4XT2B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2B01
3A0VA 5HWTA 1GSWA 3LIAA 4GS9B 2VV7A 2PD7A 5HD5A 5HDDA 3LI9A 4EESA 1OJGA 4GCZA 1OJ5A 1LSWA 3H9WA 3MQQA 2PR6A 5I5LA 1LSXA 2ZOHA 2ZOIA 3GDIA 2Z6DA 4GHIA 3H82B 4HHDA 4I5SA 1OTEA 4R70A 1UGUA 4BBVA 4R38A 1T1AA 4LPZA 2OOLA 1LSVA 3A0SA 4HJ4A 3MQOA 2V0WA 1N9NA 1S1YA 3CAXA 1LT0A 2V1BA 4NXBA 4EEPA 4WLAA 2ZBBA 4E04A 4I3AA 2HV1A 1OTBA 4MN6A 1S4RA 3F1PA 1OT9A 2V0UA 1TS8A 4EQ1A 3K3CA 2PHYA 4I38A 3IBRA 2YKFA 1WA9A 5TBMB 4GHIB 2BASA 5AVEA 2H28A 3MFXA 1D7EA 2VEAA 3IS2A 3C8CA 1LL8A 1T18A 2PYPA 1TS7A 4DJ3A 2WKPA 4MN5A 1DP8A 3LIBA 1XJ6A 2VV8A 2L4RA 1D06A 4HH3A 4B9OA 3FG8A 3ULFA 3LIDA 3OLOA 5DJTA 5HDSA 4F3LA 2KDKA 3E4OA 4JGOA 5KIZA 4WF0A 4EEUA 2VV6A 3F1PB 4K08A 1DP6A 2CMNA 3UB9A 4NXGA 5EFWA 1P0ZA 3LIEA 3EWKA 1S67L 2PD8A 1XJ4A 1F98A 1GSVA 4L9GA 3LUQA 1OT6A 3P7NA 3NOPC 4HH2A 1JNUA 4R3AA 2V9AA 3RH8B 1BYWA 2J80A 2R78A 4L9EA 3UMEA 3IS2B 4HNBA 4JGRA 2A24B 3ICYA 4WL9A 2B02A 3F1OA 3VE3A 4JGPA 1EW0A 4LRYC 4F3LB 2VLGA 4HIAA 3PHYA 2M1CA 3B33A 5IS1A 2JN7A 3HJKA 4NXEA 1N9LA 1T1CA 2YKHA 5HZHA 3T50A 4NXFA 1T1BA 2OWHA 3G6OA 5AVFA 4HJ6A 2P7JA 4KUOA 3BY9A 4GW9A 5F69A 3K3DA 2D02A 4WN5A 1XJ3A 2Z6CA 3LICA 2WKRA 3UE6A 3NHQA 4EXOA 2OWJA 1MZUA 3F1OB 4LLOB 5F5YA 2I9VA 2QWSA 1F9IA 4KUKA 5G4ZA 3CWFA 2K7SA 3RTYA 3H7WA 4HP4A 3E4PA 3SW1A 4RQ9A 4EETB 4I3JA 4I3IA 3LI8A 5F68A 5J3WA 3LYXA 3NJAA 1TS6A 4KQDA 2W0NA 4HJ3A 1OTDA 1V9YA 1XJ2A 4JGQA 3UB7A 3LIFA 5G4YA 5F6AA 5A8BA 4L9FA 2GJ3A 3UB6A 4HP9A 2INWA 1S1ZA 5DKLA 2JHEA 3CLOA 3BY8A 3F1NA 3VOLA 1T19A 4H6JA 4M4XA 4HY8A 1OTIA 5IU1A 3MR0A 4HOIA 3VE4A 1S66L 1UWNX 4EERA 3H7WB 2KX6A 3GECA 1UWPX 3FC7A 5HWWA 1Y28A 4WUJA 2QKPA 1OTAA 2WKQA 5TBMA 4EW7A 3UB8A 1GSXA 3EEHA 1XFNA 4HI4A 1N9OA 4DJ2A 4PKYG 1DRMA 1G28A 1ODVA 1NWZA 2QHKA 1VB6A 2PYRA 5HWVA 5HD3A 3KX0X 1X0OA 3F1NB 2PR5A 4H6JB 3PYPA 3UMDA 4XT2A 1XFQA 2QJ5A 1TS0A 4BBTA 2EA9A 5HSQA 2W27A 4LRZE 4HQAA 5HDCA 4GS9A 3D72A 4LRXC 4YWZA 3E4QA 1KOUA 2QJ7A 1S4SA 2L0WA 2A24A 3NOUC 3H82A 2D01A 3C2WA 4BBUA 5J7EA 3HJIA 3MJQA 2PDRA 3ZQ5A 1P97A 4I39A 5DJUA 3MXQA 5DKKA 2V1AA 1V9ZA 3NOTC 4XT2B 4R6LA 4PKYA 3BWLA 1DP9A 5J4EA 2L1MA 3A0RA
chains in the Genus database with same CATH superfamily
1HD8A 3PBQA 1GSWA 3CG5A 3LIAA 1LLBA 3CHWP 1XPBA 4XUZA 4OQIA 4FTXA 2W1TA 3MZDA 1YMXA 3LI9A 5FQJA 1BTLA 4GCZA 1OJ5A 3N7WA 4JXSA 2PR6A 5DF7A 3SS5A 2OAQ1 1BSGA 2ZM8A 1LSXA 5HAQA 1NXYA 2ZOHA 3IQAA 2ZOIA 3GVBA 3LY3A 4GHIA 4R3JA 3CUEC 3H82B 1NYYA 4I5SA 4EBLA 4CLCD 4P6BA 5F82A 3UDXA 2HDUA 4R70A 4WZ4A 1RCJA 4DE3A 4OONA 5TR7A 3TJZC 3WS0A 4BBVA 3WS2A 1AXBA 3IH9A 2Z2MB 3HLFA 2DMWA 2V0WA 1FIKA 2PU2A 1H0MA 3Q7VB 3C7VA 4WLAA 4MMNA 4WMCD 4E04A 2J9OA 5FA7A 4S2OA 3B3XA 3ZG9B 2HV1A 4MDZA 1PFLA 4GD6A 3IF6A 1OT9A 1W8QA 3MXSA 3DW0A 3IWOA 2JKGA 3WWXA 2Y55A 3HVFA 3V5MA 2BASA 2IWBA 3HLWA 3ZNTA 3SH7A 3I7JA 4JXVA 2OSUA 3E98A 2O9AA 2M7UA 1FOFA 3OZHA 4EUVA 1LL9A 5TFQA 4MN5A 5FASA 4WBGA 3N6IA 4P85A 1VQQA 4Q0JA 4X56A 5EUAA 3G30A 4S2MA 3FKVA 2WUQA 1I5QA 2KDKA 5KIZA 2VV6A 4Y2FA 1SKFA 1PWCA 4NXGA 5CHMA 3CITA 2JKRI 4C3QA 5KZHA 3LIEA 3EWKA 3ZG7B 1W79A 4MLLA 1JWPA 1IFQA 1H8MA 1NJ4A 5GLDA 1GSVA 2W3HA 4HESA 2W3FA 3NOPC 1K55C 1JTDA 3KSHA 4PM9A 1BYWA 5M1AA 3UMEA 2EWWA 3D3OA 4D2OA 2C5WB 1W63M 5GLAA 1YQSA 4N1XA 3HLCA 3VE3A 1YMSA 2W3DA 2XEPA 5L8MA 4WEKA 3MQ0A 4LFUA 2H0TA 2M1CA 3B33A 4OOLA 3S4XA 4GB7A 2JN7A 3HJKA 1ES5A 5HL1A 3C4OA 1T1CA 1ERMA 2OWHA 2FZ0A 2UWXA 3RXWA 4Q0HA 3LR3A 5AVFA 2O9CA 3UDFA 1E3UD 1G5UA 4QHCA 1S6RA 4N1HA 1GA0A 3K3DA 3G2YA 4DE1A 2XLNA 2VK3A 3UE6A 4QWOA 4N9LA 4EXOA 4WZ5A 2HP9A 1PW8A 3QP2A 3Q81A 3G4PA 1G6OA 3WS1A 5L07A 3WRTA 3ZCZA 1MWUA 3QNCA 4II7A 1XGJA 3BLSA 2ZD8A 3H7WA 4X68A 1PRQA 3T1SA 3UPOA 1S0WA 2JKTM 4IJGA 4EETB 4JXWA 4I3IA 1TDGA 3Q7ZA 4GKUA 2Y2LA 4BD0A 5EOOA 3IHAA 5EOEA 2ZL1B 1PI4A 4FH2A 3GSGA 2Y2IA 3ZG5A 4ME4A 2A2LA 2W0NA 4S2LA 3L9KA 4LCMA 3BFGA 3LIFA 2QMIA 5A8BA 1VETA 1BLHA 1N9BA 4Y0UA 3UB6A 3MKEA 4GNUA 3IT9A 5DKLA 2ZM0A 4WMCA 2O99A 4H6JA 4Y7PA 1SDNA 2PBDP 4HY8A 3WRZA 2IA2A 4DE0A 1WYBA 4DF6A 5IU1A 3MR0A 4S2NC 4YINA 2JE5A 5HWWA 5L2FA 4PM5A 2WAFA 2QKPA 5FQIA 1WYCA 2WGWB 2G2UA 4MBKA 3U2AA 4ESPA 1XFNA 3V50A 3CZDA 3IXBA 2V8CA 4PKYG 4B4XA 5FQKA 3SS3A 4OLDA 1K57C 3W4OA 2HJ9C 2RCXA 1MC0A 1GCEA 4M3KA 4N9KA 4BJPA 2VKSA 5HD3A 3KX0X 1X0OA 3ISGA 2IWCA 4S2IA 1XFQA 3V3RA 2QJ5A 1TS0A 1AWIA 3KSFA 3G35A 2ZMAA 4FSFA 3PBRA 2JCHA 2ZQ8A 5EECA 3PBSA 2J8YA 5HDCA 2XK1A 5JYOA 4X55A 2XA7M 1XXMA 4LRXC 3NBLA 3M6BA 1YLJA 4YNRA 5CTMA 4OPZA 2LB5A 4EBPA 1FCMA 4WELA 4B4ZA 2OLUA 1S4SA 2O0YA 4DXBA 1N4OA 3IXGA 3KSIA 3H82A 2D01A 3JVVA 1D1JA 3C2WA 4PM6A 3LR4A 2PRFA 4BBUA 5KMWA 1YT4A 4B93A 1P97A 5FAOA 3G32A 4ETXA 2Y8HA 4OPQA 3PAEA 4R6LA 4NK3A 4PKYA 1P9RA 5J4EA 2L1MA 1MBLA 1ZTUA 4DXCA 3LO7A 1NRJA 3Q7VA 4GS9B 4Y5FA 4QU3A 1E3UA 4EESA 1VHMA 3UPPA 4NKPA 4ZAMA 5FSRA 3MQQA 1IYSA 3N4IA 4Z1WA 5DVAA 1E4DA 5EVEA 5MC7A 4GDBA 3GDIA 4G3VA 1NY0A 3S7OA 4HHDA 1IYOA 4WM9A 2PT7A 3S7QA 2WZXA 2ZC7A 2NUPC 1XA7A 5AQ9A 3G2ZA 1EI5A 4OOMA 4XXRA 1T1AA 5FI7A 1TF1A 4LPZA 4S2PA 4HEFA 3HUMA 1RGZA 2WGIA 1NLYA 1K56D 3LGOA 1N9NA 4KZ6A 4N92A 2ZBBA 1K6RA 2ZC5B 5I94A 5E2FA 4JF5A 2XA7S 2Y2HA 2NUTC 4UA9A 2WZZA 4O0PA 2V0UA 2VGLS 4EQ1A 4I38A 5E43A 3FKWA 5F83A 2M7VA 2WGVA 1O07A 1H8YA 3QP6A 1HTZA 1W8YA 2H28A 5FI6A 1D7EA 3RXXA 3TSGA 3GMWA 1KGEA 1TS7A 4DJ3A 3QNBA 1LHYA 3LIBA 1IYPA 2L4RA 1D06A 4KZ7A 3TG9A 4HH3A 4B9OA 3T1QB 3MXRA 1IKGA 3LIDA 3OLOA 2Q9NA 5CGWA 5AQBA 3T4KA 4JGOA 2PAVP 4ZJ2A 1QMFA 3UDIA 3UB9A 2HGVA 3BLMA 4IBXA 1P0ZA 1YLWA 2PD8A 1XJ4A 2ZQCA 3VP3A 4KZ4A 3LUQA 2VGKA 4OQGA 3IBJA 3HLGA 1FILA 2V9AA 3RH8B 4L9EA 1TEMA 3HCYA 1A0KA 1KE3A 3MFDA 3IS2B 4C6YA 4HNBA 1SKOB 3Q1FA 3ICYA 1H5XA 5EM1A 5A93A 3T4TA 4P0MA 4WL9A 2B02A 1GA9A 4X1MA 1EW0A 3AGDA 2BLSA 5CXWA 3LR5A 4LRYC 2JBFA 1VEUB 4F3LB 4HIAA 4LENA 3RFBA 5HARA 1IEMA 4MBHA 5E2GA 4O01A 4RX2A 4NXEA 2ZC3B 3T50A 4DDYA 3UE0A 3ZVWA 3D9YA 4Y0TA 4NXFA 3PXPA 3PBNA 1G6AA 1K54C 1MWRA 5EPHA 5FAPA 2ZL1A 4X53A 4KUOA 4YOFA 1M6KA 2D02A 4WN5A 3LFVA 4O8GA 1XJ3A 2Z6CA 5FEGA 4K91A 2WKRA 3JPUA 4LV3A 4FD8A 3OPRA 2HDRA 1HVBA 3F1OB 5AQ7A 3SH9A 3O86A 3LEQA 3VOYA 1BULA 3OC2A 2P9VB 3WS4A 4DDSA 5FDHA 3NECA 4CPKA 3HL9A 1PW1A 4KUKA 5K5BA 5G4ZA 3CWFA 2K7SA 4OQHA 4BD1A 2EFXA 3MZFA 4RQ9A 4PM8A 4XUXA 3PBOA 2XRNA 2KOIA 3JVUA 1EROA 1CI9A 5J3WA 2WGWA 3UE1A 1OMEA 2XD5A 3P01A 2Z2LB 4U0TA 1TS6A 3ITAA 4KQDA 1SCWA 4HJ3A 3FWLA 5HPIA 1V9YA 1XJ2A 3C38A 1CF0A 1FSYA 2Y2OA 3S7PA 1K56A 4C75A 2EX8A 2INWA 3OPLA 3HUNA 4G3WA 2JHEA 2Y2PA 3VOLA 1T19A 3GQZA 1Z09A 3U4LP 3QP5A 2QYBA 1UWNX 3BYDA 1UWPX 4X25A 4BMWA 5TBMA 3ZGAB 3ITBA 4ID4A 3ZDJA 3SS4A 1GSXA 3IF6C 4E6WA 5F1FA 3P98A 4JKTA 1N9OA 1ONGA 1DJAA 2WADA 4KZ8A 1DRMA 1LI0A 4IBRA 1G28A 1NWZA 1QMEA 4PM7A 1VB6A 2PYRA 4D60A 2R9XA 1XP4A 2CC1A 5TGFA 4DMZA 5HWVA 4RYEA 2Y2GA 5EVIA 3T1RA 2HP5A 3F1NB 2PR5A 3GRJA 4KZBA 3UMDA 3PAGA 4WEJA 3E0YA 2B18A 1U60A 1IKIA 2EA9A 1WE4A 2W27A 1ZG6A 3DTKA 5CECA 4GS9A 4KG5A 4KENB 4OP8A 3NC8A 4UA6A 2R9WA 2A3UA 2OAP1 1DY6A 3BEBA 1H3QA 3OCLA 4YWZA 2J3TC 1FQGA 4CJNA 1W7FA 3BFFA 5EV0A 4QY6A 5DFXA 3ZHHA 2L0WA 2FH5A 4R3BA 2V1ZA 1ONHA 1CEGA 3C4PA 5CRFA 1KE4A 2A24A 5HX9A 3TRCA 1L0GA 2DNSA 2Y4AA 2V20A 5FATA 5FL3A 3ZQ5A 3TOIA 4MBFA 4QY5A 2HJEA 4I39A 5DJUA 4OQ0A 5LBRA 5DKKA 2FFYA 3O3VA 4XT2B 4EQIA 4H8RA 4DN0A 5HL6A 2Y2QA 3A3JA 4OPYA 3BWLA 3HUOA 4GN2A 5DF8A 4P87A 1EWZA 5HWTA 1ZHHB 2ZQ7A 4E3IA 1W63Q 5IHVA 5HW3A 4OH0A 5HD5A 4KZ3A 3UPNA 1J3WA 1OJGA 2GX5A 1LSWA 3BM6A 1KE0A 3MZEA 4IHQA 1IOUA 3BJNA 4JBFA 4R23A 1PNEA 5CERA 2VGJA 3SZTA 1BLCA 4E3MA 3VMAA 2BTFP 2Z6DA 4B88A 1K4EA 3BQ8A 1OTEA 3HLEA 1UGUA 3OBFA 1JTGA 3DBAA 1L2SA 4OVDA 2OOLA 3ZNYA 4WZ5C 1LSVA 3A0SA 1NRFA 4ZDXA 4F94A 3CMZA 1M40A 1CJFA 1S1YA 1I2SA 2ZC6B 3CJMA 1C3BA 3CAXA 1LT0A 3JYIA 4NXBA 4EEPA 2XSSA 4NETA 4K0XA 4I3AA 1BLSA 4Y0OA 1OTBA 1K4FA 1KDWA 4MN6A 1S4RA 5FQMA 1YLTA 4PAUA 1TS8A 3T4QA 2PHYA 3UN7A 3IBRA 1GHMA 4X6TA 1WA9A 4CLCC 5TBMB 1XGIA 4QJGA 5AVEA 3NCKA 2HDSA 2VGLM 3GV9A 3R4KA 3MFXA 2UV0E 4IEDA 2VEAA 3IS2A 3C8CA 2LB9A 1SKOA 1T18A 2PYPA 1L0EA 2WKPA 3NDGA 1DP8A 4Z9QA 5KSCA 2VV8A 1W5DA 3DAVA 1Q2PA 3Q07A 5CEBA 3S1YA 1MPLA 3FG8A 3ULFA 5EVIB 5DJTA 1VEUA 5HDSA 1NZOA 4F3LA 3MS6A 3T4LA 3E4OA 3BFEA 4WF0A 2HZ5A 4KQQA 3N8SA 1J9MA 4EEUA 3F1PB 4K08A 1DP6A 2W1RA 1MWTA 4BQMA 5CX7A 5EFWA 3EQVA 1S67L 4ZTKA 1F98A 4L9GA 4PPRA 2JKRM 2I72A 3P7NA 4KZ9A 1Q2QA 3E2LA 3LEZA 3M2KA 1CI8A 2R78A 2J80A 5GL9A 3G34A 2WKEA 1NZUA 2WK0A 4JGRA 2A24B 4RX3A 4KZAA 1HZOA 5HFOA 2HP6A 3NY4A 3O87A 3F1OA 3VP2A 4JGPA 2P9VA 4ETZA 5A90A 2HF6A 1GHIA 3PHYA 5C5KA 2H5SA 2IWDA 1YSPA 3ZYTA 2HDQA 1N9LA 1CQAA 2Q0OA 3PBTA 1T1BA 3G6OA 1K38A 3WS5A 4HJ6A 1RP5A 3CUEA 4LCLA 3W4PA 1L0DA 5F69A 4MEZA 5M18A 3TW8A 4ARZB 3SOIA 3VP4A 2EX2A 1ZG4A 2XFSA 2FFFB 1PWDA 4ZJ1A 5A92A 1MZUA 2GNXA 1MKMA 5AQAA 3MKFA 3N8LA 3W2ZA 2I9VA 2QWSA 4NG2A 3OOVA 5FAQA 1JWVA 1F9IA 2XF3A 1K54A 4EU0A 5EM0A 5CGXA 2JKTI 3QHYA 4UHUA 1STZA 1YLZA 1P9WA 4I3JA 5EVID 3NULA 5F68A 4E3JA 4Y17A 1PWGA 3T4SA 4S2KA 4R0QA 3LYXA 3NJAA 4DRTA 3O5YA 3ZVTA 5CEDA 1OTDA 3UO9A 1LI9A 3NIAA 4IUHA 4BL3A 3BRMA 3O88A 4QPRA 4GD8A 3QP8A 1Y4OA 4L9FA 1IELA 1F5MA 4HP9A 4P6ZS 3EOIA 2ZLYA 1MY8A 4IVIA 4Y13A 4KQOA 3CLOA 3BY8A 3F1NA 4M4XA 3MBZA 2XFTA 2H0YA 3S7NA 1K0KA 3W4QA 2K31A 2ZQDA 5FI2A 4HOIA 2W3EA 4JPMA 3GECA 3AGEA 3PTEA 1NYMA 3FC7A 4GDNA 1TD5A 1JVJA 2B95A 1K25A 4EW7A 3UB8A 2XD1A 3EEHA 1FR6A 1MWSA 3EQUA 1K55A 4DJ2A 3VP0A 3Q82A 4MNRA 4FH4A 2DCFA 3BFCA 1ODVA 5KSHA 3QP4A 3R7WB 2B5RA 3FPWA 3HREA 5E2EA 1PIOA 1FSWA 4UA7A 2VZWA 5E2HA 4KZ5A 4UQIS 4XT2A 4BBTA 2E8IA 3OCNA 4IVKA 1BUEA 4E6XA 1PYYA 3MSHA 3IX8A 1FCOA 3UB5P 3C30A 4A5RA 1KOUA 3V3SA 1JWZA 2KLIA 1TDLA 4LV1A 1DJCA 3NOUC 2H10A 4O7DA 1CEFA 5CHJA 3TE8A 3GR2A 2P74A 3HJIA 3E2KA 2PDRA 5AJGA 5A91A 4NEED 3DTIA 3MXQA 3HBRA 5FEFA 2G2WA 3ZFZA 1YLYA 2WYXA 3CPTA 3PR6A 1V9ZA 3NOTC 2XH9A 4DKIA 1H8ZA 3KYEA 5DTSA 3GTCA 1DP9A 3A0VA 2J9PA 4R4RA 5M19A 1Z6FA 2EXBA 2JKFA 4GJ4A 5FDSA 2ZJ9A 2VV7A 2PD7A 4KG2A 1IYQA 2WKHA 5HDDA 1DJBA 5D3OA 3H9WA 3IH8A 2J7VA 2VJWA 4R1GA 3IHBA 2OV5A 5I5LA 1XX2A 2EFUA 4GOGA 4YFMA 1YLPA 2ACGA 1Y54A 1L0FA 1YSQA 2P04A 1ES2A 3FZCA 3A3DA 4R38A 4OLGA 3IF5A 3RJUA 4HJ4A 3MQOA 2V8FA 2XR0A 2P08A 4S2NA 4PHTA 2V1BA 1CK3A 2W1TB 1RGYA 3LCEA 2AVXA 3IX4A 2PU4A 3LY4A 3W8KA 4EBNA 4BENA 3D4FA 1KDSA 2J3WA 2W3GA 3F1PA 2G7UA 5BOHA 3K3CA 5L10A 1OPXA 2YKFA 1ESUA 1K57A 3BQAA 3NDEA 4GHIB 4CQHA 2EXAA 2Y59A 2C6WB 4E3LA 4E3KA 5HAIA 3KYZA 1VM1A 1LL8A 4BLMA 2XQZA 1MXOA 1XJ6A 3P09A 4RVAA 4IUKA 5CGSA 2VX8A 2Y2MA 5U47A 5HAPA 5GHZA 5TJJA 4CLCA 1FCNA 4OOYA 1YAXA 4QB8A 2K2NA 4HBUA 3VOZA 4HBTA 3IF6B 3T12B 2CMNA 2E8JA 2O9BA 2Y2KA 2JC7A 2OLVA 1E25A 4U3TA 1ERQA 3DTEA 5FQ9A 2X02A 1OT6A 3UY6A 4UEYA 4HH2A 1JNUA 4EWFA 4R3AA 1BT5A 1YM1A 1G68A 1HLUP 4FUWA 1NLZA 5CTNA 4ARZA 4RA7A 5DTKA 4DE2A 4ZRRA 3L7HA 2ZC4B 1ZKJA 1SDEA 4E3OA 5EVIC 3VV4A 2Y91A 5L09A 1TVFA 3A3EA 3KSGA 4OP5A 3IXHA 2VLGA 3VSKA 3IWIA 3HLBA 3CPTB 1PZOA 5IS1A 4UAAA 1L3LA 4EUZA 1ALQA 3EGXC 1F2KA 2YKHA 5HZHA 4OPRA 2X01A 3A3FA 1XKZA 1O7EA 1BLPA 1FR1A 4S2JA 2P7JA 2PBYA 3BY9A 5F1GA 4PMAA 4GW9A 4LV0A 3S22A 3MF0A 1ES3A 3LICA 4JF6A 2ZM2A 3NHQA 1GHPA 2OWJA 3OPPA 3EGDC 4LLOB 4JF4A 5EE8A 3UE3A 4JLFA 2XGNA 5F5YA 5J8XA 3OPHA 3ZG8B 5IT5A 3G31A 5GLBA 1I2WA 3AGFA 5EVLA 3RTYA 4HP4A 2DRWA 3E4PA 4Y15A 3DWKA 3C7UA 3SW1A 3VSLA 1ACFA 3V67A 4OKPA 2EWVA 3KYQA 5GLCA 3LI8A 3T4OA 4ZJ3A 3SH8A 4G3KA 5JYPA 3BW6A 2EX9A 4MCWA 4JGQA 3C5AA 3BFDA 3DTMA 4WYYA 3UB7A 1KVMA 4BWIA 2X71A 5G4YA 2Y2JA 5F6AA 3VFFA 4AFIA 1LL5A 3CI6A 2GJ3A 4GZBA 3R7WA 2MJ6A 3IWQA 3A3IA 1S1ZA 3EEAA 2WAEA 3IXDA 3FV7A 1XA1A 4GLQA 1BZAA 1MKIA 2XDMA 1KGFA 5FQQA 2Q9MA 4U0XA 2WKIA 3K2NA 4P6ZM 1OTIA 1ES4A 3VE4A 4EV4A 1S66L 4EERA 3H7WB 2KX6A 2GDNA 3FYZA 2XROA 1K6SA 1Y28A 4WUJA 4BL2A 4Y3IA 1PZPA 4ZBEA 3HLDA 4Q8IA 1OTAA 2GZAA 2WKQA 2Y79A 2BG1A 4CLCB 3N8RA 2V2FF 3ZG0A 4Q0IA 4HI4A 3B47A 2J3TD 5DFYA 5DTTA 1VETB 1YKDA 2Y2NA 2QZ6A 2QHKA 2VA0A 3VFHA 3KO6A 3FPVA 4KG6A 2QPNA 3B42A 5GHYA 4R4SA 4X69A 1ZC2A 4H6JB 3PYPA 2ZMFA 5HPFA 3LR0A 2RL3A 3M2JA 1SHVA 2ZQ9A 3M6HA 1KVLA 5GHXA 5CHUA 3NI9A 5HSQA 4K0WA 4QD4A 3VP1A 4LRZE 4X1LA 3V39A 4HQAA 1SZVA 4UQIM 3D72A 4E3NA 1PI5A 3MMHA 2A49A 3E4QA 2HPBA 2ZQAA 1YPRA 2QJ7A 3BECA 5G18A 4FCFA 3QP1A 3T1XA 2ZMVA 1KGGA 4L0LA 4JXGA 4MN7A 2EX6A 5DF9A 5J7EA 4LV2A 3UNWA 3MJQA 3DWZA 3IX3A 3T4JA 4KQRA 4LGWA 2V1AA 1ESIA 4CLCE 3A0RA 4FOFA
chains in the Genus database with same CATH topology
3A0VA 1ZTUA 3PBQA 5HWTA 1GSWA 4GJ4A 3LIAA 1ZHHB 1NRJA 1W63Q 4GS9B 2W1TA 2VV7A 2PD7A 5HD5A 4Y5FA 5HDDA 3LI9A 4EESA 1OJGA 4GCZA 1OJ5A 1VHMA 2GX5A 1LSWA 3H9WA 4NKPA 3MQQA 4IHQA 1IOUA 2VJWA 2PR6A 3BJNA 2OAQ1 5I5LA 4Z1WA 1LSXA 2ZOHA 5MC7A 2ZOIA 3GDIA 2Z6DA 4G3VA 4GHIA 3S7OA 3CUEC 3H82B 4HHDA 4I5SA 3BQ8A 1OTEA 1YSQA 2P04A 4CLCD 2PT7A 3S7QA 4R70A 2NUPC 1UGUA 3OBFA 3TJZC 3DBAA 4BBVA 4OOMA 4R38A 1T1AA 1TF1A 4LPZA 2OOLA 1LSVA 3A0SA 4HJ4A 3MQOA 2DMWA 1NLYA 2V0WA 2P08A 1N9NA 1S1YA 3CAXA 1LT0A 4PHTA 2V1BA 4NXBA 2W1TB 4EEPA 4WLAA 2ZBBA 4MMNA 2XSSA 4E04A 4I3AA 2HV1A 1OTBA 2XA7S 2J3WA 2W3GA 4MN6A 4MDZA 2NUTC 1S4RA 3F1PA 1OT9A 4O0PA 2V0UA 2G7UA 1TS8A 4PAUA 2VGLS 3T4QA 4EQ1A 3K3CA 2PHYA 4I38A 3IBRA 1OPXA 2M7VA 2YKFA 1WA9A 4CLCC 3BQAA 5TBMB 4GHIB 4CQHA 2BASA 5AVEA 2VGLM 3R4KA 2H28A 3MFXA 3E98A 1D7EA 2VEAA 2O9AA 3KYZA 2M7UA 3IS2A 3C8CA 2LB9A 4EUVA 1LL8A 1T18A 2PYPA 1TS7A 4DJ3A 2WKPA 4MN5A 1DP8A 3LIBA 1XJ6A 2VV8A 2L4RA 4IUKA 1D06A 4HH3A 4B9OA 2VX8A 4Q0JA 3FG8A 3ULFA 3LIDA 3OLOA 5DJTA 5HDSA 4F3LA 2KDKA 3T4LA 3E4OA 3T4KA 4JGOA 5KIZA 5TJJA 4WF0A 4CLCA 1YAXA 2K2NA 4EEUA 2VV6A 3F1PB 4K08A 1DP6A 4Y2FA 2W1RA 2CMNA 3UB9A 2HGVA 4NXGA 2O9BA 3CITA 5CX7A 5EFWA 2JKRI 1P0ZA 3LIEA 3EWKA 3EQVA 1S67L 2PD8A 1IFQA 1XJ4A 1H8MA 1F98A 1GSVA 4L9GA 2JKRM 3LUQA 1OT6A 2W3HA 4UEYA 3P7NA 2W3FA 3NOPC 4HH2A 3IBJA 1JNUA 4R3AA 2V9AA 3KSHA 3RH8B 1BYWA 2J80A 2R78A 4L9EA 3UMEA 2EWWA 3HCYA 3IS2B 1NLZA 3D3OA 4HNBA 4JGRA 4ARZA 2A24B 3ICYA 4ZRRA 1W63M 3T4TA 4WL9A 2B02A 3F1OA 3VE3A 2W3DA 4JGPA 1EW0A 3VV4A 5L8MA 3KSGA 4WEKA 4ETZA 3LR5A 4LRYC 4F3LB 2VLGA 2HF6A 3MQ0A 4HIAA 3PHYA 5C5KA 3RFBA 2M1CA 3B33A 5IS1A 4OOLA 1YSPA 4O01A 3ZYTA 2JN7A 3HJKA 3EGXC 4NXEA 1N9LA 1T1CA 2YKHA 5HZHA 3T50A 3PBTA 4NXFA 3PXPA 3PBNA 1T1BA 2FZ0A 2OWHA 3G6OA 4Q0HA 3LR3A 5AVFA 4HJ6A 2O9CA 2P7JA 3CUEA 4KUOA 3BY9A 4YOFA 4GW9A 5F69A 3K3DA 2D02A 4WN5A 3LFVA 3MF0A 4O8GA 3TW8A 4ARZB 1XJ3A 2Z6CA 3LICA 2WKRA 3UE6A 3NHQA 4EXOA 2OWJA 1MZUA 2GNXA 3F1OB 3EGDC 1MKMA 4LLOB 3UE3A 5F5YA 3OC2A 1G6OA 3W2ZA 2I9VA 2QWSA 3OOVA 5IT5A 1F9IA 4EU0A 4KUKA 5K5BA 5G4ZA 4II7A 3CWFA 2K7SA 3RTYA 2JKTI 3H7WA 4HP4A 1STZA 3E4PA 3SW1A 3V67A 4RQ9A 2JKTM 1P9WA 2EWVA 3PBOA 4IJGA 4EETB 4I3JA 4I3IA 2XRNA 2KOIA 3KYQA 3JVUA 3LI8A 5F68A 5J3WA 3T4OA 3T4SA 4G3KA 3P01A 3LYXA 3BW6A 3NJAA 1TS6A 4ME4A 2A2LA 3O5YA 4KQDA 2W0NA 4HJ3A 1OTDA 4MCWA 1V9YA 5HPIA 1XJ2A 4JGQA 4IUHA 3C38A 3UB7A 3LIFA 4BWIA 4QPRA 5F6AA 5G4YA 5A8BA 3S7PA 4AFIA 4L9FA 3CI6A 1F5MA 2GJ3A 3R7WA 2MJ6A 3UB6A 4HP9A 4P6ZS 2INWA 1S1ZA 3EEAA 3EOIA 4G3WA 5DKLA 4GLQA 2JHEA 4KQOA 2O99A 3CLOA 3BY8A 3F1NA 3VOLA 1T19A 4H6JA 4M4XA 4HY8A 3S7NA 2K31A 2IA2A 3K2NA 4P6ZM 1OTIA 5IU1A 3MR0A 4HOIA 3VE4A 1S66L 1UWNX 2QYBA 4EERA 3H7WB 2KX6A 2W3EA 3GECA 1UWPX 3FC7A 5HWWA 2XROA 1Y28A 4WUJA 4Y3IA 4BMWA 1TD5A 2QKPA 1OTAA 2GZAA 2WKQA 5TBMA 2Y79A 4EW7A 4CLCB 3UB8A 1GSXA 3U2AA 3EEHA 4Q0IA 1XFNA 4HI4A 3EQUA 1N9OA 4DJ2A 4PKYG 3B47A 2J3TD 1DRMA 5DFYA 1YKDA 1G28A 1ODVA 5KSHA 3R7WB 2HJ9C 1NWZA 2QHKA 1MC0A 1VB6A 2VA0A 2PYRA 3FPWA 3KO6A 3FPVA 4DMZA 5HWVA 4BJPA 2VKSA 5HD3A 3B42A 3KX0X 1X0OA 3F1NB 2PR5A 2VZWA 4H6JB 3PYPA 2ZMFA 3UMDA 4UQIS 4WEJA 4XT2A 1XFQA 3E0YA 2B18A 2QJ5A 1TS0A 4BBTA 5HPFA 3LR0A 3KSFA 2EA9A 4FSFA 3PBRA 5HSQA 2W27A 3OCNA 3PBSA 4LRZE 4HQAA 5HDCA 4GS9A 4UQIM 3D72A 2OAP1 2XA7M 4LRXC 1H3QA 3OCLA 3MMHA 4YWZA 3C30A 3E4QA 4YNRA 2J3TC 2LB5A 1KOUA 2QJ7A 4WELA 2KLIA 1S4SA 2O0YA 2ZMVA 5DFXA 2L0WA 2FH5A 4L0LA 2A24A 4MN7A 3TRCA 3NOUC 3KSIA 5DF9A 3H82A 2D01A 3JVVA 3TE8A 3C2WA 5FL3A 3LR4A 4BBUA 5J7EA 3HJIA 3MJQA 2PDRA 3ZQ5A 4B93A 1P97A 5AJGA 4NEED 3T4JA 2HJEA 4I39A 5DJUA 5LBRA 3MXQA 5DKKA 4ETXA 2Y8HA 3PR6A 2V1AA 1V9ZA 3NOTC 4XT2B 4R6LA 4PKYA 4DN0A 5HL6A 1P9RA 3BWLA 1DP9A 4CLCE 5J4EA 2L1MA 3A0RA 4FOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0V A;  5HWT A;  1GSW A;  3LIA A;  4GS9 B;  2VV7 A;  2PD7 A;  5HD5 A;  5HDD A;  3LI9 A;  4EES A;  1OJG A;  4GCZ A;  1OJ5 A;  1LSW A;  3H9W A;  3MQQ A;  2PR6 A;  5I5L A;  1LSX A;  2ZOH A;  2ZOI A;  3GDI A;  2Z6D A;  4GHI A;  3H82 B;  4HHD A;  4I5S A;  1OTE A;  4R70 A;  1UGU A;  4BBV A;  4R38 A;  1T1A A;  4LPZ A;  2OOL A;  1LSV A;  3A0S A;  4HJ4 A;  3MQO A;  2V0W A;  1N9N A;  1S1Y A;  3CAX A;  1LT0 A;  2V1B A;  4NXB A;  4EEP A;  4WLA A;  2ZBB A;  4E04 A;  4I3A A;  2HV1 A;  1OTB A;  4MN6 A;  1S4R A;  3F1P A;  1OT9 A;  2V0U A;  1TS8 A;  4EQ1 A;  3K3C A;  2PHY A;  4I38 A;  3IBR A;  2YKF A;  1WA9 A;  5TBM B;  4GHI B;  2BAS A;  5AVE A;  2H28 A;  3MFX A;  1D7E A;  2VEA A;  3IS2 A;  3C8C A;  1LL8 A;  1T18 A;  2PYP A;  1TS7 A;  4DJ3 A;  2WKP A;  4MN5 A;  1DP8 A;  3LIB A;  1XJ6 A;  2VV8 A;  2L4R A;  1D06 A;  4HH3 A;  4B9O A;  3FG8 A;  3ULF A;  3LID A;  3OLO A;  5DJT A;  5HDS A;  4F3L A;  2KDK A;  3E4O A;  4JGO A;  5KIZ A;  4WF0 A;  4EEU A;  2VV6 A;  3F1P B;  4K08 A;  1DP6 A;  2CMN A;  3UB9 A;  4NXG A;  5EFW A;  1P0Z A;  3LIE A;  3EWK A;  1S67 L;  2PD8 A;  1XJ4 A;  1F98 A;  1GSV A;  4L9G A;  3LUQ A;  1OT6 A;  3P7N A;  3NOP C;  4HH2 A;  1JNU A;  4R3A A;  2V9A A;  3RH8 B;  1BYW A;  2J80 A;  2R78 A;  4L9E A;  3UME A;  3IS2 B;  4HNB A;  4JGR A;  2A24 B;  3ICY A;  4WL9 A;  2B02 A;  3F1O A;  3VE3 A;  4JGP A;  1EW0 A;  4LRY C;  4F3L B;  2VLG A;  4HIA A;  3PHY A;  2M1C A;  3B33 A;  5IS1 A;  2JN7 A;  3HJK A;  4NXE A;  1N9L A;  1T1C A;  2YKH A;  5HZH A;  3T50 A;  4NXF A;  1T1B A;  2OWH A;  3G6O A;  5AVF A;  4HJ6 A;  2P7J A;  4KUO A;  3BY9 A;  4GW9 A;  5F69 A;  3K3D A;  2D02 A;  4WN5 A;  1XJ3 A;  2Z6C A;  3LIC A;  2WKR A;  3UE6 A;  3NHQ A;  4EXO A;  2OWJ A;  1MZU A;  3F1O B;  4LLO B;  5F5Y A;  2I9V A;  2QWS A;  1F9I A;  4KUK A;  5G4Z A;  3CWF A;  2K7S A;  3RTY A;  3H7W A;  4HP4 A;  3E4P A;  3SW1 A;  4RQ9 A;  4EET B;  4I3J A;  4I3I A;  3LI8 A;  5F68 A;  5J3W A;  3LYX A;  3NJA A;  1TS6 A;  4KQD A;  2W0N A;  4HJ3 A;  1OTD A;  1V9Y A;  1XJ2 A;  4JGQ A;  3UB7 A;  3LIF A;  5G4Y A;  5F6A A;  5A8B A;  4L9F A;  2GJ3 A;  3UB6 A;  4HP9 A;  2INW A;  1S1Z A;  5DKL A;  2JHE A;  3CLO A;  3BY8 A;  3F1N A;  3VOL A;  1T19 A;  4H6J A;  4M4X A;  4HY8 A;  1OTI A;  5IU1 A;  3MR0 A;  4HOI A;  3VE4 A;  1S66 L;  1UWN X;  4EER A;  3H7W B;  2KX6 A;  3GEC A;  1UWP X;  3FC7 A;  5HWW A;  1Y28 A;  4WUJ A;  2QKP A;  1OTA A;  2WKQ A;  5TBM A;  4EW7 A;  3UB8 A;  1GSX A;  3EEH A;  1XFN A;  4HI4 A;  1N9O A;  4DJ2 A;  4PKY G;  1DRM A;  1G28 A;  1ODV A;  1NWZ A;  2QHK A;  1VB6 A;  2PYR A;  5HWV A;  5HD3 A;  3KX0 X;  1X0O A;  3F1N B;  2PR5 A;  4H6J B;  3PYP A;  3UMD A;  4XT2 A;  1XFQ A;  2QJ5 A;  1TS0 A;  4BBT A;  2EA9 A;  5HSQ A;  2W27 A;  4LRZ E;  4HQA A;  5HDC A;  4GS9 A;  3D72 A;  4LRX C;  4YWZ A;  3E4Q A;  1KOU A;  2QJ7 A;  1S4S A;  2L0W A;  2A24 A;  3NOU C;  3H82 A;  2D01 A;  3C2W A;  4BBU A;  5J7E A;  3HJI A;  3MJQ A;  2PDR A;  3ZQ5 A;  1P97 A;  4I39 A;  5DJU A;  3MXQ A;  5DKK A;  2V1A A;  1V9Z A;  3NOT C;  4XT2 B;  4R6L A;  4PKY A;  3BWL A;  1DP9 A;  5J4E A;  2L1M A;  3A0R A; 
#chains in the Genus database with same CATH topology
 1HD8 A;  3PBQ A;  1GSW A;  3CG5 A;  3LIA A;  1LLB A;  3CHW P;  1XPB A;  4XUZ A;  4OQI A;  4FTX A;  2W1T A;  3MZD A;  1YMX A;  3LI9 A;  5FQJ A;  1BTL A;  4GCZ A;  1OJ5 A;  3N7W A;  4JXS A;  2PR6 A;  5DF7 A;  3SS5 A;  2OAQ 1;  1BSG A;  2ZM8 A;  1LSX A;  5HAQ A;  1NXY A;  2ZOH A;  3IQA A;  2ZOI A;  3GVB A;  3LY3 A;  4GHI A;  4R3J A;  3CUE C;  3H82 B;  1NYY A;  4I5S A;  4EBL A;  4CLC D;  4P6B A;  5F82 A;  3UDX A;  2HDU A;  4R70 A;  4WZ4 A;  1RCJ A;  4DE3 A;  4OON A;  5TR7 A;  3TJZ C;  3WS0 A;  4BBV A;  3WS2 A;  1AXB A;  3IH9 A;  2Z2M B;  3HLF A;  2DMW A;  2V0W A;  1FIK A;  2PU2 A;  1H0M A;  3Q7V B;  3C7V A;  4WLA A;  4MMN A;  4WMC D;  4E04 A;  2J9O A;  5FA7 A;  4S2O A;  3B3X A;  3ZG9 B;  2HV1 A;  4MDZ A;  1PFL A;  4GD6 A;  3IF6 A;  1OT9 A;  1W8Q A;  3MXS A;  3DW0 A;  3IWO A;  2JKG A;  3WWX A;  2Y55 A;  3HVF A;  3V5M A;  2BAS A;  2IWB A;  3HLW A;  3ZNT A;  3SH7 A;  3I7J A;  4JXV A;  2OSU A;  3E98 A;  2O9A A;  2M7U A;  1FOF A;  3OZH A;  4EUV A;  1LL9 A;  5TFQ A;  4MN5 A;  5FAS A;  4WBG A;  3N6I A;  4P85 A;  1VQQ A;  4Q0J A;  4X56 A;  5EUA A;  3G30 A;  4S2M A;  3FKV A;  2WUQ A;  1I5Q A;  2KDK A;  5KIZ A;  2VV6 A;  4Y2F A;  1SKF A;  1PWC A;  4NXG A;  5CHM A;  3CIT A;  2JKR I;  4C3Q A;  5KZH A;  3LIE A;  3EWK A;  3ZG7 B;  1W79 A;  4MLL A;  1JWP A;  1IFQ A;  1H8M A;  1NJ4 A;  5GLD A;  1GSV A;  2W3H A;  4HES A;  2W3F A;  3NOP C;  1K55 C;  1JTD A;  3KSH A;  4PM9 A;  1BYW A;  5M1A A;  3UME A;  2EWW A;  3D3O A;  4D2O A;  2C5W B;  1W63 M;  5GLA A;  1YQS A;  4N1X A;  3HLC A;  3VE3 A;  1YMS A;  2W3D A;  2XEP A;  5L8M A;  4WEK A;  3MQ0 A;  4LFU A;  2H0T A;  2M1C A;  3B33 A;  4OOL A;  3S4X A;  4GB7 A;  2JN7 A;  3HJK A;  1ES5 A;  5HL1 A;  3C4O A;  1T1C A;  1ERM A;  2OWH A;  2FZ0 A;  2UWX A;  3RXW A;  4Q0H A;  3LR3 A;  5AVF A;  2O9C A;  3UDF A;  1E3U D;  1G5U A;  4QHC A;  1S6R A;  4N1H A;  1GA0 A;  3K3D A;  3G2Y A;  4DE1 A;  2XLN A;  2VK3 A;  3UE6 A;  4QWO A;  4N9L A;  4EXO A;  4WZ5 A;  2HP9 A;  1PW8 A;  3QP2 A;  3Q81 A;  3G4P A;  1G6O A;  3WS1 A;  5L07 A;  3WRT A;  3ZCZ A;  1MWU A;  3QNC A;  4II7 A;  1XGJ A;  3BLS A;  2ZD8 A;  3H7W A;  4X68 A;  1PRQ A;  3T1S A;  3UPO A;  1S0W A;  2JKT M;  4IJG A;  4EET B;  4JXW A;  4I3I A;  1TDG A;  3Q7Z A;  4GKU A;  2Y2L A;  4BD0 A;  5EOO A;  3IHA A;  5EOE A;  2ZL1 B;  1PI4 A;  4FH2 A;  3GSG A;  2Y2I A;  3ZG5 A;  4ME4 A;  2A2L A;  2W0N A;  4S2L A;  3L9K A;  4LCM A;  3BFG A;  3LIF A;  2QMI A;  5A8B A;  1VET A;  1BLH A;  1N9B A;  4Y0U A;  3UB6 A;  3MKE A;  4GNU A;  3IT9 A;  5DKL A;  2ZM0 A;  4WMC A;  2O99 A;  4H6J A;  4Y7P A;  1SDN A;  2PBD P;  4HY8 A;  3WRZ A;  2IA2 A;  4DE0 A;  1WYB A;  4DF6 A;  5IU1 A;  3MR0 A;  4S2N C;  4YIN A;  2JE5 A;  5HWW A;  5L2F A;  4PM5 A;  2WAF A;  2QKP A;  5FQI A;  1WYC A;  2WGW B;  2G2U A;  4MBK A;  3U2A A;  4ESP A;  1XFN A;  3V50 A;  3CZD A;  3IXB A;  2V8C A;  4PKY G;  4B4X A;  5FQK A;  3SS3 A;  4OLD A;  1K57 C;  3W4O A;  2HJ9 C;  2RCX A;  1MC0 A;  1GCE A;  4M3K A;  4N9K A;  4BJP A;  2VKS A;  5HD3 A;  3KX0 X;  1X0O A;  3ISG A;  2IWC A;  4S2I A;  1XFQ A;  3V3R A;  2QJ5 A;  1TS0 A;  1AWI A;  3KSF A;  3G35 A;  2ZMA A;  4FSF A;  3PBR A;  2JCH A;  2ZQ8 A;  5EEC A;  3PBS A;  2J8Y A;  5HDC A;  2XK1 A;  5JYO A;  4X55 A;  2XA7 M;  1XXM A;  4LRX C;  3NBL A;  3M6B A;  1YLJ A;  4YNR A;  5CTM A;  4OPZ A;  2LB5 A;  4EBP A;  1FCM A;  4WEL A;  4B4Z A;  2OLU A;  1S4S A;  2O0Y A;  4DXB A;  1N4O A;  3IXG A;  3KSI A;  3H82 A;  2D01 A;  3JVV A;  1D1J A;  3C2W A;  4PM6 A;  3LR4 A;  2PRF A;  4BBU A;  5KMW A;  1YT4 A;  4B93 A;  1P97 A;  5FAO A;  3G32 A;  4ETX A;  2Y8H A;  4OPQ A;  3PAE A;  4R6L A;  4NK3 A;  4PKY A;  1P9R A;  5J4E A;  2L1M A;  1MBL A;  1ZTU A;  4DXC A;  3LO7 A;  1NRJ A;  3Q7V A;  4GS9 B;  4Y5F A;  4QU3 A;  1E3U A;  4EES A;  1VHM A;  3UPP A;  4NKP A;  4ZAM A;  5FSR A;  3MQQ A;  1IYS A;  3N4I A;  4Z1W A;  5DVA A;  1E4D A;  5EVE A;  5MC7 A;  4GDB A;  3GDI A;  4G3V A;  1NY0 A;  3S7O A;  4HHD A;  1IYO A;  4WM9 A;  2PT7 A;  3S7Q A;  2WZX A;  2ZC7 A;  2NUP C;  1XA7 A;  5AQ9 A;  3G2Z A;  1EI5 A;  4OOM A;  4XXR A;  1T1A A;  5FI7 A;  1TF1 A;  4LPZ A;  4S2P A;  4HEF A;  3HUM A;  1RGZ A;  2WGI A;  1NLY A;  1K56 D;  3LGO A;  1N9N A;  4KZ6 A;  4N92 A;  2ZBB A;  1K6R A;  2ZC5 B;  5I94 A;  5E2F A;  4JF5 A;  2XA7 S;  2Y2H A;  2NUT C;  4UA9 A;  2WZZ A;  4O0P A;  2V0U A;  2VGL S;  4EQ1 A;  4I38 A;  5E43 A;  3FKW A;  5F83 A;  2M7V A;  2WGV A;  1O07 A;  1H8Y A;  3QP6 A;  1HTZ A;  1W8Y A;  2H28 A;  5FI6 A;  1D7E A;  3RXX A;  3TSG A;  3GMW A;  1KGE A;  1TS7 A;  4DJ3 A;  3QNB A;  1LHY A;  3LIB A;  1IYP A;  2L4R A;  1D06 A;  4KZ7 A;  3TG9 A;  4HH3 A;  4B9O A;  3T1Q B;  3MXR A;  1IKG A;  3LID A;  3OLO A;  2Q9N A;  5CGW A;  5AQB A;  3T4K A;  4JGO A;  2PAV P;  4ZJ2 A;  1QMF A;  3UDI A;  3UB9 A;  2HGV A;  3BLM A;  4IBX A;  1P0Z A;  1YLW A;  2PD8 A;  1XJ4 A;  2ZQC A;  3VP3 A;  4KZ4 A;  3LUQ A;  2VGK A;  4OQG A;  3IBJ A;  3HLG A;  1FIL A;  2V9A A;  3RH8 B;  4L9E A;  1TEM A;  3HCY A;  1A0K A;  1KE3 A;  3MFD A;  3IS2 B;  4C6Y A;  4HNB A;  1SKO B;  3Q1F A;  3ICY A;  1H5X A;  5EM1 A;  5A93 A;  3T4T A;  4P0M A;  4WL9 A;  2B02 A;  1GA9 A;  4X1M A;  1EW0 A;  3AGD A;  2BLS A;  5CXW A;  3LR5 A;  4LRY C;  2JBF A;  1VEU B;  4F3L B;  4HIA A;  4LEN A;  3RFB A;  5HAR A;  1IEM A;  4MBH A;  5E2G A;  4O01 A;  4RX2 A;  4NXE A;  2ZC3 B;  3T50 A;  4DDY A;  3UE0 A;  3ZVW A;  3D9Y A;  4Y0T A;  4NXF A;  3PXP A;  3PBN A;  1G6A A;  1K54 C;  1MWR A;  5EPH A;  5FAP A;  2ZL1 A;  4X53 A;  4KUO A;  4YOF A;  1M6K A;  2D02 A;  4WN5 A;  3LFV A;  4O8G A;  1XJ3 A;  2Z6C A;  5FEG A;  4K91 A;  2WKR A;  3JPU A;  4LV3 A;  4FD8 A;  3OPR A;  2HDR A;  1HVB A;  3F1O B;  5AQ7 A;  3SH9 A;  3O86 A;  3LEQ A;  3VOY A;  1BUL A;  3OC2 A;  2P9V B;  3WS4 A;  4DDS A;  5FDH A;  3NEC A;  4CPK A;  3HL9 A;  1PW1 A;  4KUK A;  5K5B A;  5G4Z A;  3CWF A;  2K7S A;  4OQH A;  4BD1 A;  2EFX A;  3MZF A;  4RQ9 A;  4PM8 A;  4XUX A;  3PBO A;  2XRN A;  2KOI A;  3JVU A;  1ERO A;  1CI9 A;  5J3W A;  2WGW A;  3UE1 A;  1OME A;  2XD5 A;  3P01 A;  2Z2L B;  4U0T A;  1TS6 A;  3ITA A;  4KQD A;  1SCW A;  4HJ3 A;  3FWL A;  5HPI A;  1V9Y A;  1XJ2 A;  3C38 A;  1CF0 A;  1FSY A;  2Y2O A;  3S7P A;  1K56 A;  4C75 A;  2EX8 A;  2INW A;  3OPL A;  3HUN A;  4G3W A;  2JHE A;  2Y2P A;  3VOL A;  1T19 A;  3GQZ A;  1Z09 A;  3U4L P;  3QP5 A;  2QYB A;  1UWN X;  3BYD A;  1UWP X;  4X25 A;  4BMW A;  5TBM A;  3ZGA B;  3ITB A;  4ID4 A;  3ZDJ A;  3SS4 A;  1GSX A;  3IF6 C;  4E6W A;  5F1F A;  3P98 A;  4JKT A;  1N9O A;  1ONG A;  1DJA A;  2WAD A;  4KZ8 A;  1DRM A;  1LI0 A;  4IBR A;  1G28 A;  1NWZ A;  1QME A;  4PM7 A;  1VB6 A;  2PYR A;  4D60 A;  2R9X A;  1XP4 A;  2CC1 A;  5TGF A;  4DMZ A;  5HWV A;  4RYE A;  2Y2G A;  5EVI A;  3T1R A;  2HP5 A;  3F1N B;  2PR5 A;  3GRJ A;  4KZB A;  3UMD A;  3PAG A;  4WEJ A;  3E0Y A;  2B18 A;  1U60 A;  1IKI A;  2EA9 A;  1WE4 A;  2W27 A;  1ZG6 A;  3DTK A;  5CEC A;  4GS9 A;  4KG5 A;  4KEN B;  4OP8 A;  3NC8 A;  4UA6 A;  2R9W A;  2A3U A;  2OAP 1;  1DY6 A;  3BEB A;  1H3Q A;  3OCL A;  4YWZ A;  2J3T C;  1FQG A;  4CJN A;  1W7F A;  3BFF A;  5EV0 A;  4QY6 A;  5DFX A;  3ZHH A;  2L0W A;  2FH5 A;  4R3B A;  2V1Z A;  1ONH A;  1CEG A;  3C4P A;  5CRF A;  1KE4 A;  2A24 A;  5HX9 A;  3TRC A;  1L0G A;  2DNS A;  2Y4A A;  2V20 A;  5FAT A;  5FL3 A;  3ZQ5 A;  3TOI A;  4MBF A;  4QY5 A;  2HJE A;  4I39 A;  5DJU A;  4OQ0 A;  5LBR A;  5DKK A;  2FFY A;  3O3V A;  4XT2 B;  4EQI A;  4H8R A;  4DN0 A;  5HL6 A;  2Y2Q A;  3A3J A;  4OPY A;  3BWL A;  3HUO A;  4GN2 A;  5DF8 A;  4P87 A;  1EWZ A;  5HWT A;  1ZHH B;  2ZQ7 A;  4E3I A;  1W63 Q;  5IHV A;  5HW3 A;  4OH0 A;  5HD5 A;  4KZ3 A;  3UPN A;  1J3W A;  1OJG A;  2GX5 A;  1LSW A;  3BM6 A;  1KE0 A;  3MZE A;  4IHQ A;  1IOU A;  3BJN A;  4JBF A;  4R23 A;  1PNE A;  5CER A;  2VGJ A;  3SZT A;  1BLC A;  4E3M A;  3VMA A;  2BTF P;  2Z6D A;  4B88 A;  1K4E A;  3BQ8 A;  1OTE A;  3HLE A;  1UGU A;  3OBF A;  1JTG A;  3DBA A;  1L2S A;  4OVD A;  2OOL A;  3ZNY A;  4WZ5 C;  1LSV A;  3A0S A;  1NRF A;  4ZDX A;  4F94 A;  3CMZ A;  1M40 A;  1CJF A;  1S1Y A;  1I2S A;  2ZC6 B;  3CJM A;  1C3B A;  3CAX A;  1LT0 A;  3JYI A;  4NXB A;  4EEP A;  2XSS A;  4NET A;  4K0X A;  4I3A A;  1BLS A;  4Y0O A;  1OTB A;  1K4F A;  1KDW A;  4MN6 A;  1S4R A;  5FQM A;  1YLT A;  4PAU A;  1TS8 A;  3T4Q A;  2PHY A;  3UN7 A;  3IBR A;  1GHM A;  4X6T A;  1WA9 A;  4CLC C;  5TBM B;  1XGI A;  4QJG A;  5AVE A;  3NCK A;  2HDS A;  2VGL M;  3GV9 A;  3R4K A;  3MFX A;  2UV0 E;  4IED A;  2VEA A;  3IS2 A;  3C8C A;  2LB9 A;  1SKO A;  1T18 A;  2PYP A;  1L0E A;  2WKP A;  3NDG A;  1DP8 A;  4Z9Q A;  5KSC A;  2VV8 A;  1W5D A;  3DAV A;  1Q2P A;  3Q07 A;  5CEB A;  3S1Y A;  1MPL A;  3FG8 A;  3ULF A;  5EVI B;  5DJT A;  1VEU A;  5HDS A;  1NZO A;  4F3L A;  3MS6 A;  3T4L A;  3E4O A;  3BFE A;  4WF0 A;  2HZ5 A;  4KQQ A;  3N8S A;  1J9M A;  4EEU A;  3F1P B;  4K08 A;  1DP6 A;  2W1R A;  1MWT A;  4BQM A;  5CX7 A;  5EFW A;  3EQV A;  1S67 L;  4ZTK A;  1F98 A;  4L9G A;  4PPR A;  2JKR M;  2I72 A;  3P7N A;  4KZ9 A;  1Q2Q A;  3E2L A;  3LEZ A;  3M2K A;  1CI8 A;  2R78 A;  2J80 A;  5GL9 A;  3G34 A;  2WKE A;  1NZU A;  2WK0 A;  4JGR A;  2A24 B;  4RX3 A;  4KZA A;  1HZO A;  5HFO A;  2HP6 A;  3NY4 A;  3O87 A;  3F1O A;  3VP2 A;  4JGP A;  2P9V A;  4ETZ A;  5A90 A;  2HF6 A;  1GHI A;  3PHY A;  5C5K A;  2H5S A;  2IWD A;  1YSP A;  3ZYT A;  2HDQ A;  1N9L A;  1CQA A;  2Q0O A;  3PBT A;  1T1B A;  3G6O A;  1K38 A;  3WS5 A;  4HJ6 A;  1RP5 A;  3CUE A;  4LCL A;  3W4P A;  1L0D A;  5F69 A;  4MEZ A;  5M18 A;  3TW8 A;  4ARZ B;  3SOI A;  3VP4 A;  2EX2 A;  1ZG4 A;  2XFS A;  2FFF B;  1PWD A;  4ZJ1 A;  5A92 A;  1MZU A;  2GNX A;  1MKM A;  5AQA A;  3MKF A;  3N8L A;  3W2Z A;  2I9V A;  2QWS A;  4NG2 A;  3OOV A;  5FAQ A;  1JWV A;  1F9I A;  2XF3 A;  1K54 A;  4EU0 A;  5EM0 A;  5CGX A;  2JKT I;  3QHY A;  4UHU A;  1STZ A;  1YLZ A;  1P9W A;  4I3J A;  5EVI D;  3NUL A;  5F68 A;  4E3J A;  4Y17 A;  1PWG A;  3T4S A;  4S2K A;  4R0Q A;  3LYX A;  3NJA A;  4DRT A;  3O5Y A;  3ZVT A;  5CED A;  1OTD A;  3UO9 A;  1LI9 A;  3NIA A;  4IUH A;  4BL3 A;  3BRM A;  3O88 A;  4QPR A;  4GD8 A;  3QP8 A;  1Y4O A;  4L9F A;  1IEL A;  1F5M A;  4HP9 A;  4P6Z S;  3EOI A;  2ZLY A;  1MY8 A;  4IVI A;  4Y13 A;  4KQO A;  3CLO A;  3BY8 A;  3F1N A;  4M4X A;  3MBZ A;  2XFT A;  2H0Y A;  3S7N A;  1K0K A;  3W4Q A;  2K31 A;  2ZQD A;  5FI2 A;  4HOI A;  2W3E A;  4JPM A;  3GEC A;  3AGE A;  3PTE A;  1NYM A;  3FC7 A;  4GDN A;  1TD5 A;  1JVJ A;  2B95 A;  1K25 A;  4EW7 A;  3UB8 A;  2XD1 A;  3EEH A;  1FR6 A;  1MWS A;  3EQU A;  1K55 A;  4DJ2 A;  3VP0 A;  3Q82 A;  4MNR A;  4FH4 A;  2DCF A;  3BFC A;  1ODV A;  5KSH A;  3QP4 A;  3R7W B;  2B5R A;  3FPW A;  3HRE A;  5E2E A;  1PIO A;  1FSW A;  4UA7 A;  2VZW A;  5E2H A;  4KZ5 A;  4UQI S;  4XT2 A;  4BBT A;  2E8I A;  3OCN A;  4IVK A;  1BUE A;  4E6X A;  1PYY A;  3MSH A;  3IX8 A;  1FCO A;  3UB5 P;  3C30 A;  4A5R A;  1KOU A;  3V3S A;  1JWZ A;  2KLI A;  1TDL A;  4LV1 A;  1DJC A;  3NOU C;  2H10 A;  4O7D A;  1CEF A;  5CHJ A;  3TE8 A;  3GR2 A;  2P74 A;  3HJI A;  3E2K A;  2PDR A;  5AJG A;  5A91 A;  4NEE D;  3DTI A;  3MXQ A;  3HBR A;  5FEF A;  2G2W A;  3ZFZ A;  1YLY A;  2WYX A;  3CPT A;  3PR6 A;  1V9Z A;  3NOT C;  2XH9 A;  4DKI A;  1H8Z A;  3KYE A;  5DTS A;  3GTC A;  1DP9 A;  3A0V A;  2J9P A;  4R4R A;  5M19 A;  1Z6F A;  2EXB A;  2JKF A;  4GJ4 A;  5FDS A;  2ZJ9 A;  2VV7 A;  2PD7 A;  4KG2 A;  1IYQ A;  2WKH A;  5HDD A;  1DJB A;  5D3O A;  3H9W A;  3IH8 A;  2J7V A;  2VJW A;  4R1G A;  3IHB A;  2OV5 A;  5I5L A;  1XX2 A;  2EFU A;  4GOG A;  4YFM A;  1YLP A;  2ACG A;  1Y54 A;  1L0F A;  1YSQ A;  2P04 A;  1ES2 A;  3FZC A;  3A3D A;  4R38 A;  4OLG A;  3IF5 A;  3RJU A;  4HJ4 A;  3MQO A;  2V8F A;  2XR0 A;  2P08 A;  4S2N A;  4PHT A;  2V1B A;  1CK3 A;  2W1T B;  1RGY A;  3LCE A;  2AVX A;  3IX4 A;  2PU4 A;  3LY4 A;  3W8K A;  4EBN A;  4BEN A;  3D4F A;  1KDS A;  2J3W A;  2W3G A;  3F1P A;  2G7U A;  5BOH A;  3K3C A;  5L10 A;  1OPX A;  2YKF A;  1ESU A;  1K57 A;  3BQA A;  3NDE A;  4GHI B;  4CQH A;  2EXA A;  2Y59 A;  2C6W B;  4E3L A;  4E3K A;  5HAI A;  3KYZ A;  1VM1 A;  1LL8 A;  4BLM A;  2XQZ A;  1MXO A;  1XJ6 A;  3P09 A;  4RVA A;  4IUK A;  5CGS A;  2VX8 A;  2Y2M A;  5U47 A;  5HAP A;  5GHZ A;  5TJJ A;  4CLC A;  1FCN A;  4OOY A;  1YAX A;  4QB8 A;  2K2N A;  4HBU A;  3VOZ A;  4HBT A;  3IF6 B;  3T12 B;  2CMN A;  2E8J A;  2O9B A;  2Y2K A;  2JC7 A;  2OLV A;  1E25 A;  4U3T A;  1ERQ A;  3DTE A;  5FQ9 A;  2X02 A;  1OT6 A;  3UY6 A;  4UEY A;  4HH2 A;  1JNU A;  4EWF A;  4R3A A;  1BT5 A;  1YM1 A;  1G68 A;  1HLU P;  4FUW A;  1NLZ A;  5CTN A;  4ARZ A;  4RA7 A;  5DTK A;  4DE2 A;  4ZRR A;  3L7H A;  2ZC4 B;  1ZKJ A;  1SDE A;  4E3O A;  5EVI C;  3VV4 A;  2Y91 A;  5L09 A;  1TVF A;  3A3E A;  3KSG A;  4OP5 A;  3IXH A;  2VLG A;  3VSK A;  3IWI A;  3HLB A;  3CPT B;  1PZO A;  5IS1 A;  4UAA A;  1L3L A;  4EUZ A;  1ALQ A;  3EGX C;  1F2K A;  2YKH A;  5HZH A;  4OPR A;  2X01 A;  3A3F A;  1XKZ A;  1O7E A;  1BLP A;  1FR1 A;  4S2J A;  2P7J A;  2PBY A;  3BY9 A;  5F1G A;  4PMA A;  4GW9 A;  4LV0 A;  3S22 A;  3MF0 A;  1ES3 A;  3LIC A;  4JF6 A;  2ZM2 A;  3NHQ A;  1GHP A;  2OWJ A;  3OPP A;  3EGD C;  4LLO B;  4JF4 A;  5EE8 A;  3UE3 A;  4JLF A;  2XGN A;  5F5Y A;  5J8X A;  3OPH A;  3ZG8 B;  5IT5 A;  3G31 A;  5GLB A;  1I2W A;  3AGF A;  5EVL A;  3RTY A;  4HP4 A;  2DRW A;  3E4P A;  4Y15 A;  3DWK A;  3C7U A;  3SW1 A;  3VSL A;  1ACF A;  3V67 A;  4OKP A;  2EWV A;  3KYQ A;  5GLC A;  3LI8 A;  3T4O A;  4ZJ3 A;  3SH8 A;  4G3K A;  5JYP A;  3BW6 A;  2EX9 A;  4MCW A;  4JGQ A;  3C5A A;  3BFD A;  3DTM A;  4WYY A;  3UB7 A;  1KVM A;  4BWI A;  2X71 A;  5G4Y A;  2Y2J A;  5F6A A;  3VFF A;  4AFI A;  1LL5 A;  3CI6 A;  2GJ3 A;  4GZB A;  3R7W A;  2MJ6 A;  3IWQ A;  3A3I A;  1S1Z A;  3EEA A;  2WAE A;  3IXD A;  3FV7 A;  1XA1 A;  4GLQ A;  1BZA A;  1MKI A;  2XDM A;  1KGF A;  5FQQ A;  2Q9M A;  4U0X A;  2WKI A;  3K2N A;  4P6Z M;  1OTI A;  1ES4 A;  3VE4 A;  4EV4 A;  1S66 L;  4EER A;  3H7W B;  2KX6 A;  2GDN A;  3FYZ A;  2XRO A;  1K6S A;  1Y28 A;  4WUJ A;  4BL2 A;  4Y3I A;  1PZP A;  4ZBE A;  3HLD A;  4Q8I A;  1OTA A;  2GZA A;  2WKQ A;  2Y79 A;  2BG1 A;  4CLC B;  3N8R A;  2V2F F;  3ZG0 A;  4Q0I A;  4HI4 A;  3B47 A;  2J3T D;  5DFY A;  5DTT A;  1VET B;  1YKD A;  2Y2N A;  2QZ6 A;  2QHK A;  2VA0 A;  3VFH A;  3KO6 A;  3FPV A;  4KG6 A;  2QPN A;  3B42 A;  5GHY A;  4R4S A;  4X69 A;  1ZC2 A;  4H6J B;  3PYP A;  2ZMF A;  5HPF A;  3LR0 A;  2RL3 A;  3M2J A;  1SHV A;  2ZQ9 A;  3M6H A;  1KVL A;  5GHX A;  5CHU A;  3NI9 A;  5HSQ A;  4K0W A;  4QD4 A;  3VP1 A;  4LRZ E;  4X1L A;  3V39 A;  4HQA A;  1SZV A;  4UQI M;  3D72 A;  4E3N A;  1PI5 A;  3MMH A;  2A49 A;  3E4Q A;  2HPB A;  2ZQA A;  1YPR A;  2QJ7 A;  3BEC A;  5G18 A;  4FCF A;  3QP1 A;  3T1X A;  2ZMV A;  1KGG A;  4L0L A;  4JXG A;  4MN7 A;  2EX6 A;  5DF9 A;  5J7E A;  4LV2 A;  3UNW A;  3MJQ A;  3DWZ A;  3IX3 A;  3T4J A;  4KQR A;  4LGW A;  2V1A A;  1ESI A;  4CLC E;  3A0R A;  4FOF A; 
#chains in the Genus database with same CATH homology
 3A0V A;  1ZTU A;  3PBQ A;  5HWT A;  1GSW A;  4GJ4 A;  3LIA A;  1ZHH B;  1NRJ A;  1W63 Q;  4GS9 B;  2W1T A;  2VV7 A;  2PD7 A;  5HD5 A;  4Y5F A;  5HDD A;  3LI9 A;  4EES A;  1OJG A;  4GCZ A;  1OJ5 A;  1VHM A;  2GX5 A;  1LSW A;  3H9W A;  4NKP A;  3MQQ A;  4IHQ A;  1IOU A;  2VJW A;  2PR6 A;  3BJN A;  2OAQ 1;  5I5L A;  4Z1W A;  1LSX A;  2ZOH A;  5MC7 A;  2ZOI A;  3GDI A;  2Z6D A;  4G3V A;  4GHI A;  3S7O A;  3CUE C;  3H82 B;  4HHD A;  4I5S A;  3BQ8 A;  1OTE A;  1YSQ A;  2P04 A;  4CLC D;  2PT7 A;  3S7Q A;  4R70 A;  2NUP C;  1UGU A;  3OBF A;  3TJZ C;  3DBA A;  4BBV A;  4OOM A;  4R38 A;  1T1A A;  1TF1 A;  4LPZ A;  2OOL A;  1LSV A;  3A0S A;  4HJ4 A;  3MQO A;  2DMW A;  1NLY A;  2V0W A;  2P08 A;  1N9N A;  1S1Y A;  3CAX A;  1LT0 A;  4PHT A;  2V1B A;  4NXB A;  2W1T B;  4EEP A;  4WLA A;  2ZBB A;  4MMN A;  2XSS A;  4E04 A;  4I3A A;  2HV1 A;  1OTB A;  2XA7 S;  2J3W A;  2W3G A;  4MN6 A;  4MDZ A;  2NUT C;  1S4R A;  3F1P A;  1OT9 A;  4O0P A;  2V0U A;  2G7U A;  1TS8 A;  4PAU A;  2VGL S;  3T4Q A;  4EQ1 A;  3K3C A;  2PHY A;  4I38 A;  3IBR A;  1OPX A;  2M7V A;  2YKF A;  1WA9 A;  4CLC C;  3BQA A;  5TBM B;  4GHI B;  4CQH A;  2BAS A;  5AVE A;  2VGL M;  3R4K A;  2H28 A;  3MFX A;  3E98 A;  1D7E A;  2VEA A;  2O9A A;  3KYZ A;  2M7U A;  3IS2 A;  3C8C A;  2LB9 A;  4EUV A;  1LL8 A;  1T18 A;  2PYP A;  1TS7 A;  4DJ3 A;  2WKP A;  4MN5 A;  1DP8 A;  3LIB A;  1XJ6 A;  2VV8 A;  2L4R A;  4IUK A;  1D06 A;  4HH3 A;  4B9O A;  2VX8 A;  4Q0J A;  3FG8 A;  3ULF A;  3LID A;  3OLO A;  5DJT A;  5HDS A;  4F3L A;  2KDK A;  3T4L A;  3E4O A;  3T4K A;  4JGO A;  5KIZ A;  5TJJ A;  4WF0 A;  4CLC A;  1YAX A;  2K2N A;  4EEU A;  2VV6 A;  3F1P B;  4K08 A;  1DP6 A;  4Y2F A;  2W1R A;  2CMN A;  3UB9 A;  2HGV A;  4NXG A;  2O9B A;  3CIT A;  5CX7 A;  5EFW A;  2JKR I;  1P0Z A;  3LIE A;  3EWK A;  3EQV A;  1S67 L;  2PD8 A;  1IFQ A;  1XJ4 A;  1H8M A;  1F98 A;  1GSV A;  4L9G A;  2JKR M;  3LUQ A;  1OT6 A;  2W3H A;  4UEY A;  3P7N A;  2W3F A;  3NOP C;  4HH2 A;  3IBJ A;  1JNU A;  4R3A A;  2V9A A;  3KSH A;  3RH8 B;  1BYW A;  2J80 A;  2R78 A;  4L9E A;  3UME A;  2EWW A;  3HCY A;  3IS2 B;  1NLZ A;  3D3O A;  4HNB A;  4JGR A;  4ARZ A;  2A24 B;  3ICY A;  4ZRR A;  1W63 M;  3T4T A;  4WL9 A;  2B02 A;  3F1O A;  3VE3 A;  2W3D A;  4JGP A;  1EW0 A;  3VV4 A;  5L8M A;  3KSG A;  4WEK A;  4ETZ A;  3LR5 A;  4LRY C;  4F3L B;  2VLG A;  2HF6 A;  3MQ0 A;  4HIA A;  3PHY A;  5C5K A;  3RFB A;  2M1C A;  3B33 A;  5IS1 A;  4OOL A;  1YSP A;  4O01 A;  3ZYT A;  2JN7 A;  3HJK A;  3EGX C;  4NXE A;  1N9L A;  1T1C A;  2YKH A;  5HZH A;  3T50 A;  3PBT A;  4NXF A;  3PXP A;  3PBN A;  1T1B A;  2FZ0 A;  2OWH A;  3G6O A;  4Q0H A;  3LR3 A;  5AVF A;  4HJ6 A;  2O9C A;  2P7J A;  3CUE A;  4KUO A;  3BY9 A;  4YOF A;  4GW9 A;  5F69 A;  3K3D A;  2D02 A;  4WN5 A;  3LFV A;  3MF0 A;  4O8G A;  3TW8 A;  4ARZ B;  1XJ3 A;  2Z6C A;  3LIC A;  2WKR A;  3UE6 A;  3NHQ A;  4EXO A;  2OWJ A;  1MZU A;  2GNX A;  3F1O B;  3EGD C;  1MKM A;  4LLO B;  3UE3 A;  5F5Y A;  3OC2 A;  1G6O A;  3W2Z A;  2I9V A;  2QWS A;  3OOV A;  5IT5 A;  1F9I A;  4EU0 A;  4KUK A;  5K5B A;  5G4Z A;  4II7 A;  3CWF A;  2K7S A;  3RTY A;  2JKT I;  3H7W A;  4HP4 A;  1STZ A;  3E4P A;  3SW1 A;  3V67 A;  4RQ9 A;  2JKT M;  1P9W A;  2EWV A;  3PBO A;  4IJG A;  4EET B;  4I3J A;  4I3I A;  2XRN A;  2KOI A;  3KYQ A;  3JVU A;  3LI8 A;  5F68 A;  5J3W A;  3T4O A;  3T4S A;  4G3K A;  3P01 A;  3LYX A;  3BW6 A;  3NJA A;  1TS6 A;  4ME4 A;  2A2L A;  3O5Y A;  4KQD A;  2W0N A;  4HJ3 A;  1OTD A;  4MCW A;  1V9Y A;  5HPI A;  1XJ2 A;  4JGQ A;  4IUH A;  3C38 A;  3UB7 A;  3LIF A;  4BWI A;  4QPR A;  5F6A A;  5G4Y A;  5A8B A;  3S7P A;  4AFI A;  4L9F A;  3CI6 A;  1F5M A;  2GJ3 A;  3R7W A;  2MJ6 A;  3UB6 A;  4HP9 A;  4P6Z S;  2INW A;  1S1Z A;  3EEA A;  3EOI A;  4G3W A;  5DKL A;  4GLQ A;  2JHE A;  4KQO A;  2O99 A;  3CLO A;  3BY8 A;  3F1N A;  3VOL A;  1T19 A;  4H6J A;  4M4X A;  4HY8 A;  3S7N A;  2K31 A;  2IA2 A;  3K2N A;  4P6Z M;  1OTI A;  5IU1 A;  3MR0 A;  4HOI A;  3VE4 A;  1S66 L;  1UWN X;  2QYB A;  4EER A;  3H7W B;  2KX6 A;  2W3E A;  3GEC A;  1UWP X;  3FC7 A;  5HWW A;  2XRO A;  1Y28 A;  4WUJ A;  4Y3I A;  4BMW A;  1TD5 A;  2QKP A;  1OTA A;  2GZA A;  2WKQ A;  5TBM A;  2Y79 A;  4EW7 A;  4CLC B;  3UB8 A;  1GSX A;  3U2A A;  3EEH A;  4Q0I A;  1XFN A;  4HI4 A;  3EQU A;  1N9O A;  4DJ2 A;  4PKY G;  3B47 A;  2J3T D;  1DRM A;  5DFY A;  1YKD A;  1G28 A;  1ODV A;  5KSH A;  3R7W B;  2HJ9 C;  1NWZ A;  2QHK A;  1MC0 A;  1VB6 A;  2VA0 A;  2PYR A;  3FPW A;  3KO6 A;  3FPV A;  4DMZ A;  5HWV A;  4BJP A;  2VKS A;  5HD3 A;  3B42 A;  3KX0 X;  1X0O A;  3F1N B;  2PR5 A;  2VZW A;  4H6J B;  3PYP A;  2ZMF A;  3UMD A;  4UQI S;  4WEJ A;  4XT2 A;  1XFQ A;  3E0Y A;  2B18 A;  2QJ5 A;  1TS0 A;  4BBT A;  5HPF A;  3LR0 A;  3KSF A;  2EA9 A;  4FSF A;  3PBR A;  5HSQ A;  2W27 A;  3OCN A;  3PBS A;  4LRZ E;  4HQA A;  5HDC A;  4GS9 A;  4UQI M;  3D72 A;  2OAP 1;  2XA7 M;  4LRX C;  1H3Q A;  3OCL A;  3MMH A;  4YWZ A;  3C30 A;  3E4Q A;  4YNR A;  2J3T C;  2LB5 A;  1KOU A;  2QJ7 A;  4WEL A;  2KLI A;  1S4S A;  2O0Y A;  2ZMV A;  5DFX A;  2L0W A;  2FH5 A;  4L0L A;  2A24 A;  4MN7 A;  3TRC A;  3NOU C;  3KSI A;  5DF9 A;  3H82 A;  2D01 A;  3JVV A;  3TE8 A;  3C2W A;  5FL3 A;  3LR4 A;  4BBU A;  5J7E A;  3HJI A;  3MJQ A;  2PDR A;  3ZQ5 A;  4B93 A;  1P97 A;  5AJG A;  4NEE D;  3T4J A;  2HJE A;  4I39 A;  5DJU A;  5LBR A;  3MXQ A;  5DKK A;  4ETX A;  2Y8H A;  3PR6 A;  2V1A A;  1V9Z A;  3NOT C;  4XT2 B;  4R6L A;  4PKY A;  4DN0 A;  5HL6 A;  1P9R A;  3BWL A;  1DP9 A;  4CLC E;  5J4E A;  2L1M A;  3A0R A;  4FOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...