2ZQCA

Aztreonam acyl-intermediate structure of class a beta-lactam toho-1 e166a/r274n/r276n triple mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
total genus 96
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqcA00
1YMSA 1L0FA 4EUZA 1DJCA 1LI9A 4B88A 1PWGA 1IKGA 1N4OA 4E3JA 4RX3A 2IWBA 1KGGA 1S0WA 3IF6C 2J9PA 4QU3A 4E3LA 2EX2A 4KQOA 4YINA 3IT9A 4Z9QA 4GD8A 5EVIB 1ES3A 2ZC3B 4H8RA 1BSGA 4X68A 1NJ4A 3OPRA 5F1GA 1RGZA 5EECA 1FR1A 3IXGA 4GZBA 4PM6A 4OKPA 2JC7A 4S2IA 3I7JA 5AQ7A 4E6XA 1TDGA 3V5MA 3IXBA 4U0XA 2C5WB 1YT4A 1CEGA 3MKFA 4S2KA 3ZNYA 3ZCZA 3ZDJA 3V3SA 4QJGA 3C4PA 4E3IA 2ZQ9A 1I2WA 2V1ZA 2ZD8A 3A3DA 1GCEA 3Q7ZA 4RVAA 5GL9A 4JF6A 5CTNA 1PW8A 4S2MA 1H8ZA 1HD8A 2HDQA 3TSGA 3IHBA 2WYXA 2WUQA 5D3OA 4WMCA 1OMEA 2Y55A 2Y2OA 1K4FA 1L2SA 4QY6A 4RX2A 1SHVA 2Z2LB 5DTKA 4DXCA 4EV4A 1MY8A 4WYYA 1RGYA 3IWQA 1MPLA 3P98A 2Y2LA 5FQJA 3IF6B 1K25A 4P87A 3W4PA 1FCMA 2G2UA 2IWCA 4QHCA 3N8SA 4BD0A 5CRFA 2WKIA 2J7VA 4XXRA 5A90A 3BRMA 4WELA 4OP5A 5FQKA 4X56A 4PM7A 1DJAA 3G2YA 1YMXA 2WGVA 4K0XA 2X71A 3ITAA 1JWVA 3SS3A 3UDFA 1IYSA 3FV7A 4BL3A 4N1XA 1KVLA 3WRZA 1JTGA 3OC2A 1SDNA 3UDXA 1SDEA 5EOOA 3RXXA 3ZGAB 5HAQA 4JPMA 3NDGA 1XX2A 1GHIA 2WK0A 1FCNA 4B4XA 3BFEA 5M19A 5J8XA 4MBKA 4WZ4A 3G32A 1PW1A 5CECA 1MBLA 3LY4A 4OQIA 3WRTA 3HLGA 1IYPA 3HLEA 3MZEA 5AQBA 1Z6FA 4E6WA 1KGEA 1JVJA 5DF9A 2X02A 1KE0A 1NYMA 4KG6A 2DCFA 4LCLA 4OLGA 2QPNA 1NRFA 4C75A 3SS5A 5M1AA 1BTLA 5A93A 1W79A 3HLDA 3MXSA 1SKFA 2JBFA 2H5SA 3E2KA 5HX9A 3MZDA 2X01A 3W4OA 5CHJA 3GQZA 1K4EA 1YLZA 4OPZA 4QB8A 4WEJA 4OOMA 2PBYA 4KZ4A 4E3KA 4LENA 1GA9A 3SS4A 3AGFA 2I72A 1TDLA 4WZ5C 3BFCA 1EWZA 4OH0A 4PM8A 3GVBA 4KQRA 4WEKA 1CI9A 3UO9A 4Y7PA 1ESUA 4PM9A 2Y2MA 2EX6A 2Y59A 1KE3A 4MLLA 3TG9A 5HW3A 2Y2PA 3HLWA 3G30A 1L0EA 4KZ7A 5KZHA 2FFYA 1ZKJA 3FYZA 5CGXA 4JKTA 4OPQA 2EX9A 4OONA 4JXWA 3SH8A 2UWXA 1PI4A 5FSRA 4S2JA 4DE2A 2XH9A 1E25A 3NY4A 2Y2NA 5FA7A 4XUXA 1RP5A 5GLDA 3VSLA 4ZJ2A 2XD1A 5FATA 1NY0A 5GLCA 3VFFA 4EWFA 2FFFB 2ZMAA 1G68A 1K56A 4BLMA 4DE1A 1J9MA 1XGIA 3AGDA 3Q7VB 4IBRA 2C6WB 4F94A 5DTSA 3S22A 3CZDA 1W8YA 4OQ0A 1QMEA 4ZJ3A 3OZHA 1PI5A 3HUNA 3HUMA 2Q9MA 3A3FA 2Y2KA 1MWTA 5I94A 5EVIA 1E3UD 2R9XA 2Y4AA 5GLBA 3ZVTA 3C4OA 2A49A 3PBNA 4BL2A 4S2NC 1K55C 4IEDA 2XD5A 2EFXA 4R0QA 5CEBA 5GHXA 3UY6A 2OLVA 3G31A 1WYCA 4BJPA 5HL1A 4N9KA 1W7FA 5FI6A 4MBHA 3BEBA 2XLNA 4NETA 2ZQ7A 3FZCA 3V39A 3BYDA 1NYYA 3WS5A 5DTTA 1XXMA 3TOIA 2Y2QA 1KE4A 4OOYA 4PMAA 2ZQ8A 2JE5A 3S4XA 4KG2A 1I2SA 1K38A 1DY6A 4P6BA 3VP1A 3VMAA 2ZJ9A 1YLTA 5DVAA 1BLHA 1XA7A 3SH9A 3IF5A 3DWZA 5CGWA 3ITBA 5CHUA 3VFHA 5F1FA 1XPBA 3B3XA 1GHPA 4QD4A 1YLPA 3MFDA 3IH9A 3NDEA 4GD6A 5E2HA 3BFGA 4P0MA 1LLBA 3VOYA 2P9VB 3IQAA 4IVKA 1FOFA 3BFDA 3GR2A 4ZTKA 5A91A 3SH7A 3V3RA 2CC1A 3IH8A 1XKZA 1LI0A 4N1HA 2WADA 2OSUA 4GNUA 4WBGA 4KZ5A 1XP4A 2HDSA 5FQ9A 5GHYA 2J9OA 1ES2A 3CJMA 4M3KA 3VP0A 3VP3A 4Y0OA 2ZC6B 3UPPA 3ZG7B 3ISGA 3WS0A 4OP8A 1KVMA 3S1YA 3G2ZA 3N7WA 2ZC5B 3NIAA 4KZAA 3WS1A 3OCLA 4BENA 4JF4A 3WS4A 4A5RA 2XQZA 3D4FA 4GOGA 3MZFA 4FCFA 3RJUA 1MXOA 1SCWA 3O86A 5CERA 3NCKA 2ZM8A 3UPOA 1ZG4A 4X69A 4JLFA 4GN2A 1PZPA 2JCHA 3PAGA 4FD8A 4HESA 1BT5A 3MBZA 1DJBA 3E2LA 3C7UA 5CTMA 4D2OA 1FR6A 4U0TA 1HVBA 2B5RA 2IWDA 3IXHA 4L0LA 4WM9A 4PPRA 1TVFA 5AQAA 4DDSA 1K57A 4RA7A 4DE0A 1JWPA 2Y2IA 1TEMA 3OPLA 4KQQA 1PWDA 4UA7A 2ZQAA 5EOEA 5FI2A 4R23A 3PBSA 3P09A 4R1GA 2Y91A 3N8RA 5JYPA 1HTZA 5CGSA 3VSKA 1NZUA 3LEZA 4Y0UA 5FAQA 5TGFA 3LCEA 5JYOA 3A3IA 3NC8A 1K54C 2Y2GA 1JTDA 2XFSA 3JYIA 4XUZA 3BFFA 2HDUA 3HBRA 3WWXA 2G2WA 3BECA 1IELA 1QMFA 1PZOA 4NK3A 3NI9A 4C6YA 4EBNA 4OPRA 4OVDA 1ERMA 2OLUA 1Q2PA 4N9LA 4K91A 2ZC7A 2XGNA 4ID4A 5HAPA 1JWZA 1W8QA 3Q82A 2HP6A 1IEMA 1I5QA 3GRJA 2XK1A 3O3VA 4B4ZA 4KZ9A 2WAEA 1BZAA 3HVFA 2WAFA 1K6SA 3PBOA 3G34A 4N92A 4BQMA 4LV3A 3UN7A 4FH2A 1LHYA 3BLMA 1WE4A 4X6TA 1FQGA 2WGWB 3Q07A 3IHAA 3M2JA 3QHYA 4P85A 1EI5A 3BM6A 4UA6A 2XEPA 3DW0A 1MWUA 4OLDA 5HFOA 1ALQA 1GA0A 5FQMA 5M18A 4LV1A 3Q7VA 4R4SA 4JXSA 5U47A 4OOLA 3UE0A 4CPKA 1VM1A 4QY5A 5KSCA 4DRTA 1MWRA 5FASA 2DRWA 4DE3A 2ZC4B 3O88A 4YFMA 1FCOA 4DDYA 5FQQA 1GHMA 4OQGA 3LY3A 4UHUA 4FSFA 5KSHA 2EFUA 1HZOA 3BLSA 1N9BA 4EBLA 1LL9A 3PTEA 4JXVA 5F83A 2WZZA 1ZG6A 3N4IA 1BULA 1YM1A 5A92A 4WMCD 2Y2HA 2ZLYA 3A3JA 4IVIA 3W8KA 2H0TA 5EUAA 3VOZA 3WS2A 3PAEA 3Q1FA 2RCXA 2WZXA 5F82A 5GHZA 1Q2QA 4Y0TA 5FAOA 1BLCA 1LL5A 1YLYA 2PU2A 3ZNTA 1H8YA 1M6KA 4C3QA 1FSWA 2BG1A 4OQHA 3NBLA 5DF8A 2EXBA 4PM5A 3MXRA 4E3NA 2E8IA 3GMWA 4ZBEA 2A3UA 3GV9A 3ZHHA 2XF3A 1E3UA 3DTMA 3G35A 3CG5A 5FI7A 2V20A 3M6HA 1BUEA 4KZ3A 4JF5A 1H5XA 2R9WA 3QNBA 1PIOA 2P9VA 3IWIA 4S2PA 3SOIA 1U60A 3IF6A 1ESIA 1FSYA 1CI8A 3PBQA 2P74A 4R3JA 5EVLA 2ZQCA 1ES5A 3HLFA 4MEZA 4MBFA 2EXAA 3RXWA 3M2KA 4KZ8A 5AQ9A 4S2LA 3ZFZA 4S2NA 1K55A 4K0WA 4HBTA 4E3MA 1EROA 2EX8A 4OPYA 2BLSA 2HP5A 2ZM0A 4R4RA 4R3BA 3N8LA 3HLBA 1L0DA 5FQIA 4BD1A 1YLWA 1ZC2A 5L2FA 1CEFA 2QMIA 1K57C 4EBPA 3FWLA 3V50A 3W4QA 1W5DA 3QNCA 4DXBA 4X55A 4RYEA 5TR7A 2DNSA 5E2FA 3HREA 3VP4A 2WGIA 4GDBA 2OV5A 4FH4A 5KMWA 3PBRA 5TFQA 3UPNA 3UNWA 3OCNA 4S2OA 3DWKA 3ZG8B 4Q8IA 2ZM2A 3FKVA 2XR0A 1AXBA 1O7EA 3OPPA 1CK3A 5E2EA 2Z2MB 4GB7A 3GSGA 3N6IA 3Q81A 1IYOA 4GDNA 5FDHA 2XDMA 1O07A 2WKHA 4U3TA 3GTCA 1MWSA 4MNRA 4ZAMA 1Y54A 3C7VA 3ZG0A 4JBFA 3LO7A 5BOHA 4O7DA 4CJNA 2HPBA 2WKEA 4KZBA 3ZG9B 5HARA 3VP2A 1KGFA 1XA1A 4IBXA 2J8YA 5IHVA 4KZ6A 1YLJA 1KDSA 1C3BA 3UE3A 2HP9A 4JXGA 3G4PA 1KDWA 2H10A 2ZQDA 3M6BA 3EQVA 2Q9NA 1ONHA 4DF6A 5GLAA 3FKWA 1MKIA 1WYBA 3HUOA 3UDIA 5FAPA 2VGJA 2H0YA 4LV2A 5CHMA 5E2GA 1K6RA 1NZOA 4ZDXA 1K56D 2GDNA 5EVIC 5CEDA 2VGKA 5CXWA 3AGEA 2Y2JA 4E3OA 3ZVWA 3ZG5A 1PWCA 1L0GA 4GKUA 1IKIA 2WGWA 4LCMA 4ZJ1A 1BLSA 3O87A 5G18A 1BLPA 2QZ6A 5EVID 2PU4A 1M40A 3UE1A 2V2FF 4LV0A 4X53A 2XFTA 3HLCA 3A3EA 3C5AA 1YQSA 4UAAA 4WZ5A 2RL3A 1IYQA 1PYYA 5HAIA 1XGJA 3IXDA 1K54A 5DF7A 3OPHA 1ERQA 1S6RA 1ONGA 4DKIA 4HBUA 4KG5A 5EPHA 3EQUA 1VQQA 1RCJA 1E4DA 3CMZA 3MKEA 3IWOA 3PBTA 4HEFA 4UA9A 2HDRA 4KENB 5E43A 3HL9A 5EE8A 4EQIA 1NXYA 1G6AA 1ES4A
chains in the Genus database with same CATH superfamily
1PWGA 1DP6A 4E3LA 2J9PA 4GD8A 3E4PA 3SW1A 4GS9B 1CEGA 3MKFA 3JVUA 4QJGA 3C4PA 4E3IA 2DMWA 1GCEA 2PR6A 5CTNA 1HD8A 2K7SA 2WUQA 4WMCA 3UMEA 1K4FA 1L2SA 4I3IA 3GECA 4QY6A 5J4EA 1N9NA 2P04A 1RGYA 3E98A 3IWQA 2O9CA 1MPLA 1GSVA 2JKRM 1K25A 1NLZA 3H82B 2ZBBA 4GHIA 4MN5A 5LBRA 3P7NA 4XXRA 3BRMA 3VV4A 4PM7A 3G2YA 3NHQA 4I3AA 3ITAA 5I5LA 1OT6A 4BL3A 1SDEA 5EOOA 3RXXA 4JPMA 3VOLA 1GHIA 1FCNA 2E8JA 2VGLS 4WZ4A 3G32A 1MBLA 3LY4A 4OQIA 5C5KA 1N9OA 1Z6FA 5DF9A 4LCLA 1KE0A 4KG6A 2Q0OA 3C38A 3SS5A 1NLYA 4R3AA 2VA0A 5A93A 2H5SA 3E2KA 1DP9A 4QB8A 4JGRA 2PBYA 5HDCA 4LENA 3E4QA 1TDLA 1P9RA 4WEKA 3UB6A 3UO9A 4GW9A 2Y59A 4IJGA 2NUTC 4MLLA 4ETZA 3HLWA 2JKFA 4KZ7A 5KZHA 4YOFA 5AJGA 3PHYA 1YPRA 3FYZA 1VEUB 2ZOHA 4JXWA 3SH8A 4XT2A 1PI4A 4DE2A 3KYZA 3NY4A 2Y2NA 1TF1A 3VSLA 2W1TA 1G68A 3B47A 4DE1A 1V9YA 1XGIA 4F94A 3Q7VB 4IBRA 2V1AA 3S22A 1IFQA 3EGDC 3F1PB 4M4XA 1YSPA 4FOFA 2Q9MA 5HWVA 2KDKA 2R9XA 3ZVTA 5GLBA 4BL2A 3PBNA 2CMNA 3MS6A 1W7FA 4N9KA 3BEBA 2XLNA 2ZQ7A 3T4SA 1NYYA 1XXMA 2Y2QA 3G6OA 2R78A 1T1BA 2JE5A 1V9ZA 3S4XA 4KG2A 5DVAA 3SH9A 4EW7A 5F1FA 1XPBA 4MN7A 4NEED 5F68A 3BFGA 2P9VB 3IQAA 4ZTKA 3V3RA 3GR2A 3NOUC 1LI0A 2VV8A 2OSUA 4WBGA 4NKPA 5FQ9A 4M3KA 2ZC6B 4OP8A 1KVMA 3N7WA 2ZC5B 3BQ8A 5DFXA 2VK3A 4A5RA 3T4TA 3MZFA 3O86A 1ZG4A 4JLFA 4FD8A 4HESA 3E2LA 3C7UA 5CTMA 4HQAA 4U0TA 3IXHA 4L0LA 5AQAA 4PPRA 1T19A 1AWIA 3DTIA 1X0OA 3S7PA 3F1OB 4KQDA 1H8MA 1HLUP 5CGSA 3VSKA 1NZUA 4Y0UA 5F6AA 3HJKA 2Y2GA 1JTDA 3IBJA 1PZOA 3S7QA 3NI9A 4EBNA 3OOVA 2OLUA 4N9LA 4K91A 5HWTA 2ZC7A 5HAPA 4ID4A 1W8QA 3LEQA 1IEMA 4B9OA 2WAEA 1BZAA 3HVFA 3W2ZA 3PBOA 1FIKA 1LHYA 1FQGA 2BASA 1EI5A 2XEPA 3MXQA 3DW0A 5HFOA 4CLCD 2J80A 1MWRA 4ETXA 5FASA 2PDRA 3MFXA 5KIZA 1JNUA 1MZUA 4UHUA 3PTEA 5F83A 1ZG6A 5IT5A 2Y2HA 2ZLYA 3R7WA 2H0TA 5EUAA 3WS2A 2RCXA 5GHZA 1Q2QA 1PRQA 3ZNTA 4C3QA 4OQHA 3MXRA 2VGLM 4E3NA 2PR5A 3NOTC 2A3UA 2IA2A 4ZBEA 3ZHHA 1E3UA 2LB5A 3CG5A 1D06A 2VZWA 3M6HA 4JF5A 2R9WA 3SOIA 1PIOA 1CQAA 3IWIA 1ESIA 3PBQA 3H82A 1SKOB 5EVLA 2ZQCA 1ES5A 3HLFA 4MEZA 3K3CA 3M2KA 4S2LA 1EW0A 1PNEA 2EX8A 2PD8A 3N8LA 5FQIA 1L0DA 4BD1A 2VJWA 2NUPC 5L2FA 2QMIA 4I39A 3V50A 3W4QA 4RYEA 1S1YA 5E2FA 5KMWA 3MMHA 2MJ6A 2JKTM 3OCNA 4I5SA 3ZG8B 1G6OA 2XR0A 1AXBA 3T1RA 2V0UA 4G3VA 5E2EA 5HZHA 2Z2MB 1XJ4A 2XDMA 1MWSA 1Y54A 2M1CA 4JBFA 3LO7A 2GX5A 4NXFA 5HARA 1KGFA 2M7UA 2HP9A 3MQQA 1KDWA 2ZQDA 2Q9NA 5FAPA 1K56D 3IBRA 3CPTA 3AGEA 2Y2JA 4YWZA 1PWCA 1L0GA 1XFNA 1BLSA 1M40A 4HI4A 2K2NA 4HP4A 3F1PA 4WZ5A 1IYQA 5HAIA 3OPHA 4DKIA 1S6RA 5EPHA 2Z6DA 1G6AA 2W1TB 1YMSA 1DJCA 2Z6CA 1IKGA 3BQAA 2B95A 2EWVA 2ZC3B 3CUEC 4H8RA 1BSGA 3B33A 5F1GA 2JKTI 1RGZA 1H0MA 4GZBA 4PM6A 1TD5A 4O0PA 4E6XA 1TDGA 2QJ7A 1T1AA 3VE3A 1TS6A 4S2KA 3ZNYA 3DAVA 5HL6A 1I2WA 1OJ5A 2V1ZA 5GL9A 1UWPX 1H8ZA 3TSGA 3IHBA 5D3OA 2Y55A 4RX2A 1SHVA 5DTKA 4BWIA 4EV4A 4LGWA 3P98A 2Y2LA 5FQJA 4IUKA 2FZ0A 2IWCA 5L10A 5CRFA 2WKIA 5A90A 4WELA 4OP5A 2WGVA 1JWVA 3U4LP 2PHYA 3SS3A 4WUJA 5HPFA 1IYSA 3WRZA 3DTEA 3OC2A 3NDGA 1KOUA 3MJQA 3D72A 5J8XA 4MDZA 3A0VA 1PW1A 3WRTA 3HLEA 5AQBA 4E6WA 1KGEA 1H3QA 1JVJA 3NJAA 2QKPA 1NYMA 4OLGA 4EU0A 4AFIA 5M1AA 4LRZE 3HLDA 4NXGA 3MZDA 4WL9A 5CHJA 4KZ4A 1GA9A 3SS4A 3AGFA 4HHDA 4WZ5C 3BFCA 4OH0A 1UWNX 4PM8A 4Y15A 3LI9A 2EA9A 3G30A 2FFYA 4FUWA 5CGXA 4OPQA 4PKYA 4ARZB 5DKKA 4OONA 4F3LA 2UWXA 2XH9A 1E25A 2O9AA 2W0NA 4XUXA 3IX3A 5GLDA 2V8FA 1NY0A 5GLCA 4EWFA 4BLMA 5DTSA 4HNBA 5I94A 2Y2KA 1MWTA 1Z09A 5EVIA 2Y4AA 2A49A 4S2NC 2AVXA 4IEDA 2EFXA 5CEBA 3T50A 2OLVA 1S4SA 4BJPA 5FI6A 2PT7A 2L1MA 3V39A 1J3WA 3R7WB 1LSWA 1GSWA 2BTFP 4PMAA 2ZQ8A 1K38A 1SKOA 1YLTA 1XA7A 4EETB 5CGWA 3B3XA 1DRMA 1YSQA 3MFDA 3NDEA 5E2HA 1LLBA 2V8CA 3VOYA 3GDIA 3D9YA 4MMNA 4N1HA 3S7OA 4GNUA 2O9BA 2KOIA 4H6JA 5GHYA 3VP0A 3KSIA 3MF0A 2W3HA 3B42A 4X1LA 3S1YA 3G2ZA 3WS1A 4BENA 1TS7A 3LFVA 4FCFA 1D1JA 3RJUA 1MXOA 1SCWA 5CERA 2ZM8A 3RFBA 2JCHA 3MBZA 4Y2FA 3PXPA 1HVBA 4KQQA 1TEMA 3QP8A 4DMZA 2J3TC 3P09A 1HTZA 4Y3IA 5FAQA 5TGFA 3C8CA 5JYOA 3NC8A 4PAUA 2Y79A 2PD7A 2HDUA 3WWXA 3BECA 2VX8A 2VLGA 1QMFA 2JKGA 4NK3A 2W1RA 1ERMA 3Q82A 2HP6A 1I5QA 3T4QA 4L9FA 3CPTB 1YAXA 4N92A 3UN7A 3E4OA 3LGOA 4X6TA 1WE4A 2LB9A 3QHYA 3M2JA 4ZRRA 1MWUA 2JKRI 1ALQA 1GA0A 5M18A 4LV1A 4JXSA 3UE0A 1DP8A 3LIAA 4YFMA 1FCOA 5KSHA 3BLSA 4EBLA 1LL9A 3N4IA 1BYWA 2VV6A 5A92A 1F5MA 4IVIA 3W8KA 3Q1FA 2JN7A 2WZXA 2VKSA 3EEHA 5FL3A 3T12B 4EERA 1XFQA 1BLCA 1T18A 1W63M 3A0RA 1G28A 2EXBA 3S7NA 3JPUA 2V20A 4KZ3A 1BUEA 1OTDA 1H5XA 3VP4A 1XJ2A 1CI8A 4R3JA 3LR3A 5J3WA 1VHMA 1LT0A 4MBFA 5IS1A 3RXWA 5AQ9A 1K55A 4K0WA 4E3MA 1EROA 4OPYA 2BLSA 4R4RA 4GCZA 1YLWA 1ZC2A 3IX4A 1P97A 3FWLA 4DXBA 3QNCA 2WGIA 2OV5A 3PBRA 5AVFA 4Q8IA 3F1NA 4NG2A 1CK3A 4LRXC 3N6IA 3Q81A 3UB5P 1IYOA 4GDNA 3LR4A 5DJTA 4MNRA 3ZG0A 5EM1A 2HPBA 5F69A 4KZBA 4FTXA 3T4JA 1TS8A 5TBMA 2J8YA 5IHVA 4KZ6A 1KDSA 4BMWA 5GLAA 3FKWA 3UDIA 4LPZA 5DJUA 5CHMA 5E2GA 4ARZA 4ZDXA 2PYRA 2VGKA 5CXWA 4L9GA 4GKUA 2WGWA 4LCMA 3O87A 1BLPA 4MN6A 5HDSA 2V2FF 1STZA 4LV0A 1OTAA 3HLCA 1F98A 4F3LB 1PYYA 3IXDA 1K54A 5DF7A 1ERQA 4HJ4A 4HBUA 3T1SA 3EQUA 3CMZA 3MKEA 4HEFA 1ZHHB 2HDRA 5E43A 4EQIA 4HY8A 4EUZA 1OPXA 1LI9A 2ZMVA 4B88A 1N4OA 3VE4A 4E3JA 2IWBA 1S0WA 2EX2A 4KQOA 4YINA 3IT9A 5IU1A 4Z9QA 5EVIB 5AVEA 3OPRA 3KO6A 4CLCA 2B18A 1FR1A 3IXGA 1YKDA 4OKPA 2JC7A 4U0XA 4HOIA 2C5WB 1YT4A 3H7WA 3ULFA 2ZQ9A 3A3DA 3H9WA 4DN0A 4I3JA 3CITA 1OTIA 3EOIA 4RVAA 2I9VA 1PW8A 2HDQA 2WYXA 2Y2OA 3L7HA 4R6LA 4DXCA 1MY8A 3CAXA 3IF6B 4P87A 1TS0A 3ICYA 1MC0A 4QHCA 5FQKA 4H6JB 4X56A 1YMXA 4K0XA 2X71A 2HJ9C 3RTYA 1JTGA 2B02A 3ZGAB 1LL8A 3BY9A 1XX2A 3QP5A 1GSXA 3OLOA 4B4XA 1OTBA 5M19A 3L9KA 3ZQ5A 5CECA 2QJ5A 3QP4A 2X02A 2DCFA 2QPNA 5FEGA 2GJ3A 2JBFA 2W3EA 2X01A 2PYPA 3GQZA 4WEJA 4OOMA 4E3KA 4G3WA 4PHTA 1EWZA 2J3WA 4KQRA 1OTEA 2Y2MA 4CLCE 1S1ZA 2QYBA 2EX6A 5HW3A 4ESPA 4JKTA 3MQ0A 5TJJA 4S2JA 2L0WA 5FATA 3VFFA 1K56A 3PR6A 2A24A 1J9MA 3A0SA 4BBUA 2C6WB 2W3GA 3CZDA 2HJEA 4Y5FA 3OZHA 1PI5A 1ODVA 3HUMA 3FPWA 4KUKA 4Q0JA 4Y13A 3C4OA 4G3KA 1A0KA 3T4LA 1WYCA 3ZYTA 4NETA 3BYDA 4D60A 1KE4A 4I38A 4OOYA 2V1BA 5J7EA 1DY6A 4P6BA 3IF5A 3DWZA 4UEYA 3ITBA 3TRCA 4UQIS 1YLPA 3KYQA 4HIAA 4IVKA 1FOFA 3BFDA 3IH8A 3LICA 1XKZA 5HD3A 1XP4A 3CLOA 2HDSA 2J9OA 1ES2A 2G7UA 3ZG7B 3ISGA 4KZAA 4E04A 3OCLA 1G5UA 4JF4A 3WS4A 1F9IA 3D4FA 4GOGA 3UPOA 4X69A 1Y4OA 1PZPA 3PAGA 1BT5A 3F1NB 4QPRA 4D2OA 2KLIA 2O0YA 4RA7A 4DE0A 1JWPA 3OPLA 1PWDA 1UGUA 3BWLA 5EOEA 3EGXC 1W63Q 4Z1WA 2KX6A 5G4ZA 5JYPA 3N8RA 3T1QB 3LEZA 4Q0IA 2W3FA 3A3IA 2XFSA 2J3TD 3JYIA 3BFFA 2G2WA 3C2WA 5TBMB 3LUQA 4MCWA 4EUVA 5FEFA 4OVDA 3FPVA 3PYPA 1ZTUA 2XGNA 4ME4A 2EWWA 3GRJA 2XK1A 1L3LA 4RQ9A 4X1MA 2WGWB 4P85A 2OOLA 3BM6A 5FQMA 5U47A 1VM1A 3MR0A 4QY5A 5KSCA 4BBVA 4DE3A 5FQQA 2EFUA 4R38A 1N9BA 3DTKA 2YKHA 2OWJA 4EXOA 4JXVA 1SZVA 4WMCD 2ZMFA 3VOZA 4WLAA 4R70A 4CLCB 1YLYA 5DFYA 1P0ZA 1XJ6A 1H8YA 2PRFA 1FSWA 2BG1A 3IX8A 3NBLA 3C30A 2E8IA 5DKLA 2XF3A 3MQOA 3H7WB 3G35A 4BBTA 3QNBA 1U60A 3IF6A 2P74A 2EXAA 2M7VA 3ZFZA 5HWWA 3JVVA 3T4OA 2HP5A 2ZM0A 4R3BA 3QP1A 3HLBA 2PBDP 5CX7A 4EBPA 5TR7A 3HREA 1CF0A 4GDBA 3V67A 5TFQA 3UPNA 1WA9A 4S2OA 4LFUA 3NULA 3CI6A 4WN5A 2YKFA 5FDHA 1O07A 2WKHA 3GTCA 4ZAMA 5BOHA 4O7DA 3BJNA 2HZ5A 3LR5A 1S4RA 3DBAA 3ZG9B 1LSXA 3VP2A 1XA1A 4IBXA 2XSSA 1YLJA 2A2LA 4K08A 3UE3A 3T1XA 4JXGA 3G4PA 2OAQ1 3M6BA 1ACFA 1MKIA 1WYBA 2GNXA 3HUOA 2VGJA 2H0YA 4LV2A 1K6RA 1NZOA 5EVIC 3ZVWA 3ZG5A 1IKIA 1D7EA 2QHKA 2QZ6A 2PU4A 3UE1A 2ZL1A 2XFTA 2O99A 3A3EA 3C5AA 1YQSA 1IOUA 3KSHA 2RL3A 1XGJA 4UQIM 1ONGA 4KG5A 4LLOB 3PBTA 1RCJA 3UMDA 1S67L 5EE8A 3DWKA 1NXYA 1ES4A 2A24B 1L0FA 2WKPA 2XA7M 2L4RA 4RX3A 1KGGA 3IF6C 3IS2A 4QU3A 4HH2A 3U2AA 2H28A 1ES3A 4JGQA 2ACGA 4X68A 1NJ4A 5EECA 4WF0A 2GZAA 3RH8B 4S2IA 3I7JA 4L9EA 5AQ7A 3V5MA 3IXBA 4QWOA 3ZCZA 3ZDJA 3V3SA 2INWA 3TW8A 3TJZC 2ZD8A 3HCYA 3Q7ZA 4JF6A 4S2MA 2HV1A 1OMEA 3UB7A 4O01A 2Z2LB 4WYYA 5EFWA 2W27A 4NXEA 3W4PA 1FCMA 2G2UA 3D3OA 2XRNA 3N8SA 4BD0A 3BW6A 2J7VA 1DJAA 2UV0E 3UDFA 2P7JA 3FV7A 4N1XA 1KVLA 3CWFA 1SDNA 3UDXA 3MSHA 5HAQA 1LSVA 1NWZA 2WK0A 3BFEA 4MBKA 5HD5A 3HLGA 1IYPA 3MZEA 2OWHA 3LYXA 4P6ZS 1NRFA 4C75A 5L09A 1BTLA 1W79A 3MXSA 1SKFA 4CQHA 5HX9A 3W4OA 1K4EA 1YLZA 4OPZA 4HJ6A 4O8GA 1NRJA 2QWSA 2I72A 4LRYC 3K2NA 3GVBA 1CI9A 4Y7PA 1ESUA 4PM9A 2WKQA 4YNRA 1KE3A 5F5YA 3TG9A 2Y2PA 1L0EA 3CHWP 1ZKJA 2EX9A 1K0KA 1FILA 5FSRA 3T4KA 4II7A 5FA7A 1RP5A 4ZJ2A 1VETA 2XD1A 2FFFB 2ZMAA 3AGDA 1Y28A 2JHEA 1W8YA 4OQ0A 1QMEA 1F2KA 4ZJ3A 3BY8A 3HUNA 3A3FA 1E3UD 4Q0HA 1N9LA 1K55C 2XD5A 4R0QA 5GHXA 5HPIA 3UY6A 2D02A 1MKMA 5L07A 3G31A 3LIEA 5HL1A 4MBHA 4GS9A 3FZCA 3WS5A 5DTTA 3TOIA 1VB6A 1I2SA 1S66L 3VP1A 3VMAA 3LIBA 2ZJ9A 1BLHA 3HJIA 5CHUA 3VFHA 2K31A 1GHPA 4QD4A 3IH9A 4GD6A 4P0MA 5A91A 3SH7A 1OT9A 2CC1A 2WKRA 3CUEA 2WADA 4HP9A 4KZ5A 2ZOIA 3VP3A 3CJMA 4Y0OA 3UPPA 4JGPA 3UB9A 3WS0A 2V0WA 3NIAA 5G4YA 2XQZA 4GHIB 3NCKA 3FG8A 4GN2A 1DJBA 4HJ3A 4IUHA 3KSFA 1FR6A 3KYEA 2B5RA 2IWDA 4WM9A 4DDSA 4EEUA 1TVFA 2FH5A 1K57A 3K3DA 2Y2IA 4UA7A 2ZQAA 5FI2A 3O5YA 2V9AA 4R23A 3PBSA 4R1GA 2Y91A 3LCEA 3UB8A 1K54C 2Y8HA 2D01A 4XUZA 3HBRA 1IELA 4C6YA 4OPRA 1Q2PA 1JWZA 2P08A 3O3VA 4B4ZA 4KZ9A 1VEUA 1K6SA 2WAFA 3G34A 4BQMA 4CLCC 4LV3A 3LIDA 4FH2A 4DJ2A 3LR0A 3BLMA 2VEAA 4NXBA 3IHAA 3Q07A 3P01A 4UA6A 4OLDA 1XJ3A 2OAP1 2ZL1B 3Q7VA 4R4SA 2PAVP 5HDDA 4OOLA 4CPKA 4DRTA 5EM0A 1T1CA 4XT2B 2DRWA 3R4KA 3NECA 5FDSA 2ZC4B 3O88A 4DDYA 1GHMA 3QP2A 4OQGA 3LY3A 4FSFA 4Y17A 1HZOA 3EWKA 3KSGA 2WZZA 1BULA 1YM1A 3A3JA 3IS2B 3OBFA 3EEAA 3PAEA 5F82A 4Y0TA 5FAOA 1LL5A 5A8BA 2PU2A 3NOPC 1M6KA 4PM5A 5DF8A 3FC7A 3GMWA 3GV9A 3DTMA 5FI7A 4S2PA 2P9VA 4HH3A 1FSYA 4PKYG 2XROA 4P6ZM 2XA7S 4KZ8A 2HGVA 4S2NA 4GJ4A 4HBTA 1OJGA 3SZTA 1CEFA 4KUOA 1K57C 1W5DA 4X55A 2DNSA 4FH4A 4B93A 1P9WA 3UNWA 2W3DA 2ZM2A 3FKVA 1O7EA 3OPPA 2HF6A 4GB7A 3GSGA 5EV0A 4EQ1A 4U3TA 5K5BA 3KX0X 5EVEA 3C7VA 3F1OA 3QP6A 4X25A 4CJNA 2WKEA 4GLQA 2VV7A 4EEPA 3LI8A 1C3BA 3TE8A 2H10A 4DF6A 3EQVA 1ONHA 4IHQA 3LIFA 2GDNA 5CEDA 3UE6A 4JGOA 4DJ3A 4E3OA 4ZJ1A 5G18A 3E0YA 5EVID 1PFLA 4X53A 1CJFA 4UAAA 5MC7A 5L8MA 1VQQA 5HSQA 1E4DA 4EESA 3IWOA 4UA9A 4KENB 3HL9A 1VETB
chains in the Genus database with same CATH topology
1YMSA 1L0FA 4EUZA 1DJCA 1LI9A 4B88A 1PWGA 1IKGA 1N4OA 4E3JA 4RX3A 2IWBA 1KGGA 1S0WA 3IF6C 2J9PA 4QU3A 4E3LA 2EX2A 4KQOA 4YINA 3IT9A 4Z9QA 4GD8A 5EVIB 1ES3A 2ZC3B 4H8RA 1BSGA 4X68A 1NJ4A 3OPRA 5F1GA 1RGZA 5EECA 1FR1A 3IXGA 4GZBA 4PM6A 4OKPA 2JC7A 4S2IA 3I7JA 5AQ7A 4E6XA 1TDGA 3V5MA 3IXBA 4U0XA 2C5WB 1YT4A 1CEGA 3MKFA 4S2KA 3ZNYA 3ZCZA 3ZDJA 3V3SA 4QJGA 3C4PA 4E3IA 2ZQ9A 1I2WA 2V1ZA 2ZD8A 3A3DA 1GCEA 3Q7ZA 4RVAA 5GL9A 4JF6A 5CTNA 1PW8A 4S2MA 1H8ZA 1HD8A 2HDQA 3TSGA 3IHBA 2WYXA 2WUQA 5D3OA 4WMCA 1OMEA 2Y55A 2Y2OA 1K4FA 1L2SA 4QY6A 4RX2A 1SHVA 2Z2LB 5DTKA 4DXCA 4EV4A 1MY8A 4WYYA 1RGYA 3IWQA 1MPLA 3P98A 2Y2LA 5FQJA 3IF6B 1K25A 4P87A 3W4PA 1FCMA 2G2UA 2IWCA 4QHCA 3N8SA 4BD0A 5CRFA 2WKIA 2J7VA 4XXRA 5A90A 3BRMA 4WELA 4OP5A 5FQKA 4X56A 4PM7A 1DJAA 3G2YA 1YMXA 2WGVA 4K0XA 2X71A 3ITAA 1JWVA 3SS3A 3UDFA 1IYSA 3FV7A 4BL3A 4N1XA 1KVLA 3WRZA 1JTGA 3OC2A 1SDNA 3UDXA 1SDEA 5EOOA 3RXXA 3ZGAB 5HAQA 4JPMA 3NDGA 1XX2A 1GHIA 2WK0A 1FCNA 4B4XA 3BFEA 5M19A 5J8XA 4MBKA 4WZ4A 3G32A 1PW1A 5CECA 1MBLA 3LY4A 4OQIA 3WRTA 3HLGA 1IYPA 3HLEA 3MZEA 5AQBA 1Z6FA 4E6WA 1KGEA 1JVJA 5DF9A 2X02A 1KE0A 1NYMA 4KG6A 2DCFA 4LCLA 4OLGA 2QPNA 1NRFA 4C75A 3SS5A 5M1AA 1BTLA 5A93A 1W79A 3HLDA 3MXSA 1SKFA 2JBFA 2H5SA 3E2KA 5HX9A 3MZDA 2X01A 3W4OA 5CHJA 3GQZA 1K4EA 1YLZA 4OPZA 4QB8A 4WEJA 4OOMA 2PBYA 4KZ4A 4E3KA 4LENA 1GA9A 3SS4A 3AGFA 2I72A 1TDLA 4WZ5C 3BFCA 1EWZA 4OH0A 4PM8A 3GVBA 4KQRA 4WEKA 1CI9A 3UO9A 4Y7PA 1ESUA 4PM9A 2Y2MA 2EX6A 2Y59A 1KE3A 4MLLA 3TG9A 5HW3A 2Y2PA 3HLWA 3G30A 1L0EA 4KZ7A 5KZHA 2FFYA 1ZKJA 3FYZA 5CGXA 4JKTA 4OPQA 2EX9A 4OONA 4JXWA 3SH8A 2UWXA 1PI4A 5FSRA 4S2JA 4DE2A 2XH9A 1E25A 3NY4A 2Y2NA 5FA7A 4XUXA 1RP5A 5GLDA 3VSLA 4ZJ2A 2XD1A 5FATA 1NY0A 5GLCA 3VFFA 4EWFA 2FFFB 2ZMAA 1G68A 1K56A 4BLMA 4DE1A 1J9MA 1XGIA 3AGDA 3Q7VB 4IBRA 2C6WB 4F94A 5DTSA 3S22A 3CZDA 1W8YA 4OQ0A 1QMEA 4ZJ3A 3OZHA 1PI5A 3HUNA 3HUMA 2Q9MA 3A3FA 2Y2KA 1MWTA 5I94A 5EVIA 1E3UD 2R9XA 2Y4AA 5GLBA 3ZVTA 3C4OA 2A49A 3PBNA 4BL2A 4S2NC 1K55C 4IEDA 2XD5A 2EFXA 4R0QA 5CEBA 5GHXA 3UY6A 2OLVA 3G31A 1WYCA 4BJPA 5HL1A 4N9KA 1W7FA 5FI6A 4MBHA 3BEBA 2XLNA 4NETA 2ZQ7A 3FZCA 3V39A 3BYDA 1NYYA 3WS5A 5DTTA 1XXMA 3TOIA 2Y2QA 1KE4A 4OOYA 4PMAA 2ZQ8A 2JE5A 3S4XA 4KG2A 1I2SA 1K38A 1DY6A 4P6BA 3VP1A 3VMAA 2ZJ9A 1YLTA 5DVAA 1BLHA 1XA7A 3SH9A 3IF5A 3DWZA 5CGWA 3ITBA 5CHUA 3VFHA 5F1FA 1XPBA 3B3XA 1GHPA 4QD4A 1YLPA 3MFDA 3IH9A 3NDEA 4GD6A 5E2HA 3BFGA 4P0MA 1LLBA 3VOYA 2P9VB 3IQAA 4IVKA 1FOFA 3BFDA 3GR2A 4ZTKA 5A91A 3SH7A 3V3RA 2CC1A 3IH8A 1XKZA 1LI0A 4N1HA 2WADA 2OSUA 4GNUA 4WBGA 4KZ5A 1XP4A 2HDSA 5FQ9A 5GHYA 2J9OA 1ES2A 3CJMA 4M3KA 3VP0A 3VP3A 4Y0OA 2ZC6B 3UPPA 3ZG7B 3ISGA 3WS0A 4OP8A 1KVMA 3S1YA 3G2ZA 3N7WA 2ZC5B 3NIAA 4KZAA 3WS1A 3OCLA 4BENA 4JF4A 3WS4A 4A5RA 2XQZA 3D4FA 4GOGA 3MZFA 4FCFA 3RJUA 1MXOA 1SCWA 3O86A 5CERA 3NCKA 2ZM8A 3UPOA 1ZG4A 4X69A 4JLFA 4GN2A 1PZPA 2JCHA 3PAGA 4FD8A 4HESA 1BT5A 3MBZA 1DJBA 3E2LA 3C7UA 5CTMA 4D2OA 1FR6A 4U0TA 1HVBA 2B5RA 2IWDA 3IXHA 4L0LA 4WM9A 4PPRA 1TVFA 5AQAA 4DDSA 1K57A 4RA7A 4DE0A 1JWPA 2Y2IA 1TEMA 3OPLA 4KQQA 1PWDA 4UA7A 2ZQAA 5EOEA 5FI2A 4R23A 3PBSA 3P09A 4R1GA 2Y91A 3N8RA 5JYPA 1HTZA 5CGSA 3VSKA 1NZUA 3LEZA 4Y0UA 5FAQA 5TGFA 3LCEA 5JYOA 3A3IA 3NC8A 1K54C 2Y2GA 1JTDA 2XFSA 3JYIA 4XUZA 3BFFA 2HDUA 3HBRA 3WWXA 2G2WA 3BECA 1IELA 1QMFA 1PZOA 4NK3A 3NI9A 4C6YA 4EBNA 4OPRA 4OVDA 1ERMA 2OLUA 1Q2PA 4N9LA 4K91A 2ZC7A 2XGNA 4ID4A 5HAPA 1JWZA 1W8QA 3Q82A 2HP6A 1IEMA 1I5QA 3GRJA 2XK1A 3O3VA 4B4ZA 4KZ9A 2WAEA 1BZAA 3HVFA 2WAFA 1K6SA 3PBOA 3G34A 4N92A 4BQMA 4LV3A 3UN7A 4FH2A 1LHYA 3BLMA 1WE4A 4X6TA 1FQGA 2WGWB 3Q07A 3IHAA 3M2JA 3QHYA 4P85A 1EI5A 3BM6A 4UA6A 2XEPA 3DW0A 1MWUA 4OLDA 5HFOA 1ALQA 1GA0A 5FQMA 5M18A 4LV1A 3Q7VA 4R4SA 4JXSA 5U47A 4OOLA 3UE0A 4CPKA 1VM1A 4QY5A 5KSCA 4DRTA 1MWRA 5FASA 2DRWA 4DE3A 2ZC4B 3O88A 4YFMA 1FCOA 4DDYA 5FQQA 1GHMA 4OQGA 3LY3A 4UHUA 4FSFA 5KSHA 2EFUA 1HZOA 3BLSA 1N9BA 4EBLA 1LL9A 3PTEA 4JXVA 5F83A 2WZZA 1ZG6A 3N4IA 1BULA 1YM1A 5A92A 4WMCD 2Y2HA 2ZLYA 3A3JA 4IVIA 3W8KA 2H0TA 5EUAA 3VOZA 3WS2A 3PAEA 3Q1FA 2RCXA 2WZXA 5F82A 5GHZA 1Q2QA 4Y0TA 5FAOA 1BLCA 1LL5A 1YLYA 2PU2A 3ZNTA 1H8YA 1M6KA 4C3QA 1FSWA 2BG1A 4OQHA 3NBLA 5DF8A 2EXBA 4PM5A 3MXRA 4E3NA 2E8IA 3GMWA 4ZBEA 2A3UA 3GV9A 3ZHHA 2XF3A 1E3UA 3DTMA 3G35A 3CG5A 5FI7A 2V20A 3M6HA 1BUEA 4KZ3A 4JF5A 1H5XA 2R9WA 3QNBA 1PIOA 2P9VA 3IWIA 4S2PA 3SOIA 1U60A 3IF6A 1ESIA 1FSYA 1CI8A 3PBQA 2P74A 4R3JA 5EVLA 2ZQCA 1ES5A 3HLFA 4MEZA 4MBFA 2EXAA 3RXWA 3M2KA 4KZ8A 5AQ9A 4S2LA 3ZFZA 4S2NA 1K55A 4K0WA 4HBTA 4E3MA 1EROA 2EX8A 4OPYA 2BLSA 2HP5A 2ZM0A 4R4RA 4R3BA 3N8LA 3HLBA 1L0DA 5FQIA 4BD1A 1YLWA 1ZC2A 5L2FA 1CEFA 2QMIA 1K57C 4EBPA 3FWLA 3V50A 3W4QA 1W5DA 3QNCA 4DXBA 4X55A 4RYEA 5TR7A 2DNSA 5E2FA 3HREA 3VP4A 2WGIA 4GDBA 2OV5A 4FH4A 5KMWA 3PBRA 5TFQA 3UPNA 3UNWA 3OCNA 4S2OA 3DWKA 3ZG8B 4Q8IA 2ZM2A 3FKVA 2XR0A 1AXBA 1O7EA 3OPPA 1CK3A 5E2EA 2Z2MB 4GB7A 3GSGA 3N6IA 3Q81A 1IYOA 4GDNA 5FDHA 2XDMA 1O07A 2WKHA 4U3TA 3GTCA 1MWSA 4MNRA 4ZAMA 1Y54A 3C7VA 3ZG0A 4JBFA 3LO7A 5BOHA 4O7DA 4CJNA 2HPBA 2WKEA 4KZBA 3ZG9B 5HARA 3VP2A 1KGFA 1XA1A 4IBXA 2J8YA 5IHVA 4KZ6A 1YLJA 1KDSA 1C3BA 3UE3A 2HP9A 4JXGA 3G4PA 1KDWA 2H10A 2ZQDA 3M6BA 3EQVA 2Q9NA 1ONHA 4DF6A 5GLAA 3FKWA 1MKIA 1WYBA 3HUOA 3UDIA 5FAPA 2VGJA 2H0YA 4LV2A 5CHMA 5E2GA 1K6RA 1NZOA 4ZDXA 1K56D 2GDNA 5EVIC 5CEDA 2VGKA 5CXWA 3AGEA 2Y2JA 4E3OA 3ZVWA 3ZG5A 1PWCA 1L0GA 4GKUA 1IKIA 2WGWA 4LCMA 4ZJ1A 1BLSA 3O87A 5G18A 1BLPA 2QZ6A 5EVID 2PU4A 1M40A 3UE1A 2V2FF 4LV0A 4X53A 2XFTA 3HLCA 3A3EA 3C5AA 1YQSA 4UAAA 4WZ5A 2RL3A 1IYQA 1PYYA 5HAIA 1XGJA 3IXDA 1K54A 5DF7A 3OPHA 1ERQA 1S6RA 1ONGA 4DKIA 4HBUA 4KG5A 5EPHA 3EQUA 1VQQA 1RCJA 1E4DA 3CMZA 3MKEA 3IWOA 3PBTA 4HEFA 4UA9A 2HDRA 4KENB 5E43A 3HL9A 5EE8A 4EQIA 1NXYA 1G6AA 1ES4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMS A;  1L0F A;  4EUZ A;  1DJC A;  1LI9 A;  4B88 A;  1PWG A;  1IKG A;  1N4O A;  4E3J A;  4RX3 A;  2IWB A;  1KGG A;  1S0W A;  3IF6 C;  2J9P A;  4QU3 A;  4E3L A;  2EX2 A;  4KQO A;  4YIN A;  3IT9 A;  4Z9Q A;  4GD8 A;  5EVI B;  1ES3 A;  2ZC3 B;  4H8R A;  1BSG A;  4X68 A;  1NJ4 A;  3OPR A;  5F1G A;  1RGZ A;  5EEC A;  1FR1 A;  3IXG A;  4GZB A;  4PM6 A;  4OKP A;  2JC7 A;  4S2I A;  3I7J A;  5AQ7 A;  4E6X A;  1TDG A;  3V5M A;  3IXB A;  4U0X A;  2C5W B;  1YT4 A;  1CEG A;  3MKF A;  4S2K A;  3ZNY A;  3ZCZ A;  3ZDJ A;  3V3S A;  4QJG A;  3C4P A;  4E3I A;  2ZQ9 A;  1I2W A;  2V1Z A;  2ZD8 A;  3A3D A;  1GCE A;  3Q7Z A;  4RVA A;  5GL9 A;  4JF6 A;  5CTN A;  1PW8 A;  4S2M A;  1H8Z A;  1HD8 A;  2HDQ A;  3TSG A;  3IHB A;  2WYX A;  2WUQ A;  5D3O A;  4WMC A;  1OME A;  2Y55 A;  2Y2O A;  1K4F A;  1L2S A;  4QY6 A;  4RX2 A;  1SHV A;  2Z2L B;  5DTK A;  4DXC A;  4EV4 A;  1MY8 A;  4WYY A;  1RGY A;  3IWQ A;  1MPL A;  3P98 A;  2Y2L A;  5FQJ A;  3IF6 B;  1K25 A;  4P87 A;  3W4P A;  1FCM A;  2G2U A;  2IWC A;  4QHC A;  3N8S A;  4BD0 A;  5CRF A;  2WKI A;  2J7V A;  4XXR A;  5A90 A;  3BRM A;  4WEL A;  4OP5 A;  5FQK A;  4X56 A;  4PM7 A;  1DJA A;  3G2Y A;  1YMX A;  2WGV A;  4K0X A;  2X71 A;  3ITA A;  1JWV A;  3SS3 A;  3UDF A;  1IYS A;  3FV7 A;  4BL3 A;  4N1X A;  1KVL A;  3WRZ A;  1JTG A;  3OC2 A;  1SDN A;  3UDX A;  1SDE A;  5EOO A;  3RXX A;  3ZGA B;  5HAQ A;  4JPM A;  3NDG A;  1XX2 A;  1GHI A;  2WK0 A;  1FCN A;  4B4X A;  3BFE A;  5M19 A;  5J8X A;  4MBK A;  4WZ4 A;  3G32 A;  1PW1 A;  5CEC A;  1MBL A;  3LY4 A;  4OQI A;  3WRT A;  3HLG A;  1IYP A;  3HLE A;  3MZE A;  5AQB A;  1Z6F A;  4E6W A;  1KGE A;  1JVJ A;  5DF9 A;  2X02 A;  1KE0 A;  1NYM A;  4KG6 A;  2DCF A;  4LCL A;  4OLG A;  2QPN A;  1NRF A;  4C75 A;  3SS5 A;  5M1A A;  1BTL A;  5A93 A;  1W79 A;  3HLD A;  3MXS A;  1SKF A;  2JBF A;  2H5S A;  3E2K A;  5HX9 A;  3MZD A;  2X01 A;  3W4O A;  5CHJ A;  3GQZ A;  1K4E A;  1YLZ A;  4OPZ A;  4QB8 A;  4WEJ A;  4OOM A;  2PBY A;  4KZ4 A;  4E3K A;  4LEN A;  1GA9 A;  3SS4 A;  3AGF A;  2I72 A;  1TDL A;  4WZ5 C;  3BFC A;  1EWZ A;  4OH0 A;  4PM8 A;  3GVB A;  4KQR A;  4WEK A;  1CI9 A;  3UO9 A;  4Y7P A;  1ESU A;  4PM9 A;  2Y2M A;  2EX6 A;  2Y59 A;  1KE3 A;  4MLL A;  3TG9 A;  5HW3 A;  2Y2P A;  3HLW A;  3G30 A;  1L0E A;  4KZ7 A;  5KZH A;  2FFY A;  1ZKJ A;  3FYZ A;  5CGX A;  4JKT A;  4OPQ A;  2EX9 A;  4OON A;  4JXW A;  3SH8 A;  2UWX A;  1PI4 A;  5FSR A;  4S2J A;  4DE2 A;  2XH9 A;  1E25 A;  3NY4 A;  2Y2N A;  5FA7 A;  4XUX A;  1RP5 A;  5GLD A;  3VSL A;  4ZJ2 A;  2XD1 A;  5FAT A;  1NY0 A;  5GLC A;  3VFF A;  4EWF A;  2FFF B;  2ZMA A;  1G68 A;  1K56 A;  4BLM A;  4DE1 A;  1J9M A;  1XGI A;  3AGD A;  3Q7V B;  4IBR A;  2C6W B;  4F94 A;  5DTS A;  3S22 A;  3CZD A;  1W8Y A;  4OQ0 A;  1QME A;  4ZJ3 A;  3OZH A;  1PI5 A;  3HUN A;  3HUM A;  2Q9M A;  3A3F A;  2Y2K A;  1MWT A;  5I94 A;  5EVI A;  1E3U D;  2R9X A;  2Y4A A;  5GLB A;  3ZVT A;  3C4O A;  2A49 A;  3PBN A;  4BL2 A;  4S2N C;  1K55 C;  4IED A;  2XD5 A;  2EFX A;  4R0Q A;  5CEB A;  5GHX A;  3UY6 A;  2OLV A;  3G31 A;  1WYC A;  4BJP A;  5HL1 A;  4N9K A;  1W7F A;  5FI6 A;  4MBH A;  3BEB A;  2XLN A;  4NET A;  2ZQ7 A;  3FZC A;  3V39 A;  3BYD A;  1NYY A;  3WS5 A;  5DTT A;  1XXM A;  3TOI A;  2Y2Q A;  1KE4 A;  4OOY A;  4PMA A;  2ZQ8 A;  2JE5 A;  3S4X A;  4KG2 A;  1I2S A;  1K38 A;  1DY6 A;  4P6B A;  3VP1 A;  3VMA A;  2ZJ9 A;  1YLT A;  5DVA A;  1BLH A;  1XA7 A;  3SH9 A;  3IF5 A;  3DWZ A;  5CGW A;  3ITB A;  5CHU A;  3VFH A;  5F1F A;  1XPB A;  3B3X A;  1GHP A;  4QD4 A;  1YLP A;  3MFD A;  3IH9 A;  3NDE A;  4GD6 A;  5E2H A;  3BFG A;  4P0M A;  1LLB A;  3VOY A;  2P9V B;  3IQA A;  4IVK A;  1FOF A;  3BFD A;  3GR2 A;  4ZTK A;  5A91 A;  3SH7 A;  3V3R A;  2CC1 A;  3IH8 A;  1XKZ A;  1LI0 A;  4N1H A;  2WAD A;  2OSU A;  4GNU A;  4WBG A;  4KZ5 A;  1XP4 A;  2HDS A;  5FQ9 A;  5GHY A;  2J9O A;  1ES2 A;  3CJM A;  4M3K A;  3VP0 A;  3VP3 A;  4Y0O A;  2ZC6 B;  3UPP A;  3ZG7 B;  3ISG A;  3WS0 A;  4OP8 A;  1KVM A;  3S1Y A;  3G2Z A;  3N7W A;  2ZC5 B;  3NIA A;  4KZA A;  3WS1 A;  3OCL A;  4BEN A;  4JF4 A;  3WS4 A;  4A5R A;  2XQZ A;  3D4F A;  4GOG A;  3MZF A;  4FCF A;  3RJU A;  1MXO A;  1SCW A;  3O86 A;  5CER A;  3NCK A;  2ZM8 A;  3UPO A;  1ZG4 A;  4X69 A;  4JLF A;  4GN2 A;  1PZP A;  2JCH A;  3PAG A;  4FD8 A;  4HES A;  1BT5 A;  3MBZ A;  1DJB A;  3E2L A;  3C7U A;  5CTM A;  4D2O A;  1FR6 A;  4U0T A;  1HVB A;  2B5R A;  2IWD A;  3IXH A;  4L0L A;  4WM9 A;  4PPR A;  1TVF A;  5AQA A;  4DDS A;  1K57 A;  4RA7 A;  4DE0 A;  1JWP A;  2Y2I A;  1TEM A;  3OPL A;  4KQQ A;  1PWD A;  4UA7 A;  2ZQA A;  5EOE A;  5FI2 A;  4R23 A;  3PBS A;  3P09 A;  4R1G A;  2Y91 A;  3N8R A;  5JYP A;  1HTZ A;  5CGS A;  3VSK A;  1NZU A;  3LEZ A;  4Y0U A;  5FAQ A;  5TGF A;  3LCE A;  5JYO A;  3A3I A;  3NC8 A;  1K54 C;  2Y2G A;  1JTD A;  2XFS A;  3JYI A;  4XUZ A;  3BFF A;  2HDU A;  3HBR A;  3WWX A;  2G2W A;  3BEC A;  1IEL A;  1QMF A;  1PZO A;  4NK3 A;  3NI9 A;  4C6Y A;  4EBN A;  4OPR A;  4OVD A;  1ERM A;  2OLU A;  1Q2P A;  4N9L A;  4K91 A;  2ZC7 A;  2XGN A;  4ID4 A;  5HAP A;  1JWZ A;  1W8Q A;  3Q82 A;  2HP6 A;  1IEM A;  1I5Q A;  3GRJ A;  2XK1 A;  3O3V A;  4B4Z A;  4KZ9 A;  2WAE A;  1BZA A;  3HVF A;  2WAF A;  1K6S A;  3PBO A;  3G34 A;  4N92 A;  4BQM A;  4LV3 A;  3UN7 A;  4FH2 A;  1LHY A;  3BLM A;  1WE4 A;  4X6T A;  1FQG A;  2WGW B;  3Q07 A;  3IHA A;  3M2J A;  3QHY A;  4P85 A;  1EI5 A;  3BM6 A;  4UA6 A;  2XEP A;  3DW0 A;  1MWU A;  4OLD A;  5HFO A;  1ALQ A;  1GA0 A;  5FQM A;  5M18 A;  4LV1 A;  3Q7V A;  4R4S A;  4JXS A;  5U47 A;  4OOL A;  3UE0 A;  4CPK A;  1VM1 A;  4QY5 A;  5KSC A;  4DRT A;  1MWR A;  5FAS A;  2DRW A;  4DE3 A;  2ZC4 B;  3O88 A;  4YFM A;  1FCO A;  4DDY A;  5FQQ A;  1GHM A;  4OQG A;  3LY3 A;  4UHU A;  4FSF A;  5KSH A;  2EFU A;  1HZO A;  3BLS A;  1N9B A;  4EBL A;  1LL9 A;  3PTE A;  4JXV A;  5F83 A;  2WZZ A;  1ZG6 A;  3N4I A;  1BUL A;  1YM1 A;  5A92 A;  4WMC D;  2Y2H A;  2ZLY A;  3A3J A;  4IVI A;  3W8K A;  2H0T A;  5EUA A;  3VOZ A;  3WS2 A;  3PAE A;  3Q1F A;  2RCX A;  2WZX A;  5F82 A;  5GHZ A;  1Q2Q A;  4Y0T A;  5FAO A;  1BLC A;  1LL5 A;  1YLY A;  2PU2 A;  3ZNT A;  1H8Y A;  1M6K A;  4C3Q A;  1FSW A;  2BG1 A;  4OQH A;  3NBL A;  5DF8 A;  2EXB A;  4PM5 A;  3MXR A;  4E3N A;  2E8I A;  3GMW A;  4ZBE A;  2A3U A;  3GV9 A;  3ZHH A;  2XF3 A;  1E3U A;  3DTM A;  3G35 A;  3CG5 A;  5FI7 A;  2V20 A;  3M6H A;  1BUE A;  4KZ3 A;  4JF5 A;  1H5X A;  2R9W A;  3QNB A;  1PIO A;  2P9V A;  3IWI A;  4S2P A;  3SOI A;  1U60 A;  3IF6 A;  1ESI A;  1FSY A;  1CI8 A;  3PBQ A;  2P74 A;  4R3J A;  5EVL A;  2ZQC A;  1ES5 A;  3HLF A;  4MEZ A;  4MBF A;  2EXA A;  3RXW A;  3M2K A;  4KZ8 A;  5AQ9 A;  4S2L A;  3ZFZ A;  4S2N A;  1K55 A;  4K0W A;  4HBT A;  4E3M A;  1ERO A;  2EX8 A;  4OPY A;  2BLS A;  2HP5 A;  2ZM0 A;  4R4R A;  4R3B A;  3N8L A;  3HLB A;  1L0D A;  5FQI A;  4BD1 A;  1YLW A;  1ZC2 A;  5L2F A;  1CEF A;  2QMI A;  1K57 C;  4EBP A;  3FWL A;  3V50 A;  3W4Q A;  1W5D A;  3QNC A;  4DXB A;  4X55 A;  4RYE A;  5TR7 A;  2DNS A;  5E2F A;  3HRE A;  3VP4 A;  2WGI A;  4GDB A;  2OV5 A;  4FH4 A;  5KMW A;  3PBR A;  5TFQ A;  3UPN A;  3UNW A;  3OCN A;  4S2O A;  3DWK A;  3ZG8 B;  4Q8I A;  2ZM2 A;  3FKV A;  2XR0 A;  1AXB A;  1O7E A;  3OPP A;  1CK3 A;  5E2E A;  2Z2M B;  4GB7 A;  3GSG A;  3N6I A;  3Q81 A;  1IYO A;  4GDN A;  5FDH A;  2XDM A;  1O07 A;  2WKH A;  4U3T A;  3GTC A;  1MWS A;  4MNR A;  4ZAM A;  1Y54 A;  3C7V A;  3ZG0 A;  4JBF A;  3LO7 A;  5BOH A;  4O7D A;  4CJN A;  2HPB A;  2WKE A;  4KZB A;  3ZG9 B;  5HAR A;  3VP2 A;  1KGF A;  1XA1 A;  4IBX A;  2J8Y A;  5IHV A;  4KZ6 A;  1YLJ A;  1KDS A;  1C3B A;  3UE3 A;  2HP9 A;  4JXG A;  3G4P A;  1KDW A;  2H10 A;  2ZQD A;  3M6B A;  3EQV A;  2Q9N A;  1ONH A;  4DF6 A;  5GLA A;  3FKW A;  1MKI A;  1WYB A;  3HUO A;  3UDI A;  5FAP A;  2VGJ A;  2H0Y A;  4LV2 A;  5CHM A;  5E2G A;  1K6R A;  1NZO A;  4ZDX A;  1K56 D;  2GDN A;  5EVI C;  5CED A;  2VGK A;  5CXW A;  3AGE A;  2Y2J A;  4E3O A;  3ZVW A;  3ZG5 A;  1PWC A;  1L0G A;  4GKU A;  1IKI A;  2WGW A;  4LCM A;  4ZJ1 A;  1BLS A;  3O87 A;  5G18 A;  1BLP A;  2QZ6 A;  5EVI D;  2PU4 A;  1M40 A;  3UE1 A;  2V2F F;  4LV0 A;  4X53 A;  2XFT A;  3HLC A;  3A3E A;  3C5A A;  1YQS A;  4UAA A;  4WZ5 A;  2RL3 A;  1IYQ A;  1PYY A;  5HAI A;  1XGJ A;  3IXD A;  1K54 A;  5DF7 A;  3OPH A;  1ERQ A;  1S6R A;  1ONG A;  4DKI A;  4HBU A;  4KG5 A;  5EPH A;  3EQU A;  1VQQ A;  1RCJ A;  1E4D A;  3CMZ A;  3MKE A;  3IWO A;  3PBT A;  4HEF A;  4UA9 A;  2HDR A;  4KEN B;  5E43 A;  3HL9 A;  5EE8 A;  4EQI A;  1NXY A;  1G6A A;  1ES4 A; 
#chains in the Genus database with same CATH topology
 1PWG A;  1DP6 A;  4E3L A;  2J9P A;  4GD8 A;  3E4P A;  3SW1 A;  4GS9 B;  1CEG A;  3MKF A;  3JVU A;  4QJG A;  3C4P A;  4E3I A;  2DMW A;  1GCE A;  2PR6 A;  5CTN A;  1HD8 A;  2K7S A;  2WUQ A;  4WMC A;  3UME A;  1K4F A;  1L2S A;  4I3I A;  3GEC A;  4QY6 A;  5J4E A;  1N9N A;  2P04 A;  1RGY A;  3E98 A;  3IWQ A;  2O9C A;  1MPL A;  1GSV A;  2JKR M;  1K25 A;  1NLZ A;  3H82 B;  2ZBB A;  4GHI A;  4MN5 A;  5LBR A;  3P7N A;  4XXR A;  3BRM A;  3VV4 A;  4PM7 A;  3G2Y A;  3NHQ A;  4I3A A;  3ITA A;  5I5L A;  1OT6 A;  4BL3 A;  1SDE A;  5EOO A;  3RXX A;  4JPM A;  3VOL A;  1GHI A;  1FCN A;  2E8J A;  2VGL S;  4WZ4 A;  3G32 A;  1MBL A;  3LY4 A;  4OQI A;  5C5K A;  1N9O A;  1Z6F A;  5DF9 A;  4LCL A;  1KE0 A;  4KG6 A;  2Q0O A;  3C38 A;  3SS5 A;  1NLY A;  4R3A A;  2VA0 A;  5A93 A;  2H5S A;  3E2K A;  1DP9 A;  4QB8 A;  4JGR A;  2PBY A;  5HDC A;  4LEN A;  3E4Q A;  1TDL A;  1P9R A;  4WEK A;  3UB6 A;  3UO9 A;  4GW9 A;  2Y59 A;  4IJG A;  2NUT C;  4MLL A;  4ETZ A;  3HLW A;  2JKF A;  4KZ7 A;  5KZH A;  4YOF A;  5AJG A;  3PHY A;  1YPR A;  3FYZ A;  1VEU B;  2ZOH A;  4JXW A;  3SH8 A;  4XT2 A;  1PI4 A;  4DE2 A;  3KYZ A;  3NY4 A;  2Y2N A;  1TF1 A;  3VSL A;  2W1T A;  1G68 A;  3B47 A;  4DE1 A;  1V9Y A;  1XGI A;  4F94 A;  3Q7V B;  4IBR A;  2V1A A;  3S22 A;  1IFQ A;  3EGD C;  3F1P B;  4M4X A;  1YSP A;  4FOF A;  2Q9M A;  5HWV A;  2KDK A;  2R9X A;  3ZVT A;  5GLB A;  4BL2 A;  3PBN A;  2CMN A;  3MS6 A;  1W7F A;  4N9K A;  3BEB A;  2XLN A;  2ZQ7 A;  3T4S A;  1NYY A;  1XXM A;  2Y2Q A;  3G6O A;  2R78 A;  1T1B A;  2JE5 A;  1V9Z A;  3S4X A;  4KG2 A;  5DVA A;  3SH9 A;  4EW7 A;  5F1F A;  1XPB A;  4MN7 A;  4NEE D;  5F68 A;  3BFG A;  2P9V B;  3IQA A;  4ZTK A;  3V3R A;  3GR2 A;  3NOU C;  1LI0 A;  2VV8 A;  2OSU A;  4WBG A;  4NKP A;  5FQ9 A;  4M3K A;  2ZC6 B;  4OP8 A;  1KVM A;  3N7W A;  2ZC5 B;  3BQ8 A;  5DFX A;  2VK3 A;  4A5R A;  3T4T A;  3MZF A;  3O86 A;  1ZG4 A;  4JLF A;  4FD8 A;  4HES A;  3E2L A;  3C7U A;  5CTM A;  4HQA A;  4U0T A;  3IXH A;  4L0L A;  5AQA A;  4PPR A;  1T19 A;  1AWI A;  3DTI A;  1X0O A;  3S7P A;  3F1O B;  4KQD A;  1H8M A;  1HLU P;  5CGS A;  3VSK A;  1NZU A;  4Y0U A;  5F6A A;  3HJK A;  2Y2G A;  1JTD A;  3IBJ A;  1PZO A;  3S7Q A;  3NI9 A;  4EBN A;  3OOV A;  2OLU A;  4N9L A;  4K91 A;  5HWT A;  2ZC7 A;  5HAP A;  4ID4 A;  1W8Q A;  3LEQ A;  1IEM A;  4B9O A;  2WAE A;  1BZA A;  3HVF A;  3W2Z A;  3PBO A;  1FIK A;  1LHY A;  1FQG A;  2BAS A;  1EI5 A;  2XEP A;  3MXQ A;  3DW0 A;  5HFO A;  4CLC D;  2J80 A;  1MWR A;  4ETX A;  5FAS A;  2PDR A;  3MFX A;  5KIZ A;  1JNU A;  1MZU A;  4UHU A;  3PTE A;  5F83 A;  1ZG6 A;  5IT5 A;  2Y2H A;  2ZLY A;  3R7W A;  2H0T A;  5EUA A;  3WS2 A;  2RCX A;  5GHZ A;  1Q2Q A;  1PRQ A;  3ZNT A;  4C3Q A;  4OQH A;  3MXR A;  2VGL M;  4E3N A;  2PR5 A;  3NOT C;  2A3U A;  2IA2 A;  4ZBE A;  3ZHH A;  1E3U A;  2LB5 A;  3CG5 A;  1D06 A;  2VZW A;  3M6H A;  4JF5 A;  2R9W A;  3SOI A;  1PIO A;  1CQA A;  3IWI A;  1ESI A;  3PBQ A;  3H82 A;  1SKO B;  5EVL A;  2ZQC A;  1ES5 A;  3HLF A;  4MEZ A;  3K3C A;  3M2K A;  4S2L A;  1EW0 A;  1PNE A;  2EX8 A;  2PD8 A;  3N8L A;  5FQI A;  1L0D A;  4BD1 A;  2VJW A;  2NUP C;  5L2F A;  2QMI A;  4I39 A;  3V50 A;  3W4Q A;  4RYE A;  1S1Y A;  5E2F A;  5KMW A;  3MMH A;  2MJ6 A;  2JKT M;  3OCN A;  4I5S A;  3ZG8 B;  1G6O A;  2XR0 A;  1AXB A;  3T1R A;  2V0U A;  4G3V A;  5E2E A;  5HZH A;  2Z2M B;  1XJ4 A;  2XDM A;  1MWS A;  1Y54 A;  2M1C A;  4JBF A;  3LO7 A;  2GX5 A;  4NXF A;  5HAR A;  1KGF A;  2M7U A;  2HP9 A;  3MQQ A;  1KDW A;  2ZQD A;  2Q9N A;  5FAP A;  1K56 D;  3IBR A;  3CPT A;  3AGE A;  2Y2J A;  4YWZ A;  1PWC A;  1L0G A;  1XFN A;  1BLS A;  1M40 A;  4HI4 A;  2K2N A;  4HP4 A;  3F1P A;  4WZ5 A;  1IYQ A;  5HAI A;  3OPH A;  4DKI A;  1S6R A;  5EPH A;  2Z6D A;  1G6A A;  2W1T B;  1YMS A;  1DJC A;  2Z6C A;  1IKG A;  3BQA A;  2B95 A;  2EWV A;  2ZC3 B;  3CUE C;  4H8R A;  1BSG A;  3B33 A;  5F1G A;  2JKT I;  1RGZ A;  1H0M A;  4GZB A;  4PM6 A;  1TD5 A;  4O0P A;  4E6X A;  1TDG A;  2QJ7 A;  1T1A A;  3VE3 A;  1TS6 A;  4S2K A;  3ZNY A;  3DAV A;  5HL6 A;  1I2W A;  1OJ5 A;  2V1Z A;  5GL9 A;  1UWP X;  1H8Z A;  3TSG A;  3IHB A;  5D3O A;  2Y55 A;  4RX2 A;  1SHV A;  5DTK A;  4BWI A;  4EV4 A;  4LGW A;  3P98 A;  2Y2L A;  5FQJ A;  4IUK A;  2FZ0 A;  2IWC A;  5L10 A;  5CRF A;  2WKI A;  5A90 A;  4WEL A;  4OP5 A;  2WGV A;  1JWV A;  3U4L P;  2PHY A;  3SS3 A;  4WUJ A;  5HPF A;  1IYS A;  3WRZ A;  3DTE A;  3OC2 A;  3NDG A;  1KOU A;  3MJQ A;  3D72 A;  5J8X A;  4MDZ A;  3A0V A;  1PW1 A;  3WRT A;  3HLE A;  5AQB A;  4E6W A;  1KGE A;  1H3Q A;  1JVJ A;  3NJA A;  2QKP A;  1NYM A;  4OLG A;  4EU0 A;  4AFI A;  5M1A A;  4LRZ E;  3HLD A;  4NXG A;  3MZD A;  4WL9 A;  5CHJ A;  4KZ4 A;  1GA9 A;  3SS4 A;  3AGF A;  4HHD A;  4WZ5 C;  3BFC A;  4OH0 A;  1UWN X;  4PM8 A;  4Y15 A;  3LI9 A;  2EA9 A;  3G30 A;  2FFY A;  4FUW A;  5CGX A;  4OPQ A;  4PKY A;  4ARZ B;  5DKK A;  4OON A;  4F3L A;  2UWX A;  2XH9 A;  1E25 A;  2O9A A;  2W0N A;  4XUX A;  3IX3 A;  5GLD A;  2V8F A;  1NY0 A;  5GLC A;  4EWF A;  4BLM A;  5DTS A;  4HNB A;  5I94 A;  2Y2K A;  1MWT A;  1Z09 A;  5EVI A;  2Y4A A;  2A49 A;  4S2N C;  2AVX A;  4IED A;  2EFX A;  5CEB A;  3T50 A;  2OLV A;  1S4S A;  4BJP A;  5FI6 A;  2PT7 A;  2L1M A;  3V39 A;  1J3W A;  3R7W B;  1LSW A;  1GSW A;  2BTF P;  4PMA A;  2ZQ8 A;  1K38 A;  1SKO A;  1YLT A;  1XA7 A;  4EET B;  5CGW A;  3B3X A;  1DRM A;  1YSQ A;  3MFD A;  3NDE A;  5E2H A;  1LLB A;  2V8C A;  3VOY A;  3GDI A;  3D9Y A;  4MMN A;  4N1H A;  3S7O A;  4GNU A;  2O9B A;  2KOI A;  4H6J A;  5GHY A;  3VP0 A;  3KSI A;  3MF0 A;  2W3H A;  3B42 A;  4X1L A;  3S1Y A;  3G2Z A;  3WS1 A;  4BEN A;  1TS7 A;  3LFV A;  4FCF A;  1D1J A;  3RJU A;  1MXO A;  1SCW A;  5CER A;  2ZM8 A;  3RFB A;  2JCH A;  3MBZ A;  4Y2F A;  3PXP A;  1HVB A;  4KQQ A;  1TEM A;  3QP8 A;  4DMZ A;  2J3T C;  3P09 A;  1HTZ A;  4Y3I A;  5FAQ A;  5TGF A;  3C8C A;  5JYO A;  3NC8 A;  4PAU A;  2Y79 A;  2PD7 A;  2HDU A;  3WWX A;  3BEC A;  2VX8 A;  2VLG A;  1QMF A;  2JKG A;  4NK3 A;  2W1R A;  1ERM A;  3Q82 A;  2HP6 A;  1I5Q A;  3T4Q A;  4L9F A;  3CPT B;  1YAX A;  4N92 A;  3UN7 A;  3E4O A;  3LGO A;  4X6T A;  1WE4 A;  2LB9 A;  3QHY A;  3M2J A;  4ZRR A;  1MWU A;  2JKR I;  1ALQ A;  1GA0 A;  5M18 A;  4LV1 A;  4JXS A;  3UE0 A;  1DP8 A;  3LIA A;  4YFM A;  1FCO A;  5KSH A;  3BLS A;  4EBL A;  1LL9 A;  3N4I A;  1BYW A;  2VV6 A;  5A92 A;  1F5M A;  4IVI A;  3W8K A;  3Q1F A;  2JN7 A;  2WZX A;  2VKS A;  3EEH A;  5FL3 A;  3T12 B;  4EER A;  1XFQ A;  1BLC A;  1T18 A;  1W63 M;  3A0R A;  1G28 A;  2EXB A;  3S7N A;  3JPU A;  2V20 A;  4KZ3 A;  1BUE A;  1OTD A;  1H5X A;  3VP4 A;  1XJ2 A;  1CI8 A;  4R3J A;  3LR3 A;  5J3W A;  1VHM A;  1LT0 A;  4MBF A;  5IS1 A;  3RXW A;  5AQ9 A;  1K55 A;  4K0W A;  4E3M A;  1ERO A;  4OPY A;  2BLS A;  4R4R A;  4GCZ A;  1YLW A;  1ZC2 A;  3IX4 A;  1P97 A;  3FWL A;  4DXB A;  3QNC A;  2WGI A;  2OV5 A;  3PBR A;  5AVF A;  4Q8I A;  3F1N A;  4NG2 A;  1CK3 A;  4LRX C;  3N6I A;  3Q81 A;  3UB5 P;  1IYO A;  4GDN A;  3LR4 A;  5DJT A;  4MNR A;  3ZG0 A;  5EM1 A;  2HPB A;  5F69 A;  4KZB A;  4FTX A;  3T4J A;  1TS8 A;  5TBM A;  2J8Y A;  5IHV A;  4KZ6 A;  1KDS A;  4BMW A;  5GLA A;  3FKW A;  3UDI A;  4LPZ A;  5DJU A;  5CHM A;  5E2G A;  4ARZ A;  4ZDX A;  2PYR A;  2VGK A;  5CXW A;  4L9G A;  4GKU A;  2WGW A;  4LCM A;  3O87 A;  1BLP A;  4MN6 A;  5HDS A;  2V2F F;  1STZ A;  4LV0 A;  1OTA A;  3HLC A;  1F98 A;  4F3L B;  1PYY A;  3IXD A;  1K54 A;  5DF7 A;  1ERQ A;  4HJ4 A;  4HBU A;  3T1S A;  3EQU A;  3CMZ A;  3MKE A;  4HEF A;  1ZHH B;  2HDR A;  5E43 A;  4EQI A;  4HY8 A;  4EUZ A;  1OPX A;  1LI9 A;  2ZMV A;  4B88 A;  1N4O A;  3VE4 A;  4E3J A;  2IWB A;  1S0W A;  2EX2 A;  4KQO A;  4YIN A;  3IT9 A;  5IU1 A;  4Z9Q A;  5EVI B;  5AVE A;  3OPR A;  3KO6 A;  4CLC A;  2B18 A;  1FR1 A;  3IXG A;  1YKD A;  4OKP A;  2JC7 A;  4U0X A;  4HOI A;  2C5W B;  1YT4 A;  3H7W A;  3ULF A;  2ZQ9 A;  3A3D A;  3H9W A;  4DN0 A;  4I3J A;  3CIT A;  1OTI A;  3EOI A;  4RVA A;  2I9V A;  1PW8 A;  2HDQ A;  2WYX A;  2Y2O A;  3L7H A;  4R6L A;  4DXC A;  1MY8 A;  3CAX A;  3IF6 B;  4P87 A;  1TS0 A;  3ICY A;  1MC0 A;  4QHC A;  5FQK A;  4H6J B;  4X56 A;  1YMX A;  4K0X A;  2X71 A;  2HJ9 C;  3RTY A;  1JTG A;  2B02 A;  3ZGA B;  1LL8 A;  3BY9 A;  1XX2 A;  3QP5 A;  1GSX A;  3OLO A;  4B4X A;  1OTB A;  5M19 A;  3L9K A;  3ZQ5 A;  5CEC A;  2QJ5 A;  3QP4 A;  2X02 A;  2DCF A;  2QPN A;  5FEG A;  2GJ3 A;  2JBF A;  2W3E A;  2X01 A;  2PYP A;  3GQZ A;  4WEJ A;  4OOM A;  4E3K A;  4G3W A;  4PHT A;  1EWZ A;  2J3W A;  4KQR A;  1OTE A;  2Y2M A;  4CLC E;  1S1Z A;  2QYB A;  2EX6 A;  5HW3 A;  4ESP A;  4JKT A;  3MQ0 A;  5TJJ A;  4S2J A;  2L0W A;  5FAT A;  3VFF A;  1K56 A;  3PR6 A;  2A24 A;  1J9M A;  3A0S A;  4BBU A;  2C6W B;  2W3G A;  3CZD A;  2HJE A;  4Y5F A;  3OZH A;  1PI5 A;  1ODV A;  3HUM A;  3FPW A;  4KUK A;  4Q0J A;  4Y13 A;  3C4O A;  4G3K A;  1A0K A;  3T4L A;  1WYC A;  3ZYT A;  4NET A;  3BYD A;  4D60 A;  1KE4 A;  4I38 A;  4OOY A;  2V1B A;  5J7E A;  1DY6 A;  4P6B A;  3IF5 A;  3DWZ A;  4UEY A;  3ITB A;  3TRC A;  4UQI S;  1YLP A;  3KYQ A;  4HIA A;  4IVK A;  1FOF A;  3BFD A;  3IH8 A;  3LIC A;  1XKZ A;  5HD3 A;  1XP4 A;  3CLO A;  2HDS A;  2J9O A;  1ES2 A;  2G7U A;  3ZG7 B;  3ISG A;  4KZA A;  4E04 A;  3OCL A;  1G5U A;  4JF4 A;  3WS4 A;  1F9I A;  3D4F A;  4GOG A;  3UPO A;  4X69 A;  1Y4O A;  1PZP A;  3PAG A;  1BT5 A;  3F1N B;  4QPR A;  4D2O A;  2KLI A;  2O0Y A;  4RA7 A;  4DE0 A;  1JWP A;  3OPL A;  1PWD A;  1UGU A;  3BWL A;  5EOE A;  3EGX C;  1W63 Q;  4Z1W A;  2KX6 A;  5G4Z A;  5JYP A;  3N8R A;  3T1Q B;  3LEZ A;  4Q0I A;  2W3F A;  3A3I A;  2XFS A;  2J3T D;  3JYI A;  3BFF A;  2G2W A;  3C2W A;  5TBM B;  3LUQ A;  4MCW A;  4EUV A;  5FEF A;  4OVD A;  3FPV A;  3PYP A;  1ZTU A;  2XGN A;  4ME4 A;  2EWW A;  3GRJ A;  2XK1 A;  1L3L A;  4RQ9 A;  4X1M A;  2WGW B;  4P85 A;  2OOL A;  3BM6 A;  5FQM A;  5U47 A;  1VM1 A;  3MR0 A;  4QY5 A;  5KSC A;  4BBV A;  4DE3 A;  5FQQ A;  2EFU A;  4R38 A;  1N9B A;  3DTK A;  2YKH A;  2OWJ A;  4EXO A;  4JXV A;  1SZV A;  4WMC D;  2ZMF A;  3VOZ A;  4WLA A;  4R70 A;  4CLC B;  1YLY A;  5DFY A;  1P0Z A;  1XJ6 A;  1H8Y A;  2PRF A;  1FSW A;  2BG1 A;  3IX8 A;  3NBL A;  3C30 A;  2E8I A;  5DKL A;  2XF3 A;  3MQO A;  3H7W B;  3G35 A;  4BBT A;  3QNB A;  1U60 A;  3IF6 A;  2P74 A;  2EXA A;  2M7V A;  3ZFZ A;  5HWW A;  3JVV A;  3T4O A;  2HP5 A;  2ZM0 A;  4R3B A;  3QP1 A;  3HLB A;  2PBD P;  5CX7 A;  4EBP A;  5TR7 A;  3HRE A;  1CF0 A;  4GDB A;  3V67 A;  5TFQ A;  3UPN A;  1WA9 A;  4S2O A;  4LFU A;  3NUL A;  3CI6 A;  4WN5 A;  2YKF A;  5FDH A;  1O07 A;  2WKH A;  3GTC A;  4ZAM A;  5BOH A;  4O7D A;  3BJN A;  2HZ5 A;  3LR5 A;  1S4R A;  3DBA A;  3ZG9 B;  1LSX A;  3VP2 A;  1XA1 A;  4IBX A;  2XSS A;  1YLJ A;  2A2L A;  4K08 A;  3UE3 A;  3T1X A;  4JXG A;  3G4P A;  2OAQ 1;  3M6B A;  1ACF A;  1MKI A;  1WYB A;  2GNX A;  3HUO A;  2VGJ A;  2H0Y A;  4LV2 A;  1K6R A;  1NZO A;  5EVI C;  3ZVW A;  3ZG5 A;  1IKI A;  1D7E A;  2QHK A;  2QZ6 A;  2PU4 A;  3UE1 A;  2ZL1 A;  2XFT A;  2O99 A;  3A3E A;  3C5A A;  1YQS A;  1IOU A;  3KSH A;  2RL3 A;  1XGJ A;  4UQI M;  1ONG A;  4KG5 A;  4LLO B;  3PBT A;  1RCJ A;  3UMD A;  1S67 L;  5EE8 A;  3DWK A;  1NXY A;  1ES4 A;  2A24 B;  1L0F A;  2WKP A;  2XA7 M;  2L4R A;  4RX3 A;  1KGG A;  3IF6 C;  3IS2 A;  4QU3 A;  4HH2 A;  3U2A A;  2H28 A;  1ES3 A;  4JGQ A;  2ACG A;  4X68 A;  1NJ4 A;  5EEC A;  4WF0 A;  2GZA A;  3RH8 B;  4S2I A;  3I7J A;  4L9E A;  5AQ7 A;  3V5M A;  3IXB A;  4QWO A;  3ZCZ A;  3ZDJ A;  3V3S A;  2INW A;  3TW8 A;  3TJZ C;  2ZD8 A;  3HCY A;  3Q7Z A;  4JF6 A;  4S2M A;  2HV1 A;  1OME A;  3UB7 A;  4O01 A;  2Z2L B;  4WYY A;  5EFW A;  2W27 A;  4NXE A;  3W4P A;  1FCM A;  2G2U A;  3D3O A;  2XRN A;  3N8S A;  4BD0 A;  3BW6 A;  2J7V A;  1DJA A;  2UV0 E;  3UDF A;  2P7J A;  3FV7 A;  4N1X A;  1KVL A;  3CWF A;  1SDN A;  3UDX A;  3MSH A;  5HAQ A;  1LSV A;  1NWZ A;  2WK0 A;  3BFE A;  4MBK A;  5HD5 A;  3HLG A;  1IYP A;  3MZE A;  2OWH A;  3LYX A;  4P6Z S;  1NRF A;  4C75 A;  5L09 A;  1BTL A;  1W79 A;  3MXS A;  1SKF A;  4CQH A;  5HX9 A;  3W4O A;  1K4E A;  1YLZ A;  4OPZ A;  4HJ6 A;  4O8G A;  1NRJ A;  2QWS A;  2I72 A;  4LRY C;  3K2N A;  3GVB A;  1CI9 A;  4Y7P A;  1ESU A;  4PM9 A;  2WKQ A;  4YNR A;  1KE3 A;  5F5Y A;  3TG9 A;  2Y2P A;  1L0E A;  3CHW P;  1ZKJ A;  2EX9 A;  1K0K A;  1FIL A;  5FSR A;  3T4K A;  4II7 A;  5FA7 A;  1RP5 A;  4ZJ2 A;  1VET A;  2XD1 A;  2FFF B;  2ZMA A;  3AGD A;  1Y28 A;  2JHE A;  1W8Y A;  4OQ0 A;  1QME A;  1F2K A;  4ZJ3 A;  3BY8 A;  3HUN A;  3A3F A;  1E3U D;  4Q0H A;  1N9L A;  1K55 C;  2XD5 A;  4R0Q A;  5GHX A;  5HPI A;  3UY6 A;  2D02 A;  1MKM A;  5L07 A;  3G31 A;  3LIE A;  5HL1 A;  4MBH A;  4GS9 A;  3FZC A;  3WS5 A;  5DTT A;  3TOI A;  1VB6 A;  1I2S A;  1S66 L;  3VP1 A;  3VMA A;  3LIB A;  2ZJ9 A;  1BLH A;  3HJI A;  5CHU A;  3VFH A;  2K31 A;  1GHP A;  4QD4 A;  3IH9 A;  4GD6 A;  4P0M A;  5A91 A;  3SH7 A;  1OT9 A;  2CC1 A;  2WKR A;  3CUE A;  2WAD A;  4HP9 A;  4KZ5 A;  2ZOI A;  3VP3 A;  3CJM A;  4Y0O A;  3UPP A;  4JGP A;  3UB9 A;  3WS0 A;  2V0W A;  3NIA A;  5G4Y A;  2XQZ A;  4GHI B;  3NCK A;  3FG8 A;  4GN2 A;  1DJB A;  4HJ3 A;  4IUH A;  3KSF A;  1FR6 A;  3KYE A;  2B5R A;  2IWD A;  4WM9 A;  4DDS A;  4EEU A;  1TVF A;  2FH5 A;  1K57 A;  3K3D A;  2Y2I A;  4UA7 A;  2ZQA A;  5FI2 A;  3O5Y A;  2V9A A;  4R23 A;  3PBS A;  4R1G A;  2Y91 A;  3LCE A;  3UB8 A;  1K54 C;  2Y8H A;  2D01 A;  4XUZ A;  3HBR A;  1IEL A;  4C6Y A;  4OPR A;  1Q2P A;  1JWZ A;  2P08 A;  3O3V A;  4B4Z A;  4KZ9 A;  1VEU A;  1K6S A;  2WAF A;  3G34 A;  4BQM A;  4CLC C;  4LV3 A;  3LID A;  4FH2 A;  4DJ2 A;  3LR0 A;  3BLM A;  2VEA A;  4NXB A;  3IHA A;  3Q07 A;  3P01 A;  4UA6 A;  4OLD A;  1XJ3 A;  2OAP 1;  2ZL1 B;  3Q7V A;  4R4S A;  2PAV P;  5HDD A;  4OOL A;  4CPK A;  4DRT A;  5EM0 A;  1T1C A;  4XT2 B;  2DRW A;  3R4K A;  3NEC A;  5FDS A;  2ZC4 B;  3O88 A;  4DDY A;  1GHM A;  3QP2 A;  4OQG A;  3LY3 A;  4FSF A;  4Y17 A;  1HZO A;  3EWK A;  3KSG A;  2WZZ A;  1BUL A;  1YM1 A;  3A3J A;  3IS2 B;  3OBF A;  3EEA A;  3PAE A;  5F82 A;  4Y0T A;  5FAO A;  1LL5 A;  5A8B A;  2PU2 A;  3NOP C;  1M6K A;  4PM5 A;  5DF8 A;  3FC7 A;  3GMW A;  3GV9 A;  3DTM A;  5FI7 A;  4S2P A;  2P9V A;  4HH3 A;  1FSY A;  4PKY G;  2XRO A;  4P6Z M;  2XA7 S;  4KZ8 A;  2HGV A;  4S2N A;  4GJ4 A;  4HBT A;  1OJG A;  3SZT A;  1CEF A;  4KUO A;  1K57 C;  1W5D A;  4X55 A;  2DNS A;  4FH4 A;  4B93 A;  1P9W A;  3UNW A;  2W3D A;  2ZM2 A;  3FKV A;  1O7E A;  3OPP A;  2HF6 A;  4GB7 A;  3GSG A;  5EV0 A;  4EQ1 A;  4U3T A;  5K5B A;  3KX0 X;  5EVE A;  3C7V A;  3F1O A;  3QP6 A;  4X25 A;  4CJN A;  2WKE A;  4GLQ A;  2VV7 A;  4EEP A;  3LI8 A;  1C3B A;  3TE8 A;  2H10 A;  4DF6 A;  3EQV A;  1ONH A;  4IHQ A;  3LIF A;  2GDN A;  5CED A;  3UE6 A;  4JGO A;  4DJ3 A;  4E3O A;  4ZJ1 A;  5G18 A;  3E0Y A;  5EVI D;  1PFL A;  4X53 A;  1CJF A;  4UAA A;  5MC7 A;  5L8M A;  1VQQ A;  5HSQ A;  1E4D A;  4EES A;  3IWO A;  4UA9 A;  4KEN B;  3HL9 A;  1VET B; 
#chains in the Genus database with same CATH homology
 1YMS A;  1L0F A;  4EUZ A;  1DJC A;  1LI9 A;  4B88 A;  1PWG A;  1IKG A;  1N4O A;  4E3J A;  4RX3 A;  2IWB A;  1KGG A;  1S0W A;  3IF6 C;  2J9P A;  4QU3 A;  4E3L A;  2EX2 A;  4KQO A;  4YIN A;  3IT9 A;  4Z9Q A;  4GD8 A;  5EVI B;  1ES3 A;  2ZC3 B;  4H8R A;  1BSG A;  4X68 A;  1NJ4 A;  3OPR A;  5F1G A;  1RGZ A;  5EEC A;  1FR1 A;  3IXG A;  4GZB A;  4PM6 A;  4OKP A;  2JC7 A;  4S2I A;  3I7J A;  5AQ7 A;  4E6X A;  1TDG A;  3V5M A;  3IXB A;  4U0X A;  2C5W B;  1YT4 A;  1CEG A;  3MKF A;  4S2K A;  3ZNY A;  3ZCZ A;  3ZDJ A;  3V3S A;  4QJG A;  3C4P A;  4E3I A;  2ZQ9 A;  1I2W A;  2V1Z A;  2ZD8 A;  3A3D A;  1GCE A;  3Q7Z A;  4RVA A;  5GL9 A;  4JF6 A;  5CTN A;  1PW8 A;  4S2M A;  1H8Z A;  1HD8 A;  2HDQ A;  3TSG A;  3IHB A;  2WYX A;  2WUQ A;  5D3O A;  4WMC A;  1OME A;  2Y55 A;  2Y2O A;  1K4F A;  1L2S A;  4QY6 A;  4RX2 A;  1SHV A;  2Z2L B;  5DTK A;  4DXC A;  4EV4 A;  1MY8 A;  4WYY A;  1RGY A;  3IWQ A;  1MPL A;  3P98 A;  2Y2L A;  5FQJ A;  3IF6 B;  1K25 A;  4P87 A;  3W4P A;  1FCM A;  2G2U A;  2IWC A;  4QHC A;  3N8S A;  4BD0 A;  5CRF A;  2WKI A;  2J7V A;  4XXR A;  5A90 A;  3BRM A;  4WEL A;  4OP5 A;  5FQK A;  4X56 A;  4PM7 A;  1DJA A;  3G2Y A;  1YMX A;  2WGV A;  4K0X A;  2X71 A;  3ITA A;  1JWV A;  3SS3 A;  3UDF A;  1IYS A;  3FV7 A;  4BL3 A;  4N1X A;  1KVL A;  3WRZ A;  1JTG A;  3OC2 A;  1SDN A;  3UDX A;  1SDE A;  5EOO A;  3RXX A;  3ZGA B;  5HAQ A;  4JPM A;  3NDG A;  1XX2 A;  1GHI A;  2WK0 A;  1FCN A;  4B4X A;  3BFE A;  5M19 A;  5J8X A;  4MBK A;  4WZ4 A;  3G32 A;  1PW1 A;  5CEC A;  1MBL A;  3LY4 A;  4OQI A;  3WRT A;  3HLG A;  1IYP A;  3HLE A;  3MZE A;  5AQB A;  1Z6F A;  4E6W A;  1KGE A;  1JVJ A;  5DF9 A;  2X02 A;  1KE0 A;  1NYM A;  4KG6 A;  2DCF A;  4LCL A;  4OLG A;  2QPN A;  1NRF A;  4C75 A;  3SS5 A;  5M1A A;  1BTL A;  5A93 A;  1W79 A;  3HLD A;  3MXS A;  1SKF A;  2JBF A;  2H5S A;  3E2K A;  5HX9 A;  3MZD A;  2X01 A;  3W4O A;  5CHJ A;  3GQZ A;  1K4E A;  1YLZ A;  4OPZ A;  4QB8 A;  4WEJ A;  4OOM A;  2PBY A;  4KZ4 A;  4E3K A;  4LEN A;  1GA9 A;  3SS4 A;  3AGF A;  2I72 A;  1TDL A;  4WZ5 C;  3BFC A;  1EWZ A;  4OH0 A;  4PM8 A;  3GVB A;  4KQR A;  4WEK A;  1CI9 A;  3UO9 A;  4Y7P A;  1ESU A;  4PM9 A;  2Y2M A;  2EX6 A;  2Y59 A;  1KE3 A;  4MLL A;  3TG9 A;  5HW3 A;  2Y2P A;  3HLW A;  3G30 A;  1L0E A;  4KZ7 A;  5KZH A;  2FFY A;  1ZKJ A;  3FYZ A;  5CGX A;  4JKT A;  4OPQ A;  2EX9 A;  4OON A;  4JXW A;  3SH8 A;  2UWX A;  1PI4 A;  5FSR A;  4S2J A;  4DE2 A;  2XH9 A;  1E25 A;  3NY4 A;  2Y2N A;  5FA7 A;  4XUX A;  1RP5 A;  5GLD A;  3VSL A;  4ZJ2 A;  2XD1 A;  5FAT A;  1NY0 A;  5GLC A;  3VFF A;  4EWF A;  2FFF B;  2ZMA A;  1G68 A;  1K56 A;  4BLM A;  4DE1 A;  1J9M A;  1XGI A;  3AGD A;  3Q7V B;  4IBR A;  2C6W B;  4F94 A;  5DTS A;  3S22 A;  3CZD A;  1W8Y A;  4OQ0 A;  1QME A;  4ZJ3 A;  3OZH A;  1PI5 A;  3HUN A;  3HUM A;  2Q9M A;  3A3F A;  2Y2K A;  1MWT A;  5I94 A;  5EVI A;  1E3U D;  2R9X A;  2Y4A A;  5GLB A;  3ZVT A;  3C4O A;  2A49 A;  3PBN A;  4BL2 A;  4S2N C;  1K55 C;  4IED A;  2XD5 A;  2EFX A;  4R0Q A;  5CEB A;  5GHX A;  3UY6 A;  2OLV A;  3G31 A;  1WYC A;  4BJP A;  5HL1 A;  4N9K A;  1W7F A;  5FI6 A;  4MBH A;  3BEB A;  2XLN A;  4NET A;  2ZQ7 A;  3FZC A;  3V39 A;  3BYD A;  1NYY A;  3WS5 A;  5DTT A;  1XXM A;  3TOI A;  2Y2Q A;  1KE4 A;  4OOY A;  4PMA A;  2ZQ8 A;  2JE5 A;  3S4X A;  4KG2 A;  1I2S A;  1K38 A;  1DY6 A;  4P6B A;  3VP1 A;  3VMA A;  2ZJ9 A;  1YLT A;  5DVA A;  1BLH A;  1XA7 A;  3SH9 A;  3IF5 A;  3DWZ A;  5CGW A;  3ITB A;  5CHU A;  3VFH A;  5F1F A;  1XPB A;  3B3X A;  1GHP A;  4QD4 A;  1YLP A;  3MFD A;  3IH9 A;  3NDE A;  4GD6 A;  5E2H A;  3BFG A;  4P0M A;  1LLB A;  3VOY A;  2P9V B;  3IQA A;  4IVK A;  1FOF A;  3BFD A;  3GR2 A;  4ZTK A;  5A91 A;  3SH7 A;  3V3R A;  2CC1 A;  3IH8 A;  1XKZ A;  1LI0 A;  4N1H A;  2WAD A;  2OSU A;  4GNU A;  4WBG A;  4KZ5 A;  1XP4 A;  2HDS A;  5FQ9 A;  5GHY A;  2J9O A;  1ES2 A;  3CJM A;  4M3K A;  3VP0 A;  3VP3 A;  4Y0O A;  2ZC6 B;  3UPP A;  3ZG7 B;  3ISG A;  3WS0 A;  4OP8 A;  1KVM A;  3S1Y A;  3G2Z A;  3N7W A;  2ZC5 B;  3NIA A;  4KZA A;  3WS1 A;  3OCL A;  4BEN A;  4JF4 A;  3WS4 A;  4A5R A;  2XQZ A;  3D4F A;  4GOG A;  3MZF A;  4FCF A;  3RJU A;  1MXO A;  1SCW A;  3O86 A;  5CER A;  3NCK A;  2ZM8 A;  3UPO A;  1ZG4 A;  4X69 A;  4JLF A;  4GN2 A;  1PZP A;  2JCH A;  3PAG A;  4FD8 A;  4HES A;  1BT5 A;  3MBZ A;  1DJB A;  3E2L A;  3C7U A;  5CTM A;  4D2O A;  1FR6 A;  4U0T A;  1HVB A;  2B5R A;  2IWD A;  3IXH A;  4L0L A;  4WM9 A;  4PPR A;  1TVF A;  5AQA A;  4DDS A;  1K57 A;  4RA7 A;  4DE0 A;  1JWP A;  2Y2I A;  1TEM A;  3OPL A;  4KQQ A;  1PWD A;  4UA7 A;  2ZQA A;  5EOE A;  5FI2 A;  4R23 A;  3PBS A;  3P09 A;  4R1G A;  2Y91 A;  3N8R A;  5JYP A;  1HTZ A;  5CGS A;  3VSK A;  1NZU A;  3LEZ A;  4Y0U A;  5FAQ A;  5TGF A;  3LCE A;  5JYO A;  3A3I A;  3NC8 A;  1K54 C;  2Y2G A;  1JTD A;  2XFS A;  3JYI A;  4XUZ A;  3BFF A;  2HDU A;  3HBR A;  3WWX A;  2G2W A;  3BEC A;  1IEL A;  1QMF A;  1PZO A;  4NK3 A;  3NI9 A;  4C6Y A;  4EBN A;  4OPR A;  4OVD A;  1ERM A;  2OLU A;  1Q2P A;  4N9L A;  4K91 A;  2ZC7 A;  2XGN A;  4ID4 A;  5HAP A;  1JWZ A;  1W8Q A;  3Q82 A;  2HP6 A;  1IEM A;  1I5Q A;  3GRJ A;  2XK1 A;  3O3V A;  4B4Z A;  4KZ9 A;  2WAE A;  1BZA A;  3HVF A;  2WAF A;  1K6S A;  3PBO A;  3G34 A;  4N92 A;  4BQM A;  4LV3 A;  3UN7 A;  4FH2 A;  1LHY A;  3BLM A;  1WE4 A;  4X6T A;  1FQG A;  2WGW B;  3Q07 A;  3IHA A;  3M2J A;  3QHY A;  4P85 A;  1EI5 A;  3BM6 A;  4UA6 A;  2XEP A;  3DW0 A;  1MWU A;  4OLD A;  5HFO A;  1ALQ A;  1GA0 A;  5FQM A;  5M18 A;  4LV1 A;  3Q7V A;  4R4S A;  4JXS A;  5U47 A;  4OOL A;  3UE0 A;  4CPK A;  1VM1 A;  4QY5 A;  5KSC A;  4DRT A;  1MWR A;  5FAS A;  2DRW A;  4DE3 A;  2ZC4 B;  3O88 A;  4YFM A;  1FCO A;  4DDY A;  5FQQ A;  1GHM A;  4OQG A;  3LY3 A;  4UHU A;  4FSF A;  5KSH A;  2EFU A;  1HZO A;  3BLS A;  1N9B A;  4EBL A;  1LL9 A;  3PTE A;  4JXV A;  5F83 A;  2WZZ A;  1ZG6 A;  3N4I A;  1BUL A;  1YM1 A;  5A92 A;  4WMC D;  2Y2H A;  2ZLY A;  3A3J A;  4IVI A;  3W8K A;  2H0T A;  5EUA A;  3VOZ A;  3WS2 A;  3PAE A;  3Q1F A;  2RCX A;  2WZX A;  5F82 A;  5GHZ A;  1Q2Q A;  4Y0T A;  5FAO A;  1BLC A;  1LL5 A;  1YLY A;  2PU2 A;  3ZNT A;  1H8Y A;  1M6K A;  4C3Q A;  1FSW A;  2BG1 A;  4OQH A;  3NBL A;  5DF8 A;  2EXB A;  4PM5 A;  3MXR A;  4E3N A;  2E8I A;  3GMW A;  4ZBE A;  2A3U A;  3GV9 A;  3ZHH A;  2XF3 A;  1E3U A;  3DTM A;  3G35 A;  3CG5 A;  5FI7 A;  2V20 A;  3M6H A;  1BUE A;  4KZ3 A;  4JF5 A;  1H5X A;  2R9W A;  3QNB A;  1PIO A;  2P9V A;  3IWI A;  4S2P A;  3SOI A;  1U60 A;  3IF6 A;  1ESI A;  1FSY A;  1CI8 A;  3PBQ A;  2P74 A;  4R3J A;  5EVL A;  2ZQC A;  1ES5 A;  3HLF A;  4MEZ A;  4MBF A;  2EXA A;  3RXW A;  3M2K A;  4KZ8 A;  5AQ9 A;  4S2L A;  3ZFZ A;  4S2N A;  1K55 A;  4K0W A;  4HBT A;  4E3M A;  1ERO A;  2EX8 A;  4OPY A;  2BLS A;  2HP5 A;  2ZM0 A;  4R4R A;  4R3B A;  3N8L A;  3HLB A;  1L0D A;  5FQI A;  4BD1 A;  1YLW A;  1ZC2 A;  5L2F A;  1CEF A;  2QMI A;  1K57 C;  4EBP A;  3FWL A;  3V50 A;  3W4Q A;  1W5D A;  3QNC A;  4DXB A;  4X55 A;  4RYE A;  5TR7 A;  2DNS A;  5E2F A;  3HRE A;  3VP4 A;  2WGI A;  4GDB A;  2OV5 A;  4FH4 A;  5KMW A;  3PBR A;  5TFQ A;  3UPN A;  3UNW A;  3OCN A;  4S2O A;  3DWK A;  3ZG8 B;  4Q8I A;  2ZM2 A;  3FKV A;  2XR0 A;  1AXB A;  1O7E A;  3OPP A;  1CK3 A;  5E2E A;  2Z2M B;  4GB7 A;  3GSG A;  3N6I A;  3Q81 A;  1IYO A;  4GDN A;  5FDH A;  2XDM A;  1O07 A;  2WKH A;  4U3T A;  3GTC A;  1MWS A;  4MNR A;  4ZAM A;  1Y54 A;  3C7V A;  3ZG0 A;  4JBF A;  3LO7 A;  5BOH A;  4O7D A;  4CJN A;  2HPB A;  2WKE A;  4KZB A;  3ZG9 B;  5HAR A;  3VP2 A;  1KGF A;  1XA1 A;  4IBX A;  2J8Y A;  5IHV A;  4KZ6 A;  1YLJ A;  1KDS A;  1C3B A;  3UE3 A;  2HP9 A;  4JXG A;  3G4P A;  1KDW A;  2H10 A;  2ZQD A;  3M6B A;  3EQV A;  2Q9N A;  1ONH A;  4DF6 A;  5GLA A;  3FKW A;  1MKI A;  1WYB A;  3HUO A;  3UDI A;  5FAP A;  2VGJ A;  2H0Y A;  4LV2 A;  5CHM A;  5E2G A;  1K6R A;  1NZO A;  4ZDX A;  1K56 D;  2GDN A;  5EVI C;  5CED A;  2VGK A;  5CXW A;  3AGE A;  2Y2J A;  4E3O A;  3ZVW A;  3ZG5 A;  1PWC A;  1L0G A;  4GKU A;  1IKI A;  2WGW A;  4LCM A;  4ZJ1 A;  1BLS A;  3O87 A;  5G18 A;  1BLP A;  2QZ6 A;  5EVI D;  2PU4 A;  1M40 A;  3UE1 A;  2V2F F;  4LV0 A;  4X53 A;  2XFT A;  3HLC A;  3A3E A;  3C5A A;  1YQS A;  4UAA A;  4WZ5 A;  2RL3 A;  1IYQ A;  1PYY A;  5HAI A;  1XGJ A;  3IXD A;  1K54 A;  5DF7 A;  3OPH A;  1ERQ A;  1S6R A;  1ONG A;  4DKI A;  4HBU A;  4KG5 A;  5EPH A;  3EQU A;  1VQQ A;  1RCJ A;  1E4D A;  3CMZ A;  3MKE A;  3IWO A;  3PBT A;  4HEF A;  4UA9 A;  2HDR A;  4KEN B;  5E43 A;  3HL9 A;  5EE8 A;  4EQI A;  1NXY A;  1G6A A;  1ES4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...