2GJ3A

Crystal structure of the fad-containing pas domain of the protein nifl from azotobacter vinelandii.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
LLPEIFRQTVEHAPIAISITDLKANILYANRAFRTITGYGSEEVLGKNESILSNGTTPRLVYQALWGRLAQKKPWSGVLVNRRKDKTLYLAELTVAPVLNEAGETIYYLGMHRDTSELH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nitrogen fixation regulatory protein
publication title Structure of the redox sensor domain of Azotobacter vinelandii NifL at atomic resolution: signaling, dimerization, and mechanism.
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gj3A00
2QHKA 3UB9A 2PYRA 3H7WA 3F1NA 4WN5A 5AVEA 4HIAA 1G28A 3H82B 3NOTC 5I5LA 5TBMB 2GJ3A 4RQ9A 2V1AA 3HJKA 4EQ1A 4NXFA 4L9FA 4HY8A 4EERA 3NOPC 4GHIA 1D06A 2R78A 1X0OA 2L4RA 3UB7A 3C2WA 4MN5A 3H7WB 3F1NB 4DJ3A 2WKQA 3ICYA 3UB8A 1OTDA 2VEAA 4MN6A 5DKLA 4GW9A 1S4RA 3IBRA 5G4YA 4B9OA 4WL9A 3PHYA 3NOUC 4HH2A 2PDRA 1OTBA 1N9LA 4I39A 2WKRA 3LUQA 3ZQ5A 1S1YA 4I3IA 3EEHA 4GHIB 2PD7A 1LL8A 3C8CA 4NXGA 2PR6A 4HHDA 4EESA 3G6OA 2ZBBA 4HQAA 2PD8A 4LRYC 2W0NA 3UE6A 2HV1A 4R70A 3LI8A 4EEPA 3LICA 4I3JA 1GSVA 1DP6A 2KDKA 1UGUA 5F69A 4M4XA 2QKPA 3LIDA 1Y28A 1T1BA 2V0UA 3E4PA 1EW0A 4PKYA 3UB6A 2YKHA 2QJ5A 2CMNA 1T19A 5IS1A 5IU1A 2ZOHA 3NHQA 4R3AA 4JGQA 2L1MA 1XJ3A 5HWVA 3MQQA 2A24A 3CWFA 1S67L 4K08A 1LSWA 1LSVA 5HDDA 3VE3A 4I3AA 2QWSA 4WLAA 2WKPA 5J7EA 1NWZA 5J3WA 4GCZA 4BBVA 2VLGA 3CLOA 5G4ZA 3UMEA 1KOUA 1P0ZA 4XT2A 2A24B 1XFNA 2I9VA 3MJQA 5F6AA 2Z6CA 4EW7A 4LRXC 1BYWA 4R38A 4BBTA 1XFQA 3MQOA 1LT0A 3LYXA 5DJTA 1DP8A 2V0WA 3GDIA 1V9ZA 3LIBA 2INWA 4KUKA 4LPZA 3BWLA 1XJ6A 2D02A 1VB6A 2JN7A 3T50A 2K7SA 2YKFA 5HD5A 4XT2B 1ODVA 4GS9A 1WA9A 3NJAA 3OLOA 1OTEA 1T18A 4LRZE 1LSXA 2J80A 2EA9A 3KX0X 4WF0A 3MXQA 2B02A 3FC7A 4R6LA 2PR5A 4NXBA 1OTAA 1TS7A 3UMDA 3LI9A 3RTYA 3MFXA 4F3LA 1D7EA 1OT9A 3LIFA 4NXEA 3PYPA 1JNUA 4L9GA 2OOLA 4GS9B 5HWWA 1GSXA 4HOIA 2L0WA 4JGPA 5KIZA 2QJ7A 2JHEA 3RH8B 3FG8A 1OJGA 2KX6A 2OWHA 1GSWA 1XJ4A 4F3LB 2PYPA 5HDSA 4EXOA 5HSQA 4EETB 3LIEA 1S1ZA 4WUJA 4I5SA 1OTIA 1V9YA 3E4OA 2P7JA 3H9WA 2VV8A 3K3DA 4H6JA 2D01A 2V1BA 4EEUA 1S66L 5HDCA 3F1PA 5HD3A 4JGRA 3MR0A 4I38A 1P97A 4YWZA 2VV6A 4HJ4A 4JGOA 3B33A 1MZUA 3A0RA 3LIAA 4KUOA 3CAXA 3E4QA 5HZHA 4BBUA 4H6JB 3EWKA 3K3CA 3D72A 3A0SA 5DKKA 5DJUA 1F9IA 3IS2A 2PHYA 4HNBA 1N9NA 1OT6A 5A8BA 3BY9A 3F1PB 3HJIA 5AVFA 4HP9A 2VV7A 5F5YA 2BASA 5HWTA 4HI4A 2ZOIA 3F1OA 2M1CA 1TS0A 3BY8A 1T1AA 3GECA 3VE4A 1F98A 4L9EA 3IS2B 4PKYG 3VOLA 4HH3A 1DP9A 1XJ2A 1T1CA 1TS8A 4LLOB 4DJ2A 4HP4A 2OWJA 2H28A 4HJ3A 2Z6DA 3F1OB 1UWPX 3P7NA 5EFWA 1OJ5A 1UWNX 4HJ6A 4E04A 3H82A 3A0VA 3ULFA 5TBMA 2W27A 3SW1A 1N9OA 2V9AA 5J4EA 1TS6A 4KQDA 5F68A 1DRMA 1S4SA
chains in the Genus database with same CATH superfamily
3UB9A 2EWWA 4CJNA 3QP2A 1L0EA 1MWRA 5AVEA 1G5UA 4HIAA 2K31A 3LCEA 3Q81A 1G28A 1U60A 4KZ7A 4NETA 3UE0A 2KLIA 3UY6A 5CHUA 4RQ9A 2V1AA 3UDFA 3HJKA 4S2MA 3NI9A 2C5WB 4DXBA 1J9MA 3MQ0A 3NOPC 3ZVTA 1D06A 2WGIA 1VHMA 5HW3A 1VETB 5EVIB 2L4RA 3DWZA 3DTMA 4MN5A 3F1NB 4OP5A 1BSGA 1ERMA 1YMSA 5CGSA 5L09A 2EFUA 3VOZA 2EFXA 4IUKA 3RXXA 1OTDA 4WEJA 2VZWA 1LLBA 2HP9A 4WL9A 1D1JA 3NOUC 4DKIA 3HUMA 4XUZA 4OOYA 3IWOA 2RL3A 3ZQ5A 4OQIA 4WEKA 1KE3A 1I2WA 1LL8A 4NXGA 2PAVP 5F1FA 1GHMA 1KVMA 4DMZA 1M6KA 4EESA 2ZBBA 3VP0A 3N4IA 4GZBA 3O3VA 1P9RA 3CITA 4E3OA 3SZTA 3U2AA 2X01A 4RX2A 2VJWA 4P87A 2XRNA 5L10A 4EBPA 4EEPA 1CEGA 4I3JA 1GSVA 3MZFA 3G32A 3CHWP 2KDKA 3R7WB 5KMWA 1G6AA 4WMCD 4DE3A 2IA2A 2Y2QA 3SOIA 4PKYA 4DDSA 5FASA 2QJ5A 2CMNA 4MNRA 4FSFA 4WYYA 2B95A 2HDUA 3R4KA 3ZGAB 5AQ7A 1Y54A 3NHQA 4R3AA 5CX7A 1LHYA 1JVJA 4OP8A 4KZ9A 3RXWA 4GN2A 3NY4A 3UPNA 2W3HA 2A24A 3ZG8B 3N7WA 4R23A 3SH9A 3CWFA 5CGXA 4K08A 5HPFA 2M7VA 1LSVA 4S2NC 3VE3A 2HDSA 5EE8A 3IH9A 3T4SA 4MMNA 1Y4OA 2Y2OA 1WYBA 2B18A 2WKHA 5U47A 5G4ZA 1I5QA 1PI4A 4E3KA 1CI9A 2V8CA 3G2YA 3V50A 3PBSA 3V3SA 2OAP1 4ZAMA 2OLUA 4UAAA 4XT2A 1L0DA 1XFNA 2I9VA 2M7UA 5F6AA 1IFQA 2Z6CA 3KSGA 2HDRA 1EWZA 4BBTA 1OPXA 1LT0A 1XGIA 4UHUA 4KUKA 4S2IA 3BWLA 2D02A 3CZDA 1GA0A 5FAOA 1GHPA 1CQAA 1M40A 2EX6A 4X25A 1PZPA 1FR1A 1NRJA 5FQJA 5CECA 2K7SA 4MCWA 1KDWA 5D3OA 3NJAA 5JYPA 3BFGA 3G35A 5C5KA 4N9LA 4LRZE 2EA9A 5DVAA 5HAIA 1PNEA 4PM8A 3PBTA 3MXSA 3MXQA 2B02A 3FC7A 2W3GA 1TS7A 1MBLA 5IT5A 3RTYA 5BOHA 4U0XA 3MZEA 3LR4A 3UPOA 4L9GA 4DE0A 5EPHA 3UDIA 5HWWA 3BJNA 5M18A 3HLGA 5EM1A 4UQIM 5KIZA 3G4PA 2Y2HA 1K6RA 1W63Q 5FEFA 5EOEA 3LGOA 2EX9A 1FQGA 4B93A 3PAGA 1VEUA 1XJ4A 1HVBA 4F3LB 4MEZA 2FH5A 4NK3A 2ACGA 5HDSA 2JC7A 3OZHA 2HP5A 2W3FA 4JBFA 3P01A 1DJCA 1OTIA 2UWXA 4OLDA 2DCFA 1PFLA 4Q0HA 2VGLS 1K4EA 2VV8A 4EWFA 2O99A 2W3DA 1SKOB 4CLCB 3BEBA 3W4PA 2V1BA 3IX4A 1K54C 3B3XA 3NC8A 1P97A 5AQAA 1YLJA 5DTSA 4JGOA 2ZM8A 3ZYTA 3B33A 1EI5A 2NUTC 5HX9A 3MKFA 1L3LA 1ES4A 3Q7VA 4IHQA 2CC1A 4OPRA 3KSIA 3L7HA 3OBFA 4Y17A 1QMEA 2ZC7A 1E4DA 5JYOA 4IVIA 3WRTA 4HNBA 1BLHA 1N9NA 1OT6A 1N9BA 5AVFA 5FI6A 5LBRA 1YT4A 4O7DA 5CXWA 4E3NA 1FOFA 4P6ZS 1CEFA 5HWTA 2A2LA 3PXPA 2ZC5B 2XH9A 4HI4A 3MFDA 4QY6A 1LI9A 3F1OA 3DTKA 4LV1A 3P09A 1PYYA 4GOGA 4EBNA 5CRFA 4DF6A 4X56A 2HP6A 3SH8A 3IXHA 1TS0A 3CPTA 2PU4A 3KSFA 4OOMA 5HL1A 4R3JA 3U4LP 4E3LA 1XJ2A 3DBAA 1TS8A 4OPQA 3VP2A 3BQAA 3CJMA 4X6TA 4HP4A 4ME4A 2OWJA 5KSCA 4R4RA 4HJ3A 1H8ZA 2Z6DA 3ZFZA 2MJ6A 4KG2A 1MKMA 5EFWA 5M19A 4HJ6A 2FFYA 3ULFA 3NDGA 4FCFA 2V9AA 3S1YA 3EEAA 4KQDA 2HF6A 5FAQA 3OC2A 4D2OA 4WZ5A 1PIOA 2ZQDA 4N9KA 1VETA 5EVIA 5TGFA 3NECA 2HPBA 5CHMA 3GTCA 4JXSA 3F1NA 4PM6A 4WN5A 3VSLA 2JKRM 4L0LA 4U0TA 3ISGA 1YMXA 3FKWA 3KSHA 3B42A 4OH0A 3H82B 3K2NA 2OSUA 5TBMB 1ESUA 1SDNA 3IF5A 4KZ3A 2WGVA 2GJ3A 3S4XA 3O87A 2DNSA 3FKVA 4EQ1A 4NXFA 4L9FA 1STZA 4Y7PA 4HY8A 2EX8A 4KQOA 1YLZA 5FQMA 5EVLA 3TW8A 2XD5A 3OOVA 4OLGA 5DFYA 1CF0A 1MXOA 2R78A 1X0OA 1EROA 3H7WB 1NLYA 4JXWA 4UA9A 1S0WA 2VEAA 3NIAA 3IBRA 4B9OA 4Y5FA 4QU3A 3DAVA 1HTZA 3MS6A 4I39A 3R7WA 2Y91A 5FQ9A 1S1YA 4QB8A 3IH8A 4GHIB 3QP1A 3O86A 4MDZA 5EUAA 3A3EA 1BTLA 5DF9A 3FWLA 1PWDA 4P6ZM 2ZC4B 3ZVWA 1W79A 3G6OA 1DY6A 4Y0TA 4FUWA 3UO9A 3UB5P 5GHXA 3ZDJA 5E2GA 4N1HA 4BD0A 5TR7A 4Z1WA 5DTTA 3TJZC 2HV1A 4G3WA 1MY8A 3LICA 2A3UA 1AWIA 1E3UA 1QMFA 3T1XA 5F69A 4M4XA 1H8MA 1BZAA 3LIDA 1Y28A 4R0QA 3IF6C 3KO6A 3AGDA 3UB6A 4G3KA 2YKHA 4LENA 4O01A 1T19A 1ONGA 3T4TA 3HLCA 4N92A 1JTDA 2FZ0A 4KG5A 4KENB 5DF8A 3OPRA 4JGQA 1NJ4A 3E2KA 1S6RA 4GD6A 2P04A 4OQHA 4FOFA 3OPLA 2Y2IA 1FILA 2Y55A 1S67L 3LFVA 2JE5A 1LSWA 4QJGA 1F5MA 5HDDA 4I3AA 4GCZA 2VLGA 3CLOA 1NY0A 2W1TB 4P0MA 3ITAA 1KOUA 4MLLA 5GHZA 4S2OA 4LCLA 3C7UA 3D9YA 4HEFA 3MMHA 4OVDA 4ARZB 1MWTA 4LRXC 3MQOA 4ETXA 5GLAA 2PBYA 4YNRA 3LYXA 2V0WA 3GDIA 3BM6A 4JXGA 3HVFA 5FEGA 2WK0A 3KYQA 4NEED 1XJ6A 1TEMA 4EBLA 3QP6A 5A90A 2JN7A 3T50A 1PWGA 1KE4A 1ODVA 4B4XA 1K25A 3EGXC 3HCYA 5E2FA 3OLOA 4QD4A 3T4OA 4YOFA 4BWIA 5A93A 3SH7A 1K55C 4R6LA 2PR5A 4CPKA 4UQIS 3MFXA 4F3LA 1D7EA 2Z2MB 2ZL1B 4D60A 3LIFA 3MF0A 4NXEA 4NG2A 2I72A 3SS3A 4JKTA 1JNUA 1K6SA 1TD5A 5HAPA 4GS9B 3LY4A 1XA7A 1GSXA 4QWOA 4HOIA 1SKOA 4CLCA 2JHEA 1TF1A 3GSGA 4KG6A 1ES2A 4PAUA 3FG8A 1OJGA 5MC7A 4RA7A 4ZRRA 1K57C 2OWHA 2IWCA 3WS5A 4PM9A 3SS5A 4EETB 3LIEA 1S1ZA 4I5SA 4AFIA 1V9YA 3MZDA 3H9WA 1SDEA 4G3VA 1KVLA 2VA0A 3FZCA 3EQVA 1S66L 2EXBA 4JGRA 3QNCA 1VQQA 2OAQ1 1RP5A 1MWSA 1GA9A 4HJ4A 1NZUA 2XF3A 3LIAA 4DDYA 1WYCA 2JKGA 3GVBA 1XXMA 3BRMA 4R1GA 2JCHA 2VGJA 4K91A 1IYSA 4E3IA 3WS1A 2WGWA 2PHYA 1K0KA 4Q0IA 3F1PB 3HJIA 2VK3A 4HP9A 3FV7A 2Y2JA 4OOLA 4C6YA 3PBNA 4UEYA 5EVID 2Z2LB 2J8YA 3VP1A 2ZM0A 4ZJ2A 1L0GA 3HREA 3D4FA 1CJFA 3BY8A 2PBDP 3TOIA 1P9WA 1O07A 2WUQA 3WS0A 4Z9QA 3M6HA 3IS2B 4X55A 1K56A 5DTKA 1NYYA 2WYXA 3ZG9B 1TDGA 3IXDA 1YPRA 2O0YA 2G2WA 4IBXA 3QP4A 3A3IA 1ZG4A 5F83A 3JYIA 3MXRA 1GHIA 1YLYA 1ZG6A 1UWPX 3P7NA 1XP4A 2NUPC 4IJGA 3H82A 3A3FA 2IWDA 4KZ6A 3Q82A 4B4ZA 3WS4A 5TBMA 3C38A 1N9OA 5J4EA 1KGGA 1A0KA 3EOIA 5F68A 4GLQA 3LEQA 1DRMA 2DMWA 1S4SA 3C4PA 3IXGA 1IYOA 2PYRA 3H7WA 1YSQA 3QP8A 1LL5A 3UN7A 4PHTA 2LB9A 4KZ5A 3WWXA 1I2SA 1RCJA 5I5LA 4BL2A 1KDSA 1W7FA 2G7UA 1E3UD 1MWUA 3EGDC 3VMAA 1G6OA 2P9VB 4GHIA 4BD1A 2O9CA 3RJUA 2XROA 4DJ3A 2AVXA 3NBLA 4F94A 2WKQA 5EECA 3C4OA 4PMAA 2J7VA 4WMCA 1NZOA 3KYEA 4S2KA 5CGWA 5FAPA 2O9BA 5CEBA 5J8XA 4MN6A 5DKLA 4GW9A 1S4RA 3PHYA 3BW6A 2J3TC 5FDHA 4HH2A 1OTBA 5CEDA 2GDNA 1N9LA 3UDXA 2Y2GA 3IX3A 2WKRA 3OCNA 4JF6A 3IHBA 3ITBA 3ZNTA 3C5AA 1BT5A 2PD7A 2V8FA 3ZHHA 3OPPA 5EVEA 5FA7A 3E2LA 1ESIA 2PR6A 4X68A 3LO7A 2GX5A 5DF7A 2WGWB 2X02A 4HQAA 2XA7M 2ZC3B 4LRYC 2XR0A 2Y8HA 4LGWA 3FPWA 4IBRA 2WAFA 4RVAA 3UE6A 4R70A 1XX2A 3S7PA 1K4FA 3V67A 2XGNA 1DP6A 4MN7A 1UGUA 3NDEA 2QKPA 3E98A 3L9KA 3W4QA 2V0UA 3ZCZA 2P74A 2W1TA 1KGEA 3HLBA 2QPNA 4UA6A 4K0XA 3T12B 1IKIA 1DJAA 4Y2FA 3N8SA 3G2ZA 2L1MA 1XJ3A 3VP4A 5HWVA 4KZAA 3HLDA 4ARZA 1W5DA 1PW1A 5AQ9A 4MBKA 4DE2A 3WS2A 1CK3A 2WKPA 4BJPA 1LL9A 4IEDA 2H0TA 3IBJA 3QP5A 1L0FA 5J7EA 1J3WA 4BBVA 2ZLYA 3SS4A 3JVVA 4GKUA 5FATA 2Y2NA 4WBGA 4JPMA 2V2FF 1FIKA 3FPVA 3VOYA 4II7A 2DRWA 3PR6A 3G31A 4EW7A 4Q8IA 4PM7A 4R38A 3P98A 2XEPA 3N8LA 5IHVA 2E8JA 3VFFA 5F82A 2J3TD 1DP8A 4BENA 2INWA 4R4SA 5FSRA 2ZL1A 3JVUA 4X69A 3S7OA 1NXYA 2GNXA 1XKZA 2YKFA 5HD5A 4GS9A 1WA9A 1W8QA 3UPPA 1OTEA 3BFEA 4Y0OA 2R9WA 4S2NA 1JTGA 1YLWA 2J80A 3IQAA 3KX0X 2ZQ7A 3IF6B 3Q1FA 2ZC6B 4HESA 4NXBA 3QNBA 1GCEA 3GR2A 4S2PA 3W8KA 3UMDA 4DE1A 3GV9A 1OT9A 4GB7A 1LI0A 2XFSA 3BFDA 5E2EA 4X53A 2OOLA 3UE3A 1G68A 5EV0A 2W3EA 2P08A 2L0WA 1WE4A 2V1ZA 4JGPA 3FYZA 5A91A 1OMEA 1RGYA 3RH8B 5GHYA 4LV3A 1YQSA 4LV2A 3TG9A 4NKPA 2WAEA 2A49A 3UE1A 4ETZA 2KX6A 3IWQA 3LR0A 3T1SA 1MPLA 1GSWA 2WKEA 2RCXA 3VV4A 1PI5A 3HBRA 1FCMA 5FL3A 5HSQA 3HL9A 4WUJA 2P7JA 5TJJA 3CUEC 2ZQAA 4C75A 3W4OA 1BLSA 4E3JA 4C3QA 2D01A 2H0YA 5F1GA 3BFCA 3T1QB 1K56D 3BQ8A 3F1PA 5HD3A 3IX8A 3MR0A 4I38A 3V39A 1AXBA 5CERA 4YWZA 4KZ4A 1N4OA 2VV6A 5AQBA 1NYMA 4UA7A 1MZUA 3A0RA 4KUOA 1FCOA 3HLWA 3C30A 1HZOA 2BG1A 4BBUA 4ZJ3A 2B5RA 4H6JB 1K38A 3K3CA 3D72A 3A0SA 5DKKA 2Y2KA 1F9IA 3G34A 2HZ5A 3T4JA 3IS2A 1SKFA 3C7VA 2R9XA 5L2FA 3NULA 1DJBA 1F2KA 2VV7A 5F5YA 5KSHA 4WZ5C 4BLMA 3PAEA 3TRCA 3DTIA 5EVIC 2XFTA 1NRFA 4OKPA 4KQQA 1ES5A 4FH4A 3GECA 3OCLA 4WM9A 4WELA 1K54A 3BFFA 4XUXA 2KOIA 1KE0A 4GDBA 4LLOB 1BULA 2XSSA 3CI6A 5HFOA 4DRTA 1E25A 2Q9MA 1IEMA 1SZVA 4N1XA 2H28A 3M6BA 1IKGA 1UWNX 2OV5A 2O9AA 3HUOA 4E04A 2W27A 3SW1A 3ZG0A 2ZD8A 5EOOA 3TSGA 2P9VA 1SHVA 2HJ9C 3T4LA 2QHKA 2XD1A 2PU2A 3GRJA 3MKEA 4ZDXA 4CLCE 3S7QA 2Q9NA 3NOTC 1PW8A 2VGKA 1ZKJA 3T4QA 4OPYA 3IXBA 5TFQA 3A3JA 3T4KA 1HLUP 4ZJ1A 2QZ6A 4P6BA 2BTFP 4EERA 3S22A 2VKSA 3B47A 3HUNA 1JWZA 2ZMAA 2V20A 1TDLA 3UB7A 3C2WA 1Q2PA 4R3BA 4DN0A 4EV4A 4M3KA 5I94A 2EX2A 5L8MA 3I7JA 3LR3A 3ICYA 1IELA 3UB8A 5CTNA 5CHJA 3O88A 1W63M 1PZOA 3AGFA 5G4YA 5CTMA 4IVKA 5K5BA 2PDRA 3LR5A 5G18A 2Y2PA 5HARA 2XA7S 4FD8A 5DFXA 4E6WA 3LUQA 3ZNYA 3S7NA 3VFHA 4GD8A 4I3IA 3EEHA 3D3OA 2J9PA 4E3MA 3C8CA 1ACFA 4S2JA 3UNWA 4HHDA 1MC0A 4U3TA 2PD8A 2HDQA 4H8RA 2W0NA 2OLVA 2ZMVA 3PBQA 4K0WA 5A92A 2GZAA 3LI8A 2WZXA 3RFBA 4WZ4A 1RGZA 2XDMA 4BL3A 1H8YA 4X1LA 3IWIA 1FCNA 2Y79A 3EQUA 3BLMA 1T1BA 3E4PA 1EW0A 4IUHA 4YINA 5FQQA 1CI8A 1L2SA 4FH2A 3DWKA 4BMWA 5IS1A 4PM5A 5IU1A 2LB5A 4OONA 1YKDA 2ZOHA 3M2JA 1ALQA 3MQQA 3W2ZA 3OPHA 4RX3A 1YAXA 2X71A 2J3WA 4RYEA 2ZQCA 4OQGA 2QWSA 4WLAA 1IYPA 2C6WB 3ZG7B 4LV0A 1NWZA 5J3WA 2Y4AA 4O8GA 2ZJ9A 2FFFB 3PTEA 3JPUA 4MBFA 1JWVA 3UMEA 2WADA 3AGEA 4EQIA 1NLZA 5HPIA 1XPBA 1FSYA 1P0ZA 2WKIA 4Q0JA 5GL9A 5KZHA 3LY3A 2A24B 1FSWA 3MJQA 3IT9A 4QPRA 1BYWA 1ZHHB 1XFQA 4CLCC 3IF6A 2XK1A 3IHAA 5DJTA 1YLTA 4EUZA 1V9ZA 3LIBA 1FR6A 4LPZA 4QY5A 2JKTM 3GMWA 1VB6A 1XA1A 2VX8A 3WRZA 1XGJA 1YLPA 2E8IA 4XT2B 1ONHA 1T18A 2EWVA 3V5MA 1ES3A 1LSXA 4JLFA 3BECA 3Q07A 4WF0A 4EUVA 1PWCA 3CUEA 5M1AA 1H5XA 4LFUA 5FQIA 3QHYA 4CQHA 1OTAA 4PPRA 3LI9A 2ZQ9A 3MBZA 4LCMA 3TE8A 2EXAA 3PYPA 2QMIA 3VSKA 2WZZA 1H3QA 3CMZA 3PBRA 1TVFA 4E6XA 4Y0UA 2J9OA 3G30A 2QJ7A 3LEZA 4O0PA 1SCWA 4JXVA 4JF5A 5GLCA 1W8YA 5FI7A 1BLCA 3M2KA 4DXCA 5HAQA 1ZTUA 2PYPA 4EXOA 5E2HA 2UV0E 5GLDA 1BLPA 3E4OA 4Y3IA 4EU0A 2K2NA 2ZQ8A 3K3DA 4H6JA 4S2LA 2JBFA 2PT7A 4ZTKA 1PRQA 2JKFA 1KGFA 4HBUA 4KZBA 4GDNA 4EEUA 1K55A 3V3RA 4Y15A 1ZC2A 4OPZA 2Y2MA 5HDCA 2XQZA 1VEUB 4OQ0A 4GNUA 4JF4A 1IOUA 5FDSA 2VGLM 4QHCA 3E0YA 2JKTI 3N6IA 4CLCD 4XXRA 5FI2A 4X1MA 2Y2LA 3BLSA 1H0MA 3CAXA 3E4QA 2Q0OA 5HZHA 2G2UA 2IWBA 3Q7ZA 3EWKA 1Z09A 3NCKA 5GLBA 5EM0A 3ZG5A 5DJUA 3KYZA 2PRFA 1O7EA 1JWPA 4P85A 2HGVA 1K57A 4ZBEA 5A8BA 3BY9A 3A3DA 1Q2QA 3N8RA 4FTXA 2BASA 5FQKA 2W1RA 3VP3A 2ZM2A 1YM1A 3Q7VB 1ERQA 2ZOIA 5L07A 2M1CA 2HJEA 3PBOA 3GQZA 3HLEA 1T1AA 1Z6FA 2QYBA 1IYQA 3VE4A 1F98A 4L9EA 4PKYG 1VM1A 2BLSA 1C3BA 3VOLA 4HH3A 4KZ8A 1DP9A 5E43A 1T1CA 4GJ4A 3CG5A 4DJ2A 2ZMFA 3T1RA 4BQMA 4HBTA 5AJGA 2H10A 1MKIA 3F1OB 2H5SA 3O5YA 4MBHA 1OJ5A 4YFMA 4KQRA 4A5RA 3BYDA 3A0VA 3CPTB 4Y13A 3HLFA 1BUEA 4ESPA 1HD8A 1TS6A 3DW0A 2Y59A 2JKRI 3DTEA 3MSHA 4B88A 1YSPA 5HL6A 4ID4A 2XLNA
chains in the Genus database with same CATH topology
2HJ9C 3T4LA 2QHKA 3UB9A 2EWWA 2PYRA 3H7WA 3F1NA 4WN5A 1YSQA 2JKRM 5AVEA 4L0LA 4HIAA 2K31A 4PHTA 2LB9A 1G28A 4CLCE 3S7QA 3KSHA 3B42A 3H82B 3NOTC 3K2NA 5I5LA 5TBMB 2GJ3A 3T4QA 2KLIA 4RQ9A 2V1AA 3HJKA 4EQ1A 4NXFA 4L9FA 1STZA 3T4KA 4HY8A 2G7UA 4KQOA 4EERA 3EGDC 2VKSA 3B47A 1G6OA 3MQ0A 3OOVA 3TW8A 3NOPC 4GHIA 5DFYA 1D06A 1VHMA 2O9CA 2R78A 1X0OA 2L4RA 3UB7A 3C2WA 4MN5A 3H7WB 2XROA 3F1NB 4DJ3A 1NLYA 4DN0A 2WKQA 5L8MA 3LR3A 3ICYA 4IUKA 3UB8A 2O9BA 1OTDA 2VEAA 4MN6A 5DKLA 4GW9A 1W63M 1S4RA 3IBRA 4WEJA 5G4YA 2VZWA 4B9OA 4WL9A 3PHYA 3BW6A 4Y5FA 2J3TC 3NOUC 4HH2A 5K5BA 2PDRA 1OTBA 3LR5A 1N9LA 2XA7S 5DFXA 4I39A 2WKRA 3LUQA 3R7WA 3S7NA 3ZQ5A 3OCNA 1S1YA 4I3IA 3EEHA 4GHIB 4WEKA 3D3OA 2PD7A 1LL8A 3C8CA 4MDZA 4NXGA 5DF9A 2PR6A 4P6ZM 4DMZA 4HHDA 4EESA 1MC0A 3G6OA 2GX5A 2ZBBA 4HQAA 2PD8A 2XA7M 1P9RA 3CITA 4LRYC 2Y8HA 2W0NA 3U2AA 2ZMVA 4Z1WA 3FPWA 3TJZC 3PBQA 2GZAA 3UE6A 2HV1A 2VJWA 4R70A 2XRNA 4G3WA 3LI8A 4EEPA 3LICA 4I3JA 3S7PA 3RFBA 1GSVA 3V67A 1DP6A 2KDKA 4MN7A 1UGUA 3R7WB 5F69A 4M4XA 1H8MA 2Y79A 3EQUA 2IA2A 2QKPA 3LIDA 3E98A 1Y28A 1T1BA 2V0UA 3E4PA 1EW0A 3KO6A 4IUHA 4G3KA 4PKYA 3UB6A 2YKHA 2QJ5A 2CMNA 4O01A 1T19A 4FSFA 2W1TA 4BMWA 3T4TA 5IS1A 5IU1A 2FZ0A 2LB5A 3R4KA 4Y2FA 1YKDA 2ZOHA 3NHQA 4R3AA 5CX7A 4JGQA 2L1MA 1XJ3A 2P04A 5HWVA 2W3HA 4FOFA 3MQQA 2A24A 3W2ZA 3CWFA 4ARZA 1S67L 1YAXA 3LFVA 4K08A 5HPFA 1LSWA 2M7VA 1F5MA 1LSVA 2J3WA 5HDDA 3VE3A 4I3AA 2QWSA 4WLAA 2WKPA 4BJPA 3IBJA 3T4SA 4MMNA 5J7EA 1NWZA 2B18A 4GCZA 5J3WA 2VLGA 4BBVA 4O8GA 3CLOA 5G4ZA 2W1TB 3JVVA 3UMEA 3PBSA 1KOUA 1NLZA 2OAP1 5HPIA 1P0ZA 4Q0JA 4XT2A 3FPVA 2A24B 4II7A 3MMHA 1XFNA 3PR6A 2I9VA 3MJQA 2M7UA 4ARZB 5F6AA 1IFQA 2Z6CA 4EW7A 3KSGA 4LRXC 4QPRA 1BYWA 1ZHHB 4R38A 4BBTA 1XFQA 4CLCC 3MQOA 1OPXA 1LT0A 4ETXA 4YNRA 3LYXA 2J3TD 1DP8A 2V0WA 3GDIA 5DJTA 1V9ZA 3LIBA 2INWA 4KUKA 4LPZA 3KYQA 2JKTM 3BWLA 1XJ6A 2D02A 4NEED 3JVUA 1VB6A 2VX8A 3S7OA 2JN7A 3T50A 1NRJA 2GNXA 2K7SA 2YKFA 1ODVA 4XT2B 4GS9A 4MCWA 1WA9A 5HD5A 3EGXC 3NJAA 3HCYA 3OLOA 1OTEA 1T18A 2EWVA 5C5KA 4LRZE 1LSXA 3T4OA 2J80A 4YOFA 2EA9A 3KX0X 4WF0A 4BWIA 4EUVA 3PBTA 3CUEA 3MXQA 2B02A 3FC7A 4R6LA 2PR5A 4CQHA 4NXBA 2W3GA 1OTAA 1TS7A 3UMDA 5IT5A 3LI9A 3RTYA 4UQIS 3MFXA 4F3LA 1D7EA 1OT9A 3TE8A 3LIFA 3MF0A 4NXEA 3PYPA 3LR4A 1JNUA 1H3QA 4L9GA 2OOLA 1TD5A 3UE3A 4GS9B 5HWWA 1GSXA 3BJNA 2W3EA 3PBRA 4HOIA 2P08A 2L0WA 4JGPA 4UQIM 4CLCA 5KIZA 2QJ7A 2JHEA 1TF1A 4O0PA 3RH8B 4PAUA 3FG8A 1W63Q 4NKPA 1OJGA 4ETZA 5MC7A 4B93A 2KX6A 4ZRRA 2OWHA 3LR0A 1GSWA 1XJ4A 4F3LB 1ZTUA 2FH5A 2PYPA 5HDSA 3VV4A 5FL3A 2W3FA 4EXOA 5HSQA 4EETB 3LIEA 1S1ZA 4WUJA 3P01A 4I5SA 4AFIA 1OTIA 1V9YA 3E4OA 2P7JA 4Q0HA 4Y3IA 5TJJA 2K2NA 2VGLS 3CUEC 3H9WA 4EU0A 2VV8A 3K3DA 4H6JA 4G3VA 2PT7A 2O99A 2W3DA 2VA0A 2D01A 4CLCB 2V1BA 4EEUA 3EQVA 1S66L 5HDCA 3BQ8A 3F1PA 5HD3A 4JGRA 1IOUA 3MR0A 2VGLM 4I38A 1P97A 2OAQ1 4YWZA 3E0YA 2VV6A 4HJ4A 4JGOA 2JKTI 3ZYTA 3B33A 4CLCD 1MZUA 2NUTC 3A0RA 3LIAA 4KUOA 3C30A 3CAXA 3E4QA 5HZHA 4IHQA 3KSIA 4BBUA 4H6JB 3EWKA 3OBFA 3K3CA 3D72A 3A0SA 5DKKA 5DJUA 1F9IA 3KYZA 3T4JA 3IS2A 2HGVA 2PHYA 4HNBA 1N9NA 4Q0IA 1OT6A 5A8BA 3BY9A 3F1PB 3HJIA 5AVFA 4HP9A 5LBRA 2VV7A 5F5YA 5KSHA 4OOLA 3PBNA 2BASA 2W1RA 4UEYA 3TRCA 4P6ZS 5HWTA 2A2LA 3PXPA 4HI4A 2ZOIA 3F1OA 2M1CA 2HJEA 3PBOA 1TS0A 3BY8A 1T1AA 3GECA 2QYBA 1P9WA 3KSFA 3OCLA 4OOMA 3VE4A 1F98A 4L9EA 4WELA 3IS2B 4PKYG 3VOLA 4HH3A 2KOIA 1DP9A 1XJ2A 2O0YA 1T1CA 3DBAA 1TS8A 4LLOB 2XSSA 4GJ4A 3CI6A 4DJ2A 3BQAA 4HP4A 4ME4A 2OWJA 2ZMFA 2H28A 5AJGA 4HJ3A 2Z6DA 2MJ6A 3F1OB 1UWPX 3O5YA 1MKMA 3P7NA 5EFWA 1OJ5A 1UWNX 2NUPC 2O9AA 4HJ6A 4E04A 4IJGA 3H82A 3A0VA 3ULFA 5TBMA 2W27A 3C38A 3SW1A 1N9OA 2V9AA 5J4EA 1TS6A 2JKRI 3EEAA 4KQDA 2HF6A 3EOIA 1YSPA 3OC2A 4GLQA 5F68A 5HL6A 1DRMA 2DMWA 1S4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHK A;  3UB9 A;  2PYR A;  3H7W A;  3F1N A;  4WN5 A;  5AVE A;  4HIA A;  1G28 A;  3H82 B;  3NOT C;  5I5L A;  5TBM B;  2GJ3 A;  4RQ9 A;  2V1A A;  3HJK A;  4EQ1 A;  4NXF A;  4L9F A;  4HY8 A;  4EER A;  3NOP C;  4GHI A;  1D06 A;  2R78 A;  1X0O A;  2L4R A;  3UB7 A;  3C2W A;  4MN5 A;  3H7W B;  3F1N B;  4DJ3 A;  2WKQ A;  3ICY A;  3UB8 A;  1OTD A;  2VEA A;  4MN6 A;  5DKL A;  4GW9 A;  1S4R A;  3IBR A;  5G4Y A;  4B9O A;  4WL9 A;  3PHY A;  3NOU C;  4HH2 A;  2PDR A;  1OTB A;  1N9L A;  4I39 A;  2WKR A;  3LUQ A;  3ZQ5 A;  1S1Y A;  4I3I A;  3EEH A;  4GHI B;  2PD7 A;  1LL8 A;  3C8C A;  4NXG A;  2PR6 A;  4HHD A;  4EES A;  3G6O A;  2ZBB A;  4HQA A;  2PD8 A;  4LRY C;  2W0N A;  3UE6 A;  2HV1 A;  4R70 A;  3LI8 A;  4EEP A;  3LIC A;  4I3J A;  1GSV A;  1DP6 A;  2KDK A;  1UGU A;  5F69 A;  4M4X A;  2QKP A;  3LID A;  1Y28 A;  1T1B A;  2V0U A;  3E4P A;  1EW0 A;  4PKY A;  3UB6 A;  2YKH A;  2QJ5 A;  2CMN A;  1T19 A;  5IS1 A;  5IU1 A;  2ZOH A;  3NHQ A;  4R3A A;  4JGQ A;  2L1M A;  1XJ3 A;  5HWV A;  3MQQ A;  2A24 A;  3CWF A;  1S67 L;  4K08 A;  1LSW A;  1LSV A;  5HDD A;  3VE3 A;  4I3A A;  2QWS A;  4WLA A;  2WKP A;  5J7E A;  1NWZ A;  5J3W A;  4GCZ A;  4BBV A;  2VLG A;  3CLO A;  5G4Z A;  3UME A;  1KOU A;  1P0Z A;  4XT2 A;  2A24 B;  1XFN A;  2I9V A;  3MJQ A;  5F6A A;  2Z6C A;  4EW7 A;  4LRX C;  1BYW A;  4R38 A;  4BBT A;  1XFQ A;  3MQO A;  1LT0 A;  3LYX A;  5DJT A;  1DP8 A;  2V0W A;  3GDI A;  1V9Z A;  3LIB A;  2INW A;  4KUK A;  4LPZ A;  3BWL A;  1XJ6 A;  2D02 A;  1VB6 A;  2JN7 A;  3T50 A;  2K7S A;  2YKF A;  5HD5 A;  4XT2 B;  1ODV A;  4GS9 A;  1WA9 A;  3NJA A;  3OLO A;  1OTE A;  1T18 A;  4LRZ E;  1LSX A;  2J80 A;  2EA9 A;  3KX0 X;  4WF0 A;  3MXQ A;  2B02 A;  3FC7 A;  4R6L A;  2PR5 A;  4NXB A;  1OTA A;  1TS7 A;  3UMD A;  3LI9 A;  3RTY A;  3MFX A;  4F3L A;  1D7E A;  1OT9 A;  3LIF A;  4NXE A;  3PYP A;  1JNU A;  4L9G A;  2OOL A;  4GS9 B;  5HWW A;  1GSX A;  4HOI A;  2L0W A;  4JGP A;  5KIZ A;  2QJ7 A;  2JHE A;  3RH8 B;  3FG8 A;  1OJG A;  2KX6 A;  2OWH A;  1GSW A;  1XJ4 A;  4F3L B;  2PYP A;  5HDS A;  4EXO A;  5HSQ A;  4EET B;  3LIE A;  1S1Z A;  4WUJ A;  4I5S A;  1OTI A;  1V9Y A;  3E4O A;  2P7J A;  3H9W A;  2VV8 A;  3K3D A;  4H6J A;  2D01 A;  2V1B A;  4EEU A;  1S66 L;  5HDC A;  3F1P A;  5HD3 A;  4JGR A;  3MR0 A;  4I38 A;  1P97 A;  4YWZ A;  2VV6 A;  4HJ4 A;  4JGO A;  3B33 A;  1MZU A;  3A0R A;  3LIA A;  4KUO A;  3CAX A;  3E4Q A;  5HZH A;  4BBU A;  4H6J B;  3EWK A;  3K3C A;  3D72 A;  3A0S A;  5DKK A;  5DJU A;  1F9I A;  3IS2 A;  2PHY A;  4HNB A;  1N9N A;  1OT6 A;  5A8B A;  3BY9 A;  3F1P B;  3HJI A;  5AVF A;  4HP9 A;  2VV7 A;  5F5Y A;  2BAS A;  5HWT A;  4HI4 A;  2ZOI A;  3F1O A;  2M1C A;  1TS0 A;  3BY8 A;  1T1A A;  3GEC A;  3VE4 A;  1F98 A;  4L9E A;  3IS2 B;  4PKY G;  3VOL A;  4HH3 A;  1DP9 A;  1XJ2 A;  1T1C A;  1TS8 A;  4LLO B;  4DJ2 A;  4HP4 A;  2OWJ A;  2H28 A;  4HJ3 A;  2Z6D A;  3F1O B;  1UWP X;  3P7N A;  5EFW A;  1OJ5 A;  1UWN X;  4HJ6 A;  4E04 A;  3H82 A;  3A0V A;  3ULF A;  5TBM A;  2W27 A;  3SW1 A;  1N9O A;  2V9A A;  5J4E A;  1TS6 A;  4KQD A;  5F68 A;  1DRM A;  1S4S A; 
#chains in the Genus database with same CATH topology
 3UB9 A;  2EWW A;  4CJN A;  3QP2 A;  1L0E A;  1MWR A;  5AVE A;  1G5U A;  4HIA A;  2K31 A;  3LCE A;  3Q81 A;  1G28 A;  1U60 A;  4KZ7 A;  4NET A;  3UE0 A;  2KLI A;  3UY6 A;  5CHU A;  4RQ9 A;  2V1A A;  3UDF A;  3HJK A;  4S2M A;  3NI9 A;  2C5W B;  4DXB A;  1J9M A;  3MQ0 A;  3NOP C;  3ZVT A;  1D06 A;  2WGI A;  1VHM A;  5HW3 A;  1VET B;  5EVI B;  2L4R A;  3DWZ A;  3DTM A;  4MN5 A;  3F1N B;  4OP5 A;  1BSG A;  1ERM A;  1YMS A;  5CGS A;  5L09 A;  2EFU A;  3VOZ A;  2EFX A;  4IUK A;  3RXX A;  1OTD A;  4WEJ A;  2VZW A;  1LLB A;  2HP9 A;  4WL9 A;  1D1J A;  3NOU C;  4DKI A;  3HUM A;  4XUZ A;  4OOY A;  3IWO A;  2RL3 A;  3ZQ5 A;  4OQI A;  4WEK A;  1KE3 A;  1I2W A;  1LL8 A;  4NXG A;  2PAV P;  5F1F A;  1GHM A;  1KVM A;  4DMZ A;  1M6K A;  4EES A;  2ZBB A;  3VP0 A;  3N4I A;  4GZB A;  3O3V A;  1P9R A;  3CIT A;  4E3O A;  3SZT A;  3U2A A;  2X01 A;  4RX2 A;  2VJW A;  4P87 A;  2XRN A;  5L10 A;  4EBP A;  4EEP A;  1CEG A;  4I3J A;  1GSV A;  3MZF A;  3G32 A;  3CHW P;  2KDK A;  3R7W B;  5KMW A;  1G6A A;  4WMC D;  4DE3 A;  2IA2 A;  2Y2Q A;  3SOI A;  4PKY A;  4DDS A;  5FAS A;  2QJ5 A;  2CMN A;  4MNR A;  4FSF A;  4WYY A;  2B95 A;  2HDU A;  3R4K A;  3ZGA B;  5AQ7 A;  1Y54 A;  3NHQ A;  4R3A A;  5CX7 A;  1LHY A;  1JVJ A;  4OP8 A;  4KZ9 A;  3RXW A;  4GN2 A;  3NY4 A;  3UPN A;  2W3H A;  2A24 A;  3ZG8 B;  3N7W A;  4R23 A;  3SH9 A;  3CWF A;  5CGX A;  4K08 A;  5HPF A;  2M7V A;  1LSV A;  4S2N C;  3VE3 A;  2HDS A;  5EE8 A;  3IH9 A;  3T4S A;  4MMN A;  1Y4O A;  2Y2O A;  1WYB A;  2B18 A;  2WKH A;  5U47 A;  5G4Z A;  1I5Q A;  1PI4 A;  4E3K A;  1CI9 A;  2V8C A;  3G2Y A;  3V50 A;  3PBS A;  3V3S A;  2OAP 1;  4ZAM A;  2OLU A;  4UAA A;  4XT2 A;  1L0D A;  1XFN A;  2I9V A;  2M7U A;  5F6A A;  1IFQ A;  2Z6C A;  3KSG A;  2HDR A;  1EWZ A;  4BBT A;  1OPX A;  1LT0 A;  1XGI A;  4UHU A;  4KUK A;  4S2I A;  3BWL A;  2D02 A;  3CZD A;  1GA0 A;  5FAO A;  1GHP A;  1CQA A;  1M40 A;  2EX6 A;  4X25 A;  1PZP A;  1FR1 A;  1NRJ A;  5FQJ A;  5CEC A;  2K7S A;  4MCW A;  1KDW A;  5D3O A;  3NJA A;  5JYP A;  3BFG A;  3G35 A;  5C5K A;  4N9L A;  4LRZ E;  2EA9 A;  5DVA A;  5HAI A;  1PNE A;  4PM8 A;  3PBT A;  3MXS A;  3MXQ A;  2B02 A;  3FC7 A;  2W3G A;  1TS7 A;  1MBL A;  5IT5 A;  3RTY A;  5BOH A;  4U0X A;  3MZE A;  3LR4 A;  3UPO A;  4L9G A;  4DE0 A;  5EPH A;  3UDI A;  5HWW A;  3BJN A;  5M18 A;  3HLG A;  5EM1 A;  4UQI M;  5KIZ A;  3G4P A;  2Y2H A;  1K6R A;  1W63 Q;  5FEF A;  5EOE A;  3LGO A;  2EX9 A;  1FQG A;  4B93 A;  3PAG A;  1VEU A;  1XJ4 A;  1HVB A;  4F3L B;  4MEZ A;  2FH5 A;  4NK3 A;  2ACG A;  5HDS A;  2JC7 A;  3OZH A;  2HP5 A;  2W3F A;  4JBF A;  3P01 A;  1DJC A;  1OTI A;  2UWX A;  4OLD A;  2DCF A;  1PFL A;  4Q0H A;  2VGL S;  1K4E A;  2VV8 A;  4EWF A;  2O99 A;  2W3D A;  1SKO B;  4CLC B;  3BEB A;  3W4P A;  2V1B A;  3IX4 A;  1K54 C;  3B3X A;  3NC8 A;  1P97 A;  5AQA A;  1YLJ A;  5DTS A;  4JGO A;  2ZM8 A;  3ZYT A;  3B33 A;  1EI5 A;  2NUT C;  5HX9 A;  3MKF A;  1L3L A;  1ES4 A;  3Q7V A;  4IHQ A;  2CC1 A;  4OPR A;  3KSI A;  3L7H A;  3OBF A;  4Y17 A;  1QME A;  2ZC7 A;  1E4D A;  5JYO A;  4IVI A;  3WRT A;  4HNB A;  1BLH A;  1N9N A;  1OT6 A;  1N9B A;  5AVF A;  5FI6 A;  5LBR A;  1YT4 A;  4O7D A;  5CXW A;  4E3N A;  1FOF A;  4P6Z S;  1CEF A;  5HWT A;  2A2L A;  3PXP A;  2ZC5 B;  2XH9 A;  4HI4 A;  3MFD A;  4QY6 A;  1LI9 A;  3F1O A;  3DTK A;  4LV1 A;  3P09 A;  1PYY A;  4GOG A;  4EBN A;  5CRF A;  4DF6 A;  4X56 A;  2HP6 A;  3SH8 A;  3IXH A;  1TS0 A;  3CPT A;  2PU4 A;  3KSF A;  4OOM A;  5HL1 A;  4R3J A;  3U4L P;  4E3L A;  1XJ2 A;  3DBA A;  1TS8 A;  4OPQ A;  3VP2 A;  3BQA A;  3CJM A;  4X6T A;  4HP4 A;  4ME4 A;  2OWJ A;  5KSC A;  4R4R A;  4HJ3 A;  1H8Z A;  2Z6D A;  3ZFZ A;  2MJ6 A;  4KG2 A;  1MKM A;  5EFW A;  5M19 A;  4HJ6 A;  2FFY A;  3ULF A;  3NDG A;  4FCF A;  2V9A A;  3S1Y A;  3EEA A;  4KQD A;  2HF6 A;  5FAQ A;  3OC2 A;  4D2O A;  4WZ5 A;  1PIO A;  2ZQD A;  4N9K A;  1VET A;  5EVI A;  5TGF A;  3NEC A;  2HPB A;  5CHM A;  3GTC A;  4JXS A;  3F1N A;  4PM6 A;  4WN5 A;  3VSL A;  2JKR M;  4L0L A;  4U0T A;  3ISG A;  1YMX A;  3FKW A;  3KSH A;  3B42 A;  4OH0 A;  3H82 B;  3K2N A;  2OSU A;  5TBM B;  1ESU A;  1SDN A;  3IF5 A;  4KZ3 A;  2WGV A;  2GJ3 A;  3S4X A;  3O87 A;  2DNS A;  3FKV A;  4EQ1 A;  4NXF A;  4L9F A;  1STZ A;  4Y7P A;  4HY8 A;  2EX8 A;  4KQO A;  1YLZ A;  5FQM A;  5EVL A;  3TW8 A;  2XD5 A;  3OOV A;  4OLG A;  5DFY A;  1CF0 A;  1MXO A;  2R78 A;  1X0O A;  1ERO A;  3H7W B;  1NLY A;  4JXW A;  4UA9 A;  1S0W A;  2VEA A;  3NIA A;  3IBR A;  4B9O A;  4Y5F A;  4QU3 A;  3DAV A;  1HTZ A;  3MS6 A;  4I39 A;  3R7W A;  2Y91 A;  5FQ9 A;  1S1Y A;  4QB8 A;  3IH8 A;  4GHI B;  3QP1 A;  3O86 A;  4MDZ A;  5EUA A;  3A3E A;  1BTL A;  5DF9 A;  3FWL A;  1PWD A;  4P6Z M;  2ZC4 B;  3ZVW A;  1W79 A;  3G6O A;  1DY6 A;  4Y0T A;  4FUW A;  3UO9 A;  3UB5 P;  5GHX A;  3ZDJ A;  5E2G A;  4N1H A;  4BD0 A;  5TR7 A;  4Z1W A;  5DTT A;  3TJZ C;  2HV1 A;  4G3W A;  1MY8 A;  3LIC A;  2A3U A;  1AWI A;  1E3U A;  1QMF A;  3T1X A;  5F69 A;  4M4X A;  1H8M A;  1BZA A;  3LID A;  1Y28 A;  4R0Q A;  3IF6 C;  3KO6 A;  3AGD A;  3UB6 A;  4G3K A;  2YKH A;  4LEN A;  4O01 A;  1T19 A;  1ONG A;  3T4T A;  3HLC A;  4N92 A;  1JTD A;  2FZ0 A;  4KG5 A;  4KEN B;  5DF8 A;  3OPR A;  4JGQ A;  1NJ4 A;  3E2K A;  1S6R A;  4GD6 A;  2P04 A;  4OQH A;  4FOF A;  3OPL A;  2Y2I A;  1FIL A;  2Y55 A;  1S67 L;  3LFV A;  2JE5 A;  1LSW A;  4QJG A;  1F5M A;  5HDD A;  4I3A A;  4GCZ A;  2VLG A;  3CLO A;  1NY0 A;  2W1T B;  4P0M A;  3ITA A;  1KOU A;  4MLL A;  5GHZ A;  4S2O A;  4LCL A;  3C7U A;  3D9Y A;  4HEF A;  3MMH A;  4OVD A;  4ARZ B;  1MWT A;  4LRX C;  3MQO A;  4ETX A;  5GLA A;  2PBY A;  4YNR A;  3LYX A;  2V0W A;  3GDI A;  3BM6 A;  4JXG A;  3HVF A;  5FEG A;  2WK0 A;  3KYQ A;  4NEE D;  1XJ6 A;  1TEM A;  4EBL A;  3QP6 A;  5A90 A;  2JN7 A;  3T50 A;  1PWG A;  1KE4 A;  1ODV A;  4B4X A;  1K25 A;  3EGX C;  3HCY A;  5E2F A;  3OLO A;  4QD4 A;  3T4O A;  4YOF A;  4BWI A;  5A93 A;  3SH7 A;  1K55 C;  4R6L A;  2PR5 A;  4CPK A;  4UQI S;  3MFX A;  4F3L A;  1D7E A;  2Z2M B;  2ZL1 B;  4D60 A;  3LIF A;  3MF0 A;  4NXE A;  4NG2 A;  2I72 A;  3SS3 A;  4JKT A;  1JNU A;  1K6S A;  1TD5 A;  5HAP A;  4GS9 B;  3LY4 A;  1XA7 A;  1GSX A;  4QWO A;  4HOI A;  1SKO A;  4CLC A;  2JHE A;  1TF1 A;  3GSG A;  4KG6 A;  1ES2 A;  4PAU A;  3FG8 A;  1OJG A;  5MC7 A;  4RA7 A;  4ZRR A;  1K57 C;  2OWH A;  2IWC A;  3WS5 A;  4PM9 A;  3SS5 A;  4EET B;  3LIE A;  1S1Z A;  4I5S A;  4AFI A;  1V9Y A;  3MZD A;  3H9W A;  1SDE A;  4G3V A;  1KVL A;  2VA0 A;  3FZC A;  3EQV A;  1S66 L;  2EXB A;  4JGR A;  3QNC A;  1VQQ A;  2OAQ 1;  1RP5 A;  1MWS A;  1GA9 A;  4HJ4 A;  1NZU A;  2XF3 A;  3LIA A;  4DDY A;  1WYC A;  2JKG A;  3GVB A;  1XXM A;  3BRM A;  4R1G A;  2JCH A;  2VGJ A;  4K91 A;  1IYS A;  4E3I A;  3WS1 A;  2WGW A;  2PHY A;  1K0K A;  4Q0I A;  3F1P B;  3HJI A;  2VK3 A;  4HP9 A;  3FV7 A;  2Y2J A;  4OOL A;  4C6Y A;  3PBN A;  4UEY A;  5EVI D;  2Z2L B;  2J8Y A;  3VP1 A;  2ZM0 A;  4ZJ2 A;  1L0G A;  3HRE A;  3D4F A;  1CJF A;  3BY8 A;  2PBD P;  3TOI A;  1P9W A;  1O07 A;  2WUQ A;  3WS0 A;  4Z9Q A;  3M6H A;  3IS2 B;  4X55 A;  1K56 A;  5DTK A;  1NYY A;  2WYX A;  3ZG9 B;  1TDG A;  3IXD A;  1YPR A;  2O0Y A;  2G2W A;  4IBX A;  3QP4 A;  3A3I A;  1ZG4 A;  5F83 A;  3JYI A;  3MXR A;  1GHI A;  1YLY A;  1ZG6 A;  1UWP X;  3P7N A;  1XP4 A;  2NUP C;  4IJG A;  3H82 A;  3A3F A;  2IWD A;  4KZ6 A;  3Q82 A;  4B4Z A;  3WS4 A;  5TBM A;  3C38 A;  1N9O A;  5J4E A;  1KGG A;  1A0K A;  3EOI A;  5F68 A;  4GLQ A;  3LEQ A;  1DRM A;  2DMW A;  1S4S A;  3C4P A;  3IXG A;  1IYO A;  2PYR A;  3H7W A;  1YSQ A;  3QP8 A;  1LL5 A;  3UN7 A;  4PHT A;  2LB9 A;  4KZ5 A;  3WWX A;  1I2S A;  1RCJ A;  5I5L A;  4BL2 A;  1KDS A;  1W7F A;  2G7U A;  1E3U D;  1MWU A;  3EGD C;  3VMA A;  1G6O A;  2P9V B;  4GHI A;  4BD1 A;  2O9C A;  3RJU A;  2XRO A;  4DJ3 A;  2AVX A;  3NBL A;  4F94 A;  2WKQ A;  5EEC A;  3C4O A;  4PMA A;  2J7V A;  4WMC A;  1NZO A;  3KYE A;  4S2K A;  5CGW A;  5FAP A;  2O9B A;  5CEB A;  5J8X A;  4MN6 A;  5DKL A;  4GW9 A;  1S4R A;  3PHY A;  3BW6 A;  2J3T C;  5FDH A;  4HH2 A;  1OTB A;  5CED A;  2GDN A;  1N9L A;  3UDX A;  2Y2G A;  3IX3 A;  2WKR A;  3OCN A;  4JF6 A;  3IHB A;  3ITB A;  3ZNT A;  3C5A A;  1BT5 A;  2PD7 A;  2V8F A;  3ZHH A;  3OPP A;  5EVE A;  5FA7 A;  3E2L A;  1ESI A;  2PR6 A;  4X68 A;  3LO7 A;  2GX5 A;  5DF7 A;  2WGW B;  2X02 A;  4HQA A;  2XA7 M;  2ZC3 B;  4LRY C;  2XR0 A;  2Y8H A;  4LGW A;  3FPW A;  4IBR A;  2WAF A;  4RVA A;  3UE6 A;  4R70 A;  1XX2 A;  3S7P A;  1K4F A;  3V67 A;  2XGN A;  1DP6 A;  4MN7 A;  1UGU A;  3NDE A;  2QKP A;  3E98 A;  3L9K A;  3W4Q A;  2V0U A;  3ZCZ A;  2P74 A;  2W1T A;  1KGE A;  3HLB A;  2QPN A;  4UA6 A;  4K0X A;  3T12 B;  1IKI A;  1DJA A;  4Y2F A;  3N8S A;  3G2Z A;  2L1M A;  1XJ3 A;  3VP4 A;  5HWV A;  4KZA A;  3HLD A;  4ARZ A;  1W5D A;  1PW1 A;  5AQ9 A;  4MBK A;  4DE2 A;  3WS2 A;  1CK3 A;  2WKP A;  4BJP A;  1LL9 A;  4IED A;  2H0T A;  3IBJ A;  3QP5 A;  1L0F A;  5J7E A;  1J3W A;  4BBV A;  2ZLY A;  3SS4 A;  3JVV A;  4GKU A;  5FAT A;  2Y2N A;  4WBG A;  4JPM A;  2V2F F;  1FIK A;  3FPV A;  3VOY A;  4II7 A;  2DRW A;  3PR6 A;  3G31 A;  4EW7 A;  4Q8I A;  4PM7 A;  4R38 A;  3P98 A;  2XEP A;  3N8L A;  5IHV A;  2E8J A;  3VFF A;  5F82 A;  2J3T D;  1DP8 A;  4BEN A;  2INW A;  4R4S A;  5FSR A;  2ZL1 A;  3JVU A;  4X69 A;  3S7O A;  1NXY A;  2GNX A;  1XKZ A;  2YKF A;  5HD5 A;  4GS9 A;  1WA9 A;  1W8Q A;  3UPP A;  1OTE A;  3BFE A;  4Y0O A;  2R9W A;  4S2N A;  1JTG A;  1YLW A;  2J80 A;  3IQA A;  3KX0 X;  2ZQ7 A;  3IF6 B;  3Q1F A;  2ZC6 B;  4HES A;  4NXB A;  3QNB A;  1GCE A;  3GR2 A;  4S2P A;  3W8K A;  3UMD A;  4DE1 A;  3GV9 A;  1OT9 A;  4GB7 A;  1LI0 A;  2XFS A;  3BFD A;  5E2E A;  4X53 A;  2OOL A;  3UE3 A;  1G68 A;  5EV0 A;  2W3E A;  2P08 A;  2L0W A;  1WE4 A;  2V1Z A;  4JGP A;  3FYZ A;  5A91 A;  1OME A;  1RGY A;  3RH8 B;  5GHY A;  4LV3 A;  1YQS A;  4LV2 A;  3TG9 A;  4NKP A;  2WAE A;  2A49 A;  3UE1 A;  4ETZ A;  2KX6 A;  3IWQ A;  3LR0 A;  3T1S A;  1MPL A;  1GSW A;  2WKE A;  2RCX A;  3VV4 A;  1PI5 A;  3HBR A;  1FCM A;  5FL3 A;  5HSQ A;  3HL9 A;  4WUJ A;  2P7J A;  5TJJ A;  3CUE C;  2ZQA A;  4C75 A;  3W4O A;  1BLS A;  4E3J A;  4C3Q A;  2D01 A;  2H0Y A;  5F1G A;  3BFC A;  3T1Q B;  1K56 D;  3BQ8 A;  3F1P A;  5HD3 A;  3IX8 A;  3MR0 A;  4I38 A;  3V39 A;  1AXB A;  5CER A;  4YWZ A;  4KZ4 A;  1N4O A;  2VV6 A;  5AQB A;  1NYM A;  4UA7 A;  1MZU A;  3A0R A;  4KUO A;  1FCO A;  3HLW A;  3C30 A;  1HZO A;  2BG1 A;  4BBU A;  4ZJ3 A;  2B5R A;  4H6J B;  1K38 A;  3K3C A;  3D72 A;  3A0S A;  5DKK A;  2Y2K A;  1F9I A;  3G34 A;  2HZ5 A;  3T4J A;  3IS2 A;  1SKF A;  3C7V A;  2R9X A;  5L2F A;  3NUL A;  1DJB A;  1F2K A;  2VV7 A;  5F5Y A;  5KSH A;  4WZ5 C;  4BLM A;  3PAE A;  3TRC A;  3DTI A;  5EVI C;  2XFT A;  1NRF A;  4OKP A;  4KQQ A;  1ES5 A;  4FH4 A;  3GEC A;  3OCL A;  4WM9 A;  4WEL A;  1K54 A;  3BFF A;  4XUX A;  2KOI A;  1KE0 A;  4GDB A;  4LLO B;  1BUL A;  2XSS A;  3CI6 A;  5HFO A;  4DRT A;  1E25 A;  2Q9M A;  1IEM A;  1SZV A;  4N1X A;  2H28 A;  3M6B A;  1IKG A;  1UWN X;  2OV5 A;  2O9A A;  3HUO A;  4E04 A;  2W27 A;  3SW1 A;  3ZG0 A;  2ZD8 A;  5EOO A;  3TSG A;  2P9V A;  1SHV A;  2HJ9 C;  3T4L A;  2QHK A;  2XD1 A;  2PU2 A;  3GRJ A;  3MKE A;  4ZDX A;  4CLC E;  3S7Q A;  2Q9N A;  3NOT C;  1PW8 A;  2VGK A;  1ZKJ A;  3T4Q A;  4OPY A;  3IXB A;  5TFQ A;  3A3J A;  3T4K A;  1HLU P;  4ZJ1 A;  2QZ6 A;  4P6B A;  2BTF P;  4EER A;  3S22 A;  2VKS A;  3B47 A;  3HUN A;  1JWZ A;  2ZMA A;  2V20 A;  1TDL A;  3UB7 A;  3C2W A;  1Q2P A;  4R3B A;  4DN0 A;  4EV4 A;  4M3K A;  5I94 A;  2EX2 A;  5L8M A;  3I7J A;  3LR3 A;  3ICY A;  1IEL A;  3UB8 A;  5CTN A;  5CHJ A;  3O88 A;  1W63 M;  1PZO A;  3AGF A;  5G4Y A;  5CTM A;  4IVK A;  5K5B A;  2PDR A;  3LR5 A;  5G18 A;  2Y2P A;  5HAR A;  2XA7 S;  4FD8 A;  5DFX A;  4E6W A;  3LUQ A;  3ZNY A;  3S7N A;  3VFH A;  4GD8 A;  4I3I A;  3EEH A;  3D3O A;  2J9P A;  4E3M A;  3C8C A;  1ACF A;  4S2J A;  3UNW A;  4HHD A;  1MC0 A;  4U3T A;  2PD8 A;  2HDQ A;  4H8R A;  2W0N A;  2OLV A;  2ZMV A;  3PBQ A;  4K0W A;  5A92 A;  2GZA A;  3LI8 A;  2WZX A;  3RFB A;  4WZ4 A;  1RGZ A;  2XDM A;  4BL3 A;  1H8Y A;  4X1L A;  3IWI A;  1FCN A;  2Y79 A;  3EQU A;  3BLM A;  1T1B A;  3E4P A;  1EW0 A;  4IUH A;  4YIN A;  5FQQ A;  1CI8 A;  1L2S A;  4FH2 A;  3DWK A;  4BMW A;  5IS1 A;  4PM5 A;  5IU1 A;  2LB5 A;  4OON A;  1YKD A;  2ZOH A;  3M2J A;  1ALQ A;  3MQQ A;  3W2Z A;  3OPH A;  4RX3 A;  1YAX A;  2X71 A;  2J3W A;  4RYE A;  2ZQC A;  4OQG A;  2QWS A;  4WLA A;  1IYP A;  2C6W B;  3ZG7 B;  4LV0 A;  1NWZ A;  5J3W A;  2Y4A A;  4O8G A;  2ZJ9 A;  2FFF B;  3PTE A;  3JPU A;  4MBF A;  1JWV A;  3UME A;  2WAD A;  3AGE A;  4EQI A;  1NLZ A;  5HPI A;  1XPB A;  1FSY A;  1P0Z A;  2WKI A;  4Q0J A;  5GL9 A;  5KZH A;  3LY3 A;  2A24 B;  1FSW A;  3MJQ A;  3IT9 A;  4QPR A;  1BYW A;  1ZHH B;  1XFQ A;  4CLC C;  3IF6 A;  2XK1 A;  3IHA A;  5DJT A;  1YLT A;  4EUZ A;  1V9Z A;  3LIB A;  1FR6 A;  4LPZ A;  4QY5 A;  2JKT M;  3GMW A;  1VB6 A;  1XA1 A;  2VX8 A;  3WRZ A;  1XGJ A;  1YLP A;  2E8I A;  4XT2 B;  1ONH A;  1T18 A;  2EWV A;  3V5M A;  1ES3 A;  1LSX A;  4JLF A;  3BEC A;  3Q07 A;  4WF0 A;  4EUV A;  1PWC A;  3CUE A;  5M1A A;  1H5X A;  4LFU A;  5FQI A;  3QHY A;  4CQH A;  1OTA A;  4PPR A;  3LI9 A;  2ZQ9 A;  3MBZ A;  4LCM A;  3TE8 A;  2EXA A;  3PYP A;  2QMI A;  3VSK A;  2WZZ A;  1H3Q A;  3CMZ A;  3PBR A;  1TVF A;  4E6X A;  4Y0U A;  2J9O A;  3G30 A;  2QJ7 A;  3LEZ A;  4O0P A;  1SCW A;  4JXV A;  4JF5 A;  5GLC A;  1W8Y A;  5FI7 A;  1BLC A;  3M2K A;  4DXC A;  5HAQ A;  1ZTU A;  2PYP A;  4EXO A;  5E2H A;  2UV0 E;  5GLD A;  1BLP A;  3E4O A;  4Y3I A;  4EU0 A;  2K2N A;  2ZQ8 A;  3K3D A;  4H6J A;  4S2L A;  2JBF A;  2PT7 A;  4ZTK A;  1PRQ A;  2JKF A;  1KGF A;  4HBU A;  4KZB A;  4GDN A;  4EEU A;  1K55 A;  3V3R A;  4Y15 A;  1ZC2 A;  4OPZ A;  2Y2M A;  5HDC A;  2XQZ A;  1VEU B;  4OQ0 A;  4GNU A;  4JF4 A;  1IOU A;  5FDS A;  2VGL M;  4QHC A;  3E0Y A;  2JKT I;  3N6I A;  4CLC D;  4XXR A;  5FI2 A;  4X1M A;  2Y2L A;  3BLS A;  1H0M A;  3CAX A;  3E4Q A;  2Q0O A;  5HZH A;  2G2U A;  2IWB A;  3Q7Z A;  3EWK A;  1Z09 A;  3NCK A;  5GLB A;  5EM0 A;  3ZG5 A;  5DJU A;  3KYZ A;  2PRF A;  1O7E A;  1JWP A;  4P85 A;  2HGV A;  1K57 A;  4ZBE A;  5A8B A;  3BY9 A;  3A3D A;  1Q2Q A;  3N8R A;  4FTX A;  2BAS A;  5FQK A;  2W1R A;  3VP3 A;  2ZM2 A;  1YM1 A;  3Q7V B;  1ERQ A;  2ZOI A;  5L07 A;  2M1C A;  2HJE A;  3PBO A;  3GQZ A;  3HLE A;  1T1A A;  1Z6F A;  2QYB A;  1IYQ A;  3VE4 A;  1F98 A;  4L9E A;  4PKY G;  1VM1 A;  2BLS A;  1C3B A;  3VOL A;  4HH3 A;  4KZ8 A;  1DP9 A;  5E43 A;  1T1C A;  4GJ4 A;  3CG5 A;  4DJ2 A;  2ZMF A;  3T1R A;  4BQM A;  4HBT A;  5AJG A;  2H10 A;  1MKI A;  3F1O B;  2H5S A;  3O5Y A;  4MBH A;  1OJ5 A;  4YFM A;  4KQR A;  4A5R A;  3BYD A;  3A0V A;  3CPT B;  4Y13 A;  3HLF A;  1BUE A;  4ESP A;  1HD8 A;  1TS6 A;  3DW0 A;  2Y59 A;  2JKR I;  3DTE A;  3MSH A;  4B88 A;  1YSP A;  5HL6 A;  4ID4 A;  2XLN A; 
#chains in the Genus database with same CATH homology
 2HJ9 C;  3T4L A;  2QHK A;  3UB9 A;  2EWW A;  2PYR A;  3H7W A;  3F1N A;  4WN5 A;  1YSQ A;  2JKR M;  5AVE A;  4L0L A;  4HIA A;  2K31 A;  4PHT A;  2LB9 A;  1G28 A;  4CLC E;  3S7Q A;  3KSH A;  3B42 A;  3H82 B;  3NOT C;  3K2N A;  5I5L A;  5TBM B;  2GJ3 A;  3T4Q A;  2KLI A;  4RQ9 A;  2V1A A;  3HJK A;  4EQ1 A;  4NXF A;  4L9F A;  1STZ A;  3T4K A;  4HY8 A;  2G7U A;  4KQO A;  4EER A;  3EGD C;  2VKS A;  3B47 A;  1G6O A;  3MQ0 A;  3OOV A;  3TW8 A;  3NOP C;  4GHI A;  5DFY A;  1D06 A;  1VHM A;  2O9C A;  2R78 A;  1X0O A;  2L4R A;  3UB7 A;  3C2W A;  4MN5 A;  3H7W B;  2XRO A;  3F1N B;  4DJ3 A;  1NLY A;  4DN0 A;  2WKQ A;  5L8M A;  3LR3 A;  3ICY A;  4IUK A;  3UB8 A;  2O9B A;  1OTD A;  2VEA A;  4MN6 A;  5DKL A;  4GW9 A;  1W63 M;  1S4R A;  3IBR A;  4WEJ A;  5G4Y A;  2VZW A;  4B9O A;  4WL9 A;  3PHY A;  3BW6 A;  4Y5F A;  2J3T C;  3NOU C;  4HH2 A;  5K5B A;  2PDR A;  1OTB A;  3LR5 A;  1N9L A;  2XA7 S;  5DFX A;  4I39 A;  2WKR A;  3LUQ A;  3R7W A;  3S7N A;  3ZQ5 A;  3OCN A;  1S1Y A;  4I3I A;  3EEH A;  4GHI B;  4WEK A;  3D3O A;  2PD7 A;  1LL8 A;  3C8C A;  4MDZ A;  4NXG A;  5DF9 A;  2PR6 A;  4P6Z M;  4DMZ A;  4HHD A;  4EES A;  1MC0 A;  3G6O A;  2GX5 A;  2ZBB A;  4HQA A;  2PD8 A;  2XA7 M;  1P9R A;  3CIT A;  4LRY C;  2Y8H A;  2W0N A;  3U2A A;  2ZMV A;  4Z1W A;  3FPW A;  3TJZ C;  3PBQ A;  2GZA A;  3UE6 A;  2HV1 A;  2VJW A;  4R70 A;  2XRN A;  4G3W A;  3LI8 A;  4EEP A;  3LIC A;  4I3J A;  3S7P A;  3RFB A;  1GSV A;  3V67 A;  1DP6 A;  2KDK A;  4MN7 A;  1UGU A;  3R7W B;  5F69 A;  4M4X A;  1H8M A;  2Y79 A;  3EQU A;  2IA2 A;  2QKP A;  3LID A;  3E98 A;  1Y28 A;  1T1B A;  2V0U A;  3E4P A;  1EW0 A;  3KO6 A;  4IUH A;  4G3K A;  4PKY A;  3UB6 A;  2YKH A;  2QJ5 A;  2CMN A;  4O01 A;  1T19 A;  4FSF A;  2W1T A;  4BMW A;  3T4T A;  5IS1 A;  5IU1 A;  2FZ0 A;  2LB5 A;  3R4K A;  4Y2F A;  1YKD A;  2ZOH A;  3NHQ A;  4R3A A;  5CX7 A;  4JGQ A;  2L1M A;  1XJ3 A;  2P04 A;  5HWV A;  2W3H A;  4FOF A;  3MQQ A;  2A24 A;  3W2Z A;  3CWF A;  4ARZ A;  1S67 L;  1YAX A;  3LFV A;  4K08 A;  5HPF A;  1LSW A;  2M7V A;  1F5M A;  1LSV A;  2J3W A;  5HDD A;  3VE3 A;  4I3A A;  2QWS A;  4WLA A;  2WKP A;  4BJP A;  3IBJ A;  3T4S A;  4MMN A;  5J7E A;  1NWZ A;  2B18 A;  4GCZ A;  5J3W A;  2VLG A;  4BBV A;  4O8G A;  3CLO A;  5G4Z A;  2W1T B;  3JVV A;  3UME A;  3PBS A;  1KOU A;  1NLZ A;  2OAP 1;  5HPI A;  1P0Z A;  4Q0J A;  4XT2 A;  3FPV A;  2A24 B;  4II7 A;  3MMH A;  1XFN A;  3PR6 A;  2I9V A;  3MJQ A;  2M7U A;  4ARZ B;  5F6A A;  1IFQ A;  2Z6C A;  4EW7 A;  3KSG A;  4LRX C;  4QPR A;  1BYW A;  1ZHH B;  4R38 A;  4BBT A;  1XFQ A;  4CLC C;  3MQO A;  1OPX A;  1LT0 A;  4ETX A;  4YNR A;  3LYX A;  2J3T D;  1DP8 A;  2V0W A;  3GDI A;  5DJT A;  1V9Z A;  3LIB A;  2INW A;  4KUK A;  4LPZ A;  3KYQ A;  2JKT M;  3BWL A;  1XJ6 A;  2D02 A;  4NEE D;  3JVU A;  1VB6 A;  2VX8 A;  3S7O A;  2JN7 A;  3T50 A;  1NRJ A;  2GNX A;  2K7S A;  2YKF A;  1ODV A;  4XT2 B;  4GS9 A;  4MCW A;  1WA9 A;  5HD5 A;  3EGX C;  3NJA A;  3HCY A;  3OLO A;  1OTE A;  1T18 A;  2EWV A;  5C5K A;  4LRZ E;  1LSX A;  3T4O A;  2J80 A;  4YOF A;  2EA9 A;  3KX0 X;  4WF0 A;  4BWI A;  4EUV A;  3PBT A;  3CUE A;  3MXQ A;  2B02 A;  3FC7 A;  4R6L A;  2PR5 A;  4CQH A;  4NXB A;  2W3G A;  1OTA A;  1TS7 A;  3UMD A;  5IT5 A;  3LI9 A;  3RTY A;  4UQI S;  3MFX A;  4F3L A;  1D7E A;  1OT9 A;  3TE8 A;  3LIF A;  3MF0 A;  4NXE A;  3PYP A;  3LR4 A;  1JNU A;  1H3Q A;  4L9G A;  2OOL A;  1TD5 A;  3UE3 A;  4GS9 B;  5HWW A;  1GSX A;  3BJN A;  2W3E A;  3PBR A;  4HOI A;  2P08 A;  2L0W A;  4JGP A;  4UQI M;  4CLC A;  5KIZ A;  2QJ7 A;  2JHE A;  1TF1 A;  4O0P A;  3RH8 B;  4PAU A;  3FG8 A;  1W63 Q;  4NKP A;  1OJG A;  4ETZ A;  5MC7 A;  4B93 A;  2KX6 A;  4ZRR A;  2OWH A;  3LR0 A;  1GSW A;  1XJ4 A;  4F3L B;  1ZTU A;  2FH5 A;  2PYP A;  5HDS A;  3VV4 A;  5FL3 A;  2W3F A;  4EXO A;  5HSQ A;  4EET B;  3LIE A;  1S1Z A;  4WUJ A;  3P01 A;  4I5S A;  4AFI A;  1OTI A;  1V9Y A;  3E4O A;  2P7J A;  4Q0H A;  4Y3I A;  5TJJ A;  2K2N A;  2VGL S;  3CUE C;  3H9W A;  4EU0 A;  2VV8 A;  3K3D A;  4H6J A;  4G3V A;  2PT7 A;  2O99 A;  2W3D A;  2VA0 A;  2D01 A;  4CLC B;  2V1B A;  4EEU A;  3EQV A;  1S66 L;  5HDC A;  3BQ8 A;  3F1P A;  5HD3 A;  4JGR A;  1IOU A;  3MR0 A;  2VGL M;  4I38 A;  1P97 A;  2OAQ 1;  4YWZ A;  3E0Y A;  2VV6 A;  4HJ4 A;  4JGO A;  2JKT I;  3ZYT A;  3B33 A;  4CLC D;  1MZU A;  2NUT C;  3A0R A;  3LIA A;  4KUO A;  3C30 A;  3CAX A;  3E4Q A;  5HZH A;  4IHQ A;  3KSI A;  4BBU A;  4H6J B;  3EWK A;  3OBF A;  3K3C A;  3D72 A;  3A0S A;  5DKK A;  5DJU A;  1F9I A;  3KYZ A;  3T4J A;  3IS2 A;  2HGV A;  2PHY A;  4HNB A;  1N9N A;  4Q0I A;  1OT6 A;  5A8B A;  3BY9 A;  3F1P B;  3HJI A;  5AVF A;  4HP9 A;  5LBR A;  2VV7 A;  5F5Y A;  5KSH A;  4OOL A;  3PBN A;  2BAS A;  2W1R A;  4UEY A;  3TRC A;  4P6Z S;  5HWT A;  2A2L A;  3PXP A;  4HI4 A;  2ZOI A;  3F1O A;  2M1C A;  2HJE A;  3PBO A;  1TS0 A;  3BY8 A;  1T1A A;  3GEC A;  2QYB A;  1P9W A;  3KSF A;  3OCL A;  4OOM A;  3VE4 A;  1F98 A;  4L9E A;  4WEL A;  3IS2 B;  4PKY G;  3VOL A;  4HH3 A;  2KOI A;  1DP9 A;  1XJ2 A;  2O0Y A;  1T1C A;  3DBA A;  1TS8 A;  4LLO B;  2XSS A;  4GJ4 A;  3CI6 A;  4DJ2 A;  3BQA A;  4HP4 A;  4ME4 A;  2OWJ A;  2ZMF A;  2H28 A;  5AJG A;  4HJ3 A;  2Z6D A;  2MJ6 A;  3F1O B;  1UWP X;  3O5Y A;  1MKM A;  3P7N A;  5EFW A;  1OJ5 A;  1UWN X;  2NUP C;  2O9A A;  4HJ6 A;  4E04 A;  4IJG A;  3H82 A;  3A0V A;  3ULF A;  5TBM A;  2W27 A;  3C38 A;  3SW1 A;  1N9O A;  2V9A A;  5J4E A;  1TS6 A;  2JKR I;  3EEA A;  4KQD A;  2HF6 A;  3EOI A;  1YSP A;  3OC2 A;  4GLQ A;  5F68 A;  5HL6 A;  1DRM A;  2DMW A;  1S4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...