4XT2B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
CQPTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Isoform-Selective and Stereoselective Inhibition of Hypoxia Inducible Factor-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 35
structure length 111
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4xt2B01
2V1AA 5HZHA 1GSWA 1UWNX 1XFQA 4JGRA 5J3WA 1P97A 4B9OA 4PKYA 1S1YA 2Z6CA 3BY9A 3F1OA 4JGPA 4EETB 1LSWA 3A0VA 3KX0X 1V9YA 1XFNA 1T1BA 5IU1A 4WF0A 2A24B 3CWFA 3F1PB 3UMEA 4DJ2A 2YKFA 3VOLA 1LT0A 4HJ4A 2BASA 4L9GA 5J7EA 2ZBBA 2H28A 3K3DA 1UWPX 3UMDA 1V9ZA 1OT6A 5HDSA 2VLGA 2QWSA 2A24A 3F1PA 4GHIB 2QKPA 4GCZA 4H6JA 2HV1A 5DKLA 2VV8A 4HH3A 2PD7A 2PYRA 2J80A 5DKKA 1OJGA 2D02A 1LSXA 3P7NA 3GECA 4HHDA 4I5SA 1S67L 2KX6A 4PKYG 3LICA 4M4XA 5AVFA 4BBTA 5TBMB 2V1BA 4HH2A 4KUKA 1TS0A 5HSQA 1S1ZA 1OTIA 2WKRA 1OTDA 2PR5A 4MN5A 2P7JA 2L4RA 1D7EA 2W0NA 4K08A 5HWVA 5HWWA 3MJQA 3NOUC 4R70A 4HP4A 1WA9A 4HIAA 4LRZE 2OWJA 3EEHA 5HDDA 5F68A 3NJAA 4EW7A 5EFWA 2PYPA 3FG8A 4HOIA 4EXOA 1DRMA 3E4OA 4GHIA 4LRXC 4E04A 2V9AA 4NXEA 4HI4A 4I3AA 5DJUA 1UGUA 2QJ5A 3EWKA 1OTAA 1S4SA 2JHEA 3C2WA 3GDIA 5I5LA 1GSVA 5HD3A 2Z6DA 4R3AA 5IS1A 5F69A 1VB6A 3VE4A 2JN7A 3RH8B 5KIZA 1GSXA 2OOLA 4EQ1A 1TS8A 4I3IA 1LSVA 2D01A 4WLAA 4EESA 4WL9A 4L9FA 1BYWA 3IS2B 4NXBA 4BBUA 4MN6A 2KDKA 5F5YA 1ODVA 2EA9A 2OWHA 2VEAA 3F1NA 1T1CA 2B02A 3LIDA 4I39A 4XT2B 4JGOA 5TBMA 4EEUA 4F3LA 3IS2A 1OTEA 3LI8A 3LUQA 3HJKA 4RQ9A 3SW1A 4I38A 5DJTA 4I3JA 2V0UA 3H7WA 4R38A 3UB9A 4F3LB 2I9VA 4HQAA 3BY8A 2PDRA 3PHYA 2CMNA 3ULFA 3LIBA 2PHYA 3VE3A 5A8BA 1DP8A 1NWZA 2WKQA 3HJIA 2R78A 1F98A 1LL8A 1N9OA 5G4ZA 3UB8A 4LLOB 1XJ6A 1T1AA 1EW0A 3MR0A 3NOTC 3NOPC 5HDCA 3UB6A 1XJ4A 1JNUA 1T18A 1TS6A 1S4RA 2INWA 4JGQA 3H82B 3CAXA 3FC7A 3D72A 1X0OA 3LIEA 3F1NB 4H6JB 4HJ6A 4WN5A 3LI9A 4XT2A 3ZQ5A 3F1OB 4HJ3A 2W27A 3E4PA 3E4QA 3IBRA 4DJ3A 2ZOIA 1OT9A 2VV6A 4KQDA 4NXFA 5F6AA 5HWTA 1XJ2A 4NXGA 1OTBA 3T50A 2WKPA 1D06A 2M1CA 4GS9B 4LPZA 3A0SA 5AVEA 2K7SA 1OJ5A 3NHQA 1P0ZA 3B33A 3C8CA 5HD5A 3CLOA 4HNBA 4LRYC 3LIAA 4GS9A 2QJ7A 2ZOHA 3BWLA 3ICYA 5G4YA 3MFXA 1S66L 4HY8A 1XJ3A 1F9IA 2QHKA 4R6LA 3RTYA 4L9EA 2VV7A 2L1MA 4EERA 4YWZA 3OLOA 4WUJA 2PD8A 2YKHA 1DP9A 3H7WB 3UE6A 3MQOA 1N9LA 1G28A 1DP6A 1KOUA 2V0WA 3K3CA 5J4EA 3LIFA 4EEPA 4KUOA 3LYXA 3MQQA 1MZUA 1TS7A 2GJ3A 3H9WA 3PYPA 2L0WA 4BBVA 1N9NA 3MXQA 1Y28A 3UB7A 3G6OA 3A0RA 3H82A 4GW9A 1T19A 2PR6A 4HP9A
chains in the Genus database with same CATH superfamily
3P98A 5HZHA 3N4IA 5HPFA 1K54A 1OMEA 3A0VA 2A24B 3O86A 2Y2KA 1XPBA 3IWIA 2W1RA 2FFYA 3FWLA 3BJNA 4GHIB 5DKLA 2HP9A 3IX3A 4EBPA 3O5YA 5CX7A 3TW8A 3LICA 4S2KA 4IUKA 3OCLA 3NULA 4ZJ1A 1JVJA 4CLCA 5CEBA 2P7JA 5CECA 3W4PA 1WA9A 4HIAA 3IT9A 4PM7A 4IVIA 1MC0A 2GNXA 5FAQA 4E04A 2WGWB 2HJ9C 5DJUA 1UGUA 2QJ5A 3ZFZA 2W3EA 2XFSA 5I5LA 1YAXA 3T1SA 3G2YA 3VOYA 3T4LA 3C5AA 1I5QA 4IHQA 1RCJA 2XD1A 3CJMA 1PIOA 3V39A 4OOLA 3H7WA 4JLFA 1PW1A 1L0EA 4Y0OA 1CI9A 1FCOA 1MWUA 1T18A 3NCKA 3M2KA 2INWA 3F1NB 3NI9A 3IBRA 2IWCA 3E98A 1FSWA 2VV6A 4DE3A 3UPNA 4CLCE 4RX3A 4BENA 3NHQA 2OV5A 3B33A 3C7VA 4II7A 3ICYA 1BLSA 2Q9MA 4GOGA 4Y7PA 1K4FA 2PAVP 1MZUA 4PM8A 4FOFA 1XGJA 3O88A 5EVEA 2WKEA 4HBUA 4MCWA 4U0TA 4EETB 4UQIS 1KE0A 1VM1A 3WS2A 2HDRA 4O8GA 1ONHA 4GZBA 3D3OA 5HDSA 2WZXA 3HLWA 5MC7A 2HV1A 2BLSA 4I5SA 4X56A 2DRWA 2W1TA 3IBJA 2Y59A 3N7WA 3VP4A 3VSKA 4NG2A 3JVUA 2L4RA 4KZ8A 3EEHA 5L8MA 1O7EA 2H10A 5GLAA 5KSCA 3JVVA 3E4OA 4JXVA 1KE4A 4RA7A 3OPHA 3V67A 2JN7A 3UE3A 5KIZA 3FKVA 2D01A 5G18A 2M7VA 2J3TD 3PR6A 3SH9A 2XH9A 2ZM2A 3UDFA 3LI8A 4RQ9A 3LUQA 3UB9A 4R38A 4G3KA 4HQAA 4S2JA 3VE3A 3N8SA 2ZC3B 3G4PA 3UB8A 2VZWA 4ZAMA 3F1OB 4BJPA 3JYIA 4LV3A 5HAIA 2ZMAA 1BLHA 5IT5A 3ITBA 1VEUA 4L0LA 5FAOA 5EVID 4B4XA 1DJAA 2Y2OA 2Y2QA 4E3JA 4OPRA 2X02A 3OLOA 4S2NA 3H7WB 1I2SA 1FCMA 5HL1A 4X69A 2CC1A 3MQQA 4OLGA 2EXAA 1NYYA 4Z9QA 5A90A 3UDIA 1PZOA 1L3LA 4JXGA 5FASA 4Y0TA 1LSWA 3P01A 1DJCA 4WF0A 3ZNTA 5FQ9A 2QWSA 1YLWA 1VETA 1C3BA 3BYDA 1HD8A 1BULA 4M4XA 3BQ8A 2XQZA 4KUKA 3ZNYA 1OTIA 1IYPA 2O9CA 5FATA 4DE2A 4MN5A 5DTTA 5FQKA 4KZ7A 5HWVA 2RL3A 2ZM0A 3OBFA 2PYPA 3VFHA 4ESPA 1E4DA 4UQIM 1L2SA 3GVBA 3MZEA 4CLCC 5HD3A 4ETXA 5F69A 4Y2FA 3VE4A 5E2HA 4X25A 5CXWA 5F1FA 3SS4A 4ETZA 4EBLA 3V50A 4U3TA 4WZ5A 1T1CA 2W1TB 1FOFA 1CEFA 1W8YA 2J7VA 1FR1A 3W2ZA 4F3LB 1MPLA 2X71A 1KVMA 4IBRA 4Q0HA 2ZQDA 4H6JB 2GZAA 4WM9A 3ZYTA 3T50A 4GS9B 4LPZA 2VK3A 2P74A 4LRYC 3LIAA 4CQHA 1YSQA 4MLLA 2IWDA 3Q7ZA 1VQQA 1K55C 3SH7A 5A92A 2XA7S 4D2OA 3LY4A 2O99A 2V1AA 1GSWA 1XFQA 5FEFA 3F1OA 3ZG8B 2H0YA 4X53A 4F94A 2ZC5B 3T4TA 1LT0A 1K6RA 4HJ4A 4R1GA 1OT6A 3NECA 5CTNA 4R4RA 1K55A 2QYBA 2HDQA 5DKKA 4HHDA 5CHMA 3GECA 2WKIA 5GHZA 5TBMB 2XROA 3MZDA 1CK3A 1LL5A 1NRJA 4Y5FA 1L0DA 3EEAA 2NUPC 3BM6A 2I72A 4S2LA 5IS1A 3TOIA 3QP5A 4WZ4A 1YLJA 4CJNA 4G3WA 4NXBA 4MMNA 3F1NA 4JGOA 3UDXA 3T12B 4KQRA 3IS2A 3CMZA 4I38A 4KZBA 4GKUA 5E2GA 3CHWP 3LIBA 3HLEA 1N9OA 2V1ZA 1W79A 2V20A 2HP6A 3MXSA 3UNWA 2Q0OA 3E0YA 3PTEA 4XT2A 2WAEA 5EOEA 3KSIA 4BL3A 2B95A 4DJ3A 3T4SA 2ZC4B 1Q2QA 3A0SA 2XK1A 3NY4A 5HD5A 2XDMA 1S66L 3LR3A 1Q2PA 2BG1A 1IELA 3W4OA 1DP9A 3M2JA 3LIFA 2PBYA 5TGFA 1DJBA 2Y79A 4OOYA 4S2IA 1H8ZA 3L7HA 4IBXA 2A49A 4L9GA 4G3VA 3UMDA 3F1PA 3VSLA 2PU4A 4QJGA 1JTGA 3PBSA 3UO9A 2K31A 2OLVA 1SHVA 1CEGA 4ZBEA 5HSQA 2ZLYA 1OTDA 2EX2A 5HWWA 5EV0A 5U47A 2OWJA 1O07A 3MQ0A 3B3XA 4HOIA 3MFDA 4OPQA 1AWIA 3N8RA 5AQBA 2ZQ8A 1TS8A 2ZQCA 4KZ9A 5EOOA 3PBTA 1PYYA 5M1AA 5GLDA 1ODVA 2VX8A 2P04A 3VOZA 3D9YA 5TBMA 5CHUA 4EEUA 4WEKA 2O9BA 1J9MA 2Z2LB 4ZJ2A 1F98A 4KG6A 3OOVA 1T1AA 1ZTUA 3MR0A 1YLPA 1SKOA 1HLUP 3LI9A 1MWTA 4OH0A 4P85A 3T4QA 4OONA 2M1CA 1KGGA 3BECA 5AQ7A 3SH8A 1FILA 2W3DA 3T1QB 3KSFA 1K4EA 4WUJA 4ZJ3A 1G28A 4UA6A 1ONGA 1H3QA 4OQHA 1E25A 3RXXA 2PR6A 2V2FF 4XUZA 3W4QA 1EI5A 4FH4A 4OQGA 5EVIB 4OQ0A 4GDNA 2VGLS 4KZAA 5FDHA 2HPBA 3R4KA 3GR2A 1VEUB 2ZBBA 5K5BA 5HARA 2IWBA 3VP0A 1OJGA 3GTCA 2BTFP 2MJ6A 1G5UA 4EBNA 1XA1A 4HH2A 3LR0A 2ZM8A 4YINA 3BFDA 2E8JA 1WYBA 1HZOA 5TJJA 3SOIA 3MSHA 3CPTB 3HLGA 3S7QA 2EFUA 1PNEA 4NEED 1N4OA 1CQAA 2Y2GA 2FFFB 2WKHA 2B5RA 2ACGA 3S7OA 1ACFA 4LV0A 4E3KA 2J8YA 2JKGA 1NRFA 4QU3A 1YLTA 2XD5A 1EWZA 1YQSA 2PHYA 4A5RA 1K57A 3G35A 3ISGA 3BEBA 5FA7A 3D72A 2W27A 3Q7VB 4BD1A 1OTBA 4WYYA 1OJ5A 3CLOA 3IXDA 5GLBA 3HLFA 4QD4A 1MXOA 1SCWA 5GL9A 1XKZA 4NK3A 3ZDJA 1FSYA 3RXWA 1YM1A 2DNSA 1YKDA 1TDGA 4R23A 2HDSA 1W63M 3PAGA 5FL3A 2ZMFA 5DFYA 4EU0A 1YSPA 3CWFA 4DJ2A 2A2LA 2EWVA 4EERA 4NKPA 4CPKA 3CI6A 4OP8A 3IX8A 3ZHHA 3LR5A 3T4OA 2Y2JA 2D02A 1W5DA 1BSGA 4R3JA 4BBTA 4RVAA 2ZC6B 1TS0A 2GX5A 4P6ZS 1D7EA 5AQAA 2Y2PA 3MJQA 3QP4A 1PZPA 2IA2A 1KGFA 4QB8A 5EFWA 1XX2A 1SDEA 4ME4A 1OTAA 4LFUA 3LFVA 3DTEA 1YPRA 2Z6DA 4Y15A 2JKTI 2WYXA 4XT2B 4DKIA 1IFQA 4F3LA 2XSSA 3HJKA 4LV2A 3LCEA 2I9VA 3OPRA 4UHUA 1BT5A 1FQGA 3BRMA 4OPYA 3ZVTA 2WADA 1PI5A 4HJ6A 3MZFA 3JPUA 4GDBA 4PM9A 3T1XA 2WKPA 3ITAA 3LR4A 3TRCA 3HUOA 3BWLA 4M3KA 4EUVA 1ES2A 3GRJA 3RTYA 1IEMA 4C3QA 4WBGA 3VP3A 4ARZB 5DTKA 3N6IA 3UE0A 2G2WA 3WS0A 4EEPA 2UWXA 2Y2IA 5D3OA 1TS7A 2L0WA 1G6AA 3UB7A 4BL2A 1NZUA 5J3WA 2OAQ1 2LB9A 2J9OA 4JGPA 1LHYA 1VHMA 2V8CA 3PBQA 1ZKJA 4E3MA 3IF5A 3G30A 3ZCZA 1NY0A 3K3DA 1KDSA 2C5WB 1K6SA 3BLSA 4CLCD 2QKPA 4GCZA 2HDUA 4B93A 1S67L 4R4SA 4PKYG 5L09A 5I94A 5A93A 4UA7A 1FIKA 4EW7A 2XEPA 3Q82A 1QMFA 4ID4A 1K25A 5FI6A 4N9LA 5GLCA 3VP2A 1SZVA 4UAAA 4R3AA 3IF6B 1YLYA 1LSVA 3VP1A 2VGJA 1BYWA 4WMCD 1HTZA 2JBFA 2VJWA 1GHPA 1CF0A 2G7UA 3BFGA 4KZ4A 3CZDA 5CGSA 2WKQA 4LV1A 1NYMA 1IKIA 2G2UA 1M40A 2EX6A 1BTLA 3S1YA 3HLCA 5EUAA 1MWSA 1GCEA 3CG5A 2HF6A 5AVEA 1K57C 4HNBA 4BLMA 2ZOHA 1S0WA 5G4YA 3DW0A 4K91A 2W3HA 2WUQA 2XR0A 3IXGA 4BWIA 1N9LA 3U2AA 4KZ3A 4E3NA 4E6XA 3PYPA 3GQZA 1Y28A 4GW9A 4PKYA 3IHAA 2Z6CA 3FV7A 3KX0X 1V9YA 2Q9NA 3VOLA 1TEMA 3MKFA 5J7EA 2H28A 3A3EA 3WRZA 5FEGA 4GB7A 4H6JA 4HH3A 3Q07A 2EWWA 5AQ9A 5AVFA 2EXBA 2HJEA 4LENA 4R70A 1PFLA 1LI0A 3NJAA 4Y0UA 4YNRA 2QPNA 3DWKA 1JWVA 3C2WA 4LCLA 1YT4A 1GSVA 1N9BA 1KE3A 3O87A 4L9FA 3ZG5A 2ZC7A 3E2LA 3S7PA 3L9KA 3G31A 3LIDA 3VMAA 5FAPA 1GA9A 1OTEA 1ZG4A 4GLQA 3MS6A 1K56D 4DDSA 5A8BA 1DP8A 1NWZA 5EE8A 3KYEA 3QNCA 4P6BA 5CGWA 3V5MA 1XJ4A 1TS6A 2KOIA 3O3VA 4ARZA 3LIEA 3C4PA 1PWDA 2C6WB 3HLBA 4NXGA 1YLZA 4GNUA 1P0ZA 3C8CA 3FZCA 2ZD8A 3C38A 3MFXA 4R6LA 1PWCA 1NXYA 2EFXA 4DRTA 2J9PA 3UE6A 1DP6A 2WK0A 4X55A 3HREA 4B4ZA 5M19A 1N9NA 4JPMA 1XFNA 4S2OA 2BASA 3HLDA 3LGOA 2R9WA 2VLGA 3MF0A 2ZQAA 4OP5A 2QMIA 1LSXA 3P7NA 1W8QA 4FTXA 3V3RA 3T4KA 1JTDA 3HVFA 5F82A 1TF1A 4K08A 3KSHA 4QWOA 1NLYA 5L07A 1E3UA 5F68A 3GMWA 4PMAA 1D1JA 4EWFA 4NXEA 4PHTA 3TJZC 4PM5A 3QNBA 3M6HA 1VB6A 3DBAA 5DF8A 1RGZA 4XXRA 4WMCA 4JXSA 3IS2B 3OCNA 1ERQA 2EA9A 2V8FA 5CTMA 4DN0A 2XF3A 4I3JA 1VETB 4DMZA 4GD8A 4PM6A 2JKFA 3NDEA 4N9KA 1EW0A 1W63Q 4HEFA 2XLNA 4JBFA 4PPRA 1E3UD 1FR6A 3H82B 3CAXA 4BQMA 5HWTA 5F6AA 3UN7A 3PBOA 2Y4AA 1LI9A 3D4FA 2P08A 2K7SA 3UPPA 2Z2MB 4IVKA 1SDNA 2GDNA 5DF9A 2L1MA 3T1RA 4IUHA 4X1LA 1KOUA 4EV4A 3K3CA 3RFBA 4GD6A 4BD0A 4U0XA 1MKMA 5HAPA 1UWNX 1P97A 1IYQA 1K54C 3HUNA 2ZQ7A 1GA0A 3A3DA 4DF6A 3F1PB 4MEZA 3IX4A 1MWRA 1YMSA 2A24A 1MBLA 4ZDXA 3CUEC 4FD8A 1IYOA 5EM1A 5KMWA 3LEZA 3KYZA 2V1BA 2WAFA 3IF6A 3G34A 1ESIA 3IF6C 1XA7A 2PR5A 4QY5A 1BLCA 3OPPA 5FSRA 3AGEA 4CLCB 3BW6A 4I3AA 3KO6A 2JKTM 3DTKA 5F1GA 3VV4A 2O0YA 4H8RA 1MY8A 2LB5A 5CGXA 2VEAA 5FQQA 4GJ4A 3SW1A 3WWXA 3PHYA 3DTIA 3UPOA 1SKOB 1H0MA 4OKPA 5AJGA 4MDZA 2JC7A 2QZ6A 3WS4A 2JKRI 3CITA 3NOTC 1JNUA 4KQQA 1S4RA 5F83A 5DFXA 3EQUA 1GHIA 1XJ2A 5C5KA 4R3BA 5CEDA 3B42A 2P9VB 2W3GA 5EVLA 2VA0A 4S2MA 5HX9A 3VFFA 1K56A 2UV0E 1F5MA 1WE4A 4ZRRA 1IYSA 2JCHA 1EROA 3TE8A 3NBLA 1DY6A 5GHXA 1PWGA 3HUMA 3G6OA 4P87A 2Y8HA 3Q1FA 4HP9A 3GV9A 4BMWA 4B9OA 3IH9A 1S1YA 3BY9A 5IU1A 3KSGA 4KQOA 2VKSA 4E6WA 2FZ0A 3MMHA 4FUWA 2PD7A 3Q7VA 1JWPA 1RP5A 4IJGA 4N92A 1STZA 3QP2A 4FCFA 4RYEA 4HP4A 1FCNA 2ZMVA 3FG8A 3GSGA 5FQJA 1DRMA 2V9AA 4HI4A 1IKGA 2J3TC 4MBHA 4OQIA 2JHEA 3PBRA 3RH8B 3DTMA 4EQ1A 3IWOA 4I3IA 3QP8A 4DDYA 5CHJA 5TFQA 2NUTC 2OWHA 4RX2A 4PAUA 1Z6FA 5HFOA 1ALQA 2Y91A 3I7JA 5HPIA 3IHBA 2M7UA 3ZG0A 3HJIA 4GN2A 4X68A 3WRTA 1WYCA 1X0OA 5EVIC 4HJ3A 5KSHA 4KQDA 4NXFA 5CRFA 1ES3A 2AVXA 5CERA 4ZTKA 4HY8A 2B18A 1F9IA 2QHKA 1XP4A 3PXPA 4L9EA 2A3UA 3BQAA 2VV7A 1SKFA 3MQOA 3OZHA 4R0QA 4KUOA 1M6KA 1NLZA 3LYXA 2GJ3A 3A0RA 2OLUA 3WS1A 3LEQA 1T1BA 3OPLA 2Y2MA 2YKFA 4WZ5C 1V9ZA 4JKTA 3S4XA 2J3WA 2VV8A 3TSGA 1XGIA 4JF4A 4QHCA 1ZG6A 2KX6A 2ZJ9A 1TDLA 3S22A 1F2KA 3FPVA 4Q0JA 5DTSA 5HDDA 3AGDA 4LRXC 3BLMA 3EWKA 3DWZA 3T4JA 2Y55A 4LCMA 4WLAA 3WS5A 2OAP1 1GHMA 4X1MA 2X01A 1AXBA 2HP5A 5DVAA 4K0XA 5J8XA 3U4LP 5HW3A 4KZ5A 4P6ZM 2WGIA 3ULFA 1LL8A 3BFEA 5HDCA 3IXHA 3R7WA 1TD5A 5EECA 4WN5A 1CI8A 2PRFA 5FDSA 3E4PA 2ZOIA 1OT9A 1KGEA 3PAEA 3C4OA 3NC8A 5L2FA 1Z09A 3MXRA 5HAQA 1Y54A 1NZOA 4KG2A 4YWZA 1S6RA 2ZL1B 4UA9A 5J4EA 4FH2A 1P9RA 1IOUA 5FQMA 4BBVA 2JKRM 3H82A 5BOHA 2EX8A 4JGRA 1P9WA 2WGWA 1JWZA 3UMEA 3W8KA 3HCYA 3P09A 4FSFA 1UWPX 2XFTA 3CUEA 5EPHA 5TR7A 2J80A 4DE1A 3IWQA 3FPWA 1YMXA 5EM0A 2KLIA 4O0PA 3SS5A 1G68A 2W0NA 2XGNA 3V3SA 3C30A 1PW8A 4E3LA 3UY6A 1XXMA 4EQIA 3BFCA 1S4SA 2PT7A 1ES4A 5E43A 3A3FA 4MBFA 1ERMA 5LBRA 4Y13A 4O01A 4D60A 2DCFA 2O9AA 2RCXA 3SS3A 1KVLA 1XJ6A 2H5SA 3NOPC 3UB6A 4JGQA 1KDWA 1OPXA 1H8MA 4WEJA 2VGKA 3E4QA 1LL9A 4K0WA 1ZC2A 3MKEA 4B88A 1D06A 2WZZA 2HGVA 1G6OA 3UB5P 5JYOA 3NDGA 2V0WA 4OOMA 3MXQA 1BLPA 2EX9A 3R7WB 1L0FA 3QP6A 1A0KA 4E3IA 4IEDA 3M6BA 1NJ4A 4OPZA 2P9VA 5JYPA 3E2KA 3KYQA 2PYRA 3DAVA 1ESUA 4KENB 4XUXA 2ZL1A 3G2ZA 1S1ZA 3AGFA 3ZG7B 4HESA 2XA7M 4LRZE 2ZQ9A 1PRQA 4EXOA 4GHIA 5FQIA 4Y3IA 4UEYA 2VGLM 3TG9A 4N1HA 4S2PA 3G32A 3GDIA 5HL6A 2OOLA 5E2FA 5E2EA 4WL9A 5F5YA 4X6TA 4AFIA 4Q0IA 1ZHHB 1HVBA 2PU2A 1CJFA 3ZG9B 1K38A 5IHVA 1BUEA 5DJTA 2V0UA 3BY8A 2PDRA 4YOFA 2WGVA 2R78A 4LLOB 1H8YA 5M18A 2XRNA 4NETA 3FC7A 4YFMA 1ES5A 4WELA 4MBKA 4DXBA 3LY3A 2Y2HA 5FI2A 3MBZA 2E8IA 4GS9A 2QJ7A 2Y2NA 4JF6A 4N1XA 4MNRA 1XJ3A 2K2NA 4HBTA 2JE5A 2YKHA 3IXBA 3C7UA 3SZTA 4Q8IA 3QP1A 4KG5A 2HZ5A 2DMWA 1QMEA 3HBRA 4LGWA 4KZ6A 4EUZA 4OVDA 1RGYA 2OSUA 1L0GA 3B47A 3ZVWA 3EQVA 5L10A 3EGDC 3OC2A 4Y17A 2WKRA 3K2NA 3N8LA 1PI4A 3NOUC 4MN7A 1I2WA 4JF5A 3FKWA 4DE0A 4JXWA 4DXCA 3S7NA 3EGXC 4Z1WA 3ZGAB 3UE1A 1GSXA 4EESA 3IQAA 3FYZA 4BBUA 4MN6A 2KDKA 1MKIA 2PBDP 2R9XA 4I39A 1BZAA 1TVFA 2B02A 3LO7A 4S2NC 4C6YA 4OLDA 3NIAA 3BFFA 5EVIA 2FH5A 4E3OA 2CMNA 4O7DA 3IH8A 5G4ZA 5KZHA 3PBNA 1K0KA 2Y2LA 3ZQ5A 2W3FA 1J3WA 5FI7A 2H0TA 5DF7A 1U60A 1H5XA 3A3JA 4QY6A 5A91A 3EOIA 1Y4OA 3QHYA 4C75A 3CPTA 1W7FA 4P0MA 2PD8A 3HL9A 1LLBA 3Q81A 3RJUA 3H9WA 4QPRA 3A3IA 5GHYA 1T19A
chains in the Genus database with same CATH topology
2Y79A 5HZHA 5HPFA 4PKYA 2Z6CA 3A0VA 3KX0X 1V9YA 1T1BA 2A24B 2YKFA 3VOLA 2W1RA 4L9GA 5J7EA 2H28A 4G3VA 3BJNA 1V9ZA 3UMDA 4GHIB 5DKLA 3F1PA 4H6JA 2J3WA 2VV8A 4HH3A 3PBSA 2K31A 3O5YA 5CX7A 3TW8A 2EWWA 2KX6A 3LICA 5AVFA 5HSQA 4IUKA 3OCLA 2HJEA 1OTDA 4CLCA 2P7JA 5HWWA 4R70A 3FPVA 4Q0JA 1WA9A 4HIAA 2OWJA 5HDDA 3MQ0A 3NJAA 1MC0A 2GNXA 4HOIA 4YNRA 4LRXC 4E04A 2HJ9C 5DJUA 1UGUA 2QJ5A 3EWKA 2W3EA 3C2WA 1YAXA 5I5LA 1GSVA 3T4LA 1TS8A 3T4JA 4WLAA 4IHQA 2OAP1 4L9FA 3PBTA 3S7PA 1ODVA 2VX8A 2P04A 3LIDA 5TBMA 4EEUA 4WEKA 2O9BA 1OTEA 4OOLA 3H7WA 4P6ZM 4GLQA 3ULFA 5A8BA 1DP8A 1NWZA 1F98A 1LL8A 3OOVA 1T1AA 1ZTUA 3MR0A 5HDCA 1TS6A 1XJ4A 1T18A 3R7WA 2KOIA 1TD5A 2INWA 4ARZA 4WN5A 3LIEA 3F1NB 3LI9A 3E4PA 3IBRA 2ZOIA 3E98A 1OT9A 2VV6A 3T4QA 4NXGA 4CLCE 2M1CA 3NHQA 1P0ZA 3B33A 3C8CA 4II7A 3ICYA 3C38A 3MFXA 4R6LA 2W3DA 4YWZA 3KSFA 4WUJA 3UE6A 1G28A 1DP6A 5J4EA 1P9RA 1IOUA 1MZUA 1H3QA 4BBVA 2JKRM 1N9NA 3H82A 4FOFA 2PR6A 4JGRA 2VGLS 4MCWA 1P9WA 4EETB 4UQIS 1XFNA 3UMEA 4O8GA 3R4KA 2BASA 3HCYA 3D3OA 2ZBBA 4FSFA 5K5BA 1UWPX 5HDSA 3CUEA 2VLGA 3MF0A 5MC7A 2HV1A 2J80A 1OJGA 1LSXA 3P7NA 4I5SA 3FPWA 2MJ6A 2W1TA 3IBJA 4HH2A 3LR0A 3T4KA 3JVUA 2KLIA 4O0PA 1TF1A 2L4RA 2W0NA 4K08A 3C30A 3KSHA 1NLYA 5TJJA 3EEHA 5F68A 5L8MA 3JVVA 3E4OA 3S7QA 4NXEA 4PHTA 3TJZC 1S4SA 4NEED 2PT7A 3V67A 1VB6A 5LBRA 2JN7A 3UE3A 5KIZA 3DBAA 2D01A 3S7OA 3IS2B 3OCNA 2M7VA 2J3TD 4O01A 3PR6A 2EA9A 4DN0A 3LI8A 4RQ9A 3LUQA 2O9AA 4I3JA 3UB9A 4R38A 4G3KA 4HQAA 3VE3A 4DMZA 2PHYA 3UB8A 1XJ6A 2VZWA 1EW0A 1W63Q 3NOPC 3UB6A 4JGQA 3H82B 3CAXA 3D72A 1OPXA 1H8MA 3F1OB 4WEJA 2W27A 3E4QA 4BJPA 5HWTA 5F6AA 3PBOA 1OTBA 1D06A 5IT5A 2P08A 2K7SA 1OJ5A 2HGVA 3CLOA 4L0LA 5DF9A 1G6OA 2L1MA 3OLOA 3H7WB 4IUHA 2V0WA 1KOUA 3K3CA 3RFBA 4OOMA 3MQQA 1MKMA 3MXQA 3R7WB 1YKDA 1UWNX 1P97A 1W63M 5FL3A 2ZMFA 5DFYA 1LSWA 4EU0A 1YSPA 3P01A 4WF0A 3F1PB 3CWFA 4DJ2A 2A2LA 2EWVA 4EERA 2QWSA 2A24A 3KYQA 4NKPA 3CI6A 3CUEC 2PYRA 3LR5A 3T4OA 2D02A 3KYZA 4M4XA 4BBTA 3BQ8A 2V1BA 4KUKA 1TS0A 2GX5A 1S1ZA 1OTIA 4P6ZS 2O9CA 2PR5A 4MN5A 1D7EA 5HWVA 3MJQA 2XA7M 2IA2A 4LRZE 4CLCB 3OBFA 2PYPA 3BW6A 5EFWA 4EXOA 4GHIA 4Y3IA 4UQIM 4UEYA 4I3AA 2VGLM 4ME4A 1OTAA 3KO6A 3LFVA 2JKTM 4CLCC 5HL6A 3GDIA 5HD3A 2Z6DA 4ETXA 5F69A 4Y2FA 3VE4A 2OOLA 2JKTI 3VV4A 2O0YA 4ETZA 4WL9A 2LB5A 5F5YA 4AFIA 4Q0IA 1ZHHB 2VEAA 4XT2B 1T1CA 1IFQA 2W1TB 4F3LA 2XSSA 4GJ4A 3HJKA 3SW1A 5DJTA 2V0UA 3W2ZA 4F3LB 2I9VA 3BY8A 2PDRA 3PHYA 4YOFA 2R78A 5AJGA 4MDZA 4LLOB 2JKRI 4Q0HA 3CITA 3NOTC 1JNUA 1S4RA 2XRNA 5DFXA 3EQUA 3FC7A 4H6JB 4HJ6A 4WELA 2GZAA 1XJ2A 5C5KA 3ZYTA 3T50A 2WKPA 4GS9B 4LPZA 3LR4A 3TRCA 4LRYC 3LIAA 3B42A 2QJ7A 4GS9A 3BWLA 4CQHA 4EUVA 2W3GA 1XJ3A 1YSQA 3RTYA 2VA0A 2K2NA 4ARZB 2YKHA 1F5MA 4ZRRA 3TE8A 4EEPA 2XA7S 1TS7A 2L0WA 2O99A 3UB7A 3G6OA 2DMWA 2Y8HA 4HP9A 2V1AA 1GSWA 1XFQA 5J3WA 4BMWA 2OAQ1 4B9OA 2LB9A 1S1YA 3BY9A 3F1OA 4JGPA 1VHMA 5IU1A 3PBQA 3T4TA 3KSGA 1LT0A 4KQOA 3B47A 2VKSA 4HJ4A 2FZ0A 3K3DA 3MMHA 1OT6A 4CLCD 2QKPA 4GCZA 2QYBA 2PD7A 3EQVA 5DKKA 4HHDA 3GECA 3EGDC 4B93A 1S67L 4IJGA 4PKYG 3OC2A 1STZA 5TBMB 2XROA 2WKRA 3K2NA 3NOUC 4HP4A 1NRJA 4Y5FA 2ZMVA 4MN7A 4EW7A 3EEAA 3FG8A 1DRMA 2V9AA 4HI4A 2J3TC 2NUPC 2JHEA 3S7NA 3EGXC 4Z1WA 5IS1A 4R3AA 3PBRA 3RH8B 1GSXA 4EQ1A 4I3IA 1LSVA 4EESA 4G3WA 1BYWA 4NXBA 4BBUA 4MN6A 2KDKA 4MMNA 2VJWA 2NUTC 2OWHA 3F1NA 4I39A 2B02A 4PAUA 4JGOA 2G7UA 3IS2A 4I38A 5HPIA 2FH5A 2M7UA 2CMNA 3LIBA 3HJIA 2WKQA 1N9OA 5G4ZA 3PBNA 1X0OA 3ZQ5A 3E0YA 2W3FA 4XT2A 3KSIA 4HJ3A 5KSHA 4DJ3A 4KQDA 3T4SA 4NXFA 3A0SA 2HF6A 5AVEA 5HD5A 3EOIA 4HNBA 2ZOHA 5G4YA 1S66L 4HY8A 2B18A 1F9IA 2QHKA 3PXPA 3LR3A 4L9EA 3BQAA 2VV7A 2PD8A 2W3HA 1DP9A 3MQOA 4BWIA 1N9LA 3U2AA 3LIFA 4KUOA 1NLZA 3LYXA 3H9WA 2GJ3A 3PYPA 4QPRA 1Y28A 3A0RA 4GW9A 1T19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1A A;  5HZH A;  1GSW A;  1UWN X;  1XFQ A;  4JGR A;  5J3W A;  1P97 A;  4B9O A;  4PKY A;  1S1Y A;  2Z6C A;  3BY9 A;  3F1O A;  4JGP A;  4EET B;  1LSW A;  3A0V A;  3KX0 X;  1V9Y A;  1XFN A;  1T1B A;  5IU1 A;  4WF0 A;  2A24 B;  3CWF A;  3F1P B;  3UME A;  4DJ2 A;  2YKF A;  3VOL A;  1LT0 A;  4HJ4 A;  2BAS A;  4L9G A;  5J7E A;  2ZBB A;  2H28 A;  3K3D A;  1UWP X;  3UMD A;  1V9Z A;  1OT6 A;  5HDS A;  2VLG A;  2QWS A;  2A24 A;  3F1P A;  4GHI B;  2QKP A;  4GCZ A;  4H6J A;  2HV1 A;  5DKL A;  2VV8 A;  4HH3 A;  2PD7 A;  2PYR A;  2J80 A;  5DKK A;  1OJG A;  2D02 A;  1LSX A;  3P7N A;  3GEC A;  4HHD A;  4I5S A;  1S67 L;  2KX6 A;  4PKY G;  3LIC A;  4M4X A;  5AVF A;  4BBT A;  5TBM B;  2V1B A;  4HH2 A;  4KUK A;  1TS0 A;  5HSQ A;  1S1Z A;  1OTI A;  2WKR A;  1OTD A;  2PR5 A;  4MN5 A;  2P7J A;  2L4R A;  1D7E A;  2W0N A;  4K08 A;  5HWV A;  5HWW A;  3MJQ A;  3NOU C;  4R70 A;  4HP4 A;  1WA9 A;  4HIA A;  4LRZ E;  2OWJ A;  3EEH A;  5HDD A;  5F68 A;  3NJA A;  4EW7 A;  5EFW A;  2PYP A;  3FG8 A;  4HOI A;  4EXO A;  1DRM A;  3E4O A;  4GHI A;  4LRX C;  4E04 A;  2V9A A;  4NXE A;  4HI4 A;  4I3A A;  5DJU A;  1UGU A;  2QJ5 A;  3EWK A;  1OTA A;  1S4S A;  2JHE A;  3C2W A;  3GDI A;  5I5L A;  1GSV A;  5HD3 A;  2Z6D A;  4R3A A;  5IS1 A;  5F69 A;  1VB6 A;  3VE4 A;  2JN7 A;  3RH8 B;  5KIZ A;  1GSX A;  2OOL A;  4EQ1 A;  1TS8 A;  4I3I A;  1LSV A;  2D01 A;  4WLA A;  4EES A;  4WL9 A;  4L9F A;  1BYW A;  3IS2 B;  4NXB A;  4BBU A;  4MN6 A;  2KDK A;  5F5Y A;  1ODV A;  2EA9 A;  2OWH A;  2VEA A;  3F1N A;  1T1C A;  2B02 A;  3LID A;  4I39 A;  4XT2 B;  4JGO A;  5TBM A;  4EEU A;  4F3L A;  3IS2 A;  1OTE A;  3LI8 A;  3LUQ A;  3HJK A;  4RQ9 A;  3SW1 A;  4I38 A;  5DJT A;  4I3J A;  2V0U A;  3H7W A;  4R38 A;  3UB9 A;  4F3L B;  2I9V A;  4HQA A;  3BY8 A;  2PDR A;  3PHY A;  2CMN A;  3ULF A;  3LIB A;  2PHY A;  3VE3 A;  5A8B A;  1DP8 A;  1NWZ A;  2WKQ A;  3HJI A;  2R78 A;  1F98 A;  1LL8 A;  1N9O A;  5G4Z A;  3UB8 A;  4LLO B;  1XJ6 A;  1T1A A;  1EW0 A;  3MR0 A;  3NOT C;  3NOP C;  5HDC A;  3UB6 A;  1XJ4 A;  1JNU A;  1T18 A;  1TS6 A;  1S4R A;  2INW A;  4JGQ A;  3H82 B;  3CAX A;  3FC7 A;  3D72 A;  1X0O A;  3LIE A;  3F1N B;  4H6J B;  4HJ6 A;  4WN5 A;  3LI9 A;  4XT2 A;  3ZQ5 A;  3F1O B;  4HJ3 A;  2W27 A;  3E4P A;  3E4Q A;  3IBR A;  4DJ3 A;  2ZOI A;  1OT9 A;  2VV6 A;  4KQD A;  4NXF A;  5F6A A;  5HWT A;  1XJ2 A;  4NXG A;  1OTB A;  3T50 A;  2WKP A;  1D06 A;  2M1C A;  4GS9 B;  4LPZ A;  3A0S A;  5AVE A;  2K7S A;  1OJ5 A;  3NHQ A;  1P0Z A;  3B33 A;  3C8C A;  5HD5 A;  3CLO A;  4HNB A;  4LRY C;  3LIA A;  4GS9 A;  2QJ7 A;  2ZOH A;  3BWL A;  3ICY A;  5G4Y A;  3MFX A;  1S66 L;  4HY8 A;  1XJ3 A;  1F9I A;  2QHK A;  4R6L A;  3RTY A;  4L9E A;  2VV7 A;  2L1M A;  4EER A;  4YWZ A;  3OLO A;  4WUJ A;  2PD8 A;  2YKH A;  1DP9 A;  3H7W B;  3UE6 A;  3MQO A;  1N9L A;  1G28 A;  1DP6 A;  1KOU A;  2V0W A;  3K3C A;  5J4E A;  3LIF A;  4EEP A;  4KUO A;  3LYX A;  3MQQ A;  1MZU A;  1TS7 A;  2GJ3 A;  3H9W A;  3PYP A;  2L0W A;  4BBV A;  1N9N A;  3MXQ A;  1Y28 A;  3UB7 A;  3G6O A;  3A0R A;  3H82 A;  4GW9 A;  1T19 A;  2PR6 A;  4HP9 A; 
#chains in the Genus database with same CATH topology
 3P98 A;  5HZH A;  3N4I A;  5HPF A;  1K54 A;  1OME A;  3A0V A;  2A24 B;  3O86 A;  2Y2K A;  1XPB A;  3IWI A;  2W1R A;  2FFY A;  3FWL A;  3BJN A;  4GHI B;  5DKL A;  2HP9 A;  3IX3 A;  4EBP A;  3O5Y A;  5CX7 A;  3TW8 A;  3LIC A;  4S2K A;  4IUK A;  3OCL A;  3NUL A;  4ZJ1 A;  1JVJ A;  4CLC A;  5CEB A;  2P7J A;  5CEC A;  3W4P A;  1WA9 A;  4HIA A;  3IT9 A;  4PM7 A;  4IVI A;  1MC0 A;  2GNX A;  5FAQ A;  4E04 A;  2WGW B;  2HJ9 C;  5DJU A;  1UGU A;  2QJ5 A;  3ZFZ A;  2W3E A;  2XFS A;  5I5L A;  1YAX A;  3T1S A;  3G2Y A;  3VOY A;  3T4L A;  3C5A A;  1I5Q A;  4IHQ A;  1RCJ A;  2XD1 A;  3CJM A;  1PIO A;  3V39 A;  4OOL A;  3H7W A;  4JLF A;  1PW1 A;  1L0E A;  4Y0O A;  1CI9 A;  1FCO A;  1MWU A;  1T18 A;  3NCK A;  3M2K A;  2INW A;  3F1N B;  3NI9 A;  3IBR A;  2IWC A;  3E98 A;  1FSW A;  2VV6 A;  4DE3 A;  3UPN A;  4CLC E;  4RX3 A;  4BEN A;  3NHQ A;  2OV5 A;  3B33 A;  3C7V A;  4II7 A;  3ICY A;  1BLS A;  2Q9M A;  4GOG A;  4Y7P A;  1K4F A;  2PAV P;  1MZU A;  4PM8 A;  4FOF A;  1XGJ A;  3O88 A;  5EVE A;  2WKE A;  4HBU A;  4MCW A;  4U0T A;  4EET B;  4UQI S;  1KE0 A;  1VM1 A;  3WS2 A;  2HDR A;  4O8G A;  1ONH A;  4GZB A;  3D3O A;  5HDS A;  2WZX A;  3HLW A;  5MC7 A;  2HV1 A;  2BLS A;  4I5S A;  4X56 A;  2DRW A;  2W1T A;  3IBJ A;  2Y59 A;  3N7W A;  3VP4 A;  3VSK A;  4NG2 A;  3JVU A;  2L4R A;  4KZ8 A;  3EEH A;  5L8M A;  1O7E A;  2H10 A;  5GLA A;  5KSC A;  3JVV A;  3E4O A;  4JXV A;  1KE4 A;  4RA7 A;  3OPH A;  3V67 A;  2JN7 A;  3UE3 A;  5KIZ A;  3FKV A;  2D01 A;  5G18 A;  2M7V A;  2J3T D;  3PR6 A;  3SH9 A;  2XH9 A;  2ZM2 A;  3UDF A;  3LI8 A;  4RQ9 A;  3LUQ A;  3UB9 A;  4R38 A;  4G3K A;  4HQA A;  4S2J A;  3VE3 A;  3N8S A;  2ZC3 B;  3G4P A;  3UB8 A;  2VZW A;  4ZAM A;  3F1O B;  4BJP A;  3JYI A;  4LV3 A;  5HAI A;  2ZMA A;  1BLH A;  5IT5 A;  3ITB A;  1VEU A;  4L0L A;  5FAO A;  5EVI D;  4B4X A;  1DJA A;  2Y2O A;  2Y2Q A;  4E3J A;  4OPR A;  2X02 A;  3OLO A;  4S2N A;  3H7W B;  1I2S A;  1FCM A;  5HL1 A;  4X69 A;  2CC1 A;  3MQQ A;  4OLG A;  2EXA A;  1NYY A;  4Z9Q A;  5A90 A;  3UDI A;  1PZO A;  1L3L A;  4JXG A;  5FAS A;  4Y0T A;  1LSW A;  3P01 A;  1DJC A;  4WF0 A;  3ZNT A;  5FQ9 A;  2QWS A;  1YLW A;  1VET A;  1C3B A;  3BYD A;  1HD8 A;  1BUL A;  4M4X A;  3BQ8 A;  2XQZ A;  4KUK A;  3ZNY A;  1OTI A;  1IYP A;  2O9C A;  5FAT A;  4DE2 A;  4MN5 A;  5DTT A;  5FQK A;  4KZ7 A;  5HWV A;  2RL3 A;  2ZM0 A;  3OBF A;  2PYP A;  3VFH A;  4ESP A;  1E4D A;  4UQI M;  1L2S A;  3GVB A;  3MZE A;  4CLC C;  5HD3 A;  4ETX A;  5F69 A;  4Y2F A;  3VE4 A;  5E2H A;  4X25 A;  5CXW A;  5F1F A;  3SS4 A;  4ETZ A;  4EBL A;  3V50 A;  4U3T A;  4WZ5 A;  1T1C A;  2W1T B;  1FOF A;  1CEF A;  1W8Y A;  2J7V A;  1FR1 A;  3W2Z A;  4F3L B;  1MPL A;  2X71 A;  1KVM A;  4IBR A;  4Q0H A;  2ZQD A;  4H6J B;  2GZA A;  4WM9 A;  3ZYT A;  3T50 A;  4GS9 B;  4LPZ A;  2VK3 A;  2P74 A;  4LRY C;  3LIA A;  4CQH A;  1YSQ A;  4MLL A;  2IWD A;  3Q7Z A;  1VQQ A;  1K55 C;  3SH7 A;  5A92 A;  2XA7 S;  4D2O A;  3LY4 A;  2O99 A;  2V1A A;  1GSW A;  1XFQ A;  5FEF A;  3F1O A;  3ZG8 B;  2H0Y A;  4X53 A;  4F94 A;  2ZC5 B;  3T4T A;  1LT0 A;  1K6R A;  4HJ4 A;  4R1G A;  1OT6 A;  3NEC A;  5CTN A;  4R4R A;  1K55 A;  2QYB A;  2HDQ A;  5DKK A;  4HHD A;  5CHM A;  3GEC A;  2WKI A;  5GHZ A;  5TBM B;  2XRO A;  3MZD A;  1CK3 A;  1LL5 A;  1NRJ A;  4Y5F A;  1L0D A;  3EEA A;  2NUP C;  3BM6 A;  2I72 A;  4S2L A;  5IS1 A;  3TOI A;  3QP5 A;  4WZ4 A;  1YLJ A;  4CJN A;  4G3W A;  4NXB A;  4MMN A;  3F1N A;  4JGO A;  3UDX A;  3T12 B;  4KQR A;  3IS2 A;  3CMZ A;  4I38 A;  4KZB A;  4GKU A;  5E2G A;  3CHW P;  3LIB A;  3HLE A;  1N9O A;  2V1Z A;  1W79 A;  2V20 A;  2HP6 A;  3MXS A;  3UNW A;  2Q0O A;  3E0Y A;  3PTE A;  4XT2 A;  2WAE A;  5EOE A;  3KSI A;  4BL3 A;  2B95 A;  4DJ3 A;  3T4S A;  2ZC4 B;  1Q2Q A;  3A0S A;  2XK1 A;  3NY4 A;  5HD5 A;  2XDM A;  1S66 L;  3LR3 A;  1Q2P A;  2BG1 A;  1IEL A;  3W4O A;  1DP9 A;  3M2J A;  3LIF A;  2PBY A;  5TGF A;  1DJB A;  2Y79 A;  4OOY A;  4S2I A;  1H8Z A;  3L7H A;  4IBX A;  2A49 A;  4L9G A;  4G3V A;  3UMD A;  3F1P A;  3VSL A;  2PU4 A;  4QJG A;  1JTG A;  3PBS A;  3UO9 A;  2K31 A;  2OLV A;  1SHV A;  1CEG A;  4ZBE A;  5HSQ A;  2ZLY A;  1OTD A;  2EX2 A;  5HWW A;  5EV0 A;  5U47 A;  2OWJ A;  1O07 A;  3MQ0 A;  3B3X A;  4HOI A;  3MFD A;  4OPQ A;  1AWI A;  3N8R A;  5AQB A;  2ZQ8 A;  1TS8 A;  2ZQC A;  4KZ9 A;  5EOO A;  3PBT A;  1PYY A;  5M1A A;  5GLD A;  1ODV A;  2VX8 A;  2P04 A;  3VOZ A;  3D9Y A;  5TBM A;  5CHU A;  4EEU A;  4WEK A;  2O9B A;  1J9M A;  2Z2L B;  4ZJ2 A;  1F98 A;  4KG6 A;  3OOV A;  1T1A A;  1ZTU A;  3MR0 A;  1YLP A;  1SKO A;  1HLU P;  3LI9 A;  1MWT A;  4OH0 A;  4P85 A;  3T4Q A;  4OON A;  2M1C A;  1KGG A;  3BEC A;  5AQ7 A;  3SH8 A;  1FIL A;  2W3D A;  3T1Q B;  3KSF A;  1K4E A;  4WUJ A;  4ZJ3 A;  1G28 A;  4UA6 A;  1ONG A;  1H3Q A;  4OQH A;  1E25 A;  3RXX A;  2PR6 A;  2V2F F;  4XUZ A;  3W4Q A;  1EI5 A;  4FH4 A;  4OQG A;  5EVI B;  4OQ0 A;  4GDN A;  2VGL S;  4KZA A;  5FDH A;  2HPB A;  3R4K A;  3GR2 A;  1VEU B;  2ZBB A;  5K5B A;  5HAR A;  2IWB A;  3VP0 A;  1OJG A;  3GTC A;  2BTF P;  2MJ6 A;  1G5U A;  4EBN A;  1XA1 A;  4HH2 A;  3LR0 A;  2ZM8 A;  4YIN A;  3BFD A;  2E8J A;  1WYB A;  1HZO A;  5TJJ A;  3SOI A;  3MSH A;  3CPT B;  3HLG A;  3S7Q A;  2EFU A;  1PNE A;  4NEE D;  1N4O A;  1CQA A;  2Y2G A;  2FFF B;  2WKH A;  2B5R A;  2ACG A;  3S7O A;  1ACF A;  4LV0 A;  4E3K A;  2J8Y A;  2JKG A;  1NRF A;  4QU3 A;  1YLT A;  2XD5 A;  1EWZ A;  1YQS A;  2PHY A;  4A5R A;  1K57 A;  3G35 A;  3ISG A;  3BEB A;  5FA7 A;  3D72 A;  2W27 A;  3Q7V B;  4BD1 A;  1OTB A;  4WYY A;  1OJ5 A;  3CLO A;  3IXD A;  5GLB A;  3HLF A;  4QD4 A;  1MXO A;  1SCW A;  5GL9 A;  1XKZ A;  4NK3 A;  3ZDJ A;  1FSY A;  3RXW A;  1YM1 A;  2DNS A;  1YKD A;  1TDG A;  4R23 A;  2HDS A;  1W63 M;  3PAG A;  5FL3 A;  2ZMF A;  5DFY A;  4EU0 A;  1YSP A;  3CWF A;  4DJ2 A;  2A2L A;  2EWV A;  4EER A;  4NKP A;  4CPK A;  3CI6 A;  4OP8 A;  3IX8 A;  3ZHH A;  3LR5 A;  3T4O A;  2Y2J A;  2D02 A;  1W5D A;  1BSG A;  4R3J A;  4BBT A;  4RVA A;  2ZC6 B;  1TS0 A;  2GX5 A;  4P6Z S;  1D7E A;  5AQA A;  2Y2P A;  3MJQ A;  3QP4 A;  1PZP A;  2IA2 A;  1KGF A;  4QB8 A;  5EFW A;  1XX2 A;  1SDE A;  4ME4 A;  1OTA A;  4LFU A;  3LFV A;  3DTE A;  1YPR A;  2Z6D A;  4Y15 A;  2JKT I;  2WYX A;  4XT2 B;  4DKI A;  1IFQ A;  4F3L A;  2XSS A;  3HJK A;  4LV2 A;  3LCE A;  2I9V A;  3OPR A;  4UHU A;  1BT5 A;  1FQG A;  3BRM A;  4OPY A;  3ZVT A;  2WAD A;  1PI5 A;  4HJ6 A;  3MZF A;  3JPU A;  4GDB A;  4PM9 A;  3T1X A;  2WKP A;  3ITA A;  3LR4 A;  3TRC A;  3HUO A;  3BWL A;  4M3K A;  4EUV A;  1ES2 A;  3GRJ A;  3RTY A;  1IEM A;  4C3Q A;  4WBG A;  3VP3 A;  4ARZ B;  5DTK A;  3N6I A;  3UE0 A;  2G2W A;  3WS0 A;  4EEP A;  2UWX A;  2Y2I A;  5D3O A;  1TS7 A;  2L0W A;  1G6A A;  3UB7 A;  4BL2 A;  1NZU A;  5J3W A;  2OAQ 1;  2LB9 A;  2J9O A;  4JGP A;  1LHY A;  1VHM A;  2V8C A;  3PBQ A;  1ZKJ A;  4E3M A;  3IF5 A;  3G30 A;  3ZCZ A;  1NY0 A;  3K3D A;  1KDS A;  2C5W B;  1K6S A;  3BLS A;  4CLC D;  2QKP A;  4GCZ A;  2HDU A;  4B93 A;  1S67 L;  4R4S A;  4PKY G;  5L09 A;  5I94 A;  5A93 A;  4UA7 A;  1FIK A;  4EW7 A;  2XEP A;  3Q82 A;  1QMF A;  4ID4 A;  1K25 A;  5FI6 A;  4N9L A;  5GLC A;  3VP2 A;  1SZV A;  4UAA A;  4R3A A;  3IF6 B;  1YLY A;  1LSV A;  3VP1 A;  2VGJ A;  1BYW A;  4WMC D;  1HTZ A;  2JBF A;  2VJW A;  1GHP A;  1CF0 A;  2G7U A;  3BFG A;  4KZ4 A;  3CZD A;  5CGS A;  2WKQ A;  4LV1 A;  1NYM A;  1IKI A;  2G2U A;  1M40 A;  2EX6 A;  1BTL A;  3S1Y A;  3HLC A;  5EUA A;  1MWS A;  1GCE A;  3CG5 A;  2HF6 A;  5AVE A;  1K57 C;  4HNB A;  4BLM A;  2ZOH A;  1S0W A;  5G4Y A;  3DW0 A;  4K91 A;  2W3H A;  2WUQ A;  2XR0 A;  3IXG A;  4BWI A;  1N9L A;  3U2A A;  4KZ3 A;  4E3N A;  4E6X A;  3PYP A;  3GQZ A;  1Y28 A;  4GW9 A;  4PKY A;  3IHA A;  2Z6C A;  3FV7 A;  3KX0 X;  1V9Y A;  2Q9N A;  3VOL A;  1TEM A;  3MKF A;  5J7E A;  2H28 A;  3A3E A;  3WRZ A;  5FEG A;  4GB7 A;  4H6J A;  4HH3 A;  3Q07 A;  2EWW A;  5AQ9 A;  5AVF A;  2EXB A;  2HJE A;  4LEN A;  4R70 A;  1PFL A;  1LI0 A;  3NJA A;  4Y0U A;  4YNR A;  2QPN A;  3DWK A;  1JWV A;  3C2W A;  4LCL A;  1YT4 A;  1GSV A;  1N9B A;  1KE3 A;  3O87 A;  4L9F A;  3ZG5 A;  2ZC7 A;  3E2L A;  3S7P A;  3L9K A;  3G31 A;  3LID A;  3VMA A;  5FAP A;  1GA9 A;  1OTE A;  1ZG4 A;  4GLQ A;  3MS6 A;  1K56 D;  4DDS A;  5A8B A;  1DP8 A;  1NWZ A;  5EE8 A;  3KYE A;  3QNC A;  4P6B A;  5CGW A;  3V5M A;  1XJ4 A;  1TS6 A;  2KOI A;  3O3V A;  4ARZ A;  3LIE A;  3C4P A;  1PWD A;  2C6W B;  3HLB A;  4NXG A;  1YLZ A;  4GNU A;  1P0Z A;  3C8C A;  3FZC A;  2ZD8 A;  3C38 A;  3MFX A;  4R6L A;  1PWC A;  1NXY A;  2EFX A;  4DRT A;  2J9P A;  3UE6 A;  1DP6 A;  2WK0 A;  4X55 A;  3HRE A;  4B4Z A;  5M19 A;  1N9N A;  4JPM A;  1XFN A;  4S2O A;  2BAS A;  3HLD A;  3LGO A;  2R9W A;  2VLG A;  3MF0 A;  2ZQA A;  4OP5 A;  2QMI A;  1LSX A;  3P7N A;  1W8Q A;  4FTX A;  3V3R A;  3T4K A;  1JTD A;  3HVF A;  5F82 A;  1TF1 A;  4K08 A;  3KSH A;  4QWO A;  1NLY A;  5L07 A;  1E3U A;  5F68 A;  3GMW A;  4PMA A;  1D1J A;  4EWF A;  4NXE A;  4PHT A;  3TJZ C;  4PM5 A;  3QNB A;  3M6H A;  1VB6 A;  3DBA A;  5DF8 A;  1RGZ A;  4XXR A;  4WMC A;  4JXS A;  3IS2 B;  3OCN A;  1ERQ A;  2EA9 A;  2V8F A;  5CTM A;  4DN0 A;  2XF3 A;  4I3J A;  1VET B;  4DMZ A;  4GD8 A;  4PM6 A;  2JKF A;  3NDE A;  4N9K A;  1EW0 A;  1W63 Q;  4HEF A;  2XLN A;  4JBF A;  4PPR A;  1E3U D;  1FR6 A;  3H82 B;  3CAX A;  4BQM A;  5HWT A;  5F6A A;  3UN7 A;  3PBO A;  2Y4A A;  1LI9 A;  3D4F A;  2P08 A;  2K7S A;  3UPP A;  2Z2M B;  4IVK A;  1SDN A;  2GDN A;  5DF9 A;  2L1M A;  3T1R A;  4IUH A;  4X1L A;  1KOU A;  4EV4 A;  3K3C A;  3RFB A;  4GD6 A;  4BD0 A;  4U0X A;  1MKM A;  5HAP A;  1UWN X;  1P97 A;  1IYQ A;  1K54 C;  3HUN A;  2ZQ7 A;  1GA0 A;  3A3D A;  4DF6 A;  3F1P B;  4MEZ A;  3IX4 A;  1MWR A;  1YMS A;  2A24 A;  1MBL A;  4ZDX A;  3CUE C;  4FD8 A;  1IYO A;  5EM1 A;  5KMW A;  3LEZ A;  3KYZ A;  2V1B A;  2WAF A;  3IF6 A;  3G34 A;  1ESI A;  3IF6 C;  1XA7 A;  2PR5 A;  4QY5 A;  1BLC A;  3OPP A;  5FSR A;  3AGE A;  4CLC B;  3BW6 A;  4I3A A;  3KO6 A;  2JKT M;  3DTK A;  5F1G A;  3VV4 A;  2O0Y A;  4H8R A;  1MY8 A;  2LB5 A;  5CGX A;  2VEA A;  5FQQ A;  4GJ4 A;  3SW1 A;  3WWX A;  3PHY A;  3DTI A;  3UPO A;  1SKO B;  1H0M A;  4OKP A;  5AJG A;  4MDZ A;  2JC7 A;  2QZ6 A;  3WS4 A;  2JKR I;  3CIT A;  3NOT C;  1JNU A;  4KQQ A;  1S4R A;  5F83 A;  5DFX A;  3EQU A;  1GHI A;  1XJ2 A;  5C5K A;  4R3B A;  5CED A;  3B42 A;  2P9V B;  2W3G A;  5EVL A;  2VA0 A;  4S2M A;  5HX9 A;  3VFF A;  1K56 A;  2UV0 E;  1F5M A;  1WE4 A;  4ZRR A;  1IYS A;  2JCH A;  1ERO A;  3TE8 A;  3NBL A;  1DY6 A;  5GHX A;  1PWG A;  3HUM A;  3G6O A;  4P87 A;  2Y8H A;  3Q1F A;  4HP9 A;  3GV9 A;  4BMW A;  4B9O A;  3IH9 A;  1S1Y A;  3BY9 A;  5IU1 A;  3KSG A;  4KQO A;  2VKS A;  4E6W A;  2FZ0 A;  3MMH A;  4FUW A;  2PD7 A;  3Q7V A;  1JWP A;  1RP5 A;  4IJG A;  4N92 A;  1STZ A;  3QP2 A;  4FCF A;  4RYE A;  4HP4 A;  1FCN A;  2ZMV A;  3FG8 A;  3GSG A;  5FQJ A;  1DRM A;  2V9A A;  4HI4 A;  1IKG A;  2J3T C;  4MBH A;  4OQI A;  2JHE A;  3PBR A;  3RH8 B;  3DTM A;  4EQ1 A;  3IWO A;  4I3I A;  3QP8 A;  4DDY A;  5CHJ A;  5TFQ A;  2NUT C;  2OWH A;  4RX2 A;  4PAU A;  1Z6F A;  5HFO A;  1ALQ A;  2Y91 A;  3I7J A;  5HPI A;  3IHB A;  2M7U A;  3ZG0 A;  3HJI A;  4GN2 A;  4X68 A;  3WRT A;  1WYC A;  1X0O A;  5EVI C;  4HJ3 A;  5KSH A;  4KQD A;  4NXF A;  5CRF A;  1ES3 A;  2AVX A;  5CER A;  4ZTK A;  4HY8 A;  2B18 A;  1F9I A;  2QHK A;  1XP4 A;  3PXP A;  4L9E A;  2A3U A;  3BQA A;  2VV7 A;  1SKF A;  3MQO A;  3OZH A;  4R0Q A;  4KUO A;  1M6K A;  1NLZ A;  3LYX A;  2GJ3 A;  3A0R A;  2OLU A;  3WS1 A;  3LEQ A;  1T1B A;  3OPL A;  2Y2M A;  2YKF A;  4WZ5 C;  1V9Z A;  4JKT A;  3S4X A;  2J3W A;  2VV8 A;  3TSG A;  1XGI A;  4JF4 A;  4QHC A;  1ZG6 A;  2KX6 A;  2ZJ9 A;  1TDL A;  3S22 A;  1F2K A;  3FPV A;  4Q0J A;  5DTS A;  5HDD A;  3AGD A;  4LRX C;  3BLM A;  3EWK A;  3DWZ A;  3T4J A;  2Y55 A;  4LCM A;  4WLA A;  3WS5 A;  2OAP 1;  1GHM A;  4X1M A;  2X01 A;  1AXB A;  2HP5 A;  5DVA A;  4K0X A;  5J8X A;  3U4L P;  5HW3 A;  4KZ5 A;  4P6Z M;  2WGI A;  3ULF A;  1LL8 A;  3BFE A;  5HDC A;  3IXH A;  3R7W A;  1TD5 A;  5EEC A;  4WN5 A;  1CI8 A;  2PRF A;  5FDS A;  3E4P A;  2ZOI A;  1OT9 A;  1KGE A;  3PAE A;  3C4O A;  3NC8 A;  5L2F A;  1Z09 A;  3MXR A;  5HAQ A;  1Y54 A;  1NZO A;  4KG2 A;  4YWZ A;  1S6R A;  2ZL1 B;  4UA9 A;  5J4E A;  4FH2 A;  1P9R A;  1IOU A;  5FQM A;  4BBV A;  2JKR M;  3H82 A;  5BOH A;  2EX8 A;  4JGR A;  1P9W A;  2WGW A;  1JWZ A;  3UME A;  3W8K A;  3HCY A;  3P09 A;  4FSF A;  1UWP X;  2XFT A;  3CUE A;  5EPH A;  5TR7 A;  2J80 A;  4DE1 A;  3IWQ A;  3FPW A;  1YMX A;  5EM0 A;  2KLI A;  4O0P A;  3SS5 A;  1G68 A;  2W0N A;  2XGN A;  3V3S A;  3C30 A;  1PW8 A;  4E3L A;  3UY6 A;  1XXM A;  4EQI A;  3BFC A;  1S4S A;  2PT7 A;  1ES4 A;  5E43 A;  3A3F A;  4MBF A;  1ERM A;  5LBR A;  4Y13 A;  4O01 A;  4D60 A;  2DCF A;  2O9A A;  2RCX A;  3SS3 A;  1KVL A;  1XJ6 A;  2H5S A;  3NOP C;  3UB6 A;  4JGQ A;  1KDW A;  1OPX A;  1H8M A;  4WEJ A;  2VGK A;  3E4Q A;  1LL9 A;  4K0W A;  1ZC2 A;  3MKE A;  4B88 A;  1D06 A;  2WZZ A;  2HGV A;  1G6O A;  3UB5 P;  5JYO A;  3NDG A;  2V0W A;  4OOM A;  3MXQ A;  1BLP A;  2EX9 A;  3R7W B;  1L0F A;  3QP6 A;  1A0K A;  4E3I A;  4IED A;  3M6B A;  1NJ4 A;  4OPZ A;  2P9V A;  5JYP A;  3E2K A;  3KYQ A;  2PYR A;  3DAV A;  1ESU A;  4KEN B;  4XUX A;  2ZL1 A;  3G2Z A;  1S1Z A;  3AGF A;  3ZG7 B;  4HES A;  2XA7 M;  4LRZ E;  2ZQ9 A;  1PRQ A;  4EXO A;  4GHI A;  5FQI A;  4Y3I A;  4UEY A;  2VGL M;  3TG9 A;  4N1H A;  4S2P A;  3G32 A;  3GDI A;  5HL6 A;  2OOL A;  5E2F A;  5E2E A;  4WL9 A;  5F5Y A;  4X6T A;  4AFI A;  4Q0I A;  1ZHH B;  1HVB A;  2PU2 A;  1CJF A;  3ZG9 B;  1K38 A;  5IHV A;  1BUE A;  5DJT A;  2V0U A;  3BY8 A;  2PDR A;  4YOF A;  2WGV A;  2R78 A;  4LLO B;  1H8Y A;  5M18 A;  2XRN A;  4NET A;  3FC7 A;  4YFM A;  1ES5 A;  4WEL A;  4MBK A;  4DXB A;  3LY3 A;  2Y2H A;  5FI2 A;  3MBZ A;  2E8I A;  4GS9 A;  2QJ7 A;  2Y2N A;  4JF6 A;  4N1X A;  4MNR A;  1XJ3 A;  2K2N A;  4HBT A;  2JE5 A;  2YKH A;  3IXB A;  3C7U A;  3SZT A;  4Q8I A;  3QP1 A;  4KG5 A;  2HZ5 A;  2DMW A;  1QME A;  3HBR A;  4LGW A;  4KZ6 A;  4EUZ A;  4OVD A;  1RGY A;  2OSU A;  1L0G A;  3B47 A;  3ZVW A;  3EQV A;  5L10 A;  3EGD C;  3OC2 A;  4Y17 A;  2WKR A;  3K2N A;  3N8L A;  1PI4 A;  3NOU C;  4MN7 A;  1I2W A;  4JF5 A;  3FKW A;  4DE0 A;  4JXW A;  4DXC A;  3S7N A;  3EGX C;  4Z1W A;  3ZGA B;  3UE1 A;  1GSX A;  4EES A;  3IQA A;  3FYZ A;  4BBU A;  4MN6 A;  2KDK A;  1MKI A;  2PBD P;  2R9X A;  4I39 A;  1BZA A;  1TVF A;  2B02 A;  3LO7 A;  4S2N C;  4C6Y A;  4OLD A;  3NIA A;  3BFF A;  5EVI A;  2FH5 A;  4E3O A;  2CMN A;  4O7D A;  3IH8 A;  5G4Z A;  5KZH A;  3PBN A;  1K0K A;  2Y2L A;  3ZQ5 A;  2W3F A;  1J3W A;  5FI7 A;  2H0T A;  5DF7 A;  1U60 A;  1H5X A;  3A3J A;  4QY6 A;  5A91 A;  3EOI A;  1Y4O A;  3QHY A;  4C75 A;  3CPT A;  1W7F A;  4P0M A;  2PD8 A;  3HL9 A;  1LLB A;  3Q81 A;  3RJU A;  3H9W A;  4QPR A;  3A3I A;  5GHY A;  1T19 A; 
#chains in the Genus database with same CATH homology
 2Y79 A;  5HZH A;  5HPF A;  4PKY A;  2Z6C A;  3A0V A;  3KX0 X;  1V9Y A;  1T1B A;  2A24 B;  2YKF A;  3VOL A;  2W1R A;  4L9G A;  5J7E A;  2H28 A;  4G3V A;  3BJN A;  1V9Z A;  3UMD A;  4GHI B;  5DKL A;  3F1P A;  4H6J A;  2J3W A;  2VV8 A;  4HH3 A;  3PBS A;  2K31 A;  3O5Y A;  5CX7 A;  3TW8 A;  2EWW A;  2KX6 A;  3LIC A;  5AVF A;  5HSQ A;  4IUK A;  3OCL A;  2HJE A;  1OTD A;  4CLC A;  2P7J A;  5HWW A;  4R70 A;  3FPV A;  4Q0J A;  1WA9 A;  4HIA A;  2OWJ A;  5HDD A;  3MQ0 A;  3NJA A;  1MC0 A;  2GNX A;  4HOI A;  4YNR A;  4LRX C;  4E04 A;  2HJ9 C;  5DJU A;  1UGU A;  2QJ5 A;  3EWK A;  2W3E A;  3C2W A;  1YAX A;  5I5L A;  1GSV A;  3T4L A;  1TS8 A;  3T4J A;  4WLA A;  4IHQ A;  2OAP 1;  4L9F A;  3PBT A;  3S7P A;  1ODV A;  2VX8 A;  2P04 A;  3LID A;  5TBM A;  4EEU A;  4WEK A;  2O9B A;  1OTE A;  4OOL A;  3H7W A;  4P6Z M;  4GLQ A;  3ULF A;  5A8B A;  1DP8 A;  1NWZ A;  1F98 A;  1LL8 A;  3OOV A;  1T1A A;  1ZTU A;  3MR0 A;  5HDC A;  1TS6 A;  1XJ4 A;  1T18 A;  3R7W A;  2KOI A;  1TD5 A;  2INW A;  4ARZ A;  4WN5 A;  3LIE A;  3F1N B;  3LI9 A;  3E4P A;  3IBR A;  2ZOI A;  3E98 A;  1OT9 A;  2VV6 A;  3T4Q A;  4NXG A;  4CLC E;  2M1C A;  3NHQ A;  1P0Z A;  3B33 A;  3C8C A;  4II7 A;  3ICY A;  3C38 A;  3MFX A;  4R6L A;  2W3D A;  4YWZ A;  3KSF A;  4WUJ A;  3UE6 A;  1G28 A;  1DP6 A;  5J4E A;  1P9R A;  1IOU A;  1MZU A;  1H3Q A;  4BBV A;  2JKR M;  1N9N A;  3H82 A;  4FOF A;  2PR6 A;  4JGR A;  2VGL S;  4MCW A;  1P9W A;  4EET B;  4UQI S;  1XFN A;  3UME A;  4O8G A;  3R4K A;  2BAS A;  3HCY A;  3D3O A;  2ZBB A;  4FSF A;  5K5B A;  1UWP X;  5HDS A;  3CUE A;  2VLG A;  3MF0 A;  5MC7 A;  2HV1 A;  2J80 A;  1OJG A;  1LSX A;  3P7N A;  4I5S A;  3FPW A;  2MJ6 A;  2W1T A;  3IBJ A;  4HH2 A;  3LR0 A;  3T4K A;  3JVU A;  2KLI A;  4O0P A;  1TF1 A;  2L4R A;  2W0N A;  4K08 A;  3C30 A;  3KSH A;  1NLY A;  5TJJ A;  3EEH A;  5F68 A;  5L8M A;  3JVV A;  3E4O A;  3S7Q A;  4NXE A;  4PHT A;  3TJZ C;  1S4S A;  4NEE D;  2PT7 A;  3V67 A;  1VB6 A;  5LBR A;  2JN7 A;  3UE3 A;  5KIZ A;  3DBA A;  2D01 A;  3S7O A;  3IS2 B;  3OCN A;  2M7V A;  2J3T D;  4O01 A;  3PR6 A;  2EA9 A;  4DN0 A;  3LI8 A;  4RQ9 A;  3LUQ A;  2O9A A;  4I3J A;  3UB9 A;  4R38 A;  4G3K A;  4HQA A;  3VE3 A;  4DMZ A;  2PHY A;  3UB8 A;  1XJ6 A;  2VZW A;  1EW0 A;  1W63 Q;  3NOP C;  3UB6 A;  4JGQ A;  3H82 B;  3CAX A;  3D72 A;  1OPX A;  1H8M A;  3F1O B;  4WEJ A;  2W27 A;  3E4Q A;  4BJP A;  5HWT A;  5F6A A;  3PBO A;  1OTB A;  1D06 A;  5IT5 A;  2P08 A;  2K7S A;  1OJ5 A;  2HGV A;  3CLO A;  4L0L A;  5DF9 A;  1G6O A;  2L1M A;  3OLO A;  3H7W B;  4IUH A;  2V0W A;  1KOU A;  3K3C A;  3RFB A;  4OOM A;  3MQQ A;  1MKM A;  3MXQ A;  3R7W B;  1YKD A;  1UWN X;  1P97 A;  1W63 M;  5FL3 A;  2ZMF A;  5DFY A;  1LSW A;  4EU0 A;  1YSP A;  3P01 A;  4WF0 A;  3F1P B;  3CWF A;  4DJ2 A;  2A2L A;  2EWV A;  4EER A;  2QWS A;  2A24 A;  3KYQ A;  4NKP A;  3CI6 A;  3CUE C;  2PYR A;  3LR5 A;  3T4O A;  2D02 A;  3KYZ A;  4M4X A;  4BBT A;  3BQ8 A;  2V1B A;  4KUK A;  1TS0 A;  2GX5 A;  1S1Z A;  1OTI A;  4P6Z S;  2O9C A;  2PR5 A;  4MN5 A;  1D7E A;  5HWV A;  3MJQ A;  2XA7 M;  2IA2 A;  4LRZ E;  4CLC B;  3OBF A;  2PYP A;  3BW6 A;  5EFW A;  4EXO A;  4GHI A;  4Y3I A;  4UQI M;  4UEY A;  4I3A A;  2VGL M;  4ME4 A;  1OTA A;  3KO6 A;  3LFV A;  2JKT M;  4CLC C;  5HL6 A;  3GDI A;  5HD3 A;  2Z6D A;  4ETX A;  5F69 A;  4Y2F A;  3VE4 A;  2OOL A;  2JKT I;  3VV4 A;  2O0Y A;  4ETZ A;  4WL9 A;  2LB5 A;  5F5Y A;  4AFI A;  4Q0I A;  1ZHH B;  2VEA A;  4XT2 B;  1T1C A;  1IFQ A;  2W1T B;  4F3L A;  2XSS A;  4GJ4 A;  3HJK A;  3SW1 A;  5DJT A;  2V0U A;  3W2Z A;  4F3L B;  2I9V A;  3BY8 A;  2PDR A;  3PHY A;  4YOF A;  2R78 A;  5AJG A;  4MDZ A;  4LLO B;  2JKR I;  4Q0H A;  3CIT A;  3NOT C;  1JNU A;  1S4R A;  2XRN A;  5DFX A;  3EQU A;  3FC7 A;  4H6J B;  4HJ6 A;  4WEL A;  2GZA A;  1XJ2 A;  5C5K A;  3ZYT A;  3T50 A;  2WKP A;  4GS9 B;  4LPZ A;  3LR4 A;  3TRC A;  4LRY C;  3LIA A;  3B42 A;  2QJ7 A;  4GS9 A;  3BWL A;  4CQH A;  4EUV A;  2W3G A;  1XJ3 A;  1YSQ A;  3RTY A;  2VA0 A;  2K2N A;  4ARZ B;  2YKH A;  1F5M A;  4ZRR A;  3TE8 A;  4EEP A;  2XA7 S;  1TS7 A;  2L0W A;  2O99 A;  3UB7 A;  3G6O A;  2DMW A;  2Y8H A;  4HP9 A;  2V1A A;  1GSW A;  1XFQ A;  5J3W A;  4BMW A;  2OAQ 1;  4B9O A;  2LB9 A;  1S1Y A;  3BY9 A;  3F1O A;  4JGP A;  1VHM A;  5IU1 A;  3PBQ A;  3T4T A;  3KSG A;  1LT0 A;  4KQO A;  3B47 A;  2VKS A;  4HJ4 A;  2FZ0 A;  3K3D A;  3MMH A;  1OT6 A;  4CLC D;  2QKP A;  4GCZ A;  2QYB A;  2PD7 A;  3EQV A;  5DKK A;  4HHD A;  3GEC A;  3EGD C;  4B93 A;  1S67 L;  4IJG A;  4PKY G;  3OC2 A;  1STZ A;  5TBM B;  2XRO A;  2WKR A;  3K2N A;  3NOU C;  4HP4 A;  1NRJ A;  4Y5F A;  2ZMV A;  4MN7 A;  4EW7 A;  3EEA A;  3FG8 A;  1DRM A;  2V9A A;  4HI4 A;  2J3T C;  2NUP C;  2JHE A;  3S7N A;  3EGX C;  4Z1W A;  5IS1 A;  4R3A A;  3PBR A;  3RH8 B;  1GSX A;  4EQ1 A;  4I3I A;  1LSV A;  4EES A;  4G3W A;  1BYW A;  4NXB A;  4BBU A;  4MN6 A;  2KDK A;  4MMN A;  2VJW A;  2NUT C;  2OWH A;  3F1N A;  4I39 A;  2B02 A;  4PAU A;  4JGO A;  2G7U A;  3IS2 A;  4I38 A;  5HPI A;  2FH5 A;  2M7U A;  2CMN A;  3LIB A;  3HJI A;  2WKQ A;  1N9O A;  5G4Z A;  3PBN A;  1X0O A;  3ZQ5 A;  3E0Y A;  2W3F A;  4XT2 A;  3KSI A;  4HJ3 A;  5KSH A;  4DJ3 A;  4KQD A;  3T4S A;  4NXF A;  3A0S A;  2HF6 A;  5AVE A;  5HD5 A;  3EOI A;  4HNB A;  2ZOH A;  5G4Y A;  1S66 L;  4HY8 A;  2B18 A;  1F9I A;  2QHK A;  3PXP A;  3LR3 A;  4L9E A;  3BQA A;  2VV7 A;  2PD8 A;  2W3H A;  1DP9 A;  3MQO A;  4BWI A;  1N9L A;  3U2A A;  3LIF A;  4KUO A;  1NLZ A;  3LYX A;  3H9W A;  2GJ3 A;  3PYP A;  4QPR A;  1Y28 A;  3A0R A;  4GW9 A;  1T19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...