3ICYA

The crystal structure of sensory box histidine kinase/response regulator domain from chlorobium tepidum tls
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
SNAEELQALVDNIPAAIYHLDVSGQATIRFRPPAFLKTLVSEHAGTTRLNTLSMIHHDDRHMLSNAYSKLREAKHSLTLVYRIVTPEGKLHWIEDHMRSSFSDDGLFSGIDGILCEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Sensor protein
publication title The crystal structure of sensory box histidine kinase/response regulator domain from Chlorobium
rcsb
source organism Chlorobaculum tepidum
total genus 13
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3icyA00
3K3CA 1LSVA 1UGUA 3LIBA 1Y28A 2ZBBA 5HDCA 1EW0A 1S4RA 4WUJA 4KUOA 3UB7A 2QWSA 2QJ5A 3MJQA 4HH2A 2BASA 2PHYA 3ZQ5A 1XJ6A 3F1OA 3LIDA 3LUQA 3F1NA 1T1CA 4EXOA 4MN5A 3H7WA 3MQQA 2PDRA 4R3AA 2Z6DA 4GW9A 3VE4A 3G6OA 4YWZA 5DKKA 5G4YA 4EEPA 3HJKA 4EETB 4XT2A 2L0WA 2WKRA 4JGPA 4HNBA 1OJ5A 1UWPX 5J7EA 2I9VA 5HZHA 5DJUA 5F6AA 2K7SA 2KX6A 4HP4A 2QKPA 2GJ3A 2W0NA 3H82A 1VB6A 3RTYA 1OTEA 5J3WA 4GHIA 3IS2A 1T1AA 1GSVA 2VV7A 4EQ1A 1S4SA 5G4ZA 3MFXA 4KUKA 4I3AA 5AVEA 5TBMB 2H28A 3LI8A 3A0VA 2JN7A 3RH8B 1LT0A 2VLGA 3A0SA 4HOIA 3SW1A 2W27A 3A0RA 5I5LA 4F3LA 4HH3A 4HI4A 1GSWA 4HQAA 4PKYA 4GS9B 3VOLA 2V9AA 1OTDA 3FC7A 3MXQA 1DP6A 2PYRA 4HJ4A 3LYXA 3MR0A 1OT6A 4RQ9A 1WA9A 2EA9A 5HD3A 1MZUA 1TS0A 5HD5A 3PYPA 3BWLA 1OJGA 3CLOA 3ICYA 1F9IA 4EEUA 4BBVA 5F69A 2WKPA 3UMEA 3KX0X 4R6LA 1P97A 4WN5A 3UB6A 1XJ2A 3B33A 1X0OA 1OT9A 1JNUA 2VV8A 4LPZA 3UE6A 1OTBA 3UMDA 4HHDA 1LL8A 5HWWA 1P0ZA 1LSXA 2M1CA 2HV1A 4LRYC 3GDIA 4DJ3A 3P7NA 4LRZE 2INWA 5IS1A 3NOPC 3UB9A 4LLOB 2A24A 4H6JA 4L9FA 5J4EA 4NXGA 4L9GA 1N9NA 3C8CA 3F1PA 4I3JA 2V1BA 4EESA 4WL9A 1UWNX 5AVFA 1TS6A 1V9YA 2Z6CA 3CWFA 3F1OB 4HJ6A 4HY8A 2L1MA 5DJTA 3F1NB 1N9LA 3LI9A 2PD7A 1V9ZA 2V1AA 2KDKA 5EFWA 3H9WA 4MN6A 3H7WB 4WLAA 5HSQA 4JGRA 2OWJA 3NHQA 1NWZA 3LIFA 2YKFA 3T50A 5DKLA 1G28A 4I3IA 4EW7A 4XT2B 1XFNA 1GSXA 4I5SA 1XJ3A 1F98A 1S1ZA 5F68A 5HWTA 3CAXA 5HDDA 2D02A 2V0WA 2PYPA 3H82B 4B9OA 4I38A 2VV6A 3NOTC 4GHIB 3IS2B 3EEHA 3BY9A 2VEAA 3FG8A 2ZOIA 2WKQA 3E4QA 2J80A 2QJ7A 2ZOHA 5HWVA 3EWKA 1D06A 4BBTA 4M4XA 2B02A 2PR5A 3PHYA 1S66L 3IBRA 4F3LB 3VE3A 3GECA 5A8BA 1DP9A 5TBMA 1DP8A 1TS8A 5F5YA 2PD8A 2JHEA 4K08A 3HJIA 1T19A 1KOUA 3LIAA 1OTIA 4KQDA 3MQOA 1ODVA 1T18A 4I39A 4DJ2A 3UB8A 4R70A 1N9OA 4JGQA 4HJ3A 1XJ4A 4GS9A 5IU1A 4NXBA 2L4RA 2V0UA 2QHKA 3NOUC 4BBUA 4E04A 3E4OA 4NXEA 3D72A 3ULFA 1OTAA 1D7EA 4R38A 4HP9A 1BYWA 1S67L 1TS7A 1LSWA 1DRMA 3K3DA 5HDSA 4EERA 1S1YA 2CMNA 2P7JA 2OOLA 4PKYG 1T1BA 2OWHA 3OLOA 4JGOA 3LICA 3LIEA 4LRXC 3E4PA 4GCZA 3NJAA 4NXFA 2PR6A 4HIAA 2D01A 2A24B 1XFQA 4H6JB 2R78A 3BY8A 3F1PB 3C2WA 4WF0A 4L9EA 2YKHA 5KIZA
chains in the Genus database with same CATH superfamily
3K3CA 3RJUA 1Y28A 4Q0HA 1PW8A 3IH8A 2ZBBA 3ZNYA 2PT7A 4RYEA 1EW0A 3T4QA 4KUOA 4R23A 2V8FA 2WK0A 4FH2A 4PM5A 5D3OA 2QJ5A 2O9BA 3S7PA 1WYCA 5TJJA 1YMXA 2B5RA 3N4IA 4EBNA 3NIAA 3F1OA 2ZQDA 2XD1A 2UV0E 4Y15A 5FQQA 3LUQA 3KSGA 2P74A 1CI8A 5E43A 4KZ4A 2HJ9C 2WGIA 1ES4A 3BM6A 4MN5A 3NDEA 3VSLA 4X55A 1ONGA 3BRMA 4R3AA 4LCLA 1SDNA 3W4OA 1S6RA 2Z6DA 4GW9A 3OZHA 3C30A 5GHZA 4P6BA 2Y4AA 4Y5FA 5CTNA 1DJAA 2OV5A 2ZJ9A 2V1ZA 4OQGA 1GA9A 4JGPA 2OAP1 2ZQ9A 2W3HA 2CC1A 3MSHA 3HLGA 5HZHA 1F2KA 4EWFA 2Q9MA 2VX8A 3ITBA 4HP4A 2JKTM 3NBLA 4PM9A 1IYSA 4GZBA 2WGWA 4P0MA 1HTZA 4OPYA 4QWOA 3FPVA 3IS2A 1FSWA 1E25A 1G68A 2VV7A 3WS4A 3R7WA 4JPMA 3MFXA 2Q0OA 3IWQA 2NUPC 5C5KA 3OOVA 1E3UD 2VGLM 3LI8A 4U0XA 1CI9A 2XF3A 3OCLA 4OOYA 4D60A 1LT0A 5EUAA 5EECA 2ZD8A 4DXCA 3A0RA 4OONA 3FZCA 4F3LA 1NYYA 3S1YA 1BLPA 1XGJA 3A3EA 1NJ4A 4HI4A 4UA9A 5FA7A 2E8JA 2J3TD 3BLSA 5FQMA 3BYDA 4PKYA 2C5WB 1JTGA 3VOLA 4OOMA 2Z2LB 3C5AA 3Q7VB 3VP1A 1VEUA 3ZNTA 5BOHA 2OLUA 3GRJA 1DP6A 2OSUA 1FCNA 4HJ4A 3LR5A 3GV9A 1OT6A 4CJNA 1MZUA 4JKTA 1F9IA 4EEUA 2V2FF 2QMIA 3LGOA 3UMEA 3L7HA 3UE0A 2HZ5A 3PAEA 4R6LA 1P97A 3LR4A 4WN5A 2P9VB 1L0GA 2FFYA 2JKGA 1W63Q 2Y55A 4KG2A 2HJEA 1JVJA 3QHYA 1X0OA 1OT9A 4FTXA 5EVLA 2ZMFA 1MWRA 4E3JA 3T4TA 1CJFA 4LPZA 5A92A 1VQQA 1QMFA 5CEBA 2W3GA 1KE4A 2JC7A 1RP5A 3S22A 1LI9A 1LSXA 2VA0A 4OLGA 5DTTA 2ZMAA 4LRYC 1ONHA 4UEYA 4IUKA 3VFFA 2INWA 5IS1A 1YSQA 2O99A 4LLOB 4LCMA 2WUQA 1SCWA 3VOZA 4E3MA 3F1PA 4I3JA 5AVFA 1V9YA 3HLDA 1L0EA 1ES3A 3S4XA 4X53A 1L0FA 1JTDA 3N8SA 4ID4A 4CLCE 2L1MA 2PD7A 4D2OA 3HL9A 5EFWA 2Y2OA 1W5DA 3IQAA 4KZ3A 4ETZA 1H8MA 1K56D 1W63M 2WAFA 4GDBA 4BMWA 5CHUA 5EVID 4MMNA 3BQAA 5DKLA 3GTCA 2XD5A 1Y4OA 3DTEA 4EW7A 1WYBA 1RGZA 2JKRM 3V39A 3P01A 1FQGA 4MNRA 4I5SA 1XXMA 3UDFA 4DDSA 1NRFA 4M3KA 1YSPA 3T12B 3EEHA 2V20A 1DJBA 5EOEA 3DWKA 1KGFA 4ZJ3A 1YM1A 2ZOIA 4KENB 2WKQA 4LGWA 3CI6A 3MZEA 1FILA 2Y2LA 4P85A 3E0YA 4GLQA 4JXWA 4YINA 1ES5A 3EWKA 1L0DA 5EPHA 3SZTA 3C38A 1IOUA 3WWXA 4ZBEA 2XSSA 3PBTA 3U4LP 3ITAA 5EOOA 5F5YA 1DJCA 4UA7A 4K08A 4KQQA 1YAXA 3PAGA 3HJIA 4C75A 1T19A 1KOUA 1OTIA 4CLCC 4BD0A 2KLIA 1ERQA 4PHTA 3MQOA 3DTMA 4I39A 2XR0A 2EXBA 4R70A 2GNXA 2WKIA 4YOFA 1ZTUA 5IU1A 1QMEA 3PR6A 3Q7VA 4KQOA 1N9BA 5DF8A 2C6WB 3DBAA 1I5QA 1BULA 3NOUC 1E4DA 2MJ6A 2RCXA 4S2LA 3VV4A 4OP8A 4IJGA 1L2SA 4E04A 3E4OA 1XX2A 4E3OA 4EBPA 1NY0A 3ZGAB 3LEZA 1S67L 3CHWP 1LSWA 1TS7A 1MKMA 4S2IA 3SS3A 4OH0A 1S1YA 3KSHA 3C4OA 1LL5A 2EFXA 2ZQCA 1PZOA 1BSGA 2P9VA 5CRFA 4KZAA 3LEQA 4KZ8A 3E4PA 1KE3A 2XA7M 4EUVA 4L0LA 1KGGA 4NXFA 4A5RA 3UE1A 1KGEA 1VETB 2A24B 1XFQA 1FOFA 4QD4A 2R78A 1XA7A 4R3JA 4QY5A 2XH9A 3C2WA 1ES2A 5L2FA 4WF0A 3UNWA 1NLYA 3UE3A 3MMHA 4QU3A 2I72A 2IA2A 4ETXA 3NCKA 2JE5A 3AGDA 3O5YA 3T4OA 3IF6C 2EX8A 5M1AA 3O87A 3MJQA 4HH2A 1XA1A 2WZZA 2BASA 2PHYA 1ZKJA 5HAQA 3PBRA 4LV2A 4X1MA 4B88A 5EVEA 4EXOA 4Y0TA 1M40A 2Y2PA 5AQBA 3MZDA 3G34A 1K54A 3VE4A 1ALQA 4YWZA 3CUEC 2ZM0A 3T4SA 4DE0A 1P9RA 5F83A 2L0WA 3TOIA 1ZHHB 1NRJA 3QNBA 5F6AA 3IF5A 1YPRA 5EM0A 2W0NA 1VB6A 1YMSA 3RTYA 5EE8A 5TR7A 4ARZB 3QP8A 3GR2A 5E2EA 1GSVA 5TFQA 4DRTA 5G4ZA 2IWBA 3D9YA 2J3WA 2H28A 2BG1A 3VSKA 2JN7A 2VLGA 3RH8B 3G4PA 2W27A 4WYYA 2JCHA 3MF0A 3DAVA 3ZFZA 1PW1A 1ZG6A 4MN7A 1GA0A 1LHYA 4OVDA 3NDGA 3PTEA 4R0QA 4DF6A 3FKWA 3ZG7B 2XA7S 3VMAA 3FC7A 4EBLA 3MXQA 2JBFA 5FQ9A 2PBYA 4DMZA 3FYZA 2PYRA 4KG6A 3LYXA 3MBZA 4JBFA 5DFXA 4RQ9A 5HD5A 5M18A 4GOGA 4X1LA 5GLCA 3EGXC 2VJWA 5AJGA 2W3FA 2QZ6A 5KZHA 2WKPA 1PI4A 3MQ0A 4H8RA 4S2PA 5A91A 4CLCB 2HDQA 2M7UA 1SZVA 5DTKA 5DVAA 4DE2A 4WEJA 4IVIA 5HL1A 4PAUA 4ZJ1A 3UPOA 4E6WA 3ZCZA 1BTLA 1ERMA 3UMDA 1PWCA 1ESIA 3SH8A 1LL8A 1DY6A 2RL3A 3MZFA 2M1CA 2HV1A 3B3XA 4DJ3A 3MS6A 5FI2A 1XKZA 5DF7A 3M6HA 1VETA 2A24A 3T1SA 4L9GA 3C8CA 4QPRA 2ACGA 3OPHA 2GZAA 4X6TA 4N92A 3ZG0A 3VOYA 3HBRA 3G32A 3BQ8A 3Q81A 1YT4A 3RXWA 3HUNA 5JYPA 2AVXA 4KZ9A 5DJTA 3F1NB 3LI9A 1JWVA 1V9ZA 2KDKA 3FWLA 4K0WA 3O88A 3IBJA 3ZG9B 3GVBA 4MN6A 5CECA 3H7WB 2ZMVA 1FIKA 3NULA 5HSQA 2W3DA 2OWJA 2PRFA 3NHQA 4B4ZA 2HP9A 1BLCA 4XT2B 3GMWA 1GSXA 4MCWA 1XJ3A 4GDNA 3L9KA 3BEBA 5F68A 4UAAA 1FCMA 4EUZA 3IF6B 2V0WA 2PYPA 2W1RA 4I38A 4R3BA 1MWSA 3NOTC 1K4FA 4RX2A 4ZJ2A 3RXXA 4E3LA 2XFSA 1K57C 2Z2MB 4C6YA 4ZTKA 3ZVWA 1ESUA 3E4QA 2QYBA 3LR3A 4C3QA 1M6KA 4ARZA 4II7A 2QJ7A 5CHJA 1FSYA 3FKVA 3WS2A 3ZG8B 2B02A 2P08A 4Z9QA 3PHYA 1MWTA 3RFBA 3VE3A 3T1RA 1DP9A 1KDWA 1DP8A 3AGFA 2Y2HA 2PD8A 3G30A 4JXVA 2DCFA 3BJNA 4KQDA 1NZOA 5FAOA 1H3QA 2Y2GA 1ODVA 3BLMA 2E8IA 2XGNA 3G35A 3UB8A 4CPKA 1N9OA 2XDMA 2IWDA 4UA6A 5E2HA 4JLFA 2V0UA 5GHYA 2QHKA 2Y2KA 2PBDP 2A2LA 5F1GA 2ZQAA 5CEDA 2X71A 4XXRA 4IUHA 3D72A 1KVMA 4R38A 2EX9A 2LB5A 1K4EA 3OPRA 5HW3A 4S2KA 4WZ5C 4OLDA 2B95A 3P98A 4K0XA 3K3DA 2VGLS 4GB7A 2Y2JA 3HLFA 3CJMA 4GD8A 4LV0A 3UO9A 2XEPA 1PWGA 5HDSA 4EERA 5FSRA 3BFFA 3HUMA 2XQZA 4MDZA 2P7JA 3KYQA 4CLCA 5CGXA 4AFIA 3T4JA 1TF1A 1FR1A 3W4PA 5AQ7A 3OLOA 3CPTB 2Y79A 1MC0A 3SH7A 1IKIA 3IXBA 4S2NC 2PR6A 3LO7A 2D01A 2VGKA 4H6JB 2Y2MA 1OPXA 4O0PA 3W8KA 2BTFP 2YKHA 4UQIM 3N7WA 5M19A 1CEFA 3KYEA 4HBUA 2WGVA 2WZXA 2G7UA 1F5MA 5EM1A 4U3TA 2QWSA 3VP4A 2O0YA 4Q0JA 2ZLYA 3N8RA 1K55C 1XPBA 3JPUA 1W7FA 4RX3A 3IHBA 3TRCA 3F1NA 3LFVA 3SH9A 1CEGA 3QP2A 2V8CA 2EWVA 1CQAA 1MKIA 3H7WA 3HUOA 4Y0UA 1K25A 3G6OA 1A0KA 2J9OA 3GSGA 4WELA 1STZA 5DKKA 4MBKA 4EEPA 2DMWA 4ZDXA 3OC2A 3ZYTA 1MPLA 4JF4A 1BLHA 5HX9A 4XT2A 3MKFA 3VP2A 2WKRA 3Q07A 5L8MA 4HNBA 1OJ5A 1IFQA 4E3NA 5J7EA 3KSIA 2I9VA 5DJUA 3WS1A 4S2OA 2K7SA 3PBOA 3C4PA 3IF6A 4PM8A 5KSCA 4IVKA 1KE0A 1OTEA 4WEKA 2ZC5B 4P6ZM 1T1AA 3ZG5A 5FL3A 3ZDJA 4EQ1A 3PBSA 3T1XA 4DN0A 5TBMB 3K2NA 1H8ZA 2FH5A 4NEED 3CG5A 3A0VA 1NXYA 4EQIA 1I2SA 1IYPA 4HOIA 3UN7A 3WRZA 3V50A 3CUEA 4MLLA 5I5LA 3SS5A 2VKSA 3Q7ZA 4LV3A 5AQAA 4HH3A 5GLBA 1GSWA 2WKEA 4LFUA 4OOLA 5E2GA 1LLBA 2A3UA 4FCFA 2HGVA 4GS9B 2J3TC 5JYOA 1GHMA 2V9AA 3T4LA 4R4RA 1OTDA 1O7EA 4HESA 4DXBA 1Q2QA 4X69A 4NK3A 4XUZA 1GHIA 3CZDA 4DKIA 1YLTA 4E3KA 2Y59A 1KVLA 1W8QA 3O3VA 5CGSA 1WA9A 4UQIS 1TS0A 3PYPA 3BWLA 3UB5P 4JXGA 3ISGA 2G2WA 3ICYA 4GD6A 1SDEA 4BBVA 1YLYA 2H10A 2ZQ7A 2J9PA 2XRNA 4N1HA 3KX0X 4GNUA 2A49A 1EROA 3B33A 3UPNA 2Y91A 1K56A 4RA7A 1HLUP 2VV8A 3CMZA 1TDLA 5IHVA 1H0MA 5A90A 3UE6A 5CXWA 3KYZA 2XLNA 3UY6A 5HWWA 3CPTA 5FATA 1PIOA 3ZHHA 2HDRA 3M2KA 3P7NA 1BT5A 3BECA 4OQ0A 3NOPC 3OPPA 1WE4A 3UB9A 4H6JA 4L9FA 5J4EA 3R4KA 4NXGA 3I7JA 1N9NA 1G6AA 3S7OA 1U60A 2V1BA 4EESA 1TS6A 2HDSA 4MEZA 5TGFA 3NECA 2XROA 4O7DA 1H8YA 1D1JA 2ZC4B 5GLAA 3O86A 2V1AA 1MBLA 4IEDA 3G2ZA 4WM9A 3H9WA 4S2JA 1MXOA 4YNRA 4U0TA 4WLAA 4JGRA 4N9LA 5HAIA 1NWZA 4KZBA 3IXDA 3SOIA 3QP4A 3GQZA 1G28A 5EVIC 4Q8IA 4Y17A 1TD5A 3WRTA 3T4KA 3IXHA 4XUXA 1F98A 2W1TB 1S1ZA 4Y2FA 4Y7PA 5FAQA 2PAVP 4LV1A 3CAXA 5HDDA 2D02A 2DNSA 3H82B 3OBFA 3LY4A 3HLCA 2VV6A 4GHIB 4Q0IA 2FFFB 4YFMA 1YKDA 5CHMA 4R4SA 4IBXA 2Y2NA 5I94A 2J80A 4S2MA 3NC8A 2G2UA 4QY6A 4M4XA 4OPRA 2Y8HA 1S66L 4NKPA 4CQHA 5A8BA 5DF9A 5TBMA 3A3IA 2EFUA 4HEFA 4G3WA 3MKEA 4CLCD 2IWCA 2ZQ8A 3LIAA 4EV4A 4BJPA 2HP6A 3JVUA 3CITA 3WS5A 3A3DA 1T18A 3OPLA 1IKGA 4DJ2A 3TW8A 5G18A 2UWXA 3PBNA 4BL3A 2P04A 4JGQA 4KZ6A 4HJ3A 5FI7A 3E98A 4GS9A 3HVFA 3JYIA 1SKFA 4FUWA 2J8YA 1K57A 3EQVA 5KMWA 3FV7A 3HCYA 4NXEA 3ULFA 3QP1A 1OTAA 2H0TA 4Y13A 1EWZA 3DW0A 1NLZA 2H5SA 2X01A 3BFEA 4BL2A 3HLWA 3D3OA 2CMNA 3EOIA 1Z09A 2OOLA 4EU0A 3DWZA 4PPRA 3EEAA 4KG5A 1T1BA 1Z6FA 2J7VA 2OWHA 5FDSA 4JGOA 2M7VA 3LICA 2ZC6B 4LRXC 3U2AA 3IX4A 5MC7A 4OPQA 4B4XA 3EGDC 3NJAA 4WMCA 4N1XA 3D4FA 2PU4A 1MY8A 1TDGA 3VP3A 4PM6A 1K0KA 5KIZA 1LSVA 1UGUA 3LIBA 2VK3A 3Q1FA 5HDCA 1S4RA 4WZ5A 4WUJA 4OQHA 1IYQA 4ZAMA 3MFDA 4HBTA 3UB7A 1PNEA 2ZM2A 3QP6A 3ZQ5A 1XJ6A 3JVVA 4UHUA 4NG2A 5K5BA 4BLMA 3E2LA 3LIDA 3ZVTA 2BLSA 1FCOA 1T1CA 2QPNA 2X02A 2HDUA 3MQQA 2PDRA 4S2NA 2WADA 4O8GA 2GDNA 4MBFA 4GKUA 5G4YA 5HPIA 4E6XA 4FH4A 3HJKA 2FZ0A 2VGJA 4K91A 5FAPA 4EETB 5GLDA 1N4OA 5F1FA 1UWPX 2NUTC 2W1TA 1HD8A 1YLJA 4FSFA 1YLPA 2KX6A 4NETA 3BFGA 1XP4A 2QKPA 5GHXA 2GJ3A 3H82A 5E2FA 3UPPA 3IWOA 2W3EA 2EX6A 3DTIA 5J3WA 1L3LA 3BFCA 4GHIA 3V3SA 3PBQA 3LY3A 5DTSA 1K55A 1S4SA 4R1GA 3TSGA 4KUKA 4I3AA 5EVIB 5AVEA 4ZRRA 1YQSA 3IHAA 4Y0OA 1EI5A 2ZM8A 4FOFA 3C7VA 1RGYA 3A0SA 3SW1A 3TG9A 4BD1A 3OCNA 4DE3A 5F82A 4Y3IA 5CX7A 2H0YA 4PM7A 5CERA 1ACFA 4Z1WA 4HQAA 1J3WA 2B18A 3IH9A 1W8YA 4X56A 4ESPA 2R9XA 5HFOA 3HLBA 1Y54A 3MR0A 1PFLA 3W2ZA 2ZL1B 1OMEA 2EA9A 5LBRA 2O9CA 5HD3A 3P09A 5DFYA 5KSHA 1IEMA 1OJGA 4BENA 3VP0A 4RVAA 3CLOA 3AGEA 5J8XA 1E3UA 5F69A 1CF0A 4B93A 5FDHA 3E2KA 3IT9A 3V5MA 3V67A 1IYOA 3B42A 3UB6A 1XJ2A 1CK3A 1NYMA 3M2JA 1JNUA 1VM1A 2HF6A 3LCEA 3FPWA 1O07A 4X25A 2Q9NA 3IX8A 1TVFA 1SKOB 3KSFA 1OTBA 2K31A 1RCJA 2WKHA 4HHDA 2ZC3B 5AQ9A 1P0ZA 1YLWA 3Q82A 4G3VA 2JKTI 3GDIA 1PYYA 1K6RA 4LRZE 3A3FA 5L09A 3HREA 3A3JA 1ZC2A 3S7QA 5HPFA 5A93A 3VFHA 4WL9A 1UWNX 3W4QA 2HPBA 3IXGA 2Z6CA 3CWFA 3NY4A 5FQKA 3F1OB 4HJ6A 4HY8A 5U47A 5L10A 3LR0A 3BFDA 3TJZC 1AWIA 1N9LA 1Q2PA 3TE8A 1NZUA 4BQMA 2Y2IA 2K2NA 1TEMA 1VHMA 5FQJA 3S7NA 3HLEA 2EX2A 3N6IA 5FI6A 2LB9A 3LIFA 2YKFA 3T50A 2O9AA 1S0WA 4I3IA 2Y2QA 3G31A 1XFNA 1BUEA 4WZ4A 1LI0A 4JF5A 4DE1A 1AXBA 4FD8A 3WS0A 1G6OA 1XGIA 2DRWA 4MBHA 5HL6A 3NI9A 5HWTA 3UDXA 1IELA 2OLVA 1GHPA 4B9OA 2WYXA 2WGWB 1PRQA 2R9WA 3IS2B 2PU2A 5FEGA 4O01A 4E3IA 1PZPA 4GN2A 3BY9A 2VEAA 3FG8A 3R7WB 5CGWA 3KO6A 3C7UA 1MWUA 2ZOHA 5HWVA 1C3BA 4OKPA 1J9MA 1D06A 2KOIA 1HZOA 4BBTA 4QB8A 4G3KA 3QP5A 5FEFA 2PR5A 3V3RA 4QJGA 3BW6A 3IBRA 1P9WA 4F3LB 1BLSA 3GECA 5L07A 5EVIA 4X68A 1TS8A 5IT5A 3T1QB 4BWIA 1I2WA 2JHEA 3B47A 1G5UA 4QHCA 2XK1A 1K38A 1SHVA 4N9KA 1GCEA 1VEUB 4F94A 2EWWA 4PMAA 2GX5A 1JWPA 3MXRA 3DTKA 4OPZA 4OQIA 5HAPA 1PWDA 4LENA 1YLZA 1XJ4A 5FQIA 4WMCD 2ZC7A 4NXBA 4ME4A 3MXSA 2L4RA 4P87A 4P6ZS 3SS4A 5CTMA 4KZ5A 3N8LA 4BBUA 5FASA 1JWZA 4KQRA 2EXAA 1ZG4A 4JF6A 2XFTA 1HVBA 2ZL1A 1D7EA 3QNCA 2JKFA 4HP9A 1BYWA 4OP5A 5GL9A 1DRMA 1K6SA 2WAEA 1BZAA 1KDSA 3IWIA 3M6BA 4IHQA 2JKRI 2HP5A 4IBRA 3UDIA 2VZWA 4PKYG 1W79A 5EV0A 1LL9A 4DDYA 1H5XA 3G2YA 5HARA 3LIEA 3PXPA 2OAQ1 4GJ4A 4WBGA 4GCZA 1SKOA 4JXSA 3IX3A 1K54C 4HIAA 4KZ7A 3BY8A 1FR6A 3F1PB 3EQUA 4L9EA 1PI5A
chains in the Genus database with same CATH topology
3K3CA 1LSVA 1UGUA 2IA2A 3LIBA 1Y28A 4Q0HA 2ZBBA 2PT7A 4ETXA 5HDCA 1EW0A 1S4RA 4WUJA 3T4QA 2G7UA 3O5YA 4KUOA 3T4OA 1F5MA 3UB7A 2QWSA 2QJ5A 2O9BA 3S7PA 3MJQA 4HH2A 2O0YA 4Q0JA 5TJJA 2BASA 2PHYA 3ZQ5A 1XJ6A 3JVVA 3F1OA 5K5BA 3PBRA 3LIDA 3LUQA 3KSGA 3TRCA 3F1NA 2HJ9C 1T1CA 3LFVA 4EXOA 4MN5A 2EWVA 3H7WA 3MQQA 2PDRA 4R3AA 2Z6DA 4GW9A 3VE4A 3G6OA 3C30A 4O8GA 4YWZA 3CUEC 4WELA 3T4SA 1STZA 5DKKA 4Y5FA 5G4YA 4EEPA 2DMWA 5HPIA 1P9RA 3OC2A 3ZYTA 3HJKA 2FZ0A 4EETB 4XT2A 2L0WA 2WKRA 1ZHHB 4JGPA 2OAP1 5L8MA 4HNBA 1OJ5A 1IFQA 1UWPX 2NUTC 2W3HA 5J7EA 3KSIA 2I9VA 2W1TA 1NRJA 5DJUA 5F6AA 5HZHA 2VX8A 4FSFA 2K7SA 2KX6A 3PBOA 4HP4A 2JKTM 2QKPA 2GJ3A 2W0NA 3H82A 1VB6A 2W3EA 3RTYA 4ARZB 1OTEA 4WEKA 5J3WA 3FPVA 4GHIA 4P6ZM 3PBQA 3IS2A 1T1AA 1GSVA 5FL3A 2VV7A 4EQ1A 1S4SA 3R7WA 5G4ZA 3MFXA 3PBSA 2NUPC 4KUKA 2J3WA 4I3AA 4DN0A 5AVEA 5C5KA 5TBMB 3OOVA 4ZRRA 2H28A 3K2NA 2VGLM 3LI8A 3OCLA 2FH5A 4NEED 4FOFA 3A0VA 2JN7A 1LT0A 2VLGA 3RH8B 3A0SA 4HOIA 3SW1A 2W27A 3CUEA 3A0RA 5I5LA 3MF0A 4F3LA 3OCNA 2VKSA 4Y3IA 4MN7A 4HH3A 4HI4A 5CX7A 1GSWA 2J3TD 4OOLA 4Z1WA 4HQAA 4PKYA 2HGVA 4GS9B 2B18A 2J3TC 2XA7S 3VOLA 4OOMA 2V9AA 3T4LA 1OTDA 3FC7A 3MXQA 1DP6A 4DMZA 2PYRA 4HJ4A 3LYXA 5DFXA 3MR0A 3LR5A 3W2ZA 1OT6A 4RQ9A 1WA9A 4UQIS 2EA9A 5LBRA 2O9CA 5HD3A 1MZUA 1TS0A 5HD5A 3PYPA 3BWLA 5DFYA 5KSHA 1OJGA 3CLOA 3ICYA 1F9IA 4EEUA 3EGXC 2VJWA 5AJGA 4BBVA 2W3FA 5F69A 4B93A 2XRNA 2WKPA 3UMEA 3MQ0A 3UE3A 3V67A 4CLCB 3KX0X 3B42A 4R6LA 1P97A 3LR4A 4WN5A 3UB6A 1XJ2A 1W63Q 2M7UA 3B33A 2HJEA 1X0OA 1OT9A 1JNUA 2ZMFA 2HF6A 2VV8A 4WEJA 3FPWA 4PAUA 3T4TA 3KSFA 4LPZA 3UE6A 1OTBA 2K31A 3UMDA 3KYZA 4HHDA 1LL8A 2W3GA 5HWWA 1P0ZA 1LSXA 2VA0A 2M1CA 2HV1A 4LRYC 4G3VA 4UEYA 2JKTI 3GDIA 4DJ3A 4IUKA 3P7NA 4LRZE 2INWA 5IS1A 3NOPC 1YSQA 2O99A 3S7QA 4LLOB 3UB9A 2A24A 4H6JA 4L9FA 5HPFA 5J4EA 3R4KA 4NXGA 1N9NA 4L9GA 3C8CA 4QPRA 3S7OA 3F1PA 4I3JA 2V1BA 4EESA 4WL9A 1UWNX 5AVFA 1TS6A 2GZAA 1V9YA 2Z6CA 3BQ8A 3CWFA 3F1OB 4HJ6A 4HY8A 2XROA 3LR0A 3TJZC 4CLCE 2L1MA 5DJTA 3F1NB 1N9LA 3LI9A 2PD7A 3TE8A 1V9ZA 2V1AA 2KDKA 5EFWA 2K2NA 3IBJA 1VHMA 3H9WA 4MN6A 3H7WB 2ZMVA 4ETZA 3S7NA 1H8MA 1W63M 4WLAA 4YNRA 5HSQA 2W3DA 4JGRA 2OWJA 4BMWA 3NHQA 1NWZA 2LB9A 3LIFA 2YKFA 3T50A 4MMNA 3BQAA 2O9AA 5DKLA 1G28A 4I3IA 4EW7A 2JKRM 4XT2B 1TD5A 1XFNA 3P01A 3T4KA 1GSXA 4MCWA 4I5SA 1XJ3A 1F98A 2W1TB 1S1ZA 1G6OA 5F68A 5HL6A 4Y2FA 5HWTA 3CAXA 5HDDA 2D02A 1NLYA 3H82B 2PYPA 2V0WA 2W1RA 3OBFA 4B9OA 4I38A 2VV6A 3NOTC 4GHIB 3IS2B 1YSPA 3EEHA 4O01A 4Q0IA 3BY9A 2VEAA 3FG8A 1YKDA 4UQIM 3R7WB 2ZOIA 2WKQA 3E4QA 2QYBA 3LR3A 3CI6A 2J80A 4ARZA 4II7A 3KO6A 3E0YA 4GLQA 2QJ7A 2ZOHA 5HWVA 3EWKA 1D06A 2KOIA 4BBTA 4G3KA 4M4XA 2B02A 2P08A 2Y8HA 2PR5A 3PHYA 3C38A 1IOUA 1S66L 3BW6A 3IBRA 1P9WA 4NKPA 3RFBA 4F3LB 3VE3A 2XSSA 3GECA 3PBTA 4CQHA 5A8BA 1DP9A 5DF9A 5TBMA 1DP8A 1TS8A 5F5YA 5IT5A 2PD8A 4G3WA 4BWIA 2JHEA 3B47A 4K08A 1YAXA 3HJIA 4CLCD 1T19A 1KOUA 3LIAA 1OTIA 3BJNA 4BJPA 4KQDA 4CLCC 3JVUA 3CITA 2KLIA 1H3QA 2EWWA 3MQOA 1ODVA 4PHTA 1T18A 2GX5A 4I39A 4DJ2A 3TW8A 3UB8A 4R70A 3PBNA 1N9OA 2P04A 2GNXA 4JGQA 4HJ3A 1XJ4A 3E98A 4GS9A 4YOFA 1ZTUA 5IU1A 3PR6A 4NXBA 4ME4A 4KQOA 3DBAA 2L4RA 2V0UA 3EQVA 2QHKA 3NOUC 2MJ6A 2A2LA 4P6ZS 3VV4A 4IJGA 4IUHA 4BBUA 4E04A 3E4OA 3HCYA 4NXEA 3D72A 3ULFA 1OTAA 1D7EA 4R38A 2LB5A 1BYWA 4HP9A 1S67L 1TS7A 1LSWA 1MKMA 1DRMA 1NLZA 2VGLS 3K3DA 5HDSA 4EERA 1S1YA 4MDZA 3D3OA 2CMNA 3EOIA 2P7JA 3KSHA 3KYQA 4IHQA 2JKRI 4CLCA 2OOLA 4AFIA 4EU0A 3T4JA 1TF1A 2VZWA 4PKYG 3EEAA 1T1BA 2OWHA 3OLOA 4JGOA 2M7VA 2Y79A 3LICA 1MC0A 3LIEA 3PXPA 2OAQ1 4LRXC 4GJ4A 3E4PA 3U2AA 4GCZA 5MC7A 2XA7M 4EUVA 3EGDC 4L0LA 3NJAA 4NXFA 2PR6A 4HIAA 2D01A 2A24B 1XFQA 4H6JB 2R78A 3BY8A 1OPXA 3F1PB 4O0PA 3C2WA 4WF0A 3EQUA 4L9EA 2YKHA 3MMHA 5KIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3C A;  1LSV A;  1UGU A;  3LIB A;  1Y28 A;  2ZBB A;  5HDC A;  1EW0 A;  1S4R A;  4WUJ A;  4KUO A;  3UB7 A;  2QWS A;  2QJ5 A;  3MJQ A;  4HH2 A;  2BAS A;  2PHY A;  3ZQ5 A;  1XJ6 A;  3F1O A;  3LID A;  3LUQ A;  3F1N A;  1T1C A;  4EXO A;  4MN5 A;  3H7W A;  3MQQ A;  2PDR A;  4R3A A;  2Z6D A;  4GW9 A;  3VE4 A;  3G6O A;  4YWZ A;  5DKK A;  5G4Y A;  4EEP A;  3HJK A;  4EET B;  4XT2 A;  2L0W A;  2WKR A;  4JGP A;  4HNB A;  1OJ5 A;  1UWP X;  5J7E A;  2I9V A;  5HZH A;  5DJU A;  5F6A A;  2K7S A;  2KX6 A;  4HP4 A;  2QKP A;  2GJ3 A;  2W0N A;  3H82 A;  1VB6 A;  3RTY A;  1OTE A;  5J3W A;  4GHI A;  3IS2 A;  1T1A A;  1GSV A;  2VV7 A;  4EQ1 A;  1S4S A;  5G4Z A;  3MFX A;  4KUK A;  4I3A A;  5AVE A;  5TBM B;  2H28 A;  3LI8 A;  3A0V A;  2JN7 A;  3RH8 B;  1LT0 A;  2VLG A;  3A0S A;  4HOI A;  3SW1 A;  2W27 A;  3A0R A;  5I5L A;  4F3L A;  4HH3 A;  4HI4 A;  1GSW A;  4HQA A;  4PKY A;  4GS9 B;  3VOL A;  2V9A A;  1OTD A;  3FC7 A;  3MXQ A;  1DP6 A;  2PYR A;  4HJ4 A;  3LYX A;  3MR0 A;  1OT6 A;  4RQ9 A;  1WA9 A;  2EA9 A;  5HD3 A;  1MZU A;  1TS0 A;  5HD5 A;  3PYP A;  3BWL A;  1OJG A;  3CLO A;  3ICY A;  1F9I A;  4EEU A;  4BBV A;  5F69 A;  2WKP A;  3UME A;  3KX0 X;  4R6L A;  1P97 A;  4WN5 A;  3UB6 A;  1XJ2 A;  3B33 A;  1X0O A;  1OT9 A;  1JNU A;  2VV8 A;  4LPZ A;  3UE6 A;  1OTB A;  3UMD A;  4HHD A;  1LL8 A;  5HWW A;  1P0Z A;  1LSX A;  2M1C A;  2HV1 A;  4LRY C;  3GDI A;  4DJ3 A;  3P7N A;  4LRZ E;  2INW A;  5IS1 A;  3NOP C;  3UB9 A;  4LLO B;  2A24 A;  4H6J A;  4L9F A;  5J4E A;  4NXG A;  4L9G A;  1N9N A;  3C8C A;  3F1P A;  4I3J A;  2V1B A;  4EES A;  4WL9 A;  1UWN X;  5AVF A;  1TS6 A;  1V9Y A;  2Z6C A;  3CWF A;  3F1O B;  4HJ6 A;  4HY8 A;  2L1M A;  5DJT A;  3F1N B;  1N9L A;  3LI9 A;  2PD7 A;  1V9Z A;  2V1A A;  2KDK A;  5EFW A;  3H9W A;  4MN6 A;  3H7W B;  4WLA A;  5HSQ A;  4JGR A;  2OWJ A;  3NHQ A;  1NWZ A;  3LIF A;  2YKF A;  3T50 A;  5DKL A;  1G28 A;  4I3I A;  4EW7 A;  4XT2 B;  1XFN A;  1GSX A;  4I5S A;  1XJ3 A;  1F98 A;  1S1Z A;  5F68 A;  5HWT A;  3CAX A;  5HDD A;  2D02 A;  2V0W A;  2PYP A;  3H82 B;  4B9O A;  4I38 A;  2VV6 A;  3NOT C;  4GHI B;  3IS2 B;  3EEH A;  3BY9 A;  2VEA A;  3FG8 A;  2ZOI A;  2WKQ A;  3E4Q A;  2J80 A;  2QJ7 A;  2ZOH A;  5HWV A;  3EWK A;  1D06 A;  4BBT A;  4M4X A;  2B02 A;  2PR5 A;  3PHY A;  1S66 L;  3IBR A;  4F3L B;  3VE3 A;  3GEC A;  5A8B A;  1DP9 A;  5TBM A;  1DP8 A;  1TS8 A;  5F5Y A;  2PD8 A;  2JHE A;  4K08 A;  3HJI A;  1T19 A;  1KOU A;  3LIA A;  1OTI A;  4KQD A;  3MQO A;  1ODV A;  1T18 A;  4I39 A;  4DJ2 A;  3UB8 A;  4R70 A;  1N9O A;  4JGQ A;  4HJ3 A;  1XJ4 A;  4GS9 A;  5IU1 A;  4NXB A;  2L4R A;  2V0U A;  2QHK A;  3NOU C;  4BBU A;  4E04 A;  3E4O A;  4NXE A;  3D72 A;  3ULF A;  1OTA A;  1D7E A;  4R38 A;  4HP9 A;  1BYW A;  1S67 L;  1TS7 A;  1LSW A;  1DRM A;  3K3D A;  5HDS A;  4EER A;  1S1Y A;  2CMN A;  2P7J A;  2OOL A;  4PKY G;  1T1B A;  2OWH A;  3OLO A;  4JGO A;  3LIC A;  3LIE A;  4LRX C;  3E4P A;  4GCZ A;  3NJA A;  4NXF A;  2PR6 A;  4HIA A;  2D01 A;  2A24 B;  1XFQ A;  4H6J B;  2R78 A;  3BY8 A;  3F1P B;  3C2W A;  4WF0 A;  4L9E A;  2YKH A;  5KIZ A; 
#chains in the Genus database with same CATH topology
 3K3C A;  3RJU A;  1Y28 A;  4Q0H A;  1PW8 A;  3IH8 A;  2ZBB A;  3ZNY A;  2PT7 A;  4RYE A;  1EW0 A;  3T4Q A;  4KUO A;  4R23 A;  2V8F A;  2WK0 A;  4FH2 A;  4PM5 A;  5D3O A;  2QJ5 A;  2O9B A;  3S7P A;  1WYC A;  5TJJ A;  1YMX A;  2B5R A;  3N4I A;  4EBN A;  3NIA A;  3F1O A;  2ZQD A;  2XD1 A;  2UV0 E;  4Y15 A;  5FQQ A;  3LUQ A;  3KSG A;  2P74 A;  1CI8 A;  5E43 A;  4KZ4 A;  2HJ9 C;  2WGI A;  1ES4 A;  3BM6 A;  4MN5 A;  3NDE A;  3VSL A;  4X55 A;  1ONG A;  3BRM A;  4R3A A;  4LCL A;  1SDN A;  3W4O A;  1S6R A;  2Z6D A;  4GW9 A;  3OZH A;  3C30 A;  5GHZ A;  4P6B A;  2Y4A A;  4Y5F A;  5CTN A;  1DJA A;  2OV5 A;  2ZJ9 A;  2V1Z A;  4OQG A;  1GA9 A;  4JGP A;  2OAP 1;  2ZQ9 A;  2W3H A;  2CC1 A;  3MSH A;  3HLG A;  5HZH A;  1F2K A;  4EWF A;  2Q9M A;  2VX8 A;  3ITB A;  4HP4 A;  2JKT M;  3NBL A;  4PM9 A;  1IYS A;  4GZB A;  2WGW A;  4P0M A;  1HTZ A;  4OPY A;  4QWO A;  3FPV A;  3IS2 A;  1FSW A;  1E25 A;  1G68 A;  2VV7 A;  3WS4 A;  3R7W A;  4JPM A;  3MFX A;  2Q0O A;  3IWQ A;  2NUP C;  5C5K A;  3OOV A;  1E3U D;  2VGL M;  3LI8 A;  4U0X A;  1CI9 A;  2XF3 A;  3OCL A;  4OOY A;  4D60 A;  1LT0 A;  5EUA A;  5EEC A;  2ZD8 A;  4DXC A;  3A0R A;  4OON A;  3FZC A;  4F3L A;  1NYY A;  3S1Y A;  1BLP A;  1XGJ A;  3A3E A;  1NJ4 A;  4HI4 A;  4UA9 A;  5FA7 A;  2E8J A;  2J3T D;  3BLS A;  5FQM A;  3BYD A;  4PKY A;  2C5W B;  1JTG A;  3VOL A;  4OOM A;  2Z2L B;  3C5A A;  3Q7V B;  3VP1 A;  1VEU A;  3ZNT A;  5BOH A;  2OLU A;  3GRJ A;  1DP6 A;  2OSU A;  1FCN A;  4HJ4 A;  3LR5 A;  3GV9 A;  1OT6 A;  4CJN A;  1MZU A;  4JKT A;  1F9I A;  4EEU A;  2V2F F;  2QMI A;  3LGO A;  3UME A;  3L7H A;  3UE0 A;  2HZ5 A;  3PAE A;  4R6L A;  1P97 A;  3LR4 A;  4WN5 A;  2P9V B;  1L0G A;  2FFY A;  2JKG A;  1W63 Q;  2Y55 A;  4KG2 A;  2HJE A;  1JVJ A;  3QHY A;  1X0O A;  1OT9 A;  4FTX A;  5EVL A;  2ZMF A;  1MWR A;  4E3J A;  3T4T A;  1CJF A;  4LPZ A;  5A92 A;  1VQQ A;  1QMF A;  5CEB A;  2W3G A;  1KE4 A;  2JC7 A;  1RP5 A;  3S22 A;  1LI9 A;  1LSX A;  2VA0 A;  4OLG A;  5DTT A;  2ZMA A;  4LRY C;  1ONH A;  4UEY A;  4IUK A;  3VFF A;  2INW A;  5IS1 A;  1YSQ A;  2O99 A;  4LLO B;  4LCM A;  2WUQ A;  1SCW A;  3VOZ A;  4E3M A;  3F1P A;  4I3J A;  5AVF A;  1V9Y A;  3HLD A;  1L0E A;  1ES3 A;  3S4X A;  4X53 A;  1L0F A;  1JTD A;  3N8S A;  4ID4 A;  4CLC E;  2L1M A;  2PD7 A;  4D2O A;  3HL9 A;  5EFW A;  2Y2O A;  1W5D A;  3IQA A;  4KZ3 A;  4ETZ A;  1H8M A;  1K56 D;  1W63 M;  2WAF A;  4GDB A;  4BMW A;  5CHU A;  5EVI D;  4MMN A;  3BQA A;  5DKL A;  3GTC A;  2XD5 A;  1Y4O A;  3DTE A;  4EW7 A;  1WYB A;  1RGZ A;  2JKR M;  3V39 A;  3P01 A;  1FQG A;  4MNR A;  4I5S A;  1XXM A;  3UDF A;  4DDS A;  1NRF A;  4M3K A;  1YSP A;  3T12 B;  3EEH A;  2V20 A;  1DJB A;  5EOE A;  3DWK A;  1KGF A;  4ZJ3 A;  1YM1 A;  2ZOI A;  4KEN B;  2WKQ A;  4LGW A;  3CI6 A;  3MZE A;  1FIL A;  2Y2L A;  4P85 A;  3E0Y A;  4GLQ A;  4JXW A;  4YIN A;  1ES5 A;  3EWK A;  1L0D A;  5EPH A;  3SZT A;  3C38 A;  1IOU A;  3WWX A;  4ZBE A;  2XSS A;  3PBT A;  3U4L P;  3ITA A;  5EOO A;  5F5Y A;  1DJC A;  4UA7 A;  4K08 A;  4KQQ A;  1YAX A;  3PAG A;  3HJI A;  4C75 A;  1T19 A;  1KOU A;  1OTI A;  4CLC C;  4BD0 A;  2KLI A;  1ERQ A;  4PHT A;  3MQO A;  3DTM A;  4I39 A;  2XR0 A;  2EXB A;  4R70 A;  2GNX A;  2WKI A;  4YOF A;  1ZTU A;  5IU1 A;  1QME A;  3PR6 A;  3Q7V A;  4KQO A;  1N9B A;  5DF8 A;  2C6W B;  3DBA A;  1I5Q A;  1BUL A;  3NOU C;  1E4D A;  2MJ6 A;  2RCX A;  4S2L A;  3VV4 A;  4OP8 A;  4IJG A;  1L2S A;  4E04 A;  3E4O A;  1XX2 A;  4E3O A;  4EBP A;  1NY0 A;  3ZGA B;  3LEZ A;  1S67 L;  3CHW P;  1LSW A;  1TS7 A;  1MKM A;  4S2I A;  3SS3 A;  4OH0 A;  1S1Y A;  3KSH A;  3C4O A;  1LL5 A;  2EFX A;  2ZQC A;  1PZO A;  1BSG A;  2P9V A;  5CRF A;  4KZA A;  3LEQ A;  4KZ8 A;  3E4P A;  1KE3 A;  2XA7 M;  4EUV A;  4L0L A;  1KGG A;  4NXF A;  4A5R A;  3UE1 A;  1KGE A;  1VET B;  2A24 B;  1XFQ A;  1FOF A;  4QD4 A;  2R78 A;  1XA7 A;  4R3J A;  4QY5 A;  2XH9 A;  3C2W A;  1ES2 A;  5L2F A;  4WF0 A;  3UNW A;  1NLY A;  3UE3 A;  3MMH A;  4QU3 A;  2I72 A;  2IA2 A;  4ETX A;  3NCK A;  2JE5 A;  3AGD A;  3O5Y A;  3T4O A;  3IF6 C;  2EX8 A;  5M1A A;  3O87 A;  3MJQ A;  4HH2 A;  1XA1 A;  2WZZ A;  2BAS A;  2PHY A;  1ZKJ A;  5HAQ A;  3PBR A;  4LV2 A;  4X1M A;  4B88 A;  5EVE A;  4EXO A;  4Y0T A;  1M40 A;  2Y2P A;  5AQB A;  3MZD A;  3G34 A;  1K54 A;  3VE4 A;  1ALQ A;  4YWZ A;  3CUE C;  2ZM0 A;  3T4S A;  4DE0 A;  1P9R A;  5F83 A;  2L0W A;  3TOI A;  1ZHH B;  1NRJ A;  3QNB A;  5F6A A;  3IF5 A;  1YPR A;  5EM0 A;  2W0N A;  1VB6 A;  1YMS A;  3RTY A;  5EE8 A;  5TR7 A;  4ARZ B;  3QP8 A;  3GR2 A;  5E2E A;  1GSV A;  5TFQ A;  4DRT A;  5G4Z A;  2IWB A;  3D9Y A;  2J3W A;  2H28 A;  2BG1 A;  3VSK A;  2JN7 A;  2VLG A;  3RH8 B;  3G4P A;  2W27 A;  4WYY A;  2JCH A;  3MF0 A;  3DAV A;  3ZFZ A;  1PW1 A;  1ZG6 A;  4MN7 A;  1GA0 A;  1LHY A;  4OVD A;  3NDG A;  3PTE A;  4R0Q A;  4DF6 A;  3FKW A;  3ZG7 B;  2XA7 S;  3VMA A;  3FC7 A;  4EBL A;  3MXQ A;  2JBF A;  5FQ9 A;  2PBY A;  4DMZ A;  3FYZ A;  2PYR A;  4KG6 A;  3LYX A;  3MBZ A;  4JBF A;  5DFX A;  4RQ9 A;  5HD5 A;  5M18 A;  4GOG A;  4X1L A;  5GLC A;  3EGX C;  2VJW A;  5AJG A;  2W3F A;  2QZ6 A;  5KZH A;  2WKP A;  1PI4 A;  3MQ0 A;  4H8R A;  4S2P A;  5A91 A;  4CLC B;  2HDQ A;  2M7U A;  1SZV A;  5DTK A;  5DVA A;  4DE2 A;  4WEJ A;  4IVI A;  5HL1 A;  4PAU A;  4ZJ1 A;  3UPO A;  4E6W A;  3ZCZ A;  1BTL A;  1ERM A;  3UMD A;  1PWC A;  1ESI A;  3SH8 A;  1LL8 A;  1DY6 A;  2RL3 A;  3MZF A;  2M1C A;  2HV1 A;  3B3X A;  4DJ3 A;  3MS6 A;  5FI2 A;  1XKZ A;  5DF7 A;  3M6H A;  1VET A;  2A24 A;  3T1S A;  4L9G A;  3C8C A;  4QPR A;  2ACG A;  3OPH A;  2GZA A;  4X6T A;  4N92 A;  3ZG0 A;  3VOY A;  3HBR A;  3G32 A;  3BQ8 A;  3Q81 A;  1YT4 A;  3RXW A;  3HUN A;  5JYP A;  2AVX A;  4KZ9 A;  5DJT A;  3F1N B;  3LI9 A;  1JWV A;  1V9Z A;  2KDK A;  3FWL A;  4K0W A;  3O88 A;  3IBJ A;  3ZG9 B;  3GVB A;  4MN6 A;  5CEC A;  3H7W B;  2ZMV A;  1FIK A;  3NUL A;  5HSQ A;  2W3D A;  2OWJ A;  2PRF A;  3NHQ A;  4B4Z A;  2HP9 A;  1BLC A;  4XT2 B;  3GMW A;  1GSX A;  4MCW A;  1XJ3 A;  4GDN A;  3L9K A;  3BEB A;  5F68 A;  4UAA A;  1FCM A;  4EUZ A;  3IF6 B;  2V0W A;  2PYP A;  2W1R A;  4I38 A;  4R3B A;  1MWS A;  3NOT C;  1K4F A;  4RX2 A;  4ZJ2 A;  3RXX A;  4E3L A;  2XFS A;  1K57 C;  2Z2M B;  4C6Y A;  4ZTK A;  3ZVW A;  1ESU A;  3E4Q A;  2QYB A;  3LR3 A;  4C3Q A;  1M6K A;  4ARZ A;  4II7 A;  2QJ7 A;  5CHJ A;  1FSY A;  3FKV A;  3WS2 A;  3ZG8 B;  2B02 A;  2P08 A;  4Z9Q A;  3PHY A;  1MWT A;  3RFB A;  3VE3 A;  3T1R A;  1DP9 A;  1KDW A;  1DP8 A;  3AGF A;  2Y2H A;  2PD8 A;  3G30 A;  4JXV A;  2DCF A;  3BJN A;  4KQD A;  1NZO A;  5FAO A;  1H3Q A;  2Y2G A;  1ODV A;  3BLM A;  2E8I A;  2XGN A;  3G35 A;  3UB8 A;  4CPK A;  1N9O A;  2XDM A;  2IWD A;  4UA6 A;  5E2H A;  4JLF A;  2V0U A;  5GHY A;  2QHK A;  2Y2K A;  2PBD P;  2A2L A;  5F1G A;  2ZQA A;  5CED A;  2X71 A;  4XXR A;  4IUH A;  3D72 A;  1KVM A;  4R38 A;  2EX9 A;  2LB5 A;  1K4E A;  3OPR A;  5HW3 A;  4S2K A;  4WZ5 C;  4OLD A;  2B95 A;  3P98 A;  4K0X A;  3K3D A;  2VGL S;  4GB7 A;  2Y2J A;  3HLF A;  3CJM A;  4GD8 A;  4LV0 A;  3UO9 A;  2XEP A;  1PWG A;  5HDS A;  4EER A;  5FSR A;  3BFF A;  3HUM A;  2XQZ A;  4MDZ A;  2P7J A;  3KYQ A;  4CLC A;  5CGX A;  4AFI A;  3T4J A;  1TF1 A;  1FR1 A;  3W4P A;  5AQ7 A;  3OLO A;  3CPT B;  2Y79 A;  1MC0 A;  3SH7 A;  1IKI A;  3IXB A;  4S2N C;  2PR6 A;  3LO7 A;  2D01 A;  2VGK A;  4H6J B;  2Y2M A;  1OPX A;  4O0P A;  3W8K A;  2BTF P;  2YKH A;  4UQI M;  3N7W A;  5M19 A;  1CEF A;  3KYE A;  4HBU A;  2WGV A;  2WZX A;  2G7U A;  1F5M A;  5EM1 A;  4U3T A;  2QWS A;  3VP4 A;  2O0Y A;  4Q0J A;  2ZLY A;  3N8R A;  1K55 C;  1XPB A;  3JPU A;  1W7F A;  4RX3 A;  3IHB A;  3TRC A;  3F1N A;  3LFV A;  3SH9 A;  1CEG A;  3QP2 A;  2V8C A;  2EWV A;  1CQA A;  1MKI A;  3H7W A;  3HUO A;  4Y0U A;  1K25 A;  3G6O A;  1A0K A;  2J9O A;  3GSG A;  4WEL A;  1STZ A;  5DKK A;  4MBK A;  4EEP A;  2DMW A;  4ZDX A;  3OC2 A;  3ZYT A;  1MPL A;  4JF4 A;  1BLH A;  5HX9 A;  4XT2 A;  3MKF A;  3VP2 A;  2WKR A;  3Q07 A;  5L8M A;  4HNB A;  1OJ5 A;  1IFQ A;  4E3N A;  5J7E A;  3KSI A;  2I9V A;  5DJU A;  3WS1 A;  4S2O A;  2K7S A;  3PBO A;  3C4P A;  3IF6 A;  4PM8 A;  5KSC A;  4IVK A;  1KE0 A;  1OTE A;  4WEK A;  2ZC5 B;  4P6Z M;  1T1A A;  3ZG5 A;  5FL3 A;  3ZDJ A;  4EQ1 A;  3PBS A;  3T1X A;  4DN0 A;  5TBM B;  3K2N A;  1H8Z A;  2FH5 A;  4NEE D;  3CG5 A;  3A0V A;  1NXY A;  4EQI A;  1I2S A;  1IYP A;  4HOI A;  3UN7 A;  3WRZ A;  3V50 A;  3CUE A;  4MLL A;  5I5L A;  3SS5 A;  2VKS A;  3Q7Z A;  4LV3 A;  5AQA A;  4HH3 A;  5GLB A;  1GSW A;  2WKE A;  4LFU A;  4OOL A;  5E2G A;  1LLB A;  2A3U A;  4FCF A;  2HGV A;  4GS9 B;  2J3T C;  5JYO A;  1GHM A;  2V9A A;  3T4L A;  4R4R A;  1OTD A;  1O7E A;  4HES A;  4DXB A;  1Q2Q A;  4X69 A;  4NK3 A;  4XUZ A;  1GHI A;  3CZD A;  4DKI A;  1YLT A;  4E3K A;  2Y59 A;  1KVL A;  1W8Q A;  3O3V A;  5CGS A;  1WA9 A;  4UQI S;  1TS0 A;  3PYP A;  3BWL A;  3UB5 P;  4JXG A;  3ISG A;  2G2W A;  3ICY A;  4GD6 A;  1SDE A;  4BBV A;  1YLY A;  2H10 A;  2ZQ7 A;  2J9P A;  2XRN A;  4N1H A;  3KX0 X;  4GNU A;  2A49 A;  1ERO A;  3B33 A;  3UPN A;  2Y91 A;  1K56 A;  4RA7 A;  1HLU P;  2VV8 A;  3CMZ A;  1TDL A;  5IHV A;  1H0M A;  5A90 A;  3UE6 A;  5CXW A;  3KYZ A;  2XLN A;  3UY6 A;  5HWW A;  3CPT A;  5FAT A;  1PIO A;  3ZHH A;  2HDR A;  3M2K A;  3P7N A;  1BT5 A;  3BEC A;  4OQ0 A;  3NOP C;  3OPP A;  1WE4 A;  3UB9 A;  4H6J A;  4L9F A;  5J4E A;  3R4K A;  4NXG A;  3I7J A;  1N9N A;  1G6A A;  3S7O A;  1U60 A;  2V1B A;  4EES A;  1TS6 A;  2HDS A;  4MEZ A;  5TGF A;  3NEC A;  2XRO A;  4O7D A;  1H8Y A;  1D1J A;  2ZC4 B;  5GLA A;  3O86 A;  2V1A A;  1MBL A;  4IED A;  3G2Z A;  4WM9 A;  3H9W A;  4S2J A;  1MXO A;  4YNR A;  4U0T A;  4WLA A;  4JGR A;  4N9L A;  5HAI A;  1NWZ A;  4KZB A;  3IXD A;  3SOI A;  3QP4 A;  3GQZ A;  1G28 A;  5EVI C;  4Q8I A;  4Y17 A;  1TD5 A;  3WRT A;  3T4K A;  3IXH A;  4XUX A;  1F98 A;  2W1T B;  1S1Z A;  4Y2F A;  4Y7P A;  5FAQ A;  2PAV P;  4LV1 A;  3CAX A;  5HDD A;  2D02 A;  2DNS A;  3H82 B;  3OBF A;  3LY4 A;  3HLC A;  2VV6 A;  4GHI B;  4Q0I A;  2FFF B;  4YFM A;  1YKD A;  5CHM A;  4R4S A;  4IBX A;  2Y2N A;  5I94 A;  2J80 A;  4S2M A;  3NC8 A;  2G2U A;  4QY6 A;  4M4X A;  4OPR A;  2Y8H A;  1S66 L;  4NKP A;  4CQH A;  5A8B A;  5DF9 A;  5TBM A;  3A3I A;  2EFU A;  4HEF A;  4G3W A;  3MKE A;  4CLC D;  2IWC A;  2ZQ8 A;  3LIA A;  4EV4 A;  4BJP A;  2HP6 A;  3JVU A;  3CIT A;  3WS5 A;  3A3D A;  1T18 A;  3OPL A;  1IKG A;  4DJ2 A;  3TW8 A;  5G18 A;  2UWX A;  3PBN A;  4BL3 A;  2P04 A;  4JGQ A;  4KZ6 A;  4HJ3 A;  5FI7 A;  3E98 A;  4GS9 A;  3HVF A;  3JYI A;  1SKF A;  4FUW A;  2J8Y A;  1K57 A;  3EQV A;  5KMW A;  3FV7 A;  3HCY A;  4NXE A;  3ULF A;  3QP1 A;  1OTA A;  2H0T A;  4Y13 A;  1EWZ A;  3DW0 A;  1NLZ A;  2H5S A;  2X01 A;  3BFE A;  4BL2 A;  3HLW A;  3D3O A;  2CMN A;  3EOI A;  1Z09 A;  2OOL A;  4EU0 A;  3DWZ A;  4PPR A;  3EEA A;  4KG5 A;  1T1B A;  1Z6F A;  2J7V A;  2OWH A;  5FDS A;  4JGO A;  2M7V A;  3LIC A;  2ZC6 B;  4LRX C;  3U2A A;  3IX4 A;  5MC7 A;  4OPQ A;  4B4X A;  3EGD C;  3NJA A;  4WMC A;  4N1X A;  3D4F A;  2PU4 A;  1MY8 A;  1TDG A;  3VP3 A;  4PM6 A;  1K0K A;  5KIZ A;  1LSV A;  1UGU A;  3LIB A;  2VK3 A;  3Q1F A;  5HDC A;  1S4R A;  4WZ5 A;  4WUJ A;  4OQH A;  1IYQ A;  4ZAM A;  3MFD A;  4HBT A;  3UB7 A;  1PNE A;  2ZM2 A;  3QP6 A;  3ZQ5 A;  1XJ6 A;  3JVV A;  4UHU A;  4NG2 A;  5K5B A;  4BLM A;  3E2L A;  3LID A;  3ZVT A;  2BLS A;  1FCO A;  1T1C A;  2QPN A;  2X02 A;  2HDU A;  3MQQ A;  2PDR A;  4S2N A;  2WAD A;  4O8G A;  2GDN A;  4MBF A;  4GKU A;  5G4Y A;  5HPI A;  4E6X A;  4FH4 A;  3HJK A;  2FZ0 A;  2VGJ A;  4K91 A;  5FAP A;  4EET B;  5GLD A;  1N4O A;  5F1F A;  1UWP X;  2NUT C;  2W1T A;  1HD8 A;  1YLJ A;  4FSF A;  1YLP A;  2KX6 A;  4NET A;  3BFG A;  1XP4 A;  2QKP A;  5GHX A;  2GJ3 A;  3H82 A;  5E2F A;  3UPP A;  3IWO A;  2W3E A;  2EX6 A;  3DTI A;  5J3W A;  1L3L A;  3BFC A;  4GHI A;  3V3S A;  3PBQ A;  3LY3 A;  5DTS A;  1K55 A;  1S4S A;  4R1G A;  3TSG A;  4KUK A;  4I3A A;  5EVI B;  5AVE A;  4ZRR A;  1YQS A;  3IHA A;  4Y0O A;  1EI5 A;  2ZM8 A;  4FOF A;  3C7V A;  1RGY A;  3A0S A;  3SW1 A;  3TG9 A;  4BD1 A;  3OCN A;  4DE3 A;  5F82 A;  4Y3I A;  5CX7 A;  2H0Y A;  4PM7 A;  5CER A;  1ACF A;  4Z1W A;  4HQA A;  1J3W A;  2B18 A;  3IH9 A;  1W8Y A;  4X56 A;  4ESP A;  2R9X A;  5HFO A;  3HLB A;  1Y54 A;  3MR0 A;  1PFL A;  3W2Z A;  2ZL1 B;  1OME A;  2EA9 A;  5LBR A;  2O9C A;  5HD3 A;  3P09 A;  5DFY A;  5KSH A;  1IEM A;  1OJG A;  4BEN A;  3VP0 A;  4RVA A;  3CLO A;  3AGE A;  5J8X A;  1E3U A;  5F69 A;  1CF0 A;  4B93 A;  5FDH A;  3E2K A;  3IT9 A;  3V5M A;  3V67 A;  1IYO A;  3B42 A;  3UB6 A;  1XJ2 A;  1CK3 A;  1NYM A;  3M2J A;  1JNU A;  1VM1 A;  2HF6 A;  3LCE A;  3FPW A;  1O07 A;  4X25 A;  2Q9N A;  3IX8 A;  1TVF A;  1SKO B;  3KSF A;  1OTB A;  2K31 A;  1RCJ A;  2WKH A;  4HHD A;  2ZC3 B;  5AQ9 A;  1P0Z A;  1YLW A;  3Q82 A;  4G3V A;  2JKT I;  3GDI A;  1PYY A;  1K6R A;  4LRZ E;  3A3F A;  5L09 A;  3HRE A;  3A3J A;  1ZC2 A;  3S7Q A;  5HPF A;  5A93 A;  3VFH A;  4WL9 A;  1UWN X;  3W4Q A;  2HPB A;  3IXG A;  2Z6C A;  3CWF A;  3NY4 A;  5FQK A;  3F1O B;  4HJ6 A;  4HY8 A;  5U47 A;  5L10 A;  3LR0 A;  3BFD A;  3TJZ C;  1AWI A;  1N9L A;  1Q2P A;  3TE8 A;  1NZU A;  4BQM A;  2Y2I A;  2K2N A;  1TEM A;  1VHM A;  5FQJ A;  3S7N A;  3HLE A;  2EX2 A;  3N6I A;  5FI6 A;  2LB9 A;  3LIF A;  2YKF A;  3T50 A;  2O9A A;  1S0W A;  4I3I A;  2Y2Q A;  3G31 A;  1XFN A;  1BUE A;  4WZ4 A;  1LI0 A;  4JF5 A;  4DE1 A;  1AXB A;  4FD8 A;  3WS0 A;  1G6O A;  1XGI A;  2DRW A;  4MBH A;  5HL6 A;  3NI9 A;  5HWT A;  3UDX A;  1IEL A;  2OLV A;  1GHP A;  4B9O A;  2WYX A;  2WGW B;  1PRQ A;  2R9W A;  3IS2 B;  2PU2 A;  5FEG A;  4O01 A;  4E3I A;  1PZP A;  4GN2 A;  3BY9 A;  2VEA A;  3FG8 A;  3R7W B;  5CGW A;  3KO6 A;  3C7U A;  1MWU A;  2ZOH A;  5HWV A;  1C3B A;  4OKP A;  1J9M A;  1D06 A;  2KOI A;  1HZO A;  4BBT A;  4QB8 A;  4G3K A;  3QP5 A;  5FEF A;  2PR5 A;  3V3R A;  4QJG A;  3BW6 A;  3IBR A;  1P9W A;  4F3L B;  1BLS A;  3GEC A;  5L07 A;  5EVI A;  4X68 A;  1TS8 A;  5IT5 A;  3T1Q B;  4BWI A;  1I2W A;  2JHE A;  3B47 A;  1G5U A;  4QHC A;  2XK1 A;  1K38 A;  1SHV A;  4N9K A;  1GCE A;  1VEU B;  4F94 A;  2EWW A;  4PMA A;  2GX5 A;  1JWP A;  3MXR A;  3DTK A;  4OPZ A;  4OQI A;  5HAP A;  1PWD A;  4LEN A;  1YLZ A;  1XJ4 A;  5FQI A;  4WMC D;  2ZC7 A;  4NXB A;  4ME4 A;  3MXS A;  2L4R A;  4P87 A;  4P6Z S;  3SS4 A;  5CTM A;  4KZ5 A;  3N8L A;  4BBU A;  5FAS A;  1JWZ A;  4KQR A;  2EXA A;  1ZG4 A;  4JF6 A;  2XFT A;  1HVB A;  2ZL1 A;  1D7E A;  3QNC A;  2JKF A;  4HP9 A;  1BYW A;  4OP5 A;  5GL9 A;  1DRM A;  1K6S A;  2WAE A;  1BZA A;  1KDS A;  3IWI A;  3M6B A;  4IHQ A;  2JKR I;  2HP5 A;  4IBR A;  3UDI A;  2VZW A;  4PKY G;  1W79 A;  5EV0 A;  1LL9 A;  4DDY A;  1H5X A;  3G2Y A;  5HAR A;  3LIE A;  3PXP A;  2OAQ 1;  4GJ4 A;  4WBG A;  4GCZ A;  1SKO A;  4JXS A;  3IX3 A;  1K54 C;  4HIA A;  4KZ7 A;  3BY8 A;  1FR6 A;  3F1P B;  3EQU A;  4L9E A;  1PI5 A; 
#chains in the Genus database with same CATH homology
 3K3C A;  1LSV A;  1UGU A;  2IA2 A;  3LIB A;  1Y28 A;  4Q0H A;  2ZBB A;  2PT7 A;  4ETX A;  5HDC A;  1EW0 A;  1S4R A;  4WUJ A;  3T4Q A;  2G7U A;  3O5Y A;  4KUO A;  3T4O A;  1F5M A;  3UB7 A;  2QWS A;  2QJ5 A;  2O9B A;  3S7P A;  3MJQ A;  4HH2 A;  2O0Y A;  4Q0J A;  5TJJ A;  2BAS A;  2PHY A;  3ZQ5 A;  1XJ6 A;  3JVV A;  3F1O A;  5K5B A;  3PBR A;  3LID A;  3LUQ A;  3KSG A;  3TRC A;  3F1N A;  2HJ9 C;  1T1C A;  3LFV A;  4EXO A;  4MN5 A;  2EWV A;  3H7W A;  3MQQ A;  2PDR A;  4R3A A;  2Z6D A;  4GW9 A;  3VE4 A;  3G6O A;  3C30 A;  4O8G A;  4YWZ A;  3CUE C;  4WEL A;  3T4S A;  1STZ A;  5DKK A;  4Y5F A;  5G4Y A;  4EEP A;  2DMW A;  5HPI A;  1P9R A;  3OC2 A;  3ZYT A;  3HJK A;  2FZ0 A;  4EET B;  4XT2 A;  2L0W A;  2WKR A;  1ZHH B;  4JGP A;  2OAP 1;  5L8M A;  4HNB A;  1OJ5 A;  1IFQ A;  1UWP X;  2NUT C;  2W3H A;  5J7E A;  3KSI A;  2I9V A;  2W1T A;  1NRJ A;  5DJU A;  5F6A A;  5HZH A;  2VX8 A;  4FSF A;  2K7S A;  2KX6 A;  3PBO A;  4HP4 A;  2JKT M;  2QKP A;  2GJ3 A;  2W0N A;  3H82 A;  1VB6 A;  2W3E A;  3RTY A;  4ARZ B;  1OTE A;  4WEK A;  5J3W A;  3FPV A;  4GHI A;  4P6Z M;  3PBQ A;  3IS2 A;  1T1A A;  1GSV A;  5FL3 A;  2VV7 A;  4EQ1 A;  1S4S A;  3R7W A;  5G4Z A;  3MFX A;  3PBS A;  2NUP C;  4KUK A;  2J3W A;  4I3A A;  4DN0 A;  5AVE A;  5C5K A;  5TBM B;  3OOV A;  4ZRR A;  2H28 A;  3K2N A;  2VGL M;  3LI8 A;  3OCL A;  2FH5 A;  4NEE D;  4FOF A;  3A0V A;  2JN7 A;  1LT0 A;  2VLG A;  3RH8 B;  3A0S A;  4HOI A;  3SW1 A;  2W27 A;  3CUE A;  3A0R A;  5I5L A;  3MF0 A;  4F3L A;  3OCN A;  2VKS A;  4Y3I A;  4MN7 A;  4HH3 A;  4HI4 A;  5CX7 A;  1GSW A;  2J3T D;  4OOL A;  4Z1W A;  4HQA A;  4PKY A;  2HGV A;  4GS9 B;  2B18 A;  2J3T C;  2XA7 S;  3VOL A;  4OOM A;  2V9A A;  3T4L A;  1OTD A;  3FC7 A;  3MXQ A;  1DP6 A;  4DMZ A;  2PYR A;  4HJ4 A;  3LYX A;  5DFX A;  3MR0 A;  3LR5 A;  3W2Z A;  1OT6 A;  4RQ9 A;  1WA9 A;  4UQI S;  2EA9 A;  5LBR A;  2O9C A;  5HD3 A;  1MZU A;  1TS0 A;  5HD5 A;  3PYP A;  3BWL A;  5DFY A;  5KSH A;  1OJG A;  3CLO A;  3ICY A;  1F9I A;  4EEU A;  3EGX C;  2VJW A;  5AJG A;  4BBV A;  2W3F A;  5F69 A;  4B93 A;  2XRN A;  2WKP A;  3UME A;  3MQ0 A;  3UE3 A;  3V67 A;  4CLC B;  3KX0 X;  3B42 A;  4R6L A;  1P97 A;  3LR4 A;  4WN5 A;  3UB6 A;  1XJ2 A;  1W63 Q;  2M7U A;  3B33 A;  2HJE A;  1X0O A;  1OT9 A;  1JNU A;  2ZMF A;  2HF6 A;  2VV8 A;  4WEJ A;  3FPW A;  4PAU A;  3T4T A;  3KSF A;  4LPZ A;  3UE6 A;  1OTB A;  2K31 A;  3UMD A;  3KYZ A;  4HHD A;  1LL8 A;  2W3G A;  5HWW A;  1P0Z A;  1LSX A;  2VA0 A;  2M1C A;  2HV1 A;  4LRY C;  4G3V A;  4UEY A;  2JKT I;  3GDI A;  4DJ3 A;  4IUK A;  3P7N A;  4LRZ E;  2INW A;  5IS1 A;  3NOP C;  1YSQ A;  2O99 A;  3S7Q A;  4LLO B;  3UB9 A;  2A24 A;  4H6J A;  4L9F A;  5HPF A;  5J4E A;  3R4K A;  4NXG A;  1N9N A;  4L9G A;  3C8C A;  4QPR A;  3S7O A;  3F1P A;  4I3J A;  2V1B A;  4EES A;  4WL9 A;  1UWN X;  5AVF A;  1TS6 A;  2GZA A;  1V9Y A;  2Z6C A;  3BQ8 A;  3CWF A;  3F1O B;  4HJ6 A;  4HY8 A;  2XRO A;  3LR0 A;  3TJZ C;  4CLC E;  2L1M A;  5DJT A;  3F1N B;  1N9L A;  3LI9 A;  2PD7 A;  3TE8 A;  1V9Z A;  2V1A A;  2KDK A;  5EFW A;  2K2N A;  3IBJ A;  1VHM A;  3H9W A;  4MN6 A;  3H7W B;  2ZMV A;  4ETZ A;  3S7N A;  1H8M A;  1W63 M;  4WLA A;  4YNR A;  5HSQ A;  2W3D A;  4JGR A;  2OWJ A;  4BMW A;  3NHQ A;  1NWZ A;  2LB9 A;  3LIF A;  2YKF A;  3T50 A;  4MMN A;  3BQA A;  2O9A A;  5DKL A;  1G28 A;  4I3I A;  4EW7 A;  2JKR M;  4XT2 B;  1TD5 A;  1XFN A;  3P01 A;  3T4K A;  1GSX A;  4MCW A;  4I5S A;  1XJ3 A;  1F98 A;  2W1T B;  1S1Z A;  1G6O A;  5F68 A;  5HL6 A;  4Y2F A;  5HWT A;  3CAX A;  5HDD A;  2D02 A;  1NLY A;  3H82 B;  2PYP A;  2V0W A;  2W1R A;  3OBF A;  4B9O A;  4I38 A;  2VV6 A;  3NOT C;  4GHI B;  3IS2 B;  1YSP A;  3EEH A;  4O01 A;  4Q0I A;  3BY9 A;  2VEA A;  3FG8 A;  1YKD A;  4UQI M;  3R7W B;  2ZOI A;  2WKQ A;  3E4Q A;  2QYB A;  3LR3 A;  3CI6 A;  2J80 A;  4ARZ A;  4II7 A;  3KO6 A;  3E0Y A;  4GLQ A;  2QJ7 A;  2ZOH A;  5HWV A;  3EWK A;  1D06 A;  2KOI A;  4BBT A;  4G3K A;  4M4X A;  2B02 A;  2P08 A;  2Y8H A;  2PR5 A;  3PHY A;  3C38 A;  1IOU A;  1S66 L;  3BW6 A;  3IBR A;  1P9W A;  4NKP A;  3RFB A;  4F3L B;  3VE3 A;  2XSS A;  3GEC A;  3PBT A;  4CQH A;  5A8B A;  1DP9 A;  5DF9 A;  5TBM A;  1DP8 A;  1TS8 A;  5F5Y A;  5IT5 A;  2PD8 A;  4G3W A;  4BWI A;  2JHE A;  3B47 A;  4K08 A;  1YAX A;  3HJI A;  4CLC D;  1T19 A;  1KOU A;  3LIA A;  1OTI A;  3BJN A;  4BJP A;  4KQD A;  4CLC C;  3JVU A;  3CIT A;  2KLI A;  1H3Q A;  2EWW A;  3MQO A;  1ODV A;  4PHT A;  1T18 A;  2GX5 A;  4I39 A;  4DJ2 A;  3TW8 A;  3UB8 A;  4R70 A;  3PBN A;  1N9O A;  2P04 A;  2GNX A;  4JGQ A;  4HJ3 A;  1XJ4 A;  3E98 A;  4GS9 A;  4YOF A;  1ZTU A;  5IU1 A;  3PR6 A;  4NXB A;  4ME4 A;  4KQO A;  3DBA A;  2L4R A;  2V0U A;  3EQV A;  2QHK A;  3NOU C;  2MJ6 A;  2A2L A;  4P6Z S;  3VV4 A;  4IJG A;  4IUH A;  4BBU A;  4E04 A;  3E4O A;  3HCY A;  4NXE A;  3D72 A;  3ULF A;  1OTA A;  1D7E A;  4R38 A;  2LB5 A;  1BYW A;  4HP9 A;  1S67 L;  1TS7 A;  1LSW A;  1MKM A;  1DRM A;  1NLZ A;  2VGL S;  3K3D A;  5HDS A;  4EER A;  1S1Y A;  4MDZ A;  3D3O A;  2CMN A;  3EOI A;  2P7J A;  3KSH A;  3KYQ A;  4IHQ A;  2JKR I;  4CLC A;  2OOL A;  4AFI A;  4EU0 A;  3T4J A;  1TF1 A;  2VZW A;  4PKY G;  3EEA A;  1T1B A;  2OWH A;  3OLO A;  4JGO A;  2M7V A;  2Y79 A;  3LIC A;  1MC0 A;  3LIE A;  3PXP A;  2OAQ 1;  4LRX C;  4GJ4 A;  3E4P A;  3U2A A;  4GCZ A;  5MC7 A;  2XA7 M;  4EUV A;  3EGD C;  4L0L A;  3NJA A;  4NXF A;  2PR6 A;  4HIA A;  2D01 A;  2A24 B;  1XFQ A;  4H6J B;  2R78 A;  3BY8 A;  1OPX A;  3F1P B;  4O0P A;  3C2W A;  4WF0 A;  3EQU A;  4L9E A;  2YKH A;  3MMH A;  5KIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...