3ICYA

The crystal structure of sensory box histidine kinase/response regulator domain from chlorobium tepidum tls
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
SNAEELQALVDNIPAAIYHLDVSGQATIRFRPPAFLKTLVSEHAGTTRLNTLSMIHHDDRHMLSNAYSKLREAKHSLTLVYRIVTPEGKLHWIEDHMRSSFSDDGLFSGIDGILCEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of sensory box histidine kinase/response regulator domain from Chlorobium
rcsb
source organism Chlorobaculum tepidum
molecule tags Structural genomics, unknown function
molecule keywords Sensor protein
total genus 13
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3icyA00
3LIAA 2Z6DA 3P7NA 1GSXA 4HP4A 2VV6A 2ZOIA 4HJ4A 3UE6A 4BBVA 5HSQA 2INWA 1S4SA 4DJ3A 2GJ3A 1JNUA 1N9LA 3EEHA 3H7WB 4I39A 3K3CA 2PR5A 1P97A 2BASA 2V0UA 2W27A 3MQOA 5HWTA 5HDSA 4LRZE 2L4RA 3BY9A 4PKYA 3A0SA 5HDDA 4MN6A 5G4YA 3UB8A 1P0ZA 2I9VA 3UMEA 3IS2A 2QKPA 5DJTA 4EETB 1OTEA 5I5LA 4K08A 1LSVA 4YWZA 3K3DA 1F9IA 3IS2B 4KQDA 1X0OA 3PYPA 5IS1A 3NHQA 4H6JB 4WF0A 2QJ7A 4JGRA 3VOLA 4GHIA 1TS0A 4EEPA 2CMNA 2YKFA 3LI9A 4I3JA 3ZQ5A 2OOLA 4I38A 4HNBA 2VV8A 5F68A 4I3AA 2KDKA 3CAXA 1N9OA 3E4PA 4HY8A 4L9GA 4LRYC 5G4ZA 3E4QA 3ICYA 4GS9A 2V0WA 1N9NA 2R78A 3BY8A 1DRMA 4B9OA 4LRXC 3RH8B 3CWFA 1S66L 4NXBA 4RQ9A 2PR6A 2A24B 4NXFA 5TBMB 3B33A 5HWWA 1V9YA 1OT9A 2PYPA 3MXQA 4EQ1A 1D06A 2K7SA 3KX0X 1KOUA 3LICA 5HD3A 2D01A 3MQQA 3OLOA 4H6JA 5DKLA 4EW7A 4F3LB 3E4OA 3C2WA 1LSWA 5J7EA 1MZUA 4L9EA 1ODVA 5AVEA 2L1MA 1F98A 3F1NB 1LSXA 4I5SA 4GCZA 2M1CA 3EWKA 3HJKA 1UWPX 3NOUC 2H28A 5AVFA 1Y28A 1T1AA 3FC7A 3LIBA 3PHYA 4MN5A 4L9FA 2JN7A 4R38A 1LL8A 4NXGA 4WN5A 1S67L 4HJ6A 5J3WA 4EEUA 4KUKA 1GSVA 1XJ3A 2V9AA 1DP9A 2YKHA 2KX6A 3LUQA 1XJ6A 4R3AA 5TBMA 4BBUA 1T1BA 2A24A 4XT2A 3ULFA 2PD8A 5KIZA 2VLGA 1DP8A 1XFQA 1XFNA 1OT6A 3A0VA 1OTDA 4JGQA 4LLOB 1XJ4A 1VB6A 2P7JA 2ZOHA 4JGOA 5HDCA 3VE4A 1XJ2A 2PDRA 3LYXA 4EXOA 3IBRA 1G28A 4EERA 3NOPC 2B02A 2JHEA 3MR0A 5HD5A 1LT0A 1UWNX 2Z6CA 3LIFA 3UB7A 3NOTC 5DKKA 2EA9A 3F1PB 1GSWA 2V1BA 4R70A 4HH2A 5HWVA 5J4EA 1EW0A 1OTIA 2L0WA 2W0NA 3A0RA 4GW9A 1WA9A 4WUJA 3UMDA 3F1PA 3VE3A 1OJ5A 4HJ3A 3CLOA 4EESA 1OTAA 2QJ5A 3NJAA 1S4RA 2HV1A 4HI4A 4GHIB 2WKQA 5F69A 3D72A 3MJQA 2D02A 4XT2B 5DJUA 5HZHA 4HHDA 3LIDA 3SW1A 1UGUA 3C8CA 3BWLA 4NXEA 1TS8A 4HQAA 3HJIA 4I3IA 2V1AA 1NWZA 1TS7A 3FG8A 2QHKA 3G6OA 1S1YA 3GECA 4PKYG 4WLAA 5IU1A 4M4XA 3UB9A 3T50A 3F1OA 3LI8A 2WKRA 1DP6A 2WKPA 4GS9B 1BYWA 2VV7A 1S1ZA 1OTBA 3H9WA 5F5YA 3RTYA 3F1OB 4R6LA 3H82A 3H7WA 2OWJA 2QWSA 3F1NA 5EFWA 3UB6A 4WL9A 4E04A 2PHYA 2VEAA 1V9ZA 3H82B 3LIEA 4JGPA 4LPZA 5F6AA 4DJ2A 4F3LA 1D7EA 1T19A 2PD7A 1OJGA 4HP9A 4HOIA 5A8BA 4HH3A 2J80A 1T18A 4KUOA 1T1CA 3GDIA 3MFXA 2PYRA 1TS6A 2OWHA 4BBTA 4HIAA 2ZBBA
chains in the Genus database with same CATH superfamily
1IYOA 3VFFA 4ZJ1A 3BFEA 4OP8A 2ZOIA 4PM6A 3MF0A 1S4SA 3A3JA 3NECA 5CHJA 3T4TA 1XGJA 3MQOA 2BASA 3IT9A 4KZ8A 1BLSA 1D1JA 3ZVWA 2EWVA 1NJ4A 5GLBA 4LV2A 1TDGA 5AQ9A 4IEDA 2P04A 3OBFA 3ZQ5A 2H0YA 4GN2A 1TF1A 3IXGA 2ZQCA 1H8YA 3IH9A 2XRNA 4MMNA 3AGFA 2ZMVA 5HWWA 1VEUA 5M1AA 2W3HA 2W3FA 1FQGA 1JWVA 3MKFA 2XD1A 4MN5A 1EI5A 4LENA 3M6BA 1IYSA 2KX6A 3HUMA 4JLFA 1XFNA 1DJBA 5HAPA 4KZAA 4QU3A 4RX3A 3PAGA 2ZOHA 1K55C 1ESUA 2Z6CA 3NOTC 3UE3A 5J8XA 2EA9A 1Z6FA 4P87A 3RJUA 3NJAA 3DW0A 5FI2A 3VV4A 2OV5A 1MC0A 5J4EA 1DP6A 5F83A 1SDEA 4R6LA 5FQJA 4E04A 1OJGA 1BZAA 1W63Q 3N7WA 4KUOA 2W3EA 3ZDJA 3CZDA 2VV6A 2Y2PA 4LFUA 4N9LA 2EX2A 4U0XA 3PBSA 4E3LA 4MN6A 2C5WB 4GHIA 4HNBA 1NRFA 2JKFA 3NBLA 2V0WA 4DDYA 3P09A 2EXBA 3FKVA 3IX4A 1K54C 1KGGA 4DKIA 5HD3A 3BFFA 3G35A 5EVLA 2ZC5B 3N8LA 5LBRA 3F1NB 3PBQA 4KENB 2M1CA 3T4SA 1KDSA 3LIBA 4L9FA 2ZM8A 5J3WA 5GLCA 3FZCA 1YSQA 3G4PA 4KUKA 1N9BA 3ULFA 3VP4A 3NDGA 3A0VA 3TE8A 4ME4A 1KVLA 5DF7A 3NCKA 2Y2MA 2JHEA 1SKFA 2LB9A 1NXYA 2VGLS 3LY3A 4X25A 5U47A 1MWTA 2XLNA 2HP5A 4U3TA 2K2NA 1K6SA 5KSCA 4BLMA 2V1AA 5HW3A 1FILA 1YSPA 3IWIA 5EM0A 3H7WA 3EOIA 4KZ6A 2NUTC 3H82B 1D7EA 4HP9A 1K55A 4HH3A 1K4EA 3MMHA 1TVFA 3UE6A 2O0YA 2J3TD 3N6IA 1Q2QA 2VX8A 2GJ3A 4NG2A 3PXPA 1BLHA 3BY9A 1L0EA 4PM7A 2I9VA 3IS2A 5DJTA 4UQIM 3S7OA 3OPLA 5TFQA 3K3DA 3FPWA 4KQDA 4Q8IA 3UB5P 5TJJA 3D9YA 5FQIA 3WS1A 4II7A 4X53A 2R78A 2VGLM 3CWFA 3OPHA 3ITBA 4RQ9A 2H10A 2PT7A 3WS0A 2X02A 5FASA 2D01A 1W7FA 2Y79A 1I2WA 1ODVA 1FSWA 4R3JA 3IHBA 2ZQ9A 5FI7A 4NXGA 1K6RA 3M6HA 1A0KA 3T4JA 4LV0A 3HCYA 2H0TA 5DFXA 3HL9A 4Y2FA 5DTSA 2EFXA 4IVKA 2BLSA 1G28A 1K54A 4IBXA 3HLCA 4N1HA 4WEJA 5FQMA 1N4OA 2FZ0A 5BOHA 2JKGA 1MWUA 5F82A 4ZAMA 2HV1A 2WKQA 5EE8A 3QNCA 4WMCD 3M2KA 1KE3A 3KSFA 4KZ5A 1BUEA 3FV7A 2R9WA 4MN7A 1L2SA 4KQOA 5FDSA 4PM9A 1NRJA 2J3TC 2WZXA 4YINA 3M2JA 4D2OA 3ZNYA 4YOFA 3BECA 4GJ4A 4HP4A 4HJ4A 2INWA 3IHAA 4S2KA 2ZQAA 5HWTA 2Y2LA 2DMWA 5HDDA 3SS5A 3UMEA 4BENA 3PYPA 1YKDA 4WF0A 2VGJA 4LCMA 1GA9A 3SZTA 1PNEA 4R1GA 1LL5A 3T4LA 4KG2A 2Y2NA 4RVAA 4C75A 4GOGA 4EQ1A 4DJ3A 3UDXA 1CI8A 4K91A 4Y0UA 3LFVA 4JXSA 4S2OA 4KZ9A 3GVBA 1L0FA 2WGIA 5AVEA 3C4OA 5AVFA 1Y28A 3T1QB 1K57C 1P9RA 2XA7M 1CEGA 3KO6A 3D3OA 4P85A 4BJPA 1PW1A 4BD1A 1TD5A 3B47A 1K4FA 5DKKA 4EBLA 1RGYA 3UMDA 4KG5A 3CMZA 3CLOA 1OTAA 1SHVA 2JKRM 4G3KA 2WKIA 4YFMA 3N8SA 3LI8A 2WKRA 3V67A 2IWCA 3UB6A 4JGPA 3JYIA 3W4PA 3ZYTA 2IWDA 2B95A 1PZPA 3IWOA 3P7NA 1C3BA 1PW8A 4Q0JA 5CHMA 3BRMA 3UB8A 5CECA 2XDMA 4OONA 2V8FA 1XGIA 3T4KA 1BLPA 1H0MA 3IS2B 1X0OA 4EBPA 3GMWA 3Q07A 1WE4A 4B93A 1XPBA 2P74A 3UE1A 5CTNA 5IT5A 1STZA 2R9XA 4JXVA 1XKZA 3HLDA 5IHVA 1E25A 1MKMA 4HBUA 5GHXA 2PYPA 1HD8A 1D06A 5EPHA 5K5BA 3SH9A 4ETXA 1GHMA 4WZ4A 2GX5A 4JF4A 2WAFA 1LL8A 2W3DA 3BQAA 2WUQA 3BEBA 4R3AA 3NIAA 2PD8A 1OT6A 3E98A 1EROA 1ES5A 1XJ4A 1Z09A 1CJFA 5EVIC 3ISGA 2OSUA 4PHTA 3ZG9B 4Y0OA 4WUJA 5EOOA 4IUHA 4HJ3A 3NULA 2Y2HA 1GCEA 5F69A 1NYMA 4BQMA 5C5KA 1MY8A 5G18A 3N8RA 1S1YA 3EGXC 4WEKA 1FSYA 3W2ZA 4KZBA 5HL6A 1ONHA 4BWIA 3C4PA 4Y5FA 1TS6A 4DE3A 2GZAA 3IQAA 4E6XA 1JTDA 3BQ8A 3IXHA 3Q7VB 5KMWA 2XROA 4AFIA 2VK3A 4S2IA 2ACGA 3D4FA 3Q7ZA 2XFSA 2QKPA 4OKPA 2M7VA 4RA7A 5FI6A 2CMNA 4NK3A 4G3VA 3LO7A 3E4PA 3V3SA 3ICYA 4GS9A 4LRXC 4GZBA 2IA2A 2A24B 3PR6A 3B33A 4XUXA 5L07A 3LCEA 5HL1A 4H6JA 5CXWA 4EBNA 4O7DA 2ZM2A 1VETA 5E2EA 2L1MA 2XF3A 1L0GA 4P6ZM 4I5SA 5L8MA 2V20A 2Y2IA 1FOFA 4ZJ2A 3LUQA 2O9CA 4K0XA 2ZQ8A 3MXRA 3O88A 1IEMA 5FQ9A 2EX8A 3LR4A 2JE5A 3ITAA 2HZ5A 5E2FA 4N92A 4JXGA 3EGDC 3TSGA 2M7UA 1KGEA 3CI6A 3BFGA 5DF9A 1S4RA 2VZWA 5DJUA 4HHDA 3MZEA 1IYQA 1YAXA 3HREA 4PAUA 4M3KA 4C3QA 3KSGA 4ZTKA 2QWSA 5AJGA 1U60A 3LIEA 2HDQA 4DJ2A 4F3LA 5EVIA 5FATA 1PI4A 4RX2A 2ZBBA 5HD5A 2E8IA 3GRJA 4N1XA 1N9LA 5CEDA 5CGSA 3CG5A 5A91A 2J9OA 2XH9A 1G68A 2A2LA 4BL2A 1LSVA 1PWGA 3RXWA 5IS1A 3BLMA 5EUAA 3VOLA 2WGVA 2YKFA 1PI5A 1G6OA 4I38A 3W4OA 4KQRA 4HY8A 1N9NA 4B9OA 2BTFP 2Y2OA 1E3UA 2OLUA 3W8KA 3OZHA 1PZOA 2XEPA 4WELA 2EWWA 2OAP1 2I72A 1KOUA 3ZHHA 4MBKA 1IKIA 3L7HA 4EW7A 1MZUA 1IELA 3NOUC 2XD5A 3UNWA 3QP5A 2H28A 1T1AA 3PHYA 3ZG0A 4QPRA 2Y8HA 4UHUA 2ZC7A 3DWZA 3TG9A 1T1BA 5M18A 1OTDA 3VE4A 2LB5A 1MXOA 3WRZA 1ES3A 4ID4A 4R70A 3HLGA 1DY6A 1J9MA 3MFDA 4CLCB 3FPVA 4K0WA 1TS8A 5HAIA 3R4KA 3JVUA 4FD8A 1HVBA 3GECA 4WYYA 4GS9B 1BYWA 4Q0HA 4HEFA 4DE0A 2P9VB 2WK0A 5FSRA 2K31A 5AQBA 1YMSA 4DMZA 3U2AA 2ZQDA 1T18A 4Y7PA 1LI0A 3V39A 3AGDA 1NYYA 3S4XA 2FFYA 3QHYA 3PBOA 4E3MA 5FAOA 1E4DA 2Z2LB 2CC1A 4UEYA 5HDSA 1ZTUA 4X69A 4GB7A 3C7VA 4KZ4A 5CGWA 1OTEA 4GNUA 3LI9A 1PWCA 3CAXA 1N9OA 3MQ0A 1GHIA 2X71A 4Q0IA 2Y55A 1JVJA 4MEZA 4BMWA 1S66L 3PBRA 1MKIA 1KVMA 2O99A 4E3JA 4CLCE 4JKTA 2VKSA 5HX9A 1DJCA 4O0PA 2XQZA 3ZCZA 5D3OA 2J3WA 1UWPX 1MWSA 2GNXA 2GDNA 5HARA 4B4ZA 3GTCA 1GSVA 2QZ6A 5CRFA 1VM1A 4ZRRA 5KIZA 1CK3A 1XFQA 4JGQA 1VB6A 5HDCA 3S22A 3MSHA 3T1RA 3F1PB 2ZL1A 2O9BA 4MBHA 3ZG8B 3SH7A 2XGNA 3Q1FA 3D72A 2D02A 2Y2QA 4S2JA 4NXEA 1VHMA 4UQIS 3G6OA 3E0YA 4E3OA 1ZG6A 1NY0A 3WS5A 4GKUA 1IYPA 3OOVA 3C5AA 4GD8A 5HPFA 1Q2PA 3BFDA 5JYPA 1YLJA 3MFXA 3T1XA 1ZHHB 2DRWA 5FL3A 4ARZB 3LEQA 4R3BA 4P6BA 2HJ9C 2J8YA 2Q0OA 3EEAA 4KZ3A 3VP3A 2P9VA 5E43A 3IF6B 2V0UA 1S0WA 1K56A 1RCJA 4QY6A 3A0SA 2PBYA 3T4QA 2B5RA 3CUEA 5L10A 1NLYA 2OLVA 1F9IA 3NHQA 5F1FA 1XA1A 5CHUA 3FWLA 4XXRA 5DTTA 3JVVA 5GL9A 2VJWA 1IOUA 1BLCA 1DJAA 3MKEA 3VFHA 5DFYA 1FR1A 5CGXA 1KDWA 3TW8A 3ZNTA 3MQQA 3V5MA 1VEUB 4CLCD 3UO9A 3VSLA 3QP6A 3IXBA 4NEED 4GCZA 4R4RA 1ACFA 3PBTA 4WN5A 1XJ3A 4KG6A 1XJ6A 3UDFA 4X55A 2WKEA 2EX6A 4L0LA 3OPRA 2PDRA 3IBRA 3LGOA 1Y54A 4DXBA 4LCLA 4OOLA 1WA9A 4CQHA 4PPRA 4OH0A 5FAPA 2G2UA 4FCFA 5HZHA 3HJIA 4I3IA 1TS7A 2UV0E 5IU1A 3A3FA 3IBJA 2KLIA 3DAVA 4OQGA 3T1SA 4BL3A 1OTBA 1PIOA 4U0TA 3B42A 2OWJA 3SH8A 5EFWA 3IWQA 4LPZA 4P0MA 4Y17A 1NZOA 1EWZA 5F68A 2VA0A 5DTKA 3G34A 5FAQA 3P98A 1HZOA 3E2KA 2Y2GA 4JF6A 3EEHA 3H7WB 3EQUA 4G3WA 1P9WA 4OVDA 2HF6A 4YWZA 5CTMA 3RXXA 4QD4A 4QB8A 3O5YA 3UPNA 3S7NA 4B4XA 4S2PA 3A3EA 3HUNA 3BJNA 3KYEA 3Q82A 4NXBA 3HVFA 3LICA 4N9KA 1W63M 4GDNA 1SKOB 4QJGA 3CUEC 2Y59A 3W4QA 4OP5A 3EWKA 3G32A 4EUVA 1YQSA 1KE0A 4LGWA 3WS4A 2JC7A 2RL3A 4HBTA 4EEUA 1M6KA 1DP9A 3NC8A 5A93A 3K2NA 1CF0A 4A5RA 3GV9A 3UY6A 3NOPC 2ZMFA 4JPMA 4R4SA 1UWNX 5A90A 2XA7S 3DTMA 1GHPA 4X1LA 3F1PA 4FSFA 4P6ZS 2QPNA 5FDHA 3LIDA 2JKTI 4HQAA 2HPBA 3FG8A 3UB9A 3F1OA 2Y4AA 2VV7A 3RTYA 3TOIA 3H82A 2VEAA 1V9ZA 3L9KA 1G5UA 1WYBA 3ZGAB 4DE2A 3NDEA 3GDIA 2PYRA 3SS4A 2J9PA 2ZJ9A 3GSGA 3QP4A 1OMEA 1W79A 5TGFA 3WWXA 2WGWA 4UA6A 5I94A 4NETA 1ERQA 5JYOA 5EVID 2PR5A 4UA9A 4FTXA 1OPXA 5FQQA 2Q9NA 3SS3A 1FCNA 2Y2JA 5EM1A 2B18A 4IUKA 4EEPA 3LR3A 5CERA 5G4ZA 5GLAA 3RH8B 3QP8A 3QP2A 1FCOA 2VGKA 3EQVA 5F1GA 3OLOA 1LI9A 5DKLA 4E3KA 1LSXA 3CJMA 2Q9MA 3IF6C 2V9AA 2A3UA 4MBFA 2A24A 5L2FA 2AVXA 4MNRA 3ZFZA 3LIFA 1FIKA 4WZ5A 3WS2A 3VE3A 3DTIA 4OLDA 4GHIB 4E6WA 1XA7A 4XT2B 3C8CA 1CI9A 2WADA 1YLTA 5HAQA 4Y3IA 4DN0A 3T50A 2WKPA 4MDZA 4JF5A 2ZC3B 2ZD8A 1AXBA 4S2NA 4CLCC 1T19A 1W8YA 2PBDP 4MLLA 1XP4A 4HESA 4WM9A 1ZG4A 5E2GA 5GHYA 1L0DA 1VQQA 2V1ZA 4Y0TA 1VETB 1P0ZA 4E3NA 5EVEA 2HGVA 1MBLA 3NI9A 5EV0A 1CQAA 3KSHA 4I3JA 4X1MA 2KDKA 1L3LA 4L9GA 1I5QA 1S6RA 2DCFA 3IX3A 4QY5A 1AWIA 5GHZA 2W1RA 3KX0X 4IHQA 4PMAA 3AGEA 2JBFA 5KSHA 1H3QA 2JKRI 4YNRA 4JBFA 4LV1A 1F98A 4EV4A 3HJKA 1BT5A 1JTGA 3UPPA 3S7QA 3BFCA 1K56D 5M19A 4XT2A 4FH2A 1BSGA 2P7JA 2RCXA 1ESIA 4OPZA 2Y2KA 4UA7A 4CPKA 3LYXA 1MWRA 4UAAA 2B02A 3MR0A 3FKWA 4CJNA 3NY4A 4ZJ3A 3HLFA 4HH2A 3DWKA 1EW0A 2L0WA 2W0NA 4GW9A 1O7EA 1OJ5A 1QMFA 4EESA 2QJ5A 2FFFB 3MZFA 3MJQA 4O8GA 4R23A 4IVIA 4ESPA 3IF6A 2JCHA 5HSQA 3BM6A 1KGFA 3LEZA 4OQ0A 3F1OB 3OCNA 1LL9A 2W1TB 2PD7A 2DNSA 3G2ZA 5GLDA 1YM1A 2J7VA 4IBRA 1H5XA 1PRQA 4BBVA 2QMIA 3C38A 3CPTB 2PU4A 3T4OA 4I39A 3K3CA 5KZHA 2Z2MB 2G2WA 3KYQA 1NLZA 3RFBA 1CEFA 4S2NC 3E2LA 5DF8A 4JGRA 2WKHA 1PYYA 2VV8A 1IFQA 5L09A 3UPOA 1ES4A 4C6YA 3BW6A 3O87A 3BYDA 4JXWA 1K25A 2IWBA 4H8RA 5EVIB 3LR0A 2ZC6B 3S1YA 4L9EA 1K0KA 2P08A 1YLYA 2O9AA 4R38A 2JN7A 4HJ6A 1IKGA 4OOYA 3MBZA 3DTEA 5FQKA 2VLGA 2XFTA 3MZDA 1SDNA 3VP1A 1YPRA 4JGOA 5FEGA 4EERA 3U4LP 3OC2A 3ZG7B 2G7UA 1ONGA 3CHWP 1GSWA 5HWVA 1OTIA 1PWDA 2ZQ7A 4EWFA 2WAEA 3VP0A 4HI4A 3IH8A 5AQAA 5FA7A 3VOYA 1RP5A 1NWZA 4D60A 5AQ7A 1LHYA 2H5SA 1S1ZA 1YLZA 3V50A 1SKOA 2J80A 3G31A 1LLBA 3LIAA 2Z6DA 1GSXA 4Y13A 3UN7A 4FUWA 1ZC2A 3IF5A 3S7PA 1ERMA 4MCWA 3UE0A 2KOIA 4LRZE 3VSKA 4PKYA 1W5DA 5G4YA 4DDSA 3O3VA 3BLSA 1JWPA 4K08A 1PFLA 4OQIA 1WYCA 1F2KA 3PBNA 3JPUA 3R7WB 2ZC4B 4I3AA 5CX7A 3TRCA 4OQHA 3P01A 4QWOA 4DXCA 4EQIA 2EXAA 2UWXA 3VP2A 1QMEA 5TBMB 5CEBA 1V9YA 4EU0A 4B88A 3HLEA 3IX8A 3C2WA 4X6TA 5DVAA 3PAEA 3LY4A 5A92A 3FC7A 5J7EA 5FEFA 4LV3A 2HDRA 2YKHA 3FYZA 1I2SA 4DE1A 1YMXA 4XUZA 4LLOB 1NZUA 4R0QA 1RGZA 3CPTA 1H8MA 2PAVP 1LT0A 3UB7A 3I7JA 4WBGA 4NKPA 2E8JA 4ZDXA 5HFOA 3WRTA 3GR2A 2XSSA 4PKYG 2HP6A 4WMCA 3HBRA 2V8CA 4PM5A 4HOIA 3IXDA 4KZ7A 1T1CA 3DBAA 3KYZA 2OWHA 4BBTA 2WYXA 1SCWA 2HP9A 2A49A 3C7UA 2HDUA 1M40A 1P97A 2W27A 4E3IA 4X68A 5I5LA 2WZZA 4H6JB 1FR6A 2FH5A 1FCMA 4EUZA 1H8ZA 1BTLA 2JKTM 2HJEA 2PU2A 4S2MA 3A3DA 3HLWA 4GD6A 3QNBA 1J3WA 1E3UD 4RYEA 4NXFA 3TJZC 4DF6A 1OT9A 2MJ6A 3MXQA 2K7SA 1ALQA 1K38A 4OPYA 3Q81A 1YT4A 1S67L 5MC7A 3MXSA 1MPLA 4PM8A 3CITA 4BBUA 5TBMA 3VMAA 1K57A 4EXOA 1HTZA 3HLBA 4ZBEA 3V3RA 1XJ2A 4BD0A 3UDIA 3ZVTA 2PRFA 1XXMA 1W8QA 5E2HA 3A0RA 5HPIA 4GLQA 2EX9A 1SZVA 3BWLA 1HLUP 5EECA 2QHKA 3ZG5A 2XK1A 3T12B 2ZM0A 4O01A 1GA0A 5F6AA 3QP1A 2X01A 4FH4A 3G2YA 5A8BA 4ARZA 1YLPA 3B3XA 3C30A 4WL9A 2ZLYA 4FOFA 4F3LB 4OLGA 2QYBA 4OPRA 4GDBA 1JNUA 1ES2A 4OOMA 4F94A 3A3IA 1Y4OA 1JWZA 2L4RA 3GQZA 1YLWA 4EETB 1F5MA 3DTKA 2QJ7A 1TS0A 2OOLA 2OAQ1 3R7WA 4LRYC 1XX2A 3E4QA 4QHCA 3BY8A 1DRMA 2PR6A 4KQQA 2EFUA 2W3GA 3Q7VA 4S2LA 3OCLA 3G30A 3LR5A 2NUPC 4IJGA 4OPQA 5EOEA 1LSWA 2W1TA 2V2FF 1BULA 1KE4A 1TEMA 3PTEA 2C6WB 3MS6A 2BG1A 3KSIA 5TR7A 2HDSA 1DP8A 3N4IA 2ZMAA 4WZ5C 4Z9QA 1G6AA 3HUOA 2ZL1B 2V1BA 4ETZA 3O86A 4Y15A 4DRTA 2WGWB 2XR0A 3SW1A 1UGUA 1ZKJA 4CLCA 4WLAA 4M4XA 2Y91A 5F5YA 3H9WA 3F1NA 4X56A 2PHYA 3OPPA 4Z1WA 1TDLA 3VOZA 3SOIA 1O07A 3E4OA 4HIAA
chains in the Genus database with same CATH topology
5FL3A 4ARZB 3P7NA 2ZOIA 2HJ9C 4BBVA 3MF0A 1S4SA 3EEAA 3C38A 3T4TA 3T4OA 4I39A 3K3CA 3MQOA 2BASA 2V0UA 4Q0JA 2EWVA 3A0SA 3T4QA 3UB8A 3CUEA 3KYQA 1NLYA 3T4KA 1NLZA 3RFBA 1F9IA 3IS2B 1X0OA 3NHQA 4JGRA 4B93A 2P04A 3OBFA 3ZQ5A 2VV8A 1IFQA 5IT5A 1STZA 3JVVA 1TF1A 2VJWA 1IOUA 3BW6A 5DFYA 1MKMA 2XRNA 4MMNA 3TW8A 2ZMVA 5HWWA 2PYPA 1D06A 2W3HA 5K5BA 3MQQA 2W3FA 4ETXA 3LR0A 4L9EA 4CLCD 2GX5A 2P08A 4NEED 4GCZA 2O9AA 4R38A 3PBTA 4MN5A 4WN5A 2JN7A 1LL8A 4HJ6A 2W3DA 1XJ3A 3BQAA 4R3AA 2KX6A 1XJ6A 2PD8A 2VLGA 1XFNA 1OT6A 3E98A 1XJ4A 2ZOHA 4L0LA 4JGOA 2PDRA 3IBRA 4EERA 3OC2A 2Z6CA 2G7UA 3NOTC 3UE3A 4PHTA 2EA9A 1GSWA 5HWVA 1OTIA 4WUJA 4OOLA 1WA9A 4IUHA 4CQHA 4HJ3A 3NJAA 4HI4A 5F69A 5HZHA 3VV4A 5C5KA 1MC0A 3HJIA 4I3IA 1NWZA 1TS7A 1S1YA 5IU1A 5J4EA 3IBJA 2KLIA 1DP6A 3EGXC 4WEKA 1S1ZA 1OTBA 4R6LA 3B42A 2OWJA 3W2ZA 5EFWA 4E04A 4LPZA 5HL6A 1OJGA 4BWIA 1W63Q 2J80A 4KUOA 4Y5FA 1TS6A 2W3EA 5F68A 2GZAA 3LIAA 2VA0A 2Z6DA 1GSXA 2VV6A 3BQ8A 3S7PA 3EEHA 3H7WB 4MCWA 2XROA 2KOIA 3EQUA 4G3WA 4LRZE 3PBSA 4AFIA 1P9WA 4PKYA 4MN6A 5G4YA 2HF6A 2QKPA 4K08A 4YWZA 2M7VA 4GHIA 3O5YA 3S7NA 2CMNA 3PBNA 4HNBA 3R7WB 4I3AA 5CX7A 4G3VA 3TRCA 3E4PA 3ICYA 3BJNA 2V0WA 4GS9A 3P01A 4LRXC 2IA2A 4NXBA 2A24B 3PR6A 5TBMB 3B33A 1V9YA 4EU0A 3LICA 5HD3A 4H6JA 1W63M 3CUEC 3C2WA 2L1MA 3F1NB 5LBRA 3PBQA 4P6ZM 4I5SA 2M1CA 3EWKA 4EUVA 3T4SA 3FC7A 3LIBA 5L8MA 4L9FA 5J3WA 5J7EA 4EEUA 1YSQA 4KUKA 1DP9A 2YKHA 3LUQA 2O9CA 3K2NA 3ULFA 3A0VA 3TE8A 4ME4A 4LLOB 3LR4A 3NOPC 1H8MA 2JHEA 2ZMFA 2LB9A 1LT0A 1UWNX 2VGLS 3UB7A 2XA7S 3EGDC 2M7UA 4NKPA 3CI6A 5DF9A 3F1PA 4FSFA 4P6ZS 1S4RA 2VZWA 2K2NA 2XSSA 5DJUA 4HHDA 3LIDA 1YAXA 2JKTI 4HQAA 2V1AA 4PAUA 3FG8A 3UB9A 4PKYG 3F1OA 1YSPA 2VV7A 3RTYA 3H82A 3H7WA 3EOIA 3KSGA 2QWSA 5AJGA 2NUTC 2VEAA 1V9ZA 3H82B 3LIEA 4DJ2A 4F3LA 1D7EA 4HP9A 4HOIA 4HH3A 1T1CA 3GDIA 3DBAA 2PYRA 3KYZA 3MMHA 2OWHA 4BBTA 2ZBBA 5HD5A 3UE6A 2O0YA 2J3TD 2VX8A 2GJ3A 1N9LA 3PXPA 2PR5A 1P97A 2W27A 1OPXA 3BY9A 2A2LA 2I9VA 3IS2A 5DJTA 4UQIM 3S7OA 5I5LA 1LSVA 3K3DA 3FPWA 4KQDA 5IS1A 4H6JB 3VOLA 2B18A 4IUKA 2FH5A 4EEPA 2YKFA 1G6OA 3LR3A 4I38A 2JKTM 5TJJA 2HJEA 4II7A 4HY8A 5G4ZA 1N9NA 2R78A 4B9OA 2VGLM 3RH8B 3CWFA 4RQ9A 4NXFA 4WELA 2PT7A 3TJZC 2EWWA 1OT9A 2OAP1 2MJ6A 3EQVA 3MXQA 2K7SA 1KOUA 2D01A 3OLOA 5DKLA 2Y79A 4EW7A 1MZUA 1ODVA 1LSXA 3NOUC 2H28A 1T1AA 3PHYA 4NXGA 1S67L 5MC7A 4QPRA 2V9AA 2Y8HA 3T4JA 3CITA 4BBUA 5TBMA 1T1BA 2A24A 3HCYA 5DFXA 1OTDA 4Y2FA 3VE4A 2LB5A 4EXOA 1XJ2A 1G28A 4WEJA 2FZ0A 3LIFA 4R70A 3A0RA 3VE3A 5HPIA 4GLQA 2HV1A 4GHIB 2WKQA 4CLCB 3FPVA 4XT2B 3C8CA 3BWLA 1TS8A 3R4KA 3JVUA 3KSFA 2QHKA 3GECA 4Y3IA 4DN0A 3T50A 2WKPA 4GS9B 4MDZA 1BYWA 4Q0HA 4MN7A 4O01A 4KQOA 5F6AA 2K31A 4DMZA 4CLCC 1T19A 1NRJA 5A8BA 2J3TC 3U2AA 4ARZA 1T18A 4YOFA 3C30A 4WL9A 4F3LB 4FOFA 4GJ4A 4HP4A 4HJ4A 3PBOA 2INWA 2QYBA 1JNUA 4OOMA 5HWTA 4UEYA 5HDSA 2L4RA 1ZTUA 2DMWA 5HDDA 1P0ZA 3UMEA 4EETB 1OTEA 2HGVA 1F5MA 3PYPA 1YKDA 4WF0A 2QJ7A 3KSHA 1TS0A 3LI9A 4I3JA 2OOLA 2KDKA 2OAQ1 1N9OA 3CAXA 3MQ0A 4L9GA 4LRYC 3R7WA 3E4QA 3T4LA 4Q0IA 3BY8A 1DRMA 4BMWA 1S66L 3PBRA 2PR6A 2W3GA 2W1RA 2O99A 4EQ1A 3KX0X 3OCLA 4IHQA 4CLCE 4DJ3A 3LR5A 2VKSA 4IJGA 2NUPC 3LFVA 5KSHA 1H3QA 2JKRI 4O0PA 4YNRA 1LSWA 2W1TA 5AVEA 1F98A 2J3WA 3HJKA 1UWPX 5AVFA 1Y28A 2GNXA 3S7QA 1P9RA 2XA7M 1GSVA 4XT2A 4ZRRA 3KSIA 5KIZA 1DP8A 1XFQA 3KO6A 3D3OA 4BJPA 4JGQA 2P7JA 1VB6A 1TD5A 5HDCA 3LYXA 2B02A 3MR0A 3B47A 5DKKA 3F1PB 2V1BA 2O9BA 4HH2A 1EW0A 2L0WA 2W0NA 4GW9A 4ETZA 3UMDA 1OJ5A 3CLOA 4EESA 1OTAA 2QJ5A 2JKRM 3D72A 3MJQA 2D02A 4G3KA 4O8GA 3SW1A 1UGUA 4NXEA 1VHMA 4UQIS 3G6OA 3E0YA 4CLCA 5HSQA 4WLAA 4M4XA 3LI8A 2WKRA 5F5YA 3H9WA 3F1OB 3OOVA 3V67A 3F1NA 3OCNA 3UB6A 2PHYA 2W1TB 5HPFA 4JGPA 4Z1WA 2PD7A 3MFXA 3E4OA 3ZYTA 4HIAA 1ZHHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIA A;  2Z6D A;  3P7N A;  1GSX A;  4HP4 A;  2VV6 A;  2ZOI A;  4HJ4 A;  3UE6 A;  4BBV A;  5HSQ A;  2INW A;  1S4S A;  4DJ3 A;  2GJ3 A;  1JNU A;  1N9L A;  3EEH A;  3H7W B;  4I39 A;  3K3C A;  2PR5 A;  1P97 A;  2BAS A;  2V0U A;  2W27 A;  3MQO A;  5HWT A;  5HDS A;  4LRZ E;  2L4R A;  3BY9 A;  4PKY A;  3A0S A;  5HDD A;  4MN6 A;  5G4Y A;  3UB8 A;  1P0Z A;  2I9V A;  3UME A;  3IS2 A;  2QKP A;  5DJT A;  4EET B;  1OTE A;  5I5L A;  4K08 A;  1LSV A;  4YWZ A;  3K3D A;  1F9I A;  3IS2 B;  4KQD A;  1X0O A;  3PYP A;  5IS1 A;  3NHQ A;  4H6J B;  4WF0 A;  2QJ7 A;  4JGR A;  3VOL A;  4GHI A;  1TS0 A;  4EEP A;  2CMN A;  2YKF A;  3LI9 A;  4I3J A;  3ZQ5 A;  2OOL A;  4I38 A;  4HNB A;  2VV8 A;  5F68 A;  4I3A A;  2KDK A;  3CAX A;  1N9O A;  3E4P A;  4HY8 A;  4L9G A;  4LRY C;  5G4Z A;  3E4Q A;  3ICY A;  4GS9 A;  2V0W A;  1N9N A;  2R78 A;  3BY8 A;  1DRM A;  4B9O A;  4LRX C;  3RH8 B;  3CWF A;  1S66 L;  4NXB A;  4RQ9 A;  2PR6 A;  2A24 B;  4NXF A;  5TBM B;  3B33 A;  5HWW A;  1V9Y A;  1OT9 A;  2PYP A;  3MXQ A;  4EQ1 A;  1D06 A;  2K7S A;  3KX0 X;  1KOU A;  3LIC A;  5HD3 A;  2D01 A;  3MQQ A;  3OLO A;  4H6J A;  5DKL A;  4EW7 A;  4F3L B;  3E4O A;  3C2W A;  1LSW A;  5J7E A;  1MZU A;  4L9E A;  1ODV A;  5AVE A;  2L1M A;  1F98 A;  3F1N B;  1LSX A;  4I5S A;  4GCZ A;  2M1C A;  3EWK A;  3HJK A;  1UWP X;  3NOU C;  2H28 A;  5AVF A;  1Y28 A;  1T1A A;  3FC7 A;  3LIB A;  3PHY A;  4MN5 A;  4L9F A;  2JN7 A;  4R38 A;  1LL8 A;  4NXG A;  4WN5 A;  1S67 L;  4HJ6 A;  5J3W A;  4EEU A;  4KUK A;  1GSV A;  1XJ3 A;  2V9A A;  1DP9 A;  2YKH A;  2KX6 A;  3LUQ A;  1XJ6 A;  4R3A A;  5TBM A;  4BBU A;  1T1B A;  2A24 A;  4XT2 A;  3ULF A;  2PD8 A;  5KIZ A;  2VLG A;  1DP8 A;  1XFQ A;  1XFN A;  1OT6 A;  3A0V A;  1OTD A;  4JGQ A;  4LLO B;  1XJ4 A;  1VB6 A;  2P7J A;  2ZOH A;  4JGO A;  5HDC A;  3VE4 A;  1XJ2 A;  2PDR A;  3LYX A;  4EXO A;  3IBR A;  1G28 A;  4EER A;  3NOP C;  2B02 A;  2JHE A;  3MR0 A;  5HD5 A;  1LT0 A;  1UWN X;  2Z6C A;  3LIF A;  3UB7 A;  3NOT C;  5DKK A;  2EA9 A;  3F1P B;  1GSW A;  2V1B A;  4R70 A;  4HH2 A;  5HWV A;  5J4E A;  1EW0 A;  1OTI A;  2L0W A;  2W0N A;  3A0R A;  4GW9 A;  1WA9 A;  4WUJ A;  3UMD A;  3F1P A;  3VE3 A;  1OJ5 A;  4HJ3 A;  3CLO A;  4EES A;  1OTA A;  2QJ5 A;  3NJA A;  1S4R A;  2HV1 A;  4HI4 A;  4GHI B;  2WKQ A;  5F69 A;  3D72 A;  3MJQ A;  2D02 A;  4XT2 B;  5DJU A;  5HZH A;  4HHD A;  3LID A;  3SW1 A;  1UGU A;  3C8C A;  3BWL A;  4NXE A;  1TS8 A;  4HQA A;  3HJI A;  4I3I A;  2V1A A;  1NWZ A;  1TS7 A;  3FG8 A;  2QHK A;  3G6O A;  1S1Y A;  3GEC A;  4PKY G;  4WLA A;  5IU1 A;  4M4X A;  3UB9 A;  3T50 A;  3F1O A;  3LI8 A;  2WKR A;  1DP6 A;  2WKP A;  4GS9 B;  1BYW A;  2VV7 A;  1S1Z A;  1OTB A;  3H9W A;  5F5Y A;  3RTY A;  3F1O B;  4R6L A;  3H82 A;  3H7W A;  2OWJ A;  2QWS A;  3F1N A;  5EFW A;  3UB6 A;  4WL9 A;  4E04 A;  2PHY A;  2VEA A;  1V9Z A;  3H82 B;  3LIE A;  4JGP A;  4LPZ A;  5F6A A;  4DJ2 A;  4F3L A;  1D7E A;  1T19 A;  2PD7 A;  1OJG A;  4HP9 A;  4HOI A;  5A8B A;  4HH3 A;  2J80 A;  1T18 A;  4KUO A;  1T1C A;  3GDI A;  3MFX A;  2PYR A;  1TS6 A;  2OWH A;  4BBT A;  4HIA A;  2ZBB A; 
#chains in the Genus database with same CATH topology
 1IYO A;  3VFF A;  4ZJ1 A;  3BFE A;  4OP8 A;  2ZOI A;  4PM6 A;  3MF0 A;  1S4S A;  3A3J A;  3NEC A;  5CHJ A;  3T4T A;  1XGJ A;  3MQO A;  2BAS A;  3IT9 A;  4KZ8 A;  1BLS A;  1D1J A;  3ZVW A;  2EWV A;  1NJ4 A;  5GLB A;  4LV2 A;  1TDG A;  5AQ9 A;  4IED A;  2P04 A;  3OBF A;  3ZQ5 A;  2H0Y A;  4GN2 A;  1TF1 A;  3IXG A;  2ZQC A;  1H8Y A;  3IH9 A;  2XRN A;  4MMN A;  3AGF A;  2ZMV A;  5HWW A;  1VEU A;  5M1A A;  2W3H A;  2W3F A;  1FQG A;  1JWV A;  3MKF A;  2XD1 A;  4MN5 A;  1EI5 A;  4LEN A;  3M6B A;  1IYS A;  2KX6 A;  3HUM A;  4JLF A;  1XFN A;  1DJB A;  5HAP A;  4KZA A;  4QU3 A;  4RX3 A;  3PAG A;  2ZOH A;  1K55 C;  1ESU A;  2Z6C A;  3NOT C;  3UE3 A;  5J8X A;  2EA9 A;  1Z6F A;  4P87 A;  3RJU A;  3NJA A;  3DW0 A;  5FI2 A;  3VV4 A;  2OV5 A;  1MC0 A;  5J4E A;  1DP6 A;  5F83 A;  1SDE A;  4R6L A;  5FQJ A;  4E04 A;  1OJG A;  1BZA A;  1W63 Q;  3N7W A;  4KUO A;  2W3E A;  3ZDJ A;  3CZD A;  2VV6 A;  2Y2P A;  4LFU A;  4N9L A;  2EX2 A;  4U0X A;  3PBS A;  4E3L A;  4MN6 A;  2C5W B;  4GHI A;  4HNB A;  1NRF A;  2JKF A;  3NBL A;  2V0W A;  4DDY A;  3P09 A;  2EXB A;  3FKV A;  3IX4 A;  1K54 C;  1KGG A;  4DKI A;  5HD3 A;  3BFF A;  3G35 A;  5EVL A;  2ZC5 B;  3N8L A;  5LBR A;  3F1N B;  3PBQ A;  4KEN B;  2M1C A;  3T4S A;  1KDS A;  3LIB A;  4L9F A;  2ZM8 A;  5J3W A;  5GLC A;  3FZC A;  1YSQ A;  3G4P A;  4KUK A;  1N9B A;  3ULF A;  3VP4 A;  3NDG A;  3A0V A;  3TE8 A;  4ME4 A;  1KVL A;  5DF7 A;  3NCK A;  2Y2M A;  2JHE A;  1SKF A;  2LB9 A;  1NXY A;  2VGL S;  3LY3 A;  4X25 A;  5U47 A;  1MWT A;  2XLN A;  2HP5 A;  4U3T A;  2K2N A;  1K6S A;  5KSC A;  4BLM A;  2V1A A;  5HW3 A;  1FIL A;  1YSP A;  3IWI A;  5EM0 A;  3H7W A;  3EOI A;  4KZ6 A;  2NUT C;  3H82 B;  1D7E A;  4HP9 A;  1K55 A;  4HH3 A;  1K4E A;  3MMH A;  1TVF A;  3UE6 A;  2O0Y A;  2J3T D;  3N6I A;  1Q2Q A;  2VX8 A;  2GJ3 A;  4NG2 A;  3PXP A;  1BLH A;  3BY9 A;  1L0E A;  4PM7 A;  2I9V A;  3IS2 A;  5DJT A;  4UQI M;  3S7O A;  3OPL A;  5TFQ A;  3K3D A;  3FPW A;  4KQD A;  4Q8I A;  3UB5 P;  5TJJ A;  3D9Y A;  5FQI A;  3WS1 A;  4II7 A;  4X53 A;  2R78 A;  2VGL M;  3CWF A;  3OPH A;  3ITB A;  4RQ9 A;  2H10 A;  2PT7 A;  3WS0 A;  2X02 A;  5FAS A;  2D01 A;  1W7F A;  2Y79 A;  1I2W A;  1ODV A;  1FSW A;  4R3J A;  3IHB A;  2ZQ9 A;  5FI7 A;  4NXG A;  1K6R A;  3M6H A;  1A0K A;  3T4J A;  4LV0 A;  3HCY A;  2H0T A;  5DFX A;  3HL9 A;  4Y2F A;  5DTS A;  2EFX A;  4IVK A;  2BLS A;  1G28 A;  1K54 A;  4IBX A;  3HLC A;  4N1H A;  4WEJ A;  5FQM A;  1N4O A;  2FZ0 A;  5BOH A;  2JKG A;  1MWU A;  5F82 A;  4ZAM A;  2HV1 A;  2WKQ A;  5EE8 A;  3QNC A;  4WMC D;  3M2K A;  1KE3 A;  3KSF A;  4KZ5 A;  1BUE A;  3FV7 A;  2R9W A;  4MN7 A;  1L2S A;  4KQO A;  5FDS A;  4PM9 A;  1NRJ A;  2J3T C;  2WZX A;  4YIN A;  3M2J A;  4D2O A;  3ZNY A;  4YOF A;  3BEC A;  4GJ4 A;  4HP4 A;  4HJ4 A;  2INW A;  3IHA A;  4S2K A;  2ZQA A;  5HWT A;  2Y2L A;  2DMW A;  5HDD A;  3SS5 A;  3UME A;  4BEN A;  3PYP A;  1YKD A;  4WF0 A;  2VGJ A;  4LCM A;  1GA9 A;  3SZT A;  1PNE A;  4R1G A;  1LL5 A;  3T4L A;  4KG2 A;  2Y2N A;  4RVA A;  4C75 A;  4GOG A;  4EQ1 A;  4DJ3 A;  3UDX A;  1CI8 A;  4K91 A;  4Y0U A;  3LFV A;  4JXS A;  4S2O A;  4KZ9 A;  3GVB A;  1L0F A;  2WGI A;  5AVE A;  3C4O A;  5AVF A;  1Y28 A;  3T1Q B;  1K57 C;  1P9R A;  2XA7 M;  1CEG A;  3KO6 A;  3D3O A;  4P85 A;  4BJP A;  1PW1 A;  4BD1 A;  1TD5 A;  3B47 A;  1K4F A;  5DKK A;  4EBL A;  1RGY A;  3UMD A;  4KG5 A;  3CMZ A;  3CLO A;  1OTA A;  1SHV A;  2JKR M;  4G3K A;  2WKI A;  4YFM A;  3N8S A;  3LI8 A;  2WKR A;  3V67 A;  2IWC A;  3UB6 A;  4JGP A;  3JYI A;  3W4P A;  3ZYT A;  2IWD A;  2B95 A;  1PZP A;  3IWO A;  3P7N A;  1C3B A;  1PW8 A;  4Q0J A;  5CHM A;  3BRM A;  3UB8 A;  5CEC A;  2XDM A;  4OON A;  2V8F A;  1XGI A;  3T4K A;  1BLP A;  1H0M A;  3IS2 B;  1X0O A;  4EBP A;  3GMW A;  3Q07 A;  1WE4 A;  4B93 A;  1XPB A;  2P74 A;  3UE1 A;  5CTN A;  5IT5 A;  1STZ A;  2R9X A;  4JXV A;  1XKZ A;  3HLD A;  5IHV A;  1E25 A;  1MKM A;  4HBU A;  5GHX A;  2PYP A;  1HD8 A;  1D06 A;  5EPH A;  5K5B A;  3SH9 A;  4ETX A;  1GHM A;  4WZ4 A;  2GX5 A;  4JF4 A;  2WAF A;  1LL8 A;  2W3D A;  3BQA A;  2WUQ A;  3BEB A;  4R3A A;  3NIA A;  2PD8 A;  1OT6 A;  3E98 A;  1ERO A;  1ES5 A;  1XJ4 A;  1Z09 A;  1CJF A;  5EVI C;  3ISG A;  2OSU A;  4PHT A;  3ZG9 B;  4Y0O A;  4WUJ A;  5EOO A;  4IUH A;  4HJ3 A;  3NUL A;  2Y2H A;  1GCE A;  5F69 A;  1NYM A;  4BQM A;  5C5K A;  1MY8 A;  5G18 A;  3N8R A;  1S1Y A;  3EGX C;  4WEK A;  1FSY A;  3W2Z A;  4KZB A;  5HL6 A;  1ONH A;  4BWI A;  3C4P A;  4Y5F A;  1TS6 A;  4DE3 A;  2GZA A;  3IQA A;  4E6X A;  1JTD A;  3BQ8 A;  3IXH A;  3Q7V B;  5KMW A;  2XRO A;  4AFI A;  2VK3 A;  4S2I A;  2ACG A;  3D4F A;  3Q7Z A;  2XFS A;  2QKP A;  4OKP A;  2M7V A;  4RA7 A;  5FI6 A;  2CMN A;  4NK3 A;  4G3V A;  3LO7 A;  3E4P A;  3V3S A;  3ICY A;  4GS9 A;  4LRX C;  4GZB A;  2IA2 A;  2A24 B;  3PR6 A;  3B33 A;  4XUX A;  5L07 A;  3LCE A;  5HL1 A;  4H6J A;  5CXW A;  4EBN A;  4O7D A;  2ZM2 A;  1VET A;  5E2E A;  2L1M A;  2XF3 A;  1L0G A;  4P6Z M;  4I5S A;  5L8M A;  2V20 A;  2Y2I A;  1FOF A;  4ZJ2 A;  3LUQ A;  2O9C A;  4K0X A;  2ZQ8 A;  3MXR A;  3O88 A;  1IEM A;  5FQ9 A;  2EX8 A;  3LR4 A;  2JE5 A;  3ITA A;  2HZ5 A;  5E2F A;  4N92 A;  4JXG A;  3EGD C;  3TSG A;  2M7U A;  1KGE A;  3CI6 A;  3BFG A;  5DF9 A;  1S4R A;  2VZW A;  5DJU A;  4HHD A;  3MZE A;  1IYQ A;  1YAX A;  3HRE A;  4PAU A;  4M3K A;  4C3Q A;  3KSG A;  4ZTK A;  2QWS A;  5AJG A;  1U60 A;  3LIE A;  2HDQ A;  4DJ2 A;  4F3L A;  5EVI A;  5FAT A;  1PI4 A;  4RX2 A;  2ZBB A;  5HD5 A;  2E8I A;  3GRJ A;  4N1X A;  1N9L A;  5CED A;  5CGS A;  3CG5 A;  5A91 A;  2J9O A;  2XH9 A;  1G68 A;  2A2L A;  4BL2 A;  1LSV A;  1PWG A;  3RXW A;  5IS1 A;  3BLM A;  5EUA A;  3VOL A;  2WGV A;  2YKF A;  1PI5 A;  1G6O A;  4I38 A;  3W4O A;  4KQR A;  4HY8 A;  1N9N A;  4B9O A;  2BTF P;  2Y2O A;  1E3U A;  2OLU A;  3W8K A;  3OZH A;  1PZO A;  2XEP A;  4WEL A;  2EWW A;  2OAP 1;  2I72 A;  1KOU A;  3ZHH A;  4MBK A;  1IKI A;  3L7H A;  4EW7 A;  1MZU A;  1IEL A;  3NOU C;  2XD5 A;  3UNW A;  3QP5 A;  2H28 A;  1T1A A;  3PHY A;  3ZG0 A;  4QPR A;  2Y8H A;  4UHU A;  2ZC7 A;  3DWZ A;  3TG9 A;  1T1B A;  5M18 A;  1OTD A;  3VE4 A;  2LB5 A;  1MXO A;  3WRZ A;  1ES3 A;  4ID4 A;  4R70 A;  3HLG A;  1DY6 A;  1J9M A;  3MFD A;  4CLC B;  3FPV A;  4K0W A;  1TS8 A;  5HAI A;  3R4K A;  3JVU A;  4FD8 A;  1HVB A;  3GEC A;  4WYY A;  4GS9 B;  1BYW A;  4Q0H A;  4HEF A;  4DE0 A;  2P9V B;  2WK0 A;  5FSR A;  2K31 A;  5AQB A;  1YMS A;  4DMZ A;  3U2A A;  2ZQD A;  1T18 A;  4Y7P A;  1LI0 A;  3V39 A;  3AGD A;  1NYY A;  3S4X A;  2FFY A;  3QHY A;  3PBO A;  4E3M A;  5FAO A;  1E4D A;  2Z2L B;  2CC1 A;  4UEY A;  5HDS A;  1ZTU A;  4X69 A;  4GB7 A;  3C7V A;  4KZ4 A;  5CGW A;  1OTE A;  4GNU A;  3LI9 A;  1PWC A;  3CAX A;  1N9O A;  3MQ0 A;  1GHI A;  2X71 A;  4Q0I A;  2Y55 A;  1JVJ A;  4MEZ A;  4BMW A;  1S66 L;  3PBR A;  1MKI A;  1KVM A;  2O99 A;  4E3J A;  4CLC E;  4JKT A;  2VKS A;  5HX9 A;  1DJC A;  4O0P A;  2XQZ A;  3ZCZ A;  5D3O A;  2J3W A;  1UWP X;  1MWS A;  2GNX A;  2GDN A;  5HAR A;  4B4Z A;  3GTC A;  1GSV A;  2QZ6 A;  5CRF A;  1VM1 A;  4ZRR A;  5KIZ A;  1CK3 A;  1XFQ A;  4JGQ A;  1VB6 A;  5HDC A;  3S22 A;  3MSH A;  3T1R A;  3F1P B;  2ZL1 A;  2O9B A;  4MBH A;  3ZG8 B;  3SH7 A;  2XGN A;  3Q1F A;  3D72 A;  2D02 A;  2Y2Q A;  4S2J A;  4NXE A;  1VHM A;  4UQI S;  3G6O A;  3E0Y A;  4E3O A;  1ZG6 A;  1NY0 A;  3WS5 A;  4GKU A;  1IYP A;  3OOV A;  3C5A A;  4GD8 A;  5HPF A;  1Q2P A;  3BFD A;  5JYP A;  1YLJ A;  3MFX A;  3T1X A;  1ZHH B;  2DRW A;  5FL3 A;  4ARZ B;  3LEQ A;  4R3B A;  4P6B A;  2HJ9 C;  2J8Y A;  2Q0O A;  3EEA A;  4KZ3 A;  3VP3 A;  2P9V A;  5E43 A;  3IF6 B;  2V0U A;  1S0W A;  1K56 A;  1RCJ A;  4QY6 A;  3A0S A;  2PBY A;  3T4Q A;  2B5R A;  3CUE A;  5L10 A;  1NLY A;  2OLV A;  1F9I A;  3NHQ A;  5F1F A;  1XA1 A;  5CHU A;  3FWL A;  4XXR A;  5DTT A;  3JVV A;  5GL9 A;  2VJW A;  1IOU A;  1BLC A;  1DJA A;  3MKE A;  3VFH A;  5DFY A;  1FR1 A;  5CGX A;  1KDW A;  3TW8 A;  3ZNT A;  3MQQ A;  3V5M A;  1VEU B;  4CLC D;  3UO9 A;  3VSL A;  3QP6 A;  3IXB A;  4NEE D;  4GCZ A;  4R4R A;  1ACF A;  3PBT A;  4WN5 A;  1XJ3 A;  4KG6 A;  1XJ6 A;  3UDF A;  4X55 A;  2WKE A;  2EX6 A;  4L0L A;  3OPR A;  2PDR A;  3IBR A;  3LGO A;  1Y54 A;  4DXB A;  4LCL A;  4OOL A;  1WA9 A;  4CQH A;  4PPR A;  4OH0 A;  5FAP A;  2G2U A;  4FCF A;  5HZH A;  3HJI A;  4I3I A;  1TS7 A;  2UV0 E;  5IU1 A;  3A3F A;  3IBJ A;  2KLI A;  3DAV A;  4OQG A;  3T1S A;  4BL3 A;  1OTB A;  1PIO A;  4U0T A;  3B42 A;  2OWJ A;  3SH8 A;  5EFW A;  3IWQ A;  4LPZ A;  4P0M A;  4Y17 A;  1NZO A;  1EWZ A;  5F68 A;  2VA0 A;  5DTK A;  3G34 A;  5FAQ A;  3P98 A;  1HZO A;  3E2K A;  2Y2G A;  4JF6 A;  3EEH A;  3H7W B;  3EQU A;  4G3W A;  1P9W A;  4OVD A;  2HF6 A;  4YWZ A;  5CTM A;  3RXX A;  4QD4 A;  4QB8 A;  3O5Y A;  3UPN A;  3S7N A;  4B4X A;  4S2P A;  3A3E A;  3HUN A;  3BJN A;  3KYE A;  3Q82 A;  4NXB A;  3HVF A;  3LIC A;  4N9K A;  1W63 M;  4GDN A;  1SKO B;  4QJG A;  3CUE C;  2Y59 A;  3W4Q A;  4OP5 A;  3EWK A;  3G32 A;  4EUV A;  1YQS A;  1KE0 A;  4LGW A;  3WS4 A;  2JC7 A;  2RL3 A;  4HBT A;  4EEU A;  1M6K A;  1DP9 A;  3NC8 A;  5A93 A;  3K2N A;  1CF0 A;  4A5R A;  3GV9 A;  3UY6 A;  3NOP C;  2ZMF A;  4JPM A;  4R4S A;  1UWN X;  5A90 A;  2XA7 S;  3DTM A;  1GHP A;  4X1L A;  3F1P A;  4FSF A;  4P6Z S;  2QPN A;  5FDH A;  3LID A;  2JKT I;  4HQA A;  2HPB A;  3FG8 A;  3UB9 A;  3F1O A;  2Y4A A;  2VV7 A;  3RTY A;  3TOI A;  3H82 A;  2VEA A;  1V9Z A;  3L9K A;  1G5U A;  1WYB A;  3ZGA B;  4DE2 A;  3NDE A;  3GDI A;  2PYR A;  3SS4 A;  2J9P A;  2ZJ9 A;  3GSG A;  3QP4 A;  1OME A;  1W79 A;  5TGF A;  3WWX A;  2WGW A;  4UA6 A;  5I94 A;  4NET A;  1ERQ A;  5JYO A;  5EVI D;  2PR5 A;  4UA9 A;  4FTX A;  1OPX A;  5FQQ A;  2Q9N A;  3SS3 A;  1FCN A;  2Y2J A;  5EM1 A;  2B18 A;  4IUK A;  4EEP A;  3LR3 A;  5CER A;  5G4Z A;  5GLA A;  3RH8 B;  3QP8 A;  3QP2 A;  1FCO A;  2VGK A;  3EQV A;  5F1G A;  3OLO A;  1LI9 A;  5DKL A;  4E3K A;  1LSX A;  3CJM A;  2Q9M A;  3IF6 C;  2V9A A;  2A3U A;  4MBF A;  2A24 A;  5L2F A;  2AVX A;  4MNR A;  3ZFZ A;  3LIF A;  1FIK A;  4WZ5 A;  3WS2 A;  3VE3 A;  3DTI A;  4OLD A;  4GHI B;  4E6W A;  1XA7 A;  4XT2 B;  3C8C A;  1CI9 A;  2WAD A;  1YLT A;  5HAQ A;  4Y3I A;  4DN0 A;  3T50 A;  2WKP A;  4MDZ A;  4JF5 A;  2ZC3 B;  2ZD8 A;  1AXB A;  4S2N A;  4CLC C;  1T19 A;  1W8Y A;  2PBD P;  4MLL A;  1XP4 A;  4HES A;  4WM9 A;  1ZG4 A;  5E2G A;  5GHY A;  1L0D A;  1VQQ A;  2V1Z A;  4Y0T A;  1VET B;  1P0Z A;  4E3N A;  5EVE A;  2HGV A;  1MBL A;  3NI9 A;  5EV0 A;  1CQA A;  3KSH A;  4I3J A;  4X1M A;  2KDK A;  1L3L A;  4L9G A;  1I5Q A;  1S6R A;  2DCF A;  3IX3 A;  4QY5 A;  1AWI A;  5GHZ A;  2W1R A;  3KX0 X;  4IHQ A;  4PMA A;  3AGE A;  2JBF A;  5KSH A;  1H3Q A;  2JKR I;  4YNR A;  4JBF A;  4LV1 A;  1F98 A;  4EV4 A;  3HJK A;  1BT5 A;  1JTG A;  3UPP A;  3S7Q A;  3BFC A;  1K56 D;  5M19 A;  4XT2 A;  4FH2 A;  1BSG A;  2P7J A;  2RCX A;  1ESI A;  4OPZ A;  2Y2K A;  4UA7 A;  4CPK A;  3LYX A;  1MWR A;  4UAA A;  2B02 A;  3MR0 A;  3FKW A;  4CJN A;  3NY4 A;  4ZJ3 A;  3HLF A;  4HH2 A;  3DWK A;  1EW0 A;  2L0W A;  2W0N A;  4GW9 A;  1O7E A;  1OJ5 A;  1QMF A;  4EES A;  2QJ5 A;  2FFF B;  3MZF A;  3MJQ A;  4O8G A;  4R23 A;  4IVI A;  4ESP A;  3IF6 A;  2JCH A;  5HSQ A;  3BM6 A;  1KGF A;  3LEZ A;  4OQ0 A;  3F1O B;  3OCN A;  1LL9 A;  2W1T B;  2PD7 A;  2DNS A;  3G2Z A;  5GLD A;  1YM1 A;  2J7V A;  4IBR A;  1H5X A;  1PRQ A;  4BBV A;  2QMI A;  3C38 A;  3CPT B;  2PU4 A;  3T4O A;  4I39 A;  3K3C A;  5KZH A;  2Z2M B;  2G2W A;  3KYQ A;  1NLZ A;  3RFB A;  1CEF A;  4S2N C;  3E2L A;  5DF8 A;  4JGR A;  2WKH A;  1PYY A;  2VV8 A;  1IFQ A;  5L09 A;  3UPO A;  1ES4 A;  4C6Y A;  3BW6 A;  3O87 A;  3BYD A;  4JXW A;  1K25 A;  2IWB A;  4H8R A;  5EVI B;  3LR0 A;  2ZC6 B;  3S1Y A;  4L9E A;  1K0K A;  2P08 A;  1YLY A;  2O9A A;  4R38 A;  2JN7 A;  4HJ6 A;  1IKG A;  4OOY A;  3MBZ A;  3DTE A;  5FQK A;  2VLG A;  2XFT A;  3MZD A;  1SDN A;  3VP1 A;  1YPR A;  4JGO A;  5FEG A;  4EER A;  3U4L P;  3OC2 A;  3ZG7 B;  2G7U A;  1ONG A;  3CHW P;  1GSW A;  5HWV A;  1OTI A;  1PWD A;  2ZQ7 A;  4EWF A;  2WAE A;  3VP0 A;  4HI4 A;  3IH8 A;  5AQA A;  5FA7 A;  3VOY A;  1RP5 A;  1NWZ A;  4D60 A;  5AQ7 A;  1LHY A;  2H5S A;  1S1Z A;  1YLZ A;  3V50 A;  1SKO A;  2J80 A;  3G31 A;  1LLB A;  3LIA A;  2Z6D A;  1GSX A;  4Y13 A;  3UN7 A;  4FUW A;  1ZC2 A;  3IF5 A;  3S7P A;  1ERM A;  4MCW A;  3UE0 A;  2KOI A;  4LRZ E;  3VSK A;  4PKY A;  1W5D A;  5G4Y A;  4DDS A;  3O3V A;  3BLS A;  1JWP A;  4K08 A;  1PFL A;  4OQI A;  1WYC A;  1F2K A;  3PBN A;  3JPU A;  3R7W B;  2ZC4 B;  4I3A A;  5CX7 A;  3TRC A;  4OQH A;  3P01 A;  4QWO A;  4DXC A;  4EQI A;  2EXA A;  2UWX A;  3VP2 A;  1QME A;  5TBM B;  5CEB A;  1V9Y A;  4EU0 A;  4B88 A;  3HLE A;  3IX8 A;  3C2W A;  4X6T A;  5DVA A;  3PAE A;  3LY4 A;  5A92 A;  3FC7 A;  5J7E A;  5FEF A;  4LV3 A;  2HDR A;  2YKH A;  3FYZ A;  1I2S A;  4DE1 A;  1YMX A;  4XUZ A;  4LLO B;  1NZU A;  4R0Q A;  1RGZ A;  3CPT A;  1H8M A;  2PAV P;  1LT0 A;  3UB7 A;  3I7J A;  4WBG A;  4NKP A;  2E8J A;  4ZDX A;  5HFO A;  3WRT A;  3GR2 A;  2XSS A;  4PKY G;  2HP6 A;  4WMC A;  3HBR A;  2V8C A;  4PM5 A;  4HOI A;  3IXD A;  4KZ7 A;  1T1C A;  3DBA A;  3KYZ A;  2OWH A;  4BBT A;  2WYX A;  1SCW A;  2HP9 A;  2A49 A;  3C7U A;  2HDU A;  1M40 A;  1P97 A;  2W27 A;  4E3I A;  4X68 A;  5I5L A;  2WZZ A;  4H6J B;  1FR6 A;  2FH5 A;  1FCM A;  4EUZ A;  1H8Z A;  1BTL A;  2JKT M;  2HJE A;  2PU2 A;  4S2M A;  3A3D A;  3HLW A;  4GD6 A;  3QNB A;  1J3W A;  1E3U D;  4RYE A;  4NXF A;  3TJZ C;  4DF6 A;  1OT9 A;  2MJ6 A;  3MXQ A;  2K7S A;  1ALQ A;  1K38 A;  4OPY A;  3Q81 A;  1YT4 A;  1S67 L;  5MC7 A;  3MXS A;  1MPL A;  4PM8 A;  3CIT A;  4BBU A;  5TBM A;  3VMA A;  1K57 A;  4EXO A;  1HTZ A;  3HLB A;  4ZBE A;  3V3R A;  1XJ2 A;  4BD0 A;  3UDI A;  3ZVT A;  2PRF A;  1XXM A;  1W8Q A;  5E2H A;  3A0R A;  5HPI A;  4GLQ A;  2EX9 A;  1SZV A;  3BWL A;  1HLU P;  5EEC A;  2QHK A;  3ZG5 A;  2XK1 A;  3T12 B;  2ZM0 A;  4O01 A;  1GA0 A;  5F6A A;  3QP1 A;  2X01 A;  4FH4 A;  3G2Y A;  5A8B A;  4ARZ A;  1YLP A;  3B3X A;  3C30 A;  4WL9 A;  2ZLY A;  4FOF A;  4F3L B;  4OLG A;  2QYB A;  4OPR A;  4GDB A;  1JNU A;  1ES2 A;  4OOM A;  4F94 A;  3A3I A;  1Y4O A;  1JWZ A;  2L4R A;  3GQZ A;  1YLW A;  4EET B;  1F5M A;  3DTK A;  2QJ7 A;  1TS0 A;  2OOL A;  2OAQ 1;  3R7W A;  4LRY C;  1XX2 A;  3E4Q A;  4QHC A;  3BY8 A;  1DRM A;  2PR6 A;  4KQQ A;  2EFU A;  2W3G A;  3Q7V A;  4S2L A;  3OCL A;  3G30 A;  3LR5 A;  2NUP C;  4IJG A;  4OPQ A;  5EOE A;  1LSW A;  2W1T A;  2V2F F;  1BUL A;  1KE4 A;  1TEM A;  3PTE A;  2C6W B;  3MS6 A;  2BG1 A;  3KSI A;  5TR7 A;  2HDS A;  1DP8 A;  3N4I A;  2ZMA A;  4WZ5 C;  4Z9Q A;  1G6A A;  3HUO A;  2ZL1 B;  2V1B A;  4ETZ A;  3O86 A;  4Y15 A;  4DRT A;  2WGW B;  2XR0 A;  3SW1 A;  1UGU A;  1ZKJ A;  4CLC A;  4WLA A;  4M4X A;  2Y91 A;  5F5Y A;  3H9W A;  3F1N A;  4X56 A;  2PHY A;  3OPP A;  4Z1W A;  1TDL A;  3VOZ A;  3SOI A;  1O07 A;  3E4O A;  4HIA A; 
#chains in the Genus database with same CATH homology
 5FL3 A;  4ARZ B;  3P7N A;  2ZOI A;  2HJ9 C;  4BBV A;  3MF0 A;  1S4S A;  3EEA A;  3C38 A;  3T4T A;  3T4O A;  4I39 A;  3K3C A;  3MQO A;  2BAS A;  2V0U A;  4Q0J A;  2EWV A;  3A0S A;  3T4Q A;  3UB8 A;  3CUE A;  3KYQ A;  1NLY A;  3T4K A;  1NLZ A;  3RFB A;  1F9I A;  3IS2 B;  1X0O A;  3NHQ A;  4JGR A;  4B93 A;  2P04 A;  3OBF A;  3ZQ5 A;  2VV8 A;  1IFQ A;  5IT5 A;  1STZ A;  3JVV A;  1TF1 A;  2VJW A;  1IOU A;  3BW6 A;  5DFY A;  1MKM A;  2XRN A;  4MMN A;  3TW8 A;  2ZMV A;  5HWW A;  2PYP A;  1D06 A;  2W3H A;  5K5B A;  3MQQ A;  2W3F A;  4ETX A;  3LR0 A;  4L9E A;  4CLC D;  2GX5 A;  2P08 A;  4NEE D;  4GCZ A;  2O9A A;  4R38 A;  3PBT A;  4MN5 A;  4WN5 A;  2JN7 A;  1LL8 A;  4HJ6 A;  2W3D A;  1XJ3 A;  3BQA A;  4R3A A;  2KX6 A;  1XJ6 A;  2PD8 A;  2VLG A;  1XFN A;  1OT6 A;  3E98 A;  1XJ4 A;  2ZOH A;  4L0L A;  4JGO A;  2PDR A;  3IBR A;  4EER A;  3OC2 A;  2Z6C A;  2G7U A;  3NOT C;  3UE3 A;  4PHT A;  2EA9 A;  1GSW A;  5HWV A;  1OTI A;  4WUJ A;  4OOL A;  1WA9 A;  4IUH A;  4CQH A;  4HJ3 A;  3NJA A;  4HI4 A;  5F69 A;  5HZH A;  3VV4 A;  5C5K A;  1MC0 A;  3HJI A;  4I3I A;  1NWZ A;  1TS7 A;  1S1Y A;  5IU1 A;  5J4E A;  3IBJ A;  2KLI A;  1DP6 A;  3EGX C;  4WEK A;  1S1Z A;  1OTB A;  4R6L A;  3B42 A;  2OWJ A;  3W2Z A;  5EFW A;  4E04 A;  4LPZ A;  5HL6 A;  1OJG A;  4BWI A;  1W63 Q;  2J80 A;  4KUO A;  4Y5F A;  1TS6 A;  2W3E A;  5F68 A;  2GZA A;  3LIA A;  2VA0 A;  2Z6D A;  1GSX A;  2VV6 A;  3BQ8 A;  3S7P A;  3EEH A;  3H7W B;  4MCW A;  2XRO A;  2KOI A;  3EQU A;  4G3W A;  4LRZ E;  3PBS A;  4AFI A;  1P9W A;  4PKY A;  4MN6 A;  5G4Y A;  2HF6 A;  2QKP A;  4K08 A;  4YWZ A;  2M7V A;  4GHI A;  3O5Y A;  3S7N A;  2CMN A;  3PBN A;  4HNB A;  3R7W B;  4I3A A;  5CX7 A;  4G3V A;  3TRC A;  3E4P A;  3ICY A;  3BJN A;  2V0W A;  4GS9 A;  3P01 A;  4LRX C;  2IA2 A;  4NXB A;  2A24 B;  3PR6 A;  5TBM B;  3B33 A;  1V9Y A;  4EU0 A;  3LIC A;  5HD3 A;  4H6J A;  1W63 M;  3CUE C;  3C2W A;  2L1M A;  3F1N B;  5LBR A;  3PBQ A;  4P6Z M;  4I5S A;  2M1C A;  3EWK A;  4EUV A;  3T4S A;  3FC7 A;  3LIB A;  5L8M A;  4L9F A;  5J3W A;  5J7E A;  4EEU A;  1YSQ A;  4KUK A;  1DP9 A;  2YKH A;  3LUQ A;  2O9C A;  3K2N A;  3ULF A;  3A0V A;  3TE8 A;  4ME4 A;  4LLO B;  3LR4 A;  3NOP C;  1H8M A;  2JHE A;  2ZMF A;  2LB9 A;  1LT0 A;  1UWN X;  2VGL S;  3UB7 A;  2XA7 S;  3EGD C;  2M7U A;  4NKP A;  3CI6 A;  5DF9 A;  3F1P A;  4FSF A;  4P6Z S;  1S4R A;  2VZW A;  2K2N A;  2XSS A;  5DJU A;  4HHD A;  3LID A;  1YAX A;  2JKT I;  4HQA A;  2V1A A;  4PAU A;  3FG8 A;  3UB9 A;  4PKY G;  3F1O A;  1YSP A;  2VV7 A;  3RTY A;  3H82 A;  3H7W A;  3EOI A;  3KSG A;  2QWS A;  5AJG A;  2NUT C;  2VEA A;  1V9Z A;  3H82 B;  3LIE A;  4DJ2 A;  4F3L A;  1D7E A;  4HP9 A;  4HOI A;  4HH3 A;  1T1C A;  3GDI A;  3DBA A;  2PYR A;  3KYZ A;  3MMH A;  2OWH A;  4BBT A;  2ZBB A;  5HD5 A;  3UE6 A;  2O0Y A;  2J3T D;  2VX8 A;  2GJ3 A;  1N9L A;  3PXP A;  2PR5 A;  1P97 A;  2W27 A;  1OPX A;  3BY9 A;  2A2L A;  2I9V A;  3IS2 A;  5DJT A;  4UQI M;  3S7O A;  5I5L A;  1LSV A;  3K3D A;  3FPW A;  4KQD A;  5IS1 A;  4H6J B;  3VOL A;  2B18 A;  4IUK A;  2FH5 A;  4EEP A;  2YKF A;  1G6O A;  3LR3 A;  4I38 A;  2JKT M;  5TJJ A;  2HJE A;  4II7 A;  4HY8 A;  5G4Z A;  1N9N A;  2R78 A;  4B9O A;  2VGL M;  3RH8 B;  3CWF A;  4RQ9 A;  4NXF A;  4WEL A;  2PT7 A;  3TJZ C;  2EWW A;  1OT9 A;  2OAP 1;  2MJ6 A;  3EQV A;  3MXQ A;  2K7S A;  1KOU A;  2D01 A;  3OLO A;  5DKL A;  2Y79 A;  4EW7 A;  1MZU A;  1ODV A;  1LSX A;  3NOU C;  2H28 A;  1T1A A;  3PHY A;  4NXG A;  1S67 L;  5MC7 A;  4QPR A;  2V9A A;  2Y8H A;  3T4J A;  3CIT A;  4BBU A;  5TBM A;  1T1B A;  2A24 A;  3HCY A;  5DFX A;  1OTD A;  4Y2F A;  3VE4 A;  2LB5 A;  4EXO A;  1XJ2 A;  1G28 A;  4WEJ A;  2FZ0 A;  3LIF A;  4R70 A;  3A0R A;  3VE3 A;  5HPI A;  4GLQ A;  2HV1 A;  4GHI B;  2WKQ A;  4CLC B;  3FPV A;  4XT2 B;  3C8C A;  3BWL A;  1TS8 A;  3R4K A;  3JVU A;  3KSF A;  2QHK A;  3GEC A;  4Y3I A;  4DN0 A;  3T50 A;  2WKP A;  4GS9 B;  4MDZ A;  1BYW A;  4Q0H A;  4MN7 A;  4O01 A;  4KQO A;  5F6A A;  2K31 A;  4DMZ A;  4CLC C;  1T19 A;  1NRJ A;  5A8B A;  2J3T C;  3U2A A;  4ARZ A;  1T18 A;  4YOF A;  3C30 A;  4WL9 A;  4F3L B;  4FOF A;  4GJ4 A;  4HP4 A;  4HJ4 A;  3PBO A;  2INW A;  2QYB A;  1JNU A;  4OOM A;  5HWT A;  4UEY A;  5HDS A;  2L4R A;  1ZTU A;  2DMW A;  5HDD A;  1P0Z A;  3UME A;  4EET B;  1OTE A;  2HGV A;  1F5M A;  3PYP A;  1YKD A;  4WF0 A;  2QJ7 A;  3KSH A;  1TS0 A;  3LI9 A;  4I3J A;  2OOL A;  2KDK A;  2OAQ 1;  1N9O A;  3CAX A;  3MQ0 A;  4L9G A;  4LRY C;  3R7W A;  3E4Q A;  3T4L A;  4Q0I A;  3BY8 A;  1DRM A;  4BMW A;  1S66 L;  3PBR A;  2PR6 A;  2W3G A;  2W1R A;  2O99 A;  4EQ1 A;  3KX0 X;  3OCL A;  4IHQ A;  4CLC E;  4DJ3 A;  3LR5 A;  2VKS A;  4IJG A;  2NUP C;  3LFV A;  5KSH A;  1H3Q A;  2JKR I;  4O0P A;  4YNR A;  1LSW A;  2W1T A;  5AVE A;  1F98 A;  2J3W A;  3HJK A;  1UWP X;  5AVF A;  1Y28 A;  2GNX A;  3S7Q A;  1P9R A;  2XA7 M;  1GSV A;  4XT2 A;  4ZRR A;  3KSI A;  5KIZ A;  1DP8 A;  1XFQ A;  3KO6 A;  3D3O A;  4BJP A;  4JGQ A;  2P7J A;  1VB6 A;  1TD5 A;  5HDC A;  3LYX A;  2B02 A;  3MR0 A;  3B47 A;  5DKK A;  3F1P B;  2V1B A;  2O9B A;  4HH2 A;  1EW0 A;  2L0W A;  2W0N A;  4GW9 A;  4ETZ A;  3UMD A;  1OJ5 A;  3CLO A;  4EES A;  1OTA A;  2QJ5 A;  2JKR M;  3D72 A;  3MJQ A;  2D02 A;  4G3K A;  4O8G A;  3SW1 A;  1UGU A;  4NXE A;  1VHM A;  4UQI S;  3G6O A;  3E0Y A;  4CLC A;  5HSQ A;  4WLA A;  4M4X A;  3LI8 A;  2WKR A;  5F5Y A;  3H9W A;  3F1O B;  3OOV A;  3V67 A;  3F1N A;  3OCN A;  3UB6 A;  2PHY A;  2W1T B;  5HPF A;  4JGP A;  4Z1W A;  2PD7 A;  3MFX A;  3E4O A;  3ZYT A;  4HIA A;  1ZHH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...