3ICYA

The crystal structure of sensory box histidine kinase/response regulator domain from chlorobium tepidum tls
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
SNAEELQALVDNIPAAIYHLDVSGQATIRFRPPAFLKTLVSEHAGTTRLNTLSMIHHDDRHMLSNAYSKLREAKHSLTLVYRIVTPEGKLHWIEDHMRSSFSDDGLFSGIDGILCEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The crystal structure of sensory box histidine kinase/response regulator domain from Chlorobium
rcsb
source organism Chlorobaculum tepidum
molecule tags Structural genomics, unknown function
total genus 13
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3icyA00
1D06A 2I9VA 1S66L 1LSXA 4PKYA 2WKRA 5TBMB 2YKHA 2L4RA 4NXFA 3PYPA 5HWVA 5HWWA 3EWKA 2INWA 2R78A 4EQ1A 4EW7A 3K3CA 1T1BA 5F6AA 4BBUA 4HJ3A 3CLOA 1GSWA 1T1CA 2L0WA 4EXOA 1V9ZA 4HY8A 2L1MA 2VV6A 1XJ4A 3BY8A 4F3LA 3LIDA 5HDCA 3LUQA 3C8CA 4HOIA 2OWJA 3CWFA 4HP9A 2PD8A 4HJ4A 4R6LA 3E4QA 3FC7A 4L9FA 4HHDA 3A0VA 4EETB 3IS2B 1Y28A 2VEAA 3VE4A 1V9YA 2W27A 4MN5A 1KOUA 1F98A 5IU1A 1OTDA 3UB9A 3A0RA 2EA9A 1UWNX 3F1NB 5TBMA 1GSXA 3C2WA 2V1BA 4EEPA 3NOPC 3UMDA 2YKFA 1DP6A 5HWTA 1DRMA 2OOLA 2PYRA 4L9EA 4LPZA 5F69A 4GCZA 4E04A 1F9IA 2W0NA 1G28A 3NOTC 4LRZE 1WA9A 4WLAA 2D01A 2QKPA 2H28A 4I39A 3LIEA 4WF0A 3OLOA 4WUJA 3LIFA 3H82B 5A8BA 2B02A 5KIZA 1LT0A 5I5LA 2HV1A 1N9LA 4GS9B 4LRXC 1T18A 2PD7A 3IS2A 4I5SA 1T19A 4K08A 1T1AA 2Z6DA 5HD5A 1OJGA 5G4YA 5HDSA 4EESA 3F1NA 2WKQA 2ZOIA 4I3AA 4HNBA 3HJIA 3UB7A 1UWPX 4R70A 4HH3A 3UMEA 3RTYA 1OT6A 5DJTA 4L9GA 2JHEA 4EEUA 2QJ7A 3UE6A 3H82A 3LYXA 1TS7A 4BBTA 4HI4A 2V0UA 5DKKA 4GS9A 4KUOA 1OTBA 3LICA 3LIBA 3K3DA 4LLOB 3UB6A 5F5YA 3E4OA 3MQOA 3NJAA 1LL8A 2Z6CA 4I38A 3MQQA 2V0WA 4XT2B 2GJ3A 2M1CA 5G4ZA 3SW1A 1OTIA 4HP4A 3MJQA 3H7WB 4DJ3A 2P7JA 4JGQA 1VB6A 3CAXA 3MXQA 2PR5A 1N9OA 2KDKA 3ULFA 3BWLA 1TS8A 4I3IA 2CMNA 3F1OB 3GECA 3LI8A 3A0SA 5AVEA 3H9WA 4F3LB 3EEHA 4EERA 1XFNA 4HH2A 3NOUC 1P97A 4WL9A 1S1ZA 3ZQ5A 2ZBBA 1ODVA 4MN6A 3MFXA 5EFWA 2QWSA 1S1YA 4B9OA 2VV8A 4WN5A 5DKLA 4HJ6A 2WKPA 2K7SA 3IBRA 1NWZA 1JNUA 1XJ6A 5HD3A 4XT2A 2PDRA 2OWHA 3FG8A 1N9NA 4GW9A 5J4EA 1GSVA 3PHYA 3H7WA 5HDDA 1MZUA 1P0ZA 4JGPA 4HIAA 1S67L 4H6JB 4KQDA 1TS6A 1X0OA 2A24B 2D02A 2JN7A 5F68A 3LI9A 2PYPA 3KX0X 5J3WA 1LSVA 3F1OA 4M4XA 3B33A 2ZOHA 4KUKA 3P7NA 3LIAA 2PR6A 3F1PB 3MR0A 4GHIB 2J80A 1DP8A 2V1AA 2BASA 3VOLA 1S4SA 1D7EA 2VLGA 4NXBA 1UGUA 4LRYC 4JGOA 3RH8B 2QHKA 3HJKA 3VE3A 1BYWA 4HQAA 1S4RA 4RQ9A 2QJ5A 1LSWA 4JGRA 1XJ2A 3T50A 3E4PA 3UB8A 1OTAA 4I3JA 5AVFA 3D72A 4NXEA 5HZHA 4H6JA 4YWZA 4BBVA 1XFQA 2A24A 2VV7A 4R3AA 5J7EA 3GDIA 1OJ5A 2V9AA 1TS0A 3G6OA 1OT9A 5IS1A 4PKYG 1XJ3A 3BY9A 5HSQA 3ICYA 4R38A 4NXGA 3F1PA 4DJ2A 5DJUA 2KX6A 3NHQA 1DP9A 4GHIA 2PHYA 1EW0A 1OTEA
chains in the Genus database with same CATH superfamily
4L0LA 1D06A 2I9VA 1LL5A 3DTEA 2GX5A 3W8KA 2KLIA 4Y0UA 5EE8A 1KGFA 2ZC5B 4OKPA 5TBMB 5HL6A 1ONHA 4IEDA 3ZFZA 1LHYA 4QB8A 3D9YA 2ZC7A 3HLCA 4FCFA 5HWVA 3EWKA 4GD8A 4O0PA 1T1BA 4HJ3A 3BFFA 3HLFA 2XK1A 4S2MA 1PRQA 4P85A 1FCOA 5TFQA 5AQ7A 1HLUP 4HY8A 4R0QA 3HCYA 2L1MA 2VV6A 1PWCA 3LR0A 4K0XA 4JXWA 2P04A 1SHVA 4HOIA 5EVIB 3E4QA 3TE8A 3A3DA 4KZ3A 1K38A 1PZOA 2GNXA 5CHMA 4E6WA 3DBAA 2PAVP 3BFCA 3IS2B 4IUKA 3LY3A 2ZM0A 4UA9A 1XXMA 1N4OA 4EBNA 3QP6A 3VE4A 3BQ8A 3W4QA 3UB9A 5CGWA 3ZG8B 4PHTA 2EA9A 3BRMA 5TBMA 1GSXA 3EOIA 1NY0A 1TDLA 5HX9A 4DN0A 3UMDA 5HWTA 1DRMA 2J8YA 1ES5A 2J7VA 3VSKA 3KSHA 4UA7A 3VP3A 4WMCD 2A2LA 1E3UA 1NLZA 3ZNYA 1QMEA 2FFFB 1PWDA 3NOTC 4LRZE 4BWIA 3C4PA 1EROA 5M1AA 4C75A 2H28A 1IFQA 3BFGA 3VP1A 2Z2LB 4D2OA 5F83A 2M7VA 3H82B 1K57C 1N9LA 3W4PA 4WM9A 5EVIA 4YFMA 3V5MA 2XF3A 1PFLA 5AQ9A 2PD7A 3LR4A 3IS2A 5FQIA 1K0KA 4D60A 2ZQCA 3QP1A 1T1AA 4DXBA 3V3RA 5HD5A 5E2GA 3IXGA 4ZTKA 5I94A 2JC7A 5HDSA 1SCWA 3M2KA 4GB7A 4JPMA 2Y55A 3RJUA 3FV7A 2P08A 4I3AA 4Y3IA 4OOLA 4GJ4A 3HLDA 4CJNA 4WZ5A 4E3IA 2O99A 4QY6A 1ACFA 2X71A 3UMEA 3RTYA 1ESIA 1XGJA 2BLSA 5DJTA 4Y17A 1VETA 5TGFA 2Y2GA 2JHEA 1K54C 3U2AA 2GZAA 3H82A 4M3KA 1L2SA 4R3BA 3S7OA 4DE3A 4JXVA 1FCMA 5DKKA 4KUOA 3VSLA 3LIBA 2P9VB 4X68A 3E4OA 4KQRA 2WAFA 4PMAA 5GLDA 3JVUA 4OH0A 2Z6CA 1BLCA 3T4QA 2V0WA 5G4ZA 1IYOA 4N1HA 4Z1WA 3QP2A 3SW1A 2EFXA 5CECA 2P7JA 2BG1A 3M6HA 3MZDA 3ZG9B 3IH9A 3EGXC 2K2NA 2OAP1 1CK3A 4BD0A 2ZL1B 1DJBA 3MQ0A 2Y4AA 5AQAA 5IHVA 4CPKA 5DF9A 3OPRA 4ZAMA 3F1OB 3PBTA 3GECA 1E3UD 4WEJA 4EBPA 3DWKA 3S1YA 3GSGA 3H9WA 4F3LB 3ITBA 3FYZA 3DTMA 5FI7A 3NOUC 1P97A 3OCLA 1O7EA 5CHJA 3KSIA 4MN6A 3MBZA 2EWWA 2Q9NA 1NRFA 4K0WA 3ZDJA 5TJJA 4OPRA 4MBHA 3S7QA 5EVID 2P9VA 1N9BA 3UNWA 2X01A 2PDRA 3BLMA 3CJMA 3WRTA 5CRFA 2V20A 5J4EA 1XKZA 1GSVA 5C5KA 1TD5A 2B95A 2FH5A 3A3IA 2K31A 4CQHA 4DXCA 3CMZA 4H6JB 1K56A 3NI9A 1XP4A 2R9XA 4KZAA 4RX3A 2ZM2A 4U3TA 5DTTA 5FI6A 4EUVA 4JF4A 2UWXA 5FQ9A 3E2LA 3MF0A 3F1OA 5BOHA 3JPUA 2VGLM 5A91A 4EUZA 4DE0A 2WKHA 3KSGA 1J3WA 2JKRI 1M40A 1BULA 3LIAA 2Y2JA 5GHXA 3HL9A 4GDNA 2Y2PA 4DE1A 2XQZA 3HBRA 1KGGA 4PPRA 1S4SA 3G31A 2VLGA 1UGUA 3FKVA 1CI9A 3UY6A 3VE3A 1JVJA 3ZG0A 3C5AA 1CF0A 4NETA 2QYBA 3SOIA 4LENA 1LSWA 5EOOA 4JGRA 1ES4A 4Q0JA 3E4PA 3L9KA 2G7UA 3UB8A 4S2NA 1GHMA 4X55A 1U60A 5EPHA 3BM6A 4H6JA 3OPPA 5E43A 2IA2A 4WBGA 4OP5A 2LB5A 5F1FA 3BFEA 2WKIA 3CITA 1ZG4A 3HVFA 4KG6A 1NYYA 2G2WA 5HFOA 1TS0A 3T12B 2ZMVA 1AWIA 1ZC2A 3G6OA 1FSWA 5HSQA 5A90A 4BL3A 3LO7A 3O5YA 5DJUA 5L07A 4E3MA 1EW0A 2HGVA 1BT5A 3Q07A 1D1JA 2WZXA 1DJAA 3UPOA 3G2ZA 3PYPA 5GLCA 3GVBA 2INWA 2R78A 4EQ1A 1G5UA 1H8YA 4BBUA 2XRNA 5GLAA 1K55A 4II7A 1GSWA 1SKOB 2XFTA 2L0WA 4EXOA 1GA0A 1YMSA 3T4LA 1K56D 3D3OA 4OONA 1K4FA 3C8CA 4GLQA 3C30A 3ZG5A 3U4LP 3E98A 3WRZA 1ALQA 3GMWA 3A0VA 1YAXA 4EETB 2H5SA 5KZHA 2VX8A 4ZBEA 5M18A 3G2YA 1V9YA 5HAIA 4MN5A 1F98A 3ZHHA 3ZVTA 3NCKA 3TOIA 3T4JA 4LFUA 1MY8A 3F1NB 1K4EA 3ISGA 4X69A 4QU3A 4AFIA 3NOPC 1DP6A 3KYQA 3ZVWA 2ZQ7A 1L0EA 1RGZA 2PYRA 5F69A 4Y0OA 3I7JA 5E2HA 4EU0A 2EX2A 5CEDA 1ERMA 1SKOA 1GHIA 1L0GA 1WA9A 1FQGA 4N92A 2VZWA 4NEED 2QKPA 5EUAA 1MC0A 4CLCE 2XD5A 3A3FA 3LIEA 5AQBA 3MMHA 4G3KA 3VP2A 2E8JA 4OP8A 5CERA 1FCNA 1LT0A 4G3WA 5I5LA 5K5BA 3ZG7B 4KG2A 4S2PA 5E2FA 2XD1A 3IF6C 3A3EA 4Y2FA 2IWCA 5HARA 3FPVA 2O9CA 3MS6A 1W79A 5D3OA 3C4OA 1FR6A 4I5SA 4OPYA 3UDXA 2Z6DA 5CGXA 3WS0A 3T1XA 3M6BA 3LFVA 2A3UA 3B42A 1WYBA 3VOYA 4DE2A 1XA1A 4EESA 1IKIA 3F1NA 4X53A 3A3JA 3T4KA 3WS4A 4GD6A 2ZC6B 4KQQA 2ZOIA 2DNSA 2XEPA 2PRFA 1HVBA 3HJIA 3N7WA 4P87A 4IHQA 2WGIA 1FILA 3PXPA 5JYPA 4N9LA 4QHCA 4HH3A 3NULA 5GHZA 1NZOA 4IBRA 3HREA 2Y2OA 4L9GA 3DTKA 3Q7ZA 1IYPA 2DCFA 3UE6A 2P74A 4BBTA 2V2FF 1YLZA 2XSSA 1Q2QA 2V0UA 2OLVA 4QJGA 1HD8A 4DDYA 3TW8A 2PT7A 1OTBA 3QP5A 1Y4OA 3OCNA 4LLOB 3NJAA 1LL8A 3VFFA 1O07A 4E3JA 4XT2B 2GJ3A 1PWGA 2HDQA 4QWOA 1OTIA 4S2JA 1Y54A 1WE4A 3G32A 3H7WB 3EGDC 3BFDA 4JGQA 1YT4A 4X25A 4IJGA 2PR5A 3HUNA 1N9OA 4K91A 2XA7M 1W63M 1MBLA 3ULFA 3BWLA 2W3HA 3FPWA 3IWIA 4I3IA 3AGDA 5DTSA 1CEGA 4BMWA 3LI8A 5AVEA 3R7WB 1ODVA 2JKFA 5EOEA 2PU4A 3MFXA 3V3SA 3CUEC 3DAVA 4JXGA 3VMAA 2EXAA 4LCLA 4U0XA 3S7PA 4KZ9A 5EVIC 3LR5A 1SDEA 3TJZC 1NWZA 4MN7A 1JNUA 1QMFA 1XJ6A 2XGNA 4BJPA 2EWVA 3O86A 4XT2A 1YLPA 4CLCB 2OWHA 4OQ0A 3PHYA 4E3NA 3H7WA 4HESA 1PW8A 1P9WA 3IHBA 1M6KA 4C3QA 2ZQ9A 3UPNA 3BECA 1MZUA 1P0ZA 3KYZA 3DWZA 4HIAA 1H8MA 2ZQAA 4JBFA 4LV2A 2ZMAA 4OVDA 1X0OA 1ESUA 4UEYA 4QY5A 4YNRA 2JN7A 3V39A 3E2KA 3NBLA 3LI9A 2PYPA 1YMXA 2WK0A 2R9WA 1NYMA 5J3WA 4WYYA 3KO6A 2ZC4B 5FATA 4JKTA 5KSCA 3UE1A 3RXXA 3F1PB 4PM5A 4KZ8A 3R7WA 3FWLA 3VV4A 2J80A 4LV0A 1IEMA 3ITAA 3C38A 4ME4A 3IF5A 1YLJA 1D7EA 3RH8B 2QHKA 2RCXA 4FH4A 4HQAA 4JF6A 4RQ9A 4CLCA 4ZRRA 1STZA 3CZDA 5FQMA 2QJ5A 3NY4A 1XJ2A 5CX7A 3GQZA 3T50A 3G30A 1H0MA 5MC7A 3QP4A 3BYDA 1LL9A 2PBYA 4Q8IA 4GZBA 2VV7A 3N4IA 2FZ0A 2KOIA 2VGLS 1KVLA 1VQQA 2NUTC 2HDRA 2WYXA 2EXBA 2XROA 3IH8A 3WS1A 1NZUA 3BY9A 2Y2IA 2XFSA 4F94A 2MJ6A 4R38A 3F1PA 4H8RA 3PTEA 2JKGA 4S2OA 1JTGA 1HTZA 3IXDA 3S7NA 1S66L 3OBFA 2ZMFA 2WKRA 1K25A 2JCHA 5FEFA 1YSPA 2L4RA 3VP0A 4ZJ3A 1W63Q 1YQSA 5HWWA 3MXRA 2ZL1A 5GHYA 3K3CA 5F6AA 1KE4A 1BZAA 3P09A 3CLOA 3IT9A 1T1CA 3TSGA 4KG5A 1BUEA 2WZZA 4Q0IA 3WWXA 1V9ZA 4ETZA 4FSFA 1XJ4A 1BLHA 4F3LA 4X6TA 3LIDA 5A92A 2W3EA 3SS4A 4GNUA 4WZ4A 1CI8A 2OWJA 4HP9A 1CQAA 4MBFA 4HJ4A 1TEMA 3FC7A 2JKTM 2Y2KA 5CTNA 4Y0TA 4HBTA 4L9FA 2HPBA 3Q81A 2Y2NA 4WELA 1G6OA 3VFHA 3CPTB 2VEAA 5M19A 2C5WB 4UQIM 4E6XA 1KOUA 5IU1A 4KZ7A 3EQVA 3LEZA 3EQUA 1TVFA 2W3DA 2V8CA 3C2WA 4EEPA 4S2IA 2Q0OA 1SDNA 3N6IA 1ES3A 4GCZA 2VA0A 3CG5A 4CLCD 4BL2A 4E04A 4KZBA 3HLGA 2W0NA 1G28A 4WLAA 1P9RA 4KENB 4OQHA 4S2NC 1MWTA 1SZVA 3OLOA 4UAAA 3LIFA 5A8BA 2B02A 5KIZA 5CXWA 2XR0A 5L2FA 3GR2A 4GS9B 3MKFA 1PZPA 3IHAA 5G18A 3OPHA 1CEFA 3VP4A 2ZQ8A 5F82A 1I2SA 2Y2HA 3CPTA 4OLDA 4YOFA 4NG2A 2Y91A 4G3VA 2J3TD 5F1GA 2GDNA 1PYYA 1JTDA 3UPPA 4OQIA 2WKEA 2X02A 4X56A 5LBRA 3D4FA 3MSHA 3LY4A 4P0MA 1EI5A 2H0TA 2HDSA 2HJEA 1YLWA 1IELA 4E3LA 1F2KA 1FOFA 3HLEA 1MXOA 1UWPX 2Y2QA 4R70A 5HW3A 4DF6A 4LV1A 1OT6A 3WS5A 3O3VA 2Y59A 3IF6B 3HUMA 3SH7A 2QJ7A 2IWDA 2WGVA 3MZFA 1TS7A 4MCWA 4JLFA 2UV0E 3EEAA 4GS9A 5FEGA 4P6ZM 3LICA 2W1TB 3Q1FA 3L7HA 3UB6A 4IBXA 5F5YA 4BD1A 2HP5A 1CJFA 1YM1A 4ZJ2A 3UE0A 3UB5P 4I38A 4OQGA 2M1CA 4FOFA 2VGJA 1LI9A 2QZ6A 4HP4A 5L8MA 5IT5A 4DJ3A 1F5MA 2LB9A 4Q0HA 1DY6A 5DFXA 3IX8A 2PBDP 2WADA 4UA6A 2KDKA 1L0DA 4EQIA 2OV5A 1TS8A 4S2LA 4XXRA 1PI4A 4HEFA 3IBJA 2VJWA 2VKSA 1PW1A 4EV4A 1W8QA 2G2UA 3IF6A 3NC8A 4U0TA 1G6AA 3EEHA 4EERA 4HH2A 3PBSA 3TG9A 1S6RA 3AGFA 3NIAA 3BLSA 3MZEA 5EFWA 5U47A 1S1YA 4B9OA 1W5DA 2W1TA 5GLBA 3KYEA 2V1ZA 4IUHA 5FL3A 1XGIA 1PIOA 4B88A 3MFDA 2K7SA 3RFBA 3IQAA 3IBRA 2XH9A 4Y7PA 5CHUA 3OZHA 3PBOA 2BTFP 1XX2A 3ZNTA 5DTKA 5FQKA 3FG8A 4GW9A 4PAUA 2XA7S 1BSGA 2O9BA 1FSYA 1S67L 3TRCA 1FIKA 1Z09A 4IVIA 4KQDA 1TS6A 4Y5FA 1KGEA 2D02A 4LGWA 4ESPA 3FZCA 2EX8A 1LSVA 4M4XA 2ZOHA 3AGEA 3BQAA 4EWFA 1IYSA 2DRWA 5FA7A 1NRJA 2VK3A 3C7UA 4X1MA 2JE5A 3PAGA 4X1LA 2V1AA 2O0YA 3QP8A 1E4DA 2Y8HA 2O9AA 3K2NA 3HJKA 3ZCZA 1IOUA 1YLTA 3DTIA 2Z2MB 2ACGA 4O8GA 1L0FA 4DRTA 3O87A 3PR6A 2W3FA 4RVAA 3SH8A 4I3JA 5L09A 4FUWA 4NXEA 1E25A 4BQMA 1GCEA 4DDSA 4KZ6A 1K57A 3IXBA 3T4OA 4R3AA 3OC2A 2ZLYA 2C6WB 5FSRA 1GA9A 3SS3A 1VETB 5J8XA 3LCEA 3ZYTA 2J9OA 3CUEA 1G68A 1MWSA 1XJ3A 3NECA 1GHPA 2OLUA 3ICYA 1IKGA 2WGWB 1YLYA 5EV0A 4RX2A 2Y2MA 5HPIA 2PU2A 1KE3A 1OTEA 1XPBA 1VEUB 3G4PA 5CEBA 3Q82A 1K6RA 1LSXA 1VHMA 4PKYA 2WUQA 2YKHA 3NDGA 1SKFA 3HUOA 4NXFA 3T1QB 3FKWA 3SS5A 1BLPA 3N8LA 1RGYA 4EW7A 4MEZA 2ZM8A 5AJGA 3N8RA 2JKTI 5HL1A 4WEKA 1K54A 3QHYA 1YPRA 2Y79A 4HBUA 2EX6A 1XA7A 4WZ5C 5E2EA 1RP5A 2QPNA 1EWZA 3BJNA 3BY8A 5HDCA 3LUQA 1HZOA 2B5RA 1PNEA 1KVMA 1MPLA 3CWFA 2PD8A 4R6LA 4HHDA 3S4XA 2WGWA 1ZHHB 1Y28A 2V8FA 2RL3A 3SH9A 5EECA 2W27A 4FH2A 2CC1A 1W8YA 3E0YA 1VEUA 4OOMA 5CTMA 1OTDA 4Y13A 3MXSA 3A0RA 1UWNX 2OAQ1 5TR7A 2V1BA 5FASA 2YKFA 3C7VA 2A49A 2HDUA 1L3LA 2OOLA 4L9EA 4LPZA 1K6SA 4NKPA 4DMZA 4KZ4A 1LI0A 1MWUA 1F9IA 3N8SA 4CLCC 3HLWA 4ID4A 4R1GA 1OPXA 3PAEA 4JXSA 2D01A 3UDFA 5FAQA 3G34A 3GV9A 4OOYA 4I39A 4C6YA 5CGSA 3DW0A 4WF0A 2E8IA 4WUJA 2ZJ9A 4S2KA 3IXHA 3V67A 2HV1A 3IWOA 4B4XA 1I5QA 4JF5A 4ETXA 1NLYA 3VOZA 2IWBA 1C3BA 4LRXC 4R23A 1T18A 4UQIS 5DF7A 4B93A 2W1RA 1T19A 4K08A 3JYIA 1H8ZA 1AXBA 2J3TC 2XDMA 3LR3A 1OJGA 2J3WA 5G4YA 4R3JA 4LV3A 2EFUA 4RYEA 2WKQA 2HZ5A 3B3XA 3KSFA 4QD4A 2HP6A 2W3GA 4HNBA 4GKUA 3UB7A 4A5RA 4BENA 3UO9A 1I2WA 4YINA 2VGKA 1KE0A 4N1XA 4O01A 4EEUA 4O7DA 4EBLA 3B47A 3LYXA 5KMWA 4HI4A 4MDZA 1ES2A 2AVXA 4PM6A 1DJCA 3IX4A 5HAQA 3PBNA 3K3DA 3LEQA 3MQOA 3PBRA 1OMEA 3MQQA 4XUXA 1ZG6A 3SZTA 1W7FA 2ZQDA 4IVKA 3T4SA 1MWRA 3W2ZA 5FDHA 3MJQA 2HF6A 3HLBA 3GTCA 1VB6A 3M2JA 4N9KA 3CAXA 3MXQA 4FD8A 4GDBA 5DFYA 2NUPC 1JWZA 4XUZA 1VM1A 2XLNA 1LLBA 1WYCA 2H10A 1JWPA 2CMNA 1TDGA 3QNBA 3CI6A 2OSUA 5DVAA 3A0SA 5JYOA 3QNCA 2ZD8A 1RCJA 1KDWA 5EVLA 1XFNA 4R4RA 3R4KA 4WL9A 3ZQ5A 1S1ZA 4P6ZS 4UHUA 2H0YA 2ZBBA 1ZTUA 4MMNA 2J9PA 4OPZA 3RXWA 3S22A 2M7UA 2QWSA 4RA7A 3LGOA 2VV8A 1MKMA 4WN5A 5DF8A 2FFYA 2Y2LA 4MBKA 5DKLA 4HJ6A 2WKPA 5FQJA 4E3OA 2DMWA 3JVVA 5HD3A 4P6BA 3ZGAB 3V50A 1N9NA 1PI5A 2QMIA 4Y15A 4OPQA 2WAEA 5HDDA 1KDSA 4JGPA 5GL9A 3BW6A 3T4TA 2A24B 1TF1A 3T1SA 3GRJA 4PM8A 3W4OA 1K55C 1NJ4A 1ERQA 1FR1A 5F68A 3Q7VB 3KX0X 2ZC3B 3MKEA 3UE3A 3B33A 3UDIA 1BLSA 5HAPA 4KUKA 3P7NA 4QPRA 5L10A 2PR6A 4ARZB 3MR0A 4KQOA 5FQQA 4LCMA 4NK3A 4GHIB 4PM9A 1IYQA 1DP8A 5FAPA 2B18A 5HPFA 4BLMA 4B4ZA 2BASA 5KSHA 3UN7A 3P98A 4OLGA 3NDEA 4GOGA 2EX9A 3VOLA 4NXBA 4LRYC 4JGOA 1J9MA 5FDSA 3IWQA 4WMCA 3CHWP 2JKRM 1BYWA 1S4RA 5FAOA 4MNRA 3OPLA 5EVEA 2HP9A 2I72A 5EM1A 4Z9QA 1OTAA 5AVFA 3D72A 1S0WA 4MLLA 1H3QA 5HZHA 4PM7A 4YWZA 4BBVA 1XFQA 1BTLA 1NXYA 1JWVA 2A24A 3WS2A 2Q9MA 1MKIA 3O88A 4FTXA 4R4SA 5J7EA 4GN2A 1YKDA 1H5XA 3P01A 3GDIA 1Q2PA 2HJ9C 3Q7VA 1OJ5A 5FI2A 3IX3A 2V9AA 3PBQA 1ZKJA 4KZ5A 3OOVA 5EM0A 1OT9A 5IS1A 4PKYG 1ONGA 4ZDXA 3G35A 2JBFA 4DKIA 4ARZA 4NXGA 4DJ2A 1A0KA 2KX6A 3NHQA 1YSQA 1Z6FA 4ZJ1A 3BEBA 1DP9A 4GHIA 3T1RA 2PHYA 5A93A 4E3KA
chains in the Genus database with same CATH topology
4L0LA 1D06A 2I9VA 3S7NA 1S66L 3OBFA 1LSXA 1VHMA 4PKYA 2GX5A 2ZMFA 2WKRA 2KLIA 5TBMB 2YKHA 5HL6A 1YSPA 2L4RA 4NXFA 1W63Q 3PYPA 5HWVA 5HWWA 3EWKA 2INWA 2R78A 4EQ1A 4EW7A 4O0PA 5AJGA 3K3CA 1T1BA 2JKTI 5F6AA 4BBUA 4HJ3A 2XRNA 4WEKA 3CLOA 4II7A 1GSWA 1T1CA 2L0WA 4EXOA 2Y79A 4Q0IA 1V9ZA 4ETZA 4HY8A 3T4LA 3HCYA 2L1MA 4FSFA 2VV6A 1XJ4A 3BJNA 3BY8A 4F3LA 3D3OA 3LIDA 5HDCA 2W3EA 3LR0A 3LUQA 3C8CA 4GLQA 2P04A 3C30A 4HOIA 2OWJA 3CWFA 4HP9A 2PD8A 4HJ4A 3E4QA 3E98A 3FC7A 2JKTM 4R6LA 3TE8A 4L9FA 4HHDA 4WELA 3A0VA 1YAXA 2GNXA 4EETB 3DBAA 3IS2B 1G6OA 4IUKA 1ZHHB 1Y28A 2VX8A 2VEAA 3VE4A 1V9YA 2W27A 3BQ8A 4UQIM 4MN5A 1KOUA 1F98A 3E0YA 4OOMA 5IU1A 1OTDA 3UB9A 3T4JA 4PHTA 3A0RA 3EQVA 3EQUA 2EA9A 2W3DA 1UWNX 3F1NB 2OAQ1 5TBMA 1GSXA 3EOIA 3C2WA 2V1BA 4EEPA 4AFIA 3NOPC 3UMDA 4DN0A 2YKFA 1DP6A 3KYQA 5HWTA 1DRMA 2OOLA 2PYRA 3KSHA 4L9EA 4LPZA 2A2LA 4NKPA 5F69A 4GCZA 2VA0A 4DMZA 4CLCD 4EU0A 4E04A 1F9IA 4CLCC 1NLZA 2W0NA 1OPXA 1G28A 3NOTC 4LRZE 4BWIA 1WA9A 2VZWA 4NEED 2D01A 2QKPA 4WLAA 1P9RA 2H28A 1IFQA 1MC0A 4I39A 4CLCE 3LIEA 4WF0A 3MMHA 4G3KA 3OLOA 4WUJA 3LIFA 2M7VA 3H82B 5A8BA 2B02A 5KIZA 1LT0A 4G3WA 3V67A 5I5LA 2HV1A 5K5BA 1N9LA 4ETXA 1NLYA 4GS9B 4Y2FA 4LRXC 3FPVA 1T18A 2PD7A 3LR4A 4UQIS 2O9CA 3IS2A 4B93A 4I5SA 2W1RA 1T19A 4K08A 1T1AA 2Z6DA 4YOFA 4G3VA 2J3TD 5HD5A 3LFVA 2J3TC 3B42A 3LR3A 1OJGA 2J3WA 5G4YA 5HDSA 4EESA 3F1NA 2WKQA 5LBRA 3KSFA 3T4KA 2P08A 2W3GA 2ZOIA 4I3AA 4Y3IA 4OOLA 4GJ4A 4HNBA 3HJIA 3UB7A 4IHQA 2HJEA 2O99A 3PXPA 1UWPX 4R70A 4HH3A 3UMEA 3RTYA 1OT6A 5DJTA 4L9GA 2JHEA 4O01A 4EEUA 2QJ7A 3U2AA 2GZAA 3B47A 3H82A 3LYXA 3UE6A 1TS7A 4BBTA 4MCWA 4HI4A 2XSSA 2V0UA 3S7OA 4MDZA 3TW8A 2PT7A 3EEAA 5DKKA 4GS9A 4KUOA 1OTBA 4P6ZM 3LICA 2W1TB 3LIBA 3OCNA 3PBNA 3K3DA 4LLOB 3UB6A 5F5YA 3E4OA 3MQOA 3NJAA 1LL8A 3JVUA 2Z6CA 3PBRA 3T4QA 4I38A 3MQQA 2V0WA 4XT2B 2GJ3A 2M1CA 5G4ZA 4FOFA 4Z1WA 3SW1A 3T4SA 3W2ZA 1OTIA 4HP4A 5L8MA 3MJQA 5IT5A 2HF6A 3H7WB 4DJ3A 2P7JA 1F5MA 3EGDC 2LB9A 4JGQA 4Q0HA 1VB6A 3EGXC 5DFXA 2K2NA 2OAP1 4IJGA 3CAXA 3MXQA 2PR5A 1N9OA 2KDKA 2XA7M 3MQ0A 1W63M 3ULFA 5DFYA 3BWLA 2NUPC 2W3HA 3FPWA 1TS8A 4I3IA 3IBJA 2VJWA 2VKSA 2CMNA 5DF9A 3CI6A 3F1OB 3PBTA 3GECA 4BMWA 3LI8A 4WEJA 3A0SA 5AVEA 3H9WA 4F3LB 3EEHA 4EERA 1XFNA 3R4KA 4HH2A 3NOUC 1P97A 4WL9A 1S1ZA 3PBSA 4P6ZS 3ZQ5A 3OCLA 3R7WB 2ZBBA 1ODVA 1ZTUA 3KSIA 4MMNA 3MFXA 4MN6A 3CUEC 2EWWA 5EFWA 2M7UA 2QWSA 1S1YA 4B9OA 5TJJA 2VV8A 1MKMA 4WN5A 2W1TA 5DKLA 3S7QA 4HJ6A 4IUHA 5FL3A 3S7PA 3LR5A 2WKPA 2K7SA 3RFBA 3TJZC 3IBRA 1NWZA 4MN7A 1JNUA 2DMWA 1XJ6A 4BJPA 2EWVA 3JVVA 5HD3A 3PBOA 4XT2A 4CLCB 2PDRA 2OWHA 3FG8A 1N9NA 4GW9A 5J4EA 4PAUA 1GSVA 5C5KA 3PHYA 1TD5A 3H7WA 2XA7S 1P9WA 5HDDA 2FH5A 1MZUA 1P0ZA 2K31A 2O9BA 3KYZA 4JGPA 4HIAA 1H8MA 4CQHA 1S67L 3TRCA 4H6JB 3BW6A 3T4TA 4KQDA 1TS6A 1X0OA 2A24B 1TF1A 4Y5FA 2D02A 4EUVA 4UEYA 4YNRA 2JN7A 5F68A 3LI9A 2PYPA 3KX0X 5J3WA 1LSVA 3MF0A 3F1OA 3UE3A 4M4XA 3B33A 3KO6A 2VGLM 2ZOHA 3BQAA 3KSGA 2JKRI 4KUKA 3P7NA 4QPRA 3LIAA 2PR6A 4ARZB 1NRJA 3F1PB 3MR0A 4KQOA 3R7WA 4GHIB 3VV4A 2J80A 1DP8A 2B18A 5HPFA 2V1AA 2BASA 2O0YA 5KSHA 3C38A 3VOLA 2Y8HA 4ME4A 1S4SA 2O9AA 1D7EA 2VLGA 4NXBA 1UGUA 3K2NA 4LRYC 4JGOA 3RH8B 2QHKA 3HJKA 1IOUA 3VE3A 2JKRM 1BYWA 4HQAA 1S4RA 4RQ9A 4ZRRA 4CLCA 1STZA 2QYBA 2QJ5A 1LSWA 4JGRA 1XJ2A 4O8GA 5CX7A 4Q0JA 3T50A 3PR6A 2W3FA 3E4PA 5MC7A 2G7UA 3UB8A 1OTAA 4I3JA 5AVFA 3D72A 4NXEA 1H3QA 5HZHA 4H6JA 4YWZA 4BBVA 1XFQA 2A24A 2VV7A 2IA2A 3T4OA 4R3AA 5J7EA 2LB5A 1YKDA 2FZ0A 2KOIA 2VGLS 3P01A 3CITA 3OC2A 3GDIA 2HJ9C 1OJ5A 2NUTC 2V9AA 1TS0A 3PBQA 2XROA 2ZMVA 3ZYTA 3CUEA 3OOVA 3G6OA 1OT9A 5IS1A 4PKYG 1XJ3A 3BY9A 5HSQA 3ICYA 2MJ6A 3O5YA 4R38A 4NXGA 4ARZA 3F1PA 4DJ2A 5DJUA 2KX6A 3NHQA 1YSQA 5HPIA 1DP9A 4GHIA 2PHYA 1EW0A 1OTEA 2HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D06 A;  2I9V A;  1S66 L;  1LSX A;  4PKY A;  2WKR A;  5TBM B;  2YKH A;  2L4R A;  4NXF A;  3PYP A;  5HWV A;  5HWW A;  3EWK A;  2INW A;  2R78 A;  4EQ1 A;  4EW7 A;  3K3C A;  1T1B A;  5F6A A;  4BBU A;  4HJ3 A;  3CLO A;  1GSW A;  1T1C A;  2L0W A;  4EXO A;  1V9Z A;  4HY8 A;  2L1M A;  2VV6 A;  1XJ4 A;  3BY8 A;  4F3L A;  3LID A;  5HDC A;  3LUQ A;  3C8C A;  4HOI A;  2OWJ A;  3CWF A;  4HP9 A;  2PD8 A;  4HJ4 A;  4R6L A;  3E4Q A;  3FC7 A;  4L9F A;  4HHD A;  3A0V A;  4EET B;  3IS2 B;  1Y28 A;  2VEA A;  3VE4 A;  1V9Y A;  2W27 A;  4MN5 A;  1KOU A;  1F98 A;  5IU1 A;  1OTD A;  3UB9 A;  3A0R A;  2EA9 A;  1UWN X;  3F1N B;  5TBM A;  1GSX A;  3C2W A;  2V1B A;  4EEP A;  3NOP C;  3UMD A;  2YKF A;  1DP6 A;  5HWT A;  1DRM A;  2OOL A;  2PYR A;  4L9E A;  4LPZ A;  5F69 A;  4GCZ A;  4E04 A;  1F9I A;  2W0N A;  1G28 A;  3NOT C;  4LRZ E;  1WA9 A;  4WLA A;  2D01 A;  2QKP A;  2H28 A;  4I39 A;  3LIE A;  4WF0 A;  3OLO A;  4WUJ A;  3LIF A;  3H82 B;  5A8B A;  2B02 A;  5KIZ A;  1LT0 A;  5I5L A;  2HV1 A;  1N9L A;  4GS9 B;  4LRX C;  1T18 A;  2PD7 A;  3IS2 A;  4I5S A;  1T19 A;  4K08 A;  1T1A A;  2Z6D A;  5HD5 A;  1OJG A;  5G4Y A;  5HDS A;  4EES A;  3F1N A;  2WKQ A;  2ZOI A;  4I3A A;  4HNB A;  3HJI A;  3UB7 A;  1UWP X;  4R70 A;  4HH3 A;  3UME A;  3RTY A;  1OT6 A;  5DJT A;  4L9G A;  2JHE A;  4EEU A;  2QJ7 A;  3UE6 A;  3H82 A;  3LYX A;  1TS7 A;  4BBT A;  4HI4 A;  2V0U A;  5DKK A;  4GS9 A;  4KUO A;  1OTB A;  3LIC A;  3LIB A;  3K3D A;  4LLO B;  3UB6 A;  5F5Y A;  3E4O A;  3MQO A;  3NJA A;  1LL8 A;  2Z6C A;  4I38 A;  3MQQ A;  2V0W A;  4XT2 B;  2GJ3 A;  2M1C A;  5G4Z A;  3SW1 A;  1OTI A;  4HP4 A;  3MJQ A;  3H7W B;  4DJ3 A;  2P7J A;  4JGQ A;  1VB6 A;  3CAX A;  3MXQ A;  2PR5 A;  1N9O A;  2KDK A;  3ULF A;  3BWL A;  1TS8 A;  4I3I A;  2CMN A;  3F1O B;  3GEC A;  3LI8 A;  3A0S A;  5AVE A;  3H9W A;  4F3L B;  3EEH A;  4EER A;  1XFN A;  4HH2 A;  3NOU C;  1P97 A;  4WL9 A;  1S1Z A;  3ZQ5 A;  2ZBB A;  1ODV A;  4MN6 A;  3MFX A;  5EFW A;  2QWS A;  1S1Y A;  4B9O A;  2VV8 A;  4WN5 A;  5DKL A;  4HJ6 A;  2WKP A;  2K7S A;  3IBR A;  1NWZ A;  1JNU A;  1XJ6 A;  5HD3 A;  4XT2 A;  2PDR A;  2OWH A;  3FG8 A;  1N9N A;  4GW9 A;  5J4E A;  1GSV A;  3PHY A;  3H7W A;  5HDD A;  1MZU A;  1P0Z A;  4JGP A;  4HIA A;  1S67 L;  4H6J B;  4KQD A;  1TS6 A;  1X0O A;  2A24 B;  2D02 A;  2JN7 A;  5F68 A;  3LI9 A;  2PYP A;  3KX0 X;  5J3W A;  1LSV A;  3F1O A;  4M4X A;  3B33 A;  2ZOH A;  4KUK A;  3P7N A;  3LIA A;  2PR6 A;  3F1P B;  3MR0 A;  4GHI B;  2J80 A;  1DP8 A;  2V1A A;  2BAS A;  3VOL A;  1S4S A;  1D7E A;  2VLG A;  4NXB A;  1UGU A;  4LRY C;  4JGO A;  3RH8 B;  2QHK A;  3HJK A;  3VE3 A;  1BYW A;  4HQA A;  1S4R A;  4RQ9 A;  2QJ5 A;  1LSW A;  4JGR A;  1XJ2 A;  3T50 A;  3E4P A;  3UB8 A;  1OTA A;  4I3J A;  5AVF A;  3D72 A;  4NXE A;  5HZH A;  4H6J A;  4YWZ A;  4BBV A;  1XFQ A;  2A24 A;  2VV7 A;  4R3A A;  5J7E A;  3GDI A;  1OJ5 A;  2V9A A;  1TS0 A;  3G6O A;  1OT9 A;  5IS1 A;  4PKY G;  1XJ3 A;  3BY9 A;  5HSQ A;  3ICY A;  4R38 A;  4NXG A;  3F1P A;  4DJ2 A;  5DJU A;  2KX6 A;  3NHQ A;  1DP9 A;  4GHI A;  2PHY A;  1EW0 A;  1OTE A; 
#chains in the Genus database with same CATH topology
 4L0L A;  1D06 A;  2I9V A;  1LL5 A;  3DTE A;  2GX5 A;  3W8K A;  2KLI A;  4Y0U A;  5EE8 A;  1KGF A;  2ZC5 B;  4OKP A;  5TBM B;  5HL6 A;  1ONH A;  4IED A;  3ZFZ A;  1LHY A;  4QB8 A;  3D9Y A;  2ZC7 A;  3HLC A;  4FCF A;  5HWV A;  3EWK A;  4GD8 A;  4O0P A;  1T1B A;  4HJ3 A;  3BFF A;  3HLF A;  2XK1 A;  4S2M A;  1PRQ A;  4P85 A;  1FCO A;  5TFQ A;  5AQ7 A;  1HLU P;  4HY8 A;  4R0Q A;  3HCY A;  2L1M A;  2VV6 A;  1PWC A;  3LR0 A;  4K0X A;  4JXW A;  2P04 A;  1SHV A;  4HOI A;  5EVI B;  3E4Q A;  3TE8 A;  3A3D A;  4KZ3 A;  1K38 A;  1PZO A;  2GNX A;  5CHM A;  4E6W A;  3DBA A;  2PAV P;  3BFC A;  3IS2 B;  4IUK A;  3LY3 A;  2ZM0 A;  4UA9 A;  1XXM A;  1N4O A;  4EBN A;  3QP6 A;  3VE4 A;  3BQ8 A;  3W4Q A;  3UB9 A;  5CGW A;  3ZG8 B;  4PHT A;  2EA9 A;  3BRM A;  5TBM A;  1GSX A;  3EOI A;  1NY0 A;  1TDL A;  5HX9 A;  4DN0 A;  3UMD A;  5HWT A;  1DRM A;  2J8Y A;  1ES5 A;  2J7V A;  3VSK A;  3KSH A;  4UA7 A;  3VP3 A;  4WMC D;  2A2L A;  1E3U A;  1NLZ A;  3ZNY A;  1QME A;  2FFF B;  1PWD A;  3NOT C;  4LRZ E;  4BWI A;  3C4P A;  1ERO A;  5M1A A;  4C75 A;  2H28 A;  1IFQ A;  3BFG A;  3VP1 A;  2Z2L B;  4D2O A;  5F83 A;  2M7V A;  3H82 B;  1K57 C;  1N9L A;  3W4P A;  4WM9 A;  5EVI A;  4YFM A;  3V5M A;  2XF3 A;  1PFL A;  5AQ9 A;  2PD7 A;  3LR4 A;  3IS2 A;  5FQI A;  1K0K A;  4D60 A;  2ZQC A;  3QP1 A;  1T1A A;  4DXB A;  3V3R A;  5HD5 A;  5E2G A;  3IXG A;  4ZTK A;  5I94 A;  2JC7 A;  5HDS A;  1SCW A;  3M2K A;  4GB7 A;  4JPM A;  2Y55 A;  3RJU A;  3FV7 A;  2P08 A;  4I3A A;  4Y3I A;  4OOL A;  4GJ4 A;  3HLD A;  4CJN A;  4WZ5 A;  4E3I A;  2O99 A;  4QY6 A;  1ACF A;  2X71 A;  3UME A;  3RTY A;  1ESI A;  1XGJ A;  2BLS A;  5DJT A;  4Y17 A;  1VET A;  5TGF A;  2Y2G A;  2JHE A;  1K54 C;  3U2A A;  2GZA A;  3H82 A;  4M3K A;  1L2S A;  4R3B A;  3S7O A;  4DE3 A;  4JXV A;  1FCM A;  5DKK A;  4KUO A;  3VSL A;  3LIB A;  2P9V B;  4X68 A;  3E4O A;  4KQR A;  2WAF A;  4PMA A;  5GLD A;  3JVU A;  4OH0 A;  2Z6C A;  1BLC A;  3T4Q A;  2V0W A;  5G4Z A;  1IYO A;  4N1H A;  4Z1W A;  3QP2 A;  3SW1 A;  2EFX A;  5CEC A;  2P7J A;  2BG1 A;  3M6H A;  3MZD A;  3ZG9 B;  3IH9 A;  3EGX C;  2K2N A;  2OAP 1;  1CK3 A;  4BD0 A;  2ZL1 B;  1DJB A;  3MQ0 A;  2Y4A A;  5AQA A;  5IHV A;  4CPK A;  5DF9 A;  3OPR A;  4ZAM A;  3F1O B;  3PBT A;  3GEC A;  1E3U D;  4WEJ A;  4EBP A;  3DWK A;  3S1Y A;  3GSG A;  3H9W A;  4F3L B;  3ITB A;  3FYZ A;  3DTM A;  5FI7 A;  3NOU C;  1P97 A;  3OCL A;  1O7E A;  5CHJ A;  3KSI A;  4MN6 A;  3MBZ A;  2EWW A;  2Q9N A;  1NRF A;  4K0W A;  3ZDJ A;  5TJJ A;  4OPR A;  4MBH A;  3S7Q A;  5EVI D;  2P9V A;  1N9B A;  3UNW A;  2X01 A;  2PDR A;  3BLM A;  3CJM A;  3WRT A;  5CRF A;  2V20 A;  5J4E A;  1XKZ A;  1GSV A;  5C5K A;  1TD5 A;  2B95 A;  2FH5 A;  3A3I A;  2K31 A;  4CQH A;  4DXC A;  3CMZ A;  4H6J B;  1K56 A;  3NI9 A;  1XP4 A;  2R9X A;  4KZA A;  4RX3 A;  2ZM2 A;  4U3T A;  5DTT A;  5FI6 A;  4EUV A;  4JF4 A;  2UWX A;  5FQ9 A;  3E2L A;  3MF0 A;  3F1O A;  5BOH A;  3JPU A;  2VGL M;  5A91 A;  4EUZ A;  4DE0 A;  2WKH A;  3KSG A;  1J3W A;  2JKR I;  1M40 A;  1BUL A;  3LIA A;  2Y2J A;  5GHX A;  3HL9 A;  4GDN A;  2Y2P A;  4DE1 A;  2XQZ A;  3HBR A;  1KGG A;  4PPR A;  1S4S A;  3G31 A;  2VLG A;  1UGU A;  3FKV A;  1CI9 A;  3UY6 A;  3VE3 A;  1JVJ A;  3ZG0 A;  3C5A A;  1CF0 A;  4NET A;  2QYB A;  3SOI A;  4LEN A;  1LSW A;  5EOO A;  4JGR A;  1ES4 A;  4Q0J A;  3E4P A;  3L9K A;  2G7U A;  3UB8 A;  4S2N A;  1GHM A;  4X55 A;  1U60 A;  5EPH A;  3BM6 A;  4H6J A;  3OPP A;  5E43 A;  2IA2 A;  4WBG A;  4OP5 A;  2LB5 A;  5F1F A;  3BFE A;  2WKI A;  3CIT A;  1ZG4 A;  3HVF A;  4KG6 A;  1NYY A;  2G2W A;  5HFO A;  1TS0 A;  3T12 B;  2ZMV A;  1AWI A;  1ZC2 A;  3G6O A;  1FSW A;  5HSQ A;  5A90 A;  4BL3 A;  3LO7 A;  3O5Y A;  5DJU A;  5L07 A;  4E3M A;  1EW0 A;  2HGV A;  1BT5 A;  3Q07 A;  1D1J A;  2WZX A;  1DJA A;  3UPO A;  3G2Z A;  3PYP A;  5GLC A;  3GVB A;  2INW A;  2R78 A;  4EQ1 A;  1G5U A;  1H8Y A;  4BBU A;  2XRN A;  5GLA A;  1K55 A;  4II7 A;  1GSW A;  1SKO B;  2XFT A;  2L0W A;  4EXO A;  1GA0 A;  1YMS A;  3T4L A;  1K56 D;  3D3O A;  4OON A;  1K4F A;  3C8C A;  4GLQ A;  3C30 A;  3ZG5 A;  3U4L P;  3E98 A;  3WRZ A;  1ALQ A;  3GMW A;  3A0V A;  1YAX A;  4EET B;  2H5S A;  5KZH A;  2VX8 A;  4ZBE A;  5M18 A;  3G2Y A;  1V9Y A;  5HAI A;  4MN5 A;  1F98 A;  3ZHH A;  3ZVT A;  3NCK A;  3TOI A;  3T4J A;  4LFU A;  1MY8 A;  3F1N B;  1K4E A;  3ISG A;  4X69 A;  4QU3 A;  4AFI A;  3NOP C;  1DP6 A;  3KYQ A;  3ZVW A;  2ZQ7 A;  1L0E A;  1RGZ A;  2PYR A;  5F69 A;  4Y0O A;  3I7J A;  5E2H A;  4EU0 A;  2EX2 A;  5CED A;  1ERM A;  1SKO A;  1GHI A;  1L0G A;  1WA9 A;  1FQG A;  4N92 A;  2VZW A;  4NEE D;  2QKP A;  5EUA A;  1MC0 A;  4CLC E;  2XD5 A;  3A3F A;  3LIE A;  5AQB A;  3MMH A;  4G3K A;  3VP2 A;  2E8J A;  4OP8 A;  5CER A;  1FCN A;  1LT0 A;  4G3W A;  5I5L A;  5K5B A;  3ZG7 B;  4KG2 A;  4S2P A;  5E2F A;  2XD1 A;  3IF6 C;  3A3E A;  4Y2F A;  2IWC A;  5HAR A;  3FPV A;  2O9C A;  3MS6 A;  1W79 A;  5D3O A;  3C4O A;  1FR6 A;  4I5S A;  4OPY A;  3UDX A;  2Z6D A;  5CGX A;  3WS0 A;  3T1X A;  3M6B A;  3LFV A;  2A3U A;  3B42 A;  1WYB A;  3VOY A;  4DE2 A;  1XA1 A;  4EES A;  1IKI A;  3F1N A;  4X53 A;  3A3J A;  3T4K A;  3WS4 A;  4GD6 A;  2ZC6 B;  4KQQ A;  2ZOI A;  2DNS A;  2XEP A;  2PRF A;  1HVB A;  3HJI A;  3N7W A;  4P87 A;  4IHQ A;  2WGI A;  1FIL A;  3PXP A;  5JYP A;  4N9L A;  4QHC A;  4HH3 A;  3NUL A;  5GHZ A;  1NZO A;  4IBR A;  3HRE A;  2Y2O A;  4L9G A;  3DTK A;  3Q7Z A;  1IYP A;  2DCF A;  3UE6 A;  2P74 A;  4BBT A;  2V2F F;  1YLZ A;  2XSS A;  1Q2Q A;  2V0U A;  2OLV A;  4QJG A;  1HD8 A;  4DDY A;  3TW8 A;  2PT7 A;  1OTB A;  3QP5 A;  1Y4O A;  3OCN A;  4LLO B;  3NJA A;  1LL8 A;  3VFF A;  1O07 A;  4E3J A;  4XT2 B;  2GJ3 A;  1PWG A;  2HDQ A;  4QWO A;  1OTI A;  4S2J A;  1Y54 A;  1WE4 A;  3G32 A;  3H7W B;  3EGD C;  3BFD A;  4JGQ A;  1YT4 A;  4X25 A;  4IJG A;  2PR5 A;  3HUN A;  1N9O A;  4K91 A;  2XA7 M;  1W63 M;  1MBL A;  3ULF A;  3BWL A;  2W3H A;  3FPW A;  3IWI A;  4I3I A;  3AGD A;  5DTS A;  1CEG A;  4BMW A;  3LI8 A;  5AVE A;  3R7W B;  1ODV A;  2JKF A;  5EOE A;  2PU4 A;  3MFX A;  3V3S A;  3CUE C;  3DAV A;  4JXG A;  3VMA A;  2EXA A;  4LCL A;  4U0X A;  3S7P A;  4KZ9 A;  5EVI C;  3LR5 A;  1SDE A;  3TJZ C;  1NWZ A;  4MN7 A;  1JNU A;  1QMF A;  1XJ6 A;  2XGN A;  4BJP A;  2EWV A;  3O86 A;  4XT2 A;  1YLP A;  4CLC B;  2OWH A;  4OQ0 A;  3PHY A;  4E3N A;  3H7W A;  4HES A;  1PW8 A;  1P9W A;  3IHB A;  1M6K A;  4C3Q A;  2ZQ9 A;  3UPN A;  3BEC A;  1MZU A;  1P0Z A;  3KYZ A;  3DWZ A;  4HIA A;  1H8M A;  2ZQA A;  4JBF A;  4LV2 A;  2ZMA A;  4OVD A;  1X0O A;  1ESU A;  4UEY A;  4QY5 A;  4YNR A;  2JN7 A;  3V39 A;  3E2K A;  3NBL A;  3LI9 A;  2PYP A;  1YMX A;  2WK0 A;  2R9W A;  1NYM A;  5J3W A;  4WYY A;  3KO6 A;  2ZC4 B;  5FAT A;  4JKT A;  5KSC A;  3UE1 A;  3RXX A;  3F1P B;  4PM5 A;  4KZ8 A;  3R7W A;  3FWL A;  3VV4 A;  2J80 A;  4LV0 A;  1IEM A;  3ITA A;  3C38 A;  4ME4 A;  3IF5 A;  1YLJ A;  1D7E A;  3RH8 B;  2QHK A;  2RCX A;  4FH4 A;  4HQA A;  4JF6 A;  4RQ9 A;  4CLC A;  4ZRR A;  1STZ A;  3CZD A;  5FQM A;  2QJ5 A;  3NY4 A;  1XJ2 A;  5CX7 A;  3GQZ A;  3T50 A;  3G30 A;  1H0M A;  5MC7 A;  3QP4 A;  3BYD A;  1LL9 A;  2PBY A;  4Q8I A;  4GZB A;  2VV7 A;  3N4I A;  2FZ0 A;  2KOI A;  2VGL S;  1KVL A;  1VQQ A;  2NUT C;  2HDR A;  2WYX A;  2EXB A;  2XRO A;  3IH8 A;  3WS1 A;  1NZU A;  3BY9 A;  2Y2I A;  2XFS A;  4F94 A;  2MJ6 A;  4R38 A;  3F1P A;  4H8R A;  3PTE A;  2JKG A;  4S2O A;  1JTG A;  1HTZ A;  3IXD A;  3S7N A;  1S66 L;  3OBF A;  2ZMF A;  2WKR A;  1K25 A;  2JCH A;  5FEF A;  1YSP A;  2L4R A;  3VP0 A;  4ZJ3 A;  1W63 Q;  1YQS A;  5HWW A;  3MXR A;  2ZL1 A;  5GHY A;  3K3C A;  5F6A A;  1KE4 A;  1BZA A;  3P09 A;  3CLO A;  3IT9 A;  1T1C A;  3TSG A;  4KG5 A;  1BUE A;  2WZZ A;  4Q0I A;  3WWX A;  1V9Z A;  4ETZ A;  4FSF A;  1XJ4 A;  1BLH A;  4F3L A;  4X6T A;  3LID A;  5A92 A;  2W3E A;  3SS4 A;  4GNU A;  4WZ4 A;  1CI8 A;  2OWJ A;  4HP9 A;  1CQA A;  4MBF A;  4HJ4 A;  1TEM A;  3FC7 A;  2JKT M;  2Y2K A;  5CTN A;  4Y0T A;  4HBT A;  4L9F A;  2HPB A;  3Q81 A;  2Y2N A;  4WEL A;  1G6O A;  3VFH A;  3CPT B;  2VEA A;  5M19 A;  2C5W B;  4UQI M;  4E6X A;  1KOU A;  5IU1 A;  4KZ7 A;  3EQV A;  3LEZ A;  3EQU A;  1TVF A;  2W3D A;  2V8C A;  3C2W A;  4EEP A;  4S2I A;  2Q0O A;  1SDN A;  3N6I A;  1ES3 A;  4GCZ A;  2VA0 A;  3CG5 A;  4CLC D;  4BL2 A;  4E04 A;  4KZB A;  3HLG A;  2W0N A;  1G28 A;  4WLA A;  1P9R A;  4KEN B;  4OQH A;  4S2N C;  1MWT A;  1SZV A;  3OLO A;  4UAA A;  3LIF A;  5A8B A;  2B02 A;  5KIZ A;  5CXW A;  2XR0 A;  5L2F A;  3GR2 A;  4GS9 B;  3MKF A;  1PZP A;  3IHA A;  5G18 A;  3OPH A;  1CEF A;  3VP4 A;  2ZQ8 A;  5F82 A;  1I2S A;  2Y2H A;  3CPT A;  4OLD A;  4YOF A;  4NG2 A;  2Y91 A;  4G3V A;  2J3T D;  5F1G A;  2GDN A;  1PYY A;  1JTD A;  3UPP A;  4OQI A;  2WKE A;  2X02 A;  4X56 A;  5LBR A;  3D4F A;  3MSH A;  3LY4 A;  4P0M A;  1EI5 A;  2H0T A;  2HDS A;  2HJE A;  1YLW A;  1IEL A;  4E3L A;  1F2K A;  1FOF A;  3HLE A;  1MXO A;  1UWP X;  2Y2Q A;  4R70 A;  5HW3 A;  4DF6 A;  4LV1 A;  1OT6 A;  3WS5 A;  3O3V A;  2Y59 A;  3IF6 B;  3HUM A;  3SH7 A;  2QJ7 A;  2IWD A;  2WGV A;  3MZF A;  1TS7 A;  4MCW A;  4JLF A;  2UV0 E;  3EEA A;  4GS9 A;  5FEG A;  4P6Z M;  3LIC A;  2W1T B;  3Q1F A;  3L7H A;  3UB6 A;  4IBX A;  5F5Y A;  4BD1 A;  2HP5 A;  1CJF A;  1YM1 A;  4ZJ2 A;  3UE0 A;  3UB5 P;  4I38 A;  4OQG A;  2M1C A;  4FOF A;  2VGJ A;  1LI9 A;  2QZ6 A;  4HP4 A;  5L8M A;  5IT5 A;  4DJ3 A;  1F5M A;  2LB9 A;  4Q0H A;  1DY6 A;  5DFX A;  3IX8 A;  2PBD P;  2WAD A;  4UA6 A;  2KDK A;  1L0D A;  4EQI A;  2OV5 A;  1TS8 A;  4S2L A;  4XXR A;  1PI4 A;  4HEF A;  3IBJ A;  2VJW A;  2VKS A;  1PW1 A;  4EV4 A;  1W8Q A;  2G2U A;  3IF6 A;  3NC8 A;  4U0T A;  1G6A A;  3EEH A;  4EER A;  4HH2 A;  3PBS A;  3TG9 A;  1S6R A;  3AGF A;  3NIA A;  3BLS A;  3MZE A;  5EFW A;  5U47 A;  1S1Y A;  4B9O A;  1W5D A;  2W1T A;  5GLB A;  3KYE A;  2V1Z A;  4IUH A;  5FL3 A;  1XGI A;  1PIO A;  4B88 A;  3MFD A;  2K7S A;  3RFB A;  3IQA A;  3IBR A;  2XH9 A;  4Y7P A;  5CHU A;  3OZH A;  3PBO A;  2BTF P;  1XX2 A;  3ZNT A;  5DTK A;  5FQK A;  3FG8 A;  4GW9 A;  4PAU A;  2XA7 S;  1BSG A;  2O9B A;  1FSY A;  1S67 L;  3TRC A;  1FIK A;  1Z09 A;  4IVI A;  4KQD A;  1TS6 A;  4Y5F A;  1KGE A;  2D02 A;  4LGW A;  4ESP A;  3FZC A;  2EX8 A;  1LSV A;  4M4X A;  2ZOH A;  3AGE A;  3BQA A;  4EWF A;  1IYS A;  2DRW A;  5FA7 A;  1NRJ A;  2VK3 A;  3C7U A;  4X1M A;  2JE5 A;  3PAG A;  4X1L A;  2V1A A;  2O0Y A;  3QP8 A;  1E4D A;  2Y8H A;  2O9A A;  3K2N A;  3HJK A;  3ZCZ A;  1IOU A;  1YLT A;  3DTI A;  2Z2M B;  2ACG A;  4O8G A;  1L0F A;  4DRT A;  3O87 A;  3PR6 A;  2W3F A;  4RVA A;  3SH8 A;  4I3J A;  5L09 A;  4FUW A;  4NXE A;  1E25 A;  4BQM A;  1GCE A;  4DDS A;  4KZ6 A;  1K57 A;  3IXB A;  3T4O A;  4R3A A;  3OC2 A;  2ZLY A;  2C6W B;  5FSR A;  1GA9 A;  3SS3 A;  1VET B;  5J8X A;  3LCE A;  3ZYT A;  2J9O A;  3CUE A;  1G68 A;  1MWS A;  1XJ3 A;  3NEC A;  1GHP A;  2OLU A;  3ICY A;  1IKG A;  2WGW B;  1YLY A;  5EV0 A;  4RX2 A;  2Y2M A;  5HPI A;  2PU2 A;  1KE3 A;  1OTE A;  1XPB A;  1VEU B;  3G4P A;  5CEB A;  3Q82 A;  1K6R A;  1LSX A;  1VHM A;  4PKY A;  2WUQ A;  2YKH A;  3NDG A;  1SKF A;  3HUO A;  4NXF A;  3T1Q B;  3FKW A;  3SS5 A;  1BLP A;  3N8L A;  1RGY A;  4EW7 A;  4MEZ A;  2ZM8 A;  5AJG A;  3N8R A;  2JKT I;  5HL1 A;  4WEK A;  1K54 A;  3QHY A;  1YPR A;  2Y79 A;  4HBU A;  2EX6 A;  1XA7 A;  4WZ5 C;  5E2E A;  1RP5 A;  2QPN A;  1EWZ A;  3BJN A;  3BY8 A;  5HDC A;  3LUQ A;  1HZO A;  2B5R A;  1PNE A;  1KVM A;  1MPL A;  3CWF A;  2PD8 A;  4R6L A;  4HHD A;  3S4X A;  2WGW A;  1ZHH B;  1Y28 A;  2V8F A;  2RL3 A;  3SH9 A;  5EEC A;  2W27 A;  4FH2 A;  2CC1 A;  1W8Y A;  3E0Y A;  1VEU A;  4OOM A;  5CTM A;  1OTD A;  4Y13 A;  3MXS A;  3A0R A;  1UWN X;  2OAQ 1;  5TR7 A;  2V1B A;  5FAS A;  2YKF A;  3C7V A;  2A49 A;  2HDU A;  1L3L A;  2OOL A;  4L9E A;  4LPZ A;  1K6S A;  4NKP A;  4DMZ A;  4KZ4 A;  1LI0 A;  1MWU A;  1F9I A;  3N8S A;  4CLC C;  3HLW A;  4ID4 A;  4R1G A;  1OPX A;  3PAE A;  4JXS A;  2D01 A;  3UDF A;  5FAQ A;  3G34 A;  3GV9 A;  4OOY A;  4I39 A;  4C6Y A;  5CGS A;  3DW0 A;  4WF0 A;  2E8I A;  4WUJ A;  2ZJ9 A;  4S2K A;  3IXH A;  3V67 A;  2HV1 A;  3IWO A;  4B4X A;  1I5Q A;  4JF5 A;  4ETX A;  1NLY A;  3VOZ A;  2IWB A;  1C3B A;  4LRX C;  4R23 A;  1T18 A;  4UQI S;  5DF7 A;  4B93 A;  2W1R A;  1T19 A;  4K08 A;  3JYI A;  1H8Z A;  1AXB A;  2J3T C;  2XDM A;  3LR3 A;  1OJG A;  2J3W A;  5G4Y A;  4R3J A;  4LV3 A;  2EFU A;  4RYE A;  2WKQ A;  2HZ5 A;  3B3X A;  3KSF A;  4QD4 A;  2HP6 A;  2W3G A;  4HNB A;  4GKU A;  3UB7 A;  4A5R A;  4BEN A;  3UO9 A;  1I2W A;  4YIN A;  2VGK A;  1KE0 A;  4N1X A;  4O01 A;  4EEU A;  4O7D A;  4EBL A;  3B47 A;  3LYX A;  5KMW A;  4HI4 A;  4MDZ A;  1ES2 A;  2AVX A;  4PM6 A;  1DJC A;  3IX4 A;  5HAQ A;  3PBN A;  3K3D A;  3LEQ A;  3MQO A;  3PBR A;  1OME A;  3MQQ A;  4XUX A;  1ZG6 A;  3SZT A;  1W7F A;  2ZQD A;  4IVK A;  3T4S A;  1MWR A;  3W2Z A;  5FDH A;  3MJQ A;  2HF6 A;  3HLB A;  3GTC A;  1VB6 A;  3M2J A;  4N9K A;  3CAX A;  3MXQ A;  4FD8 A;  4GDB A;  5DFY A;  2NUP C;  1JWZ A;  4XUZ A;  1VM1 A;  2XLN A;  1LLB A;  1WYC A;  2H10 A;  1JWP A;  2CMN A;  1TDG A;  3QNB A;  3CI6 A;  2OSU A;  5DVA A;  3A0S A;  5JYO A;  3QNC A;  2ZD8 A;  1RCJ A;  1KDW A;  5EVL A;  1XFN A;  4R4R A;  3R4K A;  4WL9 A;  3ZQ5 A;  1S1Z A;  4P6Z S;  4UHU A;  2H0Y A;  2ZBB A;  1ZTU A;  4MMN A;  2J9P A;  4OPZ A;  3RXW A;  3S22 A;  2M7U A;  2QWS A;  4RA7 A;  3LGO A;  2VV8 A;  1MKM A;  4WN5 A;  5DF8 A;  2FFY A;  2Y2L A;  4MBK A;  5DKL A;  4HJ6 A;  2WKP A;  5FQJ A;  4E3O A;  2DMW A;  3JVV A;  5HD3 A;  4P6B A;  3ZGA B;  3V50 A;  1N9N A;  1PI5 A;  2QMI A;  4Y15 A;  4OPQ A;  2WAE A;  5HDD A;  1KDS A;  4JGP A;  5GL9 A;  3BW6 A;  3T4T A;  2A24 B;  1TF1 A;  3T1S A;  3GRJ A;  4PM8 A;  3W4O A;  1K55 C;  1NJ4 A;  1ERQ A;  1FR1 A;  5F68 A;  3Q7V B;  3KX0 X;  2ZC3 B;  3MKE A;  3UE3 A;  3B33 A;  3UDI A;  1BLS A;  5HAP A;  4KUK A;  3P7N A;  4QPR A;  5L10 A;  2PR6 A;  4ARZ B;  3MR0 A;  4KQO A;  5FQQ A;  4LCM A;  4NK3 A;  4GHI B;  4PM9 A;  1IYQ A;  1DP8 A;  5FAP A;  2B18 A;  5HPF A;  4BLM A;  4B4Z A;  2BAS A;  5KSH A;  3UN7 A;  3P98 A;  4OLG A;  3NDE A;  4GOG A;  2EX9 A;  3VOL A;  4NXB A;  4LRY C;  4JGO A;  1J9M A;  5FDS A;  3IWQ A;  4WMC A;  3CHW P;  2JKR M;  1BYW A;  1S4R A;  5FAO A;  4MNR A;  3OPL A;  5EVE A;  2HP9 A;  2I72 A;  5EM1 A;  4Z9Q A;  1OTA A;  5AVF A;  3D72 A;  1S0W A;  4MLL A;  1H3Q A;  5HZH A;  4PM7 A;  4YWZ A;  4BBV A;  1XFQ A;  1BTL A;  1NXY A;  1JWV A;  2A24 A;  3WS2 A;  2Q9M A;  1MKI A;  3O88 A;  4FTX A;  4R4S A;  5J7E A;  4GN2 A;  1YKD A;  1H5X A;  3P01 A;  3GDI A;  1Q2P A;  2HJ9 C;  3Q7V A;  1OJ5 A;  5FI2 A;  3IX3 A;  2V9A A;  3PBQ A;  1ZKJ A;  4KZ5 A;  3OOV A;  5EM0 A;  1OT9 A;  5IS1 A;  4PKY G;  1ONG A;  4ZDX A;  3G35 A;  2JBF A;  4DKI A;  4ARZ A;  4NXG A;  4DJ2 A;  1A0K A;  2KX6 A;  3NHQ A;  1YSQ A;  1Z6F A;  4ZJ1 A;  3BEB A;  1DP9 A;  4GHI A;  3T1R A;  2PHY A;  5A93 A;  4E3K A; 
#chains in the Genus database with same CATH homology
 4L0L A;  1D06 A;  2I9V A;  3S7N A;  1S66 L;  3OBF A;  1LSX A;  1VHM A;  4PKY A;  2GX5 A;  2ZMF A;  2WKR A;  2KLI A;  5TBM B;  2YKH A;  5HL6 A;  1YSP A;  2L4R A;  4NXF A;  1W63 Q;  3PYP A;  5HWV A;  5HWW A;  3EWK A;  2INW A;  2R78 A;  4EQ1 A;  4EW7 A;  4O0P A;  5AJG A;  3K3C A;  1T1B A;  2JKT I;  5F6A A;  4BBU A;  4HJ3 A;  2XRN A;  4WEK A;  3CLO A;  4II7 A;  1GSW A;  1T1C A;  2L0W A;  4EXO A;  2Y79 A;  4Q0I A;  1V9Z A;  4ETZ A;  4HY8 A;  3T4L A;  3HCY A;  2L1M A;  4FSF A;  2VV6 A;  1XJ4 A;  3BJN A;  3BY8 A;  4F3L A;  3D3O A;  3LID A;  5HDC A;  2W3E A;  3LR0 A;  3LUQ A;  3C8C A;  4GLQ A;  2P04 A;  3C30 A;  4HOI A;  2OWJ A;  3CWF A;  4HP9 A;  2PD8 A;  4HJ4 A;  3E4Q A;  3E98 A;  3FC7 A;  2JKT M;  4R6L A;  3TE8 A;  4L9F A;  4HHD A;  4WEL A;  3A0V A;  1YAX A;  2GNX A;  4EET B;  3DBA A;  3IS2 B;  1G6O A;  4IUK A;  1ZHH B;  1Y28 A;  2VX8 A;  2VEA A;  3VE4 A;  1V9Y A;  2W27 A;  3BQ8 A;  4UQI M;  4MN5 A;  1KOU A;  1F98 A;  3E0Y A;  4OOM A;  5IU1 A;  1OTD A;  3UB9 A;  3T4J A;  4PHT A;  3A0R A;  3EQV A;  3EQU A;  2EA9 A;  2W3D A;  1UWN X;  3F1N B;  2OAQ 1;  5TBM A;  1GSX A;  3EOI A;  3C2W A;  2V1B A;  4EEP A;  4AFI A;  3NOP C;  3UMD A;  4DN0 A;  2YKF A;  1DP6 A;  3KYQ A;  5HWT A;  1DRM A;  2OOL A;  2PYR A;  3KSH A;  4L9E A;  4LPZ A;  2A2L A;  4NKP A;  5F69 A;  4GCZ A;  2VA0 A;  4DMZ A;  4CLC D;  4EU0 A;  4E04 A;  1F9I A;  4CLC C;  1NLZ A;  2W0N A;  1OPX A;  1G28 A;  3NOT C;  4LRZ E;  4BWI A;  1WA9 A;  2VZW A;  4NEE D;  2D01 A;  2QKP A;  4WLA A;  1P9R A;  2H28 A;  1IFQ A;  1MC0 A;  4I39 A;  4CLC E;  3LIE A;  4WF0 A;  3MMH A;  4G3K A;  3OLO A;  4WUJ A;  3LIF A;  2M7V A;  3H82 B;  5A8B A;  2B02 A;  5KIZ A;  1LT0 A;  4G3W A;  3V67 A;  5I5L A;  2HV1 A;  5K5B A;  1N9L A;  4ETX A;  1NLY A;  4GS9 B;  4Y2F A;  4LRX C;  3FPV A;  1T18 A;  2PD7 A;  3LR4 A;  4UQI S;  2O9C A;  3IS2 A;  4B93 A;  4I5S A;  2W1R A;  1T19 A;  4K08 A;  1T1A A;  2Z6D A;  4YOF A;  4G3V A;  2J3T D;  5HD5 A;  3LFV A;  2J3T C;  3B42 A;  3LR3 A;  1OJG A;  2J3W A;  5G4Y A;  5HDS A;  4EES A;  3F1N A;  2WKQ A;  5LBR A;  3KSF A;  3T4K A;  2P08 A;  2W3G A;  2ZOI A;  4I3A A;  4Y3I A;  4OOL A;  4GJ4 A;  4HNB A;  3HJI A;  3UB7 A;  4IHQ A;  2HJE A;  2O99 A;  3PXP A;  1UWP X;  4R70 A;  4HH3 A;  3UME A;  3RTY A;  1OT6 A;  5DJT A;  4L9G A;  2JHE A;  4O01 A;  4EEU A;  2QJ7 A;  3U2A A;  2GZA A;  3B47 A;  3H82 A;  3LYX A;  3UE6 A;  1TS7 A;  4BBT A;  4MCW A;  4HI4 A;  2XSS A;  2V0U A;  3S7O A;  4MDZ A;  3TW8 A;  2PT7 A;  3EEA A;  5DKK A;  4GS9 A;  4KUO A;  1OTB A;  4P6Z M;  3LIC A;  2W1T B;  3LIB A;  3OCN A;  3PBN A;  3K3D A;  4LLO B;  3UB6 A;  5F5Y A;  3E4O A;  3MQO A;  3NJA A;  1LL8 A;  3JVU A;  2Z6C A;  3PBR A;  3T4Q A;  4I38 A;  3MQQ A;  2V0W A;  4XT2 B;  2GJ3 A;  2M1C A;  5G4Z A;  4FOF A;  4Z1W A;  3SW1 A;  3T4S A;  3W2Z A;  1OTI A;  4HP4 A;  5L8M A;  3MJQ A;  5IT5 A;  2HF6 A;  3H7W B;  4DJ3 A;  2P7J A;  1F5M A;  3EGD C;  2LB9 A;  4JGQ A;  4Q0H A;  1VB6 A;  3EGX C;  5DFX A;  2K2N A;  2OAP 1;  4IJG A;  3CAX A;  3MXQ A;  2PR5 A;  1N9O A;  2KDK A;  2XA7 M;  3MQ0 A;  1W63 M;  3ULF A;  5DFY A;  3BWL A;  2NUP C;  2W3H A;  3FPW A;  1TS8 A;  4I3I A;  3IBJ A;  2VJW A;  2VKS A;  2CMN A;  5DF9 A;  3CI6 A;  3F1O B;  3PBT A;  3GEC A;  4BMW A;  3LI8 A;  4WEJ A;  3A0S A;  5AVE A;  3H9W A;  4F3L B;  3EEH A;  4EER A;  1XFN A;  3R4K A;  4HH2 A;  3NOU C;  1P97 A;  4WL9 A;  1S1Z A;  3PBS A;  4P6Z S;  3ZQ5 A;  3OCL A;  3R7W B;  2ZBB A;  1ODV A;  1ZTU A;  3KSI A;  4MMN A;  3MFX A;  4MN6 A;  3CUE C;  2EWW A;  5EFW A;  2M7U A;  2QWS A;  1S1Y A;  4B9O A;  5TJJ A;  2VV8 A;  1MKM A;  4WN5 A;  2W1T A;  5DKL A;  3S7Q A;  4HJ6 A;  4IUH A;  5FL3 A;  3S7P A;  3LR5 A;  2WKP A;  2K7S A;  3RFB A;  3TJZ C;  3IBR A;  1NWZ A;  4MN7 A;  1JNU A;  2DMW A;  1XJ6 A;  4BJP A;  2EWV A;  3JVV A;  5HD3 A;  3PBO A;  4XT2 A;  4CLC B;  2PDR A;  2OWH A;  3FG8 A;  1N9N A;  4GW9 A;  5J4E A;  4PAU A;  1GSV A;  5C5K A;  3PHY A;  1TD5 A;  3H7W A;  2XA7 S;  1P9W A;  5HDD A;  2FH5 A;  1MZU A;  1P0Z A;  2K31 A;  2O9B A;  3KYZ A;  4JGP A;  4HIA A;  1H8M A;  4CQH A;  1S67 L;  3TRC A;  4H6J B;  3BW6 A;  3T4T A;  4KQD A;  1TS6 A;  1X0O A;  2A24 B;  1TF1 A;  4Y5F A;  2D02 A;  4EUV A;  4UEY A;  4YNR A;  2JN7 A;  5F68 A;  3LI9 A;  2PYP A;  3KX0 X;  5J3W A;  1LSV A;  3MF0 A;  3F1O A;  3UE3 A;  4M4X A;  3B33 A;  3KO6 A;  2VGL M;  2ZOH A;  3BQA A;  3KSG A;  2JKR I;  4KUK A;  3P7N A;  4QPR A;  3LIA A;  2PR6 A;  4ARZ B;  1NRJ A;  3F1P B;  3MR0 A;  4KQO A;  3R7W A;  4GHI B;  3VV4 A;  2J80 A;  1DP8 A;  2B18 A;  5HPF A;  2V1A A;  2BAS A;  2O0Y A;  5KSH A;  3C38 A;  3VOL A;  2Y8H A;  4ME4 A;  1S4S A;  2O9A A;  1D7E A;  2VLG A;  4NXB A;  1UGU A;  3K2N A;  4LRY C;  4JGO A;  3RH8 B;  2QHK A;  3HJK A;  1IOU A;  3VE3 A;  2JKR M;  1BYW A;  4HQA A;  1S4R A;  4RQ9 A;  4ZRR A;  4CLC A;  1STZ A;  2QYB A;  2QJ5 A;  1LSW A;  4JGR A;  1XJ2 A;  4O8G A;  5CX7 A;  4Q0J A;  3T50 A;  3PR6 A;  2W3F A;  3E4P A;  5MC7 A;  2G7U A;  3UB8 A;  1OTA A;  4I3J A;  5AVF A;  3D72 A;  4NXE A;  1H3Q A;  5HZH A;  4H6J A;  4YWZ A;  4BBV A;  1XFQ A;  2A24 A;  2VV7 A;  2IA2 A;  3T4O A;  4R3A A;  5J7E A;  2LB5 A;  1YKD A;  2FZ0 A;  2KOI A;  2VGL S;  3P01 A;  3CIT A;  3OC2 A;  3GDI A;  2HJ9 C;  1OJ5 A;  2NUT C;  2V9A A;  1TS0 A;  3PBQ A;  2XRO A;  2ZMV A;  3ZYT A;  3CUE A;  3OOV A;  3G6O A;  1OT9 A;  5IS1 A;  4PKY G;  1XJ3 A;  3BY9 A;  5HSQ A;  3ICY A;  2MJ6 A;  3O5Y A;  4R38 A;  4NXG A;  4ARZ A;  3F1P A;  4DJ2 A;  5DJU A;  2KX6 A;  3NHQ A;  1YSQ A;  5HPI A;  1DP9 A;  4GHI A;  2PHY A;  1EW0 A;  1OTE A;  2HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...