N A;  4OH0 A;  4IVK A;  5FDH A;  3IXB A;  3S1Y A;  2XDM A;  1PW8 A;  3HLD A;  4KZ7 A;  4S2M A;  5KMW A;  4OOM A;  5GLD A;  1RP5 A;  4FH2 A;  4KQR A; 
#chains in the Genus database with same CATH topology
 2XRN A;  2Z2L B;  3MFX A;  4NEE D;  3BJN A;  4EU0 A;  2ZMV A;  2V9A A;  4DE2 A;  3DAV A;  4Z9Q A;  4Y0T A;  4H6J A;  5FQ9 A;  3VE4 A;  2ZM8 A;  1HLU P;  1N9L A;  3CI6 A;  3LIC A;  2QJ7 A;  3V3S A;  4R0Q A;  2FFY A;  3A3E A;  3ZDJ A;  5LBR A;  4PM7 A;  3ZG8 B;  5FDS A;  1JTD A;  5HFO A;  1OTE A;  3F1N A;  4N1H A;  3BLM A;  1UWN X;  2J80 A;  3NY4 A;  4YIN A;  3MBZ A;  4OP8 A;  3PXP A;  3K3C A;  4Y13 A;  1KDS A;  2HP6 A;  5L8M A;  5HWT A;  5CHJ A;  3TSG A;  1P9R A;  2OOL A;  2EX8 A;  4FCF A;  1JNU A;  3UE1 A;  1ESI A;  2ZM2 A;  5C5K A;  4X68 A;  4DJ2 A;  3MQO A;  3IS2 A;  4OPZ A;  1I5Q A;  4EBL A;  1NYM A;  2BG1 A;  4LRY C;  3QP6 A;  3ZFZ A;  2JC7 A;  3G32 A;  5M1A A;  4HIA A;  1H0M A;  5E2E A;  4B88 A;  4H6J B;  4MLL A;  2JCH A;  4HES A;  3IWQ A;  2HP9 A;  4MDZ A;  3BRM A;  2EX2 A;  3FV7 A;  1W8Y A;  2HZ5 A;  5TFQ A;  3H82 A;  3Q07 A;  4JGP A;  3MQ0 A;  1TDL A;  1VB6 A;  5CTN A;  2L4R A;  2BLS A;  5CX7 A;  3BQA A;  3F1N B;  4LLO B;  1XA1 A;  2XF3 A;  2QPN A;  2UV0 E;  3EGD C;  3WS1 A;  2HDU A;  3IHB A;  3TJZ C;  4KZA A;  3BFG A;  4DDY A;  1JWP A;  1CEG A;  4E3K A;  3MZD A;  2EA9 A;  3PAE A;  1KGE A;  3OPH A;  4KQQ A;  2HGV A;  4X69 A;  4JLF A;  1H8Y A;  1XPB A;  2ZQC A;  2UWX A;  3N8L A;  2JBF A;  4JGQ A;  1PZO A;  4Y2F A;  1JTG A;  3C4P A;  1OTB A;  5CEC A;  1NWZ A;  3IS2 B;  4CJN A;  2Y2G A;  2I72 A;  2W3G A;  1SKF A;  3WWX A;  3NOP C;  4JXS A;  3T1S A;  2ZMF A;  5EPH A;  1IEL A;  3HJI A;  4LCM A;  1ONH A;  1L0D A;  1MBL A;  2Y55 A;  3MFD A;  3T4O A;  3MSH A;  4HP4 A;  4N9K A;  4UQI S;  3A3D A;  4E04 A;  1NZO A;  3DTK A;  5CHM A;  4EEP A;  3UB6 A;  2Q0O A;  4XXR A;  3W2Z A;  1KGG A;  1FR1 A;  4KZ9 A;  5CEB A;  4LRX C;  2EX6 A;  3WS4 A;  4EET B;  4G3K A;  5F82 A;  3HLC A;  5EFW A;  2AVX A;  3UME A;  3CIT A;  5FAP A;  3FC7 A;  4YOF A;  2EWW A;  3G4P A;  4MBF A;  4WL9 A;  3PR6 A;  3PBQ A;  3NDG A;  1CI9 A;  1ACF A;  5U47 A;  3HBR A;  2WGV A;  3CWF A;  4U0X A;  2MJ6 A;  5EUA A;  1T1B A;  3CUE A;  1WYC A;  2ZLY A;  4GW9 A;  4GS9 A;  4R3A A;  4HI4 A;  4GOG A;  1BT5 A;  4R4S A;  1Q2P A;  5F83 A;  1IYS A;  5DF7 A;  2WAE A;  3M2J A;  1NXY A;  3VOY A;  4LV3 A;  3B47 A;  4X6T A;  4Q0I A;  2B95 A;  1K55 A;  4BMW A;  2XK1 A;  1GHM A;  4C6Y A;  1GHP A;  4B93 A;  1IYP A;  3PBS A;  5HW3 A;  1YPR A;  5EVE A;  5KZH A;  3W4P A;  3LCE A;  2M1C A;  5F68 A;  2IWC A;  1T1C A;  4FD8 A;  3R7W A;  2O99 A;  4YFM A;  2DRW A;  3HUO A;  4DXC A;  2D01 A;  3BEB A;  1T19 A;  3OPL A;  4ZRR A;  2WYX A;  1LT0 A;  3EEA A;  5DJU A;  3EOI A;  3E2K A;  5EOO A;  1I2S A;  1HD8 A;  1NJ4 A;  4GS9 B;  4BL3 A;  1LI9 A;  5F6A A;  2ZC3 B;  3D3O A;  3PYP A;  2ZQ8 A;  1FSY A;  3MS6 A;  2EX9 A;  4JBF A;  3I7J A;  3SZT A;  4DMZ A;  4Y15 A;  5HWW A;  4QPR A;  5D3O A;  3BW6 A;  3ZGA B;  5JYO A;  1KGF A;  3T4J A;  4CLC A;  5J8X A;  4FOF A;  1WE4 A;  3LIF A;  4I3A A;  3PAG A;  4KG5 A;  4WYY A;  2M7U A;  2OWJ A;  4K0X A;  2Z2M B;  1YSP A;  1TDG A;  1XJ6 A;  3Q7V A;  4MBH A;  3Q82 A;  1W8Q A;  5CTM A;  1J9M A;  4IBX A;  1G5U A;  4ZAM A;  3S22 A;  1S4S A;  2OWH A;  4N1X A;  3HVF A;  1LL8 A;  4F94 A;  3N7W A;  1VEU A;  3T4S A;  3UDI A;  3H7W A;  1DP8 A;  4ETZ A;  4P87 A;  1PIO A;  1PNE A;  4S2L A;  1H5X A;  4MCW A;  2KOI A;  2J9P A;  2KX6 A;  4EWF A;  1FOF A;  3IBR A;  4I5S A;  2HDS A;  1LL9 A;  3LR5 A;  1MZU A;  3VP0 A;  1YLT A;  3OOV A;  3CUE C;  5DFX A;  4O8G A;  1ZG6 A;  1SHV A;  5HL1 A;  5FI7 A;  5MC7 A;  4CQH A;  4S2N A;  4WZ4 A;  1EW0 A;  4CLC B;  3W4Q A;  3U2A A;  2PU2 A;  3Q7Z A;  3HUN A;  5A90 A;  5TGF A;  3ITB A;  5IS1 A;  1BLC A;  1FQG A;  3GR2 A;  1W5D A;  3O87 A;  1XX2 A;  1K55 C;  2PHY A;  1PWG A;  3WRZ A;  2B18 A;  4KQD A;  1TF1 A;  2ZQA A;  5EVI B;  4K08 A;  3ISG A;  4HP9 A;  3A0R A;  2W0N A;  2W1R A;  4OH0 A;  3T4K A;  4IVK A;  3H7W B;  4S2M A;  4ZJ1 A;  4Y7P A;  3W8K A;  1ZTU A;  1IKG A;  2H0Y A;  3GEC A;  1VM1 A;  3NHQ A;  3PBT A;  3N8R A;  1FSW A;  3AGE A;  3P7N A;  1YMX A;  4OQH A;  5CGW A;  1GHI A;  2PT7 A;  4IUH A;  4MBK A;  2JHE A;  4CLC D;  4JXV A;  1YLZ A;  3V5M A;  1NLY A;  2PYP A;  1XXM A;  4WUJ A;  2WGW A;  3MXR A;  5DFY A;  5CED A;  1YM1 A;  2Y2N A;  3EWK A;  3G2Y A;  4KG6 A;  1DJC A;  1S1Z A;  4S2O A;  4YNR A;  5EVL A;  1ES5 A;  4MMN A;  1GA0 A;  1L0E A;  1CK3 A;  2K7S A;  1NRF A;  3MXQ A;  3PBR A;  4WN5 A;  1DRM A;  5HDS A;  3T4Q A;  3JPU A;  4RVA A;  3UE6 A;  1N9B A;  1K6S A;  4CLC C;  1GSW A;  5K5B A;  5CHU A;  4EV4 A;  2ZQD A;  2J8Y A;  4XT2 A;  3IXG A;  3CLO A;  4LEN A;  2Y8H A;  1K0K A;  3GVB A;  1MKI A;  2E8I A;  3KSG A;  1AWI A;  3LR3 A;  1TD5 A;  1ALQ A;  4ETX A;  4RX2 A;  3CAX A;  1RGZ A;  2XH9 A;  2V1A A;  3A0S A;  4IBR A;  1SDE A;  2BAS A;  3ZVW A;  1M6K A;  2WGW B;  3TG9 A;  2ZC5 B;  1ES4 A;  4OQ0 A;  4DJ3 A;  3HLE A;  5FQQ A;  1N4O A;  3GQZ A;  3OCN A;  4X56 A;  1YT4 A;  1IKI A;  3UB9 A;  4BBU A;  1KE4 A;  4R70 A;  1BLH A;  2H28 A;  5TR7 A;  4DRT A;  1JWZ A;  1PFL A;  1BUL A;  5HD5 A;  5KSH A;  4S2N C;  3UY6 A;  2P08 A;  4JF6 A;  5L10 A;  2FFF B;  2ZMA A;  1LLB A;  5A8B A;  4XT2 B;  1SDN A;  4D2O A;  3RFB A;  4BQM A;  4FUW A;  3EEH A;  3ULF A;  3S4X A;  4KZ4 A;  1Y28 A;  1F5M A;  3WS5 A;  1IEM A;  2W3F A;  1Q2Q A;  2FZ0 A;  3BYD A;  3Q1F A;  5AQ7 A;  1K56 A;  3M2K A;  1RCJ A;  3PBN A;  2PU4 A;  3QP8 A;  3UDF A;  5AVE A;  4S2P A;  3UE3 A;  3LYX A;  1F9I A;  2JKT I;  4RX3 A;  5F1G A;  3MR0 A;  4PMA A;  3SH9 A;  3A3I A;  1TS0 A;  3IF6 B;  2XR0 A;  2PD8 A;  3ZQ5 A;  3IX8 A;  4PAU A;  5FSR A;  2VV7 A;  1E3U A;  5L07 A;  4AFI A;  3UB7 A;  4KZ3 A;  1G6A A;  3LY3 A;  1ERM A;  3N8S A;  3G34 A;  2PBY A;  3O88 A;  3L9K A;  1D7E A;  5CXW A;  3PBO A;  1D1J A;  3VV4 A;  1O07 A;  2WUQ A;  1XGI A;  5FQK A;  1PI4 A;  4ME4 A;  1JVJ A;  4HBT A;  4S2K A;  3T50 A;  5IU1 A;  5GL9 A;  1QMF A;  4KEN B;  2VGL M;  4MNR A;  2Z6C A;  1CF0 A;  4O7D A;  4QY5 A;  3SW1 A;  1K25 A;  1L0G A;  2CMN A;  1LI0 A;  2RL3 A;  2J9O A;  3IHA A;  3ZG7 B;  2JE5 A;  4L0L A;  5HAI A;  1FIL A;  4DE0 A;  3C8C A;  2K31 A;  4E6X A;  3F1O B;  1MWT A;  3CJM A;  2V1Z A;  4L9F A;  2V1B A;  1M40 A;  3V67 A;  1ERQ A;  5HPI A;  4S2I A;  1C3B A;  5AQ9 A;  3C7U A;  3LR0 A;  1WA9 A;  4C75 A;  4QJG A;  1OJ5 A;  3E4O A;  2DCF A;  2J7V A;  3LGO A;  4K91 A;  4LV2 A;  1MKM A;  5FQM A;  4MEZ A;  5HWV A;  4P6B A;  4GD8 A;  5A91 A;  3PTE A;  3C5A A;  4R38 A;  5I94 A;  1PWC A;  1KOU A;  1K56 D;  1XP4 A;  3KSH A;  1K4F A;  5EOE A;  5HD3 A;  4PKY G;  4ZDX A;  4WMC A;  3TRC A;  2WKQ A;  4OOY A;  2P74 A;  4H8R A;  3RXW A;  2C5W B;  4QU3 A;  3T1Q B;  3C7V A;  3HCY A;  3D72 A;  4R3B A;  3T4L A;  4PM9 A;  2L1M A;  3QNC A;  2JKR M;  4FTX A;  1AXB A;  4QY6 A;  3CG5 A;  4Y17 A;  2QKP A;  3BY9 A;  4D60 A;  2VV8 A;  4IJG A;  4I3J A;  3LO7 A;  1ZG4 A;  2ZOI A;  3ZCZ A;  5HL6 A;  4DXB A;  5HDD A;  1KE0 A;  1L2S A;  1NRJ A;  3DWK A;  1CEF A;  2XRO A;  3F1P A;  2JKR I;  4DE1 A;  4HQA A;  3N4I A;  3IBJ A;  1E3U D;  5FEG A;  3FWL A;  1QME A;  2QJ5 A;  4OPR A;  1ODV A;  1MWU A;  5DTS A;  4E3L A;  4FSF A;  3LIB A;  5JYP A;  4IUK A;  4G3V A;  2WKE A;  3FKW A;  3FYZ A;  3QNB A;  4PM5 A;  5FI6 A;  1LHY A;  4OPY A;  4WM9 A;  4WEK A;  4B4X A;  1FCM A;  5CRF A;  4DE3 A;  1SKO B;  1BLP A;  2A49 A;  4KZ8 A;  4KUO A;  3BM6 A;  1L0F A;  1J3W A;  3T12 B;  4PPR A;  2A2L A;  5FL3 A;  1YAX A;  3C38 A;  2ZC7 A;  3SS3 A;  4JF5 A;  3UPP A;  3NEC A;  5DTT A;  2QYB A;  2Q9N A;  3F1P B;  2VJW A;  2NUP C;  1S1Y A;  2PR6 A;  3S1Y A;  3HLD A;  2O0Y A;  4LGW A;  5KMW A;  4OOM A;  3MF0 A;  4P6Z M;  3LUQ A;  2D02 A;  1NY0 A;  4X53 A;  1OT9 A;  4GD6 A;  3VE3 A;  3LI8 A;  3LFV A;  4EQ1 A;  3NJA A;  1Z09 A;  4WMC D;  3C30 A;  2PDR A;  3DTI A;  5CGX A;  1EWZ A;  3GV9 A;  3VSL A;  3ICY A;  5G4Z A;  3K2N A;  2DMW A;  3IWO A;  4NET A;  3IXH A;  3T1X A;  4OP5 A;  2WKP A;  4P85 A;  5EVI A;  1DP9 A;  4E6W A;  3HLW A;  2WZX A;  4U0T A;  3E0Y A;  5HZH A;  3E4Q A;  1IOU A;  2Y2M A;  2KLI A;  1KDW A;  5FA7 A;  1YSQ A;  4MN7 A;  4YWZ A;  2ZOH A;  2EWV A;  2L0W A;  1V9Z A;  2ZQ7 A;  4R3J A;  2HJE A;  3NDE A;  2C6W B;  1ZHH B;  3SS5 A;  4WLA A;  2QMI A;  2VGL S;  2Y2O A;  3ZG5 A;  2W27 A;  3R4K A;  2OLV A;  4EUV A;  2E8J A;  1HVB A;  4WZ5 A;  4A5R A;  5G4Y A;  5HPF A;  5TJJ A;  4EER A;  2XA7 S;  2R9X A;  1K38 A;  5A93 A;  2VEA A;  4ID4 A;  1FCO A;  4GDB A;  1W7F A;  3Q81 A;  4BWI A;  4ZJ3 A;  1XGJ A;  1PYY A;  3G6O A;  2PD7 A;  1BZA A;  4MN5 A;  4M4X A;  3HUM A;  4EXO A;  1GA9 A;  5EE8 A;  5EM0 A;  3A3J A;  2V8C A;  2A24 A;  5HAP A;  1Y54 A;  4PM6 A;  3VP1 A;  4U3T A;  3VP3 A;  2Y59 A;  4BD1 A;  4X55 A;  3UB8 A;  3ITA A;  5GHY A;  4FH4 A;  2O9C A;  1VET A;  5AQB A;  5J4E A;  1YLW A;  1ZC2 A;  1YLP A;  4IHQ A;  3NBL A;  3OPR A;  1Z6F A;  3LEZ A;  3HLG A;  4OLG A;  2O9A A;  3NOT C;  4EUZ A;  3BFD A;  3CZD A;  4HBU A;  3DW0 A;  1KVL A;  5TBM B;  4QD4 A;  2V8F A;  1FCN A;  4NXG A;  3P98 A;  5DF8 A;  3VSK A;  2P7J A;  1W63 Q;  4HH2 A;  2XGN A;  5BOH A;  4XUZ A;  3BFE A;  4HHD A;  3LID A;  2H5S A;  1S4R A;  4GZB A;  2W3D A;  4Y0U A;  5EVI D;  3UDX A;  1JWV A;  4UA9 A;  1EI5 A;  3BLS A;  3KSI A;  5HDC A;  2XSS A;  3BEC A;  2CC1 A;  1XJ3 A;  2GZA A;  4BBT A;  2A24 B;  3ZNY A;  3IWI A;  1H3Q A;  3N6I A;  1XFN A;  5L2F A;  4ARZ B;  5AQA A;  4F3L A;  3HLF A;  2OAP 1;  1K54 C;  1GSV A;  1VET B;  1L3L A;  2Y4A A;  4BJP A;  1MWS A;  1DP6 A;  4EQI A;  4X1L A;  1H8M A;  2G2W A;  3IH8 A;  5FQJ A;  3FKV A;  4JF4 A;  3GRJ A;  4ZTK A;  5EVI C;  4O0P A;  3EQU A;  3GTC A;  2LB5 A;  1G6O A;  4EES A;  1NYY A;  2V0W A;  4NXE A;  2PBD P;  3U4L P;  5G18 A;  3TOI A;  5FEF A;  4K0W A;  3O5Y A;  2XFT A;  2Y91 A;  2WKI A;  4GHI B;  3HJK A;  2VX8 A;  2XQZ A;  1VHM A;  4JGR A;  1ES2 A;  3LIA A;  4WBG A;  2A3U A;  2RCX A;  3VOZ A;  3T1R A;  4HH3 A;  4E3N A;  3KYQ A;  3RJU A;  1LL5 A;  4ESP A;  2VKS A;  2PYR A;  2EXB A;  3TW8 A;  2ZM0 A;  2X02 A;  1X0O A;  4P6Z S;  4WZ5 C;  3IF6 A;  4JPM A;  3UB5 P;  4OOL A;  5J3W A;  4HOI A;  4F3L B;  5IT5 A;  5E43 A;  5E2H A;  1OPX A;  2XEP A;  1OTD A;  4OQG A;  4R23 A;  2IWD A;  5I5L A;  4HY8 A;  2ZL1 A;  3VOL A;  1GSX A;  5CGS A;  1E25 A;  1N9O A;  2M7V A;  2J3W A;  4NK3 A;  2V20 A;  3IQA A;  1W79 A;  5HAQ A;  4G3W A;  1OTA A;  2DNS A;  2JKG A;  2EFX A;  1PW1 A;  4UA7 A;  1H8Z A;  2VGJ A;  4B9O A;  4Y3I A;  5FAQ A;  2JKT M;  3OPP A;  4KQO A;  3SS4 A;  3V3R A;  1VQQ A;  3VFH A;  4DDS A;  5AVF A;  3S7N A;  1KVM A;  1E4D A;  2H10 A;  2YKF A;  3E2L A;  2WAF A;  3MKE A;  1PRQ A;  4X25 A;  1O7E A;  2ACG A;  1P0Z A;  5M18 A;  3KSF A;  4OVD A;  3F1O A;  3NOU C;  4EW7 A;  3A3F A;  2WZZ A;  3CMZ A;  3QP2 A;  4PHT A;  1V9Y A;  3NC8 A;  4GKU A;  1F98 A;  3G35 A;  3KO6 A;  1K57 A;  4RYE A;  4KZ5 A;  1DY6 A;  3MMH A;  3WS0 A;  4ZJ2 A;  3FZC A;  5F1F A;  2ZD8 A;  4GJ4 A;  4UHU A;  1PZP A;  4HEF A;  1DJB A;  1IYQ A;  3HL9 A;  2ZL1 B;  3FPV A;  3IX4 A;  2B5R A;  1IYO A;  3BQ8 A;  5L09 A;  4MN6 A;  4EEU A;  1DJA A;  4JKT A;  1NLZ A;  3UPO A;  4GCZ A;  3C2W A;  1F2K A;  2J3T D;  3S7O A;  3VP2 A;  4HJ3 A;  1S67 L;  3MZE A;  3ZG9 B;  3GMW A;  2XA7 M;  4E3M A;  1WYB A;  4WEL A;  1D06 A;  3VMA A;  2OLU A;  2IA2 A;  2JKF A;  3AGD A;  5KSC A;  4LPZ A;  3V39 A;  3D4F A;  5FAS A;  5DF9 A;  1YKD A;  1YLY A;  1XJ2 A;  2QWS A;  2LB9 A;  3MQQ A;  3EGX C;  2XDM A;  2HJ9 C;  4L9E A;  4FH2 A;  2J3T C;  4UEY A;  2HF6 A;  4Y5F A;  4R6L A;  4KQR A;  3P09 A;  2XLN A;  3JYI A;  4X1M A;  4BBV A;  3QP4 A;  4KG2 A;  3KYZ A;  2Z6D A;  5DKK A;  3O3V A;  4PKY A;  3IF6 C;  2K2N A;  3E4P A;  1XKZ A;  2Y79 A;  2PAV P;  3EQV A;  4GNU A;  4I38 A;  1SKO A;  3RTY A;  4KUK A;  3P01 A;  3M6H A;  4DN0 A;  3RH8 B;  1NZU A;  3H82 B;  3WRT A;  3LEQ A;  3QP1 A;  2G7U A;  3IX3 A;  1GCE A;  4BD0 A;  3MJQ A;  1SZV A;  3AGF A;  2VZW A;  5GLC A;  3WS2 A;  3VFF A;  5E2G A;  1IFQ A;  1BSG A;  4LFU A;  3T4T A;  3BFC A;  2VK3 A;  1ONG A;  5A92 A;  3KX0 X;  5FI2 A;  1S6R A;  1UWP X;  2Y2P A;  4R1G A;  3H9W A;  4S2J A;  2R9W A;  4EBP A;  3IXD A;  2VLG A;  3B42 A;  3LIE A;  1LSW A;  5DJT A;  2HP5 A;  2WKR A;  3ZVT A;  1XJ4 A;  4DF6 A;  1K4E A;  3BWL A;  3JVU A;  1PI5 A;  1K57 C;  1T1A A;  3ZG0 A;  1OTI A;  4RA7 A;  3MXS A;  2GJ3 A;  1MWR A;  2P9V A;  1G28 A;  2GX5 A;  1MXO A;  4DKI A;  3ZYT A;  1TEM A;  4P0M A;  3B33 A;  3GSG A;  1CI8 A;  1YQS A;  4OPQ A;  3DWZ A;  3ZNT A;  2G2U A;  4KZB A;  4IED A;  1FR6 A;  1K6R A;  3RXX A;  2GNX A;  4E3J A;  1MY8 A;  3QHY A;  4Y0O A;  1TVF A;  4QB8 A;  5IHV A;  2VA0 A;  2OSU A;  3GDI A;  4LV0 A;  5FAO A;  4JXW A;  5E2F A;  2ZQ9 A;  2WAD A;  5M19 A;  1G68 A;  2Y2L A;  3IF5 A;  2Y2H A;  4JGO A;  1XA7 A;  4Q0H A;  4R4R A;  4QHC A;  1PWD A;  3JVV A;  4JXG A;  4NXF A;  3OZH A;  3LI9 A;  2PR5 A;  2WGI A;  2YKH A;  3NI9 A;  1K54 A;  4WF0 A;  2XD5 A;  1STZ A;  4NG2 A;  1HTZ A;  2P9V B;  1OJG A;  1LSV A;  4WEJ A;  4BLM A;  3S7P A;  2IWB A;  4OON A;  2B02 A;  2EFU A;  4BL2 A;  1P97 A;  1MPL A;  4GB7 A;  4CLC E;  4HJ6 A;  1LSX A;  4C3Q A;  3FG8 A;  3R7W B;  4L9G A;  4OLD A;  3CPT A;  2Y2I A;  4HJ4 A;  2X71 A;  4HNB A;  4N9L A;  3IT9 A;  3LR4 A;  5DTK A;  3DTM A;  5F69 A;  1P9W A;  5HX9 A;  4GLQ A;  5FAT A;  5TBM A;  4Q8I A;  3B3X A;  3O86 A;  3HRE A;  4I39 A;  3MZF A;  2QZ6 A;  4I3I A;  2GDN A;  2W3E A;  4M3K A;  3OLO A;  3NIA A;  1KE3 A;  3G31 A;  5FQI A;  1ES3 A;  5DVA A;  5CER A;  2HDQ A;  3HLB A;  2HV1 A;  3IH9 A;  2PRF A;  3A0V A;  2WK0 A;  2ZC6 B;  3BFF A;  1TS6 A;  4UAA A;  4E3I A;  5GHZ A;  2Y2K A;  1CQA A;  3VP4 A;  4CPK A;  3G30 A;  5F5Y A;  5GLB A;  3SH7 A;  2NUT C;  3TE8 A;  3OC2 A;  3E98 A;  2FH5 A;  1BLS A;  5AJG A;  1BUE A;  2W1T A;  2Y2J A;  4ARZ A;  4GN2 A;  5KIZ A;  3G2Z A;  5J7E A;  3Q7V B;  3ZHH A;  3CPT B;  4LCL A;  2OV5 A;  2HPB A;  4XUX A;  4GDN A;  2WKH A;  4E3O A;  3BY8 A;  4OQI A;  2ZBB A;  1VEU B;  1I2W A;  2ZJ9 A;  1N9N A;  5HSQ A;  3M6B A;  1T18 A;  1XFQ A;  1ESU A;  1ZKJ A;  1RGY A;  1OT6 A;  5EEC A;  4GHI A;  3UMD A;  3NCK A;  5GHX A;  3SH8 A;  2V2F F;  2V0U A;  5EV0 A;  4NKP A;  5EM1 A;  4EBN A;  4LV1 A;  2VGK A;  4RQ9 A;  4II7 A;  3MKF A;  2QHK A;  2HDR A;  3CHW P;  2KDK A;  4Z1W A;  2JN7 A;  4O01 A;  4OKP A;  4UQI M;  4Q0J A;  1YMS A;  1UGU A;  1W63 M;  3SOI A;  3FPW A;  3L7H A;  2W1T B;  4QWO A;  3DTE A;  3NUL A;  2P04 A;  1OME A;  3QP5 A;  3OCL A;  1ERO A;  5DKL A;  1A0K A;  2Q9M A;  5HAR A;  2INW A;  3S7Q A;  3V50 A;  3K3D A;  3D9Y A;  3DBA A;  1MC0 A;  2Y2Q A;  1FIK A;  3LY4 A;  2OAQ 1;  4PM8 A;  2W3H A;  4N92 A;  2X01 A;  2VV6 A;  3UE0 A;  2EXA A;  1HZO A;  3KYE A;  1YLJ A;  2O9B A;  2XD1 A;  4UA6 A;  3UN7 A;  4B4Z A;  4IVI A;  3PHY A;  4LRZ E;  4KZ6 A;  4ZBE A;  2ZC4 B;  1Y4O A;  2R78 A;  1SCW A;  1S0W A;  2XFS A;  3OBF A;  5GLA A;  4BEN A;  1S66 L;  3C4O A;  1TS7 A;  2H0T A;  2BTF P;  1TS8 A;  1BTL A;  3UPN A;  1CJF A;  3UO9 A;  1U60 A;  4NXB A;  3W4O A;  2I9V A;  1BYW A;  3UNW A;  5FDH A;  3IXB A;  1PW8 A;  4KZ7 A;  5GLD A;  1RP5 A; 
#chains in the Genus database with same CATH homology
 4Y7P A;  1IKG A;  2Z2L B;  2H0Y A;  3P09 A;  1NY0 A;  2XLN A;  4X53 A;  4GD6 A;  3JYI A;  1VM1 A;  4KG2 A;  3PBT A;  3N8R A;  1FSW A;  4DE2 A;  3O3V A;  4Z9Q A;  3AGE A;  4Y0T A;  1YMX A;  4OQH A;  3IF6 C;  5CGW A;  4ZJ1 A;  1GHI A;  5FQ9 A;  2ZM8 A;  1XKZ A;  4WMC D;  4MBK A;  4JXV A;  3V3S A;  3EQV A;  4GNU A;  1YLZ A;  4R0Q A;  5CGX A;  3V5M A;  1EWZ A;  2FFY A;  3A3E A;  3ZDJ A;  1XXM A;  3GV9 A;  3VSL A;  4PM7 A;  3M6H A;  3ZG8 B;  1JTD A;  2WGW A;  3MXR A;  5HFO A;  1NZU A;  3WRT A;  5CED A;  3IWO A;  4N1H A;  4NET A;  1YM1 A;  2Y2N A;  3IXH A;  3BLM A;  4OP5 A;  3G2Y A;  4KG6 A;  3NY4 A;  1GCE A;  4YIN A;  4BD0 A;  1DJC A;  3MBZ A;  4P85 A;  4OP8 A;  5EVI A;  4E6W A;  3HLW A;  2WZX A;  4U0T A;  1KDS A;  4S2O A;  3AGF A;  2HP6 A;  2Y2M A;  5EVL A;  5GLC A;  1ES5 A;  1KDW A;  5FA7 A;  3WS2 A;  5CHJ A;  5E2G A;  3VFF A;  1GA0 A;  3TSG A;  1L0E A;  1BSG A;  1CK3 A;  1NRF A;  3PBR A;  3BFC A;  2EX8 A;  4FCF A;  1ONG A;  2ZQ7 A;  4RVA A;  1N9B A;  5A92 A;  1K6S A;  5FI2 A;  1S6R A;  3UE1 A;  2Y2P A;  1ESI A;  4R3J A;  4R1G A;  4S2J A;  2ZM2 A;  3W8K A;  2R9W A;  4X68 A;  3NDE A;  5CHU A;  4EBP A;  4EV4 A;  2ZQD A;  2J8Y A;  2C6W B;  4OPZ A;  1I5Q A;  3IXG A;  4LEN A;  3SS5 A;  4EBL A;  1NYM A;  3IXD A;  2QMI A;  2BG1 A;  3GVB A;  3ZVT A;  2HP5 A;  3ZFZ A;  1MKI A;  2E8I A;  2JC7 A;  4DF6 A;  1K4E A;  2Y2O A;  3G32 A;  5M1A A;  1PI5 A;  1K57 C;  1ALQ A;  3ZG0 A;  3ZG5 A;  5E2E A;  4B88 A;  4MLL A;  2JCH A;  2OLV A;  4RX2 A;  1HVB A;  4HES A;  3IWQ A;  4WZ5 A;  2HP9 A;  4RA7 A;  1RGZ A;  4A5R A;  3BRM A;  2EX2 A;  3FV7 A;  3MXS A;  1W8Y A;  5TFQ A;  3Q07 A;  1MWR A;  2R9X A;  2XH9 A;  2P9V A;  1K38 A;  1MXO A;  4IBR A;  4DKI A;  5A93 A;  4ID4 A;  1SDE A;  1TEM A;  1TDL A;  1FCO A;  3ZVW A;  4P0M A;  5CTN A;  1M6K A;  2WGW B;  4GDB A;  2BLS A;  3TG9 A;  1W7F A;  1CI8 A;  1YQS A;  3GSG A;  3Q81 A;  1XGJ A;  2ZC5 B;  3DWZ A;  4OPQ A;  1ES4 A;  2G2U A;  4ZJ3 A;  3ZNT A;  1PYY A;  4KZB A;  4OQ0 A;  4IED A;  1FR6 A;  1BZA A;  3HLE A;  3HUM A;  1XA1 A;  5FQQ A;  2XF3 A;  1GA9 A;  1N4O A;  2QPN A;  1K6R A;  3GQZ A;  5EE8 A;  3RXX A;  3OCN A;  3A3J A;  3WS1 A;  4X56 A;  1YT4 A;  4E3J A;  1MY8 A;  1IKI A;  2HDU A;  3IHB A;  5HAP A;  1Y54 A;  3QHY A;  4KZA A;  4PM6 A;  3VP1 A;  3BFG A;  4Y0O A;  1TVF A;  4DDY A;  1JWP A;  4U3T A;  1CEG A;  1KE4 A;  4E3K A;  3MZD A;  1BLH A;  3VP3 A;  2Y59 A;  3PAE A;  4QB8 A;  4BD1 A;  1KGE A;  3OPH A;  4X55 A;  4KQQ A;  3ITA A;  5IHV A;  4X69 A;  5TR7 A;  1JWZ A;  4JLF A;  5GHY A;  4DRT A;  4FH4 A;  1H8Y A;  1XPB A;  1BUL A;  2OSU A;  1YLW A;  1ZC2 A;  2ZQC A;  4LV0 A;  5AQB A;  2UWX A;  5FAO A;  5KSH A;  1YLP A;  4S2N C;  3UY6 A;  3N8L A;  3NBL A;  4JXW A;  5E2F A;  4JF6 A;  2JBF A;  3OPR A;  1Z6F A;  2ZQ9 A;  2WAD A;  1PZO A;  3LEZ A;  5M19 A;  3HLG A;  2FFF B;  1JTG A;  3C4P A;  4OLG A;  1G68 A;  2Y2L A;  2ZMA A;  5CEC A;  1LLB A;  4CJN A;  3IF5 A;  2Y2G A;  2I72 A;  2Y2H A;  1SDN A;  4EUZ A;  1XA7 A;  3BFD A;  1SKF A;  3WWX A;  4JXS A;  3CZD A;  4D2O A;  4R4R A;  4HBU A;  3DW0 A;  1PWD A;  4QHC A;  4BQM A;  1KVL A;  5EPH A;  1IEL A;  4LCM A;  4QD4 A;  4JXG A;  3S4X A;  3OZH A;  4KZ4 A;  1FCN A;  1ONH A;  1L0D A;  1MBL A;  2WGI A;  3WS5 A;  1IEM A;  2Y55 A;  3MFD A;  3P98 A;  5DF8 A;  3NI9 A;  3VSK A;  4N9K A;  1K54 A;  3A3D A;  1NZO A;  1Q2Q A;  2XD5 A;  5CHM A;  4XXR A;  1KGG A;  2XGN A;  5BOH A;  3BYD A;  3Q1F A;  1HTZ A;  5AQ7 A;  1K56 A;  1FR1 A;  2P9V B;  3BFE A;  4XUZ A;  4KZ9 A;  3M2K A;  1RCJ A;  4WEJ A;  3PBN A;  2H5S A;  4BLM A;  4GZB A;  5CEB A;  4Y0U A;  2EX6 A;  5EVI D;  2PU4 A;  1JWV A;  3UDX A;  3WS4 A;  4UA9 A;  3UDF A;  5F82 A;  3HLC A;  1EI5 A;  3BLS A;  2IWB A;  4OON A;  5FAP A;  2EFU A;  4BL2 A;  1MPL A;  4GB7 A;  3BEC A;  3G4P A;  4MBF A;  4S2P A;  2CC1 A;  3UE3 A;  3ZNY A;  3IWI A;  3PBQ A;  4RX3 A;  3NDG A;  1CI9 A;  4C3Q A;  5F1G A;  3N6I A;  4OLD A;  5U47 A;  4PMA A;  3HBR A;  2WGV A;  5L2F A;  4U0X A;  5AQA A;  2Y2I A;  5EUA A;  3HLF A;  3SH9 A;  3A3I A;  1WYC A;  1K54 C;  2ZLY A;  3IF6 B;  2XR0 A;  2X71 A;  4N9L A;  2Y4A A;  3IT9 A;  4BJP A;  1MWS A;  4GOG A;  5FSR A;  1BT5 A;  5DTK A;  4EQI A;  3DTM A;  4R4S A;  2G2W A;  1Q2P A;  3IH8 A;  5HX9 A;  5FQJ A;  5FAT A;  1E3U A;  5F83 A;  4Q8I A;  3FKV A;  3B3X A;  3O86 A;  4JF4 A;  3HRE A;  1IYS A;  5DF7 A;  3GRJ A;  4ZTK A;  5EVI C;  2WAE A;  3M2J A;  4KZ3 A;  1NXY A;  3MZF A;  3VOY A;  1G6A A;  2QZ6 A;  2GDN A;  4LV3 A;  3LY3 A;  1ERM A;  3EQU A;  3GTC A;  4X6T A;  4M3K A;  3N8S A;  3G34 A;  2PBY A;  1K55 A;  3O88 A;  5CXW A;  1NYY A;  3NIA A;  3PBO A;  1KE3 A;  3G31 A;  5FQI A;  2XK1 A;  1GHM A;  1ES3 A;  5G18 A;  1O07 A;  4C6Y A;  5DVA A;  3TOI A;  2WUQ A;  4K0W A;  1GHP A;  2HDQ A;  1XGI A;  2XFT A;  2Y91 A;  3HLB A;  5FQK A;  5CER A;  3IH9 A;  2WKI A;  1PI4 A;  1JVJ A;  4HBT A;  2WK0 A;  2ZC6 B;  4S2K A;  3BFF A;  1IYP A;  3PBS A;  1QMF A;  4KEN B;  5GL9 A;  5HW3 A;  4MNR A;  4UAA A;  2XQZ A;  4E3I A;  5GHZ A;  5KZH A;  4O7D A;  2Y2K A;  4QY5 A;  3W4P A;  1ES2 A;  3LCE A;  3VP4 A;  4WBG A;  4CPK A;  1K25 A;  2A3U A;  2RCX A;  2IWC A;  3G30 A;  1L0G A;  4FD8 A;  5GLB A;  1LI0 A;  2RL3 A;  2J9O A;  3VOZ A;  3SH7 A;  3IHA A;  3ZG7 B;  2JE5 A;  3OC2 A;  4E3N A;  3RJU A;  1LL5 A;  4YFM A;  1BLS A;  4L0L A;  1BUE A;  5HAI A;  2EXB A;  2Y2J A;  2ZM0 A;  4GN2 A;  2DRW A;  3HUO A;  4DXC A;  2X02 A;  3G2Z A;  4DE0 A;  4E6X A;  3BEB A;  4WZ5 C;  3IF6 A;  3OPL A;  1MWT A;  3CJM A;  4JPM A;  2WYX A;  2V1Z A;  3Q7V B;  3ZHH A;  4LCL A;  4OOL A;  2OV5 A;  1M40 A;  1ERQ A;  2HPB A;  4XUX A;  4GDN A;  1C3B A;  4S2I A;  5E43 A;  3C7U A;  3E2K A;  5E2H A;  5EOO A;  5AQ9 A;  2XEP A;  2WKH A;  4E3O A;  1I2S A;  1HD8 A;  1NJ4 A;  4OQG A;  4R23 A;  4C75 A;  4QJG A;  4OQI A;  4BL3 A;  2IWD A;  1LI9 A;  1I2W A;  2ZC3 B;  5CGS A;  2ZJ9 A;  1E25 A;  2DCF A;  2ZQ8 A;  2J7V A;  4LV2 A;  4K91 A;  1FSY A;  3M6B A;  4NK3 A;  2EX9 A;  5FQM A;  4JBF A;  4MEZ A;  3I7J A;  4P6B A;  4GD8 A;  1ESU A;  1ZKJ A;  1RGY A;  2V20 A;  3IQA A;  1W79 A;  5A91 A;  5HAQ A;  3PTE A;  2DNS A;  5EEC A;  3C5A A;  2EFX A;  5I94 A;  1PW1 A;  1PWC A;  3NCK A;  5GHX A;  4UA7 A;  2V2F F;  3SH8 A;  1K56 D;  1H8Z A;  1XP4 A;  5D3O A;  2VGJ A;  1K4F A;  5FAQ A;  5EOE A;  3OPP A;  4KQO A;  4LV1 A;  3SS4 A;  3V3R A;  4EBN A;  4ZDX A;  1VQQ A;  3VFH A;  4WMC A;  3ZGA B;  4DDS A;  5JYO A;  1KGF A;  2VGK A;  3MKF A;  5J8X A;  1KVM A;  1E4D A;  2H10 A;  4OOY A;  1WE4 A;  3E2L A;  2P74 A;  3PAG A;  2WAF A;  4H8R A;  2C5W B;  2HDR A;  4KG5 A;  4QU3 A;  3MKE A;  4WYY A;  3RXW A;  3C7V A;  4R3B A;  1O7E A;  4PM9 A;  5M18 A;  4OKP A;  3QNC A;  4K0X A;  2Z2M B;  1AXB A;  4OVD A;  4QY6 A;  1TDG A;  1YMS A;  3CG5 A;  3SOI A;  3Q7V A;  4MBH A;  3A3F A;  3Q82 A;  1W8Q A;  2WZZ A;  3CMZ A;  3NC8 A;  5CTM A;  1J9M A;  4GKU A;  3G35 A;  4IBX A;  4ZAM A;  3S22 A;  1K57 A;  4RYE A;  4N1X A;  3LO7 A;  1OME A;  1ZG4 A;  3HVF A;  4KZ5 A;  3OCL A;  1DY6 A;  3ZCZ A;  4DXB A;  1ERO A;  3WS0 A;  4F94 A;  1KE0 A;  3N7W A;  4ZJ2 A;  1L2S A;  3FZC A;  3DWK A;  5F1F A;  1CEF A;  2ZD8 A;  2Q9M A;  5HAR A;  4DE1 A;  3N4I A;  4UHU A;  3V50 A;  1E3U D;  3UDI A;  1PZP A;  3FWL A;  4HEF A;  2Y2Q A;  1DJB A;  1QME A;  3LY4 A;  4OPR A;  1IYQ A;  4P87 A;  4PM8 A;  3HL9 A;  1MWU A;  1PIO A;  5DTS A;  4E3L A;  4N92 A;  2X01 A;  4FSF A;  4S2L A;  1H5X A;  3UE0 A;  2EXA A;  2B5R A;  1HZO A;  1IYO A;  5JYP A;  1YLJ A;  2J9P A;  4EWF A;  2WKE A;  1FOF A;  3FKW A;  2XD1 A;  4UA6 A;  2HDS A;  3UN7 A;  1LL9 A;  3FYZ A;  3QNB A;  4B4Z A;  4IVI A;  1DJA A;  3VP0 A;  1YLT A;  4JKT A;  4PM5 A;  5FI6 A;  3UPO A;  1LHY A;  4OPY A;  1ZG6 A;  1SHV A;  5HL1 A;  5FI7 A;  4KZ6 A;  4WEK A;  4WM9 A;  4ZBE A;  4B4X A;  1FCM A;  4S2N A;  5CRF A;  2ZC4 B;  4WZ4 A;  3W4Q A;  3VP2 A;  4DE3 A;  2PU2 A;  3Q7Z A;  3HUN A;  3MZE A;  3ZG9 B;  1SCW A;  1BLP A;  5A90 A;  3GMW A;  1S0W A;  2XFS A;  5GLA A;  5TGF A;  4BEN A;  4E3M A;  1WYB A;  4WEL A;  3C4O A;  3ITB A;  1BLC A;  3VMA A;  2H0T A;  1FQG A;  2A49 A;  2OLU A;  3GR2 A;  4KZ8 A;  1W5D A;  3O87 A;  1XX2 A;  1K55 C;  1BTL A;  1PWG A;  3UPN A;  3UO9 A;  3AGD A;  1U60 A;  3BM6 A;  1L0F A;  5KSC A;  3WRZ A;  3W4O A;  4PPR A;  3V39 A;  2ZQA A;  5EVI B;  3D4F A;  3ISG A;  2ZC7 A;  3SS3 A;  3UNW A;  5FAS A;  4JF5 A;  5DF9 A;  3UPP A;  5DTT A;  1YLY A;  2Q9N A;  4OH0 A;  4IVK A;  5FDH A;  3IXB A;  3S1Y A;  2XDM A;  1PW8 A;  3HLD A;  4KZ7 A;  4S2M A;  5KMW A;  4OOM A;  5GLD A;  1RP5 A;  4FH2 A;  4KQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...