5DFXA

Structure of the parental state of gaf3 from slr1393 of synechocystis sp. pcc6803 (in vivo assembled protein/chromophore)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
158
structure length
158
Chain Sequence
GSLQNIFRATSDEVRHLLSCDRVLVYRFNPDWSGEFIHESVAQMWEPLKDLQNNFPLWQDTYLQENEGGRYRNHESLAVGDVETAGFTDCHLDNLRRFEIRAFLTVPVFVGEQLWGLLGAYQNGAPRHWQAREIHLLHQIANQLGVAVYQAQLLARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Histidine kinase
publication title Three dimensional structure of the parental state of GAF3 from Slr1393 of Synechocystis sp. PCC6803
rcsb
source organism Synechocystis sp. (strain pcc 6803 / kazusa)
total genus 52
structure length 158
sequence length 158
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dfxA00
2VJWA 2W3FA 2K31A 2OOLA 3CI6A 2W1TA 4O01A 1YKDA 2M7VA 5C5KA 3E98A 4IUKA 2GX5A 2Y79A 1MC0A 5DFYA 3G6OA 3W2ZA 2HGVA 3OOVA 3R4KA 1MKMA 2QYBA 4BWIA 1TD5A 4R6LA 3IBRA 2VZWA 3BJNA 3LFVA 2B18A 1YSQA 4YOFA 4MDZA 3O5YA 4IUHA 3S7QA 5DFXA 5L8MA 4Q0IA 3S7OA 3MF0A 4O8GA 2XRNA 1VHMA 4ETZA 5AJGA 2O9CA 3D3OA 4Q0JA 5HSQA 4DMZA 4FOFA 2O9AA 2XSSA 4RQ9A 4ME4A 2K2NA 4GW9A 2W3HA 5LBRA 1TF1A 4EUVA 4E04A 5K5BA 3MMHA 3S7PA 5HL6A 4CQHA 3KO6A 2Y8HA 4GLQA 4G3KA 2ZMFA 4LRXC 4Y2FA 3TRCA 4Y3IA 4Z1WA 4G3WA 3S7NA 5I5LA 4G3VA 2KOIA 2M7UA 3ZQ5A 3C2WA 4DN0A 3E0YA 4YNRA 4MCWA 3VV4A 1STZA 3RFBA 3IBJA 2W1RA 4R70A 3DBAA 3KSFA 3CITA 3NOPC 4Q0HA 2O0YA 2W3GA 4IJGA 5HPIA 2LB5A 3NHQA 3K2NA 2W1TB 2KLIA 2VEAA 4QPRA 2XROA 4ZRRA 1YSPA 4MMNA 4LRZE 2G7UA 3NOUC 3KSHA 3OBFA 4PAUA 2O9BA 2W3EA 4LRYC 2LB9A 3EEAA 3MQ0A 2IA2A 1ZTUA 4ETXA 3HCYA 2O99A 3KSIA 5HPFA 1F5MA 3KSGA 3NOTC 4O0PA 2W3DA 4MN7A 4Y5FA 4EU0A 2VKSA 5TJJA
chains in the Genus database with same CATH superfamily
5KZHA 1FR1A 1IYSA 1KDWA 4KZ4A 1I5QA 5CEBA 2EX2A 5DF9A 4P87A 1OJ5A 3OCLA 1LL8A 1XKZA 1JNUA 5FDHA 4EV4A 3IBRA 1ES4A 4HP9A 2WKHA 3HLDA 2J9PA 2KDKA 2XRNA 3C7VA 4EERA 4XT2A 4RQ9A 1W8YA 2E8IA 3V39A 4ZJ3A 1W63M 2A24B 4LCLA 5TBMB 1WA9A 1MBLA 4R23A 4KZ5A 3RTYA 5AQBA 4YNRA 5HWVA 1KE4A 1RGZA 4HEFA 3UE1A 1K54C 4WL9A 1ODVA 4IBRA 3B3XA 3T4KA 4EQIA 2DNSA 5EM1A 2HP9A 2ZL1A 2W1TB 1BTLA 2D01A 4OPYA 4Z9QA 4UAAA 4KZ7A 2Y59A 3RJUA 4D60A 4DKIA 5HWTA 1PWCA 1X0OA 3G35A 4BQMA 2W3EA 1TS0A 4Y7PA 5U47A 2VLGA 4BBVA 1O07A 3VOYA 2BG1A 3LIEA 5EFWA 3IX3A 3NIAA 2NUPC 1S1YA 5TJJA 3UB6A 1SDNA 2OOLA 2A3UA 4EQ1A 4JXSA 1JVJA 5DJTA 4CLCA 2XD5A 2HGVA 5F1GA 4R4RA 1TD5A 3R7WB 3LFVA 1T19A 3TE8A 4L9GA 5FL3A 3K3CA 2PR6A 4GS9B 2PT7A 3BLMA 5J7EA 5JYOA 5L8MA 5CERA 1NJ4A 3FWLA 2JBFA 2V0WA 5FDSA 1GA9A 3SOIA 5AJGA 4XUZA 3C7UA 2Y2IA 3P09A 4OQIA 2V20A 2Y2JA 3W4PA 4LGWA 4B4ZA 4WMCA 3B42A 1TS6A 1GSXA 1BLPA 2JN7A 3NJAA 4KZ3A 3C4OA 3KO6A 4E3OA 3IS2B 2OAQ1 4LLOB 4E6XA 3VE4A 3HUNA 2YKHA 5GLDA 2E8JA 3IBJA 4P6BA 3G2ZA 4ZBEA 2I72A 5EE8A 1P9WA 3M2JA 4PM6A 3MZDA 2OLVA 1PW8A 3F1PA 3IXHA 4U3TA 1KE3A 4OPRA 4IHQA 1W79A 4KUKA 3A0SA 1VETA 2LB9A 3QNBA 1XJ4A 4GHIA 5FI2A 1JTGA 3IHAA 3UPPA 4UA7A 4S2LA 2QJ7A 1DJAA 2JE5A 3LR3A 1S6RA 3PTEA 3F1NA 3T4TA 2PYPA 4LENA 3HVFA 4P0MA 1T1CA 4MBHA 4K08A 4KQRA 1S66L 3IWOA 3ZNYA 4EEPA 1K57A 4WYYA 1SHVA 4R6LA 1K25A 5TR7A 2C6WB 4FUWA 3IH8A 5J4EA 1L3LA 3DTIA 3PR6A 4GCZA 4HH3A 4C3QA 2DCFA 4OP8A 2FFFB 1T18A 4QU3A 2WAEA 4H6JA 2V2FF 1QMFA 4GJ4A 4HOIA 2Y4AA 1FQGA 3OPLA 5FI7A 4WF0A 2Z6DA 3GECA 2XLNA 5CGSA 3HLBA 2INWA 3IX8A 3GR2A 4EXOA 4UQIS 3VSLA 3VFHA 3QNCA 1V9ZA 3B47A 2R9XA 3BQ8A 3EQVA 1K0KA 3MR0A 4JGQA 2M1CA 5GL9A 1W63Q 2DMWA 3LYXA 4OOMA 3EEAA 1K6RA 4N1HA 1KGGA 4O7DA 2PHYA 1C3BA 4BD0A 4GD8A 3WRTA 4EU0A 4JGRA 3TG9A 3TJZC 4JXWA 4O01A 3PAEA 2M7VA 4NG2A 4S2KA 3V50A 3G6OA 3W2ZA 4NXFA 1SKOA 5EOOA 5FEGA 3DWZA 4JPMA 1G68A 4S2PA 3NC8A 1BSGA 5E2EA 3V67A 3BYDA 2WZXA 5EM0A 4XUXA 4PKYA 2GZAA 4MN6A 3U2AA 1FCNA 1HZOA 4O8GA 1VHMA 2HZ5A 1F9IA 2JKFA 4ZTKA 2ZL1B 4KZAA 1XJ3A 1L0DA 5FQJA 5HX9A 1M40A 4JGPA 4E04A 4LFUA 3ZVWA 3IHBA 3H7WA 5HAPA 3Q7ZA 5GLAA 3MKEA 4PM7A 3ICYA 3S4XA 2OAP1 5EVIC 2ZQAA 5M1AA 3I7JA 1WYCA 2G2WA 3IT9A 1STZA 1QMEA 3WS5A 1HLUP 3ITAA 1SKFA 4FTXA 1NRFA 3W8KA 3DAVA 3DTMA 3MZFA 5HDDA 1JWVA 3EOIA 3UDFA 4MMNA 4CLCB 1HVBA 4Y0UA 1V9YA 4X68A 1KGEA 1MWSA 4E3KA 3F1OB 4IVIA 4ZDXA 2ZMVA 1KVLA 1MWTA 1ZTUA 4UQIM 1ERQA 2UV0E 4JF5A 3LUQA 1XFNA 3LY4A 1F5MA 3Q1FA 3KSGA 3IF6A 2WKIA 4Y5FA 4HI4A 1K55C 5F68A 2Y2OA 5CEDA 2VA0A 3PAGA 5DTKA 3AGDA 1BLHA 4BL3A 2XK1A 1GHIA 1CJFA 4BENA 3UB5P 1ALQA 1OMEA 2Z2MB 5FASA 4WELA 4WZ4A 1DP6A 1FSWA 2ZD8A 4X55A 4DE3A 4HESA 2H5SA 2QKPA 5CX7A 4S2NA 3F1PB 1KOUA 1AXBA 4E3NA 5KMWA 3E2KA 1W7FA 3LEZA 4KG6A 1DP9A 4KZBA 1VETB 1XP4A 2J9OA 2QWSA 3MKFA 4U0XA 5I5LA 4GHIB 1S1ZA 4LV3A 3PHYA 4QWOA 4R70A 3N4IA 3CITA 4S2IA 2I9VA 4HH2A 3F1NB 1XGIA 4UHUA 2V1ZA 3EWKA 2Y2MA 1XA1A 5EUAA 4ARZA 2VGKA 3AGEA 2OLUA 2JCHA 4PMAA 3UN7A 2J3TC 2V9AA 2YKFA 4LRYC 3ZGAB 4A5RA 5FI6A 3CMZA 5L07A 4ETXA 4BD1A 3KSIA 2HV1A 5DJUA 3HLCA 4OH0A 1Q2PA 1J9MA 1L0FA 4UA6A 4OPQA 1S67L 1LLBA 1IKGA 3UMDA 4IVKA 4DRTA 3MXQA 4QJGA 1GHPA 3MXRA 1MY8A 2Y2GA 3MJQA 3V3SA 1T1AA 4DF6A 3GV9A 2B18A 2HP6A 3UY6A 1CK3A 5GHZA 5CGXA 5G4YA 2O9CA 3D3OA 4ESPA 1U60A 5IS1A 1PI5A 3HJKA 4M3KA 1DP8A 5GLBA 1TVFA 2J8YA 3DTEA 2L4RA 3NECA 5HL6A 4GLQA 4G3KA 4LV2A 4EWFA 2X71A 4FSFA 3LICA 4BMWA 1N4OA 3ZQ5A 4LPZA 4I3IA 4DN0A 2G2UA 2DRWA 4EBPA 1Z6FA 3C38A 3DBAA 1KDSA 1Y4OA 2PYRA 3GTCA 1IOUA 2W27A 4CLCE 4KENB 1ONHA 4Y17A 2XA7S 5DVAA 2ACGA 3UB8A 1YSPA 3KX0X 1H3QA 3OCNA 4I3JA 1SKOB 3VSKA 1TS8A 4HBTA 4L9EA 1IYOA 1FOFA 2O99A 3P7NA 3HBRA 2OWJA 5DKKA 4R38A 5TGFA 4C6YA 2WAFA 2V1AA 4MBFA 4PPRA 4L0LA 3UDIA 5EVID 2CC1A 3NI9A 3MQOA 1N9LA 1LI9A 3H7WB 3M2KA 3PBQA 3WS2A 3P01A 2EWWA 4OOYA 2ZQ9A 5E2GA 1YLYA 3CZDA 5KIZA 1NLZA 3FYZA 2PD7A 4N9KA 4QY6A 5DFXA 2IWBA 3LIFA 4DE0A 1D7EA 3ZYTA 4NEED 1NRJA 3PXPA 2XGNA 3LGOA 1VM1A 5HWWA 3LI9A 5HFOA 2EX8A 4RX3A 2WKRA 4P85A 4CQHA 3IXBA 1K56A 3S7NA 3T1QB 2Y2HA 1PW1A 3U4LP 3RH8B 5FATA 3HL9A 1I2WA 1K4EA 4KZ9A 4OQ0A 4FH2A 4HNBA 3FZCA 5HAIA 1N9OA 5E2FA 3IF6B 2HDRA 5HPIA 1O7EA 1ES3A 3NHQA 4P6ZS 2HDUA 1D06A 3UDXA 4FCFA 3UPOA 1NZOA 4HJ3A 4WBGA 4ZRRA 4NXGA 4DE2A 4JXVA 2K7SA 4CPKA 4F3LA 2ZQ8A 1Y28A 1K54A 2WKEA 2WKPA 5EVEA 4BJPA 4KZ8A 4MN7A 1BYWA 2P04A 4GNUA 1LSXA 4WLAA 4HJ6A 1OTEA 1OTDA 5BOHA 3OPPA 4EBLA 2Y79A 2W0NA 1FCMA 4D2OA 2R9WA 2QYBA 4R0QA 1JWZA 1YSQA 4YOFA 3EQUA 3ZG8B 3OPRA 4Q0IA 2Q9MA 2ZC5B 3BFGA 3JVUA 2Z2LB 1XJ2A 3MXSA 4WEKA 1OPXA 1XA7A 3S22A 2J3TD 2OWHA 1YLZA 1VB6A 3SS3A 4ARZB 1HTZA 4G3WA 3G4PA 1K6SA 1H5XA 5AVFA 1I2SA 4MCWA 2VV7A 3N8LA 1Z09A 1G5UA 1CI9A 3QP6A 3T12B 3GSGA 2JKGA 3LEQA 1BULA 5CRFA 3ZNTA 3TW8A 1L0GA 1IYPA 2VX8A 5J3WA 5FQQA 1NLYA 4E3IA 3CJMA 4KUOA 3H82A 4WEJA 3KSHA 4PAUA 2O9BA 3IF5A 4WM9A 4P6ZM 1LT0A 5HDCA 1DJCA 3JVVA 3Q7VA 3CLOA 1FR6A 3JYIA 1LL5A 1XGJA 3SH7A 3A0VA 3VP0A 1MKIA 3PBNA 1YLWA 4OP5A 1K56D 5C5KA 4IUKA 3ZFZA 1WYBA 1N9BA 4JBFA 5FEFA 3PBSA 4BL2A 2VV8A 4S2JA 1JTDA 4XT2B 4S2OA 3DW0A 3MF0A 5FSRA 1GHMA 5DTTA 1LSVA 4YFMA 1ZHHB 4X6TA 1PI4A 2O9AA 3Q07A 4GDBA 1F98A 3TOIA 4DXCA 3CUEC 1RP5A 3T4LA 4OONA 3IF6C 3OLOA 3C30A 5A8BA 1VEUA 4I5SA 3ITBA 4WZ5C 2PU2A 3E0YA 3VV4A 3HLEA 2HP5A 4ZAMA 3UE0A 1HD8A 3UE6A 1SDEA 1BLCA 2XF3A 3BEBA 2PBDP 3ZVTA 2KX6A 4DJ3A 3HLGA 3D9YA 5G4ZA 1MWUA 3UE3A 1OT9A 5L2FA 1ES5A 4LCMA 4MN5A 3NDEA 4QY5A 2QJ5A 3E4OA 3MFXA 2VKSA 4KZ6A 4B9OA 4GZBA 1KGFA 1UGUA 2IWCA 2MJ6A 1ZG4A 1XPBA 1A0KA 1RCJA 2XH9A 3FKWA 2A2LA 4XXRA 5HDSA 4IUHA 2ZM0A 3KYEA 3ULFA 2VGLS 4K0XA 1NZUA 1K4FA 3GQZA 3HUOA 3O3VA 4NXEA 2EA9A 4OQHA 5JYPA 2R78A 1YPRA 4NETA 1TF1A 4EW7A 4UEYA 4LV0A 2EWVA 2RCXA 4LRXC 1IFQA 4R1GA 4F3LB 2ZQCA 4HP4A 5MC7A 3LI8A 2PRFA 3BY8A 3RFBA 2JC7A 2Y2PA 1H0MA 2JKRI 3FPVA 3C5AA 3A3EA 2KLIA 4PHTA 1WE4A 3ZHHA 5M19A 4NK3A 5EVIA 1CI8A 2JKRM 4HY8A 4PM5A 1H8MA 4LRZE 3QP5A 2ZQ7A 4ID4A 3NOUC 4OQGA 5L10A 3JPUA 2PR5A 4OLDA 3M6BA 3GVBA 2XR0A 1FCOA 5IHVA 4EETB 2H10A 3G34A 1OTIA 5F69A 5GLCA 4DMZA 3OC2A 1PWGA 1TDGA 4RYEA 4E3MA 1YKDA 3E98A 1P97A 1RGYA 1ES2A 1H8YA 1ONGA 3LIAA 1ZC2A 1MKMA 3A3IA 4RA7A 4II7A 2C5WB 3B33A 2VK3A 2P7JA 1J3WA 2UWXA 3EGXC 1W5DA 1K55A 1OJGA 2ZOHA 3T4SA 3O86A 1EW0A 2PU4A 3M6HA 2B5RA 4ME4A 4GW9A 3SZTA 3O87A 4H6JB 2H0TA 2QPNA 3A3JA 2EFUA 3S7PA 5DTSA 3VP1A 3SH9A 3H82B 2B95A 3PBRA 2VGLM 4X25A 4R3AA 3D4FA 4G3VA 4C75A 4HQAA 1GA0A 3VOZA 3RXWA 4K91A 1L2SA 3FC7A 4MLLA 5CTMA 1NYMA 3Q7VB 2EXBA 2O0YA 5HARA 5FQIA 1YMSA 3BWLA 3K3DA 3Q82A 5F83A 5FQ9A 3LR4A 3T4QA 1YLTA 1OTBA 4WN5A 3MZEA 3LCEA 5EECA 4N9LA 5CTNA 4IEDA 3P98A 5KSHA 5A93A 1MXOA 4KG5A 1IEMA 3BECA 2HPBA 3HLFA 4F94A 2J80A 3AGFA 4CLCC 5HW3A 3MQ0A 5E2HA 1S0WA 2WGVA 3VE3A 2L0WA 5IU1A 2XQZA 4JKTA 4N92A 5A92A 3HUMA 1NWZA 3G31A 4QB8A 3FG8A 3IXDA 1UWNX 2V8CA 3GRJA 3CI6A 5FQKA 1CQAA 4E6WA 1BUEA 3L7HA 3R4KA 3W4QA 1VEUB 1XX2A 3BJNA 4NKPA 3O5YA 2EFXA 1YLJA 2NUTC 2Q0OA 4GN2A 2Y55A 2P9VA 1GSVA 1YT4A 4EBNA 3NULA 3T1RA 3A0RA 2XSSA 5CXWA 5HL1A 4QHCA 2X01A 2Y91A 4E3JA 5K5BA 5GHXA 3T4OA 1FSYA 2P08A 3EEHA 1LSWA 4KQOA 4GKUA 4Y2FA 4OOLA 3N8SA 5D3OA 2WKQA 3ISGA 2ZBBA 3WS0A 3T1XA 4ZJ2A 2PAVP 5EPHA 4GOGA 3N6IA 2PDRA 5G18A 3NOPC 3BFDA 3UB7A 4YINA 5J8XA 1OT6A 3UO9A 1EROA 2XROA 3LIBA 1W8QA 1G6AA 3E4QA 5TFQA 5M18A 3DTKA 3UB9A 3WWXA 3HJIA 4B93A 1EI5A 1NY0A 2B02A 3BM6A 3OBFA 2XFTA 2EXAA 2VGJA 1IKIA 1K57C 4JF6A 5FA7A 4MEZA 3MBZA 1S4RA 3F1OA 3ZG7B 3UMEA 3C8CA 2W3DA 3V3RA 2CMNA 2VJWA 2QMIA 4U0TA 1MC0A 4X1LA 4OPZA 2BASA 1PZOA 2WYXA 4OLGA 3NDGA 1TS7A 1YLPA 4M4XA 2J7VA 2ZC7A 3BQAA 1KVMA 2A49A 5IT5A 2XA7M 4MDZA 2HDSA 3S7QA 1F2KA 2V8FA 4B88A 3IXGA 3Q81A 5AVEA 2HJEA 5HSQA 1LI0A 3FKVA 1ERMA 2K2NA 3IH9A 3VFFA 4DDSA 2Y2QA 1LL9A 4EUVA 1AWIA 5EVIB 3MMHA 3QP8A 1SCWA 3ZG5A 2Y8HA 1YQSA 2ZMFA 5DKLA 5HZHA 1E4DA 1XFQA 2KOIA 3IWQA 1YAXA 3LO7A 1T1BA 2GJ3A 1H8ZA 1MWRA 4LV1A 3KSFA 3UNWA 3ZDJA 3D72A 1FILA 2WGWA 2WUQA 3CAXA 3K2NA 3KYZA 4GB7A 5E43A 2WADA 2Z6CA 2H0YA 1DRMA 3OPHA 2IA2A 2V1BA 1TEMA 2XDMA 4RX2A 3MQQA 4GDNA 2L1MA 1SZVA 1PIOA 5F1FA 2XFSA 3IX4A 4JF4A 3CG5A 2GX5A 5CECA 2WK0A 1P0ZA 3VP2A 1DY6A 1DJBA 4OVDA 4S2MA 5FAOA 3MS6A 3PBOA 4I38A 4FD8A 3HREA 3KYQA 1KE0A 2D02A 3A3DA 1NXYA 5A90A 1LHYA 2OSUA 3CPTA 2XEPA 1CEGA 1ZKJA 1BZAA 2ZJ9A 2WGIA 3V5MA 3T4JA 3VP4A 3CWFA 3PBTA 5LBRA 4DE1A 4E3LA 4CLCD 4KG2A 3TRCA 2FH5A 3LR0A 4Y3IA 2ZQDA 1G28A 1CEFA 1P9RA 1GCEA 2ZM8A 3T1SA 4R3JA 1E3UA 2Y2KA 4R3BA 4Y13A 1EWZA 2W3GA 4IJGA 3BW6A 3FPWA 4WMCD 1TDLA 1IELA 4PM9A 3A3FA 2VEAA 2A24A 2BTFP 5TBMA 2PD8A 2RL3A 3IWIA 1N9NA 2PBYA 4Y15A 2BLSA 2EX6A 5DF8A 4YWZA 2AVXA 2ZLYA 2X02A 3GMWA 3PYPA 3HCYA 5F5YA 2P9VB 2FFYA 4EESA 4PKYG 4K0WA 5HPFA 4Y0TA 3S1YA 3OZHA 3L9KA 4KQDA 4JGOA 5AQ7A 2QHKA 2W3FA 2W1TA 2ZC6B 2HJ9C 5CHMA 5EOEA 4S2NC 2HDQA 4HJ4A 4BWIA 3BLSA 4MBKA 1IYQA 4ZJ1A 3ZCZA 4X53A 4PM8A 1ESUA 3S7OA 2ZOIA 2EX9A 3ZG0A 3H9WA 4B4XA 2J3WA 3CHWP 4FOFA 4JXGA 3E2LA 4NXBA 3SS5A 4EUZA 2GNXA 2W3HA 4MNRA 4HHDA 3HLWA 1YM1A 3NY4A 3G32A 4DJ2A 2HF6A 1PFLA 3BY9A 1S4SA 3WRZA 3BFFA 1Y54A 3QP1A 2P74A 4N1XA 4X1MA 4BBUA 3DWKA 4WUJA 2M7UA 1YMXA 3R7WA 2Y2NA 1XJ6A 1PZPA 5F82A 2ZMAA 1PYYA 5A91A 3E4PA 4GS9A 1ZG6A 3MFDA 2W1RA 3G30A 5HAQA 5GHYA 1G6OA 4KQQA 4HBUA 3CUEA 2LB5A 5KSCA 4X56A 4QPRA 4Y0OA 2FZ0A 5AQ9A 4WZ5A 2G7UA 4HIAA 3IS2A 4R4SA 5FQMA 3ZG9B 2V0UA 1D1JA 2JHEA 3SW1A 2H28A 4X69A 1CF0A 2VV6A 3UPNA 4I39A 3W4OA 1ACFA 4I3AA 4Q8IA 2K31A 4FH4A 4DXBA 2JKTI 1NYYA 3WS1A 3FV7A 4GD6A 4RVAA 5DFYA 2ZC4B 5HD3A 3OOVA 2JKTM 3BFCA 3VP3A 1BLSA 1PNEA 3G2YA 1E3UD 2VZWA 5AQAA 1ESIA 5EV0A 4ETZA 3QP4A 4AFIA 5I94A 4Q0JA 3BRMA 5DF7A 2WGWB 3GDIA 1MZUA 3EGDC 3MSHA 1E25A 1Q2QA 4IBXA 5CGWA 1JWPA 1OTAA 3SH8A 4JLFA 4QD4A 2IWDA 2QZ6A 2GDNA 4EEUA 5CHJA 4BBTA 4Z1WA 3N7WA 4L9FA 2XD1A 1VQQA 3C2WA 1FIKA 5HD5A 3O88A 3VOLA 4BLMA 4Q0HA 3LY3A 5EVLA 3WS4A 4H8RA 3IQAA 4DDYA 5FAPA 4CJNA 1XXMA 2ZC3B 1BT5A 3LR5A 1MPLA 4UA9A 2ZM2A 5F6AA 3QHYA 1PWDA 1PRQA 5L09A 3TSGA 3VMAA 4OKPA 3T50A 1M6KA 3BFEA 1UWPX 3LIDA 3C4PA 3RXXA 2OV5A 2WZZA 2Q9NA 3QP2A 3NBLA 3SS4A 1L0EA 3CPTB 1K38A 3NOTC 4O0PA 3N8RA 5CHUA 1GSWA 3NCKA 2Y2LA 5FAQA
chains in the Genus database with same CATH topology
2VJWA 5C5KA 5F68A 4IUKA 1MC0A 2VA0A 5DF9A 2BASA 1OJ5A 3OCLA 1LL8A 1TS7A 4M4XA 1JNUA 3BQAA 3PBSA 3IBRA 2VV8A 5IT5A 2XA7M 4MDZA 4HP9A 4WELA 4XT2B 3S7QA 3MF0A 1DP6A 2KDKA 2XRNA 1LSVA 4EERA 5AVEA 2HJEA 1ZHHB 5HSQA 4XT2A 2QKPA 2O9AA 5CX7A 4RQ9A 2K2NA 3F1PB 1KOUA 1W63M 4EUVA 1F98A 2A24B 3MMHA 3CUEC 5TBMB 3T4LA 2Y8HA 1WA9A 2ZMFA 5DKLA 5HZHA 1DP9A 1XFQA 3OLOA 3C30A 5A8BA 2QWSA 5I5LA 3RTYA 2KOIA 4I5SA 4GHIB 1YAXA 1S1ZA 1T1BA 3E0YA 2GJ3A 4YNRA 3VV4A 5HWVA 4WL9A 1ODVA 3PHYA 4R70A 3KSFA 3CITA 3D72A 3T4KA 2I9VA 4HH2A 3F1NB 3CAXA 3K2NA 2W1TB 3EWKA 3KYZA 2D01A 3UE6A 4ARZA 2Z6CA 5HWTA 1X0OA 2J3TC 1DRMA 2KX6A 2V9AA 4DJ3A 2YKFA 2W3EA 1TS0A 4LRYC 2VLGA 4BBVA 2IA2A 5G4ZA 4ETXA 3KSIA 2V1BA 3UE3A 1OT9A 2HV1A 5DJUA 4MN5A 3LIEA 5EFWA 1S67L 3MQQA 2QJ5A 2NUPC 3E4OA 2L1MA 1S1YA 3MFXA 2VKSA 5TJJA 3UB6A 3UMDA 2OOLA 3MXQA 4B9OA 4EQ1A 5DJTA 2GX5A 4CLCA 1UGUA 1P0ZA 2MJ6A 2HGVA 3MJQA 1TD5A 1T1AA 3PBOA 3R7WB 2A2LA 4I38A 3LFVA 2B18A 1T19A 5HDSA 3TE8A 4L9GA 5FL3A 4IUHA 3K3CA 3ULFA 2PR6A 2PT7A 4GS9B 3KYQA 2VGLS 5J7EA 5L8MA 5G4YA 2D02A 2V0WA 5AJGA 2O9CA 3D3OA 4NXEA 2EA9A 5IS1A 2R78A 3HJKA 1DP8A 3T4JA 3B42A 3CWFA 1TS6A 3PBTA 1TF1A 5LBRA 2L4RA 1GSXA 2JN7A 4EW7A 4UEYA 4CLCD 3NJAA 5HL6A 2EWVA 3KO6A 4GLQA 4G3KA 4LRXC 1IFQA 3TRCA 2FH5A 3LR0A 4Y3IA 4F3LB 3IS2B 4FSFA 2OAQ1 1G28A 4LLOB 3LICA 4BMWA 4HP4A 1P9RA 3ZQ5A 3VE4A 4LPZA 4I3IA 4DN0A 2YKHA 5MC7A 3LI8A 3BY8A 3RFBA 3C38A 3IBJA 3DBAA 2PYRA 1P9WA 2W3GA 4IJGA 2W27A 1IOUA 2JKRI 4CLCE 3BW6A 3FPWA 3FPVA 2XA7S 3F1PA 2KLIA 4PHTA 2VEAA 2A24A 3UB8A 1YSPA 2JKRM 4HY8A 5TBMA 2PD8A 3KX0X 1H3QA 3OCNA 1H8MA 4LRZE 4IHQA 4I3JA 1N9NA 3NOUC 4KUKA 1TS8A 3A0SA 4L9EA 4YWZA 2LB9A 1XJ4A 4GHIA 2PR5A 3PYPA 3HCYA 2O99A 5F5YA 3P7NA 2OWJA 2QJ7A 4EESA 5DKKA 4PKYG 4R38A 5HPFA 4EETB 3LR3A 4KQDA 4JGOA 1OTIA 3F1NA 2QHKA 3T4TA 5F69A 2PYPA 4DMZA 2V1AA 4L0LA 2W3FA 3OC2A 1T1CA 2W1TA 1YKDA 4Y5FA 3E98A 4K08A 3MQOA 1P97A 1N9LA 2HJ9C 3H7WB 1S66L 3PBQA 4EEPA 3P01A 2EWWA 3LIAA 1MKMA 4HJ4A 4BWIA 4II7A 4R6LA 3B33A 5KIZA 1NLZA 2P7JA 2PD7A 5DFXA 3EGXC 3S7OA 5J4EA 2ZOIA 1OJGA 2ZOHA 3H9WA 3LIFA 3T4SA 2J3WA 1D7EA 1EW0A 3PR6A 3ZYTA 4FOFA 4NEED 4GCZA 1NRJA 4HH3A 3PXPA 4ME4A 4NXBA 4GW9A 5HWWA 2GNXA 2W3HA 3LI9A 4HHDA 4H6JB 4DJ2A 3S7PA 2WKRA 2HF6A 4CQHA 3BY9A 1S4SA 1T18A 3H82B 4H6JA 3PBRA 2VGLM 4R3AA 3S7NA 4BBUA 4WUJA 4G3VA 2M7UA 3R7WA 3RH8B 1XJ6A 4HQAA 4GJ4A 4HOIA 4WF0A 3E4PA 4GS9A 4HNBA 3FC7A 2W1RA 2Z6DA 1N9OA 3GECA 2INWA 2O0YA 1G6OA 4EXOA 5HPIA 3CUEA 4UQIS 2LB5A 1V9ZA 3NHQA 3BWLA 3K3DA 3B47A 4P6ZS 1D06A 3LR4A 3BQ8A 3T4QA 3EQVA 4WN5A 1OTBA 4QPRA 4HJ3A 4ZRRA 2FZ0A 3MR0A 4NXGA 5KSHA 4JGQA 2K7SA 2G7UA 2M1CA 4HIAA 4F3LA 3IS2A 1W63Q 1Y28A 2DMWA 2J80A 3LYXA 4OOMA 3EEAA 4CLCC 3MQ0A 3VE3A 2PHYA 2L0WA 5IU1A 2V0UA 3SW1A 2JHEA 2H28A 2WKPA 1NWZA 2VV6A 4BJPA 3FG8A 4I39A 4MN7A 1BYWA 2P04A 1UWNX 1LSXA 4JGRA 4EU0A 3TJZC 4WLAA 4HJ6A 4I3AA 1OTEA 2K31A 1OTDA 3CI6A 4O01A 2M7VA 2JKTI 5DFYA 2Y79A 2W0NA 3G6OA 3W2ZA 4NXFA 5HD3A 3OOVA 3R4KA 2QYBA 2JKTM 2VZWA 3BJNA 4NKPA 1YSQA 4YOFA 3V67A 3O5YA 3EQUA 2NUTC 4Q0IA 4PKYA 1GSVA 2GZAA 4MN6A 3U2AA 4O8GA 4ETZA 1VHMA 3JVUA 4AFIA 4Q0JA 3A0RA 1XJ2A 1F9IA 3GDIA 1MZUA 3EGDC 4WEKA 2XSSA 1OPXA 1OTAA 1XJ3A 2J3TD 2OWHA 4JGPA 4E04A 5K5BA 1VB6A 3T4OA 2P08A 4ARZB 3EEHA 1LSWA 3H7WA 4KQOA 4Y2FA 4OOLA 4EEUA 4BBTA 4Z1WA 4G3WA 2WKQA 3ICYA 4L9FA 2OAP1 2ZBBA 3C2WA 5AVFA 4MCWA 2VV7A 5HD5A 1STZA 2PDRA 3VOLA 3NOPC 4Q0HA 3UB7A 3LR5A 1OT6A 5F6AA 5HDDA 3TW8A 2XROA 2VX8A 3LIBA 3EOIA 3E4QA 5J3WA 3T50A 4MMNA 1NLYA 3UB9A 4CLCB 4KUOA 1V9YA 3HJIA 4B93A 3H82A 1UWPX 2B02A 3KSHA 3LIDA 4WEJA 3OBFA 4PAUA 2O9BA 3F1OB 2ZMVA 1ZTUA 4UQIM 1S4RA 3F1OA 4P6ZM 1LT0A 3UMEA 3LUQA 5HDCA 3JVVA 1XFNA 1F5MA 3KSGA 3CLOA 3NOTC 4O0PA 3C8CA 2W3DA 3A0VA 1GSWA 4HI4A 2CMNA 3PBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJW A;  2W3F A;  2K31 A;  2OOL A;  3CI6 A;  2W1T A;  4O01 A;  1YKD A;  2M7V A;  5C5K A;  3E98 A;  4IUK A;  2GX5 A;  2Y79 A;  1MC0 A;  5DFY A;  3G6O A;  3W2Z A;  2HGV A;  3OOV A;  3R4K A;  1MKM A;  2QYB A;  4BWI A;  1TD5 A;  4R6L A;  3IBR A;  2VZW A;  3BJN A;  3LFV A;  2B18 A;  1YSQ A;  4YOF A;  4MDZ A;  3O5Y A;  4IUH A;  3S7Q A;  5DFX A;  5L8M A;  4Q0I A;  3S7O A;  3MF0 A;  4O8G A;  2XRN A;  1VHM A;  4ETZ A;  5AJG A;  2O9C A;  3D3O A;  4Q0J A;  5HSQ A;  4DMZ A;  4FOF A;  2O9A A;  2XSS A;  4RQ9 A;  4ME4 A;  2K2N A;  4GW9 A;  2W3H A;  5LBR A;  1TF1 A;  4EUV A;  4E04 A;  5K5B A;  3MMH A;  3S7P A;  5HL6 A;  4CQH A;  3KO6 A;  2Y8H A;  4GLQ A;  4G3K A;  2ZMF A;  4LRX C;  4Y2F A;  3TRC A;  4Y3I A;  4Z1W A;  4G3W A;  3S7N A;  5I5L A;  4G3V A;  2KOI A;  2M7U A;  3ZQ5 A;  3C2W A;  4DN0 A;  3E0Y A;  4YNR A;  4MCW A;  3VV4 A;  1STZ A;  3RFB A;  3IBJ A;  2W1R A;  4R70 A;  3DBA A;  3KSF A;  3CIT A;  3NOP C;  4Q0H A;  2O0Y A;  2W3G A;  4IJG A;  5HPI A;  2LB5 A;  3NHQ A;  3K2N A;  2W1T B;  2KLI A;  2VEA A;  4QPR A;  2XRO A;  4ZRR A;  1YSP A;  4MMN A;  4LRZ E;  2G7U A;  3NOU C;  3KSH A;  3OBF A;  4PAU A;  2O9B A;  2W3E A;  4LRY C;  2LB9 A;  3EEA A;  3MQ0 A;  2IA2 A;  1ZTU A;  4ETX A;  3HCY A;  2O99 A;  3KSI A;  5HPF A;  1F5M A;  3KSG A;  3NOT C;  4O0P A;  2W3D A;  4MN7 A;  4Y5F A;  4EU0 A;  2VKS A;  5TJJ A; 
#chains in the Genus database with same CATH topology
 5KZH A;  1FR1 A;  1IYS A;  1KDW A;  4KZ4 A;  1I5Q A;  5CEB A;  2EX2 A;  5DF9 A;  4P87 A;  1OJ5 A;  3OCL A;  1LL8 A;  1XKZ A;  1JNU A;  5FDH A;  4EV4 A;  3IBR A;  1ES4 A;  4HP9 A;  2WKH A;  3HLD A;  2J9P A;  2KDK A;  2XRN A;  3C7V A;  4EER A;  4XT2 A;  4RQ9 A;  1W8Y A;  2E8I A;  3V39 A;  4ZJ3 A;  1W63 M;  2A24 B;  4LCL A;  5TBM B;  1WA9 A;  1MBL A;  4R23 A;  4KZ5 A;  3RTY A;  5AQB A;  4YNR A;  5HWV A;  1KE4 A;  1RGZ A;  4HEF A;  3UE1 A;  1K54 C;  4WL9 A;  1ODV A;  4IBR A;  3B3X A;  3T4K A;  4EQI A;  2DNS A;  5EM1 A;  2HP9 A;  2ZL1 A;  2W1T B;  1BTL A;  2D01 A;  4OPY A;  4Z9Q A;  4UAA A;  4KZ7 A;  2Y59 A;  3RJU A;  4D60 A;  4DKI A;  5HWT A;  1PWC A;  1X0O A;  3G35 A;  4BQM A;  2W3E A;  1TS0 A;  4Y7P A;  5U47 A;  2VLG A;  4BBV A;  1O07 A;  3VOY A;  2BG1 A;  3LIE A;  5EFW A;  3IX3 A;  3NIA A;  2NUP C;  1S1Y A;  5TJJ A;  3UB6 A;  1SDN A;  2OOL A;  2A3U A;  4EQ1 A;  4JXS A;  1JVJ A;  5DJT A;  4CLC A;  2XD5 A;  2HGV A;  5F1G A;  4R4R A;  1TD5 A;  3R7W B;  3LFV A;  1T19 A;  3TE8 A;  4L9G A;  5FL3 A;  3K3C A;  2PR6 A;  4GS9 B;  2PT7 A;  3BLM A;  5J7E A;  5JYO A;  5L8M A;  5CER A;  1NJ4 A;  3FWL A;  2JBF A;  2V0W A;  5FDS A;  1GA9 A;  3SOI A;  5AJG A;  4XUZ A;  3C7U A;  2Y2I A;  3P09 A;  4OQI A;  2V20 A;  2Y2J A;  3W4P A;  4LGW A;  4B4Z A;  4WMC A;  3B42 A;  1TS6 A;  1GSX A;  1BLP A;  2JN7 A;  3NJA A;  4KZ3 A;  3C4O A;  3KO6 A;  4E3O A;  3IS2 B;  2OAQ 1;  4LLO B;  4E6X A;  3VE4 A;  3HUN A;  2YKH A;  5GLD A;  2E8J A;  3IBJ A;  4P6B A;  3G2Z A;  4ZBE A;  2I72 A;  5EE8 A;  1P9W A;  3M2J A;  4PM6 A;  3MZD A;  2OLV A;  1PW8 A;  3F1P A;  3IXH A;  4U3T A;  1KE3 A;  4OPR A;  4IHQ A;  1W79 A;  4KUK A;  3A0S A;  1VET A;  2LB9 A;  3QNB A;  1XJ4 A;  4GHI A;  5FI2 A;  1JTG A;  3IHA A;  3UPP A;  4UA7 A;  4S2L A;  2QJ7 A;  1DJA A;  2JE5 A;  3LR3 A;  1S6R A;  3PTE A;  3F1N A;  3T4T A;  2PYP A;  4LEN A;  3HVF A;  4P0M A;  1T1C A;  4MBH A;  4K08 A;  4KQR A;  1S66 L;  3IWO A;  3ZNY A;  4EEP A;  1K57 A;  4WYY A;  1SHV A;  4R6L A;  1K25 A;  5TR7 A;  2C6W B;  4FUW A;  3IH8 A;  5J4E A;  1L3L A;  3DTI A;  3PR6 A;  4GCZ A;  4HH3 A;  4C3Q A;  2DCF A;  4OP8 A;  2FFF B;  1T18 A;  4QU3 A;  2WAE A;  4H6J A;  2V2F F;  1QMF A;  4GJ4 A;  4HOI A;  2Y4A A;  1FQG A;  3OPL A;  5FI7 A;  4WF0 A;  2Z6D A;  3GEC A;  2XLN A;  5CGS A;  3HLB A;  2INW A;  3IX8 A;  3GR2 A;  4EXO A;  4UQI S;  3VSL A;  3VFH A;  3QNC A;  1V9Z A;  3B47 A;  2R9X A;  3BQ8 A;  3EQV A;  1K0K A;  3MR0 A;  4JGQ A;  2M1C A;  5GL9 A;  1W63 Q;  2DMW A;  3LYX A;  4OOM A;  3EEA A;  1K6R A;  4N1H A;  1KGG A;  4O7D A;  2PHY A;  1C3B A;  4BD0 A;  4GD8 A;  3WRT A;  4EU0 A;  4JGR A;  3TG9 A;  3TJZ C;  4JXW A;  4O01 A;  3PAE A;  2M7V A;  4NG2 A;  4S2K A;  3V50 A;  3G6O A;  3W2Z A;  4NXF A;  1SKO A;  5EOO A;  5FEG A;  3DWZ A;  4JPM A;  1G68 A;  4S2P A;  3NC8 A;  1BSG A;  5E2E A;  3V67 A;  3BYD A;  2WZX A;  5EM0 A;  4XUX A;  4PKY A;  2GZA A;  4MN6 A;  3U2A A;  1FCN A;  1HZO A;  4O8G A;  1VHM A;  2HZ5 A;  1F9I A;  2JKF A;  4ZTK A;  2ZL1 B;  4KZA A;  1XJ3 A;  1L0D A;  5FQJ A;  5HX9 A;  1M40 A;  4JGP A;  4E04 A;  4LFU A;  3ZVW A;  3IHB A;  3H7W A;  5HAP A;  3Q7Z A;  5GLA A;  3MKE A;  4PM7 A;  3ICY A;  3S4X A;  2OAP 1;  5EVI C;  2ZQA A;  5M1A A;  3I7J A;  1WYC A;  2G2W A;  3IT9 A;  1STZ A;  1QME A;  3WS5 A;  1HLU P;  3ITA A;  1SKF A;  4FTX A;  1NRF A;  3W8K A;  3DAV A;  3DTM A;  3MZF A;  5HDD A;  1JWV A;  3EOI A;  3UDF A;  4MMN A;  4CLC B;  1HVB A;  4Y0U A;  1V9Y A;  4X68 A;  1KGE A;  1MWS A;  4E3K A;  3F1O B;  4IVI A;  4ZDX A;  2ZMV A;  1KVL A;  1MWT A;  1ZTU A;  4UQI M;  1ERQ A;  2UV0 E;  4JF5 A;  3LUQ A;  1XFN A;  3LY4 A;  1F5M A;  3Q1F A;  3KSG A;  3IF6 A;  2WKI A;  4Y5F A;  4HI4 A;  1K55 C;  5F68 A;  2Y2O A;  5CED A;  2VA0 A;  3PAG A;  5DTK A;  3AGD A;  1BLH A;  4BL3 A;  2XK1 A;  1GHI A;  1CJF A;  4BEN A;  3UB5 P;  1ALQ A;  1OME A;  2Z2M B;  5FAS A;  4WEL A;  4WZ4 A;  1DP6 A;  1FSW A;  2ZD8 A;  4X55 A;  4DE3 A;  4HES A;  2H5S A;  2QKP A;  5CX7 A;  4S2N A;  3F1P B;  1KOU A;  1AXB A;  4E3N A;  5KMW A;  3E2K A;  1W7F A;  3LEZ A;  4KG6 A;  1DP9 A;  4KZB A;  1VET B;  1XP4 A;  2J9O A;  2QWS A;  3MKF A;  4U0X A;  5I5L A;  4GHI B;  1S1Z A;  4LV3 A;  3PHY A;  4QWO A;  4R70 A;  3N4I A;  3CIT A;  4S2I A;  2I9V A;  4HH2 A;  3F1N B;  1XGI A;  4UHU A;  2V1Z A;  3EWK A;  2Y2M A;  1XA1 A;  5EUA A;  4ARZ A;  2VGK A;  3AGE A;  2OLU A;  2JCH A;  4PMA A;  3UN7 A;  2J3T C;  2V9A A;  2YKF A;  4LRY C;  3ZGA B;  4A5R A;  5FI6 A;  3CMZ A;  5L07 A;  4ETX A;  4BD1 A;  3KSI A;  2HV1 A;  5DJU A;  3HLC A;  4OH0 A;  1Q2P A;  1J9M A;  1L0F A;  4UA6 A;  4OPQ A;  1S67 L;  1LLB A;  1IKG A;  3UMD A;  4IVK A;  4DRT A;  3MXQ A;  4QJG A;  1GHP A;  3MXR A;  1MY8 A;  2Y2G A;  3MJQ A;  3V3S A;  1T1A A;  4DF6 A;  3GV9 A;  2B18 A;  2HP6 A;  3UY6 A;  1CK3 A;  5GHZ A;  5CGX A;  5G4Y A;  2O9C A;  3D3O A;  4ESP A;  1U60 A;  5IS1 A;  1PI5 A;  3HJK A;  4M3K A;  1DP8 A;  5GLB A;  1TVF A;  2J8Y A;  3DTE A;  2L4R A;  3NEC A;  5HL6 A;  4GLQ A;  4G3K A;  4LV2 A;  4EWF A;  2X71 A;  4FSF A;  3LIC A;  4BMW A;  1N4O A;  3ZQ5 A;  4LPZ A;  4I3I A;  4DN0 A;  2G2U A;  2DRW A;  4EBP A;  1Z6F A;  3C38 A;  3DBA A;  1KDS A;  1Y4O A;  2PYR A;  3GTC A;  1IOU A;  2W27 A;  4CLC E;  4KEN B;  1ONH A;  4Y17 A;  2XA7 S;  5DVA A;  2ACG A;  3UB8 A;  1YSP A;  3KX0 X;  1H3Q A;  3OCN A;  4I3J A;  1SKO B;  3VSK A;  1TS8 A;  4HBT A;  4L9E A;  1IYO A;  1FOF A;  2O99 A;  3P7N A;  3HBR A;  2OWJ A;  5DKK A;  4R38 A;  5TGF A;  4C6Y A;  2WAF A;  2V1A A;  4MBF A;  4PPR A;  4L0L A;  3UDI A;  5EVI D;  2CC1 A;  3NI9 A;  3MQO A;  1N9L A;  1LI9 A;  3H7W B;  3M2K A;  3PBQ A;  3WS2 A;  3P01 A;  2EWW A;  4OOY A;  2ZQ9 A;  5E2G A;  1YLY A;  3CZD A;  5KIZ A;  1NLZ A;  3FYZ A;  2PD7 A;  4N9K A;  4QY6 A;  5DFX A;  2IWB A;  3LIF A;  4DE0 A;  1D7E A;  3ZYT A;  4NEE D;  1NRJ A;  3PXP A;  2XGN A;  3LGO A;  1VM1 A;  5HWW A;  3LI9 A;  5HFO A;  2EX8 A;  4RX3 A;  2WKR A;  4P85 A;  4CQH A;  3IXB A;  1K56 A;  3S7N A;  3T1Q B;  2Y2H A;  1PW1 A;  3U4L P;  3RH8 B;  5FAT A;  3HL9 A;  1I2W A;  1K4E A;  4KZ9 A;  4OQ0 A;  4FH2 A;  4HNB A;  3FZC A;  5HAI A;  1N9O A;  5E2F A;  3IF6 B;  2HDR A;  5HPI A;  1O7E A;  1ES3 A;  3NHQ A;  4P6Z S;  2HDU A;  1D06 A;  3UDX A;  4FCF A;  3UPO A;  1NZO A;  4HJ3 A;  4WBG A;  4ZRR A;  4NXG A;  4DE2 A;  4JXV A;  2K7S A;  4CPK A;  4F3L A;  2ZQ8 A;  1Y28 A;  1K54 A;  2WKE A;  2WKP A;  5EVE A;  4BJP A;  4KZ8 A;  4MN7 A;  1BYW A;  2P04 A;  4GNU A;  1LSX A;  4WLA A;  4HJ6 A;  1OTE A;  1OTD A;  5BOH A;  3OPP A;  4EBL A;  2Y79 A;  2W0N A;  1FCM A;  4D2O A;  2R9W A;  2QYB A;  4R0Q A;  1JWZ A;  1YSQ A;  4YOF A;  3EQU A;  3ZG8 B;  3OPR A;  4Q0I A;  2Q9M A;  2ZC5 B;  3BFG A;  3JVU A;  2Z2L B;  1XJ2 A;  3MXS A;  4WEK A;  1OPX A;  1XA7 A;  3S22 A;  2J3T D;  2OWH A;  1YLZ A;  1VB6 A;  3SS3 A;  4ARZ B;  1HTZ A;  4G3W A;  3G4P A;  1K6S A;  1H5X A;  5AVF A;  1I2S A;  4MCW A;  2VV7 A;  3N8L A;  1Z09 A;  1G5U A;  1CI9 A;  3QP6 A;  3T12 B;  3GSG A;  2JKG A;  3LEQ A;  1BUL A;  5CRF A;  3ZNT A;  3TW8 A;  1L0G A;  1IYP A;  2VX8 A;  5J3W A;  5FQQ A;  1NLY A;  4E3I A;  3CJM A;  4KUO A;  3H82 A;  4WEJ A;  3KSH A;  4PAU A;  2O9B A;  3IF5 A;  4WM9 A;  4P6Z M;  1LT0 A;  5HDC A;  1DJC A;  3JVV A;  3Q7V A;  3CLO A;  1FR6 A;  3JYI A;  1LL5 A;  1XGJ A;  3SH7 A;  3A0V A;  3VP0 A;  1MKI A;  3PBN A;  1YLW A;  4OP5 A;  1K56 D;  5C5K A;  4IUK A;  3ZFZ A;  1WYB A;  1N9B A;  4JBF A;  5FEF A;  3PBS A;  4BL2 A;  2VV8 A;  4S2J A;  1JTD A;  4XT2 B;  4S2O A;  3DW0 A;  3MF0 A;  5FSR A;  1GHM A;  5DTT A;  1LSV A;  4YFM A;  1ZHH B;  4X6T A;  1PI4 A;  2O9A A;  3Q07 A;  4GDB A;  1F98 A;  3TOI A;  4DXC A;  3CUE C;  1RP5 A;  3T4L A;  4OON A;  3IF6 C;  3OLO A;  3C30 A;  5A8B A;  1VEU A;  4I5S A;  3ITB A;  4WZ5 C;  2PU2 A;  3E0Y A;  3VV4 A;  3HLE A;  2HP5 A;  4ZAM A;  3UE0 A;  1HD8 A;  3UE6 A;  1SDE A;  1BLC A;  2XF3 A;  3BEB A;  2PBD P;  3ZVT A;  2KX6 A;  4DJ3 A;  3HLG A;  3D9Y A;  5G4Z A;  1MWU A;  3UE3 A;  1OT9 A;  5L2F A;  1ES5 A;  4LCM A;  4MN5 A;  3NDE A;  4QY5 A;  2QJ5 A;  3E4O A;  3MFX A;  2VKS A;  4KZ6 A;  4B9O A;  4GZB A;  1KGF A;  1UGU A;  2IWC A;  2MJ6 A;  1ZG4 A;  1XPB A;  1A0K A;  1RCJ A;  2XH9 A;  3FKW A;  2A2L A;  4XXR A;  5HDS A;  4IUH A;  2ZM0 A;  3KYE A;  3ULF A;  2VGL S;  4K0X A;  1NZU A;  1K4F A;  3GQZ A;  3HUO A;  3O3V A;  4NXE A;  2EA9 A;  4OQH A;  5JYP A;  2R78 A;  1YPR A;  4NET A;  1TF1 A;  4EW7 A;  4UEY A;  4LV0 A;  2EWV A;  2RCX A;  4LRX C;  1IFQ A;  4R1G A;  4F3L B;  2ZQC A;  4HP4 A;  5MC7 A;  3LI8 A;  2PRF A;  3BY8 A;  3RFB A;  2JC7 A;  2Y2P A;  1H0M A;  2JKR I;  3FPV A;  3C5A A;  3A3E A;  2KLI A;  4PHT A;  1WE4 A;  3ZHH A;  5M19 A;  4NK3 A;  5EVI A;  1CI8 A;  2JKR M;  4HY8 A;  4PM5 A;  1H8M A;  4LRZ E;  3QP5 A;  2ZQ7 A;  4ID4 A;  3NOU C;  4OQG A;  5L10 A;  3JPU A;  2PR5 A;  4OLD A;  3M6B A;  3GVB A;  2XR0 A;  1FCO A;  5IHV A;  4EET B;  2H10 A;  3G34 A;  1OTI A;  5F69 A;  5GLC A;  4DMZ A;  3OC2 A;  1PWG A;  1TDG A;  4RYE A;  4E3M A;  1YKD A;  3E98 A;  1P97 A;  1RGY A;  1ES2 A;  1H8Y A;  1ONG A;  3LIA A;  1ZC2 A;  1MKM A;  3A3I A;  4RA7 A;  4II7 A;  2C5W B;  3B33 A;  2VK3 A;  2P7J A;  1J3W A;  2UWX A;  3EGX C;  1W5D A;  1K55 A;  1OJG A;  2ZOH A;  3T4S A;  3O86 A;  1EW0 A;  2PU4 A;  3M6H A;  2B5R A;  4ME4 A;  4GW9 A;  3SZT A;  3O87 A;  4H6J B;  2H0T A;  2QPN A;  3A3J A;  2EFU A;  3S7P A;  5DTS A;  3VP1 A;  3SH9 A;  3H82 B;  2B95 A;  3PBR A;  2VGL M;  4X25 A;  4R3A A;  3D4F A;  4G3V A;  4C75 A;  4HQA A;  1GA0 A;  3VOZ A;  3RXW A;  4K91 A;  1L2S A;  3FC7 A;  4MLL A;  5CTM A;  1NYM A;  3Q7V B;  2EXB A;  2O0Y A;  5HAR A;  5FQI A;  1YMS A;  3BWL A;  3K3D A;  3Q82 A;  5F83 A;  5FQ9 A;  3LR4 A;  3T4Q A;  1YLT A;  1OTB A;  4WN5 A;  3MZE A;  3LCE A;  5EEC A;  4N9L A;  5CTN A;  4IED A;  3P98 A;  5KSH A;  5A93 A;  1MXO A;  4KG5 A;  1IEM A;  3BEC A;  2HPB A;  3HLF A;  4F94 A;  2J80 A;  3AGF A;  4CLC C;  5HW3 A;  3MQ0 A;  5E2H A;  1S0W A;  2WGV A;  3VE3 A;  2L0W A;  5IU1 A;  2XQZ A;  4JKT A;  4N92 A;  5A92 A;  3HUM A;  1NWZ A;  3G31 A;  4QB8 A;  3FG8 A;  3IXD A;  1UWN X;  2V8C A;  3GRJ A;  3CI6 A;  5FQK A;  1CQA A;  4E6W A;  1BUE A;  3L7H A;  3R4K A;  3W4Q A;  1VEU B;  1XX2 A;  3BJN A;  4NKP A;  3O5Y A;  2EFX A;  1YLJ A;  2NUT C;  2Q0O A;  4GN2 A;  2Y55 A;  2P9V A;  1GSV A;  1YT4 A;  4EBN A;  3NUL A;  3T1R A;  3A0R A;  2XSS A;  5CXW A;  5HL1 A;  4QHC A;  2X01 A;  2Y91 A;  4E3J A;  5K5B A;  5GHX A;  3T4O A;  1FSY A;  2P08 A;  3EEH A;  1LSW A;  4KQO A;  4GKU A;  4Y2F A;  4OOL A;  3N8S A;  5D3O A;  2WKQ A;  3ISG A;  2ZBB A;  3WS0 A;  3T1X A;  4ZJ2 A;  2PAV P;  5EPH A;  4GOG A;  3N6I A;  2PDR A;  5G18 A;  3NOP C;  3BFD A;  3UB7 A;  4YIN A;  5J8X A;  1OT6 A;  3UO9 A;  1ERO A;  2XRO A;  3LIB A;  1W8Q A;  1G6A A;  3E4Q A;  5TFQ A;  5M18 A;  3DTK A;  3UB9 A;  3WWX A;  3HJI A;  4B93 A;  1EI5 A;  1NY0 A;  2B02 A;  3BM6 A;  3OBF A;  2XFT A;  2EXA A;  2VGJ A;  1IKI A;  1K57 C;  4JF6 A;  5FA7 A;  4MEZ A;  3MBZ A;  1S4R A;  3F1O A;  3ZG7 B;  3UME A;  3C8C A;  2W3D A;  3V3R A;  2CMN A;  2VJW A;  2QMI A;  4U0T A;  1MC0 A;  4X1L A;  4OPZ A;  2BAS A;  1PZO A;  2WYX A;  4OLG A;  3NDG A;  1TS7 A;  1YLP A;  4M4X A;  2J7V A;  2ZC7 A;  3BQA A;  1KVM A;  2A49 A;  5IT5 A;  2XA7 M;  4MDZ A;  2HDS A;  3S7Q A;  1F2K A;  2V8F A;  4B88 A;  3IXG A;  3Q81 A;  5AVE A;  2HJE A;  5HSQ A;  1LI0 A;  3FKV A;  1ERM A;  2K2N A;  3IH9 A;  3VFF A;  4DDS A;  2Y2Q A;  1LL9 A;  4EUV A;  1AWI A;  5EVI B;  3MMH A;  3QP8 A;  1SCW A;  3ZG5 A;  2Y8H A;  1YQS A;  2ZMF A;  5DKL A;  5HZH A;  1E4D A;  1XFQ A;  2KOI A;  3IWQ A;  1YAX A;  3LO7 A;  1T1B A;  2GJ3 A;  1H8Z A;  1MWR A;  4LV1 A;  3KSF A;  3UNW A;  3ZDJ A;  3D72 A;  1FIL A;  2WGW A;  2WUQ A;  3CAX A;  3K2N A;  3KYZ A;  4GB7 A;  5E43 A;  2WAD A;  2Z6C A;  2H0Y A;  1DRM A;  3OPH A;  2IA2 A;  2V1B A;  1TEM A;  2XDM A;  4RX2 A;  3MQQ A;  4GDN A;  2L1M A;  1SZV A;  1PIO A;  5F1F A;  2XFS A;  3IX4 A;  4JF4 A;  3CG5 A;  2GX5 A;  5CEC A;  2WK0 A;  1P0Z A;  3VP2 A;  1DY6 A;  1DJB A;  4OVD A;  4S2M A;  5FAO A;  3MS6 A;  3PBO A;  4I38 A;  4FD8 A;  3HRE A;  3KYQ A;  1KE0 A;  2D02 A;  3A3D A;  1NXY A;  5A90 A;  1LHY A;  2OSU A;  3CPT A;  2XEP A;  1CEG A;  1ZKJ A;  1BZA A;  2ZJ9 A;  2WGI A;  3V5M A;  3T4J A;  3VP4 A;  3CWF A;  3PBT A;  5LBR A;  4DE1 A;  4E3L A;  4CLC D;  4KG2 A;  3TRC A;  2FH5 A;  3LR0 A;  4Y3I A;  2ZQD A;  1G28 A;  1CEF A;  1P9R A;  1GCE A;  2ZM8 A;  3T1S A;  4R3J A;  1E3U A;  2Y2K A;  4R3B A;  4Y13 A;  1EWZ A;  2W3G A;  4IJG A;  3BW6 A;  3FPW A;  4WMC D;  1TDL A;  1IEL A;  4PM9 A;  3A3F A;  2VEA A;  2A24 A;  2BTF P;  5TBM A;  2PD8 A;  2RL3 A;  3IWI A;  1N9N A;  2PBY A;  4Y15 A;  2BLS A;  2EX6 A;  5DF8 A;  4YWZ A;  2AVX A;  2ZLY A;  2X02 A;  3GMW A;  3PYP A;  3HCY A;  5F5Y A;  2P9V B;  2FFY A;  4EES A;  4PKY G;  4K0W A;  5HPF A;  4Y0T A;  3S1Y A;  3OZH A;  3L9K A;  4KQD A;  4JGO A;  5AQ7 A;  2QHK A;  2W3F A;  2W1T A;  2ZC6 B;  2HJ9 C;  5CHM A;  5EOE A;  4S2N C;  2HDQ A;  4HJ4 A;  4BWI A;  3BLS A;  4MBK A;  1IYQ A;  4ZJ1 A;  3ZCZ A;  4X53 A;  4PM8 A;  1ESU A;  3S7O A;  2ZOI A;  2EX9 A;  3ZG0 A;  3H9W A;  4B4X A;  2J3W A;  3CHW P;  4FOF A;  4JXG A;  3E2L A;  4NXB A;  3SS5 A;  4EUZ A;  2GNX A;  2W3H A;  4MNR A;  4HHD A;  3HLW A;  1YM1 A;  3NY4 A;  3G32 A;  4DJ2 A;  2HF6 A;  1PFL A;  3BY9 A;  1S4S A;  3WRZ A;  3BFF A;  1Y54 A;  3QP1 A;  2P74 A;  4N1X A;  4X1M A;  4BBU A;  3DWK A;  4WUJ A;  2M7U A;  1YMX A;  3R7W A;  2Y2N A;  1XJ6 A;  1PZP A;  5F82 A;  2ZMA A;  1PYY A;  5A91 A;  3E4P A;  4GS9 A;  1ZG6 A;  3MFD A;  2W1R A;  3G30 A;  5HAQ A;  5GHY A;  1G6O A;  4KQQ A;  4HBU A;  3CUE A;  2LB5 A;  5KSC A;  4X56 A;  4QPR A;  4Y0O A;  2FZ0 A;  5AQ9 A;  4WZ5 A;  2G7U A;  4HIA A;  3IS2 A;  4R4S A;  5FQM A;  3ZG9 B;  2V0U A;  1D1J A;  2JHE A;  3SW1 A;  2H28 A;  4X69 A;  1CF0 A;  2VV6 A;  3UPN A;  4I39 A;  3W4O A;  1ACF A;  4I3A A;  4Q8I A;  2K31 A;  4FH4 A;  4DXB A;  2JKT I;  1NYY A;  3WS1 A;  3FV7 A;  4GD6 A;  4RVA A;  5DFY A;  2ZC4 B;  5HD3 A;  3OOV A;  2JKT M;  3BFC A;  3VP3 A;  1BLS A;  1PNE A;  3G2Y A;  1E3U D;  2VZW A;  5AQA A;  1ESI A;  5EV0 A;  4ETZ A;  3QP4 A;  4AFI A;  5I94 A;  4Q0J A;  3BRM A;  5DF7 A;  2WGW B;  3GDI A;  1MZU A;  3EGD C;  3MSH A;  1E25 A;  1Q2Q A;  4IBX A;  5CGW A;  1JWP A;  1OTA A;  3SH8 A;  4JLF A;  4QD4 A;  2IWD A;  2QZ6 A;  2GDN A;  4EEU A;  5CHJ A;  4BBT A;  4Z1W A;  3N7W A;  4L9F A;  2XD1 A;  1VQQ A;  3C2W A;  1FIK A;  5HD5 A;  3O88 A;  3VOL A;  4BLM A;  4Q0H A;  3LY3 A;  5EVL A;  3WS4 A;  4H8R A;  3IQA A;  4DDY A;  5FAP A;  4CJN A;  1XXM A;  2ZC3 B;  1BT5 A;  3LR5 A;  1MPL A;  4UA9 A;  2ZM2 A;  5F6A A;  3QHY A;  1PWD A;  1PRQ A;  5L09 A;  3TSG A;  3VMA A;  4OKP A;  3T50 A;  1M6K A;  3BFE A;  1UWP X;  3LID A;  3C4P A;  3RXX A;  2OV5 A;  2WZZ A;  2Q9N A;  3QP2 A;  3NBL A;  3SS4 A;  1L0E A;  3CPT B;  1K38 A;  3NOT C;  4O0P A;  3N8R A;  5CHU A;  1GSW A;  3NCK A;  2Y2L A;  5FAQ A; 
#chains in the Genus database with same CATH homology
 2VJW A;  5C5K A;  5F68 A;  4IUK A;  1MC0 A;  2VA0 A;  5DF9 A;  2BAS A;  1OJ5 A;  3OCL A;  1LL8 A;  1TS7 A;  4M4X A;  1JNU A;  3BQA A;  3PBS A;  3IBR A;  2VV8 A;  5IT5 A;  2XA7 M;  4MDZ A;  4HP9 A;  4WEL A;  4XT2 B;  3S7Q A;  3MF0 A;  1DP6 A;  2KDK A;  2XRN A;  1LSV A;  4EER A;  5AVE A;  2HJE A;  1ZHH B;  5HSQ A;  4XT2 A;  2QKP A;  2O9A A;  5CX7 A;  4RQ9 A;  2K2N A;  3F1P B;  1KOU A;  1W63 M;  4EUV A;  1F98 A;  2A24 B;  3MMH A;  3CUE C;  5TBM B;  3T4L A;  2Y8H A;  1WA9 A;  2ZMF A;  5DKL A;  5HZH A;  1DP9 A;  1XFQ A;  3OLO A;  3C30 A;  5A8B A;  2QWS A;  5I5L A;  3RTY A;  2KOI A;  4I5S A;  4GHI B;  1YAX A;  1S1Z A;  1T1B A;  3E0Y A;  2GJ3 A;  4YNR A;  3VV4 A;  5HWV A;  4WL9 A;  1ODV A;  3PHY A;  4R70 A;  3KSF A;  3CIT A;  3D72 A;  3T4K A;  2I9V A;  4HH2 A;  3F1N B;  3CAX A;  3K2N A;  2W1T B;  3EWK A;  3KYZ A;  2D01 A;  3UE6 A;  4ARZ A;  2Z6C A;  5HWT A;  1X0O A;  2J3T C;  1DRM A;  2KX6 A;  2V9A A;  4DJ3 A;  2YKF A;  2W3E A;  1TS0 A;  4LRY C;  2VLG A;  4BBV A;  2IA2 A;  5G4Z A;  4ETX A;  3KSI A;  2V1B A;  3UE3 A;  1OT9 A;  2HV1 A;  5DJU A;  4MN5 A;  3LIE A;  5EFW A;  1S67 L;  3MQQ A;  2QJ5 A;  2NUP C;  3E4O A;  2L1M A;  1S1Y A;  3MFX A;  2VKS A;  5TJJ A;  3UB6 A;  3UMD A;  2OOL A;  3MXQ A;  4B9O A;  4EQ1 A;  5DJT A;  2GX5 A;  4CLC A;  1UGU A;  1P0Z A;  2MJ6 A;  2HGV A;  3MJQ A;  1TD5 A;  1T1A A;  3PBO A;  3R7W B;  2A2L A;  4I38 A;  3LFV A;  2B18 A;  1T19 A;  5HDS A;  3TE8 A;  4L9G A;  5FL3 A;  4IUH A;  3K3C A;  3ULF A;  2PR6 A;  2PT7 A;  4GS9 B;  3KYQ A;  2VGL S;  5J7E A;  5L8M A;  5G4Y A;  2D02 A;  2V0W A;  5AJG A;  2O9C A;  3D3O A;  4NXE A;  2EA9 A;  5IS1 A;  2R78 A;  3HJK A;  1DP8 A;  3T4J A;  3B42 A;  3CWF A;  1TS6 A;  3PBT A;  1TF1 A;  5LBR A;  2L4R A;  1GSX A;  2JN7 A;  4EW7 A;  4UEY A;  4CLC D;  3NJA A;  5HL6 A;  2EWV A;  3KO6 A;  4GLQ A;  4G3K A;  4LRX C;  1IFQ A;  3TRC A;  2FH5 A;  3LR0 A;  4Y3I A;  4F3L B;  3IS2 B;  4FSF A;  2OAQ 1;  1G28 A;  4LLO B;  3LIC A;  4BMW A;  4HP4 A;  1P9R A;  3ZQ5 A;  3VE4 A;  4LPZ A;  4I3I A;  4DN0 A;  2YKH A;  5MC7 A;  3LI8 A;  3BY8 A;  3RFB A;  3C38 A;  3IBJ A;  3DBA A;  2PYR A;  1P9W A;  2W3G A;  4IJG A;  2W27 A;  1IOU A;  2JKR I;  4CLC E;  3BW6 A;  3FPW A;  3FPV A;  2XA7 S;  3F1P A;  2KLI A;  4PHT A;  2VEA A;  2A24 A;  3UB8 A;  1YSP A;  2JKR M;  4HY8 A;  5TBM A;  2PD8 A;  3KX0 X;  1H3Q A;  3OCN A;  1H8M A;  4LRZ E;  4IHQ A;  4I3J A;  1N9N A;  3NOU C;  4KUK A;  1TS8 A;  3A0S A;  4L9E A;  4YWZ A;  2LB9 A;  1XJ4 A;  4GHI A;  2PR5 A;  3PYP A;  3HCY A;  2O99 A;  5F5Y A;  3P7N A;  2OWJ A;  2QJ7 A;  4EES A;  5DKK A;  4PKY G;  4R38 A;  5HPF A;  4EET B;  3LR3 A;  4KQD A;  4JGO A;  1OTI A;  3F1N A;  2QHK A;  3T4T A;  5F69 A;  2PYP A;  4DMZ A;  2V1A A;  4L0L A;  2W3F A;  3OC2 A;  1T1C A;  2W1T A;  1YKD A;  4Y5F A;  3E98 A;  4K08 A;  3MQO A;  1P97 A;  1N9L A;  2HJ9 C;  3H7W B;  1S66 L;  3PBQ A;  4EEP A;  3P01 A;  2EWW A;  3LIA A;  1MKM A;  4HJ4 A;  4BWI A;  4II7 A;  4R6L A;  3B33 A;  5KIZ A;  1NLZ A;  2P7J A;  2PD7 A;  5DFX A;  3EGX C;  3S7O A;  5J4E A;  2ZOI A;  1OJG A;  2ZOH A;  3H9W A;  3LIF A;  3T4S A;  2J3W A;  1D7E A;  1EW0 A;  3PR6 A;  3ZYT A;  4FOF A;  4NEE D;  4GCZ A;  1NRJ A;  4HH3 A;  3PXP A;  4ME4 A;  4NXB A;  4GW9 A;  5HWW A;  2GNX A;  2W3H A;  3LI9 A;  4HHD A;  4H6J B;  4DJ2 A;  3S7P A;  2WKR A;  2HF6 A;  4CQH A;  3BY9 A;  1S4S A;  1T18 A;  3H82 B;  4H6J A;  3PBR A;  2VGL M;  4R3A A;  3S7N A;  4BBU A;  4WUJ A;  4G3V A;  2M7U A;  3R7W A;  3RH8 B;  1XJ6 A;  4HQA A;  4GJ4 A;  4HOI A;  4WF0 A;  3E4P A;  4GS9 A;  4HNB A;  3FC7 A;  2W1R A;  2Z6D A;  1N9O A;  3GEC A;  2INW A;  2O0Y A;  1G6O A;  4EXO A;  5HPI A;  3CUE A;  4UQI S;  2LB5 A;  1V9Z A;  3NHQ A;  3BWL A;  3K3D A;  3B47 A;  4P6Z S;  1D06 A;  3LR4 A;  3BQ8 A;  3T4Q A;  3EQV A;  4WN5 A;  1OTB A;  4QPR A;  4HJ3 A;  4ZRR A;  2FZ0 A;  3MR0 A;  4NXG A;  5KSH A;  4JGQ A;  2K7S A;  2G7U A;  2M1C A;  4HIA A;  4F3L A;  3IS2 A;  1W63 Q;  1Y28 A;  2DMW A;  2J80 A;  3LYX A;  4OOM A;  3EEA A;  4CLC C;  3MQ0 A;  3VE3 A;  2PHY A;  2L0W A;  5IU1 A;  2V0U A;  3SW1 A;  2JHE A;  2H28 A;  2WKP A;  1NWZ A;  2VV6 A;  4BJP A;  3FG8 A;  4I39 A;  4MN7 A;  1BYW A;  2P04 A;  1UWN X;  1LSX A;  4JGR A;  4EU0 A;  3TJZ C;  4WLA A;  4HJ6 A;  4I3A A;  1OTE A;  2K31 A;  1OTD A;  3CI6 A;  4O01 A;  2M7V A;  2JKT I;  5DFY A;  2Y79 A;  2W0N A;  3G6O A;  3W2Z A;  4NXF A;  5HD3 A;  3OOV A;  3R4K A;  2QYB A;  2JKT M;  2VZW A;  3BJN A;  4NKP A;  1YSQ A;  4YOF A;  3V67 A;  3O5Y A;  3EQU A;  2NUT C;  4Q0I A;  4PKY A;  1GSV A;  2GZA A;  4MN6 A;  3U2A A;  4O8G A;  4ETZ A;  1VHM A;  3JVU A;  4AFI A;  4Q0J A;  3A0R A;  1XJ2 A;  1F9I A;  3GDI A;  1MZU A;  3EGD C;  4WEK A;  2XSS A;  1OPX A;  1OTA A;  1XJ3 A;  2J3T D;  2OWH A;  4JGP A;  4E04 A;  5K5B A;  1VB6 A;  3T4O A;  2P08 A;  4ARZ B;  3EEH A;  1LSW A;  3H7W A;  4KQO A;  4Y2F A;  4OOL A;  4EEU A;  4BBT A;  4Z1W A;  4G3W A;  2WKQ A;  3ICY A;  4L9F A;  2OAP 1;  2ZBB A;  3C2W A;  5AVF A;  4MCW A;  2VV7 A;  5HD5 A;  1STZ A;  2PDR A;  3VOL A;  3NOP C;  4Q0H A;  3UB7 A;  3LR5 A;  1OT6 A;  5F6A A;  5HDD A;  3TW8 A;  2XRO A;  2VX8 A;  3LIB A;  3EOI A;  3E4Q A;  5J3W A;  3T50 A;  4MMN A;  1NLY A;  3UB9 A;  4CLC B;  4KUO A;  1V9Y A;  3HJI A;  4B93 A;  3H82 A;  1UWP X;  2B02 A;  3KSH A;  3LID A;  4WEJ A;  3OBF A;  4PAU A;  2O9B A;  3F1O B;  2ZMV A;  1ZTU A;  4UQI M;  1S4R A;  3F1O A;  4P6Z M;  1LT0 A;  3UME A;  3LUQ A;  5HDC A;  3JVV A;  1XFN A;  1F5M A;  3KSG A;  3CLO A;  3NOT C;  4O0P A;  3C8C A;  2W3D A;  3A0V A;  1GSW A;  4HI4 A;  2CMN A;  3PBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...