2ZQCA

Aztreonam acyl-intermediate structure of class a beta-lactam toho-1 e166a/r274n/r276n triple mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
261
Chain Sequence
b'NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Structural Basis of Extend Spectrum Beta-Lactamase in Correlation of Enzymatic Kinetics and Thermal Stability of Acyl-Intermediates
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zqcA00
5FSRA 1KDWA 1XGJA 1ESIA 1IELA 2HDUA 1ES2A 5FQ9A 1YM1A 3MBZA 4N9KA 5TR7A 1PI5A 4WBGA 3VP4A 5TFQA 5FDHA 2XQZA 2ZMAA 2H5SA 3GR2A 1CI9A 2JE5A 4WMCA 2ZM2A 3CZDA 5CGSA 3DWZA 3VSKA 1L0EA 3OZHA 4X55A 4DE0A 3IF6C 3G31A 5A91A 4KG2A 4OLDA 5DTSA 5HL1A 1KE4A 3NC8A 3PBTA 2ZC7A 1LI0A 3ZCZA 5FQQA 3V3RA 1FSYA 1NYYA 2WYXA 5E2EA 4IVIA 3WS0A 4N1XA 5FI6A 5CGWA 3BFEA 4WZ5A 3UY6A 1H5XA 4K91A 4KZ9A 5DTTA 1U60A 1HVBA 1FQGA 1WE4A 2XLNA 3BFGA 1WYBA 3BRMA 3QNBA 4LV0A 4DE1A 3ITBA 2R9XA 4IVKA 2ZQ9A 3IHBA 2Y2MA 3ZHHA 1K56D 2DCFA 5KSCA 1BULA 5DTKA 4JF6A 1MWRA 5KSHA 2WKHA 4Y0TA 3PTEA 5J8XA 1YMXA 1SCWA 4XXRA 3IQAA 5FA7A 3VFHA 4BQMA 4JXGA 5EECA 4NK3A 4UAAA 5AQ9A 3DWKA 1W79A 2PU2A 1G6AA 4WYYA 5CTNA 5FQKA 3TOIA 3VP2A 4S2KA 4UHUA 3S1YA 5FAQA 1O7EA 4QU3A 4R4RA 1YLZA 4IBRA 1K57C 2J8YA 4XUZA 3FV7A 5CEDA 1K54A 1EI5A 1BLHA 3QNCA 1FR6A 3WRZA 3W8KA 5EVID 1CK3A 4L0LA 5M1AA 3S4XA 2EFXA 5HARA 4GKUA 1W8QA 3VOYA 2JC7A 1PW8A 4E3NA 3Q7ZA 1PWCA 4K0WA 1LLBA 2ZJ9A 3GTCA 4PM5A 1XP4A 5CHUA 4BLMA 3W4PA 4JLFA 1RP5A 1ZG4A 4X69A 5CHJA 4HEFA 4ZAMA 3W4QA 3FWLA 5CXWA 2X71A 5FQJA 2P9VB 1MY8A 3NBLA 1N4OA 4KZ5A 1MWSA 5FI2A 1KVMA 1Q2QA 3C7VA 3V5MA 5CERA 3ZG0A 1E25A 3G32A 3HUMA 4R4SA 1FSWA 1IYQA 3LEZA 5FQIA 4OPYA 1KE0A 2WZXA 4Q8IA 2H10A 5U47A 1Z6FA 4KZ7A 3E2LA 4C6YA 5BOHA 3Q82A 4DXCA 1YLWA 4KZ3A 4GDBA 1TDGA 5M19A 2X01A 2EX9A 2PBYA 4WEJA 2VGKA 3EQVA 4GOGA 4X56A 5GL9A 3MZDA 2Y2IA 1FOFA 1YLYA 4QY5A 3RJUA 4LENA 3UDFA 2Y2LA 3GQZA 1K55A 4QHCA 1LI9A 1S0WA 2WAFA 1ALQA 3EQUA 4FD8A 3OCLA 1K25A 2RCXA 3HL9A 4OVDA 3SH8A 3PAGA 5A92A 1OMEA 5CECA 4OP5A 4JXVA 4BD0A 1L2SA 4RA7A 4ZBEA 5HAPA 3NI9A 1NZUA 5I94A 4JKTA 1KE3A 4DE2A 3ITAA 3C4PA 4E3IA 1XKZA 4DXBA 3PBRA 5JYPA 5FQMA 4OH0A 1PYYA 4BENA 1HZOA 2HPBA 2C6WB 1K56A 4RVAA 2OLUA 4KG6A 4EV4A 2BLSA 4QJGA 1XGIA 4R1GA 2WUQA 5GLCA 1H8ZA 5EOEA 4HESA 4PM8A 1XA7A 4S2NC 3NDGA 1ZKJA 4S2OA 4EQIA 3VFFA 5F1FA 4YFMA 4ID4A 2ZC6B 2XFTA 2ZM8A 3HLEA 4MBFA 4U0TA 2Y2QA 4PMAA 4PM6A 3RXWA 4DF6A 5HX9A 3B3XA 1GHPA 3NIAA 4DE3A 3OPHA 5EVIA 2Y2HA 1MKIA 2UWXA 3OPRA 3MKFA 2BG1A 5GLBA 1VQQA 1H8YA 2WKEA 4OPQA 1JWVA 1HTZA 2R9WA 2QMIA 1M6KA 2I72A 3LCEA 4S2MA 2Q9MA 3ZDJA 1NRFA 3VSLA 4P87A 4MBKA 1BSGA 4E6XA 3WWXA 3G30A 5D3OA 4CPKA 4EWFA 4NETA 1IYSA 3HUNA 3IXDA 1I2SA 1AXBA 3IWIA 3GVBA 5HAIA 3G2ZA 3JYIA 4C3QA 4RX2A 3NY4A 2EXBA 3GSGA 1NZOA 1LL5A 1E4DA 1K38A 3UPNA 1CI8A 3OPPA 4GD6A 4KZBA 2CC1A 4EUZA 1ES5A 1ONHA 4JPMA 2WGVA 5FAOA 3BYDA 1CEGA 4LV1A 1Q2PA 1W8YA 1VM1A 4UA9A 1FCOA 4B4XA 2FFFB 3AGDA 4R3JA 4ZTKA 1JTDA 1RGZA 2H0YA 4KQRA 3PBOA 4Y7PA 3CMZA 3SH7A 2VGJA 1M40A 2V1ZA 2G2WA 5L2FA 3M2JA 1O07A 1GA9A 3HLDA 4K0XA 4P6BA 1GHIA 3C7UA 4LCLA 3V39A 1DJBA 5E2FA 2P74A 1BUEA 2Y59A 4GDNA 3IF6A 1KGGA 3ZNYA 3O88A 4FCFA 1JWZA 2IWDA 1BLCA 4E6WA 2ZC3B 2ZLYA 2XR0A 4XUXA 3V3SA 1ES3A 4E3KA 3BFCA 3NCKA 2Y55A 2PU4A 3QHYA 2ZQ7A 1K4FA 4M3KA 2EX2A 2XF3A 4OQ0A 2WAEA 3IXBA 3N7WA 1TDLA 2JCHA 1L0GA 3HLGA 4KZ4A 5EOOA 3ZG8B 3HVFA 4PM9A 2HP9A 3HLFA 4JXWA 2HDQA 3FKWA 3OPLA 5A90A 4R3BA 3LY4A 3PBQA 4Y0UA 3MZFA 1G68A 3MXRA 1K57A 1YLPA 2XK1A 2Y2GA 3E2KA 3UO9A 1E3UD 2RL3A 1KGEA 2JBFA 3HLCA 3G4PA 4B88A 3GV9A 3MKEA 1DJCA 1BLPA 2B5RA 3ISGA 3VMAA 3N6IA 1IKIA 2A49A 3N4IA 3A3DA 1JTGA 5CTMA 3WRTA 4FH4A 5GLDA 4KENB 2IWCA 1K6RA 2Y2JA 4PM7A 1J9MA 2EFUA 5HAQA 3IWOA 1MWUA 4FH2A 4ZJ2A 3S22A 2XFSA 1MBLA 4MNRA 5IHVA 4ZJ1A 4OQGA 2ZD8A 2Z2LB 3AGEA 3ZVTA 1Y54A 4ZDXA 1IEMA 3UDXA 3G34A 5EUAA 3HLBA 4QD4A 2OSUA 3UE1A 3MXSA 3IWQA 3UNWA 2XD5A 4BL3A 2A3UA 1XA1A 1ZG6A 4LV3A 4S2JA 3MZEA 2C5WB 1NY0A 4OQHA 4RX3A 1JWPA 2DNSA 2QZ6A 4WZ5C 1TEMA 3PBNA 3PBSA 5E2GA 1S6RA 5F83A 3HBRA 5G18A 3UN7A 3WS1A 3UE3A 4IBXA 3O86A 2J9PA 4H8RA 5DF9A 1IKGA 1EROA 1JVJA 4CJNA 2XH9A 2ZC5B 3GRJA 4OP8A 2XEPA 3IXGA 4QB8A 3BM6A 3CJMA 4B4ZA 1XX2A 5DF8A 3SOIA 3ZGAB 1C3BA 4P85A 1GA0A 3P09A 1ERMA 3A3IA 1YLJA 1PW1A 1IYOA 3D4FA 3O87A 2Y4AA 3RXXA 1KGFA 2ZQ8A 3BECA 1K4EA 4DDYA 1N9BA 3TG9A 3P98A 5FAPA 1K54C 1NJ4A 1PIOA 1L0DA 4OOLA 4R0QA 1L0FA 1I2WA 2WKIA 4WZ4A 3ZFZA 3Q7VA 1FR1A 4GZBA 5EVIB 1YLTA 2ZQCA 4BL2A 3M6HA 5CGXA 3SS5A 2J7VA 5HW3A 4DRTA 1NXYA 3OC2A 1RGYA 2Y2PA 4A5RA 2XDMA 2ZQDA 4UA7A 3FZCA 2WGIA 2Y91A 4IEDA 5GLAA 1MPLA 3A3JA 5EE8A 4R23A 3TSGA 3C4OA 1PZPA 4X6TA 1SHVA 2G2UA 1QMFA 2HP5A 4S2NA 2EXAA 2ZC4B 4D2OA 3Q7VB 1YQSA 5GHZA 1CEFA 4O7DA 2DRWA 5A93A 2X02A 4KG5A 4WEKA 5EVLA 1E3UA 1LL9A 4MLLA 4GD8A 5CHMA 3G35A 4X68A 5AQ7A 2Z2MB 5TGFA 5EPHA 4E3MA 2E8IA 4OONA 3WS2A 1DY6A 3WS4A 1ONGA 4E3JA 1IYPA 3W4OA 1GCEA 5FATA 4N9LA 5AQBA 4OOYA 4UA6A 4KZAA 4U3TA 1HD8A 3O3VA 1SDNA 4MBHA 3CG5A 1W7FA 3A3FA 3UDIA 1SKFA 2Y2KA 3BFFA 2P9VA 3SS3A 3GMWA 3VOZA 1ERQA 4U0XA 1K55C 4F94A 1WYCA 1YT4A 2GDNA 5E2HA 2WK0A 1TVFA 5E43A 4HBUA 2FFYA 4WMCD 3MFDA 1ES4A 3FYZA 5F82A 3VP1A 1LHYA 4E3OA 4Z9QA 5M18A 2OV5A 2Y2NA 5JYOA 3SS4A 3IF6B 4KQQA 4KZ8A 3IF5A 5DF7A 1BLSA 1PI4A 4OKPA 1PZOA 3IH8A 3N8RA 5GHYA 5GHXA 4DDSA 3ZG7B 4S2LA 4WM9A 2Y2OA 1NYMA 3HREA 3M6BA 3Q81A 4KQOA 3BLSA 3AGFA 2OLVA 4GN2A 1K6SA 3VP0A 4N92A 4OOMA 1RCJA 1PWGA 1XXMA 2J9OA 1GHMA 1DJAA 1QMEA 3BFDA 4JBFA 4X53A 4YINA 1KDSA 3Q1FA 5HFOA 4QY6A 1YMSA 4FSFA 4DKIA 4BD1A 3HLWA 4BJPA 4C75A 1BT5A 4JXSA 5FASA 3SH9A 1MXOA 2EX6A 2V2FF 2WGWA 2IWBA 2HDSA 4HBTA 4EBPA 1BTLA 3I7JA 3N8SA 3G2YA 4E3LA 4RYEA 1KVLA 5AQAA 2WZZA 3A3EA 4EBNA 4S2IA 5EVIC 1ESUA 2EX8A 1I5QA 3NDEA 1FCNA 3ZG9B 2QPNA 4WELA 2ZM0A 1XPBA 4PPRA 5CRFA 3HUOA 3UE0A 1EWZA 3ZVWA 1BZAA 2HP6A 4Y0OA 5DVAA 4ZJ3A 5FI7A 3IT9A 1W5DA 3LO7A 4OQIA 2WGWB 3DTMA 3V50A 4EBLA 5KMWA 4GNUA 2HDRA 2XD1A 2ZQAA 3FKVA 4LCMA 5KZHA 3IXHA 1MWTA 2WADA 4N1HA 1SDEA 2Q9NA 5F1GA 2H0TA 3IH9A 3IHAA 4JF5A 3BLMA 4GB7A 4P0MA 3M2KA 3LY3A 3ZNTA 3UPOA 4LV2A 3N8LA 5CEBA 4OLGA 3BEBA 4MEZA 2V20A 3DW0A 1FCMA 4KZ6A 3Q07A 3UPPA 4OPZA 3WS5A 4S2PA 2XGNA 1PWDA 3C5AA 3OCNA 3PAEA 4OPRA 3ZG5A 4JF4A 3VP3A 1ZC2A
chains in the Genus database with same CATH superfamily
3MBZA 5TFQA 4PKYG 3OOVA 3GR2A 2JE5A 1IOUA 5CGSA 4PAUA 3IF6C 3G31A 4I39A 5HL1A 5FQQA 1FSYA 3FC7A 4WZ5A 1WYBA 4LV0A 1K56D 5CX7A 4CLCB 1OTDA 3ZQ5A 2PHYA 1YMXA 3VFHA 5EECA 4UAAA 1YSPA 3JVVA 5FQKA 3KSHA 4S2KA 3S1YA 5FAQA 1GSVA 1O7EA 4HY8A 5HWWA 3PXPA 1YLZA 4IBRA 1K57C 5CEDA 1K54A 1FR6A 5EVID 2HJEA 4L0LA 5M1AA 3S4XA 2J3TC 3ZYTA 5HARA 4GKUA 1W8QA 3VOYA 2W1TA 1PWCA 4K0WA 4KUOA 2ZJ9A 1RP5A 2XRNA 3W4QA 1Z09A 4WL9A 5FQJA 1VETA 2P9VB 4ARZB 3V5MA 3ZG0A 5K5BA 1DP9A 4MDZA 4Q8IA 2H10A 2W0NA 2MJ6A 4HJ3A 4GDBA 5M19A 2X01A 2EX9A 4QHCA 2WAFA 4OVDA 3VE3A 1OMEA 3KYQA 1XKZA 3H7WA 4DXBA 1VEUB 4OH0A 4R6LA 1HZOA 1H8MA 2C6WB 3CI6A 4RVAA 1D06A 2OLUA 2BLSA 4FOFA 4PM8A 2P7JA 5F1FA 4YFMA 2QKPA 2XFTA 3HLEA 4U0TA 3VOLA 4PM6A 3RXWA 4DF6A 5HX9A 3W2ZA 4DE3A 2Y2HA 4LLOB 1MKIA 3OPRA 3FPWA 3MKFA 3LIFA 1HTZA 2I72A 4S2MA 3KSGA 3CUEA 2ACGA 1TS7A 4P87A 1BSGA 4E6XA 3G30A 4CPKA 1GSWA 3IXDA 1YAXA 1AXBA 4ETZA 5HWVA 5L07A 1E4DA 1K38A 3OPPA 2CC1A 1ONHA 4JPMA 1CEGA 1DRMA 1Q2PA 2FFFB 4R3JA 1CQAA 3BW6A 2V1ZA 2B02A 4UQIM 2G2WA 4XT2B 5L2FA 2G7UA 2FH5A 4K0XA 1GA9A 1K0KA 3HJKA 4IHQA 4EETB 1KGGA 4FCFA 5DFYA 2IWDA 5LBRA 4XUXA 2M7VA 3NOUC 3RFBA 1GSXA 5AJGA 2Y55A 2PU4A 4BBVA 3RH8B 4NG2A 2PR6A 2JCHA 3S7NA 5EOOA 1YKDA 3ZG8B 3HLFA 1VETB 4R3BA 4Y0UA 2PRFA 4AFIA 2PD8A 2W3EA 2Y2GA 2JBFA 3HLCA 4NKPA 3LIAA 5F69A 3ISGA 5F68A 2ZL1B 3A3DA 3WRTA 5CTMA 4FH4A 4KENB 2IWCA 5HAQA 3IWOA 4FH2A 1SKOA 1ZHHB 4ZJ1A 2ZD8A 2Z2LB 3LR4A 1IEMA 3G34A 3A0RA 3UNWA 4LV3A 2C5WB 2PYRA 5F83A 5L10A 5DF9A 1JVJA 3LIEA 3E0YA 4OP8A 2GX5A 2XEPA 4QB8A 2QJ7A 4P6ZM 5EV0A 1YLJA 1IYOA 2Q0OA 3LIBA 2ZQ8A 3BECA 1K4EA 4DDYA 3P98A 1NJ4A 4R0QA 4WZ4A 3ZFZA 1YLTA 5HD3A 2JKRM 3SS5A 3DTEA 1TS8A 1YSQA 3OBFA 1J3WA 1MPLA 4LGWA 1PZPA 4X6TA 2G2UA 1QMFA 3Q7VB 1YQSA 5GHZA 5A8BA 2V8CA 5A93A 3MQ0A 1E3UA 3KSIA 3G35A 5EPHA 3BQAA 4LRYC 1DY6A 4E3JA 5AQBA 4OOYA 4KZAA 3EGDC 1W7FA 3BFFA 3IBRA 1WYCA 2WK0A 4MN5A 1ES4A 3FYZA 5F82A 1LHYA 2OV5A 2VLGA 1FILA 1PI4A 1PZOA 5GHXA 4DDSA 4S2LA 2HJ9C 3M6BA 2HZ5A 3E98A 2OLVA 2K2NA 4N92A 2JHEA 5TBMB 4JBFA 4X53A 2ZBBA 2QHKA 4DKIA 3LIDA 4C75A 5FASA 1UWPX 2IWBA 4EBPA 1BTLA 2NUTC 3I7JA 3N8SA 4RYEA 1KVLA 3T4QA 5EVIC 1ESUA 2EX8A 2JKFA 2JKGA 1PNEA 3ZG9B 3HUOA 1EWZA 2OAP1 2JKRI 5FI7A 1MC0A 3LO7A 4OQIA 5KMWA 4NXFA 4GNUA 3HJIA 2HDRA 2ZQAA 4LCMA 3IXHA 2J80A 2Q9NA 5F1GA 1OT9A 3IH9A 3IHAA 3NHQA 1PFLA 4LV2A 3Q07A 3NECA 2XGNA 1PWDA 4GS9B 1XJ3A 4O01A 3BJNA 3U2AA 3MSHA 4HP4A 4CQHA 3C30A 5HSQA 1YM1A 4IUHA 4WBGA 3VP4A 1MKMA 2ZMAA 2H5SA 3KX0X 2B95A 4CLCA 4M4XA 3OZHA 5G4YA 5A91A 2VJWA 4OLDA 5HPIA 2V1AA 3NC8A 2ZC7A 3V3RA 2WYXA 5CGWA 1HVBA 4IVKA 4Y0TA 3IQAA 5FA7A 4D60A 4JXGA 3U4LP 3DWKA 1W79A 1G6AA 3C2WA 4WYYA 4UHUA 1TD5A 3T4LA 4QU3A 4XUZA 1EI5A 4ARZA 3QNCA 4Y13A 3W8KA 1CK3A 2EFXA 2VV8A 2P08A 3D3OA 2JC7A 1PW8A 3Q7ZA 3GTCA 4JLFA 1TS6A 4HEFA 1NRJA 4HJ4A 2X71A 3T4JA 4KZ5A 5FI2A 3C7VA 3G32A 1S67L 3LEZA 3QP6A 5FQIA 4OPYA 4NXGA 1KE0A 1Z6FA 4KZ7A 2CMNA 5BOHA 3Q82A 1WA9A 2PDRA 1TDGA 4WF0A 2VGKA 3MZDA 4QY5A 1FOFA 4CLCE 2V8FA 3UDFA 3GQZA 1K55A 1LI9A 1S0WA 1F2KA 4FD8A 1K25A 4YOFA 2RCXA 3HL9A 5CECA 4BD0A 5I94A 1KE3A 2QYBA 3ITAA 3MF0A 4E04A 1XFQA 5IS1A 2FZ0A 2H28A 1PYYA 4EU0A 5HPFA 4EV4A 1XGIA 5GLCA 4L9GA 2VA0A 4HESA 1DP6A 4P6ZS 1ZKJA 4S2OA 4MBFA 2Y2QA 4PMAA 3B3XA 3NIAA 3OPHA 4DMZA 1JWVA 1N9NA 3T50A 3LCEA 2XSSA 3T1SA 1ODVA 4EWFA 1H0MA 3MFXA 1JNUA 3GVBA 4RX2A 1NZOA 4EUVA 1CI8A 4XT2A 4GD6A 2WGVA 3VV4A 1W8YA 5C5KA 4UA9A 3JPUA 4ZTKA 4ETXA 4K08A 2H0YA 3CMZA 2A2LA 3SH7A 2VGJA 3MJQA 4X1MA 3M2JA 1O07A 4JGPA 4P6BA 4LCLA 4I3AA 2O9CA 2P74A 4GJ4A 4RQ9A 1X0OA 2Y59A 4GDNA 3O88A 4YWZA 4E6WA 2ZLYA 2XR0A 2BASA 3V3SA 3F1PA 1VB6A 4E3KA 3IX3A 3NCKA 3MXQA 2W3HA 1K4FA 2EX2A 2WAEA 1TDLA 2L1MA 4KZ4A 3NOPC 3HVFA 3ULFA 2ZL1A 3OPLA 3V67A 3MZFA 3MXRA 3E2KA 1E3UD 5FEGA 3G4PA 3R7WA 3PYPA 1DJCA 3SZTA 3VMAA 3N6IA 2A49A 4IUKA 2EFUA 3QP5A 4ZJ2A 2XFSA 5HZHA 4MNRA 4ZDXA 1Y54A 3UMEA 2V0UA 3HLBA 1AWIA 4QD4A 2OSUA 3MXSA 4BL3A 4HP9A 1XA1A 2QJ5A 3MZEA 4RX3A 2VGLM 4WZ5C 1TEMA 3PBNA 3PBSA 1S6RA 3WS1A 5G18A 3UN7A 4IBXA 1IKGA 4CJNA 2XH9A 3BM6A 3D72A 1XX2A 3ZGAB 1C3BA 3S7QA 2L4RA 1GA0A 1PW1A 2Y4AA 4LPZA 1KGFA 3FPVA 1K54C 4OOLA 1I2WA 2WKIA 3MQQA 3Q7VA 3M6HA 2J7VA 4DRTA 1NXYA 4F3LB 4A5RA 2Y91A 4BWIA 5GLAA 4ME4A 5EE8A 3C4OA 1SHVA 4S2NA 4BBUA 3C8CA 2VK3A 5HD5A 1CEFA 2J3WA 2DRWA 1UWNX 2VKSA 4WEKA 4LFUA 4GD8A 5AQ7A 2Z2MB 3DBAA 1ONGA 1IYPA 3W4OA 3KYEA 4UA6A 3LEQA 1SKFA 3IX4A 1ERQA 5FL3A 4HBUA 2FFYA 2A24B 5TBMA 4CLCD 2HGVA 4WN5A 5TJJA 3SS4A 1XJ2A 3DTKA 5DF7A 5IT5A 5F6AA 3EWKA 2WKQA 5GHYA 5AVEA 4MN6A 4LRXC 3F1PB 1NYMA 4NXBA 3AGFA 4DJ3A 4OOMA 2NUPC 2V1BA 4GCZA 5HDCA 1QMEA 3BFDA 3P7NA 2E8JA 4HQAA 1YMSA 1D7EA 4BD1A 3HLWA 2B18A 4JXSA 4NXEA 4KQDA 1MXOA 4JGOA 2EX6A 5FDSA 5AQAA 2WZZA 3A3EA 4EBNA 3R7WB 3UB8A 1W63Q 2ZM0A 1XPBA 4PPRA 3UE0A 3BWLA 3ZVWA 2HP6A 1XFNA 2HV1A 3CUEC 5DFXA 3V50A 3DTMA 4GS9A 2R78A 2XD1A 3LI8A 2WADA 3BY8A 2H0TA 4JF5A 4GB7A 4P0MA 3LY3A 3N8LA 1H3QA 4GLQA 4I5SA 4OLGA 2V20A 3DW0A 1FCMA 4OPZA 3PHYA 4S2PA 2W1RA 4OPRA 4JF4A 5FSRA 1XGJA 1L3LA 1IELA 2HDUA 2HF6A 1ES2A 1OTAA 4N9KA 1PI5A 2ZM2A 3CZDA 3DWZA 1YPRA 1TF1A 4KG2A 5DTSA 1F5MA 3PBTA 3MR0A 2KLIA 1NYYA 5E2EA 4IVIA 4N1XA 3UY6A 4K91A 4Y17A 3T4TA 1WE4A 2XLNA 3BRMA 2ZQ9A 3IHBA 5KSCA 3B42A 2DCFA 1MWRA 5KSHA 3PTEA 5J8XA 1SCWA 4BQMA 4NK3A 4DN0A 5AQ9A 2PU2A 5CTNA 3TOIA 3VP2A 3DTIA 2GZAA 3LGOA 1BLHA 4HNBA 4HOIA 2W3FA 4E3NA 1LLBA 4PM5A 4FUWA 1XP4A 3B47A 5CHUA 3CHWP 5DJUA 4BLMA 5CHJA 4X69A 2XROA 3CWFA 1MY8A 3NBLA 1MWSA 1Q2QA 1E25A 3HUMA 1FSWA 2WZXA 4EQ1A 2INWA 3E2LA 4C6YA 3F1NA 3MMHA 3H82A 1YLWA 5GL9A 4GOGA 3RJUA 3IBJA 2W27A 2K31A 2Y2LA 4X1LA 1D1JA 3UB6A 2EWWA 3LICA 3OCLA 5A92A 3PAGA 4JXVA 4ZBEA 4RA7A 5HAPA 4EXOA 3CPTA 1V9YA 4FTXA 3D9YA 2VEAA 3PBRA 3T4KA 2VGLS 4BENA 1LL8A 4R1GA 4B93A 5EOEA 4H6JB 4WLAA 2W3DA 3NDGA 2DMWA 1P9RA 4O0PA 3VFFA 3BY9A 4ID4A 2ZC6B 5EM0A 1LT0A 3S7OA 4Q0HA 2L0WA 3SW1A 3MS6A 2BG1A 1M6KA 3TRCA 3NOTC 2Q9MA 3ZDJA 3VSLA 4BMWA 3WWXA 3OLOA 3K3CA 5D3OA 4NETA 1IYSA 3F1OA 3HUNA 3G2ZA 3NY4A 5I5LA 3GSGA 1LL5A 3FG8A 4KZBA 4EUZA 1ES5A 4GW9A 5FAOA 3PR6A 4LV1A 1VM1A 5FEFA 3AGDA 3S7PA 1JTDA 4Y7PA 3TJZC 3HLDA 1GHIA 4I3IA 3C7UA 3V39A 5E2FA 3IF6A 4QWOA 1JWZA 1ACFA 2ZC3B 2Y79A 4UEYA 3T1QB 1ES3A 1CF0A 3TW8A 4IJGA 3HLGA 5DKKA 4Z1WA 2PR5A 4PM9A 2HP9A 2HDQA 3FKWA 2OAQ1 3LY4A 3PBQA 4MN7A 1K57A 1S66L 1YLPA 2XK1A 3UO9A 4B88A 3GV9A 2GNXA 1BLPA 2B5RA 3F1NB 3UB9A 1IKIA 3H82B 1G28A 1JTGA 2Y2JA 4HIAA 2ZOIA 3S22A 1MBLA 5IHVA 4CLCC 5EUAA 3UE1A 3IWQA 2YKFA 3CPTB 1JWPA 2QZ6A 4G3VA 3UE3A 5MC7A 1EROA 3GRJA 2ZC5B 3IXGA 1V9ZA 4Y5FA 3UB5P 4GHIA 1ERMA 4I38A 4F3LA 3D4FA 3O87A 3RXXA 5HWTA 1N9BA 4G3WA 5FAPA 5EVEA 1T19A 4PKYA 1L0FA 1S1ZA 4GZBA 1FR1A 2ZQCA 2WKRA 4BL2A 5HW3A 2M7UA 2XDMA 2ZQDA 4UA7A 5DKLA 1TS0A 3A3JA 3TSGA 2HP5A 3F1OB 2ZC4B 4D2OA 3VE4A 2O9AA 2X02A 2PAVP 4KG5A 5EVLA 5CHMA 4X68A 5TGFA 2XA7M 1F9IA 2E8IA 2A24A 4OONA 3C38A 3WS4A 1GCEA 5FATA 1STZA 4U3TA 5G4ZA 1SDNA 4MBHA 3A3FA 3UDIA 3VOZA 3GMWA 4U0XA 5L09A 1K55C 4F94A 2GDNA 1TVFA 5E43A 1T1BA 3VP1A 5M18A 5F5YA 2BTFP 5JYOA 3IF6B 4HH3A 4KQQA 1BLSA 3IH8A 3ZG7B 2Y2OA 4KQOA 4GN2A 1K6SA 4Q0JA 4HH2A 2WKPA 5J3WA 2J9OA 1GHMA 1DJAA 3A0SA 3Q1FA 5HFOA 4FSFA 4JGQA 1BT5A 4EEPA 2V2FF 4HBTA 4E3LA 1BYWA 1OTIA 2IA2A 2VX8A 5KIZA 2QPNA 4WELA 2EA9A 3CLOA 1BZAA 4Y0OA 3IT9A 1W5DA 2WGWB 4Y3IA 3FKVA 5KZHA 1MWTA 4BBTA 3A0VA 1SDEA 1EW0A 3M2KA 3UPOA 3BEBA 1OTBA 3UPPA 3IS2A 3TE8A 2KX6A 3PAEA 1N9LA 1S4SA 1W63M 1KDWA 1ESIA 2Z6DA 5FQ9A 4Q0IA 5TR7A 2ZMFA 5FDHA 2XQZA 4GHIB 1NLZA 1KOUA 1CI9A 4Y15A 2I9VA 4WMCA 3VSKA 1L0EA 4X55A 4DE0A 1PRQA 1KE4A 2ZMVA 1LI0A 3ZCZA 3WS0A 5FI6A 3BFEA 1H5XA 4KZ9A 5DTTA 1U60A 4X25A 1FQGA 3QNBA 3BFGA 4DE1A 3ITBA 2R9XA 2Y2MA 3ZHHA 3RTYA 1T1AA 1BULA 5DTKA 4JF6A 4R38A 2WKHA 4O8GA 2EWVA 3HCYA 4XXRA 3QP1A 4II7A 1F98A 3EEHA 4R4RA 2J8YA 3FV7A 3WRZA 2QWSA 3NJAA 2D01A 3UE6A 1T18A 3W4PA 3CITA 1ZG4A 4ZAMA 1LSVA 3FWLA 5CXWA 3T1RA 1N4OA 3LYXA 1KVMA 1DP8A 1VHMA 1IFQA 5CERA 2KDKA 4R4SA 1IYQA 1XJ4A 2W1TB 5U47A 1S4RA 4DXCA 4KZ3A 5J7EA 2W3GA 2PBYA 4WEJA 3EQVA 4X56A 2Y2IA 1YLYA 4LENA 1P9WA 3K2NA 2GJ3A 1ALQA 3EQUA 3SH8A 4OP5A 2PBDP 3CAXA 1L2SA 3L7HA 3NI9A 1NZUA 4JKTA 4DE2A 3C4PA 4H6JA 5AVFA 4E3IA 5JYPA 5FQMA 4ZRRA 3L9KA 2HPBA 1K56A 2OOLA 1NWZA 4KG6A 4QJGA 1SZVA 2WUQA 1H8ZA 4I3JA 1XA7A 4S2NC 3E4OA 3KO6A 3H7WB 4HHDA 3NULA 4EQIA 1Y4OA 2ZM8A 2M1CA 3KYZA 4EESA 1N9OA 1GHPA 5EVIA 2J3TD 2OWHA 5J4EA 3E4PA 3G6OA 3GDIA 2UWXA 5GLBA 3IS2B 1VQQA 1H8YA 2WKEA 4OPQA 2R9WA 2QMIA 2V9AA 5EFWA 4MMNA 1NRFA 4MBKA 1I2SA 4R70A 3IWIA 5HAIA 4B9OA 3JYIA 4C3QA 2PT7A 2EXBA 1HLUP 3UPNA 1OPXA 2JKTM 3BYDA 2XA7S 4EEUA 1G5UA 1G6OA 3DAVA 1NLYA 1FCOA 5L8MA 4B4XA 3K3DA 2VV7A 1RGZA 3R4KA 4KQRA 3PBOA 5HL6A 4KUKA 3QP2A 1M40A 2OWJA 3T4SA 1P0ZA 3EEAA 1DJBA 1BUEA 3ZNYA 1BLCA 3LUQA 1A0KA 4QPRA 1OJ5A 3BFCA 4DJ2A 3QHYA 2ZQ7A 1XJ6A 4M3KA 2XF3A 4OQ0A 3IXBA 3T12B 3N7WA 1L0GA 2Y8HA 2JN7A 2Z6CA 4JXWA 4MCWA 5A90A 4NEED 3EGXC 4EERA 1MZUA 1G68A 3GECA 3LR0A 2RL3A 1KGEA 2AVXA 5IU1A 3MKEA 2PD7A 3LI9A 3N4IA 5GLDA 1K6RA 4PM7A 1J9MA 4EW7A 1MWUA 3LR3A 4YNRA 4OQGA 2UV0E 3AGEA 3ZVTA 1LSXA 3UDXA 2PYPA 1LSWA 4R3AA 3B33A 2LB9A 2VV6A 2XD5A 3QP8A 2A3UA 2JKTI 1ZG6A 3ICYA 3P01A 4S2JA 1NY0A 4OQHA 2DNSA 5E2GA 1SKOB 3HBRA 3O86A 2J9PA 1CJFA 2VZWA 4H8RA 3QP4A 3T4OA 5HDDA 4B4ZA 3CJMA 5DF8A 3SOIA 1OJGA 1FIKA 4P85A 3P09A 3A3IA 2O0YA 2V0WA 3BQ8A 3TG9A 5DJTA 1PIOA 4PHTA 1L0DA 3T1XA 3MQOA 4Y2FA 5EVIB 5CGXA 3IX8A 3UMDA 3OC2A 1RGYA 2Y2PA 1T1CA 3FZCA 2WGIA 4IEDA 4R23A 1OT6A 5HDSA 2EXAA 3O5YA 4O7DA 4G3KA 2K7SA 1LL9A 4MLLA 4L9FA 4E3MA 3WS2A 1UGUA 4UQIS 4N9LA 1P97A 3JVUA 1HD8A 3O3VA 3UB7A 3CG5A 2KOIA 2Y2KA 2P9VA 3LR5A 1Y28A 3SS3A 5EM1A 1YT4A 5E2HA 4WMCD 3MFDA 4HJ6A 2LB5A 4E3OA 4Z9QA 2Y2NA 4KZ8A 3IF5A 4OKPA 3N8RA 4WM9A 3Q81A 3HREA 3BLSA 3VP0A 1RCJA 1PWGA 3H9WA 1S1YA 1XXMA 1OTEA 4YINA 1KDSA 2D02A 4QY6A 4BJPA 3SH9A 2WGWA 2HDSA 4JGRA 4L9EA 3G2YA 4WUJA 4S2IA 2YKHA 1I5QA 3NDEA 1VEUA 1FCNA 3KSFA 5CRFA 3EOIA 4HI4A 5DVAA 4ZJ3A 4EBLA 4LRZE 4N1HA 3E4QA 3BLMA 3ZNTA 2ZOHA 5CEBA 4MEZA 2P04A 4KZ6A 1ZTUA 2O9BA 3WS5A 3LFVA 4ESPA 3C5AA 3OCNA 3ZG5A 3VP3A 2O99A 1ZC2A
chains in the Genus database with same CATH topology
5FSRA 1KDWA 1XGJA 1ESIA 1IELA 2HDUA 1ES2A 5FQ9A 1YM1A 3MBZA 4N9KA 5TR7A 1PI5A 4WBGA 3VP4A 5TFQA 5FDHA 2XQZA 2ZMAA 2H5SA 3GR2A 1CI9A 2JE5A 4WMCA 2ZM2A 3CZDA 5CGSA 3DWZA 3VSKA 1L0EA 3OZHA 4X55A 4DE0A 3IF6C 3G31A 5A91A 4KG2A 4OLDA 5DTSA 5HL1A 1KE4A 3NC8A 3PBTA 2ZC7A 1LI0A 3ZCZA 5FQQA 3V3RA 1FSYA 1NYYA 2WYXA 5E2EA 4IVIA 3WS0A 4N1XA 5FI6A 5CGWA 3BFEA 4WZ5A 3UY6A 1H5XA 4K91A 4KZ9A 5DTTA 1U60A 1HVBA 1FQGA 1WE4A 2XLNA 3BFGA 1WYBA 3BRMA 3QNBA 4LV0A 4DE1A 3ITBA 2R9XA 4IVKA 2ZQ9A 3IHBA 2Y2MA 3ZHHA 1K56D 2DCFA 5KSCA 1BULA 5DTKA 4JF6A 1MWRA 5KSHA 2WKHA 4Y0TA 3PTEA 5J8XA 1YMXA 1SCWA 4XXRA 3IQAA 5FA7A 3VFHA 4BQMA 4JXGA 5EECA 4NK3A 4UAAA 5AQ9A 3DWKA 1W79A 2PU2A 1G6AA 4WYYA 5CTNA 5FQKA 3TOIA 3VP2A 4S2KA 4UHUA 3S1YA 5FAQA 1O7EA 4QU3A 4R4RA 1YLZA 4IBRA 1K57C 2J8YA 4XUZA 3FV7A 5CEDA 1K54A 1EI5A 1BLHA 3QNCA 1FR6A 3WRZA 3W8KA 5EVID 1CK3A 4L0LA 5M1AA 3S4XA 2EFXA 5HARA 4GKUA 1W8QA 3VOYA 2JC7A 1PW8A 4E3NA 3Q7ZA 1PWCA 4K0WA 1LLBA 2ZJ9A 3GTCA 4PM5A 1XP4A 5CHUA 4BLMA 3W4PA 4JLFA 1RP5A 1ZG4A 4X69A 5CHJA 4HEFA 4ZAMA 3W4QA 3FWLA 5CXWA 2X71A 5FQJA 2P9VB 1MY8A 3NBLA 1N4OA 4KZ5A 1MWSA 5FI2A 1KVMA 1Q2QA 3C7VA 3V5MA 5CERA 3ZG0A 1E25A 3G32A 3HUMA 4R4SA 1FSWA 1IYQA 3LEZA 5FQIA 4OPYA 1KE0A 2WZXA 4Q8IA 2H10A 5U47A 1Z6FA 4KZ7A 3E2LA 4C6YA 5BOHA 3Q82A 4DXCA 1YLWA 4KZ3A 4GDBA 1TDGA 5M19A 2X01A 2EX9A 2PBYA 4WEJA 2VGKA 3EQVA 4GOGA 4X56A 5GL9A 3MZDA 2Y2IA 1FOFA 1YLYA 4QY5A 3RJUA 4LENA 3UDFA 2Y2LA 3GQZA 1K55A 4QHCA 1LI9A 1S0WA 2WAFA 1ALQA 3EQUA 4FD8A 3OCLA 1K25A 2RCXA 3HL9A 4OVDA 3SH8A 3PAGA 5A92A 1OMEA 5CECA 4OP5A 4JXVA 4BD0A 1L2SA 4RA7A 4ZBEA 5HAPA 3NI9A 1NZUA 5I94A 4JKTA 1KE3A 4DE2A 3ITAA 3C4PA 4E3IA 1XKZA 4DXBA 3PBRA 5JYPA 5FQMA 4OH0A 1PYYA 4BENA 1HZOA 2HPBA 2C6WB 1K56A 4RVAA 2OLUA 4KG6A 4EV4A 2BLSA 4QJGA 1XGIA 4R1GA 2WUQA 5GLCA 1H8ZA 5EOEA 4HESA 4PM8A 1XA7A 4S2NC 3NDGA 1ZKJA 4S2OA 4EQIA 3VFFA 5F1FA 4YFMA 4ID4A 2ZC6B 2XFTA 2ZM8A 3HLEA 4MBFA 4U0TA 2Y2QA 4PMAA 4PM6A 3RXWA 4DF6A 5HX9A 3B3XA 1GHPA 3NIAA 4DE3A 3OPHA 5EVIA 2Y2HA 1MKIA 2UWXA 3OPRA 3MKFA 2BG1A 5GLBA 1VQQA 1H8YA 2WKEA 4OPQA 1JWVA 1HTZA 2R9WA 2QMIA 1M6KA 2I72A 3LCEA 4S2MA 2Q9MA 3ZDJA 1NRFA 3VSLA 4P87A 4MBKA 1BSGA 4E6XA 3WWXA 3G30A 5D3OA 4CPKA 4EWFA 4NETA 1IYSA 3HUNA 3IXDA 1I2SA 1AXBA 3IWIA 3GVBA 5HAIA 3G2ZA 3JYIA 4C3QA 4RX2A 3NY4A 2EXBA 3GSGA 1NZOA 1LL5A 1E4DA 1K38A 3UPNA 1CI8A 3OPPA 4GD6A 4KZBA 2CC1A 4EUZA 1ES5A 1ONHA 4JPMA 2WGVA 5FAOA 3BYDA 1CEGA 4LV1A 1Q2PA 1W8YA 1VM1A 4UA9A 1FCOA 4B4XA 2FFFB 3AGDA 4R3JA 4ZTKA 1JTDA 1RGZA 2H0YA 4KQRA 3PBOA 4Y7PA 3CMZA 3SH7A 2VGJA 1M40A 2V1ZA 2G2WA 5L2FA 3M2JA 1O07A 1GA9A 3HLDA 4K0XA 4P6BA 1GHIA 3C7UA 4LCLA 3V39A 1DJBA 5E2FA 2P74A 1BUEA 2Y59A 4GDNA 3IF6A 1KGGA 3ZNYA 3O88A 4FCFA 1JWZA 2IWDA 1BLCA 4E6WA 2ZC3B 2ZLYA 2XR0A 4XUXA 3V3SA 1ES3A 4E3KA 3BFCA 3NCKA 2Y55A 2PU4A 3QHYA 2ZQ7A 1K4FA 4M3KA 2EX2A 2XF3A 4OQ0A 2WAEA 3IXBA 3N7WA 1TDLA 2JCHA 1L0GA 3HLGA 4KZ4A 5EOOA 3ZG8B 3HVFA 4PM9A 2HP9A 3HLFA 4JXWA 2HDQA 3FKWA 3OPLA 5A90A 4R3BA 3LY4A 3PBQA 4Y0UA 3MZFA 1G68A 3MXRA 1K57A 1YLPA 2XK1A 2Y2GA 3E2KA 3UO9A 1E3UD 2RL3A 1KGEA 2JBFA 3HLCA 3G4PA 4B88A 3GV9A 3MKEA 1DJCA 1BLPA 2B5RA 3ISGA 3VMAA 3N6IA 1IKIA 2A49A 3N4IA 3A3DA 1JTGA 5CTMA 3WRTA 4FH4A 5GLDA 4KENB 2IWCA 1K6RA 2Y2JA 4PM7A 1J9MA 2EFUA 5HAQA 3IWOA 1MWUA 4FH2A 4ZJ2A 3S22A 2XFSA 1MBLA 4MNRA 5IHVA 4ZJ1A 4OQGA 2ZD8A 2Z2LB 3AGEA 3ZVTA 1Y54A 4ZDXA 1IEMA 3UDXA 3G34A 5EUAA 3HLBA 4QD4A 2OSUA 3UE1A 3MXSA 3IWQA 3UNWA 2XD5A 4BL3A 2A3UA 1XA1A 1ZG6A 4LV3A 4S2JA 3MZEA 2C5WB 1NY0A 4OQHA 4RX3A 1JWPA 2DNSA 2QZ6A 4WZ5C 1TEMA 3PBNA 3PBSA 5E2GA 1S6RA 5F83A 3HBRA 5G18A 3UN7A 3WS1A 3UE3A 4IBXA 3O86A 2J9PA 4H8RA 5DF9A 1IKGA 1EROA 1JVJA 4CJNA 2XH9A 2ZC5B 3GRJA 4OP8A 2XEPA 3IXGA 4QB8A 3BM6A 3CJMA 4B4ZA 1XX2A 5DF8A 3SOIA 3ZGAB 1C3BA 4P85A 1GA0A 3P09A 1ERMA 3A3IA 1YLJA 1PW1A 1IYOA 3D4FA 3O87A 2Y4AA 3RXXA 1KGFA 2ZQ8A 3BECA 1K4EA 4DDYA 1N9BA 3TG9A 3P98A 5FAPA 1K54C 1NJ4A 1PIOA 1L0DA 4OOLA 4R0QA 1L0FA 1I2WA 2WKIA 4WZ4A 3ZFZA 3Q7VA 1FR1A 4GZBA 5EVIB 1YLTA 2ZQCA 4BL2A 3M6HA 5CGXA 3SS5A 2J7VA 5HW3A 4DRTA 1NXYA 3OC2A 1RGYA 2Y2PA 4A5RA 2XDMA 2ZQDA 4UA7A 3FZCA 2WGIA 2Y91A 4IEDA 5GLAA 1MPLA 3A3JA 5EE8A 4R23A 3TSGA 3C4OA 1PZPA 4X6TA 1SHVA 2G2UA 1QMFA 2HP5A 4S2NA 2EXAA 2ZC4B 4D2OA 3Q7VB 1YQSA 5GHZA 1CEFA 4O7DA 2DRWA 5A93A 2X02A 4KG5A 4WEKA 5EVLA 1E3UA 1LL9A 4MLLA 4GD8A 5CHMA 3G35A 4X68A 5AQ7A 2Z2MB 5TGFA 5EPHA 4E3MA 2E8IA 4OONA 3WS2A 1DY6A 3WS4A 1ONGA 4E3JA 1IYPA 3W4OA 1GCEA 5FATA 4N9LA 5AQBA 4OOYA 4UA6A 4KZAA 4U3TA 1HD8A 3O3VA 1SDNA 4MBHA 3CG5A 1W7FA 3A3FA 3UDIA 1SKFA 2Y2KA 3BFFA 2P9VA 3SS3A 3GMWA 3VOZA 1ERQA 4U0XA 1K55C 4F94A 1WYCA 1YT4A 2GDNA 5E2HA 2WK0A 1TVFA 5E43A 4HBUA 2FFYA 4WMCD 3MFDA 1ES4A 3FYZA 5F82A 3VP1A 1LHYA 4E3OA 4Z9QA 5M18A 2OV5A 2Y2NA 5JYOA 3SS4A 3IF6B 4KQQA 4KZ8A 3IF5A 5DF7A 1BLSA 1PI4A 4OKPA 1PZOA 3IH8A 3N8RA 5GHYA 5GHXA 4DDSA 3ZG7B 4S2LA 4WM9A 2Y2OA 1NYMA 3HREA 3M6BA 3Q81A 4KQOA 3BLSA 3AGFA 2OLVA 4GN2A 1K6SA 3VP0A 4N92A 4OOMA 1RCJA 1PWGA 1XXMA 2J9OA 1GHMA 1DJAA 1QMEA 3BFDA 4JBFA 4X53A 4YINA 1KDSA 3Q1FA 5HFOA 4QY6A 1YMSA 4FSFA 4DKIA 4BD1A 3HLWA 4BJPA 4C75A 1BT5A 4JXSA 5FASA 3SH9A 1MXOA 2EX6A 2V2FF 2WGWA 2IWBA 2HDSA 4HBTA 4EBPA 1BTLA 3I7JA 3N8SA 3G2YA 4E3LA 4RYEA 1KVLA 5AQAA 2WZZA 3A3EA 4EBNA 4S2IA 5EVIC 1ESUA 2EX8A 1I5QA 3NDEA 1FCNA 3ZG9B 2QPNA 4WELA 2ZM0A 1XPBA 4PPRA 5CRFA 3HUOA 3UE0A 1EWZA 3ZVWA 1BZAA 2HP6A 4Y0OA 5DVAA 4ZJ3A 5FI7A 3IT9A 1W5DA 3LO7A 4OQIA 2WGWB 3DTMA 3V50A 4EBLA 5KMWA 4GNUA 2HDRA 2XD1A 2ZQAA 3FKVA 4LCMA 5KZHA 3IXHA 1MWTA 2WADA 4N1HA 1SDEA 2Q9NA 5F1GA 2H0TA 3IH9A 3IHAA 4JF5A 3BLMA 4GB7A 4P0MA 3M2KA 3LY3A 3ZNTA 3UPOA 4LV2A 3N8LA 5CEBA 4OLGA 3BEBA 4MEZA 2V20A 3DW0A 1FCMA 4KZ6A 3Q07A 3UPPA 4OPZA 3WS5A 4S2PA 2XGNA 1PWDA 3C5AA 3OCNA 3PAEA 4OPRA 3ZG5A 4JF4A 3VP3A 1ZC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSR A;  1KDW A;  1XGJ A;  1ESI A;  1IEL A;  2HDU A;  1ES2 A;  5FQ9 A;  1YM1 A;  3MBZ A;  4N9K A;  5TR7 A;  1PI5 A;  4WBG A;  3VP4 A;  5TFQ A;  5FDH A;  2XQZ A;  2ZMA A;  2H5S A;  3GR2 A;  1CI9 A;  2JE5 A;  4WMC A;  2ZM2 A;  3CZD A;  5CGS A;  3DWZ A;  3VSK A;  1L0E A;  3OZH A;  4X55 A;  4DE0 A;  3IF6 C;  3G31 A;  5A91 A;  4KG2 A;  4OLD A;  5DTS A;  5HL1 A;  1KE4 A;  3NC8 A;  3PBT A;  2ZC7 A;  1LI0 A;  3ZCZ A;  5FQQ A;  3V3R A;  1FSY A;  1NYY A;  2WYX A;  5E2E A;  4IVI A;  3WS0 A;  4N1X A;  5FI6 A;  5CGW A;  3BFE A;  4WZ5 A;  3UY6 A;  1H5X A;  4K91 A;  4KZ9 A;  5DTT A;  1U60 A;  1HVB A;  1FQG A;  1WE4 A;  2XLN A;  3BFG A;  1WYB A;  3BRM A;  3QNB A;  4LV0 A;  4DE1 A;  3ITB A;  2R9X A;  4IVK A;  2ZQ9 A;  3IHB A;  2Y2M A;  3ZHH A;  1K56 D;  2DCF A;  5KSC A;  1BUL A;  5DTK A;  4JF6 A;  1MWR A;  5KSH A;  2WKH A;  4Y0T A;  3PTE A;  5J8X A;  1YMX A;  1SCW A;  4XXR A;  3IQA A;  5FA7 A;  3VFH A;  4BQM A;  4JXG A;  5EEC A;  4NK3 A;  4UAA A;  5AQ9 A;  3DWK A;  1W79 A;  2PU2 A;  1G6A A;  4WYY A;  5CTN A;  5FQK A;  3TOI A;  3VP2 A;  4S2K A;  4UHU A;  3S1Y A;  5FAQ A;  1O7E A;  4QU3 A;  4R4R A;  1YLZ A;  4IBR A;  1K57 C;  2J8Y A;  4XUZ A;  3FV7 A;  5CED A;  1K54 A;  1EI5 A;  1BLH A;  3QNC A;  1FR6 A;  3WRZ A;  3W8K A;  5EVI D;  1CK3 A;  4L0L A;  5M1A A;  3S4X A;  2EFX A;  5HAR A;  4GKU A;  1W8Q A;  3VOY A;  2JC7 A;  1PW8 A;  4E3N A;  3Q7Z A;  1PWC A;  4K0W A;  1LLB A;  2ZJ9 A;  3GTC A;  4PM5 A;  1XP4 A;  5CHU A;  4BLM A;  3W4P A;  4JLF A;  1RP5 A;  1ZG4 A;  4X69 A;  5CHJ A;  4HEF A;  4ZAM A;  3W4Q A;  3FWL A;  5CXW A;  2X71 A;  5FQJ A;  2P9V B;  1MY8 A;  3NBL A;  1N4O A;  4KZ5 A;  1MWS A;  5FI2 A;  1KVM A;  1Q2Q A;  3C7V A;  3V5M A;  5CER A;  3ZG0 A;  1E25 A;  3G32 A;  3HUM A;  4R4S A;  1FSW A;  1IYQ A;  3LEZ A;  5FQI A;  4OPY A;  1KE0 A;  2WZX A;  4Q8I A;  2H10 A;  5U47 A;  1Z6F A;  4KZ7 A;  3E2L A;  4C6Y A;  5BOH A;  3Q82 A;  4DXC A;  1YLW A;  4KZ3 A;  4GDB A;  1TDG A;  5M19 A;  2X01 A;  2EX9 A;  2PBY A;  4WEJ A;  2VGK A;  3EQV A;  4GOG A;  4X56 A;  5GL9 A;  3MZD A;  2Y2I A;  1FOF A;  1YLY A;  4QY5 A;  3RJU A;  4LEN A;  3UDF A;  2Y2L A;  3GQZ A;  1K55 A;  4QHC A;  1LI9 A;  1S0W A;  2WAF A;  1ALQ A;  3EQU A;  4FD8 A;  3OCL A;  1K25 A;  2RCX A;  3HL9 A;  4OVD A;  3SH8 A;  3PAG A;  5A92 A;  1OME A;  5CEC A;  4OP5 A;  4JXV A;  4BD0 A;  1L2S A;  4RA7 A;  4ZBE A;  5HAP A;  3NI9 A;  1NZU A;  5I94 A;  4JKT A;  1KE3 A;  4DE2 A;  3ITA A;  3C4P A;  4E3I A;  1XKZ A;  4DXB A;  3PBR A;  5JYP A;  5FQM A;  4OH0 A;  1PYY A;  4BEN A;  1HZO A;  2HPB A;  2C6W B;  1K56 A;  4RVA A;  2OLU A;  4KG6 A;  4EV4 A;  2BLS A;  4QJG A;  1XGI A;  4R1G A;  2WUQ A;  5GLC A;  1H8Z A;  5EOE A;  4HES A;  4PM8 A;  1XA7 A;  4S2N C;  3NDG A;  1ZKJ A;  4S2O A;  4EQI A;  3VFF A;  5F1F A;  4YFM A;  4ID4 A;  2ZC6 B;  2XFT A;  2ZM8 A;  3HLE A;  4MBF A;  4U0T A;  2Y2Q A;  4PMA A;  4PM6 A;  3RXW A;  4DF6 A;  5HX9 A;  3B3X A;  1GHP A;  3NIA A;  4DE3 A;  3OPH A;  5EVI A;  2Y2H A;  1MKI A;  2UWX A;  3OPR A;  3MKF A;  2BG1 A;  5GLB A;  1VQQ A;  1H8Y A;  2WKE A;  4OPQ A;  1JWV A;  1HTZ A;  2R9W A;  2QMI A;  1M6K A;  2I72 A;  3LCE A;  4S2M A;  2Q9M A;  3ZDJ A;  1NRF A;  3VSL A;  4P87 A;  4MBK A;  1BSG A;  4E6X A;  3WWX A;  3G30 A;  5D3O A;  4CPK A;  4EWF A;  4NET A;  1IYS A;  3HUN A;  3IXD A;  1I2S A;  1AXB A;  3IWI A;  3GVB A;  5HAI A;  3G2Z A;  3JYI A;  4C3Q A;  4RX2 A;  3NY4 A;  2EXB A;  3GSG A;  1NZO A;  1LL5 A;  1E4D A;  1K38 A;  3UPN A;  1CI8 A;  3OPP A;  4GD6 A;  4KZB A;  2CC1 A;  4EUZ A;  1ES5 A;  1ONH A;  4JPM A;  2WGV A;  5FAO A;  3BYD A;  1CEG A;  4LV1 A;  1Q2P A;  1W8Y A;  1VM1 A;  4UA9 A;  1FCO A;  4B4X A;  2FFF B;  3AGD A;  4R3J A;  4ZTK A;  1JTD A;  1RGZ A;  2H0Y A;  4KQR A;  3PBO A;  4Y7P A;  3CMZ A;  3SH7 A;  2VGJ A;  1M40 A;  2V1Z A;  2G2W A;  5L2F A;  3M2J A;  1O07 A;  1GA9 A;  3HLD A;  4K0X A;  4P6B A;  1GHI A;  3C7U A;  4LCL A;  3V39 A;  1DJB A;  5E2F A;  2P74 A;  1BUE A;  2Y59 A;  4GDN A;  3IF6 A;  1KGG A;  3ZNY A;  3O88 A;  4FCF A;  1JWZ A;  2IWD A;  1BLC A;  4E6W A;  2ZC3 B;  2ZLY A;  2XR0 A;  4XUX A;  3V3S A;  1ES3 A;  4E3K A;  3BFC A;  3NCK A;  2Y55 A;  2PU4 A;  3QHY A;  2ZQ7 A;  1K4F A;  4M3K A;  2EX2 A;  2XF3 A;  4OQ0 A;  2WAE A;  3IXB A;  3N7W A;  1TDL A;  2JCH A;  1L0G A;  3HLG A;  4KZ4 A;  5EOO A;  3ZG8 B;  3HVF A;  4PM9 A;  2HP9 A;  3HLF A;  4JXW A;  2HDQ A;  3FKW A;  3OPL A;  5A90 A;  4R3B A;  3LY4 A;  3PBQ A;  4Y0U A;  3MZF A;  1G68 A;  3MXR A;  1K57 A;  1YLP A;  2XK1 A;  2Y2G A;  3E2K A;  3UO9 A;  1E3U D;  2RL3 A;  1KGE A;  2JBF A;  3HLC A;  3G4P A;  4B88 A;  3GV9 A;  3MKE A;  1DJC A;  1BLP A;  2B5R A;  3ISG A;  3VMA A;  3N6I A;  1IKI A;  2A49 A;  3N4I A;  3A3D A;  1JTG A;  5CTM A;  3WRT A;  4FH4 A;  5GLD A;  4KEN B;  2IWC A;  1K6R A;  2Y2J A;  4PM7 A;  1J9M A;  2EFU A;  5HAQ A;  3IWO A;  1MWU A;  4FH2 A;  4ZJ2 A;  3S22 A;  2XFS A;  1MBL A;  4MNR A;  5IHV A;  4ZJ1 A;  4OQG A;  2ZD8 A;  2Z2L B;  3AGE A;  3ZVT A;  1Y54 A;  4ZDX A;  1IEM A;  3UDX A;  3G34 A;  5EUA A;  3HLB A;  4QD4 A;  2OSU A;  3UE1 A;  3MXS A;  3IWQ A;  3UNW A;  2XD5 A;  4BL3 A;  2A3U A;  1XA1 A;  1ZG6 A;  4LV3 A;  4S2J A;  3MZE A;  2C5W B;  1NY0 A;  4OQH A;  4RX3 A;  1JWP A;  2DNS A;  2QZ6 A;  4WZ5 C;  1TEM A;  3PBN A;  3PBS A;  5E2G A;  1S6R A;  5F83 A;  3HBR A;  5G18 A;  3UN7 A;  3WS1 A;  3UE3 A;  4IBX A;  3O86 A;  2J9P A;  4H8R A;  5DF9 A;  1IKG A;  1ERO A;  1JVJ A;  4CJN A;  2XH9 A;  2ZC5 B;  3GRJ A;  4OP8 A;  2XEP A;  3IXG A;  4QB8 A;  3BM6 A;  3CJM A;  4B4Z A;  1XX2 A;  5DF8 A;  3SOI A;  3ZGA B;  1C3B A;  4P85 A;  1GA0 A;  3P09 A;  1ERM A;  3A3I A;  1YLJ A;  1PW1 A;  1IYO A;  3D4F A;  3O87 A;  2Y4A A;  3RXX A;  1KGF A;  2ZQ8 A;  3BEC A;  1K4E A;  4DDY A;  1N9B A;  3TG9 A;  3P98 A;  5FAP A;  1K54 C;  1NJ4 A;  1PIO A;  1L0D A;  4OOL A;  4R0Q A;  1L0F A;  1I2W A;  2WKI A;  4WZ4 A;  3ZFZ A;  3Q7V A;  1FR1 A;  4GZB A;  5EVI B;  1YLT A;  2ZQC A;  4BL2 A;  3M6H A;  5CGX A;  3SS5 A;  2J7V A;  5HW3 A;  4DRT A;  1NXY A;  3OC2 A;  1RGY A;  2Y2P A;  4A5R A;  2XDM A;  2ZQD A;  4UA7 A;  3FZC A;  2WGI A;  2Y91 A;  4IED A;  5GLA A;  1MPL A;  3A3J A;  5EE8 A;  4R23 A;  3TSG A;  3C4O A;  1PZP A;  4X6T A;  1SHV A;  2G2U A;  1QMF A;  2HP5 A;  4S2N A;  2EXA A;  2ZC4 B;  4D2O A;  3Q7V B;  1YQS A;  5GHZ A;  1CEF A;  4O7D A;  2DRW A;  5A93 A;  2X02 A;  4KG5 A;  4WEK A;  5EVL A;  1E3U A;  1LL9 A;  4MLL A;  4GD8 A;  5CHM A;  3G35 A;  4X68 A;  5AQ7 A;  2Z2M B;  5TGF A;  5EPH A;  4E3M A;  2E8I A;  4OON A;  3WS2 A;  1DY6 A;  3WS4 A;  1ONG A;  4E3J A;  1IYP A;  3W4O A;  1GCE A;  5FAT A;  4N9L A;  5AQB A;  4OOY A;  4UA6 A;  4KZA A;  4U3T A;  1HD8 A;  3O3V A;  1SDN A;  4MBH A;  3CG5 A;  1W7F A;  3A3F A;  3UDI A;  1SKF A;  2Y2K A;  3BFF A;  2P9V A;  3SS3 A;  3GMW A;  3VOZ A;  1ERQ A;  4U0X A;  1K55 C;  4F94 A;  1WYC A;  1YT4 A;  2GDN A;  5E2H A;  2WK0 A;  1TVF A;  5E43 A;  4HBU A;  2FFY A;  4WMC D;  3MFD A;  1ES4 A;  3FYZ A;  5F82 A;  3VP1 A;  1LHY A;  4E3O A;  4Z9Q A;  5M18 A;  2OV5 A;  2Y2N A;  5JYO A;  3SS4 A;  3IF6 B;  4KQQ A;  4KZ8 A;  3IF5 A;  5DF7 A;  1BLS A;  1PI4 A;  4OKP A;  1PZO A;  3IH8 A;  3N8R A;  5GHY A;  5GHX A;  4DDS A;  3ZG7 B;  4S2L A;  4WM9 A;  2Y2O A;  1NYM A;  3HRE A;  3M6B A;  3Q81 A;  4KQO A;  3BLS A;  3AGF A;  2OLV A;  4GN2 A;  1K6S A;  3VP0 A;  4N92 A;  4OOM A;  1RCJ A;  1PWG A;  1XXM A;  2J9O A;  1GHM A;  1DJA A;  1QME A;  3BFD A;  4JBF A;  4X53 A;  4YIN A;  1KDS A;  3Q1F A;  5HFO A;  4QY6 A;  1YMS A;  4FSF A;  4DKI A;  4BD1 A;  3HLW A;  4BJP A;  4C75 A;  1BT5 A;  4JXS A;  5FAS A;  3SH9 A;  1MXO A;  2EX6 A;  2V2F F;  2WGW A;  2IWB A;  2HDS A;  4HBT A;  4EBP A;  1BTL A;  3I7J A;  3N8S A;  3G2Y A;  4E3L A;  4RYE A;  1KVL A;  5AQA A;  2WZZ A;  3A3E A;  4EBN A;  4S2I A;  5EVI C;  1ESU A;  2EX8 A;  1I5Q A;  3NDE A;  1FCN A;  3ZG9 B;  2QPN A;  4WEL A;  2ZM0 A;  1XPB A;  4PPR A;  5CRF A;  3HUO A;  3UE0 A;  1EWZ A;  3ZVW A;  1BZA A;  2HP6 A;  4Y0O A;  5DVA A;  4ZJ3 A;  5FI7 A;  3IT9 A;  1W5D A;  3LO7 A;  4OQI A;  2WGW B;  3DTM A;  3V50 A;  4EBL A;  5KMW A;  4GNU A;  2HDR A;  2XD1 A;  2ZQA A;  3FKV A;  4LCM A;  5KZH A;  3IXH A;  1MWT A;  2WAD A;  4N1H A;  1SDE A;  2Q9N A;  5F1G A;  2H0T A;  3IH9 A;  3IHA A;  4JF5 A;  3BLM A;  4GB7 A;  4P0M A;  3M2K A;  3LY3 A;  3ZNT A;  3UPO A;  4LV2 A;  3N8L A;  5CEB A;  4OLG A;  3BEB A;  4MEZ A;  2V20 A;  3DW0 A;  1FCM A;  4KZ6 A;  3Q07 A;  3UPP A;  4OPZ A;  3WS5 A;  4S2P A;  2XGN A;  1PWD A;  3C5A A;  3OCN A;  3PAE A;  4OPR A;  3ZG5 A;  4JF4 A;  3VP3 A;  1ZC2 A; 
#chains in the Genus database with same CATH topology
 3MBZ A;  5TFQ A;  4PKY G;  3OOV A;  3GR2 A;  2JE5 A;  1IOU A;  5CGS A;  4PAU A;  3IF6 C;  3G31 A;  4I39 A;  5HL1 A;  5FQQ A;  1FSY A;  3FC7 A;  4WZ5 A;  1WYB A;  4LV0 A;  1K56 D;  5CX7 A;  4CLC B;  1OTD A;  3ZQ5 A;  2PHY A;  1YMX A;  3VFH A;  5EEC A;  4UAA A;  1YSP A;  3JVV A;  5FQK A;  3KSH A;  4S2K A;  3S1Y A;  5FAQ A;  1GSV A;  1O7E A;  4HY8 A;  5HWW A;  3PXP A;  1YLZ A;  4IBR A;  1K57 C;  5CED A;  1K54 A;  1FR6 A;  5EVI D;  2HJE A;  4L0L A;  5M1A A;  3S4X A;  2J3T C;  3ZYT A;  5HAR A;  4GKU A;  1W8Q A;  3VOY A;  2W1T A;  1PWC A;  4K0W A;  4KUO A;  2ZJ9 A;  1RP5 A;  2XRN A;  3W4Q A;  1Z09 A;  4WL9 A;  5FQJ A;  1VET A;  2P9V B;  4ARZ B;  3V5M A;  3ZG0 A;  5K5B A;  1DP9 A;  4MDZ A;  4Q8I A;  2H10 A;  2W0N A;  2MJ6 A;  4HJ3 A;  4GDB A;  5M19 A;  2X01 A;  2EX9 A;  4QHC A;  2WAF A;  4OVD A;  3VE3 A;  1OME A;  3KYQ A;  1XKZ A;  3H7W A;  4DXB A;  1VEU B;  4OH0 A;  4R6L A;  1HZO A;  1H8M A;  2C6W B;  3CI6 A;  4RVA A;  1D06 A;  2OLU A;  2BLS A;  4FOF A;  4PM8 A;  2P7J A;  5F1F A;  4YFM A;  2QKP A;  2XFT A;  3HLE A;  4U0T A;  3VOL A;  4PM6 A;  3RXW A;  4DF6 A;  5HX9 A;  3W2Z A;  4DE3 A;  2Y2H A;  4LLO B;  1MKI A;  3OPR A;  3FPW A;  3MKF A;  3LIF A;  1HTZ A;  2I72 A;  4S2M A;  3KSG A;  3CUE A;  2ACG A;  1TS7 A;  4P87 A;  1BSG A;  4E6X A;  3G30 A;  4CPK A;  1GSW A;  3IXD A;  1YAX A;  1AXB A;  4ETZ A;  5HWV A;  5L07 A;  1E4D A;  1K38 A;  3OPP A;  2CC1 A;  1ONH A;  4JPM A;  1CEG A;  1DRM A;  1Q2P A;  2FFF B;  4R3J A;  1CQA A;  3BW6 A;  2V1Z A;  2B02 A;  4UQI M;  2G2W A;  4XT2 B;  5L2F A;  2G7U A;  2FH5 A;  4K0X A;  1GA9 A;  1K0K A;  3HJK A;  4IHQ A;  4EET B;  1KGG A;  4FCF A;  5DFY A;  2IWD A;  5LBR A;  4XUX A;  2M7V A;  3NOU C;  3RFB A;  1GSX A;  5AJG A;  2Y55 A;  2PU4 A;  4BBV A;  3RH8 B;  4NG2 A;  2PR6 A;  2JCH A;  3S7N A;  5EOO A;  1YKD A;  3ZG8 B;  3HLF A;  1VET B;  4R3B A;  4Y0U A;  2PRF A;  4AFI A;  2PD8 A;  2W3E A;  2Y2G A;  2JBF A;  3HLC A;  4NKP A;  3LIA A;  5F69 A;  3ISG A;  5F68 A;  2ZL1 B;  3A3D A;  3WRT A;  5CTM A;  4FH4 A;  4KEN B;  2IWC A;  5HAQ A;  3IWO A;  4FH2 A;  1SKO A;  1ZHH B;  4ZJ1 A;  2ZD8 A;  2Z2L B;  3LR4 A;  1IEM A;  3G34 A;  3A0R A;  3UNW A;  4LV3 A;  2C5W B;  2PYR A;  5F83 A;  5L10 A;  5DF9 A;  1JVJ A;  3LIE A;  3E0Y A;  4OP8 A;  2GX5 A;  2XEP A;  4QB8 A;  2QJ7 A;  4P6Z M;  5EV0 A;  1YLJ A;  1IYO A;  2Q0O A;  3LIB A;  2ZQ8 A;  3BEC A;  1K4E A;  4DDY A;  3P98 A;  1NJ4 A;  4R0Q A;  4WZ4 A;  3ZFZ A;  1YLT A;  5HD3 A;  2JKR M;  3SS5 A;  3DTE A;  1TS8 A;  1YSQ A;  3OBF A;  1J3W A;  1MPL A;  4LGW A;  1PZP A;  4X6T A;  2G2U A;  1QMF A;  3Q7V B;  1YQS A;  5GHZ A;  5A8B A;  2V8C A;  5A93 A;  3MQ0 A;  1E3U A;  3KSI A;  3G35 A;  5EPH A;  3BQA A;  4LRY C;  1DY6 A;  4E3J A;  5AQB A;  4OOY A;  4KZA A;  3EGD C;  1W7F A;  3BFF A;  3IBR A;  1WYC A;  2WK0 A;  4MN5 A;  1ES4 A;  3FYZ A;  5F82 A;  1LHY A;  2OV5 A;  2VLG A;  1FIL A;  1PI4 A;  1PZO A;  5GHX A;  4DDS A;  4S2L A;  2HJ9 C;  3M6B A;  2HZ5 A;  3E98 A;  2OLV A;  2K2N A;  4N92 A;  2JHE A;  5TBM B;  4JBF A;  4X53 A;  2ZBB A;  2QHK A;  4DKI A;  3LID A;  4C75 A;  5FAS A;  1UWP X;  2IWB A;  4EBP A;  1BTL A;  2NUT C;  3I7J A;  3N8S A;  4RYE A;  1KVL A;  3T4Q A;  5EVI C;  1ESU A;  2EX8 A;  2JKF A;  2JKG A;  1PNE A;  3ZG9 B;  3HUO A;  1EWZ A;  2OAP 1;  2JKR I;  5FI7 A;  1MC0 A;  3LO7 A;  4OQI A;  5KMW A;  4NXF A;  4GNU A;  3HJI A;  2HDR A;  2ZQA A;  4LCM A;  3IXH A;  2J80 A;  2Q9N A;  5F1G A;  1OT9 A;  3IH9 A;  3IHA A;  3NHQ A;  1PFL A;  4LV2 A;  3Q07 A;  3NEC A;  2XGN A;  1PWD A;  4GS9 B;  1XJ3 A;  4O01 A;  3BJN A;  3U2A A;  3MSH A;  4HP4 A;  4CQH A;  3C30 A;  5HSQ A;  1YM1 A;  4IUH A;  4WBG A;  3VP4 A;  1MKM A;  2ZMA A;  2H5S A;  3KX0 X;  2B95 A;  4CLC A;  4M4X A;  3OZH A;  5G4Y A;  5A91 A;  2VJW A;  4OLD A;  5HPI A;  2V1A A;  3NC8 A;  2ZC7 A;  3V3R A;  2WYX A;  5CGW A;  1HVB A;  4IVK A;  4Y0T A;  3IQA A;  5FA7 A;  4D60 A;  4JXG A;  3U4L P;  3DWK A;  1W79 A;  1G6A A;  3C2W A;  4WYY A;  4UHU A;  1TD5 A;  3T4L A;  4QU3 A;  4XUZ A;  1EI5 A;  4ARZ A;  3QNC A;  4Y13 A;  3W8K A;  1CK3 A;  2EFX A;  2VV8 A;  2P08 A;  3D3O A;  2JC7 A;  1PW8 A;  3Q7Z A;  3GTC A;  4JLF A;  1TS6 A;  4HEF A;  1NRJ A;  4HJ4 A;  2X71 A;  3T4J A;  4KZ5 A;  5FI2 A;  3C7V A;  3G32 A;  1S67 L;  3LEZ A;  3QP6 A;  5FQI A;  4OPY A;  4NXG A;  1KE0 A;  1Z6F A;  4KZ7 A;  2CMN A;  5BOH A;  3Q82 A;  1WA9 A;  2PDR A;  1TDG A;  4WF0 A;  2VGK A;  3MZD A;  4QY5 A;  1FOF A;  4CLC E;  2V8F A;  3UDF A;  3GQZ A;  1K55 A;  1LI9 A;  1S0W A;  1F2K A;  4FD8 A;  1K25 A;  4YOF A;  2RCX A;  3HL9 A;  5CEC A;  4BD0 A;  5I94 A;  1KE3 A;  2QYB A;  3ITA A;  3MF0 A;  4E04 A;  1XFQ A;  5IS1 A;  2FZ0 A;  2H28 A;  1PYY A;  4EU0 A;  5HPF A;  4EV4 A;  1XGI A;  5GLC A;  4L9G A;  2VA0 A;  4HES A;  1DP6 A;  4P6Z S;  1ZKJ A;  4S2O A;  4MBF A;  2Y2Q A;  4PMA A;  3B3X A;  3NIA A;  3OPH A;  4DMZ A;  1JWV A;  1N9N A;  3T50 A;  3LCE A;  2XSS A;  3T1S A;  1ODV A;  4EWF A;  1H0M A;  3MFX A;  1JNU A;  3GVB A;  4RX2 A;  1NZO A;  4EUV A;  1CI8 A;  4XT2 A;  4GD6 A;  2WGV A;  3VV4 A;  1W8Y A;  5C5K A;  4UA9 A;  3JPU A;  4ZTK A;  4ETX A;  4K08 A;  2H0Y A;  3CMZ A;  2A2L A;  3SH7 A;  2VGJ A;  3MJQ A;  4X1M A;  3M2J A;  1O07 A;  4JGP A;  4P6B A;  4LCL A;  4I3A A;  2O9C A;  2P74 A;  4GJ4 A;  4RQ9 A;  1X0O A;  2Y59 A;  4GDN A;  3O88 A;  4YWZ A;  4E6W A;  2ZLY A;  2XR0 A;  2BAS A;  3V3S A;  3F1P A;  1VB6 A;  4E3K A;  3IX3 A;  3NCK A;  3MXQ A;  2W3H A;  1K4F A;  2EX2 A;  2WAE A;  1TDL A;  2L1M A;  4KZ4 A;  3NOP C;  3HVF A;  3ULF A;  2ZL1 A;  3OPL A;  3V67 A;  3MZF A;  3MXR A;  3E2K A;  1E3U D;  5FEG A;  3G4P A;  3R7W A;  3PYP A;  1DJC A;  3SZT A;  3VMA A;  3N6I A;  2A49 A;  4IUK A;  2EFU A;  3QP5 A;  4ZJ2 A;  2XFS A;  5HZH A;  4MNR A;  4ZDX A;  1Y54 A;  3UME A;  2V0U A;  3HLB A;  1AWI A;  4QD4 A;  2OSU A;  3MXS A;  4BL3 A;  4HP9 A;  1XA1 A;  2QJ5 A;  3MZE A;  4RX3 A;  2VGL M;  4WZ5 C;  1TEM A;  3PBN A;  3PBS A;  1S6R A;  3WS1 A;  5G18 A;  3UN7 A;  4IBX A;  1IKG A;  4CJN A;  2XH9 A;  3BM6 A;  3D72 A;  1XX2 A;  3ZGA B;  1C3B A;  3S7Q A;  2L4R A;  1GA0 A;  1PW1 A;  2Y4A A;  4LPZ A;  1KGF A;  3FPV A;  1K54 C;  4OOL A;  1I2W A;  2WKI A;  3MQQ A;  3Q7V A;  3M6H A;  2J7V A;  4DRT A;  1NXY A;  4F3L B;  4A5R A;  2Y91 A;  4BWI A;  5GLA A;  4ME4 A;  5EE8 A;  3C4O A;  1SHV A;  4S2N A;  4BBU A;  3C8C A;  2VK3 A;  5HD5 A;  1CEF A;  2J3W A;  2DRW A;  1UWN X;  2VKS A;  4WEK A;  4LFU A;  4GD8 A;  5AQ7 A;  2Z2M B;  3DBA A;  1ONG A;  1IYP A;  3W4O A;  3KYE A;  4UA6 A;  3LEQ A;  1SKF A;  3IX4 A;  1ERQ A;  5FL3 A;  4HBU A;  2FFY A;  2A24 B;  5TBM A;  4CLC D;  2HGV A;  4WN5 A;  5TJJ A;  3SS4 A;  1XJ2 A;  3DTK A;  5DF7 A;  5IT5 A;  5F6A A;  3EWK A;  2WKQ A;  5GHY A;  5AVE A;  4MN6 A;  4LRX C;  3F1P B;  1NYM A;  4NXB A;  3AGF A;  4DJ3 A;  4OOM A;  2NUP C;  2V1B A;  4GCZ A;  5HDC A;  1QME A;  3BFD A;  3P7N A;  2E8J A;  4HQA A;  1YMS A;  1D7E A;  4BD1 A;  3HLW A;  2B18 A;  4JXS A;  4NXE A;  4KQD A;  1MXO A;  4JGO A;  2EX6 A;  5FDS A;  5AQA A;  2WZZ A;  3A3E A;  4EBN A;  3R7W B;  3UB8 A;  1W63 Q;  2ZM0 A;  1XPB A;  4PPR A;  3UE0 A;  3BWL A;  3ZVW A;  2HP6 A;  1XFN A;  2HV1 A;  3CUE C;  5DFX A;  3V50 A;  3DTM A;  4GS9 A;  2R78 A;  2XD1 A;  3LI8 A;  2WAD A;  3BY8 A;  2H0T A;  4JF5 A;  4GB7 A;  4P0M A;  3LY3 A;  3N8L A;  1H3Q A;  4GLQ A;  4I5S A;  4OLG A;  2V20 A;  3DW0 A;  1FCM A;  4OPZ A;  3PHY A;  4S2P A;  2W1R A;  4OPR A;  4JF4 A;  5FSR A;  1XGJ A;  1L3L A;  1IEL A;  2HDU A;  2HF6 A;  1ES2 A;  1OTA A;  4N9K A;  1PI5 A;  2ZM2 A;  3CZD A;  3DWZ A;  1YPR A;  1TF1 A;  4KG2 A;  5DTS A;  1F5M A;  3PBT A;  3MR0 A;  2KLI A;  1NYY A;  5E2E A;  4IVI A;  4N1X A;  3UY6 A;  4K91 A;  4Y17 A;  3T4T A;  1WE4 A;  2XLN A;  3BRM A;  2ZQ9 A;  3IHB A;  5KSC A;  3B42 A;  2DCF A;  1MWR A;  5KSH A;  3PTE A;  5J8X A;  1SCW A;  4BQM A;  4NK3 A;  4DN0 A;  5AQ9 A;  2PU2 A;  5CTN A;  3TOI A;  3VP2 A;  3DTI A;  2GZA A;  3LGO A;  1BLH A;  4HNB A;  4HOI A;  2W3F A;  4E3N A;  1LLB A;  4PM5 A;  4FUW A;  1XP4 A;  3B47 A;  5CHU A;  3CHW P;  5DJU A;  4BLM A;  5CHJ A;  4X69 A;  2XRO A;  3CWF A;  1MY8 A;  3NBL A;  1MWS A;  1Q2Q A;  1E25 A;  3HUM A;  1FSW A;  2WZX A;  4EQ1 A;  2INW A;  3E2L A;  4C6Y A;  3F1N A;  3MMH A;  3H82 A;  1YLW A;  5GL9 A;  4GOG A;  3RJU A;  3IBJ A;  2W27 A;  2K31 A;  2Y2L A;  4X1L A;  1D1J A;  3UB6 A;  2EWW A;  3LIC A;  3OCL A;  5A92 A;  3PAG A;  4JXV A;  4ZBE A;  4RA7 A;  5HAP A;  4EXO A;  3CPT A;  1V9Y A;  4FTX A;  3D9Y A;  2VEA A;  3PBR A;  3T4K A;  2VGL S;  4BEN A;  1LL8 A;  4R1G A;  4B93 A;  5EOE A;  4H6J B;  4WLA A;  2W3D A;  3NDG A;  2DMW A;  1P9R A;  4O0P A;  3VFF A;  3BY9 A;  4ID4 A;  2ZC6 B;  5EM0 A;  1LT0 A;  3S7O A;  4Q0H A;  2L0W A;  3SW1 A;  3MS6 A;  2BG1 A;  1M6K A;  3TRC A;  3NOT C;  2Q9M A;  3ZDJ A;  3VSL A;  4BMW A;  3WWX A;  3OLO A;  3K3C A;  5D3O A;  4NET A;  1IYS A;  3F1O A;  3HUN A;  3G2Z A;  3NY4 A;  5I5L A;  3GSG A;  1LL5 A;  3FG8 A;  4KZB A;  4EUZ A;  1ES5 A;  4GW9 A;  5FAO A;  3PR6 A;  4LV1 A;  1VM1 A;  5FEF A;  3AGD A;  3S7P A;  1JTD A;  4Y7P A;  3TJZ C;  3HLD A;  1GHI A;  4I3I A;  3C7U A;  3V39 A;  5E2F A;  3IF6 A;  4QWO A;  1JWZ A;  1ACF A;  2ZC3 B;  2Y79 A;  4UEY A;  3T1Q B;  1ES3 A;  1CF0 A;  3TW8 A;  4IJG A;  3HLG A;  5DKK A;  4Z1W A;  2PR5 A;  4PM9 A;  2HP9 A;  2HDQ A;  3FKW A;  2OAQ 1;  3LY4 A;  3PBQ A;  4MN7 A;  1K57 A;  1S66 L;  1YLP A;  2XK1 A;  3UO9 A;  4B88 A;  3GV9 A;  2GNX A;  1BLP A;  2B5R A;  3F1N B;  3UB9 A;  1IKI A;  3H82 B;  1G28 A;  1JTG A;  2Y2J A;  4HIA A;  2ZOI A;  3S22 A;  1MBL A;  5IHV A;  4CLC C;  5EUA A;  3UE1 A;  3IWQ A;  2YKF A;  3CPT B;  1JWP A;  2QZ6 A;  4G3V A;  3UE3 A;  5MC7 A;  1ERO A;  3GRJ A;  2ZC5 B;  3IXG A;  1V9Z A;  4Y5F A;  3UB5 P;  4GHI A;  1ERM A;  4I38 A;  4F3L A;  3D4F A;  3O87 A;  3RXX A;  5HWT A;  1N9B A;  4G3W A;  5FAP A;  5EVE A;  1T19 A;  4PKY A;  1L0F A;  1S1Z A;  4GZB A;  1FR1 A;  2ZQC A;  2WKR A;  4BL2 A;  5HW3 A;  2M7U A;  2XDM A;  2ZQD A;  4UA7 A;  5DKL A;  1TS0 A;  3A3J A;  3TSG A;  2HP5 A;  3F1O B;  2ZC4 B;  4D2O A;  3VE4 A;  2O9A A;  2X02 A;  2PAV P;  4KG5 A;  5EVL A;  5CHM A;  4X68 A;  5TGF A;  2XA7 M;  1F9I A;  2E8I A;  2A24 A;  4OON A;  3C38 A;  3WS4 A;  1GCE A;  5FAT A;  1STZ A;  4U3T A;  5G4Z A;  1SDN A;  4MBH A;  3A3F A;  3UDI A;  3VOZ A;  3GMW A;  4U0X A;  5L09 A;  1K55 C;  4F94 A;  2GDN A;  1TVF A;  5E43 A;  1T1B A;  3VP1 A;  5M18 A;  5F5Y A;  2BTF P;  5JYO A;  3IF6 B;  4HH3 A;  4KQQ A;  1BLS A;  3IH8 A;  3ZG7 B;  2Y2O A;  4KQO A;  4GN2 A;  1K6S A;  4Q0J A;  4HH2 A;  2WKP A;  5J3W A;  2J9O A;  1GHM A;  1DJA A;  3A0S A;  3Q1F A;  5HFO A;  4FSF A;  4JGQ A;  1BT5 A;  4EEP A;  2V2F F;  4HBT A;  4E3L A;  1BYW A;  1OTI A;  2IA2 A;  2VX8 A;  5KIZ A;  2QPN A;  4WEL A;  2EA9 A;  3CLO A;  1BZA A;  4Y0O A;  3IT9 A;  1W5D A;  2WGW B;  4Y3I A;  3FKV A;  5KZH A;  1MWT A;  4BBT A;  3A0V A;  1SDE A;  1EW0 A;  3M2K A;  3UPO A;  3BEB A;  1OTB A;  3UPP A;  3IS2 A;  3TE8 A;  2KX6 A;  3PAE A;  1N9L A;  1S4S A;  1W63 M;  1KDW A;  1ESI A;  2Z6D A;  5FQ9 A;  4Q0I A;  5TR7 A;  2ZMF A;  5FDH A;  2XQZ A;  4GHI B;  1NLZ A;  1KOU A;  1CI9 A;  4Y15 A;  2I9V A;  4WMC A;  3VSK A;  1L0E A;  4X55 A;  4DE0 A;  1PRQ A;  1KE4 A;  2ZMV A;  1LI0 A;  3ZCZ A;  3WS0 A;  5FI6 A;  3BFE A;  1H5X A;  4KZ9 A;  5DTT A;  1U60 A;  4X25 A;  1FQG A;  3QNB A;  3BFG A;  4DE1 A;  3ITB A;  2R9X A;  2Y2M A;  3ZHH A;  3RTY A;  1T1A A;  1BUL A;  5DTK A;  4JF6 A;  4R38 A;  2WKH A;  4O8G A;  2EWV A;  3HCY A;  4XXR A;  3QP1 A;  4II7 A;  1F98 A;  3EEH A;  4R4R A;  2J8Y A;  3FV7 A;  3WRZ A;  2QWS A;  3NJA A;  2D01 A;  3UE6 A;  1T18 A;  3W4P A;  3CIT A;  1ZG4 A;  4ZAM A;  1LSV A;  3FWL A;  5CXW A;  3T1R A;  1N4O A;  3LYX A;  1KVM A;  1DP8 A;  1VHM A;  1IFQ A;  5CER A;  2KDK A;  4R4S A;  1IYQ A;  1XJ4 A;  2W1T B;  5U47 A;  1S4R A;  4DXC A;  4KZ3 A;  5J7E A;  2W3G A;  2PBY A;  4WEJ A;  3EQV A;  4X56 A;  2Y2I A;  1YLY A;  4LEN A;  1P9W A;  3K2N A;  2GJ3 A;  1ALQ A;  3EQU A;  3SH8 A;  4OP5 A;  2PBD P;  3CAX A;  1L2S A;  3L7H A;  3NI9 A;  1NZU A;  4JKT A;  4DE2 A;  3C4P A;  4H6J A;  5AVF A;  4E3I A;  5JYP A;  5FQM A;  4ZRR A;  3L9K A;  2HPB A;  1K56 A;  2OOL A;  1NWZ A;  4KG6 A;  4QJG A;  1SZV A;  2WUQ A;  1H8Z A;  4I3J A;  1XA7 A;  4S2N C;  3E4O A;  3KO6 A;  3H7W B;  4HHD A;  3NUL A;  4EQI A;  1Y4O A;  2ZM8 A;  2M1C A;  3KYZ A;  4EES A;  1N9O A;  1GHP A;  5EVI A;  2J3T D;  2OWH A;  5J4E A;  3E4P A;  3G6O A;  3GDI A;  2UWX A;  5GLB A;  3IS2 B;  1VQQ A;  1H8Y A;  2WKE A;  4OPQ A;  2R9W A;  2QMI A;  2V9A A;  5EFW A;  4MMN A;  1NRF A;  4MBK A;  1I2S A;  4R70 A;  3IWI A;  5HAI A;  4B9O A;  3JYI A;  4C3Q A;  2PT7 A;  2EXB A;  1HLU P;  3UPN A;  1OPX A;  2JKT M;  3BYD A;  2XA7 S;  4EEU A;  1G5U A;  1G6O A;  3DAV A;  1NLY A;  1FCO A;  5L8M A;  4B4X A;  3K3D A;  2VV7 A;  1RGZ A;  3R4K A;  4KQR A;  3PBO A;  5HL6 A;  4KUK A;  3QP2 A;  1M40 A;  2OWJ A;  3T4S A;  1P0Z A;  3EEA A;  1DJB A;  1BUE A;  3ZNY A;  1BLC A;  3LUQ A;  1A0K A;  4QPR A;  1OJ5 A;  3BFC A;  4DJ2 A;  3QHY A;  2ZQ7 A;  1XJ6 A;  4M3K A;  2XF3 A;  4OQ0 A;  3IXB A;  3T12 B;  3N7W A;  1L0G A;  2Y8H A;  2JN7 A;  2Z6C A;  4JXW A;  4MCW A;  5A90 A;  4NEE D;  3EGX C;  4EER A;  1MZU A;  1G68 A;  3GEC A;  3LR0 A;  2RL3 A;  1KGE A;  2AVX A;  5IU1 A;  3MKE A;  2PD7 A;  3LI9 A;  3N4I A;  5GLD A;  1K6R A;  4PM7 A;  1J9M A;  4EW7 A;  1MWU A;  3LR3 A;  4YNR A;  4OQG A;  2UV0 E;  3AGE A;  3ZVT A;  1LSX A;  3UDX A;  2PYP A;  1LSW A;  4R3A A;  3B33 A;  2LB9 A;  2VV6 A;  2XD5 A;  3QP8 A;  2A3U A;  2JKT I;  1ZG6 A;  3ICY A;  3P01 A;  4S2J A;  1NY0 A;  4OQH A;  2DNS A;  5E2G A;  1SKO B;  3HBR A;  3O86 A;  2J9P A;  1CJF A;  2VZW A;  4H8R A;  3QP4 A;  3T4O A;  5HDD A;  4B4Z A;  3CJM A;  5DF8 A;  3SOI A;  1OJG A;  1FIK A;  4P85 A;  3P09 A;  3A3I A;  2O0Y A;  2V0W A;  3BQ8 A;  3TG9 A;  5DJT A;  1PIO A;  4PHT A;  1L0D A;  3T1X A;  3MQO A;  4Y2F A;  5EVI B;  5CGX A;  3IX8 A;  3UMD A;  3OC2 A;  1RGY A;  2Y2P A;  1T1C A;  3FZC A;  2WGI A;  4IED A;  4R23 A;  1OT6 A;  5HDS A;  2EXA A;  3O5Y A;  4O7D A;  4G3K A;  2K7S A;  1LL9 A;  4MLL A;  4L9F A;  4E3M A;  3WS2 A;  1UGU A;  4UQI S;  4N9L A;  1P97 A;  3JVU A;  1HD8 A;  3O3V A;  3UB7 A;  3CG5 A;  2KOI A;  2Y2K A;  2P9V A;  3LR5 A;  1Y28 A;  3SS3 A;  5EM1 A;  1YT4 A;  5E2H A;  4WMC D;  3MFD A;  4HJ6 A;  2LB5 A;  4E3O A;  4Z9Q A;  2Y2N A;  4KZ8 A;  3IF5 A;  4OKP A;  3N8R A;  4WM9 A;  3Q81 A;  3HRE A;  3BLS A;  3VP0 A;  1RCJ A;  1PWG A;  3H9W A;  1S1Y A;  1XXM A;  1OTE A;  4YIN A;  1KDS A;  2D02 A;  4QY6 A;  4BJP A;  3SH9 A;  2WGW A;  2HDS A;  4JGR A;  4L9E A;  3G2Y A;  4WUJ A;  4S2I A;  2YKH A;  1I5Q A;  3NDE A;  1VEU A;  1FCN A;  3KSF A;  5CRF A;  3EOI A;  4HI4 A;  5DVA A;  4ZJ3 A;  4EBL A;  4LRZ E;  4N1H A;  3E4Q A;  3BLM A;  3ZNT A;  2ZOH A;  5CEB A;  4MEZ A;  2P04 A;  4KZ6 A;  1ZTU A;  2O9B A;  3WS5 A;  3LFV A;  4ESP A;  3C5A A;  3OCN A;  3ZG5 A;  3VP3 A;  2O99 A;  1ZC2 A; 
#chains in the Genus database with same CATH homology
 5FSR A;  1KDW A;  1XGJ A;  1ESI A;  1IEL A;  2HDU A;  1ES2 A;  5FQ9 A;  1YM1 A;  3MBZ A;  4N9K A;  5TR7 A;  1PI5 A;  4WBG A;  3VP4 A;  5TFQ A;  5FDH A;  2XQZ A;  2ZMA A;  2H5S A;  3GR2 A;  1CI9 A;  2JE5 A;  4WMC A;  2ZM2 A;  3CZD A;  5CGS A;  3DWZ A;  3VSK A;  1L0E A;  3OZH A;  4X55 A;  4DE0 A;  3IF6 C;  3G31 A;  5A91 A;  4KG2 A;  4OLD A;  5DTS A;  5HL1 A;  1KE4 A;  3NC8 A;  3PBT A;  2ZC7 A;  1LI0 A;  3ZCZ A;  5FQQ A;  3V3R A;  1FSY A;  1NYY A;  2WYX A;  5E2E A;  4IVI A;  3WS0 A;  4N1X A;  5FI6 A;  5CGW A;  3BFE A;  4WZ5 A;  3UY6 A;  1H5X A;  4K91 A;  4KZ9 A;  5DTT A;  1U60 A;  1HVB A;  1FQG A;  1WE4 A;  2XLN A;  3BFG A;  1WYB A;  3BRM A;  3QNB A;  4LV0 A;  4DE1 A;  3ITB A;  2R9X A;  4IVK A;  2ZQ9 A;  3IHB A;  2Y2M A;  3ZHH A;  1K56 D;  2DCF A;  5KSC A;  1BUL A;  5DTK A;  4JF6 A;  1MWR A;  5KSH A;  2WKH A;  4Y0T A;  3PTE A;  5J8X A;  1YMX A;  1SCW A;  4XXR A;  3IQA A;  5FA7 A;  3VFH A;  4BQM A;  4JXG A;  5EEC A;  4NK3 A;  4UAA A;  5AQ9 A;  3DWK A;  1W79 A;  2PU2 A;  1G6A A;  4WYY A;  5CTN A;  5FQK A;  3TOI A;  3VP2 A;  4S2K A;  4UHU A;  3S1Y A;  5FAQ A;  1O7E A;  4QU3 A;  4R4R A;  1YLZ A;  4IBR A;  1K57 C;  2J8Y A;  4XUZ A;  3FV7 A;  5CED A;  1K54 A;  1EI5 A;  1BLH A;  3QNC A;  1FR6 A;  3WRZ A;  3W8K A;  5EVI D;  1CK3 A;  4L0L A;  5M1A A;  3S4X A;  2EFX A;  5HAR A;  4GKU A;  1W8Q A;  3VOY A;  2JC7 A;  1PW8 A;  4E3N A;  3Q7Z A;  1PWC A;  4K0W A;  1LLB A;  2ZJ9 A;  3GTC A;  4PM5 A;  1XP4 A;  5CHU A;  4BLM A;  3W4P A;  4JLF A;  1RP5 A;  1ZG4 A;  4X69 A;  5CHJ A;  4HEF A;  4ZAM A;  3W4Q A;  3FWL A;  5CXW A;  2X71 A;  5FQJ A;  2P9V B;  1MY8 A;  3NBL A;  1N4O A;  4KZ5 A;  1MWS A;  5FI2 A;  1KVM A;  1Q2Q A;  3C7V A;  3V5M A;  5CER A;  3ZG0 A;  1E25 A;  3G32 A;  3HUM A;  4R4S A;  1FSW A;  1IYQ A;  3LEZ A;  5FQI A;  4OPY A;  1KE0 A;  2WZX A;  4Q8I A;  2H10 A;  5U47 A;  1Z6F A;  4KZ7 A;  3E2L A;  4C6Y A;  5BOH A;  3Q82 A;  4DXC A;  1YLW A;  4KZ3 A;  4GDB A;  1TDG A;  5M19 A;  2X01 A;  2EX9 A;  2PBY A;  4WEJ A;  2VGK A;  3EQV A;  4GOG A;  4X56 A;  5GL9 A;  3MZD A;  2Y2I A;  1FOF A;  1YLY A;  4QY5 A;  3RJU A;  4LEN A;  3UDF A;  2Y2L A;  3GQZ A;  1K55 A;  4QHC A;  1LI9 A;  1S0W A;  2WAF A;  1ALQ A;  3EQU A;  4FD8 A;  3OCL A;  1K25 A;  2RCX A;  3HL9 A;  4OVD A;  3SH8 A;  3PAG A;  5A92 A;  1OME A;  5CEC A;  4OP5 A;  4JXV A;  4BD0 A;  1L2S A;  4RA7 A;  4ZBE A;  5HAP A;  3NI9 A;  1NZU A;  5I94 A;  4JKT A;  1KE3 A;  4DE2 A;  3ITA A;  3C4P A;  4E3I A;  1XKZ A;  4DXB A;  3PBR A;  5JYP A;  5FQM A;  4OH0 A;  1PYY A;  4BEN A;  1HZO A;  2HPB A;  2C6W B;  1K56 A;  4RVA A;  2OLU A;  4KG6 A;  4EV4 A;  2BLS A;  4QJG A;  1XGI A;  4R1G A;  2WUQ A;  5GLC A;  1H8Z A;  5EOE A;  4HES A;  4PM8 A;  1XA7 A;  4S2N C;  3NDG A;  1ZKJ A;  4S2O A;  4EQI A;  3VFF A;  5F1F A;  4YFM A;  4ID4 A;  2ZC6 B;  2XFT A;  2ZM8 A;  3HLE A;  4MBF A;  4U0T A;  2Y2Q A;  4PMA A;  4PM6 A;  3RXW A;  4DF6 A;  5HX9 A;  3B3X A;  1GHP A;  3NIA A;  4DE3 A;  3OPH A;  5EVI A;  2Y2H A;  1MKI A;  2UWX A;  3OPR A;  3MKF A;  2BG1 A;  5GLB A;  1VQQ A;  1H8Y A;  2WKE A;  4OPQ A;  1JWV A;  1HTZ A;  2R9W A;  2QMI A;  1M6K A;  2I72 A;  3LCE A;  4S2M A;  2Q9M A;  3ZDJ A;  1NRF A;  3VSL A;  4P87 A;  4MBK A;  1BSG A;  4E6X A;  3WWX A;  3G30 A;  5D3O A;  4CPK A;  4EWF A;  4NET A;  1IYS A;  3HUN A;  3IXD A;  1I2S A;  1AXB A;  3IWI A;  3GVB A;  5HAI A;  3G2Z A;  3JYI A;  4C3Q A;  4RX2 A;  3NY4 A;  2EXB A;  3GSG A;  1NZO A;  1LL5 A;  1E4D A;  1K38 A;  3UPN A;  1CI8 A;  3OPP A;  4GD6 A;  4KZB A;  2CC1 A;  4EUZ A;  1ES5 A;  1ONH A;  4JPM A;  2WGV A;  5FAO A;  3BYD A;  1CEG A;  4LV1 A;  1Q2P A;  1W8Y A;  1VM1 A;  4UA9 A;  1FCO A;  4B4X A;  2FFF B;  3AGD A;  4R3J A;  4ZTK A;  1JTD A;  1RGZ A;  2H0Y A;  4KQR A;  3PBO A;  4Y7P A;  3CMZ A;  3SH7 A;  2VGJ A;  1M40 A;  2V1Z A;  2G2W A;  5L2F A;  3M2J A;  1O07 A;  1GA9 A;  3HLD A;  4K0X A;  4P6B A;  1GHI A;  3C7U A;  4LCL A;  3V39 A;  1DJB A;  5E2F A;  2P74 A;  1BUE A;  2Y59 A;  4GDN A;  3IF6 A;  1KGG A;  3ZNY A;  3O88 A;  4FCF A;  1JWZ A;  2IWD A;  1BLC A;  4E6W A;  2ZC3 B;  2ZLY A;  2XR0 A;  4XUX A;  3V3S A;  1ES3 A;  4E3K A;  3BFC A;  3NCK A;  2Y55 A;  2PU4 A;  3QHY A;  2ZQ7 A;  1K4F A;  4M3K A;  2EX2 A;  2XF3 A;  4OQ0 A;  2WAE A;  3IXB A;  3N7W A;  1TDL A;  2JCH A;  1L0G A;  3HLG A;  4KZ4 A;  5EOO A;  3ZG8 B;  3HVF A;  4PM9 A;  2HP9 A;  3HLF A;  4JXW A;  2HDQ A;  3FKW A;  3OPL A;  5A90 A;  4R3B A;  3LY4 A;  3PBQ A;  4Y0U A;  3MZF A;  1G68 A;  3MXR A;  1K57 A;  1YLP A;  2XK1 A;  2Y2G A;  3E2K A;  3UO9 A;  1E3U D;  2RL3 A;  1KGE A;  2JBF A;  3HLC A;  3G4P A;  4B88 A;  3GV9 A;  3MKE A;  1DJC A;  1BLP A;  2B5R A;  3ISG A;  3VMA A;  3N6I A;  1IKI A;  2A49 A;  3N4I A;  3A3D A;  1JTG A;  5CTM A;  3WRT A;  4FH4 A;  5GLD A;  4KEN B;  2IWC A;  1K6R A;  2Y2J A;  4PM7 A;  1J9M A;  2EFU A;  5HAQ A;  3IWO A;  1MWU A;  4FH2 A;  4ZJ2 A;  3S22 A;  2XFS A;  1MBL A;  4MNR A;  5IHV A;  4ZJ1 A;  4OQG A;  2ZD8 A;  2Z2L B;  3AGE A;  3ZVT A;  1Y54 A;  4ZDX A;  1IEM A;  3UDX A;  3G34 A;  5EUA A;  3HLB A;  4QD4 A;  2OSU A;  3UE1 A;  3MXS A;  3IWQ A;  3UNW A;  2XD5 A;  4BL3 A;  2A3U A;  1XA1 A;  1ZG6 A;  4LV3 A;  4S2J A;  3MZE A;  2C5W B;  1NY0 A;  4OQH A;  4RX3 A;  1JWP A;  2DNS A;  2QZ6 A;  4WZ5 C;  1TEM A;  3PBN A;  3PBS A;  5E2G A;  1S6R A;  5F83 A;  3HBR A;  5G18 A;  3UN7 A;  3WS1 A;  3UE3 A;  4IBX A;  3O86 A;  2J9P A;  4H8R A;  5DF9 A;  1IKG A;  1ERO A;  1JVJ A;  4CJN A;  2XH9 A;  2ZC5 B;  3GRJ A;  4OP8 A;  2XEP A;  3IXG A;  4QB8 A;  3BM6 A;  3CJM A;  4B4Z A;  1XX2 A;  5DF8 A;  3SOI A;  3ZGA B;  1C3B A;  4P85 A;  1GA0 A;  3P09 A;  1ERM A;  3A3I A;  1YLJ A;  1PW1 A;  1IYO A;  3D4F A;  3O87 A;  2Y4A A;  3RXX A;  1KGF A;  2ZQ8 A;  3BEC A;  1K4E A;  4DDY A;  1N9B A;  3TG9 A;  3P98 A;  5FAP A;  1K54 C;  1NJ4 A;  1PIO A;  1L0D A;  4OOL A;  4R0Q A;  1L0F A;  1I2W A;  2WKI A;  4WZ4 A;  3ZFZ A;  3Q7V A;  1FR1 A;  4GZB A;  5EVI B;  1YLT A;  2ZQC A;  4BL2 A;  3M6H A;  5CGX A;  3SS5 A;  2J7V A;  5HW3 A;  4DRT A;  1NXY A;  3OC2 A;  1RGY A;  2Y2P A;  4A5R A;  2XDM A;  2ZQD A;  4UA7 A;  3FZC A;  2WGI A;  2Y91 A;  4IED A;  5GLA A;  1MPL A;  3A3J A;  5EE8 A;  4R23 A;  3TSG A;  3C4O A;  1PZP A;  4X6T A;  1SHV A;  2G2U A;  1QMF A;  2HP5 A;  4S2N A;  2EXA A;  2ZC4 B;  4D2O A;  3Q7V B;  1YQS A;  5GHZ A;  1CEF A;  4O7D A;  2DRW A;  5A93 A;  2X02 A;  4KG5 A;  4WEK A;  5EVL A;  1E3U A;  1LL9 A;  4MLL A;  4GD8 A;  5CHM A;  3G35 A;  4X68 A;  5AQ7 A;  2Z2M B;  5TGF A;  5EPH A;  4E3M A;  2E8I A;  4OON A;  3WS2 A;  1DY6 A;  3WS4 A;  1ONG A;  4E3J A;  1IYP A;  3W4O A;  1GCE A;  5FAT A;  4N9L A;  5AQB A;  4OOY A;  4UA6 A;  4KZA A;  4U3T A;  1HD8 A;  3O3V A;  1SDN A;  4MBH A;  3CG5 A;  1W7F A;  3A3F A;  3UDI A;  1SKF A;  2Y2K A;  3BFF A;  2P9V A;  3SS3 A;  3GMW A;  3VOZ A;  1ERQ A;  4U0X A;  1K55 C;  4F94 A;  1WYC A;  1YT4 A;  2GDN A;  5E2H A;  2WK0 A;  1TVF A;  5E43 A;  4HBU A;  2FFY A;  4WMC D;  3MFD A;  1ES4 A;  3FYZ A;  5F82 A;  3VP1 A;  1LHY A;  4E3O A;  4Z9Q A;  5M18 A;  2OV5 A;  2Y2N A;  5JYO A;  3SS4 A;  3IF6 B;  4KQQ A;  4KZ8 A;  3IF5 A;  5DF7 A;  1BLS A;  1PI4 A;  4OKP A;  1PZO A;  3IH8 A;  3N8R A;  5GHY A;  5GHX A;  4DDS A;  3ZG7 B;  4S2L A;  4WM9 A;  2Y2O A;  1NYM A;  3HRE A;  3M6B A;  3Q81 A;  4KQO A;  3BLS A;  3AGF A;  2OLV A;  4GN2 A;  1K6S A;  3VP0 A;  4N92 A;  4OOM A;  1RCJ A;  1PWG A;  1XXM A;  2J9O A;  1GHM A;  1DJA A;  1QME A;  3BFD A;  4JBF A;  4X53 A;  4YIN A;  1KDS A;  3Q1F A;  5HFO A;  4QY6 A;  1YMS A;  4FSF A;  4DKI A;  4BD1 A;  3HLW A;  4BJP A;  4C75 A;  1BT5 A;  4JXS A;  5FAS A;  3SH9 A;  1MXO A;  2EX6 A;  2V2F F;  2WGW A;  2IWB A;  2HDS A;  4HBT A;  4EBP A;  1BTL A;  3I7J A;  3N8S A;  3G2Y A;  4E3L A;  4RYE A;  1KVL A;  5AQA A;  2WZZ A;  3A3E A;  4EBN A;  4S2I A;  5EVI C;  1ESU A;  2EX8 A;  1I5Q A;  3NDE A;  1FCN A;  3ZG9 B;  2QPN A;  4WEL A;  2ZM0 A;  1XPB A;  4PPR A;  5CRF A;  3HUO A;  3UE0 A;  1EWZ A;  3ZVW A;  1BZA A;  2HP6 A;  4Y0O A;  5DVA A;  4ZJ3 A;  5FI7 A;  3IT9 A;  1W5D A;  3LO7 A;  4OQI A;  2WGW B;  3DTM A;  3V50 A;  4EBL A;  5KMW A;  4GNU A;  2HDR A;  2XD1 A;  2ZQA A;  3FKV A;  4LCM A;  5KZH A;  3IXH A;  1MWT A;  2WAD A;  4N1H A;  1SDE A;  2Q9N A;  5F1G A;  2H0T A;  3IH9 A;  3IHA A;  4JF5 A;  3BLM A;  4GB7 A;  4P0M A;  3M2K A;  3LY3 A;  3ZNT A;  3UPO A;  4LV2 A;  3N8L A;  5CEB A;  4OLG A;  3BEB A;  4MEZ A;  2V20 A;  3DW0 A;  1FCM A;  4KZ6 A;  3Q07 A;  3UPP A;  4OPZ A;  3WS5 A;  4S2P A;  2XGN A;  1PWD A;  3C5A A;  3OCN A;  3PAE A;  4OPR A;  3ZG5 A;  4JF4 A;  3VP3 A;  1ZC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...