4XT2B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2B01
4RQ9A 3BY9A 2ZBBA 3IS2B 3F1PA 2PDRA 4HP9A 4BBTA 3UB6A 3F1OA 3HJKA 4GCZA 1OTIA 2V0UA 4YWZA 3VE3A 4F3LA 3F1NB 4NXGA 2V9AA 4BBVA 1T1CA 3KX0X 3NHQA 1G28A 5G4ZA 4B9OA 3H7WB 3H9WA 4EXOA 2B02A 2L0WA 3MXQA 1JNUA 4HHDA 2BASA 4NXBA 3GDIA 1OJGA 4JGPA 3LIDA 2WKRA 3EEHA 3UB7A 2L1MA 3B33A 3UMDA 5TBMB 3NOTC 1S1YA 3H82B 1ODVA 3PHYA 4LLOB 3A0RA 2A24A 2PD7A 4NXFA 2JHEA 4LRYC 1P0ZA 5HDCA 4HNBA 4HIAA 1DP8A 5G4YA 2K7SA 1NWZA 3IBRA 4GHIB 1TS7A 3BY8A 2EA9A 4EEUA 3P7NA 4I3AA 4R70A 5HWVA 5HZHA 4I5SA 4NXEA 1T18A 5HWTA 3OLOA 1XFNA 5DKKA 5A8BA 2PD8A 3MFXA 2H28A 2HV1A 2I9VA 3UMEA 1XJ6A 4JGOA 4BBUA 1TS8A 3MQOA 1UGUA 3MQQA 4LPZA 2D02A 5KIZA 1N9OA 1GSXA 1OJ5A 2PYRA 5I5LA 5F6AA 3K3CA 1WA9A 2ZOHA 3SW1A 4KUOA 5IU1A 1T1BA 3CWFA 2QJ5A 3D72A 5AVEA 4XT2A 2VV6A 1KOUA 1F98A 1S1ZA 2OWHA 4EEPA 2QWSA 3NOPC 4WF0A 3ZQ5A 5HWWA 3LIAA 4H6JB 4WLAA 4EETB 3LIEA 2YKHA 1OTDA 3LIFA 1DRMA 1V9ZA 1S66L 3HJIA 1TS6A 4WN5A 3LUQA 3A0VA 3LIBA 2V1BA 3IS2A 4L9EA 5F68A 2W27A 2VLGA 5IS1A 2R78A 1T1AA 4WUJA 3VE4A 4K08A 4R3AA 3PYPA 5J7EA 2W0NA 3VOLA 1OTEA 3LYXA 3E4OA 2WKPA 4HH3A 3ICYA 3F1NA 4HJ3A 3T50A 3F1PB 3H7WA 5HDSA 1S67L 3F1OB 2WKQA 1P97A 5J3WA 2PHYA 3C2WA 4F3LB 4GS9A 3LI8A 1OTAA 2M1CA 2V1AA 4XT2B 1XFQA 1TS0A 4MN6A 5AVFA 5TBMA 4HY8A 3H82A 4PKYA 3NOUC 4I3JA 3UB9A 3G6OA 3BWLA 4EESA 4DJ2A 4HOIA 3A0SA 1LSVA 2QKPA 4GHIA 2OOLA 2QHKA 3EWKA 1S4SA 2A24B 1V9YA 4I39A 4PKYG 4I3IA 4HP4A 4EQ1A 2ZOIA 4HH2A 1T19A 4MN5A 2VV7A 3LICA 5DJTA 2PR6A 1S4RA 1LSXA 3E4PA 1EW0A 3FC7A 2D01A 4LRXC 5HDDA 1VB6A 1X0OA 2INWA 3MR0A 1DP6A 1D7EA 4R38A 2VV8A 3FG8A 1XJ3A 1MZUA 5HSQA 2Z6CA 1UWNX 4GS9B 3CLOA 5F69A 4KUKA 4LRZE 2YKFA 3GECA 3NJAA 3ULFA 1XJ2A 5DKLA 4KQDA 1BYWA 5HD3A 4L9FA 3UB8A 2P7JA 2L4RA 5J4EA 1LT0A 3CAXA 4R6LA 1D06A 1UWPX 4JGRA 2OWJA 4HQAA 5DJUA 4H6JA 3MJQA 1GSVA 4DJ3A 4HJ4A 2PYPA 4I38A 4WL9A 1LL8A 4HJ6A 1GSWA 5HD5A 5EFWA 1DP9A 3LI9A 4EW7A 2KDKA 4JGQA 3RH8B 1F9IA 4HI4A 3C8CA 2KX6A 3K3DA 4GW9A 4L9GA 5F5YA 3UE6A 4EERA 3RTYA 1N9LA 2J80A 2QJ7A 1OTBA 2VEAA 2Z6DA 2GJ3A 1OT9A 4E04A 1N9NA 2CMNA 2PR5A 1XJ4A 3E4QA 2V0WA 2JN7A 1LSWA 1OT6A 4M4XA 1Y28A
chains in the Genus database with same CATH superfamily
4U0TA 4CLCA 2XK1A 2Y2PA 3UPOA 3MS6A 2PDRA 4BBTA 3L7HA 2HF6A 3F1OA 2A49A 1MWUA 1ZG6A 3JVVA 4NKPA 4KZ7A 3T12B 4OVDA 2MJ6A 3T1QB 3T4KA 3HLCA 1FR6A 4MLLA 3V50A 5CHMA 4KZ9A 1GHMA 4RX3A 1TDLA 3BFGA 1G28A 1MC0A 2JC7A 4B9OA 3H7WB 2K31A 2WGWB 2FH5A 2L0WA 1TD5A 4N9LA 3NBLA 2BASA 5FSRA 5FQMA 4CLCC 3GDIA 4KZ4A 1PYYA 3TRCA 4JF6A 4X69A 1FCOA 2OAQ1 4G3KA 3EEHA 5DFYA 3UB7A 3O5YA 3B33A 3NOTC 1S1YA 3GTCA 3H82B 1EI5A 1K6SA 3V39A 3BW6A 4FSFA 2PD7A 1BT5A 2Y79A 1LHYA 4LRYC 1P0ZA 1JWPA 2IWCA 4H8RA 3PAEA 1YLPA 4IVKA 3V67A 3ZNTA 3ITAA 2G2UA 1MKIA 3GMWA 2JKRI 1JWZA 3BY8A 3S4XA 1PW8A 5HARA 2EA9A 4R23A 4D60A 3P7NA 1NRFA 3NY4A 1ZG4A 5CGXA 3CJMA 4I5SA 3KSHA 4KZAA 4PM8A 3G30A 2WZXA 5A8BA 2B95A 1FIKA 4GLQA 2HV1A 2I9VA 4GDBA 4KZ6A 4E3OA 2DRWA 4BMWA 5IHVA 4ARZA 3BQAA 4WEJA 3G34A 1F2KA 3E2KA 2ZQCA 4A5RA 5F1FA 4ZBEA 1UGUA 4JXVA 3GQZA 4LPZA 3Q7VB 1PNEA 5KIZA 4GOGA 1N9OA 3VMAA 3T4JA 1ES5A 4Y15A 5F6AA 1MBLA 5CERA 3K3CA 2ZOHA 3SW1A 4B88A 2HZ5A 1GHIA 3CWFA 4FCFA 1MWTA 4XT2A 5TFQA 2VV6A 2J3TD 5E2FA 1S1ZA 4G3WA 2VKSA 2OWHA 2Y91A 2ZM8A 1Z09A 3VFFA 4H6JB 4KZ5A 1IYQA 3ZFZA 2YKHA 1SKFA 3FYZA 4JXGA 5M19A 2V1ZA 3CI6A 4OPZA 1KGGA 1LI0A 3VP3A 4BENA 1RP5A 5DVAA 2O9AA 1TS6A 5CECA 1HD8A 4WN5A 5FAPA 3A0VA 3FKVA 3ZGAB 3GVBA 1M6KA 4L9EA 1CI8A 2VLGA 5AQ9A 4MBFA 3AGEA 3M2JA 4WUJA 4QHCA 3VE4A 2XRNA 4YINA 1BUEA 3LYXA 1BLCA 3LGOA 4PM6A 3WS5A 1ALQA 4UEYA 3F1NA 3W8KA 3Q81A 4HEFA 5HL1A 2Q9NA 5EVID 5HAQA 5D3OA 4S2NA 1TDGA 1ZTUA 4JXSA 4FH4A 2WKQA 2JCHA 3QP8A 3G31A 1GA9A 1PWGA 2PHYA 3C2WA 1N9BA 3LI8A 4IUKA 3LCEA 3ZDJA 3BRMA 2M1CA 4XT2B 3CITA 1SKOA 2H10A 3EGXC 3KYZA 5CHJA 2VGLS 4MN6A 1W63M 3A3DA 4HY8A 2H0TA 3PBTA 4PKYA 3BM6A 1NXYA 3NOUC 4ZJ2A 4OPYA 3T4QA 1KE4A 4YNRA 4Y2FA 4HOIA 3O86A 2M7UA 4DN0A 3U2AA 1LSVA 4LV1A 4S2KA 5CTNA 5CEBA 5EECA 3IX4A 3GSGA 1V9YA 4WBGA 5A93A 4PPRA 1M40A 1G6OA 2DMWA 1ERMA 4B93A 2PT7A 4MN5A 2WYXA 5L09A 4IHQA 3LFVA 4N1HA 3LICA 3VSKA 5DJTA 5KSHA 1S4RA 2BG1A 4GN2A 2PU2A 2D01A 2PAVP 4LRXC 2ZQDA 1VB6A 4DDYA 4QJGA 5HX9A 4P87A 3JVUA 2VX8A 4UQIM 3FG8A 1MZUA 3Q7ZA 4DE0A 1K0KA 5HSQA 2Z6CA 5FAQA 1UWNX 2JKRM 3IXGA 4X55A 4EUZA 5HPFA 4LRZE 4WEKA 5GLCA 1K55A 3R7WA 2JBFA 3JPUA 1NYYA 3TJZC 1W8YA 3LEZA 4L9FA 5FQKA 2P7JA 3GRJA 1HLUP 3IT9A 5J4EA 5I94A 3LY3A 1ZHHB 3KSIA 3MXSA 1HTZA 4BD1A 1Z6FA 4E6WA 1UWPX 4GKUA 3BFCA 2EX6A 2Y2OA 4F94A 4GJ4A 5DJUA 1GCEA 1MPLA 5A91A 1GSVA 4LV2A 5CHUA 3VP0A 1MY8A 4Q0IA 1JVJA 3G2ZA 4HJ6A 1PI5A 3CMZA 1K55C 3BFDA 2KDKA 4EW7A 2JKTI 3SH7A 3PBSA 5F82A 4OKPA 3VP1A 1YMXA 4HI4A 5L07A 2OV5A 1TEMA 4IUHA 2IWDA 3C5AA 5M1AA 2QJ7A 2VEAA 1LI9A 5EM1A 1E25A 1RGZA 2Z6DA 2GJ3A 3PBNA 4MEZA 5FEFA 3QNBA 1BTLA 2JN7A 1K25A 1LSWA 1OT6A 1CF0A 4RQ9A 4RYEA 4P0MA 1K4FA 4DE1A 3IS2B 3F1PA 1ES3A 4C6YA 1A0KA 2C5WB 3HLGA 1PWDA 2VGJA 4GCZA 1OTIA 1IOUA 2A2LA 1ACFA 2V0UA 5GHYA 4DF6A 4YWZA 2VA0A 3KYEA 2NUPC 3HLDA 2BTFP 5AJGA 5CRFA 3P01A 1E4DA 4DE3A 1Q2PA 1ES2A 2V9AA 3N8SA 4B4XA 3NHQA 5KZHA 3MQ0A 5G4ZA 2B02A 2ZC4B 3IXBA 3MXQA 3M6BA 1JNUA 4HHDA 3BYDA 2ZL1B 4UHUA 1OJGA 5GLAA 4YOFA 4BLMA 3IF6A 3PBRA 2EXBA 3IWOA 4JGPA 3LIDA 5CGSA 3UDFA 2GNXA 3UMDA 3LR0A 5TBMB 4LGWA 2KLIA 1ODVA 3PHYA 5L8MA 2A24A 3MKFA 4C75A 1FSYA 4NXFA 4OLDA 5M18A 4MDZA 3VP4A 4HNBA 1SDNA 4HIAA 4R0QA 4WMCD 2ZLYA 3ZVTA 3FZCA 1FCNA 2K7SA 2ACGA 4GHIB 3MZFA 1TS7A 3UPNA 3PBQA 1STZA 3UB5P 4CJNA 2OSUA 4I3AA 4R70A 5HWVA 5HZHA 4X68A 3CZDA 1D1JA 1YKDA 1BLPA 3IF6C 1WYBA 1W79A 5HWTA 4CQHA 1AXBA 2EX9A 1VHMA 1KGFA 2R9XA 3MFXA 2ZQ7A 4GB7A 4XXRA 4KENB 2GX5A 4S2MA 3IX3A 1SDEA 1L0EA 4Y3IA 3LR5A 4JGOA 1EWZA 3P98A 1TS8A 2LB9A 3IH8A 4B4ZA 1DY6A 1PI4A 3PR6A 3M2KA 2G7UA 1XP4A 2IWBA 1GSXA 1YLTA 2HP5A 4Q8IA 3NIAA 1OJ5A 1TVFA 3SH8A 3VOYA 2HJ9C 3A3JA 1FOFA 3LO7A 3C4OA 3D72A 3FPVA 3NC8A 5TJJA 1F98A 1VETB 5KSCA 3S7PA 4WM9A 3NOPC 5HWWA 3N8LA 4C3QA 3LIAA 1L0DA 2ZMFA 4KQOA 1VEUA 2ZMAA 3DTMA 1KDSA 2B5RA 5FI7A 2CC1A 3EOIA 4K91A 3DW0A 3ZG5A 1DJAA 2V1BA 5F68A 1L3LA 2W27A 4LV3A 4QB8A 2XD5A 3MF0A 3T1SA 4O7DA 4JF5A 4QPRA 4R3AA 3PYPA 5J7EA 3FV7A 1OTEA 4MBKA 3E4OA 1ZKJA 5AQAA 4BL2A 2O99A 4HH3A 3CPTA 2J9PA 2JKTM 4UAAA 1ZC2A 4IBRA 1K56D 4CLCB 4N1XA 4MBHA 4ZAMA 3VSLA 1IELA 5HDSA 4P85A 5TR7A 3F1OB 3VV4A 5GLBA 3B47A 5GHXA 1NRJA 4GS9A 3IHBA 2RL3A 3OCNA 5HL6A 2WAFA 3DAVA 4Q0JA 5CXWA 5AVFA 2XA7M 4O0PA 4I3JA 1RCJA 4P6ZM 4Y17A 5A90A 1LL9A 4GD8A 3Q1FA 3UO9A 3HLWA 3A0SA 4OOYA 3QP2A 2OOLA 2A3UA 3O3VA 2W3HA 3UN7A 1YLZA 2QHKA 3EWKA 5K5BA 4XUZA 4JXWA 2WADA 1LL5A 4ZRRA 3C38A 4PKYG 5A92A 1PWCA 5KMWA 2DCFA 3TOIA 2RCXA 3P09A 4E3LA 2G2WA 1T19A 4S2PA 2J9OA 2VV7A 1S0WA 4RVAA 3A3FA 3CPTB 1AWIA 4XUXA 4M3KA 3T4TA 5EPHA 5HDDA 4Z1WA 1E3UD 4R1GA 4KZ3A 3C7UA 1DP6A 4R38A 5FASA 3V3RA 3U4LP 2ZQ9A 3QP1A 4DMZA 4KZ8A 4GS9B 3CLOA 4OQHA 5F69A 5FQJA 3IHAA 3IWIA 4LFUA 3IXHA 1HVBA 4MMNA 4ARZB 5E2GA 1XJ2A 4KQDA 1BYWA 2VZWA 2Y55A 2L4RA 1YLWA 1LT0A 2Y2LA 3EQVA 5L2FA 4R6LA 4MN7A 1BLHA 3ZG7B 1I2SA 2Z2MB 5CTMA 4JGRA 2WGVA 5HAPA 4R4SA 4IBXA 5FQ9A 4HJ4A 2PYPA 1K6RA 4JBFA 1LL8A 4DE2A 4UA6A 3T4SA 3L9KA 3OCLA 4Q0HA 3IXDA 1L0FA 5HD5A 1IFQA 3FPWA 4Y7PA 1DP9A 4R3JA 4OOMA 3HREA 5IT5A 2KX6A 4GW9A 5F5YA 3NULA 5DF8A 1N9LA 1OTBA 4KG6A 3SS5A 1XKZA 4OPQA 1OT9A 4S2NC 1BULA 2ZQ8A 1N9NA 2CMNA 3RFBA 4G3VA 3HL9A 3Q82A 3KO6A 1Y28A 4HP9A 3IF5A 3UB6A 3Q07A 3QP6A 2HP9A 3HJKA 4BL3A 4R4RA 1FILA 4F3LA 2XEPA 4WYYA 3ZCZA 3NECA 1WYCA 5MC7A 3F1NB 2XQZA 1MWSA 3MBZA 4BBVA 5CEDA 1T1CA 4PMAA 2ZM2A 3KX0X 2W3GA 3SZTA 3WWXA 1S6RA 2W3DA 1OPXA 3W4OA 4E3MA 4NXBA 2V2FF 1CEFA 1JTGA 4QY6A 3TE8A 3WRTA 2WKRA 1SKOB 2L1MA 4WZ5A 3N7WA 2Y2GA 1EROA 4S2LA 5AQBA 3A0RA 2W3FA 1CI9A 1XX2A 2JHEA 1NYMA 2HP6A 1F5MA 2P9VA 5F1GA 2AVXA 1H8MA 3OZHA 3IQAA 2XR0A 4LCLA 5EVLA 3O88A 3D9YA 5DFXA 5G4YA 3IBRA 4EQIA 2ZQAA 4BWIA 4EEUA 3ZG8B 2IA2A 2QMIA 3BLMA 3HVFA 3KSFA 4KG2A 2X71A 3MSHA 3PTEA 4WZ5C 1XFNA 4E6XA 4OONA 4NETA 5DKKA 5GLDA 5EVIA 4L0LA 2H28A 4OP8A 3S7QA 3C7VA 4KQRA 2PBDP 3TSGA 1NZOA 4CLCD 4IEDA 2Y2MA 1XJ6A 2XFTA 3ZVWA 3MQQA 1SHVA 2D02A 1KE3A 2H0YA 5C5KA 4NG2A 2V20A 4JLFA 3MMHA 2PYRA 4QWOA 3MZDA 3ITBA 2Y2HA 1GHPA 1RGYA 3R7WB 1WA9A 2ZD8A 1IKGA 5EVIC 3NI9A 4D2OA 5EOEA 3HUNA 5DF9A 4JF4A 1KOUA 1P9RA 4EEPA 2KOIA 2XH9A 2ZJ9A 4BJPA 3T4OA 3WRZA 4WF0A 2W1TA 2FFYA 4WLAA 4EETB 4EV4A 4QD4A 1OTDA 2XFSA 2V8CA 2HDQA 3SS4A 1W7FA 4DXBA 3BJNA 3UE1A 3LIFA 1WE4A 2VGKA 4OQ0A 3ZHHA 4EBPA 1DRMA 1YLJA 4ZTKA 4KQQA 3W4PA 2HGVA 3HLFA 4ZJ3A 1NZUA 4QU3A 4Y13A 3LUQA 4DRTA 4ZDXA 3QHYA 5IS1A 3S7NA 2NUTC 3DTIA 4FTXA 1H8ZA 4K08A 4UA7A 1YM1A 4ZJ1A 3VOLA 2O0YA 4YFMA 4DKIA 4EU0A 3S7OA 3DTKA 3OBFA 2Y8HA 3ICYA 3ZYTA 4LCMA 5FQIA 4IVIA 3CG5A 4FD8A 2XROA 3UE3A 2LB5A 3SH9A 1PZOA 3F1PB 4FH2A 3H7WA 2WGWA 3G35A 1P97A 1FR1A 5J3WA 4E3NA 1FCMA 4ESPA 3ZG9B 2R9WA 1OTAA 2V1AA 3UE0A 4FUWA 2OLVA 1TS0A 5FA7A 3H82A 3LEQA 2Y59A 2VGLM 3UB9A 5HPIA 4X1LA 2PRFA 1YPRA 3BECA 4ID4A 4R3BA 4EESA 4DJ2A 3CUEA 3FWLA 2W3EA 1IYSA 2EX8A 3IF6B 2QKPA 4GD6A 5GL9A 5DF7A 1PRQA 2WKEA 2A24B 3BFFA 3UPPA 4I3IA 2O9CA 3ISGA 1H5XA 4EQ1A 3DTEA 4DXCA 4HH2A 3BQ8A 3EQUA 1LSXA 1VM1A 2Y4AA 4AFIA 1DJBA 4U0XA 2EFUA 1EW0A 2WKIA 3N6IA 1L0GA 3CUEC 1X0OA 2Q9MA 2Y2KA 1W63Q 4UQIS 3SS3A 4UA9A 5FI6A 3Q7VA 4CLCE 4GZBA 2Z2LB 2ZC6B 1H3QA 1GA0A 5FDHA 5L10A 4OPRA 4KUKA 1G68A 2YKFA 4E3KA 3W2ZA 1LLBA 1BLSA 5HD3A 2XD1A 4Y0OA 1MXOA 4JKTA 3NDGA 1NJ4A 2M7VA 3CAXA 3B3XA 1FSWA 1D06A 2WAEA 1OMEA 3OC2A 2EX2A 3DWKA 2W1RA 3K2NA 3D4FA 3WS2A 4H6JA 4S2IA 1ESUA 5FDSA 5FAOA 3MJQA 4DJ3A 4GNUA 5JYPA 5LBRA 4LV0A 1GSWA 3V5MA 4WMCA 1CJFA 3D3OA 5U47A 3LI9A 3HUMA 3HBRA 2Y2JA 5CGWA 5E2HA 3RH8B 2O9BA 3S1YA 1P9WA 1PIOA 3C8CA 4IJGA 3K3DA 4EERA 5EVEA 3RTYA 1KDWA 2J80A 1VEUB 2XLNA 5GHZA 2WUQA 1K57A 3AGDA 4K0WA 4NK3A 3G4PA 4MNRA 2PR5A 3HLEA 4M4XA 2XSSA 3BY9A 2ZBBA 1I5QA 3HUOA 1Y54A 4PM7A 4KZBA 5E2EA 1O07A 1J9MA 4JPMA 2Y2NA 4ETZA 4KG5A 3VE3A 5EUAA 2BLSA 3ZNYA 4NXGA 4OP5A 2B18A 1L2SA 3JYIA 3CHWP 4EBNA 3H9WA 4EXOA 1U60A 1K57C 5FQQA 3PBOA 3VOZA 1N4OA 2XGNA 5FATA 1XXMA 2ZC5B 4OLGA 3UNWA 4N92A 2PU4A 3C30A 4Y5FA 2I72A 4P6BA 4OH0A 4WELA 4LLOB 4X6TA 3A3IA 3I7JA 2FZ0A 1NLZA 3GR2A 3PXPA 1QMFA 5HDCA 1IYOA 4PHTA 1ESIA 1XGJA 1DP8A 3ZG0A 3MZEA 2Y2IA 1NWZA 2EFXA 3OPPA 3G32A 3IH9A 3O87A 1NLYA 1YSPA 4NEED 5EE8A 3LR4A 2Q0OA 3UDIA 2ZC3B 4E3IA 4EBLA 1HZOA 4NXEA 3EGDC 1T18A 4II7A 5TGFA 3OLOA 2E8IA 2HDRA 1IEMA 3DBAA 3G2YA 1TF1A 1K56A 2PD8A 1Y4OA 5HW3A 2WK0A 3MKEA 4ME4A 2P04A 3N4IA 2EWVA 5FL3A 3EEAA 4S2JA 1CK3A 2JKGA 5EOOA 3UMEA 1YT4A 4BBUA 3MQOA 1MWRA 3VP2A 1ES4A 2WZZA 4GDNA 3PAGA 4QY5A 2WGIA 5DTKA 2ZMVA 4Y0UA 3IWQA 3OPLA 3OPHA 1KVLA 1QMEA 5I5LA 4HESA 2WKHA 1PZPA 3S22A 1H0MA 3BEBA 3V3SA 3GV9A 5FI2A 4X25A 4KUOA 3NCKA 5IU1A 1T1BA 3B42A 5BOHA 2Y2QA 2QJ5A 5AVEA 1IKIA 2QWSA 1H8YA 2C6WB 3ZQ5A 3W4QA 1YLYA 3LIEA 3QP4A 1PFLA 3HCYA 1YAXA 1PW1A 1BSGA 2HPBA 5E43A 4O01A 1V9ZA 4Z9QA 3UY6A 2K2NA 2ZC7A 1S66L 1NY0A 2VK3A 3HJIA 5EM0A 1JTDA 3BLSA 4X53A 1ONGA 3LIBA 1E3UA 1W5DA 3IS2A 1MKMA 4OQIA 2P08A 4OQGA 3WS4A 1J3WA 1FQGA 4RX2A 3VFHA 2R78A 1T1AA 3T1RA 1K38A 1KVMA 1YQSA 4Y0TA 2W0NA 5CX7A 2X02A 3FKWA 2UV0E 5FEGA 2WKPA 2HDSA 3E0YA 2J3TC 1K54A 4HJ3A 3T50A 1KE0A 1I2WA 5AQ7A 4N9KA 4HBTA 1S67L 1BZAA 4CPKA 2ZL1A 2QYBA 3KSGA 2H5SA 4U3TA 3QNCA 4F3LB 4X56A 2EXAA 3OPRA 3RXWA 1G5UA 1CQAA 1XFQA 2XA7S 5TBMA 4P6ZS 1C3BA 1IYPA 1O7EA 2UWXA 4OOLA 5DTSA 3G6OA 1W8QA 1XA1A 2XDMA 3BWLA 1K54C 2GDNA 3IBJA 1XPBA 3E98A 3BFEA 2J8YA 3M6HA 2EWWA 5F83A 1G6AA 4GHIA 3SOIA 1YMSA 1XGIA 1S4SA 4PAUA 4PM5A 4I39A 2FFFB 4HP4A 2P9VB 2ZOIA 2J7VA 3OOVA 2E8JA 2QPNA 2PR6A 3UDXA 5DTTA 3E4PA 2HDUA 2ZM0A 4S2OA 3HLBA 3FC7A 1SZVA 2QZ6A 5HAIA 3KYQA 4PM9A 3R4KA 5G18A 2INWA 4ETXA 3MR0A 3MXRA 4EWFA 5JYOA 2VJWA 1D7EA 1JWVA 4EUVA 3NDEA 2VV8A 4WZ4A 1XJ3A 1Q2QA 2OAP1 5EVIB 3LY4A 1VQQA 1SCWA 3LR3A 4RA7A 2OLUA 2DNSA 3AGFA 4X1MA 3GECA 3NJAA 3ULFA 3RJUA 5DKLA 2HJEA 5EV0A 4HBUA 4BD0A 2XF3A 3WS1A 1K4EA 3UB8A 3QP5A 4FOFA 3TG9A 2GZAA 3WS0A 1DJCA 5HFOA 1VETA 3RXXA 4LENA 3A3EA 1ONHA 2OWJA 4HQAA 3MFDA 1XA7A 4I38A 4WL9A 3N8RA 4DDSA 2X01A 5EFWA 4BQMA 4E3JA 1ERQA 4JGQA 1F9IA 4K0XA 5J8XA 2V8FA 2JKFA 3IX8A 4O8GA 2W1TB 4L9GA 3UE6A 2P74A 4MCWA 2JE5A 2PBYA 3E2LA 3DWZA 3TW8A 1CEGA 1KGEA 3T1XA 3T4LA 1YSQA 4E04A 2J3WA 1XJ4A 3C4PA 2V0WA 3E4QA
chains in the Genus database with same CATH topology
4RQ9A 3BY9A 4CLCA 2ZBBA 3IS2B 3F1PA 2PDRA 4HP9A 4BBTA 2HF6A 3UB6A 3F1OA 3JVVA 3HJKA 4NKPA 4GCZA 1OTIA 1IOUA 2A2LA 2MJ6A 2V0UA 4ETZA 4YWZA 3VE3A 4F3LA 2VA0A 3T4KA 2NUPC 5MC7A 3F1NB 5AJGA 3P01A 4NXGA 2V9AA 4BBVA 1T1CA 3KX0X 2B18A 3NHQA 1G28A 3MQ0A 1MC0A 5G4ZA 2W3GA 4B9OA 3H7WB 3H9WA 4EXOA 2B02A 2K31A 2W3DA 1OPXA 2FH5A 2L0WA 3MXQA 1JNUA 1TD5A 3PBOA 4HHDA 2BASA 4NXBA 4CLCC 3GDIA 1OJGA 4YOFA 3TRCA 3PBRA 3TE8A 4JGPA 3LIDA 2WKRA 2OAQ1 4G3KA 3EEHA 5DFYA 3UB7A 3C30A 3O5YA 2L1MA 3B33A 2GNXA 3UMDA 3LR0A 5TBMB 4Y5FA 3NOTC 2KLIA 1S1YA 3H82B 1ODVA 4WELA 3PHYA 4LLOB 5L8MA 3A0RA 2A24A 3BW6A 4FSFA 2PD7A 2Y79A 2W3FA 2FZ0A 1NLZA 4NXFA 2JHEA 4LRYC 3PXPA 1F5MA 1P0ZA 5HDCA 4MDZA 4HNBA 1H8MA 4PHTA 4HIAA 1DP8A 3V67A 5DFXA 5G4YA 2K7SA 1NWZA 3IBRA 4GHIB 2JKRI 1TS7A 4BWIA 3BY8A 3PBQA 2EA9A 4EEUA 1NLYA 1STZA 2IA2A 3P7NA 1YSPA 4I3AA 4NEED 4R70A 3LR4A 5HWVA 5HZHA 1YKDA 4I5SA 3KSHA 4NXEA 3KSFA 3EGDC 1T18A 5HWTA 4II7A 4CQHA 3OLOA 1XFNA 3DBAA 5DKKA 5A8BA 1VHMA 1TF1A 2PD8A 4L0LA 3MFXA 2H28A 4GLQA 3S7QA 2HV1A 2I9VA 4ME4A 2P04A 4BMWA 2GX5A 2EWVA 4ARZA 5FL3A 3BQAA 4CLCD 3EEAA 4WEJA 4Y3IA 3UMEA 3LR5A 1XJ6A 4JGOA 4BBUA 1TS8A 3MQOA 2LB9A 1UGUA 3MQQA 4LPZA 2D02A 3PR6A 5KIZA 2ZMVA 1N9OA 2G7UA 1GSXA 5C5KA 3T4JA 3MMHA 1OJ5A 2PYRA 5I5LA 5F6AA 3R7WB 3K3CA 1WA9A 2ZOHA 3SW1A 2HJ9C 4KUOA 5IU1A 1T1BA 3B42A 3CWFA 2QJ5A 3D72A 5AVEA 4XT2A 3FPVA 5DF9A 2VV6A 5TJJA 1KOUA 2J3TD 1F98A 1S1ZA 1P9RA 2VKSA 4G3WA 2OWHA 4EEPA 2KOIA 2QWSA 3S7PA 4BJPA 3T4OA 3NOPC 4WF0A 3ZQ5A 5HWWA 2W1TA 3LIAA 4H6JB 2ZMFA 4WLAA 4EETB 3LIEA 2YKHA 1OTDA 4KQOA 3HCYA 1YAXA 3BJNA 3LIFA 3CI6A 1DRMA 4O01A 1V9ZA 2K2NA 1S66L 3HJIA 2O9AA 2HGVA 1TS6A 3EOIA 4WN5A 3LUQA 3A0VA 3LIBA 2V1BA 3IS2A 1MKMA 2P08A 4L9EA 5F68A 2W27A 2VLGA 5IS1A 2R78A 1T1AA 3S7NA 4WUJA 2NUTC 3MF0A 3VE4A 2XRNA 4K08A 4QPRA 4R3AA 3PYPA 5J7EA 2W0NA 5CX7A 3VOLA 1OTEA 2O0YA 3LYXA 3E4OA 2O99A 4EU0A 2WKPA 3S7OA 4HH3A 3OBFA 2Y8HA 3ICYA 2JKTM 3F1NA 4UEYA 3E0YA 2J3TC 3ZYTA 4HJ3A 3T50A 2XROA 3UE3A 4CLCB 2LB5A 3F1PB 3H7WA 5HDSA 1S67L 3F1OB 1ZTUA 3VV4A 2WKQA 1P97A 3B47A 1NRJA 5J3WA 2QYBA 3KSGA 2PHYA 3C2WA 4F3LB 4GS9A 3LI8A 1OTAA 3OCNA 4IUKA 5HL6A 2M1CA 2V1AA 4XT2B 3CITA 1XFQA 3EGXC 1TS0A 3KYZA 4Q0JA 2VGLS 2XA7S 4MN6A 5AVFA 1W63M 5TBMA 4HY8A 3H82A 4P6ZS 3PBTA 4PKYA 3NOUC 2VGLM 2XA7M 4O0PA 4OOLA 4I3JA 3UB9A 4P6ZM 3T4QA 5HPIA 3G6OA 4YNRA 4Y2FA 3BWLA 3IBJA 4EESA 4DJ2A 3CUEA 3E98A 4HOIA 3A0SA 2EWWA 2W3EA 2M7UA 4DN0A 3U2AA 1LSVA 2QKPA 4GHIA 2OOLA 2W3HA 2QHKA 3EWKA 5K5BA 1S4SA 2A24B 1V9YA 4PAUA 4I39A 4ZRRA 3C38A 4PKYG 4I3IA 2O9CA 4HP4A 1G6OA 2DMWA 4B93A 4EQ1A 2ZOIA 2PT7A 3OOVA 4HH2A 1T19A 4MN5A 4IHQA 3LFVA 2VV7A 3BQ8A 3LICA 5DJTA 5KSHA 3EQUA 2PR6A 1S4RA 1LSXA 4AFIA 3E4PA 1EW0A 3T4TA 3FC7A 2D01A 4LRXC 3KYQA 5HDDA 4Z1WA 3R4KA 3CUEC 1VB6A 1X0OA 1W63Q 2INWA 4ETXA 3MR0A 2VJWA 1DP6A 1D7EA 4UQIS 4R38A 3JVUA 2VX8A 4EUVA 2VV8A 4CLCE 4UQIM 4DMZA 3FG8A 1XJ3A 1H3QA 1MZUA 2OAP1 5HSQA 2Z6CA 1UWNX 2JKRM 4GS9B 3CLOA 3LR3A 5F69A 4KUKA 5HPFA 4LRZE 4MMNA 2YKFA 4ARZB 3GECA 4WEKA 3NJAA 3ULFA 1XJ2A 3W2ZA 5DKLA 2HJEA 3R7WA 4KQDA 1BYWA 2VZWA 3TJZC 5HD3A 4L9FA 3UB8A 4FOFA 2P7JA 2L4RA 5J4EA 1ZHHB 2GZAA 3KSIA 1LT0A 3EQVA 3CAXA 2M7VA 4R6LA 4MN7A 1D06A 1UWPX 3OC2A 4JGRA 2OWJA 2W1RA 3K2NA 4HQAA 4GJ4A 5DJUA 4H6JA 3MJQA 1GSVA 4DJ3A 4HJ4A 2PYPA 4Q0IA 5LBRA 4I38A 4WL9A 1LL8A 4HJ6A 1GSWA 3T4SA 3OCLA 4Q0HA 5HD5A 1IFQA 3D3OA 3FPWA 5EFWA 1DP9A 4OOMA 3LI9A 4EW7A 2KDKA 2JKTI 5IT5A 3PBSA 4JGQA 3RH8B 1F9IA 2O9BA 4HI4A 1P9WA 3C8CA 4IUHA 4O8GA 2W1TB 4IJGA 2KX6A 3K3DA 4GW9A 4L9GA 5F5YA 3UE6A 4EERA 3RTYA 4MCWA 1N9LA 2J80A 2QJ7A 1OTBA 2VEAA 3TW8A 2Z6DA 2GJ3A 1OT9A 3PBNA 3T4LA 1YSQA 4E04A 2J3WA 1N9NA 2CMNA 2PR5A 1XJ4A 3E4QA 2V0WA 3RFBA 4G3VA 2JN7A 1LSWA 1OT6A 4M4XA 3KO6A 1Y28A 2XSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  3BY9 A;  2ZBB A;  3IS2 B;  3F1P A;  2PDR A;  4HP9 A;  4BBT A;  3UB6 A;  3F1O A;  3HJK A;  4GCZ A;  1OTI A;  2V0U A;  4YWZ A;  3VE3 A;  4F3L A;  3F1N B;  4NXG A;  2V9A A;  4BBV A;  1T1C A;  3KX0 X;  3NHQ A;  1G28 A;  5G4Z A;  4B9O A;  3H7W B;  3H9W A;  4EXO A;  2B02 A;  2L0W A;  3MXQ A;  1JNU A;  4HHD A;  2BAS A;  4NXB A;  3GDI A;  1OJG A;  4JGP A;  3LID A;  2WKR A;  3EEH A;  3UB7 A;  2L1M A;  3B33 A;  3UMD A;  5TBM B;  3NOT C;  1S1Y A;  3H82 B;  1ODV A;  3PHY A;  4LLO B;  3A0R A;  2A24 A;  2PD7 A;  4NXF A;  2JHE A;  4LRY C;  1P0Z A;  5HDC A;  4HNB A;  4HIA A;  1DP8 A;  5G4Y A;  2K7S A;  1NWZ A;  3IBR A;  4GHI B;  1TS7 A;  3BY8 A;  2EA9 A;  4EEU A;  3P7N A;  4I3A A;  4R70 A;  5HWV A;  5HZH A;  4I5S A;  4NXE A;  1T18 A;  5HWT A;  3OLO A;  1XFN A;  5DKK A;  5A8B A;  2PD8 A;  3MFX A;  2H28 A;  2HV1 A;  2I9V A;  3UME A;  1XJ6 A;  4JGO A;  4BBU A;  1TS8 A;  3MQO A;  1UGU A;  3MQQ A;  4LPZ A;  2D02 A;  5KIZ A;  1N9O A;  1GSX A;  1OJ5 A;  2PYR A;  5I5L A;  5F6A A;  3K3C A;  1WA9 A;  2ZOH A;  3SW1 A;  4KUO A;  5IU1 A;  1T1B A;  3CWF A;  2QJ5 A;  3D72 A;  5AVE A;  4XT2 A;  2VV6 A;  1KOU A;  1F98 A;  1S1Z A;  2OWH A;  4EEP A;  2QWS A;  3NOP C;  4WF0 A;  3ZQ5 A;  5HWW A;  3LIA A;  4H6J B;  4WLA A;  4EET B;  3LIE A;  2YKH A;  1OTD A;  3LIF A;  1DRM A;  1V9Z A;  1S66 L;  3HJI A;  1TS6 A;  4WN5 A;  3LUQ A;  3A0V A;  3LIB A;  2V1B A;  3IS2 A;  4L9E A;  5F68 A;  2W27 A;  2VLG A;  5IS1 A;  2R78 A;  1T1A A;  4WUJ A;  3VE4 A;  4K08 A;  4R3A A;  3PYP A;  5J7E A;  2W0N A;  3VOL A;  1OTE A;  3LYX A;  3E4O A;  2WKP A;  4HH3 A;  3ICY A;  3F1N A;  4HJ3 A;  3T50 A;  3F1P B;  3H7W A;  5HDS A;  1S67 L;  3F1O B;  2WKQ A;  1P97 A;  5J3W A;  2PHY A;  3C2W A;  4F3L B;  4GS9 A;  3LI8 A;  1OTA A;  2M1C A;  2V1A A;  4XT2 B;  1XFQ A;  1TS0 A;  4MN6 A;  5AVF A;  5TBM A;  4HY8 A;  3H82 A;  4PKY A;  3NOU C;  4I3J A;  3UB9 A;  3G6O A;  3BWL A;  4EES A;  4DJ2 A;  4HOI A;  3A0S A;  1LSV A;  2QKP A;  4GHI A;  2OOL A;  2QHK A;  3EWK A;  1S4S A;  2A24 B;  1V9Y A;  4I39 A;  4PKY G;  4I3I A;  4HP4 A;  4EQ1 A;  2ZOI A;  4HH2 A;  1T19 A;  4MN5 A;  2VV7 A;  3LIC A;  5DJT A;  2PR6 A;  1S4R A;  1LSX A;  3E4P A;  1EW0 A;  3FC7 A;  2D01 A;  4LRX C;  5HDD A;  1VB6 A;  1X0O A;  2INW A;  3MR0 A;  1DP6 A;  1D7E A;  4R38 A;  2VV8 A;  3FG8 A;  1XJ3 A;  1MZU A;  5HSQ A;  2Z6C A;  1UWN X;  4GS9 B;  3CLO A;  5F69 A;  4KUK A;  4LRZ E;  2YKF A;  3GEC A;  3NJA A;  3ULF A;  1XJ2 A;  5DKL A;  4KQD A;  1BYW A;  5HD3 A;  4L9F A;  3UB8 A;  2P7J A;  2L4R A;  5J4E A;  1LT0 A;  3CAX A;  4R6L A;  1D06 A;  1UWP X;  4JGR A;  2OWJ A;  4HQA A;  5DJU A;  4H6J A;  3MJQ A;  1GSV A;  4DJ3 A;  4HJ4 A;  2PYP A;  4I38 A;  4WL9 A;  1LL8 A;  4HJ6 A;  1GSW A;  5HD5 A;  5EFW A;  1DP9 A;  3LI9 A;  4EW7 A;  2KDK A;  4JGQ A;  3RH8 B;  1F9I A;  4HI4 A;  3C8C A;  2KX6 A;  3K3D A;  4GW9 A;  4L9G A;  5F5Y A;  3UE6 A;  4EER A;  3RTY A;  1N9L A;  2J80 A;  2QJ7 A;  1OTB A;  2VEA A;  2Z6D A;  2GJ3 A;  1OT9 A;  4E04 A;  1N9N A;  2CMN A;  2PR5 A;  1XJ4 A;  3E4Q A;  2V0W A;  2JN7 A;  1LSW A;  1OT6 A;  4M4X A;  1Y28 A; 
#chains in the Genus database with same CATH topology
 4U0T A;  4CLC A;  2XK1 A;  2Y2P A;  3UPO A;  3MS6 A;  2PDR A;  4BBT A;  3L7H A;  2HF6 A;  3F1O A;  2A49 A;  1MWU A;  1ZG6 A;  3JVV A;  4NKP A;  4KZ7 A;  3T12 B;  4OVD A;  2MJ6 A;  3T1Q B;  3T4K A;  3HLC A;  1FR6 A;  4MLL A;  3V50 A;  5CHM A;  4KZ9 A;  1GHM A;  4RX3 A;  1TDL A;  3BFG A;  1G28 A;  1MC0 A;  2JC7 A;  4B9O A;  3H7W B;  2K31 A;  2WGW B;  2FH5 A;  2L0W A;  1TD5 A;  4N9L A;  3NBL A;  2BAS A;  5FSR A;  5FQM A;  4CLC C;  3GDI A;  4KZ4 A;  1PYY A;  3TRC A;  4JF6 A;  4X69 A;  1FCO A;  2OAQ 1;  4G3K A;  3EEH A;  5DFY A;  3UB7 A;  3O5Y A;  3B33 A;  3NOT C;  1S1Y A;  3GTC A;  3H82 B;  1EI5 A;  1K6S A;  3V39 A;  3BW6 A;  4FSF A;  2PD7 A;  1BT5 A;  2Y79 A;  1LHY A;  4LRY C;  1P0Z A;  1JWP A;  2IWC A;  4H8R A;  3PAE A;  1YLP A;  4IVK A;  3V67 A;  3ZNT A;  3ITA A;  2G2U A;  1MKI A;  3GMW A;  2JKR I;  1JWZ A;  3BY8 A;  3S4X A;  1PW8 A;  5HAR A;  2EA9 A;  4R23 A;  4D60 A;  3P7N A;  1NRF A;  3NY4 A;  1ZG4 A;  5CGX A;  3CJM A;  4I5S A;  3KSH A;  4KZA A;  4PM8 A;  3G30 A;  2WZX A;  5A8B A;  2B95 A;  1FIK A;  4GLQ A;  2HV1 A;  2I9V A;  4GDB A;  4KZ6 A;  4E3O A;  2DRW A;  4BMW A;  5IHV A;  4ARZ A;  3BQA A;  4WEJ A;  3G34 A;  1F2K A;  3E2K A;  2ZQC A;  4A5R A;  5F1F A;  4ZBE A;  1UGU A;  4JXV A;  3GQZ A;  4LPZ A;  3Q7V B;  1PNE A;  5KIZ A;  4GOG A;  1N9O A;  3VMA A;  3T4J A;  1ES5 A;  4Y15 A;  5F6A A;  1MBL A;  5CER A;  3K3C A;  2ZOH A;  3SW1 A;  4B88 A;  2HZ5 A;  1GHI A;  3CWF A;  4FCF A;  1MWT A;  4XT2 A;  5TFQ A;  2VV6 A;  2J3T D;  5E2F A;  1S1Z A;  4G3W A;  2VKS A;  2OWH A;  2Y91 A;  2ZM8 A;  1Z09 A;  3VFF A;  4H6J B;  4KZ5 A;  1IYQ A;  3ZFZ A;  2YKH A;  1SKF A;  3FYZ A;  4JXG A;  5M19 A;  2V1Z A;  3CI6 A;  4OPZ A;  1KGG A;  1LI0 A;  3VP3 A;  4BEN A;  1RP5 A;  5DVA A;  2O9A A;  1TS6 A;  5CEC A;  1HD8 A;  4WN5 A;  5FAP A;  3A0V A;  3FKV A;  3ZGA B;  3GVB A;  1M6K A;  4L9E A;  1CI8 A;  2VLG A;  5AQ9 A;  4MBF A;  3AGE A;  3M2J A;  4WUJ A;  4QHC A;  3VE4 A;  2XRN A;  4YIN A;  1BUE A;  3LYX A;  1BLC A;  3LGO A;  4PM6 A;  3WS5 A;  1ALQ A;  4UEY A;  3F1N A;  3W8K A;  3Q81 A;  4HEF A;  5HL1 A;  2Q9N A;  5EVI D;  5HAQ A;  5D3O A;  4S2N A;  1TDG A;  1ZTU A;  4JXS A;  4FH4 A;  2WKQ A;  2JCH A;  3QP8 A;  3G31 A;  1GA9 A;  1PWG A;  2PHY A;  3C2W A;  1N9B A;  3LI8 A;  4IUK A;  3LCE A;  3ZDJ A;  3BRM A;  2M1C A;  4XT2 B;  3CIT A;  1SKO A;  2H10 A;  3EGX C;  3KYZ A;  5CHJ A;  2VGL S;  4MN6 A;  1W63 M;  3A3D A;  4HY8 A;  2H0T A;  3PBT A;  4PKY A;  3BM6 A;  1NXY A;  3NOU C;  4ZJ2 A;  4OPY A;  3T4Q A;  1KE4 A;  4YNR A;  4Y2F A;  4HOI A;  3O86 A;  2M7U A;  4DN0 A;  3U2A A;  1LSV A;  4LV1 A;  4S2K A;  5CTN A;  5CEB A;  5EEC A;  3IX4 A;  3GSG A;  1V9Y A;  4WBG A;  5A93 A;  4PPR A;  1M40 A;  1G6O A;  2DMW A;  1ERM A;  4B93 A;  2PT7 A;  4MN5 A;  2WYX A;  5L09 A;  4IHQ A;  3LFV A;  4N1H A;  3LIC A;  3VSK A;  5DJT A;  5KSH A;  1S4R A;  2BG1 A;  4GN2 A;  2PU2 A;  2D01 A;  2PAV P;  4LRX C;  2ZQD A;  1VB6 A;  4DDY A;  4QJG A;  5HX9 A;  4P87 A;  3JVU A;  2VX8 A;  4UQI M;  3FG8 A;  1MZU A;  3Q7Z A;  4DE0 A;  1K0K A;  5HSQ A;  2Z6C A;  5FAQ A;  1UWN X;  2JKR M;  3IXG A;  4X55 A;  4EUZ A;  5HPF A;  4LRZ E;  4WEK A;  5GLC A;  1K55 A;  3R7W A;  2JBF A;  3JPU A;  1NYY A;  3TJZ C;  1W8Y A;  3LEZ A;  4L9F A;  5FQK A;  2P7J A;  3GRJ A;  1HLU P;  3IT9 A;  5J4E A;  5I94 A;  3LY3 A;  1ZHH B;  3KSI A;  3MXS A;  1HTZ A;  4BD1 A;  1Z6F A;  4E6W A;  1UWP X;  4GKU A;  3BFC A;  2EX6 A;  2Y2O A;  4F94 A;  4GJ4 A;  5DJU A;  1GCE A;  1MPL A;  5A91 A;  1GSV A;  4LV2 A;  5CHU A;  3VP0 A;  1MY8 A;  4Q0I A;  1JVJ A;  3G2Z A;  4HJ6 A;  1PI5 A;  3CMZ A;  1K55 C;  3BFD A;  2KDK A;  4EW7 A;  2JKT I;  3SH7 A;  3PBS A;  5F82 A;  4OKP A;  3VP1 A;  1YMX A;  4HI4 A;  5L07 A;  2OV5 A;  1TEM A;  4IUH A;  2IWD A;  3C5A A;  5M1A A;  2QJ7 A;  2VEA A;  1LI9 A;  5EM1 A;  1E25 A;  1RGZ A;  2Z6D A;  2GJ3 A;  3PBN A;  4MEZ A;  5FEF A;  3QNB A;  1BTL A;  2JN7 A;  1K25 A;  1LSW A;  1OT6 A;  1CF0 A;  4RQ9 A;  4RYE A;  4P0M A;  1K4F A;  4DE1 A;  3IS2 B;  3F1P A;  1ES3 A;  4C6Y A;  1A0K A;  2C5W B;  3HLG A;  1PWD A;  2VGJ A;  4GCZ A;  1OTI A;  1IOU A;  2A2L A;  1ACF A;  2V0U A;  5GHY A;  4DF6 A;  4YWZ A;  2VA0 A;  3KYE A;  2NUP C;  3HLD A;  2BTF P;  5AJG A;  5CRF A;  3P01 A;  1E4D A;  4DE3 A;  1Q2P A;  1ES2 A;  2V9A A;  3N8S A;  4B4X A;  3NHQ A;  5KZH A;  3MQ0 A;  5G4Z A;  2B02 A;  2ZC4 B;  3IXB A;  3MXQ A;  3M6B A;  1JNU A;  4HHD A;  3BYD A;  2ZL1 B;  4UHU A;  1OJG A;  5GLA A;  4YOF A;  4BLM A;  3IF6 A;  3PBR A;  2EXB A;  3IWO A;  4JGP A;  3LID A;  5CGS A;  3UDF A;  2GNX A;  3UMD A;  3LR0 A;  5TBM B;  4LGW A;  2KLI A;  1ODV A;  3PHY A;  5L8M A;  2A24 A;  3MKF A;  4C75 A;  1FSY A;  4NXF A;  4OLD A;  5M18 A;  4MDZ A;  3VP4 A;  4HNB A;  1SDN A;  4HIA A;  4R0Q A;  4WMC D;  2ZLY A;  3ZVT A;  3FZC A;  1FCN A;  2K7S A;  2ACG A;  4GHI B;  3MZF A;  1TS7 A;  3UPN A;  3PBQ A;  1STZ A;  3UB5 P;  4CJN A;  2OSU A;  4I3A A;  4R70 A;  5HWV A;  5HZH A;  4X68 A;  3CZD A;  1D1J A;  1YKD A;  1BLP A;  3IF6 C;  1WYB A;  1W79 A;  5HWT A;  4CQH A;  1AXB A;  2EX9 A;  1VHM A;  1KGF A;  2R9X A;  3MFX A;  2ZQ7 A;  4GB7 A;  4XXR A;  4KEN B;  2GX5 A;  4S2M A;  3IX3 A;  1SDE A;  1L0E A;  4Y3I A;  3LR5 A;  4JGO A;  1EWZ A;  3P98 A;  1TS8 A;  2LB9 A;  3IH8 A;  4B4Z A;  1DY6 A;  1PI4 A;  3PR6 A;  3M2K A;  2G7U A;  1XP4 A;  2IWB A;  1GSX A;  1YLT A;  2HP5 A;  4Q8I A;  3NIA A;  1OJ5 A;  1TVF A;  3SH8 A;  3VOY A;  2HJ9 C;  3A3J A;  1FOF A;  3LO7 A;  3C4O A;  3D72 A;  3FPV A;  3NC8 A;  5TJJ A;  1F98 A;  1VET B;  5KSC A;  3S7P A;  4WM9 A;  3NOP C;  5HWW A;  3N8L A;  4C3Q A;  3LIA A;  1L0D A;  2ZMF A;  4KQO A;  1VEU A;  2ZMA A;  3DTM A;  1KDS A;  2B5R A;  5FI7 A;  2CC1 A;  3EOI A;  4K91 A;  3DW0 A;  3ZG5 A;  1DJA A;  2V1B A;  5F68 A;  1L3L A;  2W27 A;  4LV3 A;  4QB8 A;  2XD5 A;  3MF0 A;  3T1S A;  4O7D A;  4JF5 A;  4QPR A;  4R3A A;  3PYP A;  5J7E A;  3FV7 A;  1OTE A;  4MBK A;  3E4O A;  1ZKJ A;  5AQA A;  4BL2 A;  2O99 A;  4HH3 A;  3CPT A;  2J9P A;  2JKT M;  4UAA A;  1ZC2 A;  4IBR A;  1K56 D;  4CLC B;  4N1X A;  4MBH A;  4ZAM A;  3VSL A;  1IEL A;  5HDS A;  4P85 A;  5TR7 A;  3F1O B;  3VV4 A;  5GLB A;  3B47 A;  5GHX A;  1NRJ A;  4GS9 A;  3IHB A;  2RL3 A;  3OCN A;  5HL6 A;  2WAF A;  3DAV A;  4Q0J A;  5CXW A;  5AVF A;  2XA7 M;  4O0P A;  4I3J A;  1RCJ A;  4P6Z M;  4Y17 A;  5A90 A;  1LL9 A;  4GD8 A;  3Q1F A;  3UO9 A;  3HLW A;  3A0S A;  4OOY A;  3QP2 A;  2OOL A;  2A3U A;  3O3V A;  2W3H A;  3UN7 A;  1YLZ A;  2QHK A;  3EWK A;  5K5B A;  4XUZ A;  4JXW A;  2WAD A;  1LL5 A;  4ZRR A;  3C38 A;  4PKY G;  5A92 A;  1PWC A;  5KMW A;  2DCF A;  3TOI A;  2RCX A;  3P09 A;  4E3L A;  2G2W A;  1T19 A;  4S2P A;  2J9O A;  2VV7 A;  1S0W A;  4RVA A;  3A3F A;  3CPT B;  1AWI A;  4XUX A;  4M3K A;  3T4T A;  5EPH A;  5HDD A;  4Z1W A;  1E3U D;  4R1G A;  4KZ3 A;  3C7U A;  1DP6 A;  4R38 A;  5FAS A;  3V3R A;  3U4L P;  2ZQ9 A;  3QP1 A;  4DMZ A;  4KZ8 A;  4GS9 B;  3CLO A;  4OQH A;  5F69 A;  5FQJ A;  3IHA A;  3IWI A;  4LFU A;  3IXH A;  1HVB A;  4MMN A;  4ARZ B;  5E2G A;  1XJ2 A;  4KQD A;  1BYW A;  2VZW A;  2Y55 A;  2L4R A;  1YLW A;  1LT0 A;  2Y2L A;  3EQV A;  5L2F A;  4R6L A;  4MN7 A;  1BLH A;  3ZG7 B;  1I2S A;  2Z2M B;  5CTM A;  4JGR A;  2WGV A;  5HAP A;  4R4S A;  4IBX A;  5FQ9 A;  4HJ4 A;  2PYP A;  1K6R A;  4JBF A;  1LL8 A;  4DE2 A;  4UA6 A;  3T4S A;  3L9K A;  3OCL A;  4Q0H A;  3IXD A;  1L0F A;  5HD5 A;  1IFQ A;  3FPW A;  4Y7P A;  1DP9 A;  4R3J A;  4OOM A;  3HRE A;  5IT5 A;  2KX6 A;  4GW9 A;  5F5Y A;  3NUL A;  5DF8 A;  1N9L A;  1OTB A;  4KG6 A;  3SS5 A;  1XKZ A;  4OPQ A;  1OT9 A;  4S2N C;  1BUL A;  2ZQ8 A;  1N9N A;  2CMN A;  3RFB A;  4G3V A;  3HL9 A;  3Q82 A;  3KO6 A;  1Y28 A;  4HP9 A;  3IF5 A;  3UB6 A;  3Q07 A;  3QP6 A;  2HP9 A;  3HJK A;  4BL3 A;  4R4R A;  1FIL A;  4F3L A;  2XEP A;  4WYY A;  3ZCZ A;  3NEC A;  1WYC A;  5MC7 A;  3F1N B;  2XQZ A;  1MWS A;  3MBZ A;  4BBV A;  5CED A;  1T1C A;  4PMA A;  2ZM2 A;  3KX0 X;  2W3G A;  3SZT A;  3WWX A;  1S6R A;  2W3D A;  1OPX A;  3W4O A;  4E3M A;  4NXB A;  2V2F F;  1CEF A;  1JTG A;  4QY6 A;  3TE8 A;  3WRT A;  2WKR A;  1SKO B;  2L1M A;  4WZ5 A;  3N7W A;  2Y2G A;  1ERO A;  4S2L A;  5AQB A;  3A0R A;  2W3F A;  1CI9 A;  1XX2 A;  2JHE A;  1NYM A;  2HP6 A;  1F5M A;  2P9V A;  5F1G A;  2AVX A;  1H8M A;  3OZH A;  3IQA A;  2XR0 A;  4LCL A;  5EVL A;  3O88 A;  3D9Y A;  5DFX A;  5G4Y A;  3IBR A;  4EQI A;  2ZQA A;  4BWI A;  4EEU A;  3ZG8 B;  2IA2 A;  2QMI A;  3BLM A;  3HVF A;  3KSF A;  4KG2 A;  2X71 A;  3MSH A;  3PTE A;  4WZ5 C;  1XFN A;  4E6X A;  4OON A;  4NET A;  5DKK A;  5GLD A;  5EVI A;  4L0L A;  2H28 A;  4OP8 A;  3S7Q A;  3C7V A;  4KQR A;  2PBD P;  3TSG A;  1NZO A;  4CLC D;  4IED A;  2Y2M A;  1XJ6 A;  2XFT A;  3ZVW A;  3MQQ A;  1SHV A;  2D02 A;  1KE3 A;  2H0Y A;  5C5K A;  4NG2 A;  2V20 A;  4JLF A;  3MMH A;  2PYR A;  4QWO A;  3MZD A;  3ITB A;  2Y2H A;  1GHP A;  1RGY A;  3R7W B;  1WA9 A;  2ZD8 A;  1IKG A;  5EVI C;  3NI9 A;  4D2O A;  5EOE A;  3HUN A;  5DF9 A;  4JF4 A;  1KOU A;  1P9R A;  4EEP A;  2KOI A;  2XH9 A;  2ZJ9 A;  4BJP A;  3T4O A;  3WRZ A;  4WF0 A;  2W1T A;  2FFY A;  4WLA A;  4EET B;  4EV4 A;  4QD4 A;  1OTD A;  2XFS A;  2V8C A;  2HDQ A;  3SS4 A;  1W7F A;  4DXB A;  3BJN A;  3UE1 A;  3LIF A;  1WE4 A;  2VGK A;  4OQ0 A;  3ZHH A;  4EBP A;  1DRM A;  1YLJ A;  4ZTK A;  4KQQ A;  3W4P A;  2HGV A;  3HLF A;  4ZJ3 A;  1NZU A;  4QU3 A;  4Y13 A;  3LUQ A;  4DRT A;  4ZDX A;  3QHY A;  5IS1 A;  3S7N A;  2NUT C;  3DTI A;  4FTX A;  1H8Z A;  4K08 A;  4UA7 A;  1YM1 A;  4ZJ1 A;  3VOL A;  2O0Y A;  4YFM A;  4DKI A;  4EU0 A;  3S7O A;  3DTK A;  3OBF A;  2Y8H A;  3ICY A;  3ZYT A;  4LCM A;  5FQI A;  4IVI A;  3CG5 A;  4FD8 A;  2XRO A;  3UE3 A;  2LB5 A;  3SH9 A;  1PZO A;  3F1P B;  4FH2 A;  3H7W A;  2WGW A;  3G35 A;  1P97 A;  1FR1 A;  5J3W A;  4E3N A;  1FCM A;  4ESP A;  3ZG9 B;  2R9W A;  1OTA A;  2V1A A;  3UE0 A;  4FUW A;  2OLV A;  1TS0 A;  5FA7 A;  3H82 A;  3LEQ A;  2Y59 A;  2VGL M;  3UB9 A;  5HPI A;  4X1L A;  2PRF A;  1YPR A;  3BEC A;  4ID4 A;  4R3B A;  4EES A;  4DJ2 A;  3CUE A;  3FWL A;  2W3E A;  1IYS A;  2EX8 A;  3IF6 B;  2QKP A;  4GD6 A;  5GL9 A;  5DF7 A;  1PRQ A;  2WKE A;  2A24 B;  3BFF A;  3UPP A;  4I3I A;  2O9C A;  3ISG A;  1H5X A;  4EQ1 A;  3DTE A;  4DXC A;  4HH2 A;  3BQ8 A;  3EQU A;  1LSX A;  1VM1 A;  2Y4A A;  4AFI A;  1DJB A;  4U0X A;  2EFU A;  1EW0 A;  2WKI A;  3N6I A;  1L0G A;  3CUE C;  1X0O A;  2Q9M A;  2Y2K A;  1W63 Q;  4UQI S;  3SS3 A;  4UA9 A;  5FI6 A;  3Q7V A;  4CLC E;  4GZB A;  2Z2L B;  2ZC6 B;  1H3Q A;  1GA0 A;  5FDH A;  5L10 A;  4OPR A;  4KUK A;  1G68 A;  2YKF A;  4E3K A;  3W2Z A;  1LLB A;  1BLS A;  5HD3 A;  2XD1 A;  4Y0O A;  1MXO A;  4JKT A;  3NDG A;  1NJ4 A;  2M7V A;  3CAX A;  3B3X A;  1FSW A;  1D06 A;  2WAE A;  1OME A;  3OC2 A;  2EX2 A;  3DWK A;  2W1R A;  3K2N A;  3D4F A;  3WS2 A;  4H6J A;  4S2I A;  1ESU A;  5FDS A;  5FAO A;  3MJQ A;  4DJ3 A;  4GNU A;  5JYP A;  5LBR A;  4LV0 A;  1GSW A;  3V5M A;  4WMC A;  1CJF A;  3D3O A;  5U47 A;  3LI9 A;  3HUM A;  3HBR A;  2Y2J A;  5CGW A;  5E2H A;  3RH8 B;  2O9B A;  3S1Y A;  1P9W A;  1PIO A;  3C8C A;  4IJG A;  3K3D A;  4EER A;  5EVE A;  3RTY A;  1KDW A;  2J80 A;  1VEU B;  2XLN A;  5GHZ A;  2WUQ A;  1K57 A;  3AGD A;  4K0W A;  4NK3 A;  3G4P A;  4MNR A;  2PR5 A;  3HLE A;  4M4X A;  2XSS A;  3BY9 A;  2ZBB A;  1I5Q A;  3HUO A;  1Y54 A;  4PM7 A;  4KZB A;  5E2E A;  1O07 A;  1J9M A;  4JPM A;  2Y2N A;  4ETZ A;  4KG5 A;  3VE3 A;  5EUA A;  2BLS A;  3ZNY A;  4NXG A;  4OP5 A;  2B18 A;  1L2S A;  3JYI A;  3CHW P;  4EBN A;  3H9W A;  4EXO A;  1U60 A;  1K57 C;  5FQQ A;  3PBO A;  3VOZ A;  1N4O A;  2XGN A;  5FAT A;  1XXM A;  2ZC5 B;  4OLG A;  3UNW A;  4N92 A;  2PU4 A;  3C30 A;  4Y5F A;  2I72 A;  4P6B A;  4OH0 A;  4WEL A;  4LLO B;  4X6T A;  3A3I A;  3I7J A;  2FZ0 A;  1NLZ A;  3GR2 A;  3PXP A;  1QMF A;  5HDC A;  1IYO A;  4PHT A;  1ESI A;  1XGJ A;  1DP8 A;  3ZG0 A;  3MZE A;  2Y2I A;  1NWZ A;  2EFX A;  3OPP A;  3G32 A;  3IH9 A;  3O87 A;  1NLY A;  1YSP A;  4NEE D;  5EE8 A;  3LR4 A;  2Q0O A;  3UDI A;  2ZC3 B;  4E3I A;  4EBL A;  1HZO A;  4NXE A;  3EGD C;  1T18 A;  4II7 A;  5TGF A;  3OLO A;  2E8I A;  2HDR A;  1IEM A;  3DBA A;  3G2Y A;  1TF1 A;  1K56 A;  2PD8 A;  1Y4O A;  5HW3 A;  2WK0 A;  3MKE A;  4ME4 A;  2P04 A;  3N4I A;  2EWV A;  5FL3 A;  3EEA A;  4S2J A;  1CK3 A;  2JKG A;  5EOO A;  3UME A;  1YT4 A;  4BBU A;  3MQO A;  1MWR A;  3VP2 A;  1ES4 A;  2WZZ A;  4GDN A;  3PAG A;  4QY5 A;  2WGI A;  5DTK A;  2ZMV A;  4Y0U A;  3IWQ A;  3OPL A;  3OPH A;  1KVL A;  1QME A;  5I5L A;  4HES A;  2WKH A;  1PZP A;  3S22 A;  1H0M A;  3BEB A;  3V3S A;  3GV9 A;  5FI2 A;  4X25 A;  4KUO A;  3NCK A;  5IU1 A;  1T1B A;  3B42 A;  5BOH A;  2Y2Q A;  2QJ5 A;  5AVE A;  1IKI A;  2QWS A;  1H8Y A;  2C6W B;  3ZQ5 A;  3W4Q A;  1YLY A;  3LIE A;  3QP4 A;  1PFL A;  3HCY A;  1YAX A;  1PW1 A;  1BSG A;  2HPB A;  5E43 A;  4O01 A;  1V9Z A;  4Z9Q A;  3UY6 A;  2K2N A;  2ZC7 A;  1S66 L;  1NY0 A;  2VK3 A;  3HJI A;  5EM0 A;  1JTD A;  3BLS A;  4X53 A;  1ONG A;  3LIB A;  1E3U A;  1W5D A;  3IS2 A;  1MKM A;  4OQI A;  2P08 A;  4OQG A;  3WS4 A;  1J3W A;  1FQG A;  4RX2 A;  3VFH A;  2R78 A;  1T1A A;  3T1R A;  1K38 A;  1KVM A;  1YQS A;  4Y0T A;  2W0N A;  5CX7 A;  2X02 A;  3FKW A;  2UV0 E;  5FEG A;  2WKP A;  2HDS A;  3E0Y A;  2J3T C;  1K54 A;  4HJ3 A;  3T50 A;  1KE0 A;  1I2W A;  5AQ7 A;  4N9K A;  4HBT A;  1S67 L;  1BZA A;  4CPK A;  2ZL1 A;  2QYB A;  3KSG A;  2H5S A;  4U3T A;  3QNC A;  4F3L B;  4X56 A;  2EXA A;  3OPR A;  3RXW A;  1G5U A;  1CQA A;  1XFQ A;  2XA7 S;  5TBM A;  4P6Z S;  1C3B A;  1IYP A;  1O7E A;  2UWX A;  4OOL A;  5DTS A;  3G6O A;  1W8Q A;  1XA1 A;  2XDM A;  3BWL A;  1K54 C;  2GDN A;  3IBJ A;  1XPB A;  3E98 A;  3BFE A;  2J8Y A;  3M6H A;  2EWW A;  5F83 A;  1G6A A;  4GHI A;  3SOI A;  1YMS A;  1XGI A;  1S4S A;  4PAU A;  4PM5 A;  4I39 A;  2FFF B;  4HP4 A;  2P9V B;  2ZOI A;  2J7V A;  3OOV A;  2E8J A;  2QPN A;  2PR6 A;  3UDX A;  5DTT A;  3E4P A;  2HDU A;  2ZM0 A;  4S2O A;  3HLB A;  3FC7 A;  1SZV A;  2QZ6 A;  5HAI A;  3KYQ A;  4PM9 A;  3R4K A;  5G18 A;  2INW A;  4ETX A;  3MR0 A;  3MXR A;  4EWF A;  5JYO A;  2VJW A;  1D7E A;  1JWV A;  4EUV A;  3NDE A;  2VV8 A;  4WZ4 A;  1XJ3 A;  1Q2Q A;  2OAP 1;  5EVI B;  3LY4 A;  1VQQ A;  1SCW A;  3LR3 A;  4RA7 A;  2OLU A;  2DNS A;  3AGF A;  4X1M A;  3GEC A;  3NJA A;  3ULF A;  3RJU A;  5DKL A;  2HJE A;  5EV0 A;  4HBU A;  4BD0 A;  2XF3 A;  3WS1 A;  1K4E A;  3UB8 A;  3QP5 A;  4FOF A;  3TG9 A;  2GZA A;  3WS0 A;  1DJC A;  5HFO A;  1VET A;  3RXX A;  4LEN A;  3A3E A;  1ONH A;  2OWJ A;  4HQA A;  3MFD A;  1XA7 A;  4I38 A;  4WL9 A;  3N8R A;  4DDS A;  2X01 A;  5EFW A;  4BQM A;  4E3J A;  1ERQ A;  4JGQ A;  1F9I A;  4K0X A;  5J8X A;  2V8F A;  2JKF A;  3IX8 A;  4O8G A;  2W1T B;  4L9G A;  3UE6 A;  2P74 A;  4MCW A;  2JE5 A;  2PBY A;  3E2L A;  3DWZ A;  3TW8 A;  1CEG A;  1KGE A;  3T1X A;  3T4L A;  1YSQ A;  4E04 A;  2J3W A;  1XJ4 A;  3C4P A;  2V0W A;  3E4Q A; 
#chains in the Genus database with same CATH homology
 4RQ9 A;  3BY9 A;  4CLC A;  2ZBB A;  3IS2 B;  3F1P A;  2PDR A;  4HP9 A;  4BBT A;  2HF6 A;  3UB6 A;  3F1O A;  3JVV A;  3HJK A;  4NKP A;  4GCZ A;  1OTI A;  1IOU A;  2A2L A;  2MJ6 A;  2V0U A;  4ETZ A;  4YWZ A;  3VE3 A;  4F3L A;  2VA0 A;  3T4K A;  2NUP C;  5MC7 A;  3F1N B;  5AJG A;  3P01 A;  4NXG A;  2V9A A;  4BBV A;  1T1C A;  3KX0 X;  2B18 A;  3NHQ A;  1G28 A;  3MQ0 A;  1MC0 A;  5G4Z A;  2W3G A;  4B9O A;  3H7W B;  3H9W A;  4EXO A;  2B02 A;  2K31 A;  2W3D A;  1OPX A;  2FH5 A;  2L0W A;  3MXQ A;  1JNU A;  1TD5 A;  3PBO A;  4HHD A;  2BAS A;  4NXB A;  4CLC C;  3GDI A;  1OJG A;  4YOF A;  3TRC A;  3PBR A;  3TE8 A;  4JGP A;  3LID A;  2WKR A;  2OAQ 1;  4G3K A;  3EEH A;  5DFY A;  3UB7 A;  3C30 A;  3O5Y A;  2L1M A;  3B33 A;  2GNX A;  3UMD A;  3LR0 A;  5TBM B;  4Y5F A;  3NOT C;  2KLI A;  1S1Y A;  3H82 B;  1ODV A;  4WEL A;  3PHY A;  4LLO B;  5L8M A;  3A0R A;  2A24 A;  3BW6 A;  4FSF A;  2PD7 A;  2Y79 A;  2W3F A;  2FZ0 A;  1NLZ A;  4NXF A;  2JHE A;  4LRY C;  3PXP A;  1F5M A;  1P0Z A;  5HDC A;  4MDZ A;  4HNB A;  1H8M A;  4PHT A;  4HIA A;  1DP8 A;  3V67 A;  5DFX A;  5G4Y A;  2K7S A;  1NWZ A;  3IBR A;  4GHI B;  2JKR I;  1TS7 A;  4BWI A;  3BY8 A;  3PBQ A;  2EA9 A;  4EEU A;  1NLY A;  1STZ A;  2IA2 A;  3P7N A;  1YSP A;  4I3A A;  4NEE D;  4R70 A;  3LR4 A;  5HWV A;  5HZH A;  1YKD A;  4I5S A;  3KSH A;  4NXE A;  3KSF A;  3EGD C;  1T18 A;  5HWT A;  4II7 A;  4CQH A;  3OLO A;  1XFN A;  3DBA A;  5DKK A;  5A8B A;  1VHM A;  1TF1 A;  2PD8 A;  4L0L A;  3MFX A;  2H28 A;  4GLQ A;  3S7Q A;  2HV1 A;  2I9V A;  4ME4 A;  2P04 A;  4BMW A;  2GX5 A;  2EWV A;  4ARZ A;  5FL3 A;  3BQA A;  4CLC D;  3EEA A;  4WEJ A;  4Y3I A;  3UME A;  3LR5 A;  1XJ6 A;  4JGO A;  4BBU A;  1TS8 A;  3MQO A;  2LB9 A;  1UGU A;  3MQQ A;  4LPZ A;  2D02 A;  3PR6 A;  5KIZ A;  2ZMV A;  1N9O A;  2G7U A;  1GSX A;  5C5K A;  3T4J A;  3MMH A;  1OJ5 A;  2PYR A;  5I5L A;  5F6A A;  3R7W B;  3K3C A;  1WA9 A;  2ZOH A;  3SW1 A;  2HJ9 C;  4KUO A;  5IU1 A;  1T1B A;  3B42 A;  3CWF A;  2QJ5 A;  3D72 A;  5AVE A;  4XT2 A;  3FPV A;  5DF9 A;  2VV6 A;  5TJJ A;  1KOU A;  2J3T D;  1F98 A;  1S1Z A;  1P9R A;  2VKS A;  4G3W A;  2OWH A;  4EEP A;  2KOI A;  2QWS A;  3S7P A;  4BJP A;  3T4O A;  3NOP C;  4WF0 A;  3ZQ5 A;  5HWW A;  2W1T A;  3LIA A;  4H6J B;  2ZMF A;  4WLA A;  4EET B;  3LIE A;  2YKH A;  1OTD A;  4KQO A;  3HCY A;  1YAX A;  3BJN A;  3LIF A;  3CI6 A;  1DRM A;  4O01 A;  1V9Z A;  2K2N A;  1S66 L;  3HJI A;  2O9A A;  2HGV A;  1TS6 A;  3EOI A;  4WN5 A;  3LUQ A;  3A0V A;  3LIB A;  2V1B A;  3IS2 A;  1MKM A;  2P08 A;  4L9E A;  5F68 A;  2W27 A;  2VLG A;  5IS1 A;  2R78 A;  1T1A A;  3S7N A;  4WUJ A;  2NUT C;  3MF0 A;  3VE4 A;  2XRN A;  4K08 A;  4QPR A;  4R3A A;  3PYP A;  5J7E A;  2W0N A;  5CX7 A;  3VOL A;  1OTE A;  2O0Y A;  3LYX A;  3E4O A;  2O99 A;  4EU0 A;  2WKP A;  3S7O A;  4HH3 A;  3OBF A;  2Y8H A;  3ICY A;  2JKT M;  3F1N A;  4UEY A;  3E0Y A;  2J3T C;  3ZYT A;  4HJ3 A;  3T50 A;  2XRO A;  3UE3 A;  4CLC B;  2LB5 A;  3F1P B;  3H7W A;  5HDS A;  1S67 L;  3F1O B;  1ZTU A;  3VV4 A;  2WKQ A;  1P97 A;  3B47 A;  1NRJ A;  5J3W A;  2QYB A;  3KSG A;  2PHY A;  3C2W A;  4F3L B;  4GS9 A;  3LI8 A;  1OTA A;  3OCN A;  4IUK A;  5HL6 A;  2M1C A;  2V1A A;  4XT2 B;  3CIT A;  1XFQ A;  3EGX C;  1TS0 A;  3KYZ A;  4Q0J A;  2VGL S;  2XA7 S;  4MN6 A;  5AVF A;  1W63 M;  5TBM A;  4HY8 A;  3H82 A;  4P6Z S;  3PBT A;  4PKY A;  3NOU C;  2VGL M;  2XA7 M;  4O0P A;  4OOL A;  4I3J A;  3UB9 A;  4P6Z M;  3T4Q A;  5HPI A;  3G6O A;  4YNR A;  4Y2F A;  3BWL A;  3IBJ A;  4EES A;  4DJ2 A;  3CUE A;  3E98 A;  4HOI A;  3A0S A;  2EWW A;  2W3E A;  2M7U A;  4DN0 A;  3U2A A;  1LSV A;  2QKP A;  4GHI A;  2OOL A;  2W3H A;  2QHK A;  3EWK A;  5K5B A;  1S4S A;  2A24 B;  1V9Y A;  4PAU A;  4I39 A;  4ZRR A;  3C38 A;  4PKY G;  4I3I A;  2O9C A;  4HP4 A;  1G6O A;  2DMW A;  4B93 A;  4EQ1 A;  2ZOI A;  2PT7 A;  3OOV A;  4HH2 A;  1T19 A;  4MN5 A;  4IHQ A;  3LFV A;  2VV7 A;  3BQ8 A;  3LIC A;  5DJT A;  5KSH A;  3EQU A;  2PR6 A;  1S4R A;  1LSX A;  4AFI A;  3E4P A;  1EW0 A;  3T4T A;  3FC7 A;  2D01 A;  4LRX C;  3KYQ A;  5HDD A;  4Z1W A;  3R4K A;  3CUE C;  1VB6 A;  1X0O A;  1W63 Q;  2INW A;  4ETX A;  3MR0 A;  2VJW A;  1DP6 A;  1D7E A;  4UQI S;  4R38 A;  3JVU A;  2VX8 A;  4EUV A;  2VV8 A;  4CLC E;  4UQI M;  4DMZ A;  3FG8 A;  1XJ3 A;  1H3Q A;  1MZU A;  2OAP 1;  5HSQ A;  2Z6C A;  1UWN X;  2JKR M;  4GS9 B;  3CLO A;  3LR3 A;  5F69 A;  4KUK A;  5HPF A;  4LRZ E;  4MMN A;  2YKF A;  4ARZ B;  3GEC A;  4WEK A;  3NJA A;  3ULF A;  1XJ2 A;  3W2Z A;  5DKL A;  2HJE A;  3R7W A;  4KQD A;  1BYW A;  2VZW A;  3TJZ C;  5HD3 A;  4L9F A;  3UB8 A;  4FOF A;  2P7J A;  2L4R A;  5J4E A;  1ZHH B;  2GZA A;  3KSI A;  1LT0 A;  3EQV A;  3CAX A;  2M7V A;  4R6L A;  4MN7 A;  1D06 A;  1UWP X;  3OC2 A;  4JGR A;  2OWJ A;  2W1R A;  3K2N A;  4HQA A;  4GJ4 A;  5DJU A;  4H6J A;  3MJQ A;  1GSV A;  4DJ3 A;  4HJ4 A;  2PYP A;  4Q0I A;  5LBR A;  4I38 A;  4WL9 A;  1LL8 A;  4HJ6 A;  1GSW A;  3T4S A;  3OCL A;  4Q0H A;  5HD5 A;  1IFQ A;  3D3O A;  3FPW A;  5EFW A;  1DP9 A;  4OOM A;  3LI9 A;  4EW7 A;  2KDK A;  2JKT I;  5IT5 A;  3PBS A;  4JGQ A;  3RH8 B;  1F9I A;  2O9B A;  4HI4 A;  1P9W A;  3C8C A;  4IUH A;  4O8G A;  2W1T B;  4IJG A;  2KX6 A;  3K3D A;  4GW9 A;  4L9G A;  5F5Y A;  3UE6 A;  4EER A;  3RTY A;  4MCW A;  1N9L A;  2J80 A;  2QJ7 A;  1OTB A;  2VEA A;  3TW8 A;  2Z6D A;  2GJ3 A;  1OT9 A;  3PBN A;  3T4L A;  1YSQ A;  4E04 A;  2J3W A;  1N9N A;  2CMN A;  2PR5 A;  1XJ4 A;  3E4Q A;  2V0W A;  3RFB A;  4G3V A;  2JN7 A;  1LSW A;  1OT6 A;  4M4X A;  3KO6 A;  1Y28 A;  2XSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...