1H8MA

Solution structure of ykt6
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
140
structure length
140
Chain Sequence
MRIYYIGVFRSGGEKALELSEVKDLSQFGFFERSSVGQFMTFFAETVASRTGAGERQSIEEGNYIGHVYARSEGICGVLITDKQYPVRPAYTLLNKILDEYLVAHPKEEWADVTETNDALKMKQLDTYISKYQDPSQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords SYNAPTOBREVIN HOMOLOG 1
publication title An Autoinhibitory Mechanism for Nonsyntaxin Snare Proteins Revealed by the Structure of Ykt6P
pubmed doi rcsb
total genus 31
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1h8mA00
1IFQA 1IOUA 2DMWA 3EGXC 2NUTC 3EGDC 3KYQA 4B93A 1H8MA 3BW6A 2NUPC 2VX8A 4AFIA
chains in the Genus database with same CATH superfamily
4JBFA 1L0GA 1CI9A 4LRYC 3GVBA 1D06A 3DW0A 3NHQA 2O99A 3O88A 3MMHA 4OLGA 1JNUA 4NKPA 2HV1A 1TS6A 2W1RA 1TD5A 4EBPA 1YSPA 4R4RA 1K56A 3BLSA 3DTKA 5FEFA 4ZAMA 4R3BA 3JVVA 4IVIA 3U4LP 1MWSA 3C4PA 1CI8A 3GTCA 3A0RA 4XT2A 4PM9A 4NXFA 2JKTM 2ZMVA 4NG2A 2EWWA 2W1TB 4JGOA 3C2WA 1PYYA 5HPFA 1IELA 3DWKA 1P9RA 4DF6A 5M1AA 1BLHA 4P6ZS 1BTLA 3F1PA 1K55C 3ZGAB 4HP9A 3DTEA 4EWFA 1VEUA 2WKPA 3G4PA 4GDNA 4Z9QA 1GHIA 4L0LA 3W8KA 2A49A 4Q0HA 2GJ3A 4XUXA 1SCWA 2HPBA 3CWFA 1N9OA 4L9GA 3VP0A 1CEGA 3OLOA 3LO7A 3ZNTA 1XXMA 1TS7A 2WZXA 2W3FA 3VP4A 2J9OA 4DXCA 1FCMA 1LT0A 1ACFA 4E3OA 3OPPA 4C75A 2QJ5A 4JKTA 3NDEA 2A2LA 3N8RA 5AQBA 2KX6A 2G2UA 3OOVA 3T1RA 2VGLS 3NCKA 2IWCA 4DJ3A 3IHAA 4LCLA 3A3EA 2UV0E 5CHMA 1Z6FA 1BLSA 3MKFA 5FSRA 4ZJ2A 3W2ZA 3VFHA 3VP2A 2ZM2A 5FQIA 2ZMFA 3VFFA 2V20A 3TE8A 3BW6A 5AVEA 1SDEA 2ZL1A 3T4TA 3A0SA 4GB7A 4PKYG 4E3MA 3GV9A 2WUQA 4OH0A 2BG1A 1WA9A 3BFGA 3N7WA 3BFEA 5EOOA 4KZ6A 1PFLA 5HSQA 3MZDA 1YT4A 2CMNA 2JKRM 3C4OA 4LV2A 2Y59A 2XH9A 1DP9A 3A3FA 1DP8A 4NETA 2O9BA 2DMWA 5A8BA 1S67L 2WYXA 5DF8A 4DJ2A 2HP6A 1D1JA 5HDCA 4AFIA 4BQMA 5FEGA 1YMXA 5F69A 2ZM8A 3KYQA 4DE3A 4LRXC 1E4DA 2LB9A 4B4ZA 4EETB 2GDNA 1ESIA 2Y2HA 2YKHA 4X68A 1J9MA 4ESPA 5HPIA 2WK0A 5HAQA 4JXVA 3EQUA 1YLPA 4GCZA 3QNBA 3LIDA 1T1CA 1L0EA 2PU2A 3ZFZA 3AGDA 3FV7A 3LR4A 4IUHA 3LICA 3BJNA 5GHXA 3CPTB 1NLZA 2P04A 5CGWA 3M6HA 2O9AA 5GL9A 2ZM0A 1N4OA 1T18A 5EPHA 1MY8A 1JWVA 4GD8A 5HFOA 5KMWA 4KG2A 2ZC7A 3BM6A 3MZEA 5AQAA 2Z6DA 1DJCA 2JKTI 3MJQA 2XDMA 3S7PA 1NZOA 4ARZA 3PBTA 3B47A 3NOUC 3NI9A 5EVIC 3SS5A 2XA7S 4CLCD 4BBVA 4EUVA 1MPLA 5TFQA 4DMZA 3UMDA 3O86A 5L8MA 3BFCA 3BFFA 3IX3A 3ZYTA 3DTIA 2B02A 2PYRA 3ZG5A 4PPRA 1K25A 1G28A 1N9LA 3G6OA 2Y2JA 4MDZA 3ZVTA 1S4RA 4YFMA 5FDHA 3HJKA 3HUMA 5TBMB 4GD6A 3UO9A 3MS6A 1GSWA 3PAEA 2XQZA 1Y28A 3E4OA 3H82B 1H0MA 1H8MA 1A0KA 3F1OA 3GR2A 4PM6A 4QY5A 2C5WB 3K2NA 3SH9A 2JBFA 1XJ6A 3TJZC 1TDGA 2HGVA 5L10A 1NXYA 1MWUA 2VGKA 2Q9MA 3IF6A 2VZWA 1KE3A 3D3OA 3ZG0A 2PYPA 3WRZA 4CJNA 4S2NA 1ODVA 2ZOHA 2FFYA 2Y2IA 1C3BA 5DFXA 3DBAA 1I5QA 3T1XA 3K3DA 2OV5A 1YSQA 4KZBA 2GZAA 1LI9A 2P7JA 4BL2A 3IXHA 3S1YA 4NEED 3NDGA 1YKDA 2BASA 2JKRI 2EXAA 4JPMA 2J3WA 4BBUA 1GA9A 4WUJA 1PZOA 1F5MA 3G32A 1EI5A 1K4FA 1P9WA 3BY9A 3LR3A 4EESA 5HD5A 4DE2A 3GSGA 2XSSA 4P6ZM 4ZJ1A 4CLCE 3QP2A 1V9YA 4UA9A 1HVBA 4S2NC 1Y54A 1NZUA 4Y0TA 3B42A 2PHYA 2V9AA 3O5YA 3ULFA 4CLCB 5AVFA 4BENA 3OPHA 4WYYA 4E3KA 5J4EA 3GDIA 1IYSA 2ZMAA 2ZQCA 4S2LA 2ZC3B 3FZCA 1S0WA 5CX7A 2J3TD 1TEMA 1DJAA 1GA0A 3T4LA 2PU4A 4KG6A 3LCEA 5MC7A 3QNCA 1Q2QA 5DTSA 1LL5A 1BSGA 4BBTA 3WS5A 2A24A 1W5DA 4ETZA 3ITBA 2FH5A 1K38A 2JN7A 1EW0A 1MC0A 1NYYA 4OP8A 1MBLA 5KZHA 3OC2A 2ZLYA 4GHIB 2E8IA 3SH7A 1XA1A 3T4JA 2XGNA 4KZ5A 4FH4A 2JHEA 4K91A 1HZOA 2H0TA 1L3LA 4OQ0A 4PAUA 3WRTA 3NECA 4JGRA 4CQHA 3S7QA 3GQZA 3A3IA 3P09A 3HLDA 5TR7A 3BECA 3EGDC 2Y2GA 4ME4A 2Y4AA 4PM5A 1PRQA 4MEZA 1G5UA 1F9IA 3ZHHA 2HDQA 1H8YA 4MMNA 5F83A 4UEYA 1NY0A 5EVLA 2D01A 1Z09A 5CERA 3MQQA 3VOLA 4EBLA 1VETB 3L7HA 4RX3A 1U60A 1FQGA 4S2OA 2OSUA 5JYOA 2H0YA 4LGWA 2VK3A 3UB8A 4MN5A 2Y79A 3IXGA 3MXQA 3PR6A 2P08A 1K54A 3FG8A 1T19A 1XJ3A 2VV6A 5GLAA 3R7WB 2PD8A 1IYPA 3SS3A 2ZBBA 1KE0A 3MFXA 2V8FA 4OVDA 3B3XA 2EX2A 3EGXC 4WZ5A 2EXBA 4E3LA 1KE4A 1XJ2A 1MWRA 2VGJA 3HUNA 2W3GA 2XA7M 2ZQ7A 2V2FF 4RYEA 1W63M 5DF7A 3KSGA 1K54C 3ZVWA 3T4KA 2XLNA 2H28A 4MLLA 3RTYA 2W3DA 5HWTA 1K0KA 4OKPA 5CEDA 2CC1A 5CECA 2XK1A 2WGWA 2HJ9C 4PKYA 1J3WA 3Q7ZA 1BULA 3S4XA 5HAPA 1JTGA 4WZ5C 4OPQA 2P74A 1ZTUA 1YLYA 3Q07A 4Y17A 1K55A 5FI2A 4KZ4A 4PMAA 1TVFA 4Q8IA 4E3IA 4QD4A 1YPRA 3OPRA 5M18A 2Y2LA 1ZG4A 3E2KA 4MBHA 2R9WA 3HVFA 4EQIA 1MWTA 5IT5A 2EFXA 1DP6A 2V1ZA 2WAEA 1YQSA 4Y7PA 1STZA 3T1SA 3HLWA 1ALQA 1N9BA 4KQRA 2OLVA 2NUPC 4KZ8A 3NIAA 1XKZA 2Z6CA 4OLDA 3G35A 3EEHA 3CLOA 2OLUA 3LIBA 1IYQA 5IU1A 1S1ZA 4QWOA 4HH3A 2QZ6A 2BLSA 2L0WA 4LPZA 1YLTA 3HL9A 3SS4A 4Y13A 2ZC6B 4R1GA 2Y2NA 3MF0A 3QP4A 1LSXA 1SZVA 1XJ4A 1L0DA 1ONGA 1D7EA 4HJ3A 4H6JA 1IOUA 1LSWA 2XFSA 3HUOA 3G30A 4F94A 2J7VA 1YAXA 2WKEA 3IS2A 2HDRA 4R6LA 2WKHA 3CG5A 3RH8B 4LRZE 5FAQA 5HD3A 1GHMA 2C6WB 1SDNA 2J80A 4LFUA 5U47A 3D4FA 1JWPA 1S66L 4A5RA 2G7UA 2VV8A 4CLCA 4I3AA 3BFDA 4F3LB 5E2EA 3MBZA 2XROA 3S22A 4MN6A 3F1NB 4BLMA 4KQQA 1W79A 4NXGA 3MQOA 3QP6A 2V8CA 4GJ4A 4R3AA 1I2SA 4MCWA 1G6OA 3NBLA 3QP5A 3MXRA 3HCYA 3OBFA 1KGGA 2VKSA 4Y0UA 1NWZA 2V0WA 4KG5A 4CLCC 3V50A 4Y0OA 2VJWA 1S4SA 4IVKA 5AQ7A 5DTKA 2ACGA 2OOLA 1Q2PA 3T1QB 4X53A 1YLWA 4QPRA 2Y55A 2Z2LB 2WZZA 1TDLA 4EBNA 4Y5FA 3BRMA 4N1HA 4E6XA 3L9KA 3VSKA 1ES4A 3LFVA 2R78A 5HDSA 3PXPA 2GNXA 4HESA 5EVIA 3TG9A 1MZUA 4G3WA 4KZ9A 3AGEA 1Y4OA 2K31A 2Y2OA 4EEUA 4K08A 2YKFA 3P7NA 1FCNA 2O9CA 3H7WA 1DRMA 5DKKA 4Q0JA 4LV1A 1CEFA 4OOYA 1FILA 3UE1A 2Y2MA 4OQHA 5FI7A 4GZBA 2ZQ8A 4ZBEA 1PI5A 4QU3A 3T4OA 4WEJA 3IWOA 2V1AA 1L2SA 3MSHA 4WN5A 1RCJA 3N4IA 3BWLA 4L9FA 3V3RA 3HREA 4HBTA 5DKLA 2X02A 4BD1A 2Q0OA 1FR6A 2P9VB 3PBNA 2DCFA 5F1GA 5E2HA 4O01A 1ES5A 1SKFA 2M7VA 1VHMA 4S2JA 3TRCA 1PW1A 1TF1A 2EFUA 4NXBA 4XUZA 4P85A 5CXWA 2Y8HA 1DJBA 4GS9A 4I3JA 3G31A 4IUKA 4U0TA 4LLOB 3DAVA 3NULA 4K0XA 3KSIA 3AGFA 5HARA 2EX8A 2JKFA 4ETXA 5CTNA 3UDXA 4RQ9A 1KVMA 1IEMA 3NC8A 3PTEA 3WS4A 3IBJA 4HHDA 2FZ0A 2HZ5A 4XT2B 3LIAA 2J3TC 2EX6A 3HLBA 2W0NA 1VM1A 1FIKA 3NOTC 1BLCA 4U0XA 3VE4A 3EWKA 1HTZA 3EOIA 4MBKA 1E25A 3F1PB 4DXBA 2ZJ9A 3LR0A 3FPWA 5EOEA 3C7VA 4E04A 2Y2PA 1UGUA 4K0WA 4LV3A 3WS2A 3HLCA 4OQGA 4KZ7A 4JXWA 3HLFA 3VV4A 4U3TA 3Q7VB 3A3DA 5CGXA 5HX9A 2KOIA 5BOHA 4MN7A 2E8JA 5TGFA 2HP5A 3IT9A 1W7FA 5F5YA 1NRJA 4ZRRA 2IWDA 2WADA 5CGSA 4B88A 3DTMA 2V1BA 5E43A 3G34A 4PM8A 1H3QA 4IBRA 1F2KA 2VEAA 3U2AA 4KQOA 3PBQA 2Y2KA 1LI0A 2W1TA 1K6SA 2XR0A 1PIOA 2H5SA 1XP4A 5J8XA 3BY8A 3IF5A 2K7SA 5A92A 1LL8A 4P0MA 5FQ9A 4E3NA 2Y91A 4S2MA 4FD8A 2OWHA 2ZL1B 4HNBA 4GNUA 1JWZA 5E2GA 1ZHHB 1K57A 2B95A 1PI4A 2PAVP 3TOIA 4C6YA 1LSVA 3BQAA 5F68A 3HLEA 2ZOIA 3W4OA 4HIAA 5HW3A 3NOPC 3V3SA 4KZAA 2J9PA 5F1FA 4D2OA 3DWZA 1CQAA 1P97A 1BZAA 1DY6A 4P87A 4IJGA 3KX0X 2V0UA 5FAOA 1XX2A 2J8YA 2RL3A 1OPXA 3FWLA 4L9EA 4HJ4A 4HEFA 4X55A 3UPOA 2EA9A 4G3KA 3MXSA 4X25A 3T4SA 4O0PA 1O07A 1K57C 3T12B 3IWIA 3UN7A 3IWQA 5J7EA 5GLDA 3OCLA 3WWXA 5CTMA 1IFQA 3UE6A 3ZDJA 3EQVA 1M40A 5IHVA 4HBUA 3E0YA 4KUKA 3D72A 1K4EA 2WKIA 1MKIA 5FA7A 2PRFA 1G6AA 3UMEA 2VA0A 2QPNA 4DE0A 3G2YA 1G68A 1ES2A 2K2NA 4RVAA 1GSVA 1E3UD 4Y3IA 5G18A 3R4KA 3S7NA 4DDSA 4EQ1A 4ARZB 1TS8A 3N8SA 1P0ZA 3T4QA 1LHYA 3PBSA 2JKGA 4JXSA 2PR6A 4DDYA 4YWZA 4JXGA 1QMFA 2PD7A 3B33A 3C5AA 5I94A 1EROA 4DN0A 4OONA 2ZQAA 1OT9A 4WL9A 3ZQ5A 1XGIA 3CPTA 1H8ZA 1OTEA 1NYMA 4RX2A 2KDKA 3VP1A 5FDSA 4HH2A 4ZJ3A 3LGOA 4FTXA 3M6BA 3FYZA 3KO6A 3UPPA 2I9VA 5IS1A 2QYBA 3GRJA 1PWCA 3F1OB 3FC7A 1PNEA 4LV0A 4BJPA 5EM1A 3IHBA 3PYPA 2UWXA 3CHWP 1CK3A 5FATA 3N8LA 5FQMA 1GCEA 1LLBA 3E2LA 3IF6B 4M4XA 3FKWA 4WMCD 1LL9A 3HLGA 5CRFA 5I5LA 1QMEA 5AQ9A 4EEPA 2OAP1 1AXBA 2INWA 4KENB 3UB6A 4OPRA 1ES3A 4I38A 4OQIA 1AWIA 3CJMA 3CUEC 1JVJA 2Q9NA 1K6RA 5TBMA 4B9OA 1S6RA 3MKEA 4OOLA 3K3CA 2GX5A 3H82A 5GLBA 2AVXA 3KYZA 3KSHA 2ZQ9A 2DNSA 3CZDA 4IHQA 2H10A 2XRNA 2L1MA 4WM9A 4N1XA 4KUOA 2LB5A 3I7JA 4I3IA 1KOUA 4N9KA 4QB8A 4JGPA 3KSFA 5HWVA 1HD8A 1CF0A 5DTTA 1OTIA 4HJ6A 5HDDA 2XD1A 2XD5A 4DE1A 5F82A 2A24B 3LY3A 3SW1A 4NK3A 5FQJA 3UB7A 4JF4A 3LI9A 3UDIA 3UNWA 3Q7VA 1OJ5A 3O3VA 2JCHA 3LIEA 2OAQ1 1CJFA 4X1MA 3A3JA 2QMIA 4FSFA 1MKMA 1FR1A 3V39A 1ONHA 4LCMA 3O87A 5EECA 3UE3A 3PHYA 1RGZA 1SKOB 4OP5A 2VX8A 4FH2A 1F98A 1XPBA 1VB6A 3RXWA 3FKVA 4X69A 5KIZA 2Z2MB 3ICYA 5HZHA 4WEKA 4S2PA 5TJJA 5A90A 5J3WA 1ZC2A 3JYIA 3N6IA 2HJEA 3UB9A 4N92A 3V67A 4H8RA 1K56D 1KDSA 4LENA 5M19A 4O7DA 3HJIA 3ZCZA 4B4XA 4JGQA 3IQAA 4X6TA 3QP8A 3S7OA 2G2WA 5FI6A 4R3JA 4II7A 4GHIA 4WZ4A 3E4PA 1WYCA 5AJGA 3IBRA 4GN2A 4WLAA 3SOIA 3MR0A 3BEBA 3BQ8A 3LIFA 4ID4A 4Y2FA 1NRFA 1XFNA 2HP9A 4RA7A 2X71A 1UWPX 5HWWA 1FSYA 4YOFA 5LBRA 2W3EA 3IXBA 4JLFA 5DF9A 2A3UA 4C3QA 3ZNYA 3PBOA 2IA2A 4R70A 2KLIA 3IH8A 1KDWA 3M2JA 1T1AA 1XA7A 1ZG6A 1VETA 2QWSA 4KZ3A 3LYXA 3C38A 2RCXA 1WYBA 4JF6A 5DVAA 2X01A 1HLUP 4CPKA 3G2ZA 1GHPA 1O7EA 1UWNX 3QP1A 4UQIM 1M6KA 1T1BA 3PAGA 1V9ZA 4BMWA 1TS0A 2WGWB 1OT6A 3WS1A 3CMZA 4WELA 1BUEA 2NUTC 4B93A 5GLCA 3R7WA 4HI4A 1GSXA 4KQDA 1BT5A 4UHUA 4EERA 5HL1A 2PBDP 4UA7A 1YLJA 3OCNA 4X56A 4FCFA 2WGVA 4N9LA 4HOIA 5KSHA 4E3JA 4GOGA 3OZHA 1IYOA 3D9YA 1KGFA 5FASA 1L0FA 3H9WA 3C8CA 4S2IA 1YMSA 2Y2QA 1PWGA 3C30A 1PZPA 3CI6A 2WKRA 3VOYA 5EVEA 3VE3A 5A91A 5HAIA 2EX9A 2PR5A 4P6BA 5G4ZA 3LR5A 4WBGA 4DKIA 4QHCA 4HP4A 1VEUB 2DRWA 2PBYA 2B18A 4PM7A 2OWJA 2QJ7A 3P01A 1OTAA 5EVID 3NJAA 1FOFA 2WAFA 3TW8A 2QKPA 5L07A 3MZFA 4HY8A 4E6WA 1ESUA 5DFYA 4DRTA 3NY4A 3KYEA 4GKUA 5L2FA 3IXDA 4I5SA 3Q1FA 4H6JB 2XFTA 3IS2B 4JF5A 3LI8A 4HQAA 4D60A 5DJTA 1H5XA 2IWBA 3WS0A 3ZG8B 3FPVA 4OPZA 2ZC5B 4M3KA 4I39A 4OOMA 1E3UA 3UPNA 3BLMA 5FQQA 3IF6C 3UB5P 3C7UA 1W8YA 4MBFA 1KGEA 3T50A 5KSCA 4PHTA 3GECA 4R23A 1OTDA 1YM1A 1N9NA 1ERMA 3HBRA 5EM0A 5FL3A 2VV7A 2XF3A 4O8GA 4G3VA 4Q0IA 3VP3A 5FQKA 3VOZA 3VMAA 1BLPA 1NLYA 3W4PA 4ZTKA 2I72A 3ZG7B 1JTDA 5F6AA 2BTFP 5EUAA 3UDFA 4BWIA 4X1LA 3QHYA 2VGLM 5HL6A 3MFDA 3SZTA 4BD0A 4R38A 4FOFA 2ZQDA 3EEAA 4GDBA 4ZDXA 4FUWA 1OTBA 4YINA 3LEZA 5JYPA 5EFWA 2M1CA 4MNRA 2B5RA 1RP5A 4OPYA 3RFBA 3LUQA 2D02A 3VSLA 1SKOA 4F3LA 2QHKA 4IEDA 5EVIB 3P98A 4EUZA 4Z1WA 3LEQA 3BYDA 4WMCA 3F1NA 2PDRA 4EW7A 3JVUA 2ZD8A 2EWVA 3SH8A 3IX4A 1X0OA 2O0YA 5CHJA 1PW8A 3IX8A 5GHYA 2JC7A 3CITA 1FSWA 4UAAA 3H7WB 4UA6A 3UY6A 4XXRA 5A93A 5GHZA 3E4QA 4QY6A 3ZG9B 4WF0A 1OJGA 4EU0A 1NJ4A 4QJGA 3Q82A 2VLGA 1W63Q 2ZC4B 4R0QA 2WKQA 3ISGA 2L4RA 1EWZA 5CEBA 5EE8A 1OMEA 3M2KA 1IKGA 1PWDA 4UQIS 2HF6A 1RGYA 1YLZA 1S1YA 4BL3A 4R4SA 5K5BA 3LY4A 3Q81A 1KVLA 5D3OA 5FAPA 3OPLA 2HDSA 3ITAA 1FCOA 3A0VA 3GMWA 3V5MA 3UE0A 5L09A 3MQ0A 4NXEA 1W8QA 3E98A 2FFFB 2WGIA 1SHVA 3JPUA 2M7UA 4GS9B 1BYWA 1ERQA 2W27A 3CAXA 2PT7A 3RXXA 5E2FA 2HDUA 2JE5A 2XEPA 2W3HA 3CUEA 3TSGA 1I2WA 2R9XA 1WE4A 2MJ6A 4EV4A 3W4QA 4GW9A 1ZKJA 4Y15A 5DJUA 3RJUA 4GLQA 5C5KA 5CHUA 5EV0A 3PBRA 1VQQA 4S2KA 1MXOA 1XFQA 4YNRA 4EXOA 3IH9A 5G4YA 1XGJA 1IKIA 2P9VA 4IBXA
chains in the Genus database with same CATH topology
4ETXA 4LRYC 2JHEA 4RQ9A 1D06A 3NHQA 2O99A 3IBJA 4HHDA 3HJIA 3MMHA 4PAUA 4JGQA 2FZ0A 1JNUA 4XT2B 3LIAA 2J3TC 4JGRA 4NKPA 2HV1A 4CQHA 2W0NA 3S7OA 1TS6A 3S7QA 2W1RA 1TD5A 1YSPA 4II7A 4GHIA 3NOTC 3E4PA 3VE4A 3EGDC 5AJGA 3EWKA 3IBRA 3EOIA 4ME4A 3F1PB 3JVVA 4WLAA 3MR0A 3LR0A 3BQ8A 3FPWA 1F9IA 3LIFA 4Y2FA 4E04A 3A0RA 1UGUA 1XFNA 4XT2A 4MMNA 1UWPX 4NXFA 4UEYA 2JKTM 2D01A 2ZMVA 3VV4A 3MQQA 5HWWA 4YOFA 5LBRA 2KOIA 2EWWA 2W1TB 4JGOA 3VOLA 3C2WA 2W3EA 5DF9A 5HPFA 4MN7A 3PBOA 1P9RA 5F5YA 4P6ZS 2IA2A 3F1PA 4R70A 1NRJA 4HP9A 4ZRRA 2WKPA 3UB8A 4MN5A 2V1BA 2KLIA 2Y79A 3MXQA 3PR6A 4L0LA 2P08A 1H3QA 3FG8A 1T19A 1T1AA 1XJ3A 2VV6A 2VEAA 3U2AA 4KQOA 2GJ3A 4Q0HA 3PBQA 3CWFA 1N9OA 4L9GA 2W1TA 3R7WB 2PD8A 3OLOA 2QWSA 3LYXA 2ZBBA 3C38A 1TS7A 3BY8A 3MFXA 1UWNX 2K7SA 2W3FA 4UQIM 1LL8A 1T1BA 3EGXC 1LT0A 1V9ZA 2OWHA 4BMWA 2QJ5A 1TS0A 4HNBA 2A2LA 1XJ2A 1OT6A 2W3GA 2KX6A 4WELA 2XA7M 1ZHHB 3OOVA 2NUTC 4B93A 2VGLS 1W63M 4DJ3A 3R7WA 3KSGA 4HI4A 1GSXA 4KQDA 3T4KA 1LSVA 2H28A 3BQAA 5F68A 4EERA 2ZOIA 3RTYA 2W3DA 5HWTA 3W2ZA 4HIAA 3OCNA 3NOPC 2ZMFA 3TE8A 3BW6A 5AVEA 1P97A 3T4TA 2HJ9C 3A0SA 4PKYA 4PKYG 4IJGA 4HOIA 5KSHA 3KX0X 2V0UA 1WA9A 3H9WA 3C8CA 1ZTUA 1OPXA 4L9EA 4HJ4A 5HSQA 3C30A 2EA9A 4G3KA 3T4SA 3CI6A 4O0PA 2CMNA 2WKRA 2JKRM 5J7EA 3VE3A 1DP9A 3OCLA 2PR5A 5G4ZA 3LR5A 1DP8A 2O9BA 1IFQA 2DMWA 5A8BA 3UE6A 1S67L 3EQVA 4DJ2A 4HP4A 4AFIA 5HDCA 2B18A 3E0YA 2QJ7A 2OWJA 4KUKA 3D72A 5F69A 5IT5A 3P01A 1OTAA 1DP6A 3NJAA 3UMEA 3KYQA 2VA0A 4LRXC 2LB9A 4EETB 1STZA 3TW8A 2QKPA 2YKHA 4HY8A 5DFYA 2NUPC 5HPIA 2K2NA 2Z6CA 3EQUA 3EEHA 4GCZA 4I5SA 1GSVA 3CLOA 4Y3IA 3LIDA 3LIBA 3R4KA 1T1CA 4H6JB 3LR4A 4IUHA 3LICA 3BJNA 3S7NA 1NLZA 2P04A 3IS2B 5IU1A 1S1ZA 4EQ1A 3LI8A 4ARZB 4HH3A 1TS8A 4HQAA 2L0WA 2O9AA 4LPZA 5DJTA 1P0ZA 3T4QA 3PBSA 1T18A 2PR6A 3FPVA 4YWZA 4OOMA 4I39A 2PD7A 3MF0A 3B33A 1LSXA 4DN0A 1XJ4A 1D7EA 1OT9A 4HJ3A 4WL9A 4H6JA 2Z6DA 3T50A 1LSWA 1IOUA 2JKTI 4PHTA 3GECA 3MJQA 3ZQ5A 1YAXA 1OTDA 1OTEA 3IS2A 1N9NA 3S7PA 2KDKA 4ARZA 3PBTA 3B47A 3NOUC 4R6LA 4HH2A 5FL3A 2VV7A 2XA7S 4CLCD 4BBVA 3RH8B 4EUVA 4LRZE 4DMZA 5HD3A 3UMDA 4O8GA 4G3VA 3KO6A 4Q0IA 5L8MA 2I9VA 3ZYTA 5IS1A 2J80A 2B02A 2PYRA 2QYBA 3F1OB 1NLYA 1S66L 3FC7A 2G7UA 2VV8A 4CLCA 4BJPA 1G28A 3PYPA 4I3AA 5F6AA 1N9LA 4F3LB 3G6OA 4BWIA 2XROA 4MDZA 4MN6A 2VGLM 3F1NB 5HL6A 1S4RA 4NXGA 3HJKA 3MQOA 4R38A 5TBMB 4FOFA 3EEAA 1GSWA 1Y28A 4GJ4A 4M4XA 4R3AA 3E4OA 1OTBA 4MCWA 3H82B 1H8MA 5I5LA 1G6OA 5EFWA 2M1CA 3F1OA 4EEPA 2OAP1 3RFBA 2INWA 3LUQA 3UB6A 2D02A 3K2NA 4I38A 3HCYA 4F3LA 3OBFA 2QHKA 2VKSA 1XJ6A 4Z1WA 3CUEC 1NWZA 2V0WA 3TJZC 2HGVA 3F1NA 2PDRA 4CLCC 4EW7A 3JVUA 2EWVA 2VJWA 1S4SA 5TBMA 4B9OA 1X0OA 2O0YA 2OOLA 4OOLA 2VZWA 3K3CA 3D3OA 2GX5A 2PYPA 4QPRA 3H82A 3CITA 1ODVA 2ZOHA 3H7WB 4Y5FA 3KYZA 3KSHA 5DFXA 3DBAA 3LFVA 2R78A 5HDSA 3PXPA 3K3DA 2GNXA 4IHQA 3E4QA 1YSQA 2GZAA 1MZUA 2XRNA 4G3WA 2L1MA 2P7JA 4WF0A 4KUOA 2LB5A 1OJGA 4EU0A 2K31A 4NEED 1YKDA 4EEUA 2BASA 2JKRI 2YKFA 3P7NA 2J3WA 4I3IA 4K08A 4BBUA 1KOUA 2VLGA 4WUJA 4JGPA 3KSFA 1F5MA 5HWVA 1W63Q 1P9WA 3BY9A 3LR3A 2WKQA 2O9CA 3H7WA 1DRMA 4EESA 2L4RA 5HD5A 5DKKA 4Q0JA 2XSSA 4P6ZM 1OTIA 4HJ6A 5HDDA 4CLCE 1V9YA 2HF6A 4UQIS 3B42A 2A24B 2PHYA 2V9AA 3O5YA 1S1YA 3ULFA 4CLCB 5AVFA 5K5BA 3SW1A 5J4EA 3GDIA 3T4OA 3UB7A 3A0VA 3LI9A 4WEJA 2V1AA 1OJ5A 3MQ0A 4NXEA 5CX7A 3LIEA 3E98A 2J3TD 4WN5A 2M7UA 4GS9B 1BYWA 2OAQ1 3BWLA 4L9FA 2W27A 3CAXA 3T4LA 4FSFA 2PT7A 1MKMA 5DKLA 5MC7A 2W3HA 3CUEA 3PBNA 4BBTA 4O01A 2A24A 3UE3A 2MJ6A 4GW9A 2M7VA 1VHMA 3PHYA 5DJUA 3TRCA 4ETZA 4GLQA 5C5KA 2VX8A 2FH5A 1TF1A 4NXBA 1F98A 1VB6A 2JN7A 1EW0A 3PBRA 2Y8HA 4I3JA 4GS9A 1MC0A 4IUKA 5KIZA 3ICYA 5HZHA 1XFQA 4LLOB 4WEKA 5TJJA 3OC2A 4YNRA 5J3WA 4GHIB 4EXOA 2HJEA 5G4YA 3T4JA 3KSIA 3UB9A 3V67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFQ A;  1IOU A;  2DMW A;  3EGX C;  2NUT C;  3EGD C;  3KYQ A;  4B93 A;  1H8M A;  3BW6 A;  2NUP C;  2VX8 A;  4AFI A; 
#chains in the Genus database with same CATH topology
 4JBF A;  1L0G A;  1CI9 A;  4LRY C;  3GVB A;  1D06 A;  3DW0 A;  3NHQ A;  2O99 A;  3O88 A;  3MMH A;  4OLG A;  1JNU A;  4NKP A;  2HV1 A;  1TS6 A;  2W1R A;  1TD5 A;  4EBP A;  1YSP A;  4R4R A;  1K56 A;  3BLS A;  3DTK A;  5FEF A;  4ZAM A;  4R3B A;  3JVV A;  4IVI A;  3U4L P;  1MWS A;  3C4P A;  1CI8 A;  3GTC A;  3A0R A;  4XT2 A;  4PM9 A;  4NXF A;  2JKT M;  2ZMV A;  4NG2 A;  2EWW A;  2W1T B;  4JGO A;  3C2W A;  1PYY A;  5HPF A;  1IEL A;  3DWK A;  1P9R A;  4DF6 A;  5M1A A;  1BLH A;  4P6Z S;  1BTL A;  3F1P A;  1K55 C;  3ZGA B;  4HP9 A;  3DTE A;  4EWF A;  1VEU A;  2WKP A;  3G4P A;  4GDN A;  4Z9Q A;  1GHI A;  4L0L A;  3W8K A;  2A49 A;  4Q0H A;  2GJ3 A;  4XUX A;  1SCW A;  2HPB A;  3CWF A;  1N9O A;  4L9G A;  3VP0 A;  1CEG A;  3OLO A;  3LO7 A;  3ZNT A;  1XXM A;  1TS7 A;  2WZX A;  2W3F A;  3VP4 A;  2J9O A;  4DXC A;  1FCM A;  1LT0 A;  1ACF A;  4E3O A;  3OPP A;  4C75 A;  2QJ5 A;  4JKT A;  3NDE A;  2A2L A;  3N8R A;  5AQB A;  2KX6 A;  2G2U A;  3OOV A;  3T1R A;  2VGL S;  3NCK A;  2IWC A;  4DJ3 A;  3IHA A;  4LCL A;  3A3E A;  2UV0 E;  5CHM A;  1Z6F A;  1BLS A;  3MKF A;  5FSR A;  4ZJ2 A;  3W2Z A;  3VFH A;  3VP2 A;  2ZM2 A;  5FQI A;  2ZMF A;  3VFF A;  2V20 A;  3TE8 A;  3BW6 A;  5AVE A;  1SDE A;  2ZL1 A;  3T4T A;  3A0S A;  4GB7 A;  4PKY G;  4E3M A;  3GV9 A;  2WUQ A;  4OH0 A;  2BG1 A;  1WA9 A;  3BFG A;  3N7W A;  3BFE A;  5EOO A;  4KZ6 A;  1PFL A;  5HSQ A;  3MZD A;  1YT4 A;  2CMN A;  2JKR M;  3C4O A;  4LV2 A;  2Y59 A;  2XH9 A;  1DP9 A;  3A3F A;  1DP8 A;  4NET A;  2O9B A;  2DMW A;  5A8B A;  1S67 L;  2WYX A;  5DF8 A;  4DJ2 A;  2HP6 A;  1D1J A;  5HDC A;  4AFI A;  4BQM A;  5FEG A;  1YMX A;  5F69 A;  2ZM8 A;  3KYQ A;  4DE3 A;  4LRX C;  1E4D A;  2LB9 A;  4B4Z A;  4EET B;  2GDN A;  1ESI A;  2Y2H A;  2YKH A;  4X68 A;  1J9M A;  4ESP A;  5HPI A;  2WK0 A;  5HAQ A;  4JXV A;  3EQU A;  1YLP A;  4GCZ A;  3QNB A;  3LID A;  1T1C A;  1L0E A;  2PU2 A;  3ZFZ A;  3AGD A;  3FV7 A;  3LR4 A;  4IUH A;  3LIC A;  3BJN A;  5GHX A;  3CPT B;  1NLZ A;  2P04 A;  5CGW A;  3M6H A;  2O9A A;  5GL9 A;  2ZM0 A;  1N4O A;  1T18 A;  5EPH A;  1MY8 A;  1JWV A;  4GD8 A;  5HFO A;  5KMW A;  4KG2 A;  2ZC7 A;  3BM6 A;  3MZE A;  5AQA A;  2Z6D A;  1DJC A;  2JKT I;  3MJQ A;  2XDM A;  3S7P A;  1NZO A;  4ARZ A;  3PBT A;  3B47 A;  3NOU C;  3NI9 A;  5EVI C;  3SS5 A;  2XA7 S;  4CLC D;  4BBV A;  4EUV A;  1MPL A;  5TFQ A;  4DMZ A;  3UMD A;  3O86 A;  5L8M A;  3BFC A;  3BFF A;  3IX3 A;  3ZYT A;  3DTI A;  2B02 A;  2PYR A;  3ZG5 A;  4PPR A;  1K25 A;  1G28 A;  1N9L A;  3G6O A;  2Y2J A;  4MDZ A;  3ZVT A;  1S4R A;  4YFM A;  5FDH A;  3HJK A;  3HUM A;  5TBM B;  4GD6 A;  3UO9 A;  3MS6 A;  1GSW A;  3PAE A;  2XQZ A;  1Y28 A;  3E4O A;  3H82 B;  1H0M A;  1H8M A;  1A0K A;  3F1O A;  3GR2 A;  4PM6 A;  4QY5 A;  2C5W B;  3K2N A;  3SH9 A;  2JBF A;  1XJ6 A;  3TJZ C;  1TDG A;  2HGV A;  5L10 A;  1NXY A;  1MWU A;  2VGK A;  2Q9M A;  3IF6 A;  2VZW A;  1KE3 A;  3D3O A;  3ZG0 A;  2PYP A;  3WRZ A;  4CJN A;  4S2N A;  1ODV A;  2ZOH A;  2FFY A;  2Y2I A;  1C3B A;  5DFX A;  3DBA A;  1I5Q A;  3T1X A;  3K3D A;  2OV5 A;  1YSQ A;  4KZB A;  2GZA A;  1LI9 A;  2P7J A;  4BL2 A;  3IXH A;  3S1Y A;  4NEE D;  3NDG A;  1YKD A;  2BAS A;  2JKR I;  2EXA A;  4JPM A;  2J3W A;  4BBU A;  1GA9 A;  4WUJ A;  1PZO A;  1F5M A;  3G32 A;  1EI5 A;  1K4F A;  1P9W A;  3BY9 A;  3LR3 A;  4EES A;  5HD5 A;  4DE2 A;  3GSG A;  2XSS A;  4P6Z M;  4ZJ1 A;  4CLC E;  3QP2 A;  1V9Y A;  4UA9 A;  1HVB A;  4S2N C;  1Y54 A;  1NZU A;  4Y0T A;  3B42 A;  2PHY A;  2V9A A;  3O5Y A;  3ULF A;  4CLC B;  5AVF A;  4BEN A;  3OPH A;  4WYY A;  4E3K A;  5J4E A;  3GDI A;  1IYS A;  2ZMA A;  2ZQC A;  4S2L A;  2ZC3 B;  3FZC A;  1S0W A;  5CX7 A;  2J3T D;  1TEM A;  1DJA A;  1GA0 A;  3T4L A;  2PU4 A;  4KG6 A;  3LCE A;  5MC7 A;  3QNC A;  1Q2Q A;  5DTS A;  1LL5 A;  1BSG A;  4BBT A;  3WS5 A;  2A24 A;  1W5D A;  4ETZ A;  3ITB A;  2FH5 A;  1K38 A;  2JN7 A;  1EW0 A;  1MC0 A;  1NYY A;  4OP8 A;  1MBL A;  5KZH A;  3OC2 A;  2ZLY A;  4GHI B;  2E8I A;  3SH7 A;  1XA1 A;  3T4J A;  2XGN A;  4KZ5 A;  4FH4 A;  2JHE A;  4K91 A;  1HZO A;  2H0T A;  1L3L A;  4OQ0 A;  4PAU A;  3WRT A;  3NEC A;  4JGR A;  4CQH A;  3S7Q A;  3GQZ A;  3A3I A;  3P09 A;  3HLD A;  5TR7 A;  3BEC A;  3EGD C;  2Y2G A;  4ME4 A;  2Y4A A;  4PM5 A;  1PRQ A;  4MEZ A;  1G5U A;  1F9I A;  3ZHH A;  2HDQ A;  1H8Y A;  4MMN A;  5F83 A;  4UEY A;  1NY0 A;  5EVL A;  2D01 A;  1Z09 A;  5CER A;  3MQQ A;  3VOL A;  4EBL A;  1VET B;  3L7H A;  4RX3 A;  1U60 A;  1FQG A;  4S2O A;  2OSU A;  5JYO A;  2H0Y A;  4LGW A;  2VK3 A;  3UB8 A;  4MN5 A;  2Y79 A;  3IXG A;  3MXQ A;  3PR6 A;  2P08 A;  1K54 A;  3FG8 A;  1T19 A;  1XJ3 A;  2VV6 A;  5GLA A;  3R7W B;  2PD8 A;  1IYP A;  3SS3 A;  2ZBB A;  1KE0 A;  3MFX A;  2V8F A;  4OVD A;  3B3X A;  2EX2 A;  3EGX C;  4WZ5 A;  2EXB A;  4E3L A;  1KE4 A;  1XJ2 A;  1MWR A;  2VGJ A;  3HUN A;  2W3G A;  2XA7 M;  2ZQ7 A;  2V2F F;  4RYE A;  1W63 M;  5DF7 A;  3KSG A;  1K54 C;  3ZVW A;  3T4K A;  2XLN A;  2H28 A;  4MLL A;  3RTY A;  2W3D A;  5HWT A;  1K0K A;  4OKP A;  5CED A;  2CC1 A;  5CEC A;  2XK1 A;  2WGW A;  2HJ9 C;  4PKY A;  1J3W A;  3Q7Z A;  1BUL A;  3S4X A;  5HAP A;  1JTG A;  4WZ5 C;  4OPQ A;  2P74 A;  1ZTU A;  1YLY A;  3Q07 A;  4Y17 A;  1K55 A;  5FI2 A;  4KZ4 A;  4PMA A;  1TVF A;  4Q8I A;  4E3I A;  4QD4 A;  1YPR A;  3OPR A;  5M18 A;  2Y2L A;  1ZG4 A;  3E2K A;  4MBH A;  2R9W A;  3HVF A;  4EQI A;  1MWT A;  5IT5 A;  2EFX A;  1DP6 A;  2V1Z A;  2WAE A;  1YQS A;  4Y7P A;  1STZ A;  3T1S A;  3HLW A;  1ALQ A;  1N9B A;  4KQR A;  2OLV A;  2NUP C;  4KZ8 A;  3NIA A;  1XKZ A;  2Z6C A;  4OLD A;  3G35 A;  3EEH A;  3CLO A;  2OLU A;  3LIB A;  1IYQ A;  5IU1 A;  1S1Z A;  4QWO A;  4HH3 A;  2QZ6 A;  2BLS A;  2L0W A;  4LPZ A;  1YLT A;  3HL9 A;  3SS4 A;  4Y13 A;  2ZC6 B;  4R1G A;  2Y2N A;  3MF0 A;  3QP4 A;  1LSX A;  1SZV A;  1XJ4 A;  1L0D A;  1ONG A;  1D7E A;  4HJ3 A;  4H6J A;  1IOU A;  1LSW A;  2XFS A;  3HUO A;  3G30 A;  4F94 A;  2J7V A;  1YAX A;  2WKE A;  3IS2 A;  2HDR A;  4R6L A;  2WKH A;  3CG5 A;  3RH8 B;  4LRZ E;  5FAQ A;  5HD3 A;  1GHM A;  2C6W B;  1SDN A;  2J80 A;  4LFU A;  5U47 A;  3D4F A;  1JWP A;  1S66 L;  4A5R A;  2G7U A;  2VV8 A;  4CLC A;  4I3A A;  3BFD A;  4F3L B;  5E2E A;  3MBZ A;  2XRO A;  3S22 A;  4MN6 A;  3F1N B;  4BLM A;  4KQQ A;  1W79 A;  4NXG A;  3MQO A;  3QP6 A;  2V8C A;  4GJ4 A;  4R3A A;  1I2S A;  4MCW A;  1G6O A;  3NBL A;  3QP5 A;  3MXR A;  3HCY A;  3OBF A;  1KGG A;  2VKS A;  4Y0U A;  1NWZ A;  2V0W A;  4KG5 A;  4CLC C;  3V50 A;  4Y0O A;  2VJW A;  1S4S A;  4IVK A;  5AQ7 A;  5DTK A;  2ACG A;  2OOL A;  1Q2P A;  3T1Q B;  4X53 A;  1YLW A;  4QPR A;  2Y55 A;  2Z2L B;  2WZZ A;  1TDL A;  4EBN A;  4Y5F A;  3BRM A;  4N1H A;  4E6X A;  3L9K A;  3VSK A;  1ES4 A;  3LFV A;  2R78 A;  5HDS A;  3PXP A;  2GNX A;  4HES A;  5EVI A;  3TG9 A;  1MZU A;  4G3W A;  4KZ9 A;  3AGE A;  1Y4O A;  2K31 A;  2Y2O A;  4EEU A;  4K08 A;  2YKF A;  3P7N A;  1FCN A;  2O9C A;  3H7W A;  1DRM A;  5DKK A;  4Q0J A;  4LV1 A;  1CEF A;  4OOY A;  1FIL A;  3UE1 A;  2Y2M A;  4OQH A;  5FI7 A;  4GZB A;  2ZQ8 A;  4ZBE A;  1PI5 A;  4QU3 A;  3T4O A;  4WEJ A;  3IWO A;  2V1A A;  1L2S A;  3MSH A;  4WN5 A;  1RCJ A;  3N4I A;  3BWL A;  4L9F A;  3V3R A;  3HRE A;  4HBT A;  5DKL A;  2X02 A;  4BD1 A;  2Q0O A;  1FR6 A;  2P9V B;  3PBN A;  2DCF A;  5F1G A;  5E2H A;  4O01 A;  1ES5 A;  1SKF A;  2M7V A;  1VHM A;  4S2J A;  3TRC A;  1PW1 A;  1TF1 A;  2EFU A;  4NXB A;  4XUZ A;  4P85 A;  5CXW A;  2Y8H A;  1DJB A;  4GS9 A;  4I3J A;  3G31 A;  4IUK A;  4U0T A;  4LLO B;  3DAV A;  3NUL A;  4K0X A;  3KSI A;  3AGF A;  5HAR A;  2EX8 A;  2JKF A;  4ETX A;  5CTN A;  3UDX A;  4RQ9 A;  1KVM A;  1IEM A;  3NC8 A;  3PTE A;  3WS4 A;  3IBJ A;  4HHD A;  2FZ0 A;  2HZ5 A;  4XT2 B;  3LIA A;  2J3T C;  2EX6 A;  3HLB A;  2W0N A;  1VM1 A;  1FIK A;  3NOT C;  1BLC A;  4U0X A;  3VE4 A;  3EWK A;  1HTZ A;  3EOI A;  4MBK A;  1E25 A;  3F1P B;  4DXB A;  2ZJ9 A;  3LR0 A;  3FPW A;  5EOE A;  3C7V A;  4E04 A;  2Y2P A;  1UGU A;  4K0W A;  4LV3 A;  3WS2 A;  3HLC A;  4OQG A;  4KZ7 A;  4JXW A;  3HLF A;  3VV4 A;  4U3T A;  3Q7V B;  3A3D A;  5CGX A;  5HX9 A;  2KOI A;  5BOH A;  4MN7 A;  2E8J A;  5TGF A;  2HP5 A;  3IT9 A;  1W7F A;  5F5Y A;  1NRJ A;  4ZRR A;  2IWD A;  2WAD A;  5CGS A;  4B88 A;  3DTM A;  2V1B A;  5E43 A;  3G34 A;  4PM8 A;  1H3Q A;  4IBR A;  1F2K A;  2VEA A;  3U2A A;  4KQO A;  3PBQ A;  2Y2K A;  1LI0 A;  2W1T A;  1K6S A;  2XR0 A;  1PIO A;  2H5S A;  1XP4 A;  5J8X A;  3BY8 A;  3IF5 A;  2K7S A;  5A92 A;  1LL8 A;  4P0M A;  5FQ9 A;  4E3N A;  2Y91 A;  4S2M A;  4FD8 A;  2OWH A;  2ZL1 B;  4HNB A;  4GNU A;  1JWZ A;  5E2G A;  1ZHH B;  1K57 A;  2B95 A;  1PI4 A;  2PAV P;  3TOI A;  4C6Y A;  1LSV A;  3BQA A;  5F68 A;  3HLE A;  2ZOI A;  3W4O A;  4HIA A;  5HW3 A;  3NOP C;  3V3S A;  4KZA A;  2J9P A;  5F1F A;  4D2O A;  3DWZ A;  1CQA A;  1P97 A;  1BZA A;  1DY6 A;  4P87 A;  4IJG A;  3KX0 X;  2V0U A;  5FAO A;  1XX2 A;  2J8Y A;  2RL3 A;  1OPX A;  3FWL A;  4L9E A;  4HJ4 A;  4HEF A;  4X55 A;  3UPO A;  2EA9 A;  4G3K A;  3MXS A;  4X25 A;  3T4S A;  4O0P A;  1O07 A;  1K57 C;  3T12 B;  3IWI A;  3UN7 A;  3IWQ A;  5J7E A;  5GLD A;  3OCL A;  3WWX A;  5CTM A;  1IFQ A;  3UE6 A;  3ZDJ A;  3EQV A;  1M40 A;  5IHV A;  4HBU A;  3E0Y A;  4KUK A;  3D72 A;  1K4E A;  2WKI A;  1MKI A;  5FA7 A;  2PRF A;  1G6A A;  3UME A;  2VA0 A;  2QPN A;  4DE0 A;  3G2Y A;  1G68 A;  1ES2 A;  2K2N A;  4RVA A;  1GSV A;  1E3U D;  4Y3I A;  5G18 A;  3R4K A;  3S7N A;  4DDS A;  4EQ1 A;  4ARZ B;  1TS8 A;  3N8S A;  1P0Z A;  3T4Q A;  1LHY A;  3PBS A;  2JKG A;  4JXS A;  2PR6 A;  4DDY A;  4YWZ A;  4JXG A;  1QMF A;  2PD7 A;  3B33 A;  3C5A A;  5I94 A;  1ERO A;  4DN0 A;  4OON A;  2ZQA A;  1OT9 A;  4WL9 A;  3ZQ5 A;  1XGI A;  3CPT A;  1H8Z A;  1OTE A;  1NYM A;  4RX2 A;  2KDK A;  3VP1 A;  5FDS A;  4HH2 A;  4ZJ3 A;  3LGO A;  4FTX A;  3M6B A;  3FYZ A;  3KO6 A;  3UPP A;  2I9V A;  5IS1 A;  2QYB A;  3GRJ A;  1PWC A;  3F1O B;  3FC7 A;  1PNE A;  4LV0 A;  4BJP A;  5EM1 A;  3IHB A;  3PYP A;  2UWX A;  3CHW P;  1CK3 A;  5FAT A;  3N8L A;  5FQM A;  1GCE A;  1LLB A;  3E2L A;  3IF6 B;  4M4X A;  3FKW A;  4WMC D;  1LL9 A;  3HLG A;  5CRF A;  5I5L A;  1QME A;  5AQ9 A;  4EEP A;  2OAP 1;  1AXB A;  2INW A;  4KEN B;  3UB6 A;  4OPR A;  1ES3 A;  4I38 A;  4OQI A;  1AWI A;  3CJM A;  3CUE C;  1JVJ A;  2Q9N A;  1K6R A;  5TBM A;  4B9O A;  1S6R A;  3MKE A;  4OOL A;  3K3C A;  2GX5 A;  3H82 A;  5GLB A;  2AVX A;  3KYZ A;  3KSH A;  2ZQ9 A;  2DNS A;  3CZD A;  4IHQ A;  2H10 A;  2XRN A;  2L1M A;  4WM9 A;  4N1X A;  4KUO A;  2LB5 A;  3I7J A;  4I3I A;  1KOU A;  4N9K A;  4QB8 A;  4JGP A;  3KSF A;  5HWV A;  1HD8 A;  1CF0 A;  5DTT A;  1OTI A;  4HJ6 A;  5HDD A;  2XD1 A;  2XD5 A;  4DE1 A;  5F82 A;  2A24 B;  3LY3 A;  3SW1 A;  4NK3 A;  5FQJ A;  3UB7 A;  4JF4 A;  3LI9 A;  3UDI A;  3UNW A;  3Q7V A;  1OJ5 A;  3O3V A;  2JCH A;  3LIE A;  2OAQ 1;  1CJF A;  4X1M A;  3A3J A;  2QMI A;  4FSF A;  1MKM A;  1FR1 A;  3V39 A;  1ONH A;  4LCM A;  3O87 A;  5EEC A;  3UE3 A;  3PHY A;  1RGZ A;  1SKO B;  4OP5 A;  2VX8 A;  4FH2 A;  1F98 A;  1XPB A;  1VB6 A;  3RXW A;  3FKV A;  4X69 A;  5KIZ A;  2Z2M B;  3ICY A;  5HZH A;  4WEK A;  4S2P A;  5TJJ A;  5A90 A;  5J3W A;  1ZC2 A;  3JYI A;  3N6I A;  2HJE A;  3UB9 A;  4N92 A;  3V67 A;  4H8R A;  1K56 D;  1KDS A;  4LEN A;  5M19 A;  4O7D A;  3HJI A;  3ZCZ A;  4B4X A;  4JGQ A;  3IQA A;  4X6T A;  3QP8 A;  3S7O A;  2G2W A;  5FI6 A;  4R3J A;  4II7 A;  4GHI A;  4WZ4 A;  3E4P A;  1WYC A;  5AJG A;  3IBR A;  4GN2 A;  4WLA A;  3SOI A;  3MR0 A;  3BEB A;  3BQ8 A;  3LIF A;  4ID4 A;  4Y2F A;  1NRF A;  1XFN A;  2HP9 A;  4RA7 A;  2X71 A;  1UWP X;  5HWW A;  1FSY A;  4YOF A;  5LBR A;  2W3E A;  3IXB A;  4JLF A;  5DF9 A;  2A3U A;  4C3Q A;  3ZNY A;  3PBO A;  2IA2 A;  4R70 A;  2KLI A;  3IH8 A;  1KDW A;  3M2J A;  1T1A A;  1XA7 A;  1ZG6 A;  1VET A;  2QWS A;  4KZ3 A;  3LYX A;  3C38 A;  2RCX A;  1WYB A;  4JF6 A;  5DVA A;  2X01 A;  1HLU P;  4CPK A;  3G2Z A;  1GHP A;  1O7E A;  1UWN X;  3QP1 A;  4UQI M;  1M6K A;  1T1B A;  3PAG A;  1V9Z A;  4BMW A;  1TS0 A;  2WGW B;  1OT6 A;  3WS1 A;  3CMZ A;  4WEL A;  1BUE A;  2NUT C;  4B93 A;  5GLC A;  3R7W A;  4HI4 A;  1GSX A;  4KQD A;  1BT5 A;  4UHU A;  4EER A;  5HL1 A;  2PBD P;  4UA7 A;  1YLJ A;  3OCN A;  4X56 A;  4FCF A;  2WGV A;  4N9L A;  4HOI A;  5KSH A;  4E3J A;  4GOG A;  3OZH A;  1IYO A;  3D9Y A;  1KGF A;  5FAS A;  1L0F A;  3H9W A;  3C8C A;  4S2I A;  1YMS A;  2Y2Q A;  1PWG A;  3C30 A;  1PZP A;  3CI6 A;  2WKR A;  3VOY A;  5EVE A;  3VE3 A;  5A91 A;  5HAI A;  2EX9 A;  2PR5 A;  4P6B A;  5G4Z A;  3LR5 A;  4WBG A;  4DKI A;  4QHC A;  4HP4 A;  1VEU B;  2DRW A;  2PBY A;  2B18 A;  4PM7 A;  2OWJ A;  2QJ7 A;  3P01 A;  1OTA A;  5EVI D;  3NJA A;  1FOF A;  2WAF A;  3TW8 A;  2QKP A;  5L07 A;  3MZF A;  4HY8 A;  4E6W A;  1ESU A;  5DFY A;  4DRT A;  3NY4 A;  3KYE A;  4GKU A;  5L2F A;  3IXD A;  4I5S A;  3Q1F A;  4H6J B;  2XFT A;  3IS2 B;  4JF5 A;  3LI8 A;  4HQA A;  4D60 A;  5DJT A;  1H5X A;  2IWB A;  3WS0 A;  3ZG8 B;  3FPV A;  4OPZ A;  2ZC5 B;  4M3K A;  4I39 A;  4OOM A;  1E3U A;  3UPN A;  3BLM A;  5FQQ A;  3IF6 C;  3UB5 P;  3C7U A;  1W8Y A;  4MBF A;  1KGE A;  3T50 A;  5KSC A;  4PHT A;  3GEC A;  4R23 A;  1OTD A;  1YM1 A;  1N9N A;  1ERM A;  3HBR A;  5EM0 A;  5FL3 A;  2VV7 A;  2XF3 A;  4O8G A;  4G3V A;  4Q0I A;  3VP3 A;  5FQK A;  3VOZ A;  3VMA A;  1BLP A;  1NLY A;  3W4P A;  4ZTK A;  2I72 A;  3ZG7 B;  1JTD A;  5F6A A;  2BTF P;  5EUA A;  3UDF A;  4BWI A;  4X1L A;  3QHY A;  2VGL M;  5HL6 A;  3MFD A;  3SZT A;  4BD0 A;  4R38 A;  4FOF A;  2ZQD A;  3EEA A;  4GDB A;  4ZDX A;  4FUW A;  1OTB A;  4YIN A;  3LEZ A;  5JYP A;  5EFW A;  2M1C A;  4MNR A;  2B5R A;  1RP5 A;  4OPY A;  3RFB A;  3LUQ A;  2D02 A;  3VSL A;  1SKO A;  4F3L A;  2QHK A;  4IED A;  5EVI B;  3P98 A;  4EUZ A;  4Z1W A;  3LEQ A;  3BYD A;  4WMC A;  3F1N A;  2PDR A;  4EW7 A;  3JVU A;  2ZD8 A;  2EWV A;  3SH8 A;  3IX4 A;  1X0O A;  2O0Y A;  5CHJ A;  1PW8 A;  3IX8 A;  5GHY A;  2JC7 A;  3CIT A;  1FSW A;  4UAA A;  3H7W B;  4UA6 A;  3UY6 A;  4XXR A;  5A93 A;  5GHZ A;  3E4Q A;  4QY6 A;  3ZG9 B;  4WF0 A;  1OJG A;  4EU0 A;  1NJ4 A;  4QJG A;  3Q82 A;  2VLG A;  1W63 Q;  2ZC4 B;  4R0Q A;  2WKQ A;  3ISG A;  2L4R A;  1EWZ A;  5CEB A;  5EE8 A;  1OME A;  3M2K A;  1IKG A;  1PWD A;  4UQI S;  2HF6 A;  1RGY A;  1YLZ A;  1S1Y A;  4BL3 A;  4R4S A;  5K5B A;  3LY4 A;  3Q81 A;  1KVL A;  5D3O A;  5FAP A;  3OPL A;  2HDS A;  3ITA A;  1FCO A;  3A0V A;  3GMW A;  3V5M A;  3UE0 A;  5L09 A;  3MQ0 A;  4NXE A;  1W8Q A;  3E98 A;  2FFF B;  2WGI A;  1SHV A;  3JPU A;  2M7U A;  4GS9 B;  1BYW A;  1ERQ A;  2W27 A;  3CAX A;  2PT7 A;  3RXX A;  5E2F A;  2HDU A;  2JE5 A;  2XEP A;  2W3H A;  3CUE A;  3TSG A;  1I2W A;  2R9X A;  1WE4 A;  2MJ6 A;  4EV4 A;  3W4Q A;  4GW9 A;  1ZKJ A;  4Y15 A;  5DJU A;  3RJU A;  4GLQ A;  5C5K A;  5CHU A;  5EV0 A;  3PBR A;  1VQQ A;  4S2K A;  1MXO A;  1XFQ A;  4YNR A;  4EXO A;  3IH9 A;  5G4Y A;  1XGJ A;  1IKI A;  2P9V A;  4IBX A; 
#chains in the Genus database with same CATH homology
 4ETX A;  4LRY C;  2JHE A;  4RQ9 A;  1D06 A;  3NHQ A;  2O99 A;  3IBJ A;  4HHD A;  3HJI A;  3MMH A;  4PAU A;  4JGQ A;  2FZ0 A;  1JNU A;  4XT2 B;  3LIA A;  2J3T C;  4JGR A;  4NKP A;  2HV1 A;  4CQH A;  2W0N A;  3S7O A;  1TS6 A;  3S7Q A;  2W1R A;  1TD5 A;  1YSP A;  4II7 A;  4GHI A;  3NOT C;  3E4P A;  3VE4 A;  3EGD C;  5AJG A;  3EWK A;  3IBR A;  3EOI A;  4ME4 A;  3F1P B;  3JVV A;  4WLA A;  3MR0 A;  3LR0 A;  3BQ8 A;  3FPW A;  1F9I A;  3LIF A;  4Y2F A;  4E04 A;  3A0R A;  1UGU A;  1XFN A;  4XT2 A;  4MMN A;  1UWP X;  4NXF A;  4UEY A;  2JKT M;  2D01 A;  2ZMV A;  3VV4 A;  3MQQ A;  5HWW A;  4YOF A;  5LBR A;  2KOI A;  2EWW A;  2W1T B;  4JGO A;  3VOL A;  3C2W A;  2W3E A;  5DF9 A;  5HPF A;  4MN7 A;  3PBO A;  1P9R A;  5F5Y A;  4P6Z S;  2IA2 A;  3F1P A;  4R70 A;  1NRJ A;  4HP9 A;  4ZRR A;  2WKP A;  3UB8 A;  4MN5 A;  2V1B A;  2KLI A;  2Y79 A;  3MXQ A;  3PR6 A;  4L0L A;  2P08 A;  1H3Q A;  3FG8 A;  1T19 A;  1T1A A;  1XJ3 A;  2VV6 A;  2VEA A;  3U2A A;  4KQO A;  2GJ3 A;  4Q0H A;  3PBQ A;  3CWF A;  1N9O A;  4L9G A;  2W1T A;  3R7W B;  2PD8 A;  3OLO A;  2QWS A;  3LYX A;  2ZBB A;  3C38 A;  1TS7 A;  3BY8 A;  3MFX A;  1UWN X;  2K7S A;  2W3F A;  4UQI M;  1LL8 A;  1T1B A;  3EGX C;  1LT0 A;  1V9Z A;  2OWH A;  4BMW A;  2QJ5 A;  1TS0 A;  4HNB A;  2A2L A;  1XJ2 A;  1OT6 A;  2W3G A;  2KX6 A;  4WEL A;  2XA7 M;  1ZHH B;  3OOV A;  2NUT C;  4B93 A;  2VGL S;  1W63 M;  4DJ3 A;  3R7W A;  3KSG A;  4HI4 A;  1GSX A;  4KQD A;  3T4K A;  1LSV A;  2H28 A;  3BQA A;  5F68 A;  4EER A;  2ZOI A;  3RTY A;  2W3D A;  5HWT A;  3W2Z A;  4HIA A;  3OCN A;  3NOP C;  2ZMF A;  3TE8 A;  3BW6 A;  5AVE A;  1P97 A;  3T4T A;  2HJ9 C;  3A0S A;  4PKY A;  4PKY G;  4IJG A;  4HOI A;  5KSH A;  3KX0 X;  2V0U A;  1WA9 A;  3H9W A;  3C8C A;  1ZTU A;  1OPX A;  4L9E A;  4HJ4 A;  5HSQ A;  3C30 A;  2EA9 A;  4G3K A;  3T4S A;  3CI6 A;  4O0P A;  2CMN A;  2WKR A;  2JKR M;  5J7E A;  3VE3 A;  1DP9 A;  3OCL A;  2PR5 A;  5G4Z A;  3LR5 A;  1DP8 A;  2O9B A;  1IFQ A;  2DMW A;  5A8B A;  3UE6 A;  1S67 L;  3EQV A;  4DJ2 A;  4HP4 A;  4AFI A;  5HDC A;  2B18 A;  3E0Y A;  2QJ7 A;  2OWJ A;  4KUK A;  3D72 A;  5F69 A;  5IT5 A;  3P01 A;  1OTA A;  1DP6 A;  3NJA A;  3UME A;  3KYQ A;  2VA0 A;  4LRX C;  2LB9 A;  4EET B;  1STZ A;  3TW8 A;  2QKP A;  2YKH A;  4HY8 A;  5DFY A;  2NUP C;  5HPI A;  2K2N A;  2Z6C A;  3EQU A;  3EEH A;  4GCZ A;  4I5S A;  1GSV A;  3CLO A;  4Y3I A;  3LID A;  3LIB A;  3R4K A;  1T1C A;  4H6J B;  3LR4 A;  4IUH A;  3LIC A;  3BJN A;  3S7N A;  1NLZ A;  2P04 A;  3IS2 B;  5IU1 A;  1S1Z A;  4EQ1 A;  3LI8 A;  4ARZ B;  4HH3 A;  1TS8 A;  4HQA A;  2L0W A;  2O9A A;  4LPZ A;  5DJT A;  1P0Z A;  3T4Q A;  3PBS A;  1T18 A;  2PR6 A;  3FPV A;  4YWZ A;  4OOM A;  4I39 A;  2PD7 A;  3MF0 A;  3B33 A;  1LSX A;  4DN0 A;  1XJ4 A;  1D7E A;  1OT9 A;  4HJ3 A;  4WL9 A;  4H6J A;  2Z6D A;  3T50 A;  1LSW A;  1IOU A;  2JKT I;  4PHT A;  3GEC A;  3MJQ A;  3ZQ5 A;  1YAX A;  1OTD A;  1OTE A;  3IS2 A;  1N9N A;  3S7P A;  2KDK A;  4ARZ A;  3PBT A;  3B47 A;  3NOU C;  4R6L A;  4HH2 A;  5FL3 A;  2VV7 A;  2XA7 S;  4CLC D;  4BBV A;  3RH8 B;  4EUV A;  4LRZ E;  4DMZ A;  5HD3 A;  3UMD A;  4O8G A;  4G3V A;  3KO6 A;  4Q0I A;  5L8M A;  2I9V A;  3ZYT A;  5IS1 A;  2J80 A;  2B02 A;  2PYR A;  2QYB A;  3F1O B;  1NLY A;  1S66 L;  3FC7 A;  2G7U A;  2VV8 A;  4CLC A;  4BJP A;  1G28 A;  3PYP A;  4I3A A;  5F6A A;  1N9L A;  4F3L B;  3G6O A;  4BWI A;  2XRO A;  4MDZ A;  4MN6 A;  2VGL M;  3F1N B;  5HL6 A;  1S4R A;  4NXG A;  3HJK A;  3MQO A;  4R38 A;  5TBM B;  4FOF A;  3EEA A;  1GSW A;  1Y28 A;  4GJ4 A;  4M4X A;  4R3A A;  3E4O A;  1OTB A;  4MCW A;  3H82 B;  1H8M A;  5I5L A;  1G6O A;  5EFW A;  2M1C A;  3F1O A;  4EEP A;  2OAP 1;  3RFB A;  2INW A;  3LUQ A;  3UB6 A;  2D02 A;  3K2N A;  4I38 A;  3HCY A;  4F3L A;  3OBF A;  2QHK A;  2VKS A;  1XJ6 A;  4Z1W A;  3CUE C;  1NWZ A;  2V0W A;  3TJZ C;  2HGV A;  3F1N A;  2PDR A;  4CLC C;  4EW7 A;  3JVU A;  2EWV A;  2VJW A;  1S4S A;  5TBM A;  4B9O A;  1X0O A;  2O0Y A;  2OOL A;  4OOL A;  2VZW A;  3K3C A;  3D3O A;  2GX5 A;  2PYP A;  4QPR A;  3H82 A;  3CIT A;  1ODV A;  2ZOH A;  3H7W B;  4Y5F A;  3KYZ A;  3KSH A;  5DFX A;  3DBA A;  3LFV A;  2R78 A;  5HDS A;  3PXP A;  3K3D A;  2GNX A;  4IHQ A;  3E4Q A;  1YSQ A;  2GZA A;  1MZU A;  2XRN A;  4G3W A;  2L1M A;  2P7J A;  4WF0 A;  4KUO A;  2LB5 A;  1OJG A;  4EU0 A;  2K31 A;  4NEE D;  1YKD A;  4EEU A;  2BAS A;  2JKR I;  2YKF A;  3P7N A;  2J3W A;  4I3I A;  4K08 A;  4BBU A;  1KOU A;  2VLG A;  4WUJ A;  4JGP A;  3KSF A;  1F5M A;  5HWV A;  1W63 Q;  1P9W A;  3BY9 A;  3LR3 A;  2WKQ A;  2O9C A;  3H7W A;  1DRM A;  4EES A;  2L4R A;  5HD5 A;  5DKK A;  4Q0J A;  2XSS A;  4P6Z M;  1OTI A;  4HJ6 A;  5HDD A;  4CLC E;  1V9Y A;  2HF6 A;  4UQI S;  3B42 A;  2A24 B;  2PHY A;  2V9A A;  3O5Y A;  1S1Y A;  3ULF A;  4CLC B;  5AVF A;  5K5B A;  3SW1 A;  5J4E A;  3GDI A;  3T4O A;  3UB7 A;  3A0V A;  3LI9 A;  4WEJ A;  2V1A A;  1OJ5 A;  3MQ0 A;  4NXE A;  5CX7 A;  3LIE A;  3E98 A;  2J3T D;  4WN5 A;  2M7U A;  4GS9 B;  1BYW A;  2OAQ 1;  3BWL A;  4L9F A;  2W27 A;  3CAX A;  3T4L A;  4FSF A;  2PT7 A;  1MKM A;  5DKL A;  5MC7 A;  2W3H A;  3CUE A;  3PBN A;  4BBT A;  4O01 A;  2A24 A;  3UE3 A;  2MJ6 A;  4GW9 A;  2M7V A;  1VHM A;  3PHY A;  5DJU A;  3TRC A;  4ETZ A;  4GLQ A;  5C5K A;  2VX8 A;  2FH5 A;  1TF1 A;  4NXB A;  1F98 A;  1VB6 A;  2JN7 A;  1EW0 A;  3PBR A;  2Y8H A;  4I3J A;  4GS9 A;  1MC0 A;  4IUK A;  5KIZ A;  3ICY A;  5HZH A;  1XFQ A;  4LLO B;  4WEK A;  5TJJ A;  3OC2 A;  4YNR A;  5J3W A;  4GHI B;  4EXO A;  2HJE A;  5G4Y A;  3T4J A;  3KSI A;  3UB9 A;  3V67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...