4XT2B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2B01
4EW7A 3MJQA 4JGOA 2M1CA 3SW1A 1V9ZA 4I3IA 1X0OA 2QKPA 4B9OA 4LRXC 3VE4A 3H7WA 1DP9A 4LRZE 3F1PB 3ICYA 4K08A 2D01A 2YKFA 4EQ1A 2EA9A 3A0RA 4JGPA 4L9GA 2Z6DA 1S1ZA 3NOUC 2ZBBA 4GCZA 5HWVA 1T19A 3IS2B 4R6LA 1EW0A 2P7JA 3F1OB 4NXGA 4EXOA 4I39A 4HJ3A 4LPZA 4HNBA 3RH8B 2YKHA 3UB9A 5I5LA 2PDRA 3K3DA 3LICA 4GW9A 1S4RA 5IS1A 3H7WB 5DKLA 1DP8A 1F98A 3D72A 4KUKA 1D7EA 2K7SA 4LRYC 3G6OA 5TBMB 2Z6CA 4YWZA 4R3AA 1OT9A 5HWWA 4HP4A 5HD5A 4HH2A 3T50A 2A24A 3K3CA 3RTYA 4HY8A 2VV6A 3LUQA 5IU1A 1S66L 1GSXA 4XT2A 4EESA 4WN5A 4JGQA 3A0VA 3LI9A 5AVFA 1OJGA 2INWA 5EFWA 1T1CA 5HDDA 3HJIA 1XFNA 2VV8A 3LIBA 2BASA 1LSWA 3FC7A 3H82A 2OOLA 3VOLA 1LT0A 1ODVA 2J80A 2A24B 4E04A 2CMNA 4HOIA 3CLOA 1F9IA 3H9WA 4DJ3A 2JHEA 1S1YA 5AVEA 3GDIA 4XT2B 3UB6A 4DJ2A 3F1NB 2PD8A 1P97A 3CWFA 4I5SA 3NHQA 5J7EA 1VB6A 3FG8A 2GJ3A 3OLOA 1UWPX 2PD7A 4H6JA 3E4QA 2ZOHA 5G4ZA 3H82B 5F6AA 2VLGA 4WUJA 1LL8A 4I3AA 1WA9A 3E4PA 1T1AA 4NXEA 3UMDA 2V9AA 3MXQA 2QJ5A 2JN7A 4HJ4A 4GS9A 5DKKA 2ZOIA 3IBRA 2VV7A 4BBUA 1XJ2A 2PYRA 3C8CA 1LSXA 4GHIA 5HDCA 2VEAA 2B02A 4WF0A 1DRMA 4R38A 3B33A 1Y28A 4HH3A 1UGUA 3PHYA 3BY9A 1T18A 1DP6A 4HJ6A 4WL9A 2W0NA 3MR0A 3NOTC 4F3LA 3UB8A 3A0SA 4NXFA 2KX6A 3NJAA 2L0WA 1TS6A 4HI4A 3HJKA 2R78A 3LI8A 2V1AA 2PYPA 2WKPA 4EETB 4HIAA 4KUOA 1UWNX 1JNUA 2D02A 3UE6A 4M4XA 2W27A 4GHIB 1XJ3A 2I9VA 5HD3A 3NOPC 5KIZA 4EEPA 3E4OA 1GSVA 4HQAA 1N9NA 4MN6A 2H28A 3UB7A 1TS0A 1NWZA 3F1OA 3GECA 2PR5A 4HP9A 4KQDA 3LIDA 1BYWA 2KDKA 4L9EA 1TS7A 1OT6A 4RQ9A 4EEUA 1S4SA 4BBVA 3LIAA 1OJ5A 3ZQ5A 4I3JA 2PR6A 5G4YA 1P0ZA 5TBMA 4PKYG 4MN5A 4I38A 1XJ6A 2WKQA 5F5YA 4NXBA 1GSWA 2QWSA 3C2WA 3VE3A 1OTDA 2OWJA 1XJ4A 3LIFA 3UMEA 2PHYA 3LIEA 1LSVA 4H6JB 1KOUA 3EWKA 2HV1A 3ULFA 2V0UA 2L1MA 4R70A 2QHKA 5HSQA 5F68A 3CAXA 1V9YA 5DJUA 5HDSA 3MFXA 2WKRA 3MQQA 3MQOA 5J3WA 4JGRA 2V1BA 1G28A 4GS9B 4BBTA 1T1BA 5J4EA 1OTBA 4PKYA 3KX0X 3P7NA 2V0WA 4WLAA 1N9LA 5HZHA 4LLOB 5DJTA 1OTIA 3BWLA 5A8BA 2QJ7A 1OTAA 1N9OA 4HHDA 3F1NA 3F1PA 5F69A 1S67L 3EEHA 4F3LB 1OTEA 3BY8A 3PYPA 1D06A 1MZUA 5HWTA 3LYXA 4EERA 2L4RA 3IS2A 2OWHA 4L9FA 1XFQA 1TS8A
chains in the Genus database with same CATH superfamily
4OPRA 4C6YA 3FV7A 2CC1A 4KENB 4X69A 3G2YA 2WZZA 2J3TC 4B9OA 1KDWA 1HTZA 1KGFA 3HL9A 2QPNA 1XP4A 3KSHA 1KDSA 4GZBA 4DE3A 3R4KA 1TDLA 2V20A 1P9RA 4WZ4A 5TFQA 1Q2QA 3OPRA 2Z6DA 3W8KA 1QMEA 5M1AA 3UY6A 5CTMA 1O7EA 1TF1A 1TVFA 3ZCZA 5F1FA 1T19A 3IX4A 4R23A 3JYIA 2XD5A 5EOOA 1TEMA 1J3WA 3VMAA 3BLMA 3WWXA 3KSFA 1L0DA 1ONGA 2BG1A 4QB8A 5CERA 3OZHA 3MF0A 3LICA 4GW9A 5K5BA 3WRTA 2A49A 4O01A 2GX5A 2W3DA 3G2ZA 5KSCA 4XUXA 5EE8A 4LRYC 4R1GA 2Z6CA 2OSUA 5GHYA 4X6TA 4Y7PA 2J9OA 1YLPA 1MPLA 5L09A 2ZM8A 3RFBA 5E2EA 5EM0A 2P9VA 3B3XA 3TE8A 3NDEA 4HH2A 4KZ5A 3T50A 3KYEA 2JC7A 3PAGA 1CEGA 5GHXA 4JLFA 3MZDA 5IU1A 5FI7A 4UHUA 4JGQA 1AWIA 3LI9A 2ZQ8A 2ZQAA 4Y0TA 2J9PA 3GVBA 4CQHA 5HDDA 2PAVP 1LI9A 2XRNA 3HLFA 1XXMA 3D3OA 1GHIA 1MWRA 3T1SA 4P0MA 3UPPA 5E2GA 2W3GA 5DF7A 3T4OA 3HUMA 4HOIA 3P01A 4KG5A 4ESPA 2JHEA 1S1YA 3UB6A 3F1NB 1ZC2A 5C5KA 4I5SA 3E98A 4JXGA 4YFMA 4OQHA 4Y3IA 1VB6A 1N4OA 1MWTA 2GJ3A 1UWPX 2Z2LB 4H6JA 5FDHA 4D60A 1MXOA 3H82B 3HUNA 4CLCB 1LL8A 3IBJA 2Q0OA 4KG2A 1WA9A 2BLSA 3MXQA 3PBOA 4WYYA 4C3QA 3Q82A 3VOZA 4DMZA 1PNEA 1BT5A 3V3SA 4Z1WA 3A3JA 1HD8A 4F94A 1K56D 1IYSA 3HBRA 4S2JA 4BBUA 1XJ2A 3RJUA 1KE0A 3C7UA 4QHCA 4UQIM 3QP2A 5HDCA 5A91A 1DRMA 2HP5A 4IBRA 4LV2A 2J8YA 1NXYA 3PHYA 3BEBA 5JYPA 3IX3A 3C5AA 4O8GA 4WL9A 2DMWA 2QMIA 1MKMA 3NOTC 4NXFA 3PBRA 2KX6A 3HUOA 1A0KA 5L2FA 2JKFA 1YLTA 3PXPA 3G31A 2EXBA 3N6IA 1G6OA 3N4IA 1KVLA 1NZOA 3SZTA 2LB5A 3UE6A 1PWGA 3P98A 1Z6FA 3BLSA 1Y4OA 4GHIB 2V2FF 2I9VA 2WKHA 3NOPC 4GB7A 1H8MA 3WRZA 3PBNA 3B42A 2P9VB 3WS0A 2VK3A 3LEQA 3FZCA 1LLBA 3OCLA 4CJNA 1N9NA 4MN6A 2FFYA 2VGJA 4HEFA 3T1QB 4CLCC 5L8MA 5FSRA 3GECA 2Y79A 3UPNA 3LIDA 1BYWA 3UNWA 2XR0A 3SS5A 2JKTM 2ZD8A 2X71A 3KYQA 4OQGA 5CHMA 5AQAA 1OT6A 1S4SA 3LEZA 1PFLA 1S6RA 4LCLA 3ZQ5A 3MQ0A 5TBMA 4PKYG 4I38A 1VEUB 5FQJA 3R7WA 2EX9A 1FR6A 1PRQA 1FILA 4KZ6A 4ETZA 4BMWA 5D3OA 3FKWA 1LL9A 3Q7VA 3VE3A 3Q1FA 4YNRA 1XGJA 2HZ5A 3LIFA 5EECA 3ITBA 2IWBA 4LCMA 2R9XA 3NCKA 1E25A 2EWVA 3FPVA 4MBFA 4H6JB 4DF6A 1KOUA 2IWDA 3EWKA 2ZC6B 3KO6A 2ZMAA 5E2FA 3IHAA 3CAXA 2Y2JA 2KLIA 3LR4A 3MQOA 4X55A 5J3WA 2OV5A 4LENA 1RGZA 3AGEA 4BBTA 2ZC7A 1OTBA 4Y15A 4QY5A 1MWSA 2G2UA 3NI9A 4OH0A 3EGXC 4LLOB 3BRMA 3BWLA 1IYQA 5FQMA 3DTMA 2QJ7A 1N9OA 1OTAA 3AGFA 3ZVTA 5EVID 2O9AA 3EEHA 3SS4A 4OLGA 3JVVA 2WAFA 4OLDA 5HWTA 4FSFA 3VFFA 4EU0A 1LHYA 2E8IA 3ZG8B 3MJQA 4DRTA 1ZTUA 2K2NA 3SW1A 1V9ZA 4I3IA 1X0OA 3ITAA 3TG9A 1K54C 3UDXA 4H8RA 4YINA 1FCOA 3A3FA 1YM1A 1DP9A 3P09A 4R3BA 3ICYA 4EQ1A 2D01A 2Q9MA 1XGIA 2W3FA 3HLEA 2E8JA 4JGPA 4WEKA 1S1ZA 2AVXA 5FATA 4S2OA 4ZJ3A 3GV9A 3EQUA 1E3UD 1PI4A 3IS2B 3HLGA 2LB9A 1U60A 4NXGA 5DVAA 3GSGA 4I39A 2Y2NA 1K4EA 4FOFA 1GA0A 2YKHA 4KQQA 1IYOA 1K55A 2JE5A 4JF4A 3IXDA 4ZTKA 1S4RA 3DTEA 5DKLA 5FASA 3CPTA 4PM6A 1FQGA 1G68A 4PAUA 3C38A 5TBMB 3HREA 4YWZA 5DFXA 5HWWA 3HLDA 1YSQA 2VZWA 3FPWA 3QNBA 5EV0A 3Q7VB 3RTYA 3TW8A 3O86A 1QMFA 3G32A 4G3VA 1K57A 2VV6A 5KMWA 4E3JA 1GSXA 4K0WA 2EX8A 5EFWA 1T1CA 5FI2A 2VV8A 2Y55A 3NDGA 4WEJA 4EWFA 3UO9A 2ZL1A 1CI8A 1GCEA 3ZFZA 3H82A 2OOLA 5EM1A 2XGNA 4JPMA 3VOLA 4WMCA 3O3VA 3VP1A 4Y5FA 1BUEA 4CLCA 2O0YA 1D1JA 1WYBA 2A24B 4E04A 2GNXA 2CMNA 2HF6A 5GLDA 4CLCD 4Y0OA 4DJ3A 1L2SA 3IWIA 5AVEA 4XT2B 5DTSA 1BSGA 4XUZA 5DFYA 4PM7A 5TJJA 2Y2LA 2OLVA 4PM9A 3NECA 3N8LA 3ZVWA 3OLOA 4ZRRA 4QU3A 3G35A 5CXWA 3VP4A 5FQKA 3L9KA 1RCJA 1FR1A 2VLGA 3E2LA 3C4PA 4I3AA 2VJWA 2Y2QA 4NXEA 3UMDA 4LV0A 1NYMA 1ACFA 1PW8A 2JKTI 4EBNA 5CEDA 3WS4A 2EFXA 3MKEA 4GS9A 5FAQA 2HP9A 1NLYA 4P6ZS 5CGWA 1FCMA 2VV7A 1W7FA 2PYRA 1IKIA 3ZG9B 1SDEA 1LSXA 4GHIA 3MS6A 2VEAA 2XFTA 4R38A 2ZQ7A 4WF0A 4K91A 3B33A 1H8YA 2W3HA 2XA7S 4HJ6A 2HJEA 1KGEA 2ACGA 1XPBA 3KSGA 3A3IA 4UA9A 3EGDC 4OOLA 4A5RA 3DWKA 3A0SA 5GL9A 1W5DA 5AQBA 1EI5A 2L0WA 3QP1A 5MC7A 4P85A 3IXHA 3S7QA 2WYXA 2Z2MB 1BTLA 2V1AA 4OQ0A 3FYZA 4KUOA 3CPTB 1JNUA 4Y0UA 4UAAA 4N1HA 3BQ8A 3SH7A 4FTXA 1SZVA 4DE1A 2VX8A 1YMXA 1HLUP 1BZAA 4QD4A 2DNSA 1W63Q 2JKRM 1YKDA 3E4OA 1GSVA 4MEZA 1MBLA 2X02A 1VEUA 1K54A 4Y13A 1BULA 3TSGA 1TS0A 1CEFA 2VGKA 4KZBA 4KZ4A 1MY8A 4R4SA 3VV4A 5GLBA 4PHTA 3ZGAB 3VP3A 2XDMA 3IWOA 2KDKA 2ZQCA 2ZL1B 1NRFA 2ZQ9A 4L9EA 3DTKA 3VSKA 3LIAA 4AFIA 4X56A 2OLUA 4FCFA 1P0ZA 4G3WA 2QYBA 2XFSA 1XJ6A 3MKFA 5F5YA 4DE0A 3WS1A 3C2WA 1CI9A 4OKPA 4IVIA 4KZ8A 3PTEA 1NY0A 2ZC4B 3SS3A 3KSIA 1K55C 4NEED 2PHYA 3UDFA 5FEGA 4N1XA 5M18A 3HLBA 4OOYA 1H0MA 5GLAA 1NLZA 3VFHA 2L1MA 4R70A 2QHKA 5HSQA 4G3KA 1I5QA 1MWUA 2A2LA 4GN2A 4BL2A 1SKFA 2EX6A 5E2HA 3UDIA 3IH8A 4N9LA 3V39A 2UV0E 4U3TA 2W3EA 4GS9B 1T1BA 3BFFA 5J4EA 4PKYA 3P7NA 5LBRA 5FQIA 5CHJA 1K4FA 4UEYA 4IUKA 1K57C 1K38A 3FWLA 4QWOA 2PT7A 3O5YA 3T1XA 4ZAMA 1CJFA 3IF6A 2R9WA 3MZEA 1W79A 2FZ0A 4O0PA 3TRCA 1XKZA 1VM1A 3LFVA 4S2PA 4PM5A 1MZUA 3IHBA 4B4ZA 3OC2A 3CZDA 4E3IA 3LYXA 4EERA 3IS2A 4X68A 2J3TD 4O7DA 1TS8A 4FUWA 4EW7A 4JGOA 1MKIA 3BFCA 2J7VA 2H0TA 1K25A 1ERQA 2Y2HA 1PZOA 2NUTC 2QKPA 3V3RA 4LRXC 4EQIA 3LO7A 4K08A 2EA9A 3A0RA 2PU4A 2P08A 4ZJ1A 3LR5A 3T4QA 1KE4A 2B5RA 4DXBA 1ALQA 5EUAA 3EOIA 2P7JA 4X1MA 4EXOA 1JTGA 1WYCA 3B47A 2ZLYA 1FIKA 4HJ3A 2Y8HA 3LY3A 4LPZA 2VA0A 4HNBA 4ZJ2A 5I5LA 3UB9A 3QNCA 2WZXA 4FH2A 3GR2A 5IS1A 3ZYTA 3H7WB 4HESA 4GKUA 4Q8IA 4N9KA 4KUKA 1YSPA 2K7SA 3V5MA 3BFGA 3UE3A 3MZFA 3G6OA 2X01A 4OP8A 1M6KA 4QJGA 3Q07A 4GDBA 1STZA 1FOFA 3T4JA 4Q0JA 2VGLS 2A24A 3O87A 4GD6A 3K3CA 1O07A 4OP5A 1SCWA 1ESIA 5TGFA 1YLZA 4S2NA 3LUQA 1Z09A 4XT2A 4EESA 4WN5A 3BM6A 4MMNA 3VP0A 2RCXA 3IF5A 1OJGA 3ZG7B 1CF0A 2INWA 2HDRA 3ZDJA 4RX2A 2FFFB 4EBLA 2OAP1 3HJIA 1XFNA 3SH9A 5EOEA 3T4SA 1ODVA 2J80A 4JF6A 4MLLA 3T4LA 3A3EA 3DTIA 2ZMVA 1OMEA 1HZOA 1F9IA 2ZC3B 3HLWA 2Q9NA 3N8RA 2BTFP 4PM8A 3GDIA 4DJ2A 2V8CA 2PD8A 3SOIA 3MSHA 1HVBA 3IF6B 5U47A 3LCEA 3L7HA 4NG2A 1RGYA 2JKRI 3S7OA 2HDUA 3BFDA 3G30A 1ERMA 4DXCA 2JBFA 1ONHA 3FG8A 2WUQA 2W1RA 5F6AA 4E3KA 5L07A 4LFUA 4WUJA 5CHUA 3G4PA 1T1AA 1IKGA 4BJPA 2V9AA 3JVUA 3MFDA 3CUEA 4IJGA 1J9MA 2JN7A 3Q7ZA 4HJ4A 1H3QA 3W4PA 3NULA 3QP4A 2B18A 3T4TA 4JKTA 3IBRA 2DRWA 4KQRA 2P04A 1Y54A 4LV1A 1YQSA 3HVFA 2ZM0A 1IELA 3E0YA 1WE4A 1Y28A 2WGWB 4HH3A 5HFOA 1UGUA 1AXBA 3BY9A 1T18A 2XK1A 1DP6A 1IOUA 2C6WB 1KVMA 3IQAA 1L0EA 2W0NA 3MR0A 3UB8A 5FQQA 4MNRA 3W4OA 3NJAA 3C7VA 4ARZA 3GMWA 3UE1A 1TS6A 5FI6A 4JF5A 2R78A 5FEFA 5L10A 1UWNX 1NRJA 2J3WA 4GNUA 3PBQA 2D02A 1M40A 2UWXA 3MXRA 4JXVA 4M4XA 2W27A 1SKOA 3IH9A 5HPFA 1EROA 1JTDA 5DF9A 4P6BA 2MJ6A 5E43A 4DN0A 3QHYA 2XROA 3IX8A 5A93A 3M2JA 1IYPA 2EXAA 3IF6C 2ZM2A 4NKPA 2OAQ1 2WGVA 1Q2PA 1FSYA 4WMCD 4R3JA 1OPXA 3D4FA 1BLCA 5DTKA 2ZJ9A 4UA7A 5IHVA 2ZQDA 4CPKA 4WELA 5FA7A 1NWZA 4IHQA 4DE2A 3F1OA 5HPIA 4WZ5C 2PR5A 3UPOA 1XA1A 4KQDA 4MBKA 3HCYA 1VETA 1YLYA 4CLCE 1ES2A 5EVIB 4BENA 5F83A 2KOIA 4BBVA 1GHPA 3TJZC 3OPLA 3NBLA 5KZHA 1OJ5A 4S2LA 4GLQA 5G4YA 5F82A 2QZ6A 4S2IA 4FH4A 3DAVA 2JKGA 2WKQA 3U4LP 1PW1A 1VHMA 5FQ9A 4B88A 1I2WA 4UQIS 2PBYA 4NXBA 1GSWA 1XX2A 2QWSA 4E3NA 2OWJA 5DF8A 3UMEA 4PPRA 3WS5A 3BJNA 2O9CA 4EUVA 3LIEA 1LSVA 2XD1A 2M7VA 4MBHA 2V0UA 5CGXA 1ES3A 5J8XA 1PIOA 3CMZA 2H0YA 2GZAA 5BOHA 2Y4AA 5DJUA 4OOMA 1YLWA 2Y2GA 2Y2MA 4QPRA 5HDSA 5EVEA 4WM9A 4KZAA 2WKRA 3GTCA 4S2KA 4GJ4A 4R0QA 1N9BA 1LI0A 1BLSA 4P87A 3KX0X 5HL1A 2V0WA 4FD8A 2Y2KA 1YPRA 1N9LA 5HZHA 5DJTA 2M7UA 1OTIA 2RL3A 5A92A 5A8BA 4JXWA 4S2NC 1IEMA 2HJ9C 3DWZA 4GDNA 4Z9QA 5FDSA 3MMHA 4OONA 5F69A 3C4OA 1SDNA 1S67L 1PI5A 1OTEA 3NC8A 3O88A 5EVIC 4ARZB 5HL6A 4MCWA 5AJGA 4JBFA 2VKSA 2O99A 2L4RA 1XFQA 3LY4A 1I2SA 3T1RA 4Y2FA 2M1CA 4NK3A 1PWDA 1SKOB 4KZ7A 3IT9A 4D2OA 3OPHA 1YMSA 2HPBA 4OPQA 3VE4A 3H7WA 5FL3A 5I94A 4LRZE 3F1PB 2YKFA 2NUPC 5FAOA 5TR7A 3S1YA 4L9GA 1W8QA 3CITA 3NOUC 2H5SA 5FAPA 2ZBBA 2HDSA 4GCZA 5HWVA 5HW3A 3OCNA 5HAQA 4KG6A 4R6LA 1EW0A 1S0WA 3N8SA 3PBTA 3OBFA 2I72A 3F1OB 1JWZA 5CEBA 5EVLA 2EWWA 2W1TA 2WKEA 5JYOA 4IVKA 3CUEC 4X1LA 1VETB 1G5UA 3RH8B 3W4QA 3CI6A 2PDRA 2HDQA 2FH5A 3K3DA 1K56A 1ESUA 3CHWP 1DP8A 3LR0A 4WBGA 3N7WA 1F98A 3D72A 5CTNA 1D7EA 2O9BA 1EWZA 3ISGA 4EV4A 3QP5A 3U2AA 4RX3A 4P6ZM 2G7UA 4Q0HA 4R3AA 1OT9A 2V8FA 5F1GA 4HP4A 5GLCA 4KQOA 4B93A 1BLHA 3OPPA 5HD5A 5A90A 4C75A 1P9WA 4BWIA 4KZ3A 1FCNA 4GOGA 4XXRA 2IA2A 4UA6A 2XA7M 4HY8A 3E2KA 1S66L 2XH9A 3PAEA 3Q81A 1PYYA 3A0VA 3JPUA 1ZKJA 5AVFA 1LL5A 4M3KA 4X53A 4MDZA 5AQ7A 4X25A 3PBSA 2Y2IA 1L0FA 5CECA 4K0XA 4IUHA 3LIBA 1F2KA 3T4KA 2PU2A 3I7JA 2BASA 4YOFA 1LSWA 3DBAA 4BQMA 5EPHA 3FC7A 2WKIA 3VSLA 1LT0A 4WZ5A 3UE0A 4GD8A 4LGWA 4BL3A 3CLOA 4BLMA 4U0XA 3BW6A 5M19A 3H9WA 4OVDA 1ZG6A 3BYDA 3PR6A 1W63M 2IWCA 4EBPA 1YT4A 3A3DA 5AQ9A 1FSWA 3S7PA 2WAEA 3MBZA 1P97A 3CWFA 1GA9A 4E3LA 3KYZA 3ZHHA 4BD0A 1K0KA 3NHQA 5J7EA 1KE3A 3V50A 1L3LA 1F5MA 3S7NA 2A3UA 2Y2OA 3CJMA 1ES5A 3DW0A 2B95A 2WGWA 4N92A 2PD7A 1DJAA 3E4QA 4MN7A 2ZOHA 5G4ZA 3LGOA 5DTTA 4BD1A 3K2NA 1JWVA 4IBXA 2JCHA 5CX7A 3E4PA 3M2KA 1ZHHB 3GQZA 3EQVA 2QJ5A 3RXXA 4E3OA 3S4XA 4OPZA 5DKKA 1MC0A 3C30A 2ZOIA 1SHVA 3C8CA 4QY6A 4RYEA 2B02A 3FKVA 3QP8A 3S22A 1KGGA 3NY4A 3OOVA 2Y2PA 1DJCA 4F3LA 2W1TB 3SH8A 3GRJA 4DDYA 1XA7A 4OQIA 1NZUA 1YAXA 4Y17A 1JWPA 4HI4A 3HJKA 3LI8A 4B4XA 2PYPA 2WKPA 4EETB 4HIAA 1JVJA 4E3MA 4II7A 2DCFA 5G18A 1DY6A 1NYYA 2Y59A 3WS2A 5IT5A 1RP5A 2PBDP 3MXSA 3IWQA 3NIAA 2V1ZA 1C3BA 5EVIA 1CQAA 1XJ3A 2G2WA 3HLCA 4HBTA 5HD3A 5KIZA 2P74A 4E6XA 1TDGA 3BQAA 3TOIA 3BFEA 4PMAA 4EUZA 4KZ9A 1ZG4A 3D9YA 3ZNTA 4EEPA 2XLNA 3UB5P 4HQAA 5HARA 1H5XA 4L0LA 2WADA 2EX2A 4NETA 2GDNA 2H28A 3UB7A 5HAPA 4IEDA 1G6AA 4LV3A 4HP9A 2HGVA 5CRFA 4S2MA 4ID4A 1W8YA 3G34A 1L0GA 3UN7A 1NJ4A 1TS7A 4RQ9A 4EEUA 1K6SA 4HBUA 3RXWA 4R4RA 3M6BA 1TD5A 1VQQA 4I3JA 4DKIA 2PR6A 4MN5A 1E3UA 2PRFA 2XSSA 5HX9A 3IXGA 1CK3A 4U0TA 2ZMFA 2C5WB 2WGIA 2ZC5B 1E4DA 3ZG5A 1OTDA 5CGSA 2XEPA 1XJ4A 4E6WA 1YLJA 4OPYA 4DDSA 1GHMA 3M6HA 2XQZA 3EEAA 5GHZA 1PWCA 4Q0IA 2HV1A 3ULFA 3CG5A 3VOYA 5F68A 1V9YA 3W2ZA 4ETXA 4RA7A 3ZG0A 3BECA 3MFXA 3MQQA 4ZDXA 3R7WB 4ZBEA 4JGRA 2V1BA 3IXBA 1G28A 3QP6A 3LR3A 4WLAA 2XF3A 2HP6A 2WK0A 2VGLM 1DJBA 4HHDA 1PZPA 3F1NA 2K31A 1ES4A 3F1PA 5HAIA 2H10A 2EFUA 1IFQA 4JXSA 5KSHA 4F3LB 3ZNYA 3BY8A 4ME4A 3PYPA 1D06A 1K6RA 2Y91A 3V67A 3T12B 1H8ZA 4L9FA 2OWHA 1BLPA 3AGDA 3VP2A 4RVAA
chains in the Genus database with same CATH topology
4EW7A 3MJQA 4JGOA 4Y2FA 1ZTUA 2K2NA 2M1CA 3SW1A 1V9ZA 2J3TC 4I3IA 1X0OA 2NUTC 2QKPA 4B9OA 4LRXC 3VE4A 3H7WA 5FL3A 1DP9A 4LRZE 3ICYA 3F1PB 4K08A 2D01A 2YKFA 2NUPC 3KSHA 4EQ1A 2EA9A 3A0RA 2W3FA 3R4KA 2P08A 1P9RA 4JGPA 4L9GA 2Z6DA 4WEKA 1S1ZA 3CITA 3LR5A 3NOUC 3T4QA 2ZBBA 4GCZA 5HWVA 1TF1A 3OCNA 3EQUA 1T19A 3IS2B 4R6LA 1EW0A 3EOIA 3PBTA 2P7JA 3OBFA 2LB9A 3F1OB 4NXGA 4EXOA 2EWWA 2W1TA 3B47A 3KSFA 4I39A 4HJ3A 2Y8HA 4FOFA 4LPZA 3CUEC 2VA0A 4HNBA 3RH8B 2YKHA 3CI6A 3UB9A 5I5LA 2PDRA 2FH5A 3K3DA 3MF0A 3LICA 4GW9A 5K5BA 1S4RA 5IS1A 3ZYTA 3H7WB 5DKLA 1DP8A 3LR0A 4O01A 2GX5A 2W3DA 1F98A 3D72A 4KUKA 1YSPA 1D7EA 2O9BA 4PAUA 2K7SA 3C38A 4LRYC 3UE3A 3G6OA 5TBMB 2Z6CA 3U2AA 4YWZA 5DFXA 4P6ZM 2G7UA 4Q0HA 4R3AA 1OT9A 5HWWA 4HP4A 1STZA 4KQOA 3RFBA 4B93A 1YSQA 2VZWA 5HD5A 3T4JA 3FPWA 4Q0JA 2VGLS 3TE8A 4HH2A 3T50A 2A24A 3K3CA 3RTYA 3TW8A 1P9WA 4BWIA 2IA2A 4G3VA 2XA7M 4HY8A 2VV6A 3LUQA 1S66L 1GSXA 5IU1A 4XT2A 4EESA 4WN5A 4JGQA 4MMNA 3A0VA 3LI9A 5AVFA 1OJGA 2INWA 4CQHA 5EFWA 1T1CA 5HDDA 4MDZA 2OAP1 2XRNA 3HJIA 1XFNA 3PBSA 2VV8A 4IUHA 3LIBA 4WEJA 3T4KA 3D3OA 2BASA 4YOFA 1LSWA 3DBAA 3FC7A 3H82A 2OOLA 3VOLA 4Y5FA 3T4SA 1LT0A 1ODVA 4CLCA 2J80A 2O0YA 2W3GA 2A24B 4E04A 3T4LA 2GNXA 2CMNA 3T4OA 2HF6A 2ZMVA 4HOIA 3P01A 3CLOA 4CLCD 1F9IA 3BW6A 3H9WA 4DJ3A 3PR6A 2JHEA 1W63M 1S1YA 5AVEA 3GDIA 4XT2B 3UB6A 4DJ2A 3F1NB 2PD8A 3S7PA 5DFYA 5TJJA 1P97A 3CWFA 3KYZA 5C5KA 4I5SA 3NHQA 5J7EA 2JKRI 3S7OA 1F5MA 3E98A 3S7NA 4Y3IA 1VB6A 3FG8A 2GJ3A 3OLOA 4ZRRA 1UWPX 2PD7A 4H6JA 3E4QA 4MN7A 2ZOHA 2W1RA 5G4ZA 3H82B 5F6AA 2VLGA 3K2NA 4WUJA 4CLCB 1LL8A 3IBJA 4I3AA 2VJWA 1WA9A 5CX7A 3E4PA 1T1AA 4NXEA 4BJPA 3UMDA 2V9AA 3MXQA 3JVUA 3PBOA 1ZHHB 2JKTI 3CUEA 3EQVA 2QJ5A 4IJGA 2JN7A 4DMZA 4HJ4A 1H3QA 4GS9A 4Z1WA 5DKKA 1MC0A 3C30A 1NLYA 2B18A 4P6ZS 3T4TA 2ZOIA 3IBRA 2VV7A 2P04A 4BBUA 1XJ2A 2PYRA 3C8CA 1LSXA 4GHIA 4UQIM 5HDCA 2VEAA 2B02A 4WF0A 1DRMA 4R38A 3E0YA 3B33A 1Y28A 4HH3A 2W3HA 1UGUA 3PHYA 3BY9A 1T18A 2XA7S 1DP6A 4HJ6A 2HJEA 4O8GA 1IOUA 4WL9A 2DMWA 3OOVA 3KSGA 1MKMA 2W0NA 3MR0A 3NOTC 4F3LA 3UB8A 2W1TB 3EGDC 4OOLA 3A0SA 4NXFA 3PBRA 2KX6A 3NJAA 4ARZA 2L0WA 5MC7A 1TS6A 1YAXA 3S7QA 3PXPA 4HI4A 3HJKA 2R78A 3LI8A 2V1AA 2PYPA 2WKPA 4EETB 4HIAA 4KUOA 1G6OA 1UWNX 1JNUA 1NRJA 2J3WA 4II7A 3PBQA 2D02A 2LB5A 3BQ8A 3UE6A 5IT5A 4M4XA 2W27A 5HPFA 5DF9A 4GHIB 2MJ6A 4DN0A 2XROA 1XJ3A 2VX8A 2I9VA 5HD3A 3NOPC 1H8MA 5KIZA 4NKPA 2OAQ1 3B42A 3PBNA 3BQAA 1W63Q 2JKRM 1YKDA 4EEPA 3E4OA 1GSVA 3OCLA 1OPXA 4HQAA 1N9NA 4L0LA 4MN6A 2H28A 3UB7A 1TS0A 4WELA 1NWZA 4IHQA 4CLCC 5L8MA 3F1OA 5HPIA 3GECA 2PR5A 4HP9A 4KQDA 2HGVA 2Y79A 3VV4A 3LIDA 3HCYA 1BYWA 2JKTM 4PHTA 4CLCE 3KYQA 2KDKA 4L9EA 1TS7A 1OT6A 2KOIA 4RQ9A 4EEUA 1S4SA 4BBVA 3LIAA 3TJZC 1TD5A 4AFIA 1OJ5A 3ZQ5A 3MQ0A 4I3JA 4GLQA 2PR6A 5G4YA 1P0ZA 5TBMA 4PKYG 4G3WA 4MN5A 4I38A 2QYBA 3R7WA 2XSSA 1XJ6A 2WKQA 5F5YA 1VHMA 4ETZA 4BMWA 4UQIS 2ZMFA 4NXBA 1GSWA 2QWSA 3C2WA 3VE3A 1OTDA 2OWJA 4YNRA 1XJ4A 3LIFA 3UMEA 3KSIA 4NEED 3BJNA 2O9CA 2PHYA 3LIEA 4EUVA 1LSVA 2M7VA 2EWVA 3FPVA 3EEAA 4H6JB 1KOUA 3EWKA 4Q0IA 2HV1A 3ULFA 3KO6A 2V0UA 1NLZA 2L1MA 4R70A 2QHKA 5HSQA 5F68A 3CAXA 1V9YA 3W2ZA 4G3KA 4ETXA 2GZAA 5DJUA 4OOMA 5HDSA 3MFXA 4QPRA 2WKRA 2A2LA 2KLIA 3LR4A 3MQQA 3MQOA 3R7WB 5J3WA 4JGRA 4GJ4A 2V1BA 1G28A 2W3EA 4GS9B 4BBTA 1T1BA 5J4EA 3LR3A 1OTBA 4PKYA 3KX0X 3P7NA 5LBRA 2V0WA 4WLAA 1N9LA 3EGXC 4LLOB 5HZHA 5DJTA 2M7UA 4UEYA 1OTIA 4IUKA 3BWLA 5A8BA 2VGLM 2QJ7A 2PT7A 2HJ9C 1OTAA 1N9OA 4HHDA 3F1NA 2K31A 3O5YA 3MMHA 3F1PA 5F69A 2O9AA 1S67L 2FZ0A 3EEHA 1IFQA 4O0PA 5KSHA 4F3LB 3TRCA 1OTEA 3BY8A 3LFVA 3JVVA 4ME4A 3PYPA 1D06A 5HL6A 4ARZB 1MZUA 4MCWA 5AJGA 5HWTA 3OC2A 2VKSA 2O99A 4FSFA 3LYXA 3V67A 4EERA 2L4RA 3IS2A 2OWHA 4L9FA 2J3TD 4EU0A 1XFQA 1TS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EW7 A;  3MJQ A;  4JGO A;  2M1C A;  3SW1 A;  1V9Z A;  4I3I A;  1X0O A;  2QKP A;  4B9O A;  4LRX C;  3VE4 A;  3H7W A;  1DP9 A;  4LRZ E;  3F1P B;  3ICY A;  4K08 A;  2D01 A;  2YKF A;  4EQ1 A;  2EA9 A;  3A0R A;  4JGP A;  4L9G A;  2Z6D A;  1S1Z A;  3NOU C;  2ZBB A;  4GCZ A;  5HWV A;  1T19 A;  3IS2 B;  4R6L A;  1EW0 A;  2P7J A;  3F1O B;  4NXG A;  4EXO A;  4I39 A;  4HJ3 A;  4LPZ A;  4HNB A;  3RH8 B;  2YKH A;  3UB9 A;  5I5L A;  2PDR A;  3K3D A;  3LIC A;  4GW9 A;  1S4R A;  5IS1 A;  3H7W B;  5DKL A;  1DP8 A;  1F98 A;  3D72 A;  4KUK A;  1D7E A;  2K7S A;  4LRY C;  3G6O A;  5TBM B;  2Z6C A;  4YWZ A;  4R3A A;  1OT9 A;  5HWW A;  4HP4 A;  5HD5 A;  4HH2 A;  3T50 A;  2A24 A;  3K3C A;  3RTY A;  4HY8 A;  2VV6 A;  3LUQ A;  5IU1 A;  1S66 L;  1GSX A;  4XT2 A;  4EES A;  4WN5 A;  4JGQ A;  3A0V A;  3LI9 A;  5AVF A;  1OJG A;  2INW A;  5EFW A;  1T1C A;  5HDD A;  3HJI A;  1XFN A;  2VV8 A;  3LIB A;  2BAS A;  1LSW A;  3FC7 A;  3H82 A;  2OOL A;  3VOL A;  1LT0 A;  1ODV A;  2J80 A;  2A24 B;  4E04 A;  2CMN A;  4HOI A;  3CLO A;  1F9I A;  3H9W A;  4DJ3 A;  2JHE A;  1S1Y A;  5AVE A;  3GDI A;  4XT2 B;  3UB6 A;  4DJ2 A;  3F1N B;  2PD8 A;  1P97 A;  3CWF A;  4I5S A;  3NHQ A;  5J7E A;  1VB6 A;  3FG8 A;  2GJ3 A;  3OLO A;  1UWP X;  2PD7 A;  4H6J A;  3E4Q A;  2ZOH A;  5G4Z A;  3H82 B;  5F6A A;  2VLG A;  4WUJ A;  1LL8 A;  4I3A A;  1WA9 A;  3E4P A;  1T1A A;  4NXE A;  3UMD A;  2V9A A;  3MXQ A;  2QJ5 A;  2JN7 A;  4HJ4 A;  4GS9 A;  5DKK A;  2ZOI A;  3IBR A;  2VV7 A;  4BBU A;  1XJ2 A;  2PYR A;  3C8C A;  1LSX A;  4GHI A;  5HDC A;  2VEA A;  2B02 A;  4WF0 A;  1DRM A;  4R38 A;  3B33 A;  1Y28 A;  4HH3 A;  1UGU A;  3PHY A;  3BY9 A;  1T18 A;  1DP6 A;  4HJ6 A;  4WL9 A;  2W0N A;  3MR0 A;  3NOT C;  4F3L A;  3UB8 A;  3A0S A;  4NXF A;  2KX6 A;  3NJA A;  2L0W A;  1TS6 A;  4HI4 A;  3HJK A;  2R78 A;  3LI8 A;  2V1A A;  2PYP A;  2WKP A;  4EET B;  4HIA A;  4KUO A;  1UWN X;  1JNU A;  2D02 A;  3UE6 A;  4M4X A;  2W27 A;  4GHI B;  1XJ3 A;  2I9V A;  5HD3 A;  3NOP C;  5KIZ A;  4EEP A;  3E4O A;  1GSV A;  4HQA A;  1N9N A;  4MN6 A;  2H28 A;  3UB7 A;  1TS0 A;  1NWZ A;  3F1O A;  3GEC A;  2PR5 A;  4HP9 A;  4KQD A;  3LID A;  1BYW A;  2KDK A;  4L9E A;  1TS7 A;  1OT6 A;  4RQ9 A;  4EEU A;  1S4S A;  4BBV A;  3LIA A;  1OJ5 A;  3ZQ5 A;  4I3J A;  2PR6 A;  5G4Y A;  1P0Z A;  5TBM A;  4PKY G;  4MN5 A;  4I38 A;  1XJ6 A;  2WKQ A;  5F5Y A;  4NXB A;  1GSW A;  2QWS A;  3C2W A;  3VE3 A;  1OTD A;  2OWJ A;  1XJ4 A;  3LIF A;  3UME A;  2PHY A;  3LIE A;  1LSV A;  4H6J B;  1KOU A;  3EWK A;  2HV1 A;  3ULF A;  2V0U A;  2L1M A;  4R70 A;  2QHK A;  5HSQ A;  5F68 A;  3CAX A;  1V9Y A;  5DJU A;  5HDS A;  3MFX A;  2WKR A;  3MQQ A;  3MQO A;  5J3W A;  4JGR A;  2V1B A;  1G28 A;  4GS9 B;  4BBT A;  1T1B A;  5J4E A;  1OTB A;  4PKY A;  3KX0 X;  3P7N A;  2V0W A;  4WLA A;  1N9L A;  5HZH A;  4LLO B;  5DJT A;  1OTI A;  3BWL A;  5A8B A;  2QJ7 A;  1OTA A;  1N9O A;  4HHD A;  3F1N A;  3F1P A;  5F69 A;  1S67 L;  3EEH A;  4F3L B;  1OTE A;  3BY8 A;  3PYP A;  1D06 A;  1MZU A;  5HWT A;  3LYX A;  4EER A;  2L4R A;  3IS2 A;  2OWH A;  4L9F A;  1XFQ A;  1TS8 A; 
#chains in the Genus database with same CATH topology
 4OPR A;  4C6Y A;  3FV7 A;  2CC1 A;  4KEN B;  4X69 A;  3G2Y A;  2WZZ A;  2J3T C;  4B9O A;  1KDW A;  1HTZ A;  1KGF A;  3HL9 A;  2QPN A;  1XP4 A;  3KSH A;  1KDS A;  4GZB A;  4DE3 A;  3R4K A;  1TDL A;  2V20 A;  1P9R A;  4WZ4 A;  5TFQ A;  1Q2Q A;  3OPR A;  2Z6D A;  3W8K A;  1QME A;  5M1A A;  3UY6 A;  5CTM A;  1O7E A;  1TF1 A;  1TVF A;  3ZCZ A;  5F1F A;  1T19 A;  3IX4 A;  4R23 A;  3JYI A;  2XD5 A;  5EOO A;  1TEM A;  1J3W A;  3VMA A;  3BLM A;  3WWX A;  3KSF A;  1L0D A;  1ONG A;  2BG1 A;  4QB8 A;  5CER A;  3OZH A;  3MF0 A;  3LIC A;  4GW9 A;  5K5B A;  3WRT A;  2A49 A;  4O01 A;  2GX5 A;  2W3D A;  3G2Z A;  5KSC A;  4XUX A;  5EE8 A;  4LRY C;  4R1G A;  2Z6C A;  2OSU A;  5GHY A;  4X6T A;  4Y7P A;  2J9O A;  1YLP A;  1MPL A;  5L09 A;  2ZM8 A;  3RFB A;  5E2E A;  5EM0 A;  2P9V A;  3B3X A;  3TE8 A;  3NDE A;  4HH2 A;  4KZ5 A;  3T50 A;  3KYE A;  2JC7 A;  3PAG A;  1CEG A;  5GHX A;  4JLF A;  3MZD A;  5IU1 A;  5FI7 A;  4UHU A;  4JGQ A;  1AWI A;  3LI9 A;  2ZQ8 A;  2ZQA A;  4Y0T A;  2J9P A;  3GVB A;  4CQH A;  5HDD A;  2PAV P;  1LI9 A;  2XRN A;  3HLF A;  1XXM A;  3D3O A;  1GHI A;  1MWR A;  3T1S A;  4P0M A;  3UPP A;  5E2G A;  2W3G A;  5DF7 A;  3T4O A;  3HUM A;  4HOI A;  3P01 A;  4KG5 A;  4ESP A;  2JHE A;  1S1Y A;  3UB6 A;  3F1N B;  1ZC2 A;  5C5K A;  4I5S A;  3E98 A;  4JXG A;  4YFM A;  4OQH A;  4Y3I A;  1VB6 A;  1N4O A;  1MWT A;  2GJ3 A;  1UWP X;  2Z2L B;  4H6J A;  5FDH A;  4D60 A;  1MXO A;  3H82 B;  3HUN A;  4CLC B;  1LL8 A;  3IBJ A;  2Q0O A;  4KG2 A;  1WA9 A;  2BLS A;  3MXQ A;  3PBO A;  4WYY A;  4C3Q A;  3Q82 A;  3VOZ A;  4DMZ A;  1PNE A;  1BT5 A;  3V3S A;  4Z1W A;  3A3J A;  1HD8 A;  4F94 A;  1K56 D;  1IYS A;  3HBR A;  4S2J A;  4BBU A;  1XJ2 A;  3RJU A;  1KE0 A;  3C7U A;  4QHC A;  4UQI M;  3QP2 A;  5HDC A;  5A91 A;  1DRM A;  2HP5 A;  4IBR A;  4LV2 A;  2J8Y A;  1NXY A;  3PHY A;  3BEB A;  5JYP A;  3IX3 A;  3C5A A;  4O8G A;  4WL9 A;  2DMW A;  2QMI A;  1MKM A;  3NOT C;  4NXF A;  3PBR A;  2KX6 A;  3HUO A;  1A0K A;  5L2F A;  2JKF A;  1YLT A;  3PXP A;  3G31 A;  2EXB A;  3N6I A;  1G6O A;  3N4I A;  1KVL A;  1NZO A;  3SZT A;  2LB5 A;  3UE6 A;  1PWG A;  3P98 A;  1Z6F A;  3BLS A;  1Y4O A;  4GHI B;  2V2F F;  2I9V A;  2WKH A;  3NOP C;  4GB7 A;  1H8M A;  3WRZ A;  3PBN A;  3B42 A;  2P9V B;  3WS0 A;  2VK3 A;  3LEQ A;  3FZC A;  1LLB A;  3OCL A;  4CJN A;  1N9N A;  4MN6 A;  2FFY A;  2VGJ A;  4HEF A;  3T1Q B;  4CLC C;  5L8M A;  5FSR A;  3GEC A;  2Y79 A;  3UPN A;  3LID A;  1BYW A;  3UNW A;  2XR0 A;  3SS5 A;  2JKT M;  2ZD8 A;  2X71 A;  3KYQ A;  4OQG A;  5CHM A;  5AQA A;  1OT6 A;  1S4S A;  3LEZ A;  1PFL A;  1S6R A;  4LCL A;  3ZQ5 A;  3MQ0 A;  5TBM A;  4PKY G;  4I38 A;  1VEU B;  5FQJ A;  3R7W A;  2EX9 A;  1FR6 A;  1PRQ A;  1FIL A;  4KZ6 A;  4ETZ A;  4BMW A;  5D3O A;  3FKW A;  1LL9 A;  3Q7V A;  3VE3 A;  3Q1F A;  4YNR A;  1XGJ A;  2HZ5 A;  3LIF A;  5EEC A;  3ITB A;  2IWB A;  4LCM A;  2R9X A;  3NCK A;  1E25 A;  2EWV A;  3FPV A;  4MBF A;  4H6J B;  4DF6 A;  1KOU A;  2IWD A;  3EWK A;  2ZC6 B;  3KO6 A;  2ZMA A;  5E2F A;  3IHA A;  3CAX A;  2Y2J A;  2KLI A;  3LR4 A;  3MQO A;  4X55 A;  5J3W A;  2OV5 A;  4LEN A;  1RGZ A;  3AGE A;  4BBT A;  2ZC7 A;  1OTB A;  4Y15 A;  4QY5 A;  1MWS A;  2G2U A;  3NI9 A;  4OH0 A;  3EGX C;  4LLO B;  3BRM A;  3BWL A;  1IYQ A;  5FQM A;  3DTM A;  2QJ7 A;  1N9O A;  1OTA A;  3AGF A;  3ZVT A;  5EVI D;  2O9A A;  3EEH A;  3SS4 A;  4OLG A;  3JVV A;  2WAF A;  4OLD A;  5HWT A;  4FSF A;  3VFF A;  4EU0 A;  1LHY A;  2E8I A;  3ZG8 B;  3MJQ A;  4DRT A;  1ZTU A;  2K2N A;  3SW1 A;  1V9Z A;  4I3I A;  1X0O A;  3ITA A;  3TG9 A;  1K54 C;  3UDX A;  4H8R A;  4YIN A;  1FCO A;  3A3F A;  1YM1 A;  1DP9 A;  3P09 A;  4R3B A;  3ICY A;  4EQ1 A;  2D01 A;  2Q9M A;  1XGI A;  2W3F A;  3HLE A;  2E8J A;  4JGP A;  4WEK A;  1S1Z A;  2AVX A;  5FAT A;  4S2O A;  4ZJ3 A;  3GV9 A;  3EQU A;  1E3U D;  1PI4 A;  3IS2 B;  3HLG A;  2LB9 A;  1U60 A;  4NXG A;  5DVA A;  3GSG A;  4I39 A;  2Y2N A;  1K4E A;  4FOF A;  1GA0 A;  2YKH A;  4KQQ A;  1IYO A;  1K55 A;  2JE5 A;  4JF4 A;  3IXD A;  4ZTK A;  1S4R A;  3DTE A;  5DKL A;  5FAS A;  3CPT A;  4PM6 A;  1FQG A;  1G68 A;  4PAU A;  3C38 A;  5TBM B;  3HRE A;  4YWZ A;  5DFX A;  5HWW A;  3HLD A;  1YSQ A;  2VZW A;  3FPW A;  3QNB A;  5EV0 A;  3Q7V B;  3RTY A;  3TW8 A;  3O86 A;  1QMF A;  3G32 A;  4G3V A;  1K57 A;  2VV6 A;  5KMW A;  4E3J A;  1GSX A;  4K0W A;  2EX8 A;  5EFW A;  1T1C A;  5FI2 A;  2VV8 A;  2Y55 A;  3NDG A;  4WEJ A;  4EWF A;  3UO9 A;  2ZL1 A;  1CI8 A;  1GCE A;  3ZFZ A;  3H82 A;  2OOL A;  5EM1 A;  2XGN A;  4JPM A;  3VOL A;  4WMC A;  3O3V A;  3VP1 A;  4Y5F A;  1BUE A;  4CLC A;  2O0Y A;  1D1J A;  1WYB A;  2A24 B;  4E04 A;  2GNX A;  2CMN A;  2HF6 A;  5GLD A;  4CLC D;  4Y0O A;  4DJ3 A;  1L2S A;  3IWI A;  5AVE A;  4XT2 B;  5DTS A;  1BSG A;  4XUZ A;  5DFY A;  4PM7 A;  5TJJ A;  2Y2L A;  2OLV A;  4PM9 A;  3NEC A;  3N8L A;  3ZVW A;  3OLO A;  4ZRR A;  4QU3 A;  3G35 A;  5CXW A;  3VP4 A;  5FQK A;  3L9K A;  1RCJ A;  1FR1 A;  2VLG A;  3E2L A;  3C4P A;  4I3A A;  2VJW A;  2Y2Q A;  4NXE A;  3UMD A;  4LV0 A;  1NYM A;  1ACF A;  1PW8 A;  2JKT I;  4EBN A;  5CED A;  3WS4 A;  2EFX A;  3MKE A;  4GS9 A;  5FAQ A;  2HP9 A;  1NLY A;  4P6Z S;  5CGW A;  1FCM A;  2VV7 A;  1W7F A;  2PYR A;  1IKI A;  3ZG9 B;  1SDE A;  1LSX A;  4GHI A;  3MS6 A;  2VEA A;  2XFT A;  4R38 A;  2ZQ7 A;  4WF0 A;  4K91 A;  3B33 A;  1H8Y A;  2W3H A;  2XA7 S;  4HJ6 A;  2HJE A;  1KGE A;  2ACG A;  1XPB A;  3KSG A;  3A3I A;  4UA9 A;  3EGD C;  4OOL A;  4A5R A;  3DWK A;  3A0S A;  5GL9 A;  1W5D A;  5AQB A;  1EI5 A;  2L0W A;  3QP1 A;  5MC7 A;  4P85 A;  3IXH A;  3S7Q A;  2WYX A;  2Z2M B;  1BTL A;  2V1A A;  4OQ0 A;  3FYZ A;  4KUO A;  3CPT B;  1JNU A;  4Y0U A;  4UAA A;  4N1H A;  3BQ8 A;  3SH7 A;  4FTX A;  1SZV A;  4DE1 A;  2VX8 A;  1YMX A;  1HLU P;  1BZA A;  4QD4 A;  2DNS A;  1W63 Q;  2JKR M;  1YKD A;  3E4O A;  1GSV A;  4MEZ A;  1MBL A;  2X02 A;  1VEU A;  1K54 A;  4Y13 A;  1BUL A;  3TSG A;  1TS0 A;  1CEF A;  2VGK A;  4KZB A;  4KZ4 A;  1MY8 A;  4R4S A;  3VV4 A;  5GLB A;  4PHT A;  3ZGA B;  3VP3 A;  2XDM A;  3IWO A;  2KDK A;  2ZQC A;  2ZL1 B;  1NRF A;  2ZQ9 A;  4L9E A;  3DTK A;  3VSK A;  3LIA A;  4AFI A;  4X56 A;  2OLU A;  4FCF A;  1P0Z A;  4G3W A;  2QYB A;  2XFS A;  1XJ6 A;  3MKF A;  5F5Y A;  4DE0 A;  3WS1 A;  3C2W A;  1CI9 A;  4OKP A;  4IVI A;  4KZ8 A;  3PTE A;  1NY0 A;  2ZC4 B;  3SS3 A;  3KSI A;  1K55 C;  4NEE D;  2PHY A;  3UDF A;  5FEG A;  4N1X A;  5M18 A;  3HLB A;  4OOY A;  1H0M A;  5GLA A;  1NLZ A;  3VFH A;  2L1M A;  4R70 A;  2QHK A;  5HSQ A;  4G3K A;  1I5Q A;  1MWU A;  2A2L A;  4GN2 A;  4BL2 A;  1SKF A;  2EX6 A;  5E2H A;  3UDI A;  3IH8 A;  4N9L A;  3V39 A;  2UV0 E;  4U3T A;  2W3E A;  4GS9 B;  1T1B A;  3BFF A;  5J4E A;  4PKY A;  3P7N A;  5LBR A;  5FQI A;  5CHJ A;  1K4F A;  4UEY A;  4IUK A;  1K57 C;  1K38 A;  3FWL A;  4QWO A;  2PT7 A;  3O5Y A;  3T1X A;  4ZAM A;  1CJF A;  3IF6 A;  2R9W A;  3MZE A;  1W79 A;  2FZ0 A;  4O0P A;  3TRC A;  1XKZ A;  1VM1 A;  3LFV A;  4S2P A;  4PM5 A;  1MZU A;  3IHB A;  4B4Z A;  3OC2 A;  3CZD A;  4E3I A;  3LYX A;  4EER A;  3IS2 A;  4X68 A;  2J3T D;  4O7D A;  1TS8 A;  4FUW A;  4EW7 A;  4JGO A;  1MKI A;  3BFC A;  2J7V A;  2H0T A;  1K25 A;  1ERQ A;  2Y2H A;  1PZO A;  2NUT C;  2QKP A;  3V3R A;  4LRX C;  4EQI A;  3LO7 A;  4K08 A;  2EA9 A;  3A0R A;  2PU4 A;  2P08 A;  4ZJ1 A;  3LR5 A;  3T4Q A;  1KE4 A;  2B5R A;  4DXB A;  1ALQ A;  5EUA A;  3EOI A;  2P7J A;  4X1M A;  4EXO A;  1JTG A;  1WYC A;  3B47 A;  2ZLY A;  1FIK A;  4HJ3 A;  2Y8H A;  3LY3 A;  4LPZ A;  2VA0 A;  4HNB A;  4ZJ2 A;  5I5L A;  3UB9 A;  3QNC A;  2WZX A;  4FH2 A;  3GR2 A;  5IS1 A;  3ZYT A;  3H7W B;  4HES A;  4GKU A;  4Q8I A;  4N9K A;  4KUK A;  1YSP A;  2K7S A;  3V5M A;  3BFG A;  3UE3 A;  3MZF A;  3G6O A;  2X01 A;  4OP8 A;  1M6K A;  4QJG A;  3Q07 A;  4GDB A;  1STZ A;  1FOF A;  3T4J A;  4Q0J A;  2VGL S;  2A24 A;  3O87 A;  4GD6 A;  3K3C A;  1O07 A;  4OP5 A;  1SCW A;  1ESI A;  5TGF A;  1YLZ A;  4S2N A;  3LUQ A;  1Z09 A;  4XT2 A;  4EES A;  4WN5 A;  3BM6 A;  4MMN A;  3VP0 A;  2RCX A;  3IF5 A;  1OJG A;  3ZG7 B;  1CF0 A;  2INW A;  2HDR A;  3ZDJ A;  4RX2 A;  2FFF B;  4EBL A;  2OAP 1;  3HJI A;  1XFN A;  3SH9 A;  5EOE A;  3T4S A;  1ODV A;  2J80 A;  4JF6 A;  4MLL A;  3T4L A;  3A3E A;  3DTI A;  2ZMV A;  1OME A;  1HZO A;  1F9I A;  2ZC3 B;  3HLW A;  2Q9N A;  3N8R A;  2BTF P;  4PM8 A;  3GDI A;  4DJ2 A;  2V8C A;  2PD8 A;  3SOI A;  3MSH A;  1HVB A;  3IF6 B;  5U47 A;  3LCE A;  3L7H A;  4NG2 A;  1RGY A;  2JKR I;  3S7O A;  2HDU A;  3BFD A;  3G30 A;  1ERM A;  4DXC A;  2JBF A;  1ONH A;  3FG8 A;  2WUQ A;  2W1R A;  5F6A A;  4E3K A;  5L07 A;  4LFU A;  4WUJ A;  5CHU A;  3G4P A;  1T1A A;  1IKG A;  4BJP A;  2V9A A;  3JVU A;  3MFD A;  3CUE A;  4IJG A;  1J9M A;  2JN7 A;  3Q7Z A;  4HJ4 A;  1H3Q A;  3W4P A;  3NUL A;  3QP4 A;  2B18 A;  3T4T A;  4JKT A;  3IBR A;  2DRW A;  4KQR A;  2P04 A;  1Y54 A;  4LV1 A;  1YQS A;  3HVF A;  2ZM0 A;  1IEL A;  3E0Y A;  1WE4 A;  1Y28 A;  2WGW B;  4HH3 A;  5HFO A;  1UGU A;  1AXB A;  3BY9 A;  1T18 A;  2XK1 A;  1DP6 A;  1IOU A;  2C6W B;  1KVM A;  3IQA A;  1L0E A;  2W0N A;  3MR0 A;  3UB8 A;  5FQQ A;  4MNR A;  3W4O A;  3NJA A;  3C7V A;  4ARZ A;  3GMW A;  3UE1 A;  1TS6 A;  5FI6 A;  4JF5 A;  2R78 A;  5FEF A;  5L10 A;  1UWN X;  1NRJ A;  2J3W A;  4GNU A;  3PBQ A;  2D02 A;  1M40 A;  2UWX A;  3MXR A;  4JXV A;  4M4X A;  2W27 A;  1SKO A;  3IH9 A;  5HPF A;  1ERO A;  1JTD A;  5DF9 A;  4P6B A;  2MJ6 A;  5E43 A;  4DN0 A;  3QHY A;  2XRO A;  3IX8 A;  5A93 A;  3M2J A;  1IYP A;  2EXA A;  3IF6 C;  2ZM2 A;  4NKP A;  2OAQ 1;  2WGV A;  1Q2P A;  1FSY A;  4WMC D;  4R3J A;  1OPX A;  3D4F A;  1BLC A;  5DTK A;  2ZJ9 A;  4UA7 A;  5IHV A;  2ZQD A;  4CPK A;  4WEL A;  5FA7 A;  1NWZ A;  4IHQ A;  4DE2 A;  3F1O A;  5HPI A;  4WZ5 C;  2PR5 A;  3UPO A;  1XA1 A;  4KQD A;  4MBK A;  3HCY A;  1VET A;  1YLY A;  4CLC E;  1ES2 A;  5EVI B;  4BEN A;  5F83 A;  2KOI A;  4BBV A;  1GHP A;  3TJZ C;  3OPL A;  3NBL A;  5KZH A;  1OJ5 A;  4S2L A;  4GLQ A;  5G4Y A;  5F82 A;  2QZ6 A;  4S2I A;  4FH4 A;  3DAV A;  2JKG A;  2WKQ A;  3U4L P;  1PW1 A;  1VHM A;  5FQ9 A;  4B88 A;  1I2W A;  4UQI S;  2PBY A;  4NXB A;  1GSW A;  1XX2 A;  2QWS A;  4E3N A;  2OWJ A;  5DF8 A;  3UME A;  4PPR A;  3WS5 A;  3BJN A;  2O9C A;  4EUV A;  3LIE A;  1LSV A;  2XD1 A;  2M7V A;  4MBH A;  2V0U A;  5CGX A;  1ES3 A;  5J8X A;  1PIO A;  3CMZ A;  2H0Y A;  2GZA A;  5BOH A;  2Y4A A;  5DJU A;  4OOM A;  1YLW A;  2Y2G A;  2Y2M A;  4QPR A;  5HDS A;  5EVE A;  4WM9 A;  4KZA A;  2WKR A;  3GTC A;  4S2K A;  4GJ4 A;  4R0Q A;  1N9B A;  1LI0 A;  1BLS A;  4P87 A;  3KX0 X;  5HL1 A;  2V0W A;  4FD8 A;  2Y2K A;  1YPR A;  1N9L A;  5HZH A;  5DJT A;  2M7U A;  1OTI A;  2RL3 A;  5A92 A;  5A8B A;  4JXW A;  4S2N C;  1IEM A;  2HJ9 C;  3DWZ A;  4GDN A;  4Z9Q A;  5FDS A;  3MMH A;  4OON A;  5F69 A;  3C4O A;  1SDN A;  1S67 L;  1PI5 A;  1OTE A;  3NC8 A;  3O88 A;  5EVI C;  4ARZ B;  5HL6 A;  4MCW A;  5AJG A;  4JBF A;  2VKS A;  2O99 A;  2L4R A;  1XFQ A;  3LY4 A;  1I2S A;  3T1R A;  4Y2F A;  2M1C A;  4NK3 A;  1PWD A;  1SKO B;  4KZ7 A;  3IT9 A;  4D2O A;  3OPH A;  1YMS A;  2HPB A;  4OPQ A;  3VE4 A;  3H7W A;  5FL3 A;  5I94 A;  4LRZ E;  3F1P B;  2YKF A;  2NUP C;  5FAO A;  5TR7 A;  3S1Y A;  4L9G A;  1W8Q A;  3CIT A;  3NOU C;  2H5S A;  5FAP A;  2ZBB A;  2HDS A;  4GCZ A;  5HWV A;  5HW3 A;  3OCN A;  5HAQ A;  4KG6 A;  4R6L A;  1EW0 A;  1S0W A;  3N8S A;  3PBT A;  3OBF A;  2I72 A;  3F1O B;  1JWZ A;  5CEB A;  5EVL A;  2EWW A;  2W1T A;  2WKE A;  5JYO A;  4IVK A;  3CUE C;  4X1L A;  1VET B;  1G5U A;  3RH8 B;  3W4Q A;  3CI6 A;  2PDR A;  2HDQ A;  2FH5 A;  3K3D A;  1K56 A;  1ESU A;  3CHW P;  1DP8 A;  3LR0 A;  4WBG A;  3N7W A;  1F98 A;  3D72 A;  5CTN A;  1D7E A;  2O9B A;  1EWZ A;  3ISG A;  4EV4 A;  3QP5 A;  3U2A A;  4RX3 A;  4P6Z M;  2G7U A;  4Q0H A;  4R3A A;  1OT9 A;  2V8F A;  5F1G A;  4HP4 A;  5GLC A;  4KQO A;  4B93 A;  1BLH A;  3OPP A;  5HD5 A;  5A90 A;  4C75 A;  1P9W A;  4BWI A;  4KZ3 A;  1FCN A;  4GOG A;  4XXR A;  2IA2 A;  4UA6 A;  2XA7 M;  4HY8 A;  3E2K A;  1S66 L;  2XH9 A;  3PAE A;  3Q81 A;  1PYY A;  3A0V A;  3JPU A;  1ZKJ A;  5AVF A;  1LL5 A;  4M3K A;  4X53 A;  4MDZ A;  5AQ7 A;  4X25 A;  3PBS A;  2Y2I A;  1L0F A;  5CEC A;  4K0X A;  4IUH A;  3LIB A;  1F2K A;  3T4K A;  2PU2 A;  3I7J A;  2BAS A;  4YOF A;  1LSW A;  3DBA A;  4BQM A;  5EPH A;  3FC7 A;  2WKI A;  3VSL A;  1LT0 A;  4WZ5 A;  3UE0 A;  4GD8 A;  4LGW A;  4BL3 A;  3CLO A;  4BLM A;  4U0X A;  3BW6 A;  5M19 A;  3H9W A;  4OVD A;  1ZG6 A;  3BYD A;  3PR6 A;  1W63 M;  2IWC A;  4EBP A;  1YT4 A;  3A3D A;  5AQ9 A;  1FSW A;  3S7P A;  2WAE A;  3MBZ A;  1P97 A;  3CWF A;  1GA9 A;  4E3L A;  3KYZ A;  3ZHH A;  4BD0 A;  1K0K A;  3NHQ A;  5J7E A;  1KE3 A;  3V50 A;  1L3L A;  1F5M A;  3S7N A;  2A3U A;  2Y2O A;  3CJM A;  1ES5 A;  3DW0 A;  2B95 A;  2WGW A;  4N92 A;  2PD7 A;  1DJA A;  3E4Q A;  4MN7 A;  2ZOH A;  5G4Z A;  3LGO A;  5DTT A;  4BD1 A;  3K2N A;  1JWV A;  4IBX A;  2JCH A;  5CX7 A;  3E4P A;  3M2K A;  1ZHH B;  3GQZ A;  3EQV A;  2QJ5 A;  3RXX A;  4E3O A;  3S4X A;  4OPZ A;  5DKK A;  1MC0 A;  3C30 A;  2ZOI A;  1SHV A;  3C8C A;  4QY6 A;  4RYE A;  2B02 A;  3FKV A;  3QP8 A;  3S22 A;  1KGG A;  3NY4 A;  3OOV A;  2Y2P A;  1DJC A;  4F3L A;  2W1T B;  3SH8 A;  3GRJ A;  4DDY A;  1XA7 A;  4OQI A;  1NZU A;  1YAX A;  4Y17 A;  1JWP A;  4HI4 A;  3HJK A;  3LI8 A;  4B4X A;  2PYP A;  2WKP A;  4EET B;  4HIA A;  1JVJ A;  4E3M A;  4II7 A;  2DCF A;  5G18 A;  1DY6 A;  1NYY A;  2Y59 A;  3WS2 A;  5IT5 A;  1RP5 A;  2PBD P;  3MXS A;  3IWQ A;  3NIA A;  2V1Z A;  1C3B A;  5EVI A;  1CQA A;  1XJ3 A;  2G2W A;  3HLC A;  4HBT A;  5HD3 A;  5KIZ A;  2P74 A;  4E6X A;  1TDG A;  3BQA A;  3TOI A;  3BFE A;  4PMA A;  4EUZ A;  4KZ9 A;  1ZG4 A;  3D9Y A;  3ZNT A;  4EEP A;  2XLN A;  3UB5 P;  4HQA A;  5HAR A;  1H5X A;  4L0L A;  2WAD A;  2EX2 A;  4NET A;  2GDN A;  2H28 A;  3UB7 A;  5HAP A;  4IED A;  1G6A A;  4LV3 A;  4HP9 A;  2HGV A;  5CRF A;  4S2M A;  4ID4 A;  1W8Y A;  3G34 A;  1L0G A;  3UN7 A;  1NJ4 A;  1TS7 A;  4RQ9 A;  4EEU A;  1K6S A;  4HBU A;  3RXW A;  4R4R A;  3M6B A;  1TD5 A;  1VQQ A;  4I3J A;  4DKI A;  2PR6 A;  4MN5 A;  1E3U A;  2PRF A;  2XSS A;  5HX9 A;  3IXG A;  1CK3 A;  4U0T A;  2ZMF A;  2C5W B;  2WGI A;  2ZC5 B;  1E4D A;  3ZG5 A;  1OTD A;  5CGS A;  2XEP A;  1XJ4 A;  4E6W A;  1YLJ A;  4OPY A;  4DDS A;  1GHM A;  3M6H A;  2XQZ A;  3EEA A;  5GHZ A;  1PWC A;  4Q0I A;  2HV1 A;  3ULF A;  3CG5 A;  3VOY A;  5F68 A;  1V9Y A;  3W2Z A;  4ETX A;  4RA7 A;  3ZG0 A;  3BEC A;  3MFX A;  3MQQ A;  4ZDX A;  3R7W B;  4ZBE A;  4JGR A;  2V1B A;  3IXB A;  1G28 A;  3QP6 A;  3LR3 A;  4WLA A;  2XF3 A;  2HP6 A;  2WK0 A;  2VGL M;  1DJB A;  4HHD A;  1PZP A;  3F1N A;  2K31 A;  1ES4 A;  3F1P A;  5HAI A;  2H10 A;  2EFU A;  1IFQ A;  4JXS A;  5KSH A;  4F3L B;  3ZNY A;  3BY8 A;  4ME4 A;  3PYP A;  1D06 A;  1K6R A;  2Y91 A;  3V67 A;  3T12 B;  1H8Z A;  4L9F A;  2OWH A;  1BLP A;  3AGD A;  3VP2 A;  4RVA A; 
#chains in the Genus database with same CATH homology
 4EW7 A;  3MJQ A;  4JGO A;  4Y2F A;  1ZTU A;  2K2N A;  2M1C A;  3SW1 A;  1V9Z A;  2J3T C;  4I3I A;  1X0O A;  2NUT C;  2QKP A;  4B9O A;  4LRX C;  3VE4 A;  3H7W A;  5FL3 A;  1DP9 A;  4LRZ E;  3ICY A;  3F1P B;  4K08 A;  2D01 A;  2YKF A;  2NUP C;  3KSH A;  4EQ1 A;  2EA9 A;  3A0R A;  2W3F A;  3R4K A;  2P08 A;  1P9R A;  4JGP A;  4L9G A;  2Z6D A;  4WEK A;  1S1Z A;  3CIT A;  3LR5 A;  3NOU C;  3T4Q A;  2ZBB A;  4GCZ A;  5HWV A;  1TF1 A;  3OCN A;  3EQU A;  1T19 A;  3IS2 B;  4R6L A;  1EW0 A;  3EOI A;  3PBT A;  2P7J A;  3OBF A;  2LB9 A;  3F1O B;  4NXG A;  4EXO A;  2EWW A;  2W1T A;  3B47 A;  3KSF A;  4I39 A;  4HJ3 A;  2Y8H A;  4FOF A;  4LPZ A;  3CUE C;  2VA0 A;  4HNB A;  3RH8 B;  2YKH A;  3CI6 A;  3UB9 A;  5I5L A;  2PDR A;  2FH5 A;  3K3D A;  3MF0 A;  3LIC A;  4GW9 A;  5K5B A;  1S4R A;  5IS1 A;  3ZYT A;  3H7W B;  5DKL A;  1DP8 A;  3LR0 A;  4O01 A;  2GX5 A;  2W3D A;  1F98 A;  3D72 A;  4KUK A;  1YSP A;  1D7E A;  2O9B A;  4PAU A;  2K7S A;  3C38 A;  4LRY C;  3UE3 A;  3G6O A;  5TBM B;  2Z6C A;  3U2A A;  4YWZ A;  5DFX A;  4P6Z M;  2G7U A;  4Q0H A;  4R3A A;  1OT9 A;  5HWW A;  4HP4 A;  1STZ A;  4KQO A;  3RFB A;  4B93 A;  1YSQ A;  2VZW A;  5HD5 A;  3T4J A;  3FPW A;  4Q0J A;  2VGL S;  3TE8 A;  4HH2 A;  3T50 A;  2A24 A;  3K3C A;  3RTY A;  3TW8 A;  1P9W A;  4BWI A;  2IA2 A;  4G3V A;  2XA7 M;  4HY8 A;  2VV6 A;  3LUQ A;  1S66 L;  1GSX A;  5IU1 A;  4XT2 A;  4EES A;  4WN5 A;  4JGQ A;  4MMN A;  3A0V A;  3LI9 A;  5AVF A;  1OJG A;  2INW A;  4CQH A;  5EFW A;  1T1C A;  5HDD A;  4MDZ A;  2OAP 1;  2XRN A;  3HJI A;  1XFN A;  3PBS A;  2VV8 A;  4IUH A;  3LIB A;  4WEJ A;  3T4K A;  3D3O A;  2BAS A;  4YOF A;  1LSW A;  3DBA A;  3FC7 A;  3H82 A;  2OOL A;  3VOL A;  4Y5F A;  3T4S A;  1LT0 A;  1ODV A;  4CLC A;  2J80 A;  2O0Y A;  2W3G A;  2A24 B;  4E04 A;  3T4L A;  2GNX A;  2CMN A;  3T4O A;  2HF6 A;  2ZMV A;  4HOI A;  3P01 A;  3CLO A;  4CLC D;  1F9I A;  3BW6 A;  3H9W A;  4DJ3 A;  3PR6 A;  2JHE A;  1W63 M;  1S1Y A;  5AVE A;  3GDI A;  4XT2 B;  3UB6 A;  4DJ2 A;  3F1N B;  2PD8 A;  3S7P A;  5DFY A;  5TJJ A;  1P97 A;  3CWF A;  3KYZ A;  5C5K A;  4I5S A;  3NHQ A;  5J7E A;  2JKR I;  3S7O A;  1F5M A;  3E98 A;  3S7N A;  4Y3I A;  1VB6 A;  3FG8 A;  2GJ3 A;  3OLO A;  4ZRR A;  1UWP X;  2PD7 A;  4H6J A;  3E4Q A;  4MN7 A;  2ZOH A;  2W1R A;  5G4Z A;  3H82 B;  5F6A A;  2VLG A;  3K2N A;  4WUJ A;  4CLC B;  1LL8 A;  3IBJ A;  4I3A A;  2VJW A;  1WA9 A;  5CX7 A;  3E4P A;  1T1A A;  4NXE A;  4BJP A;  3UMD A;  2V9A A;  3MXQ A;  3JVU A;  3PBO A;  1ZHH B;  2JKT I;  3CUE A;  3EQV A;  2QJ5 A;  4IJG A;  2JN7 A;  4DMZ A;  4HJ4 A;  1H3Q A;  4GS9 A;  4Z1W A;  5DKK A;  1MC0 A;  3C30 A;  1NLY A;  2B18 A;  4P6Z S;  3T4T A;  2ZOI A;  3IBR A;  2VV7 A;  2P04 A;  4BBU A;  1XJ2 A;  2PYR A;  3C8C A;  1LSX A;  4GHI A;  4UQI M;  5HDC A;  2VEA A;  2B02 A;  4WF0 A;  1DRM A;  4R38 A;  3E0Y A;  3B33 A;  1Y28 A;  4HH3 A;  2W3H A;  1UGU A;  3PHY A;  3BY9 A;  1T18 A;  2XA7 S;  1DP6 A;  4HJ6 A;  2HJE A;  4O8G A;  1IOU A;  4WL9 A;  2DMW A;  3OOV A;  3KSG A;  1MKM A;  2W0N A;  3MR0 A;  3NOT C;  4F3L A;  3UB8 A;  2W1T B;  3EGD C;  4OOL A;  3A0S A;  4NXF A;  3PBR A;  2KX6 A;  3NJA A;  4ARZ A;  2L0W A;  5MC7 A;  1TS6 A;  1YAX A;  3S7Q A;  3PXP A;  4HI4 A;  3HJK A;  2R78 A;  3LI8 A;  2V1A A;  2PYP A;  2WKP A;  4EET B;  4HIA A;  4KUO A;  1G6O A;  1UWN X;  1JNU A;  1NRJ A;  2J3W A;  4II7 A;  3PBQ A;  2D02 A;  2LB5 A;  3BQ8 A;  3UE6 A;  5IT5 A;  4M4X A;  2W27 A;  5HPF A;  5DF9 A;  4GHI B;  2MJ6 A;  4DN0 A;  2XRO A;  1XJ3 A;  2VX8 A;  2I9V A;  5HD3 A;  3NOP C;  1H8M A;  5KIZ A;  4NKP A;  2OAQ 1;  3B42 A;  3PBN A;  3BQA A;  1W63 Q;  2JKR M;  1YKD A;  4EEP A;  3E4O A;  1GSV A;  3OCL A;  1OPX A;  4HQA A;  1N9N A;  4L0L A;  4MN6 A;  2H28 A;  3UB7 A;  1TS0 A;  4WEL A;  1NWZ A;  4IHQ A;  4CLC C;  5L8M A;  3F1O A;  5HPI A;  3GEC A;  2PR5 A;  4HP9 A;  4KQD A;  2HGV A;  2Y79 A;  3VV4 A;  3LID A;  3HCY A;  1BYW A;  2JKT M;  4PHT A;  4CLC E;  3KYQ A;  2KDK A;  4L9E A;  1TS7 A;  1OT6 A;  2KOI A;  4RQ9 A;  4EEU A;  1S4S A;  4BBV A;  3LIA A;  3TJZ C;  1TD5 A;  4AFI A;  1OJ5 A;  3ZQ5 A;  3MQ0 A;  4I3J A;  4GLQ A;  2PR6 A;  5G4Y A;  1P0Z A;  5TBM A;  4PKY G;  4G3W A;  4MN5 A;  4I38 A;  2QYB A;  3R7W A;  2XSS A;  1XJ6 A;  2WKQ A;  5F5Y A;  1VHM A;  4ETZ A;  4BMW A;  4UQI S;  2ZMF A;  4NXB A;  1GSW A;  2QWS A;  3C2W A;  3VE3 A;  1OTD A;  2OWJ A;  4YNR A;  1XJ4 A;  3LIF A;  3UME A;  3KSI A;  4NEE D;  3BJN A;  2O9C A;  2PHY A;  3LIE A;  4EUV A;  1LSV A;  2M7V A;  2EWV A;  3FPV A;  3EEA A;  4H6J B;  1KOU A;  3EWK A;  4Q0I A;  2HV1 A;  3ULF A;  3KO6 A;  2V0U A;  1NLZ A;  2L1M A;  4R70 A;  2QHK A;  5HSQ A;  5F68 A;  3CAX A;  1V9Y A;  3W2Z A;  4G3K A;  4ETX A;  2GZA A;  5DJU A;  4OOM A;  5HDS A;  3MFX A;  4QPR A;  2WKR A;  2A2L A;  2KLI A;  3LR4 A;  3MQQ A;  3MQO A;  3R7W B;  5J3W A;  4JGR A;  4GJ4 A;  2V1B A;  1G28 A;  2W3E A;  4GS9 B;  4BBT A;  1T1B A;  5J4E A;  3LR3 A;  1OTB A;  4PKY A;  3KX0 X;  3P7N A;  5LBR A;  2V0W A;  4WLA A;  1N9L A;  3EGX C;  4LLO B;  5HZH A;  5DJT A;  2M7U A;  4UEY A;  1OTI A;  4IUK A;  3BWL A;  5A8B A;  2VGL M;  2QJ7 A;  2PT7 A;  2HJ9 C;  1OTA A;  1N9O A;  4HHD A;  3F1N A;  2K31 A;  3O5Y A;  3MMH A;  3F1P A;  5F69 A;  2O9A A;  1S67 L;  2FZ0 A;  3EEH A;  1IFQ A;  4O0P A;  5KSH A;  4F3L B;  3TRC A;  1OTE A;  3BY8 A;  3LFV A;  3JVV A;  4ME4 A;  3PYP A;  1D06 A;  5HL6 A;  4ARZ B;  1MZU A;  4MCW A;  5AJG A;  5HWT A;  3OC2 A;  2VKS A;  2O99 A;  4FSF A;  3LYX A;  3V67 A;  4EER A;  2L4R A;  3IS2 A;  2OWH A;  4L9F A;  2J3T D;  4EU0 A;  1XFQ A;  1TS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...