3ICYA

The crystal structure of sensory box histidine kinase/response regulator domain from chlorobium tepidum tls
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
SNAEELQALVDNIPAAIYHLDVSGQATIRFRPPAFLKTLVSEHAGTTRLNTLSMIHHDDRHMLSNAYSKLREAKHSLTLVYRIVTPEGKLHWIEDHMRSSFSDDGLFSGIDGILCEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The crystal structure of sensory box histidine kinase/response regulator domain from Chlorobium
rcsb
source organism Chlorobaculum tepidum
molecule tags Structural genomics, unknown function
total genus 13
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3icyA00
1OJ5A 2PR6A 1OT6A 4HP9A 5HZHA 4I3AA 1D06A 4BBVA 1JNUA 3BY9A 3IS2A 2EA9A 1V9YA 2CMNA 3UMEA 4R70A 4GW9A 1TS6A 3HJIA 4WUJA 3RH8B 3HJKA 3GDIA 5F6AA 3MXQA 4WLAA 2D01A 1BYWA 4HY8A 1S67L 2VV6A 4R38A 3MJQA 4H6JB 1S4RA 3ULFA 2ZOIA 4NXGA 5AVFA 1LSXA 4LPZA 3F1PA 3H7WB 4GCZA 3VE3A 4I39A 3A0RA 4PKYG 3E4PA 1DP8A 1TS0A 3LIDA 4EERA 2M1CA 4LRXC 1T1BA 5J4EA 1OTAA 2WKQA 5TBMB 3K3DA 5IU1A 1G28A 4XT2B 2JHEA 5IS1A 3ICYA 3C8CA 4R6LA 2QKPA 4L9EA 3UB6A 3LI8A 4HP4A 4WN5A 3F1NA 1S4SA 1XJ2A 2KX6A 2WKRA 5EFWA 5DKKA 4BBTA 1ODVA 3NOUC 1XJ4A 2VEAA 4HOIA 1TS7A 5HDSA 3MR0A 1XFNA 3G6OA 4KQDA 5KIZA 4I3IA 2WKPA 5F5YA 2J80A 2A24B 3LUQA 3NOTC 1X0OA 3E4OA 2GJ3A 5I5LA 2BASA 1OT9A 5A8BA 1F9IA 3H7WA 4M4XA 4KUOA 4HJ6A 4F3LB 1OTIA 3LIBA 5G4YA 2Z6CA 3D72A 1F98A 3CAXA 2D02A 1NWZA 4PKYA 2V1BA 4I38A 5TBMA 4XT2A 1T19A 3B33A 3UMDA 4LRZE 5DKLA 3MFXA 4EEPA 4LLOB 4HJ3A 4EXOA 1OJGA 4YWZA 3BY8A 4HNBA 2HV1A 2PD8A 2R78A 1UGUA 3LICA 3H82B 1N9OA 3VE4A 3MQOA 2INWA 4I5SA 4JGOA 4LRYC 4L9GA 5F69A 2A24A 1N9LA 2K7SA 4EETB 4GS9A 5DJTA 3RTYA 1N9NA 3UB7A 1S1ZA 1OTBA 2KDKA 2OOLA 3A0SA 1S1YA 2QHKA 3LIEA 1XJ6A 2L1MA 3LI9A 1P0ZA 1GSWA 2H28A 4MN6A 5HDCA 2I9VA 1XFQA 3NOPC 4MN5A 4GHIB 2VV7A 4EESA 2W0NA 4HH2A 3PYPA 3IBRA 1DP6A 1UWPX 2YKFA 1XJ3A 3F1OB 3H82A 1S66L 4HHDA 3BWLA 5F68A 1T18A 4HH3A 1LSWA 4EW7A 3CLOA 4H6JA 1P97A 3CWFA 2PHYA 2L4RA 2PDRA 4BBUA 5HWWA 4JGPA 4L9FA 5HDDA 4DJ3A 4RQ9A 3K3CA 2V1AA 4I3JA 3UB8A 3KX0X 1VB6A 1DP9A 3EEHA 1MZUA 4JGQA 3UB9A 3A0VA 3E4QA 2YKHA 4GHIA 4EEUA 4HJ4A 2V0UA 3F1PB 3EWKA 2ZBBA 2V0WA 1OTDA 2QJ7A 5J7EA 2PYPA 1V9ZA 1KOUA 1EW0A 2JN7A 4HIAA 3GECA 4K08A 4B9OA 3H9WA 1WA9A 5HWTA 3VOLA 1D7EA 3LIFA 3F1NB 2V9AA 2Z6DA 3PHYA 4F3LA 4KUKA 2P7JA 4JGRA 3SW1A 4WF0A 2PR5A 5G4ZA 1UWNX 4NXFA 3OLOA 2QJ5A 4WL9A 2OWHA 3NHQA 5DJUA 2QWSA 3FC7A 4HI4A 4HQAA 2B02A 2L0WA 2ZOHA 1GSXA 4EQ1A 2OWJA 5HWVA 2VLGA 1LL8A 1T1CA 3FG8A 2VV8A 3C2WA 5HD3A 1TS8A 5J3WA 3IS2B 1DRMA 1Y28A 2W27A 5AVEA 3ZQ5A 4E04A 2PD7A 3T50A 3NJAA 3LYXA 1T1AA 3P7NA 2PYRA 1GSVA 4NXEA 4DJ2A 4GS9B 3LIAA 4R3AA 5HD5A 1LSVA 3MQQA 1LT0A 1OTEA 3F1OA 5HSQA 4NXBA 3UE6A
chains in the Genus database with same CATH superfamily
3BM6A 5CRFA 2XFSA 2HP5A 4HP9A 4I3AA 4AFIA 2EX8A 4DMZA 2JKTM 4EUZA 1F5MA 2CMNA 4R70A 3MZDA 2DCFA 2JKTI 3RH8B 1K25A 1RGYA 3GDIA 5FAOA 4DDSA 1VM1A 4JXGA 4HY8A 5E2GA 1S67L 4R38A 3NECA 4O7DA 4HESA 4F94A 3MJQA 3ULFA 4B88A 2XA7M 1C3BA 4NK3A 4JBFA 5DTTA 1ESIA 3T4SA 4ARZA 4U0TA 1H8YA 4EV4A 1K54A 4PKYG 4QY5A 4DE1A 4MBKA 4XUZA 4CLCE 4BMWA 5IHVA 2HF6A 3LIDA 2M1CA 2Y2QA 5E2HA 4PM7A 3UDIA 4XT2B 4YFMA 3V50A 3ICYA 5IS1A 4FSFA 4R6LA 3UB6A 3LI8A 2XSSA 5HFOA 1MPLA 3F1NA 2PT7A 1XJ2A 1SKOA 1YMSA 3VFFA 3NOUC 4GLQA 2HPBA 1TS7A 3BEBA 3ZDJA 2FH5A 1FCMA 4X69A 1S0WA 2XFTA 3MR0A 3G6OA 5KIZA 4A5RA 2A24B 3FPVA 3LUQA 4R23A 2BASA 3UE1A 3AGFA 2X71A 4OPRA 1F9IA 5E2FA 4DXBA 4IEDA 1PWCA 2P9VA 4KZBA 1JWVA 4HJ6A 1FOFA 3CHWP 4KG5A 5CEBA 5I94A 2WGWA 4F3LB 3DTKA 3ZNYA 1VQQA 1BLHA 1MKIA 2V1BA 3HLGA 3IX8A 4I38A 5TBMA 3GV9A 4LGWA 3B33A 1K6SA 4Y0TA 5DKLA 4O8GA 3MFXA 4G3WA 1K38A 1KDSA 2ZMAA 1BLSA 1OJGA 1BLPA 3S7NA 2H10A 2EXAA 2J7VA 3A3DA 1FSWA 3O87A 2B95A 2R78A 2WKEA 4JF5A 3LICA 4YINA 4DE2A 4X68A 3H82B 4Z1WA 4OP8A 1N9OA 3VE4A 1OMEA 2INWA 4I5SA 4LRYC 4L9GA 1XP4A 2CC1A 4KZ9A 1N9LA 3B42A 4ETXA 1DY6A 4IVIA 2ZJ9A 1NRJA 3M2KA 3C7VA 2Y2OA 2B5RA 4FUWA 1I5QA 3HLFA 5DTKA 3LI9A 1P0ZA 1TDGA 4RX2A 3DBAA 5GHZA 1XFQA 3V39A 5GL9A 4MN5A 3VP0A 1CJFA 1K4FA 1IOUA 1CI9A 4DXCA 3R7WB 4EESA 3SS3A 1KDWA 2EX6A 3LR3A 1K0KA 3ZYTA 2ZC4B 2YKFA 5FL3A 1XJ3A 3C38A 3Q81A 1IKGA 1NYYA 3LEQA 4RVAA 3GQZA 3LY4A 2K31A 1YQSA 1IYPA 2H5SA 4IHQA 4EW7A 3OC2A 1Q2PA 3CLOA 3ZNTA 2DMWA 4N92A 4H6JA 1P97A 2E8JA 2NUTC 2PHYA 1M6KA 5HWWA 1Z09A 3UPPA 4S2PA 4DJ3A 3ZG9B 4CPKA 4EU0A 5KZHA 4ID4A 2Y79A 2ZLYA 3KX0X 2O9BA 1MWSA 1MZUA 2EWVA 3G34A 3MKFA 1ES5A 4JGQA 3QNCA 2PBDP 3KSFA 2PRFA 4R3BA 2Z2MB 1GHMA 4PM6A 3BJNA 1Y54A 3FYZA 2O9AA 3IXGA 3NI9A 5HAIA 3V3SA 5FQIA 4S2MA 2FZ0A 1V9ZA 4BQMA 1KOUA 3T1QB 1CQAA 1XA7A 1Q2QA 3R4KA 4OOMA 1EW0A 2ZM2A 3JYIA 4K08A 3GVBA 3RXXA 3BQ8A 5L09A 1EWZA 5KSHA 4OOYA 3IHBA 3G31A 3KYQA 3F1NB 4BENA 3QP5A 3QP6A 1NXYA 4XUXA 2IA2A 3SZTA 4KUKA 5JYOA 4S2NC 3HVFA 5HW3A 4OQHA 5L2FA 5FQ9A 1KGFA 2PR5A 4KZAA 2ZC7A 2ZQCA 5CTNA 1BT5A 4HBUA 3PBOA 4JXVA 3HL9A 4MBFA 3B3XA 3N4IA 4FH4A 1VETA 3ZG7B 3SS5A 4S2LA 3MBZA 2WGWB 3VP1A 4QJGA 3DTEA 1H5XA 3FC7A 4XXRA 5FA7A 1WE4A 4Y7PA 2OWJA 3E98A 5HWVA 3RXWA 1T1CA 4O01A 1H8ZA 3PBSA 2VV8A 3IQAA 1TS8A 4G3KA 3ZQ5A 4RA7A 3GR2A 2R9WA 1MXOA 2PD7A 1YM1A 1W79A 4DKIA 2XRNA 3NJAA 4DE0A 3GSGA 3IXHA 4DJ2A 1ZTUA 5TR7A 4JXSA 2RL3A 5GLDA 1ESUA 1E25A 4P6ZM 2XLNA 4PM5A 5HD5A 2WADA 1K55C 1HVBA 3F1OA 3O3VA 5HSQA 2W1TB 4NEED 1E3UD 1YT4A 2G2UA 3UE0A 1OJ5A 4IBRA 1OT6A 2ZC3B 1KE4A 4MNRA 1ONHA 2UWXA 1NRFA 5DVAA 4BBVA 1XGJA 1YSPA 3HUMA 4MBHA 3UMEA 4JLFA 3T4OA 3HJIA 4Q0HA 3A3IA 4DRTA 3ZVTA 4KG2A 4WLAA 1P9WA 5L10A 1SZVA 5EOEA 3MF0A 4LV1A 3ZGAB 4H6JB 3T1SA 3KYZA 4UQIS 3C4OA 1SKFA 2ZOIA 2HJ9C 2PAVP 2HP9A 1FIKA 4QB8A 4QWOA 1LSXA 4E3JA 3H7WB 3PAEA 2ZC5B 2XDMA 1L2SA 4GCZA 5TJJA 1TVFA 3NC8A 2VJWA 2OV5A 3PBNA 4Y5FA 3G2YA 2JKFA 5J4EA 1T1BA 3VFHA 2R9XA 1K6RA 1ALQA 3C8CA 3T4QA 3IF6A 2QKPA 4L9EA 2E8IA 2VK3A 1ZHHB 2Y2KA 3M6HA 3Q7VA 5CHJA 1S4SA 5CHUA 2WKRA 3E0YA 3HLWA 4ZTKA 2FFFB 1G68A 1BLCA 4X55A 1N4OA 2Y2PA 5HDSA 1GHIA 4KQDA 4S2NA 3LR5A 4UA6A 3NOTC 1KVLA 3LGOA 2Y91A 2GJ3A 3CG5A 5EVIB 1N9BA 2IWDA 3W4QA 2WGIA 4CLCD 4KUOA 5U47A 1VEUA 1OTIA 5G4YA 4CLCC 2ZQDA 4LV2A 3O5YA 1CEFA 4PKYA 1NLZA 1CI8A 4E6WA 4LRZE 4PHTA 3WS4A 1VETB 4IBXA 4HJ3A 2ZQ7A 2B18A 1I2SA 1YPRA 4YWZA 4UAAA 2HV1A 2PD8A 5E43A 3IWIA 2HDQA 4E3KA 5DF9A 5FAPA 3JVUA 4B4XA 4JGOA 3BFDA 1D1JA 4IUKA 2A49A 4PMAA 2IWBA 5HPFA 5EV0A 2ACGA 5CX7A 1EROA 5HAQA 1YLJA 3P98A 1W63Q 1WYBA 3UB7A 3CUEC 2WAEA 1OTBA 5KSCA 3LEZA 3LIEA 3HREA 3CJMA 3QP1A 1BUEA 1NYMA 2ZMFA 1GSWA 4EQIA 3NBLA 5GLAA 5AJGA 1JTGA 4JPMA 3VMAA 1BSGA 5TFQA 4GHIB 2EWWA 5EM1A 1E3UA 2VV7A 4UHUA 4HH2A 3IBRA 1U60A 1L0GA 3BQAA 4N1HA 1AWIA 3F1OB 4LV0A 1S66L 4HHDA 1CK3A 3QP2A 4C75A 2OLUA 3KSHA 2V8FA 4FH2A 4FOFA 1DJBA 2XROA 2PDRA 2Y2HA 4JF6A 4JGPA 5HDDA 1LLBA 1L0FA 2OSUA 2K2NA 4I3JA 3UB8A 2H0YA 2JC7A 1FCOA 1DP9A 1YLTA 1TDLA 2JKGA 4EEUA 3EGDC 3BFGA 3UY6A 5FI7A 1GA9A 4PM9A 4IUHA 4ZBEA 2I72A 3HBRA 1ES2A 4OQ0A 4JXWA 1G6OA 5CTMA 1ES4A 3IF6B 3ITBA 1MWTA 1NZOA 4B9OA 3H9WA 2OAQ1 3NCKA 5AQ7A 2VA0A 1WA9A 1ERQA 2RCXA 3DTMA 3D9YA 1RP5A 3VOLA 3VP4A 3LIFA 1S6RA 3UPOA 3IXDA 4S2OA 2AVXA 4L0LA 3IWOA 4Y17A 4IJGA 2Z6DA 4GN2A 3SS4A 4CLCA 4K0XA 3SW1A 3OPLA 3IH8A 4BWIA 5G4ZA 1GA0A 4MEZA 1UWNX 1W8YA 3BW6A 4MN7A 2QJ5A 4YOFA 4EBNA 1LHYA 2Y8HA 3NHQA 4E3NA 1ONGA 5M19A 4HI4A 4ETZA 1KVMA 4GD6A 2ZM0A 4KQQA 2IWCA 2ZQAA 4OP5A 1GSXA 4Y0OA 3S1YA 1E4DA 3C2WA 5HD3A 2M7VA 3QHYA 1DRMA 1Y28A 2W27A 5AVEA 4LV3A 1IFQA 1JWZA 3FV7A 5EE8A 3ZG0A 1H8MA 1CF0A 4P6BA 4HBTA 4QY6A 2ZM8A 1TEMA 3LYXA 5CEDA 4BJPA 1T1AA 2PYRA 1GSVA 2HP6A 4GD8A 4N9LA 4R4RA 2QYBA 4ZJ3A 3G2ZA 3OPHA 1KGGA 3LIAA 3A3FA 4ARZB 4C6YA 2HDRA 3IT9A 3MQQA 3VOZA 3BECA 1LT0A 4WELA 3S7OA 4MMNA 4X56A 2J3TC 3N7WA 3HUNA 4KZ8A 3OOVA 3W4OA 3UE6A 5GHYA 1L0DA 1W8QA 2PR6A 3KSIA 4BL2A 4OLGA 2QMIA 2ZC6B 5F83A 1D06A 1K4EA 1EI5A 5E2EA 3IS2A 2EA9A 1JVJA 1V9YA 1SKOB 4B4ZA 4D2OA 2A3UA 2W3DA 3HJKA 1BULA 3PBTA 2D01A 1SDNA 1PZOA 5FEGA 4GNUA 4WEJA 2VX8A 3T1XA 4CJNA 3S22A 4NXGA 1GCEA 3S4XA 2VGJA 4ZJ1A 4LPZA 3F1PA 2P9VB 4Q0JA 1Z6FA 3A3EA 3VSKA 4GZBA 4I39A 3MKEA 3A0RA 5GHXA 3E4PA 5EOOA 3EEAA 3UPNA 3IX4A 1DP8A 4KZ7A 4LRXC 2WKQA 5TBMB 3K3DA 1G28A 5D3OA 3OCNA 4YNRA 5CXWA 4WN5A 1JWPA 1MC0A 2HJEA 3ITAA 2VGLM 2OAP1 3NDEA 3O86A 4OVDA 3E2KA 2W3GA 2VKSA 5EFWA 4BBTA 4GKUA 1ODVA 1LI0A 4LCMA 1YLYA 2VEAA 3OBFA 4HOIA 3UE3A 1XFNA 4I3IA 2WKPA 5F5YA 3ISGA 5GLBA 1IEMA 2V8CA 3WS1A 3S7QA 3ZHHA 4OPZA 3E4OA 3HLCA 1AXBA 3BFEA 1HZOA 4KZ4A 5A8BA 3KYEA 2WYXA 2O99A 3RFBA 5JYPA 4OH0A 3LIBA 1A0KA 3PAGA 5BOHA 3CAXA 2D02A 1H3QA 5M18A 2W3EA 1NWZA 2XK1A 2Y2GA 1YSQA 4WZ5C 4XT2A 1LL5A 4E3OA 4EEPA 4P85A 2XGNA 4OONA 1LL9A 3C4PA 1IELA 2XH9A 2XD1A 5FEFA 3M6BA 3BY8A 1K54C 2J3WA 3MMHA 4X6TA 4S2IA 3DAVA 2GX5A 3TRCA 3TSGA 2WZXA 4LCLA 3DWZA 2HZ5A 4PPRA 3MQOA 3CI6A 4O0PA 1PYYA 5F69A 3RJUA 5J8XA 1FR1A 2A24A 3MQ0A 3IBJA 4NKPA 5AQ9A 2K7SA 4EETB 4GS9A 1CEGA 3NULA 3RTYA 1N9NA 1YLPA 1NZUA 1S1ZA 2DRWA 2KDKA 4OQIA 1M40A 4WEKA 1XPBA 2WKHA 4KG6A 3Q1FA 4X1MA 3DWKA 5L8MA 2H28A 4MN6A 3N8RA 5M1AA 3G4PA 3IX3A 4LFUA 1QMFA 3DW0A 4WYYA 4MDZA 1K56D 1UWPX 3FPWA 3WS5A 4NETA 3BYDA 4E3MA 3NY4A 3H82A 2ZD8A 1SHVA 2EFXA 5FDHA 3BWLA 1RCJA 3VSLA 1T18A 1WYCA 3IWQA 3EQUA 2V2FF 4RX3A 3Q7ZA 2XF3A 3CWFA 2L4RA 1ZKJA 1ERMA 4BBUA 2NUPC 2X01A 4KZ6A 2ZQ9A 4Y3IA 4RQ9A 5F1GA 2O9CA 5HL6A 1XGIA 2BG1A 2JCHA 3IH9A 1PI4A 1L0EA 1KE3A 1FILA 1IYSA 4ESPA 1MY8A 3ZG5A 2Q9NA 3EEHA 3W8KA 1DJCA 1NY0A 1FR6A 1LI9A 2Q9MA 3E4QA 2YKHA 3OCLA 3P01A 4HJ4A 1SCWA 2V0UA 3F1PB 3GRJA 3R7WA 1XX2A 2V0WA 3VOYA 5A93A 1OTDA 2QJ7A 2DNSA 3G32A 5DFXA 3EOIA 4Y13A 3EQVA 3VP2A 4GOGA 4Q0IA 4LENA 4HIAA 3GECA 3IXBA 1IYOA 5HWTA 3OPRA 1D7EA 2VZWA 3PBQA 2FFYA 1ACFA 3IHAA 2W1RA 3G35A 2BLSA 2WK0A 5FSRA 4K0WA 3HLEA 4NG2A 3PHYA 2W3FA 2P7JA 4JGRA 4BD1A 4WBGA 3D4FA 1K55A 3C30A 4P87A 2XA7S 4WZ5A 5AQAA 2OLVA 4NXFA 2GNXA 3C5AA 4WL9A 2OWHA 3NIAA 5FQQA 2G7UA 4ZJ2A 3O88A 3WRTA 2P08A 4KZ5A 2WZZA 2QWSA 4HQAA 4Y2FA 3A3JA 4OQGA 4UEYA 3T4JA 1IKIA 4EQ1A 1PW1A 2ZQ8A 4X53A 2XEPA 1LL8A 1GHPA 3MXRA 3FG8A 2M7UA 3OPPA 3TW8A 4GDNA 5J3WA 3UDXA 1K57C 3D3OA 3ZCZA 2W3HA 5DTSA 4OKPA 5EUAA 2EXBA 2P04A 3VP3A 4ME4A 5FASA 1W63M 4DF6A 3TG9A 5EVID 3P7NA 2C6WB 3Q07A 3TOIA 3ZG8B 4GS9B 5EVIC 3UB5P 4R1GA 2Y59A 1O7EA 3W4PA 5CECA 2EFUA 4OPYA 4R3AA 5A90A 1LSVA 3C7UA 4N1XA 4KQOA 4FCFA 5EVLA 3BFCA 1OTEA 5HL1A 1K56A 4BD0A 3L9KA 4NXBA 1XJ4A 2J9PA 2LB5A 1ZG4A 3U2AA 1G5UA 2MJ6A 4DDYA 1YMXA 2BTFP 1SDEA 5HZHA 4D60A 4H8RA 2WGVA 3KO6A 1JNUA 3BY9A 3Q7VB 1NJ4A 1STZA 3WS0A 3E2LA 3VV4A 4GW9A 4II7A 5CGXA 1TS6A 5HARA 3T4KA 4WUJA 4Y15A 5C5KA 5F6AA 1J3WA 1FCNA 2XD5A 3MXQA 4FD8A 1BYWA 5LBRA 4BLMA 1OPXA 4IVKA 2VV6A 1ES3A 4N9KA 1S4RA 1RGZA 4PM8A 4P0MA 3SH7A 1QMEA 4KQRA 5AVFA 4Z9QA 2WAFA 2JBFA 5HX9A 2ZL1A 1VEUB 2WKIA 1J9MA 3VE3A 1IYQA 4GDBA 3V67A 2G2WA 4OLDA 3WS2A 4E6XA 1TS0A 3V5MA 4EERA 3SH8A 1OTAA 4ZAMA 3TE8A 2W1TA 1BTLA 3KSGA 1HTZA 1PNEA 5IU1A 5CGWA 1L3LA 5FQMA 2JHEA 4OPQA 4PAUA 3MXSA 5HPIA 3FWLA 3MSHA 4S2JA 4WMCD 4HP4A 5MC7A 1YLZA 3DTIA 2J9OA 2C5WB 3QP4A 2KX6A 5DKKA 3CUEA 2EX2A 3AGDA 3WRZA 2J8YA 2ZMVA 2J80A 2VGKA 1X0OA 5I5LA 1OT9A 1FSYA 1YKDA 5TGFA 2KLIA 3H7WA 4M4XA 3U4LP 3LR0A 2Z6CA 1MWUA 4K91A 2J3TD 3CITA 3D72A 3JPUA 1F98A 4EWFA 1H0MA 3LCEA 1T19A 3HCYA 3UMDA 3MS6A 4QD4A 2P74A 4X25A 3OZHA 2Y2JA 4LLOB 4DN0A 1BZAA 3T12B 3W2ZA 1G6AA 4EXOA 4G3VA 4U0XA 4HNBA 4EBPA 4JF4A 1K57A 5EPHA 1Y4OA 1UGUA 3SH9A 1F2KA 5FATA 2Y2MA 4HEFA 4MCWA 3B47A 2XR0A 1I2WA 5DFYA 4R0QA 3IF6C 3V3RA 3LO7A 4GJ4A 1TD5A 4WZ4A 3UDFA 3CMZA 1HLUP 3PXPA 4S2KA 2JKRM 2Z2LB 5EVIA 3QP8A 5A91A 5A92A 5DJTA 3BLSA 2JKRI 2OOLA 4Y0UA 3A0SA 1S1YA 4R4SA 2QHKA 1MKMA 3CPTA 3UO9A 1XJ6A 2PU2A 3ZFZA 2L1MA 4E3IA 2X02A 5KMWA 3WWXA 5L07A 5HDCA 2I9VA 3NOPC 2GDNA 2V1ZA 2XQZA 4QU3A 1KE0A 4KZ3A 2JE5A 2W0NA 3PYPA 3LY3A 3I7JA 3ZVWA 1DP6A 2KOIA 1MWRA 5F82A 4C3QA 4E3LA 4CQHA 4UA9A 3N8SA 3AGEA 5GLCA 1PZPA 5F68A 4HH3A 1LSWA 4WM9A 3M2JA 3MZFA 2VGLS 1TF1A 4KENB 3TJZC 4L9FA 3T1RA 4RYEA 3K3CA 3PBRA 5K5BA 2V1AA 4CLCB 4UA7A 3LFVA 1NLYA 1O07A 1ZC2A 2QPNA 3BLMA 1VB6A 3JVVA 4EBLA 3UB9A 3A0VA 1VHMA 1PW8A 5CERA 4GHIA 2ZL1B 1PFLA 3EWKA 2ZBBA 2UV0E 5CHMA 4P6ZS 4ZRRA 5J7EA 4QHCA 4WMCA 4DE3A 2PYPA 2EX9A 2QZ6A 3FZCA 3UNWA 1JTDA 1PWDA 2JN7A 5CGSA 2Y4AA 1XA1A 4Q8IA 3GMWA 1W5DA 5FQJA 4QPRA 2Q0OA 3Q82A 4UQIM 1XXMA 3UN7A 3N6IA 3EGXC 1XKZA 2V9AA 3NDGA 4X1LA 4F3LA 1PRQA 4BL3A 4GB7A 3IF5A 3P09A 2HDSA 4WF0A 4EUVA 2Y2IA 3S7PA 4B93A 4M3KA 3HLBA 5HAPA 1PIOA 5FI2A 3OLOA 3N8LA 1KGEA 2HGVA 3CZDA 5DJUA 1HD8A 1YAXA 4ZDXA 3LR4A 2B02A 2V20A 2L0WA 1FQGA 4MLLA 5EVEA 2ZOHA 3FKWA 5IT5A 2O0YA 2Y55A 1PWGA 4R3JA 2WUQA 2VLGA 3T4LA 3L7HA 3HLDA 2GZAA 3BRMA 2PBYA 3FKVA 2Y2NA 3K2NA 1ZG6A 1MBLA 3IS2B 5AQBA 3MFDA 2H0TA 3PR6A 4OOLA 2LB9A 4E04A 3T50A 1W7FA 5EM0A 1YLWA 4JKTA 5DF8A 4FTXA 5FI6A 3QNBA 5G18A 4NXEA 5F1FA 3BFFA 5EECA 3GTCA 4U3TA 3PTEA 5FDSA 2PU4A 1PI5A 5FAQA 3T4TA 1DJAA 3G30A 5DF7A 2A2LA 3HUOA 3CPTB 3MZEA 2HDUA 1P9RA 2Y2LA 3SOIA 5FQKA
chains in the Genus database with same CATH topology
2LB5A 3U2AA 1OJ5A 2MJ6A 2PR6A 3KSIA 1OT6A 4HP9A 5HZHA 4I3AA 4AFIA 1D06A 4DMZA 3KO6A 1JNUA 4BBVA 3BY9A 3IS2A 2EA9A 2JKTM 1YSPA 1V9YA 1F5MA 2CMNA 3UMEA 1STZA 4R70A 3T4OA 2JKTI 4GW9A 4II7A 3VV4A 1TS6A 3T4KA 3HJIA 4Q0HA 4WUJA 5C5KA 3RH8B 2W3DA 3HJKA 3GDIA 5F6AA 3PBTA 3MXQA 4WLAA 1P9WA 2D01A 1BYWA 4HY8A 5LBRA 1OPXA 1S67L 4WEJA 2VV6A 4R38A 2VX8A 3MF0A 3MJQA 4H6JB 1S4RA 3ULFA 3KYZA 4UQIS 2XA7M 2ZOIA 2HJ9C 4NXGA 5AVFA 1LSXA 4LPZA 3F1PA 3H7WB 4Q0JA 3T4SA 4GCZA 5TJJA 4ARZA 3VE3A 4I39A 2VJWA 3A0RA 3V67A 4PKYG 3E4PA 3EEAA 3PBNA 1DP8A 1TS0A 4Y5FA 4CLCE 4BMWA 2HF6A 3LIDA 2M1CA 4LRXC 1T1BA 4EERA 5J4EA 1OTAA 2WKQA 3TE8A 5TBMB 2W1TA 3K3DA 3KSGA 5IU1A 1G28A 4XT2B 2JHEA 4PAUA 3OCNA 5IS1A 3ICYA 4FSFA 3C8CA 3T4QA 5HPIA 4R6LA 4YNRA 2QKPA 4L9EA 3UB6A 3LI8A 1ZHHB 4HP4A 5MC7A 4WN5A 2XSSA 1MC0A 2HJEA 2VGLM 3F1NA 1S4SA 2PT7A 1XJ2A 2KX6A 2OAP1 2W3GA 2WKRA 3E0YA 2VKSA 5EFWA 5DKKA 4BBTA 1ODVA 3NOUC 2VEAA 3CUEA 3OBFA 4GLQA 4HOIA 1TS7A 5HDSA 2FH5A 3UE3A 3MR0A 1XFNA 3G6OA 2ZMVA 4KQDA 5KIZA 4I3IA 2WKPA 5F5YA 2J80A 3LR5A 2A24B 3FPVA 3LUQA 3NOTC 3S7QA 1X0OA 2GJ3A 3E4OA 5I5LA 2BASA 1OT9A 5A8BA 1F9IA 1YKDA 2KLIA 2O99A 3H7WA 4CLCD 4M4XA 3RFBA 4KUOA 4HJ6A 4F3LB 3LR0A 1OTIA 3LIBA 5G4YA 4CLCC 2Z6CA 2J3TD 3CITA 3D72A 1F98A 3CAXA 3O5YA 2D02A 1H3QA 2W3EA 1NWZA 4PKYA 1NLZA 2V1BA 3UE6A 4I38A 5TBMA 1YSQA 4XT2A 1T19A 3B33A 3HCYA 3UMDA 4LRZE 4PHTA 5DKLA 4O8GA 3MFXA 4G3WA 4EEPA 4LLOB 4DN0A 4HJ3A 3W2ZA 4EXOA 2B18A 4G3VA 1OJGA 3S7NA 4YWZA 3BY8A 4HNBA 2J3WA 2HV1A 3MMHA 2PD8A 2R78A 1UGUA 2GX5A 3TRCA 3LICA 3H82B 4Z1WA 5DF9A 1N9OA 3JVUA 4MCWA 3B47A 3VE4A 3MQOA 3CI6A 5DFYA 2INWA 4I5SA 4O0PA 4JGOA 4LRYC 4L9GA 5F69A 4IUKA 4GJ4A 2A24A 1N9LA 3B42A 3MQ0A 5HPFA 3IBJA 1TD5A 4NKPA 5CX7A 4ETXA 3PXPA 2JKRM 2K7SA 4EETB 4GS9A 5DJTA 3RTYA 1N9NA 1NRJA 1W63Q 2JKRI 1S1ZA 3UB7A 3CUEC 1OTBA 2KDKA 2OOLA 3A0SA 1S1YA 2QHKA 3LIEA 1MKMA 4WEKA 1XJ6A 2L1MA 3LI9A 1P0ZA 2ZMFA 1GSWA 3DBAA 5L8MA 2H28A 4MN6A 5HDCA 2I9VA 1XFQA 3NOPC 5AJGA 4MN5A 4GHIB 2EWWA 1IOUA 3R7WB 2VV7A 4EESA 2W0NA 4HH2A 3LR3A 3PYPA 3IBRA 4MDZA 1DP6A 1UWPX 3FPWA 3ZYTA 2KOIA 2YKFA 3BQAA 5FL3A 1XJ3A 3C38A 4CQHA 3F1OB 3H82A 4NEED 1S66L 4HHDA 3BWLA 3KSHA 2K31A 5F68A 1T18A 4HH3A 1LSWA 4FOFA 4IHQA 4EW7A 3OC2A 2XROA 3CLOA 3EQUA 2DMWA 4H6JA 1P97A 2NUTC 3CWFA 2PHYA 2VGLS 2L4RA 2PDRA 4BBUA 1TF1A 5HWWA 2NUPC 3TJZC 4JGPA 4L9FA 5HDDA 4DJ3A 4Y3IA 4RQ9A 4EU0A 3K3CA 3PBRA 2O9CA 5HL6A 5K5BA 2V1AA 4CLCB 3LFVA 1NLYA 2K2NA 4I3JA 3UB8A 2Y79A 3KX0X 1VB6A 3JVVA 1DP9A 2O9BA 3EEHA 1MZUA 2EWVA 4JGQA 3KSFA 3A0VA 3UB9A 3E4QA 1VHMA 3BJNA 2YKHA 4GHIA 4EEUA 3OCLA 3P01A 4HJ4A 3F1PB 2O9AA 2V0UA 3EGDC 3EWKA 2ZBBA 3R7WA 2V0WA 4P6ZS 4ZRRA 1OTDA 2QJ7A 5J7EA 2PYPA 4IUHA 5DFXA 2FZ0A 3EOIA 1V9ZA 3EQVA 1KOUA 1G6OA 4Q0IA 3R4KA 4OOMA 1EW0A 2JN7A 4HIAA 3GECA 4K08A 3BQ8A 4B9OA 5KSHA 3H9WA 2OAQ1 4QPRA 2VA0A 1WA9A 5HWTA 3VOLA 1D7EA 3LIFA 2VZWA 3KYQA 3PBQA 3F1NB 4UQIM 2W1RA 3EGXC 2V9AA 4L0LA 4IJGA 2Z6DA 2IA2A 3PHYA 4F3LA 4CLCA 2W3FA 4KUKA 2P7JA 4JGRA 3SW1A 4WF0A 4EUVA 2PR5A 3S7PA 4B93A 3C30A 4BWIA 5G4ZA 2XA7S 3PBOA 1UWNX 3BW6A 4NXFA 4MN7A 3OLOA 2GNXA 2QJ5A 4WL9A 4YOFA 2OWHA 2HGVA 2G7UA 2Y8HA 3NHQA 2P08A 5DJUA 1YAXA 2QWSA 3FC7A 3LR4A 4HI4A 4HQAA 2B02A 4Y2FA 2L0WA 4ETZA 2ZOHA 4UEYA 3T4JA 5IT5A 2O0YA 1GSXA 4EQ1A 2OWJA 3E98A 5HWVA 2VLGA 3T4LA 1LL8A 1T1CA 4O01A 3FG8A 3PBSA 2VV8A 2GZAA 3C2WA 2M7UA 5HD3A 3K2NA 2M7VA 3TW8A 1TS8A 5J3WA 3IS2B 4G3KA 1DRMA 1Y28A 2W27A 5AVEA 3ZQ5A 3D3OA 1IFQA 3PR6A 4OOLA 2LB9A 2W3HA 4E04A 2PD7A 3T50A 2P04A 4ME4A 1H8MA 1W63M 2XRNA 3NJAA 3LYXA 4BJPA 1T1AA 3P7NA 2PYRA 1GSVA 4NXEA 4DJ2A 4GS9B 1ZTUA 2QYBA 3T4TA 3LIAA 2A2LA 4ARZB 4P6ZM 4R3AA 5HD5A 1LSVA 3MQQA 4KQOA 1P9RA 1LT0A 4WELA 3S7OA 4MMNA 1OTEA 3F1OA 5HSQA 2J3TC 2W1TB 3OOVA 4NXBA 1XJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ5 A;  2PR6 A;  1OT6 A;  4HP9 A;  5HZH A;  4I3A A;  1D06 A;  4BBV A;  1JNU A;  3BY9 A;  3IS2 A;  2EA9 A;  1V9Y A;  2CMN A;  3UME A;  4R70 A;  4GW9 A;  1TS6 A;  3HJI A;  4WUJ A;  3RH8 B;  3HJK A;  3GDI A;  5F6A A;  3MXQ A;  4WLA A;  2D01 A;  1BYW A;  4HY8 A;  1S67 L;  2VV6 A;  4R38 A;  3MJQ A;  4H6J B;  1S4R A;  3ULF A;  2ZOI A;  4NXG A;  5AVF A;  1LSX A;  4LPZ A;  3F1P A;  3H7W B;  4GCZ A;  3VE3 A;  4I39 A;  3A0R A;  4PKY G;  3E4P A;  1DP8 A;  1TS0 A;  3LID A;  4EER A;  2M1C A;  4LRX C;  1T1B A;  5J4E A;  1OTA A;  2WKQ A;  5TBM B;  3K3D A;  5IU1 A;  1G28 A;  4XT2 B;  2JHE A;  5IS1 A;  3ICY A;  3C8C A;  4R6L A;  2QKP A;  4L9E A;  3UB6 A;  3LI8 A;  4HP4 A;  4WN5 A;  3F1N A;  1S4S A;  1XJ2 A;  2KX6 A;  2WKR A;  5EFW A;  5DKK A;  4BBT A;  1ODV A;  3NOU C;  1XJ4 A;  2VEA A;  4HOI A;  1TS7 A;  5HDS A;  3MR0 A;  1XFN A;  3G6O A;  4KQD A;  5KIZ A;  4I3I A;  2WKP A;  5F5Y A;  2J80 A;  2A24 B;  3LUQ A;  3NOT C;  1X0O A;  3E4O A;  2GJ3 A;  5I5L A;  2BAS A;  1OT9 A;  5A8B A;  1F9I A;  3H7W A;  4M4X A;  4KUO A;  4HJ6 A;  4F3L B;  1OTI A;  3LIB A;  5G4Y A;  2Z6C A;  3D72 A;  1F98 A;  3CAX A;  2D02 A;  1NWZ A;  4PKY A;  2V1B A;  4I38 A;  5TBM A;  4XT2 A;  1T19 A;  3B33 A;  3UMD A;  4LRZ E;  5DKL A;  3MFX A;  4EEP A;  4LLO B;  4HJ3 A;  4EXO A;  1OJG A;  4YWZ A;  3BY8 A;  4HNB A;  2HV1 A;  2PD8 A;  2R78 A;  1UGU A;  3LIC A;  3H82 B;  1N9O A;  3VE4 A;  3MQO A;  2INW A;  4I5S A;  4JGO A;  4LRY C;  4L9G A;  5F69 A;  2A24 A;  1N9L A;  2K7S A;  4EET B;  4GS9 A;  5DJT A;  3RTY A;  1N9N A;  3UB7 A;  1S1Z A;  1OTB A;  2KDK A;  2OOL A;  3A0S A;  1S1Y A;  2QHK A;  3LIE A;  1XJ6 A;  2L1M A;  3LI9 A;  1P0Z A;  1GSW A;  2H28 A;  4MN6 A;  5HDC A;  2I9V A;  1XFQ A;  3NOP C;  4MN5 A;  4GHI B;  2VV7 A;  4EES A;  2W0N A;  4HH2 A;  3PYP A;  3IBR A;  1DP6 A;  1UWP X;  2YKF A;  1XJ3 A;  3F1O B;  3H82 A;  1S66 L;  4HHD A;  3BWL A;  5F68 A;  1T18 A;  4HH3 A;  1LSW A;  4EW7 A;  3CLO A;  4H6J A;  1P97 A;  3CWF A;  2PHY A;  2L4R A;  2PDR A;  4BBU A;  5HWW A;  4JGP A;  4L9F A;  5HDD A;  4DJ3 A;  4RQ9 A;  3K3C A;  2V1A A;  4I3J A;  3UB8 A;  3KX0 X;  1VB6 A;  1DP9 A;  3EEH A;  1MZU A;  4JGQ A;  3UB9 A;  3A0V A;  3E4Q A;  2YKH A;  4GHI A;  4EEU A;  4HJ4 A;  2V0U A;  3F1P B;  3EWK A;  2ZBB A;  2V0W A;  1OTD A;  2QJ7 A;  5J7E A;  2PYP A;  1V9Z A;  1KOU A;  1EW0 A;  2JN7 A;  4HIA A;  3GEC A;  4K08 A;  4B9O A;  3H9W A;  1WA9 A;  5HWT A;  3VOL A;  1D7E A;  3LIF A;  3F1N B;  2V9A A;  2Z6D A;  3PHY A;  4F3L A;  4KUK A;  2P7J A;  4JGR A;  3SW1 A;  4WF0 A;  2PR5 A;  5G4Z A;  1UWN X;  4NXF A;  3OLO A;  2QJ5 A;  4WL9 A;  2OWH A;  3NHQ A;  5DJU A;  2QWS A;  3FC7 A;  4HI4 A;  4HQA A;  2B02 A;  2L0W A;  2ZOH A;  1GSX A;  4EQ1 A;  2OWJ A;  5HWV A;  2VLG A;  1LL8 A;  1T1C A;  3FG8 A;  2VV8 A;  3C2W A;  5HD3 A;  1TS8 A;  5J3W A;  3IS2 B;  1DRM A;  1Y28 A;  2W27 A;  5AVE A;  3ZQ5 A;  4E04 A;  2PD7 A;  3T50 A;  3NJA A;  3LYX A;  1T1A A;  3P7N A;  2PYR A;  1GSV A;  4NXE A;  4DJ2 A;  4GS9 B;  3LIA A;  4R3A A;  5HD5 A;  1LSV A;  3MQQ A;  1LT0 A;  1OTE A;  3F1O A;  5HSQ A;  4NXB A;  3UE6 A; 
#chains in the Genus database with same CATH topology
 3BM6 A;  5CRF A;  2XFS A;  2HP5 A;  4HP9 A;  4I3A A;  4AFI A;  2EX8 A;  4DMZ A;  2JKT M;  4EUZ A;  1F5M A;  2CMN A;  4R70 A;  3MZD A;  2DCF A;  2JKT I;  3RH8 B;  1K25 A;  1RGY A;  3GDI A;  5FAO A;  4DDS A;  1VM1 A;  4JXG A;  4HY8 A;  5E2G A;  1S67 L;  4R38 A;  3NEC A;  4O7D A;  4HES A;  4F94 A;  3MJQ A;  3ULF A;  4B88 A;  2XA7 M;  1C3B A;  4NK3 A;  4JBF A;  5DTT A;  1ESI A;  3T4S A;  4ARZ A;  4U0T A;  1H8Y A;  4EV4 A;  1K54 A;  4PKY G;  4QY5 A;  4DE1 A;  4MBK A;  4XUZ A;  4CLC E;  4BMW A;  5IHV A;  2HF6 A;  3LID A;  2M1C A;  2Y2Q A;  5E2H A;  4PM7 A;  3UDI A;  4XT2 B;  4YFM A;  3V50 A;  3ICY A;  5IS1 A;  4FSF A;  4R6L A;  3UB6 A;  3LI8 A;  2XSS A;  5HFO A;  1MPL A;  3F1N A;  2PT7 A;  1XJ2 A;  1SKO A;  1YMS A;  3VFF A;  3NOU C;  4GLQ A;  2HPB A;  1TS7 A;  3BEB A;  3ZDJ A;  2FH5 A;  1FCM A;  4X69 A;  1S0W A;  2XFT A;  3MR0 A;  3G6O A;  5KIZ A;  4A5R A;  2A24 B;  3FPV A;  3LUQ A;  4R23 A;  2BAS A;  3UE1 A;  3AGF A;  2X71 A;  4OPR A;  1F9I A;  5E2F A;  4DXB A;  4IED A;  1PWC A;  2P9V A;  4KZB A;  1JWV A;  4HJ6 A;  1FOF A;  3CHW P;  4KG5 A;  5CEB A;  5I94 A;  2WGW A;  4F3L B;  3DTK A;  3ZNY A;  1VQQ A;  1BLH A;  1MKI A;  2V1B A;  3HLG A;  3IX8 A;  4I38 A;  5TBM A;  3GV9 A;  4LGW A;  3B33 A;  1K6S A;  4Y0T A;  5DKL A;  4O8G A;  3MFX A;  4G3W A;  1K38 A;  1KDS A;  2ZMA A;  1BLS A;  1OJG A;  1BLP A;  3S7N A;  2H10 A;  2EXA A;  2J7V A;  3A3D A;  1FSW A;  3O87 A;  2B95 A;  2R78 A;  2WKE A;  4JF5 A;  3LIC A;  4YIN A;  4DE2 A;  4X68 A;  3H82 B;  4Z1W A;  4OP8 A;  1N9O A;  3VE4 A;  1OME A;  2INW A;  4I5S A;  4LRY C;  4L9G A;  1XP4 A;  2CC1 A;  4KZ9 A;  1N9L A;  3B42 A;  4ETX A;  1DY6 A;  4IVI A;  2ZJ9 A;  1NRJ A;  3M2K A;  3C7V A;  2Y2O A;  2B5R A;  4FUW A;  1I5Q A;  3HLF A;  5DTK A;  3LI9 A;  1P0Z A;  1TDG A;  4RX2 A;  3DBA A;  5GHZ A;  1XFQ A;  3V39 A;  5GL9 A;  4MN5 A;  3VP0 A;  1CJF A;  1K4F A;  1IOU A;  1CI9 A;  4DXC A;  3R7W B;  4EES A;  3SS3 A;  1KDW A;  2EX6 A;  3LR3 A;  1K0K A;  3ZYT A;  2ZC4 B;  2YKF A;  5FL3 A;  1XJ3 A;  3C38 A;  3Q81 A;  1IKG A;  1NYY A;  3LEQ A;  4RVA A;  3GQZ A;  3LY4 A;  2K31 A;  1YQS A;  1IYP A;  2H5S A;  4IHQ A;  4EW7 A;  3OC2 A;  1Q2P A;  3CLO A;  3ZNT A;  2DMW A;  4N92 A;  4H6J A;  1P97 A;  2E8J A;  2NUT C;  2PHY A;  1M6K A;  5HWW A;  1Z09 A;  3UPP A;  4S2P A;  4DJ3 A;  3ZG9 B;  4CPK A;  4EU0 A;  5KZH A;  4ID4 A;  2Y79 A;  2ZLY A;  3KX0 X;  2O9B A;  1MWS A;  1MZU A;  2EWV A;  3G34 A;  3MKF A;  1ES5 A;  4JGQ A;  3QNC A;  2PBD P;  3KSF A;  2PRF A;  4R3B A;  2Z2M B;  1GHM A;  4PM6 A;  3BJN A;  1Y54 A;  3FYZ A;  2O9A A;  3IXG A;  3NI9 A;  5HAI A;  3V3S A;  5FQI A;  4S2M A;  2FZ0 A;  1V9Z A;  4BQM A;  1KOU A;  3T1Q B;  1CQA A;  1XA7 A;  1Q2Q A;  3R4K A;  4OOM A;  1EW0 A;  2ZM2 A;  3JYI A;  4K08 A;  3GVB A;  3RXX A;  3BQ8 A;  5L09 A;  1EWZ A;  5KSH A;  4OOY A;  3IHB A;  3G31 A;  3KYQ A;  3F1N B;  4BEN A;  3QP5 A;  3QP6 A;  1NXY A;  4XUX A;  2IA2 A;  3SZT A;  4KUK A;  5JYO A;  4S2N C;  3HVF A;  5HW3 A;  4OQH A;  5L2F A;  5FQ9 A;  1KGF A;  2PR5 A;  4KZA A;  2ZC7 A;  2ZQC A;  5CTN A;  1BT5 A;  4HBU A;  3PBO A;  4JXV A;  3HL9 A;  4MBF A;  3B3X A;  3N4I A;  4FH4 A;  1VET A;  3ZG7 B;  3SS5 A;  4S2L A;  3MBZ A;  2WGW B;  3VP1 A;  4QJG A;  3DTE A;  1H5X A;  3FC7 A;  4XXR A;  5FA7 A;  1WE4 A;  4Y7P A;  2OWJ A;  3E98 A;  5HWV A;  3RXW A;  1T1C A;  4O01 A;  1H8Z A;  3PBS A;  2VV8 A;  3IQA A;  1TS8 A;  4G3K A;  3ZQ5 A;  4RA7 A;  3GR2 A;  2R9W A;  1MXO A;  2PD7 A;  1YM1 A;  1W79 A;  4DKI A;  2XRN A;  3NJA A;  4DE0 A;  3GSG A;  3IXH A;  4DJ2 A;  1ZTU A;  5TR7 A;  4JXS A;  2RL3 A;  5GLD A;  1ESU A;  1E25 A;  4P6Z M;  2XLN A;  4PM5 A;  5HD5 A;  2WAD A;  1K55 C;  1HVB A;  3F1O A;  3O3V A;  5HSQ A;  2W1T B;  4NEE D;  1E3U D;  1YT4 A;  2G2U A;  3UE0 A;  1OJ5 A;  4IBR A;  1OT6 A;  2ZC3 B;  1KE4 A;  4MNR A;  1ONH A;  2UWX A;  1NRF A;  5DVA A;  4BBV A;  1XGJ A;  1YSP A;  3HUM A;  4MBH A;  3UME A;  4JLF A;  3T4O A;  3HJI A;  4Q0H A;  3A3I A;  4DRT A;  3ZVT A;  4KG2 A;  4WLA A;  1P9W A;  5L10 A;  1SZV A;  5EOE A;  3MF0 A;  4LV1 A;  3ZGA B;  4H6J B;  3T1S A;  3KYZ A;  4UQI S;  3C4O A;  1SKF A;  2ZOI A;  2HJ9 C;  2PAV P;  2HP9 A;  1FIK A;  4QB8 A;  4QWO A;  1LSX A;  4E3J A;  3H7W B;  3PAE A;  2ZC5 B;  2XDM A;  1L2S A;  4GCZ A;  5TJJ A;  1TVF A;  3NC8 A;  2VJW A;  2OV5 A;  3PBN A;  4Y5F A;  3G2Y A;  2JKF A;  5J4E A;  1T1B A;  3VFH A;  2R9X A;  1K6R A;  1ALQ A;  3C8C A;  3T4Q A;  3IF6 A;  2QKP A;  4L9E A;  2E8I A;  2VK3 A;  1ZHH B;  2Y2K A;  3M6H A;  3Q7V A;  5CHJ A;  1S4S A;  5CHU A;  2WKR A;  3E0Y A;  3HLW A;  4ZTK A;  2FFF B;  1G68 A;  1BLC A;  4X55 A;  1N4O A;  2Y2P A;  5HDS A;  1GHI A;  4KQD A;  4S2N A;  3LR5 A;  4UA6 A;  3NOT C;  1KVL A;  3LGO A;  2Y91 A;  2GJ3 A;  3CG5 A;  5EVI B;  1N9B A;  2IWD A;  3W4Q A;  2WGI A;  4CLC D;  4KUO A;  5U47 A;  1VEU A;  1OTI A;  5G4Y A;  4CLC C;  2ZQD A;  4LV2 A;  3O5Y A;  1CEF A;  4PKY A;  1NLZ A;  1CI8 A;  4E6W A;  4LRZ E;  4PHT A;  3WS4 A;  1VET B;  4IBX A;  4HJ3 A;  2ZQ7 A;  2B18 A;  1I2S A;  1YPR A;  4YWZ A;  4UAA A;  2HV1 A;  2PD8 A;  5E43 A;  3IWI A;  2HDQ A;  4E3K A;  5DF9 A;  5FAP A;  3JVU A;  4B4X A;  4JGO A;  3BFD A;  1D1J A;  4IUK A;  2A49 A;  4PMA A;  2IWB A;  5HPF A;  5EV0 A;  2ACG A;  5CX7 A;  1ERO A;  5HAQ A;  1YLJ A;  3P98 A;  1W63 Q;  1WYB A;  3UB7 A;  3CUE C;  2WAE A;  1OTB A;  5KSC A;  3LEZ A;  3LIE A;  3HRE A;  3CJM A;  3QP1 A;  1BUE A;  1NYM A;  2ZMF A;  1GSW A;  4EQI A;  3NBL A;  5GLA A;  5AJG A;  1JTG A;  4JPM A;  3VMA A;  1BSG A;  5TFQ A;  4GHI B;  2EWW A;  5EM1 A;  1E3U A;  2VV7 A;  4UHU A;  4HH2 A;  3IBR A;  1U60 A;  1L0G A;  3BQA A;  4N1H A;  1AWI A;  3F1O B;  4LV0 A;  1S66 L;  4HHD A;  1CK3 A;  3QP2 A;  4C75 A;  2OLU A;  3KSH A;  2V8F A;  4FH2 A;  4FOF A;  1DJB A;  2XRO A;  2PDR A;  2Y2H A;  4JF6 A;  4JGP A;  5HDD A;  1LLB A;  1L0F A;  2OSU A;  2K2N A;  4I3J A;  3UB8 A;  2H0Y A;  2JC7 A;  1FCO A;  1DP9 A;  1YLT A;  1TDL A;  2JKG A;  4EEU A;  3EGD C;  3BFG A;  3UY6 A;  5FI7 A;  1GA9 A;  4PM9 A;  4IUH A;  4ZBE A;  2I72 A;  3HBR A;  1ES2 A;  4OQ0 A;  4JXW A;  1G6O A;  5CTM A;  1ES4 A;  3IF6 B;  3ITB A;  1MWT A;  1NZO A;  4B9O A;  3H9W A;  2OAQ 1;  3NCK A;  5AQ7 A;  2VA0 A;  1WA9 A;  1ERQ A;  2RCX A;  3DTM A;  3D9Y A;  1RP5 A;  3VOL A;  3VP4 A;  3LIF A;  1S6R A;  3UPO A;  3IXD A;  4S2O A;  2AVX A;  4L0L A;  3IWO A;  4Y17 A;  4IJG A;  2Z6D A;  4GN2 A;  3SS4 A;  4CLC A;  4K0X A;  3SW1 A;  3OPL A;  3IH8 A;  4BWI A;  5G4Z A;  1GA0 A;  4MEZ A;  1UWN X;  1W8Y A;  3BW6 A;  4MN7 A;  2QJ5 A;  4YOF A;  4EBN A;  1LHY A;  2Y8H A;  3NHQ A;  4E3N A;  1ONG A;  5M19 A;  4HI4 A;  4ETZ A;  1KVM A;  4GD6 A;  2ZM0 A;  4KQQ A;  2IWC A;  2ZQA A;  4OP5 A;  1GSX A;  4Y0O A;  3S1Y A;  1E4D A;  3C2W A;  5HD3 A;  2M7V A;  3QHY A;  1DRM A;  1Y28 A;  2W27 A;  5AVE A;  4LV3 A;  1IFQ A;  1JWZ A;  3FV7 A;  5EE8 A;  3ZG0 A;  1H8M A;  1CF0 A;  4P6B A;  4HBT A;  4QY6 A;  2ZM8 A;  1TEM A;  3LYX A;  5CED A;  4BJP A;  1T1A A;  2PYR A;  1GSV A;  2HP6 A;  4GD8 A;  4N9L A;  4R4R A;  2QYB A;  4ZJ3 A;  3G2Z A;  3OPH A;  1KGG A;  3LIA A;  3A3F A;  4ARZ B;  4C6Y A;  2HDR A;  3IT9 A;  3MQQ A;  3VOZ A;  3BEC A;  1LT0 A;  4WEL A;  3S7O A;  4MMN A;  4X56 A;  2J3T C;  3N7W A;  3HUN A;  4KZ8 A;  3OOV A;  3W4O A;  3UE6 A;  5GHY A;  1L0D A;  1W8Q A;  2PR6 A;  3KSI A;  4BL2 A;  4OLG A;  2QMI A;  2ZC6 B;  5F83 A;  1D06 A;  1K4E A;  1EI5 A;  5E2E A;  3IS2 A;  2EA9 A;  1JVJ A;  1V9Y A;  1SKO B;  4B4Z A;  4D2O A;  2A3U A;  2W3D A;  3HJK A;  1BUL A;  3PBT A;  2D01 A;  1SDN A;  1PZO A;  5FEG A;  4GNU A;  4WEJ A;  2VX8 A;  3T1X A;  4CJN A;  3S22 A;  4NXG A;  1GCE A;  3S4X A;  2VGJ A;  4ZJ1 A;  4LPZ A;  3F1P A;  2P9V B;  4Q0J A;  1Z6F A;  3A3E A;  3VSK A;  4GZB A;  4I39 A;  3MKE A;  3A0R A;  5GHX A;  3E4P A;  5EOO A;  3EEA A;  3UPN A;  3IX4 A;  1DP8 A;  4KZ7 A;  4LRX C;  2WKQ A;  5TBM B;  3K3D A;  1G28 A;  5D3O A;  3OCN A;  4YNR A;  5CXW A;  4WN5 A;  1JWP A;  1MC0 A;  2HJE A;  3ITA A;  2VGL M;  2OAP 1;  3NDE A;  3O86 A;  4OVD A;  3E2K A;  2W3G A;  2VKS A;  5EFW A;  4BBT A;  4GKU A;  1ODV A;  1LI0 A;  4LCM A;  1YLY A;  2VEA A;  3OBF A;  4HOI A;  3UE3 A;  1XFN A;  4I3I A;  2WKP A;  5F5Y A;  3ISG A;  5GLB A;  1IEM A;  2V8C A;  3WS1 A;  3S7Q A;  3ZHH A;  4OPZ A;  3E4O A;  3HLC A;  1AXB A;  3BFE A;  1HZO A;  4KZ4 A;  5A8B A;  3KYE A;  2WYX A;  2O99 A;  3RFB A;  5JYP A;  4OH0 A;  3LIB A;  1A0K A;  3PAG A;  5BOH A;  3CAX A;  2D02 A;  1H3Q A;  5M18 A;  2W3E A;  1NWZ A;  2XK1 A;  2Y2G A;  1YSQ A;  4WZ5 C;  4XT2 A;  1LL5 A;  4E3O A;  4EEP A;  4P85 A;  2XGN A;  4OON A;  1LL9 A;  3C4P A;  1IEL A;  2XH9 A;  2XD1 A;  5FEF A;  3M6B A;  3BY8 A;  1K54 C;  2J3W A;  3MMH A;  4X6T A;  4S2I A;  3DAV A;  2GX5 A;  3TRC A;  3TSG A;  2WZX A;  4LCL A;  3DWZ A;  2HZ5 A;  4PPR A;  3MQO A;  3CI6 A;  4O0P A;  1PYY A;  5F69 A;  3RJU A;  5J8X A;  1FR1 A;  2A24 A;  3MQ0 A;  3IBJ A;  4NKP A;  5AQ9 A;  2K7S A;  4EET B;  4GS9 A;  1CEG A;  3NUL A;  3RTY A;  1N9N A;  1YLP A;  1NZU A;  1S1Z A;  2DRW A;  2KDK A;  4OQI A;  1M40 A;  4WEK A;  1XPB A;  2WKH A;  4KG6 A;  3Q1F A;  4X1M A;  3DWK A;  5L8M A;  2H28 A;  4MN6 A;  3N8R A;  5M1A A;  3G4P A;  3IX3 A;  4LFU A;  1QMF A;  3DW0 A;  4WYY A;  4MDZ A;  1K56 D;  1UWP X;  3FPW A;  3WS5 A;  4NET A;  3BYD A;  4E3M A;  3NY4 A;  3H82 A;  2ZD8 A;  1SHV A;  2EFX A;  5FDH A;  3BWL A;  1RCJ A;  3VSL A;  1T18 A;  1WYC A;  3IWQ A;  3EQU A;  2V2F F;  4RX3 A;  3Q7Z A;  2XF3 A;  3CWF A;  2L4R A;  1ZKJ A;  1ERM A;  4BBU A;  2NUP C;  2X01 A;  4KZ6 A;  2ZQ9 A;  4Y3I A;  4RQ9 A;  5F1G A;  2O9C A;  5HL6 A;  1XGI A;  2BG1 A;  2JCH A;  3IH9 A;  1PI4 A;  1L0E A;  1KE3 A;  1FIL A;  1IYS A;  4ESP A;  1MY8 A;  3ZG5 A;  2Q9N A;  3EEH A;  3W8K A;  1DJC A;  1NY0 A;  1FR6 A;  1LI9 A;  2Q9M A;  3E4Q A;  2YKH A;  3OCL A;  3P01 A;  4HJ4 A;  1SCW A;  2V0U A;  3F1P B;  3GRJ A;  3R7W A;  1XX2 A;  2V0W A;  3VOY A;  5A93 A;  1OTD A;  2QJ7 A;  2DNS A;  3G32 A;  5DFX A;  3EOI A;  4Y13 A;  3EQV A;  3VP2 A;  4GOG A;  4Q0I A;  4LEN A;  4HIA A;  3GEC A;  3IXB A;  1IYO A;  5HWT A;  3OPR A;  1D7E A;  2VZW A;  3PBQ A;  2FFY A;  1ACF A;  3IHA A;  2W1R A;  3G35 A;  2BLS A;  2WK0 A;  5FSR A;  4K0W A;  3HLE A;  4NG2 A;  3PHY A;  2W3F A;  2P7J A;  4JGR A;  4BD1 A;  4WBG A;  3D4F A;  1K55 A;  3C30 A;  4P87 A;  2XA7 S;  4WZ5 A;  5AQA A;  2OLV A;  4NXF A;  2GNX A;  3C5A A;  4WL9 A;  2OWH A;  3NIA A;  5FQQ A;  2G7U A;  4ZJ2 A;  3O88 A;  3WRT A;  2P08 A;  4KZ5 A;  2WZZ A;  2QWS A;  4HQA A;  4Y2F A;  3A3J A;  4OQG A;  4UEY A;  3T4J A;  1IKI A;  4EQ1 A;  1PW1 A;  2ZQ8 A;  4X53 A;  2XEP A;  1LL8 A;  1GHP A;  3MXR A;  3FG8 A;  2M7U A;  3OPP A;  3TW8 A;  4GDN A;  5J3W A;  3UDX A;  1K57 C;  3D3O A;  3ZCZ A;  2W3H A;  5DTS A;  4OKP A;  5EUA A;  2EXB A;  2P04 A;  3VP3 A;  4ME4 A;  5FAS A;  1W63 M;  4DF6 A;  3TG9 A;  5EVI D;  3P7N A;  2C6W B;  3Q07 A;  3TOI A;  3ZG8 B;  4GS9 B;  5EVI C;  3UB5 P;  4R1G A;  2Y59 A;  1O7E A;  3W4P A;  5CEC A;  2EFU A;  4OPY A;  4R3A A;  5A90 A;  1LSV A;  3C7U A;  4N1X A;  4KQO A;  4FCF A;  5EVL A;  3BFC A;  1OTE A;  5HL1 A;  1K56 A;  4BD0 A;  3L9K A;  4NXB A;  1XJ4 A;  2J9P A;  2LB5 A;  1ZG4 A;  3U2A A;  1G5U A;  2MJ6 A;  4DDY A;  1YMX A;  2BTF P;  1SDE A;  5HZH A;  4D60 A;  4H8R A;  2WGV A;  3KO6 A;  1JNU A;  3BY9 A;  3Q7V B;  1NJ4 A;  1STZ A;  3WS0 A;  3E2L A;  3VV4 A;  4GW9 A;  4II7 A;  5CGX A;  1TS6 A;  5HAR A;  3T4K A;  4WUJ A;  4Y15 A;  5C5K A;  5F6A A;  1J3W A;  1FCN A;  2XD5 A;  3MXQ A;  4FD8 A;  1BYW A;  5LBR A;  4BLM A;  1OPX A;  4IVK A;  2VV6 A;  1ES3 A;  4N9K A;  1S4R A;  1RGZ A;  4PM8 A;  4P0M A;  3SH7 A;  1QME A;  4KQR A;  5AVF A;  4Z9Q A;  2WAF A;  2JBF A;  5HX9 A;  2ZL1 A;  1VEU B;  2WKI A;  1J9M A;  3VE3 A;  1IYQ A;  4GDB A;  3V67 A;  2G2W A;  4OLD A;  3WS2 A;  4E6X A;  1TS0 A;  3V5M A;  4EER A;  3SH8 A;  1OTA A;  4ZAM A;  3TE8 A;  2W1T A;  1BTL A;  3KSG A;  1HTZ A;  1PNE A;  5IU1 A;  5CGW A;  1L3L A;  5FQM A;  2JHE A;  4OPQ A;  4PAU A;  3MXS A;  5HPI A;  3FWL A;  3MSH A;  4S2J A;  4WMC D;  4HP4 A;  5MC7 A;  1YLZ A;  3DTI A;  2J9O A;  2C5W B;  3QP4 A;  2KX6 A;  5DKK A;  3CUE A;  2EX2 A;  3AGD A;  3WRZ A;  2J8Y A;  2ZMV A;  2J80 A;  2VGK A;  1X0O A;  5I5L A;  1OT9 A;  1FSY A;  1YKD A;  5TGF A;  2KLI A;  3H7W A;  4M4X A;  3U4L P;  3LR0 A;  2Z6C A;  1MWU A;  4K91 A;  2J3T D;  3CIT A;  3D72 A;  3JPU A;  1F98 A;  4EWF A;  1H0M A;  3LCE A;  1T19 A;  3HCY A;  3UMD A;  3MS6 A;  4QD4 A;  2P74 A;  4X25 A;  3OZH A;  2Y2J A;  4LLO B;  4DN0 A;  1BZA A;  3T12 B;  3W2Z A;  1G6A A;  4EXO A;  4G3V A;  4U0X A;  4HNB A;  4EBP A;  4JF4 A;  1K57 A;  5EPH A;  1Y4O A;  1UGU A;  3SH9 A;  1F2K A;  5FAT A;  2Y2M A;  4HEF A;  4MCW A;  3B47 A;  2XR0 A;  1I2W A;  5DFY A;  4R0Q A;  3IF6 C;  3V3R A;  3LO7 A;  4GJ4 A;  1TD5 A;  4WZ4 A;  3UDF A;  3CMZ A;  1HLU P;  3PXP A;  4S2K A;  2JKR M;  2Z2L B;  5EVI A;  3QP8 A;  5A91 A;  5A92 A;  5DJT A;  3BLS A;  2JKR I;  2OOL A;  4Y0U A;  3A0S A;  1S1Y A;  4R4S A;  2QHK A;  1MKM A;  3CPT A;  3UO9 A;  1XJ6 A;  2PU2 A;  3ZFZ A;  2L1M A;  4E3I A;  2X02 A;  5KMW A;  3WWX A;  5L07 A;  5HDC A;  2I9V A;  3NOP C;  2GDN A;  2V1Z A;  2XQZ A;  4QU3 A;  1KE0 A;  4KZ3 A;  2JE5 A;  2W0N A;  3PYP A;  3LY3 A;  3I7J A;  3ZVW A;  1DP6 A;  2KOI A;  1MWR A;  5F82 A;  4C3Q A;  4E3L A;  4CQH A;  4UA9 A;  3N8S A;  3AGE A;  5GLC A;  1PZP A;  5F68 A;  4HH3 A;  1LSW A;  4WM9 A;  3M2J A;  3MZF A;  2VGL S;  1TF1 A;  4KEN B;  3TJZ C;  4L9F A;  3T1R A;  4RYE A;  3K3C A;  3PBR A;  5K5B A;  2V1A A;  4CLC B;  4UA7 A;  3LFV A;  1NLY A;  1O07 A;  1ZC2 A;  2QPN A;  3BLM A;  1VB6 A;  3JVV A;  4EBL A;  3UB9 A;  3A0V A;  1VHM A;  1PW8 A;  5CER A;  4GHI A;  2ZL1 B;  1PFL A;  3EWK A;  2ZBB A;  2UV0 E;  5CHM A;  4P6Z S;  4ZRR A;  5J7E A;  4QHC A;  4WMC A;  4DE3 A;  2PYP A;  2EX9 A;  2QZ6 A;  3FZC A;  3UNW A;  1JTD A;  1PWD A;  2JN7 A;  5CGS A;  2Y4A A;  1XA1 A;  4Q8I A;  3GMW A;  1W5D A;  5FQJ A;  4QPR A;  2Q0O A;  3Q82 A;  4UQI M;  1XXM A;  3UN7 A;  3N6I A;  3EGX C;  1XKZ A;  2V9A A;  3NDG A;  4X1L A;  4F3L A;  1PRQ A;  4BL3 A;  4GB7 A;  3IF5 A;  3P09 A;  2HDS A;  4WF0 A;  4EUV A;  2Y2I A;  3S7P A;  4B93 A;  4M3K A;  3HLB A;  5HAP A;  1PIO A;  5FI2 A;  3OLO A;  3N8L A;  1KGE A;  2HGV A;  3CZD A;  5DJU A;  1HD8 A;  1YAX A;  4ZDX A;  3LR4 A;  2B02 A;  2V20 A;  2L0W A;  1FQG A;  4MLL A;  5EVE A;  2ZOH A;  3FKW A;  5IT5 A;  2O0Y A;  2Y55 A;  1PWG A;  4R3J A;  2WUQ A;  2VLG A;  3T4L A;  3L7H A;  3HLD A;  2GZA A;  3BRM A;  2PBY A;  3FKV A;  2Y2N A;  3K2N A;  1ZG6 A;  1MBL A;  3IS2 B;  5AQB A;  3MFD A;  2H0T A;  3PR6 A;  4OOL A;  2LB9 A;  4E04 A;  3T50 A;  1W7F A;  5EM0 A;  1YLW A;  4JKT A;  5DF8 A;  4FTX A;  5FI6 A;  3QNB A;  5G18 A;  4NXE A;  5F1F A;  3BFF A;  5EEC A;  3GTC A;  4U3T A;  3PTE A;  5FDS A;  2PU4 A;  1PI5 A;  5FAQ A;  3T4T A;  1DJA A;  3G30 A;  5DF7 A;  2A2L A;  3HUO A;  3CPT B;  3MZE A;  2HDU A;  1P9R A;  2Y2L A;  3SOI A;  5FQK A; 
#chains in the Genus database with same CATH homology
 2LB5 A;  3U2A A;  1OJ5 A;  2MJ6 A;  2PR6 A;  3KSI A;  1OT6 A;  4HP9 A;  5HZH A;  4I3A A;  4AFI A;  1D06 A;  4DMZ A;  3KO6 A;  1JNU A;  4BBV A;  3BY9 A;  3IS2 A;  2EA9 A;  2JKT M;  1YSP A;  1V9Y A;  1F5M A;  2CMN A;  3UME A;  1STZ A;  4R70 A;  3T4O A;  2JKT I;  4GW9 A;  4II7 A;  3VV4 A;  1TS6 A;  3T4K A;  3HJI A;  4Q0H A;  4WUJ A;  5C5K A;  3RH8 B;  2W3D A;  3HJK A;  3GDI A;  5F6A A;  3PBT A;  3MXQ A;  4WLA A;  1P9W A;  2D01 A;  1BYW A;  4HY8 A;  5LBR A;  1OPX A;  1S67 L;  4WEJ A;  2VV6 A;  4R38 A;  2VX8 A;  3MF0 A;  3MJQ A;  4H6J B;  1S4R A;  3ULF A;  3KYZ A;  4UQI S;  2XA7 M;  2ZOI A;  2HJ9 C;  4NXG A;  5AVF A;  1LSX A;  4LPZ A;  3F1P A;  3H7W B;  4Q0J A;  3T4S A;  4GCZ A;  5TJJ A;  4ARZ A;  3VE3 A;  4I39 A;  2VJW A;  3A0R A;  3V67 A;  4PKY G;  3E4P A;  3EEA A;  3PBN A;  1DP8 A;  1TS0 A;  4Y5F A;  4CLC E;  4BMW A;  2HF6 A;  3LID A;  2M1C A;  4LRX C;  1T1B A;  4EER A;  5J4E A;  1OTA A;  2WKQ A;  3TE8 A;  5TBM B;  2W1T A;  3K3D A;  3KSG A;  5IU1 A;  1G28 A;  4XT2 B;  2JHE A;  4PAU A;  3OCN A;  5IS1 A;  3ICY A;  4FSF A;  3C8C A;  3T4Q A;  5HPI A;  4R6L A;  4YNR A;  2QKP A;  4L9E A;  3UB6 A;  3LI8 A;  1ZHH B;  4HP4 A;  5MC7 A;  4WN5 A;  2XSS A;  1MC0 A;  2HJE A;  2VGL M;  3F1N A;  1S4S A;  2PT7 A;  1XJ2 A;  2KX6 A;  2OAP 1;  2W3G A;  2WKR A;  3E0Y A;  2VKS A;  5EFW A;  5DKK A;  4BBT A;  1ODV A;  3NOU C;  2VEA A;  3CUE A;  3OBF A;  4GLQ A;  4HOI A;  1TS7 A;  5HDS A;  2FH5 A;  3UE3 A;  3MR0 A;  1XFN A;  3G6O A;  2ZMV A;  4KQD A;  5KIZ A;  4I3I A;  2WKP A;  5F5Y A;  2J80 A;  3LR5 A;  2A24 B;  3FPV A;  3LUQ A;  3NOT C;  3S7Q A;  1X0O A;  2GJ3 A;  3E4O A;  5I5L A;  2BAS A;  1OT9 A;  5A8B A;  1F9I A;  1YKD A;  2KLI A;  2O99 A;  3H7W A;  4CLC D;  4M4X A;  3RFB A;  4KUO A;  4HJ6 A;  4F3L B;  3LR0 A;  1OTI A;  3LIB A;  5G4Y A;  4CLC C;  2Z6C A;  2J3T D;  3CIT A;  3D72 A;  1F98 A;  3CAX A;  3O5Y A;  2D02 A;  1H3Q A;  2W3E A;  1NWZ A;  4PKY A;  1NLZ A;  2V1B A;  3UE6 A;  4I38 A;  5TBM A;  1YSQ A;  4XT2 A;  1T19 A;  3B33 A;  3HCY A;  3UMD A;  4LRZ E;  4PHT A;  5DKL A;  4O8G A;  3MFX A;  4G3W A;  4EEP A;  4LLO B;  4DN0 A;  4HJ3 A;  3W2Z A;  4EXO A;  2B18 A;  4G3V A;  1OJG A;  3S7N A;  4YWZ A;  3BY8 A;  4HNB A;  2J3W A;  2HV1 A;  3MMH A;  2PD8 A;  2R78 A;  1UGU A;  2GX5 A;  3TRC A;  3LIC A;  3H82 B;  4Z1W A;  5DF9 A;  1N9O A;  3JVU A;  4MCW A;  3B47 A;  3VE4 A;  3MQO A;  3CI6 A;  5DFY A;  2INW A;  4I5S A;  4O0P A;  4JGO A;  4LRY C;  4L9G A;  5F69 A;  4IUK A;  4GJ4 A;  2A24 A;  1N9L A;  3B42 A;  3MQ0 A;  5HPF A;  3IBJ A;  1TD5 A;  4NKP A;  5CX7 A;  4ETX A;  3PXP A;  2JKR M;  2K7S A;  4EET B;  4GS9 A;  5DJT A;  3RTY A;  1N9N A;  1NRJ A;  1W63 Q;  2JKR I;  1S1Z A;  3UB7 A;  3CUE C;  1OTB A;  2KDK A;  2OOL A;  3A0S A;  1S1Y A;  2QHK A;  3LIE A;  1MKM A;  4WEK A;  1XJ6 A;  2L1M A;  3LI9 A;  1P0Z A;  2ZMF A;  1GSW A;  3DBA A;  5L8M A;  2H28 A;  4MN6 A;  5HDC A;  2I9V A;  1XFQ A;  3NOP C;  5AJG A;  4MN5 A;  4GHI B;  2EWW A;  1IOU A;  3R7W B;  2VV7 A;  4EES A;  2W0N A;  4HH2 A;  3LR3 A;  3PYP A;  3IBR A;  4MDZ A;  1DP6 A;  1UWP X;  3FPW A;  3ZYT A;  2KOI A;  2YKF A;  3BQA A;  5FL3 A;  1XJ3 A;  3C38 A;  4CQH A;  3F1O B;  3H82 A;  4NEE D;  1S66 L;  4HHD A;  3BWL A;  3KSH A;  2K31 A;  5F68 A;  1T18 A;  4HH3 A;  1LSW A;  4FOF A;  4IHQ A;  4EW7 A;  3OC2 A;  2XRO A;  3CLO A;  3EQU A;  2DMW A;  4H6J A;  1P97 A;  2NUT C;  3CWF A;  2PHY A;  2VGL S;  2L4R A;  2PDR A;  4BBU A;  1TF1 A;  5HWW A;  2NUP C;  3TJZ C;  4JGP A;  4L9F A;  5HDD A;  4DJ3 A;  4Y3I A;  4RQ9 A;  4EU0 A;  3K3C A;  3PBR A;  2O9C A;  5HL6 A;  5K5B A;  2V1A A;  4CLC B;  3LFV A;  1NLY A;  2K2N A;  4I3J A;  3UB8 A;  2Y79 A;  3KX0 X;  1VB6 A;  3JVV A;  1DP9 A;  2O9B A;  3EEH A;  1MZU A;  2EWV A;  4JGQ A;  3KSF A;  3A0V A;  3UB9 A;  3E4Q A;  1VHM A;  3BJN A;  2YKH A;  4GHI A;  4EEU A;  3OCL A;  3P01 A;  4HJ4 A;  3F1P B;  2O9A A;  2V0U A;  3EGD C;  3EWK A;  2ZBB A;  3R7W A;  2V0W A;  4P6Z S;  4ZRR A;  1OTD A;  2QJ7 A;  5J7E A;  2PYP A;  4IUH A;  5DFX A;  2FZ0 A;  3EOI A;  1V9Z A;  3EQV A;  1KOU A;  1G6O A;  4Q0I A;  3R4K A;  4OOM A;  1EW0 A;  2JN7 A;  4HIA A;  3GEC A;  4K08 A;  3BQ8 A;  4B9O A;  5KSH A;  3H9W A;  2OAQ 1;  4QPR A;  2VA0 A;  1WA9 A;  5HWT A;  3VOL A;  1D7E A;  3LIF A;  2VZW A;  3KYQ A;  3PBQ A;  3F1N B;  4UQI M;  2W1R A;  3EGX C;  2V9A A;  4L0L A;  4IJG A;  2Z6D A;  2IA2 A;  3PHY A;  4F3L A;  4CLC A;  2W3F A;  4KUK A;  2P7J A;  4JGR A;  3SW1 A;  4WF0 A;  4EUV A;  2PR5 A;  3S7P A;  4B93 A;  3C30 A;  4BWI A;  5G4Z A;  2XA7 S;  3PBO A;  1UWN X;  3BW6 A;  4NXF A;  4MN7 A;  3OLO A;  2GNX A;  2QJ5 A;  4WL9 A;  4YOF A;  2OWH A;  2HGV A;  2G7U A;  2Y8H A;  3NHQ A;  2P08 A;  5DJU A;  1YAX A;  2QWS A;  3FC7 A;  3LR4 A;  4HI4 A;  4HQA A;  2B02 A;  4Y2F A;  2L0W A;  4ETZ A;  2ZOH A;  4UEY A;  3T4J A;  5IT5 A;  2O0Y A;  1GSX A;  4EQ1 A;  2OWJ A;  3E98 A;  5HWV A;  2VLG A;  3T4L A;  1LL8 A;  1T1C A;  4O01 A;  3FG8 A;  3PBS A;  2VV8 A;  2GZA A;  3C2W A;  2M7U A;  5HD3 A;  3K2N A;  2M7V A;  3TW8 A;  1TS8 A;  5J3W A;  3IS2 B;  4G3K A;  1DRM A;  1Y28 A;  2W27 A;  5AVE A;  3ZQ5 A;  3D3O A;  1IFQ A;  3PR6 A;  4OOL A;  2LB9 A;  2W3H A;  4E04 A;  2PD7 A;  3T50 A;  2P04 A;  4ME4 A;  1H8M A;  1W63 M;  2XRN A;  3NJA A;  3LYX A;  4BJP A;  1T1A A;  3P7N A;  2PYR A;  1GSV A;  4NXE A;  4DJ2 A;  4GS9 B;  1ZTU A;  2QYB A;  3T4T A;  3LIA A;  2A2L A;  4ARZ B;  4P6Z M;  4R3A A;  5HD5 A;  1LSV A;  3MQQ A;  4KQO A;  1P9R A;  1LT0 A;  4WEL A;  3S7O A;  4MMN A;  1OTE A;  3F1O A;  5HSQ A;  2J3T C;  2W1T B;  3OOV A;  4NXB A;  1XJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...