3ICYA

The crystal structure of sensory box histidine kinase/response regulator domain from chlorobium tepidum tls
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
118
structure length
118
Chain Sequence
b'SNAEELQALVDNIPAAIYHLDVSGQATIRFRPPAFLKTLVSEHAGTTRLNTLSMIHHDDRHMLSNAYSKLREAKHSLTLVYRIVTPEGKLHWIEDHMRSSFSDDGLFSGIDGILCEVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title The crystal structure of sensory box histidine kinase/response regulator domain from Chlorobium
rcsb
source organism Chlorobaculum tepidum
molecule tags Structural genomics, unknown function
total genus 13
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3icyA00
4H6JA 4DJ3A 4F3LB 1LSXA 2OOLA 4HI4A 1DP6A 3LIFA 2PD8A 3KX0X 1S4SA 1V9YA 4NXBA 4GS9B 1XJ3A 3MQQA 3CLOA 4K08A 3BY8A 1G28A 3BWLA 1S1YA 3C8CA 1JNUA 3LUQA 1TS0A 3LI9A 4HHDA 4WN5A 3LI8A 2QKPA 1OT6A 4HP4A 3UB6A 1T1CA 1T1AA 5KIZA 4H6JB 5I5LA 3E4QA 4GCZA 2EA9A 1LT0A 5DKKA 4I5SA 1N9OA 2Z6DA 3NOUC 4EEPA 1DRMA 3CWFA 3MQOA 2WKQA 3H9WA 2GJ3A 3UB8A 3GECA 3E4PA 4MN5A 3NHQA 1T18A 2I9VA 5J7EA 2JN7A 2QWSA 4JGOA 3F1OA 4WUJA 3LIEA 3CAXA 5F5YA 4XT2A 2ZBBA 2V1AA 1XJ4A 3F1PA 2V0UA 3BY9A 1OTEA 1S67L 3UB9A 1N9LA 4GHIA 5G4ZA 4LLOB 2L1MA 3NOPC 4KUKA 2HV1A 3G6OA 2L0WA 1UWPX 1S1ZA 1P97A 4I3AA 5TBMB 5A8BA 3D72A 4XT2B 2QJ5A 3A0RA 4HOIA 5HDDA 1TS6A 1NWZA 2INWA 2PR6A 1GSXA 4BBVA 5F69A 3SW1A 3H7WB 4R6LA 2D02A 2YKHA 4HY8A 5IS1A 2PD7A 4GW9A 4HJ6A 1XJ6A 1LSWA 4E04A 3HJIA 1OJ5A 4EQ1A 4WL9A 3MJQA 2PYPA 1TS8A 2W0NA 2PDRA 4HQAA 2VV8A 3H82A 4DJ2A 3E4OA 3B33A 5DJTA 2ZOHA 5DJUA 3A0VA 3K3CA 1TS7A 2WKPA 2V0WA 4HIAA 3RTYA 1OTDA 4LPZA 2WKRA 3K3DA 2P7JA 4HJ4A 3PHYA 2J80A 5IU1A 4LRXC 1XFNA 1DP9A 3PYPA 4EESA 4JGPA 4BBUA 3VOLA 1D06A 2ZOIA 3F1NA 3FC7A 4HP9A 4L9GA 3UMDA 1OTBA 3IBRA 2A24A 2M1CA 3MR0A 5HWTA 2YKFA 2V1BA 2VV6A 4L9FA 1DP8A 2BASA 4PKYA 2VV7A 1S66L 5AVFA 3MFXA 1GSVA 5HD5A 4KQDA 2VEAA 2JHEA 1Y28A 2KX6A 1F9IA 3ICYA 3F1NB 5G4YA 3F1OB 3LIAA 4I38A 2QJ7A 4HJ3A 1V9ZA 3LYXA 4F3LA 3P7NA 2KDKA 4GS9A 3F1PB 2W27A 1T19A 3C2WA 1MZUA 5J4EA 4GHIB 5HDCA 5HWWA 2PR5A 3NJAA 3MXQA 1XFQA 1KOUA 4NXEA 5J3WA 5HSQA 5F6AA 1XJ2A 3LIDA 2QHKA 1OJGA 2Z6CA 3RH8B 1S4RA 1WA9A 1X0OA 4EW7A 4I39A 2CMNA 3IS2A 2R78A 5F68A 1LL8A 1ODVA 4NXFA 4EERA 4EETB 4RQ9A 1OT9A 4NXGA 4EXOA 1EW0A 3EWKA 1F98A 2L4RA 2K7SA 2H28A 3LIBA 2OWHA 2B02A 4YWZA 4HH3A 3ULFA 3IS2B 4WF0A 4R70A 4JGQA 3H82B 5DKLA 5HDSA 4I3IA 1D7EA 5AVEA 5HD3A 4I3JA 2D01A 1OTIA 4PKYG 3NOTC 2PYRA 1VB6A 3ZQ5A 4L9EA 1GSWA 5TBMA 4R38A 4M4XA 3EEHA 3VE3A 4LRYC 3FG8A 1OTAA 3GDIA 3HJKA 4BBTA 1T1BA 4MN6A 3H7WA 2A24B 2VLGA 1UGUA 4R3AA 4B9OA 4LRZE 1LSVA 3OLOA 2V9AA 4HNBA 3UMEA 3T50A 3UE6A 1N9NA 4WLAA 4EEUA 4JGRA 5HWVA 3LICA 3VE4A 1BYWA 5EFWA 2PHYA 1UWNX 2OWJA 4HH2A 1P0ZA 4KUOA 5HZHA 3UB7A 3A0SA
chains in the Genus database with same CATH superfamily
3C30A 1VEUA 4DJ3A 3M2JA 3WRTA 5GHXA 4HI4A 1DP6A 4IEDA 3KX0X 3NBLA 3Q7VB 3KSFA 1XJ3A 4LV3A 4WZ5A 1G28A 3BWLA 4ME4A 5I94A 3T4KA 4WZ5C 3DTKA 1EROA 4HESA 1YMXA 5CX7A 4PMAA 5GLCA 4BL3A 1H8YA 1JTDA 1KE4A 4IUKA 2EA9A 4I5SA 3VMAA 1N9OA 1MKIA 3BFFA 3O86A 1K55A 5FEGA 1DRMA 3CWFA 4S2JA 4QHCA 5HARA 2HZ5A 4MN5A 3MFDA 3BYDA 2HF6A 3MS6A 4ARZA 1H0MA 1NRFA 5J7EA 4G3VA 2Y55A 2QYBA 2Y2OA 4JBFA 4E3KA 3OPRA 4JXSA 1P9RA 5HPFA 3CAXA 5DVAA 4LFUA 4F94A 4MBHA 3ITBA 5FQIA 4II7A 1JVJA 5CEBA 1PI4A 5KZHA 2LB9A 3KSHA 5M18A 1YQSA 2W3GA 3ZVWA 1ERQA 3HUMA 4WMCA 5G4ZA 4KUKA 1JTGA 4OPYA 4O7DA 2WKEA 2L0WA 4JF6A 3QP5A 4Y5FA 1NXYA 3ZDJA 1P97A 3IX8A 5TBMB 1PIOA 1J9MA 1FILA 2ZM2A 3BQAA 1YAXA 3OCLA 4XT2B 5HDDA 2Q9MA 1HZOA 2ZMFA 3TSGA 3U4LP 3N4IA 3SW1A 5A90A 3H7WB 5DF8A 3UPOA 3FZCA 4R6LA 3NC8A 1XGIA 4HY8A 1YSPA 1GHIA 3Q07A 3VP3A 2PD7A 4GW9A 2PBDP 3CPTB 1XJ6A 1MWTA 3G34A 5AQBA 4CLCA 4ZBEA 3GQZA 2BG1A 2CC1A 3HCYA 2G2WA 5C5KA 5F83A 4S2KA 3LR0A 1OJ5A 1K6SA 4WL9A 1TS8A 4DE2A 3UDXA 4X1MA 1MPLA 4DJ2A 1L3LA 2GNXA 3B33A 3LR5A 2ZOHA 4NETA 5DJUA 4Y13A 2UWXA 2JKGA 3SS3A 1OTDA 3M2KA 1KGEA 5EVIA 2P7JA 5HPIA 4KG2A 3BM6A 1E3UA 3UN7A 2RL3A 1Z09A 1DP9A 5EVIC 3PYPA 1KDSA 3SS4A 4JGPA 4S2OA 2P9VB 5IT5A 5DF7A 1YPRA 4KQQA 4KG5A 3F1NA 1ES2A 4EV4A 4L9GA 4ETZA 5JYPA 3S7QA 1NLYA 3UMDA 1ZC2A 2EXBA 2VJWA 3GR2A 3IBRA 2A24A 4WYYA 2M1CA 5TJJA 1OPXA 3LGOA 5HAIA 2VV7A 5FAOA 5FI7A 1VM1A 5K5BA 4OKPA 1QMEA 4Y0TA 4KQDA 4FH2A 2VEAA 2JHEA 2JKRI 4DN0A 2KX6A 4NK3A 4Q0HA 1JWPA 4EU0A 5G4YA 4KZ9A 3LIAA 1OMEA 1SKOB 3A3IA 3QP4A 4Y7PA 3P7NA 3EOIA 4OVDA 2KDKA 5TFQA 3VOYA 3MQ0A 2W27A 3C2WA 4GDNA 2ZQ8A 2ZM8A 3MSHA 1K56A 3N7WA 3OBFA 4KZ7A 3MZFA 5F6AA 1XJ2A 3RXWA 1Y54A 4DDSA 2X01A 2W3EA 2X71A 1DJAA 1PZPA 4LV1A 3ZYTA 5EVEA 1YLWA 4P85A 1MWUA 4EERA 3EGXC 4GNUA 1GA0A 1FCNA 2FH5A 2ZQCA 4E3JA 4QU3A 4OQIA 4R4RA 1IFQA 2JKTM 2G2UA 1YT4A 2XGNA 4JF4A 2H28A 4UQIS 4NG2A 4U0TA 5CHUA 3FWLA 5EM1A 4R70A 3H82B 1CEGA 2OV5A 5CRFA 4Q0IA 4PM9A 3S1YA 4XUZA 3OOVA 1CEFA 1W5DA 3TG9A 5E2GA 4A5RA 3VP4A 1IYQA 2PYRA 3ZG8B 4ID4A 1VB6A 4EBLA 2K31A 2J3TD 5IHVA 5TBMA 3EEHA 3FG8A 5GLDA 3T1QB 3LR3A 1HLUP 4FSFA 4UEYA 1ZG6A 2ZC7A 3H7WA 1A0KA 5DTKA 3IWOA 4UHUA 4JXWA 3EGDC 4B9OA 3CPTA 2EXAA 1LSVA 4GJ4A 3KYZA 3DTIA 4HNBA 3UMEA 2PU2A 2Q9NA 2GDNA 3UE6A 4RVAA 2ZC4B 3FPVA 3BQ8A 4JGRA 4FOFA 3LICA 1KE3A 4UAAA 4KZ5A 2HPBA 3GMWA 3VE4A 3D3OA 5U47A 4YNRA 4PHTA 5KSHA 3WS4A 1P0ZA 5HL6A 1K57A 5MC7A 1FOFA 5E2EA 4F3LB 3CUEA 1K57C 1E4DA 3LIFA 4NXBA 5CXWA 4E6XA 1PNEA 2Y8HA 2Z2MB 3HL9A 3CUEC 3MQQA 3LFVA 5A93A 3O3VA 3BY8A 5HAQA 1NYMA 4BL2A 1S1YA 3OC2A 5FQ9A 1BLHA 1JWZA 1AXBA 4HHDA 2P9VA 5F1GA 3ZNTA 5KSCA 2QKPA 4HP4A 3UB6A 2PAVP 1FIKA 3LEZA 5DTSA 4H6JB 1IKGA 5I5LA 1LT0A 1RGZA 2ZD8A 3U2AA 3O87A 2JC7A 3A0SA 2WAEA 2NUTC 3BFEA 3NCKA 1GHPA 3GV9A 3R7WB 4G3WA 1N9BA 4OQHA 2WKQA 4FH4A 1MKMA 2OSUA 3UB8A 2J3WA 4S2IA 2JN7A 2WGWB 2QMIA 2QWSA 2WKIA 3MF0A 4WUJA 3LIEA 2X02A 2UV0E 1SKOA 3FKWA 5F5YA 2DNSA 2V1AA 3T4QA 3T4LA 4E6WA 2J8YA 4DF6A 1PWDA 3DWZA 4OOLA 3T1SA 3DBAA 3K2NA 1S67L 5FI6A 3G32A 3B47A 3UB9A 5DF9A 2ZC5B 3PBSA 2VZWA 4KZ6A 4BQMA 3LY3A 2EFXA 3UE1A 3SS5A 5HFOA 3NY4A 3Q7ZA 2WZXA 4PM8A 4I3AA 2W1TA 1VETB 5E43A 3NDEA 3A0RA 1H5XA 2OLUA 3CJMA 2INWA 1GSXA 3UE0A 4BBVA 5F69A 3ZCZA 4DKIA 5CTNA 2HJ9C 4X69A 5FATA 1NZUA 3AGDA 4WM9A 4E04A 3TW8A 1BTLA 2JBFA 3HJIA 3ZG5A 4N9LA 3IHAA 3S4XA 3IX3A 1IYSA 4MMNA 3MJQA 4H8RA 5JYOA 2Y2LA 3OPLA 5FDHA 4HQAA 4QB8A 2VV8A 1WYCA 3MXSA 1YLTA 5FQKA 3H82A 4BD0A 2ZMAA 4Z9QA 2Y2QA 4M3KA 2EX8A 2IWCA 3WWXA 3MKEA 3QNBA 3VFHA 3A3JA 2WKPA 2V0WA 3UE3A 1FCOA 3ISGA 2E8JA 5F82A 4OQ0A 5AQAA 4HJ4A 2EX2A 3Q1FA 4LRXC 2EX6A 4XXRA 4WEJA 2XA7S 3HBRA 1C3BA 3CITA 5EUAA 1W63Q 3UPPA 2FFYA 3CI6A 3D9YA 3R4KA 3HLGA 1OTBA 4S2NC 2YKFA 3HLWA 1HD8A 4R0QA 1VHMA 4Y15A 3QP2A 4L9FA 1DP8A 4HBUA 3OZHA 4S2MA 3EEAA 1ZTUA 2OAQ1 1GSVA 3IXBA 3T4SA 4YINA 3IWQA 1Y28A 3SH8A 1F9IA 2ZC6B 4PPRA 1TF1A 4HEFA 3F1OB 2Y4AA 3KSGA 2QJ7A 1V9ZA 3PAGA 4F3LA 5FI2A 1PW1A 4R3BA 2V8CA 4BENA 3BFCA 1N4OA 4FD8A 1T19A 4DDYA 4WMCD 1ALQA 1FQGA 2Y2JA 2Y79A 1MZUA 2KLIA 3A3EA 3UB5P 2DCFA 4GHIB 5HDCA 1PWGA 4UQIM 4QY6A 1YMSA 2VGLS 1KOUA 4NXEA 2VGJA 3FYZA 1TDGA 4G3KA 1H8ZA 5HSQA 4JXGA 3PR6A 2XFTA 2V8FA 3LIDA 4B4XA 3RH8B 3MMHA 3BLMA 3IH9A 3OPHA 4I39A 2CMNA 3T4TA 1CJFA 2C5WB 3UPNA 1LHYA 5GHZA 1YLJA 1MY8A 1TDLA 1ES4A 3R7WA 3PBTA 1LL8A 3SOIA 4KG6A 5KMWA 1ODVA 4OH0A 2K2NA 4NXFA 4U3TA 4CLCD 4EETB 2XQZA 4GB7A 4RQ9A 5FEFA 3IWIA 4NXGA 2H0YA 3VSLA 4EXOA 1F98A 1PFLA 1IKIA 3C7UA 2WGWA 3LIBA 3ZG7B 4N9KA 1HTZA 3WS5A 2J7VA 2ACGA 2WKHA 3G2ZA 4Y2FA 3ULFA 3IS2B 4WF0A 1RP5A 4JGQA 3M6HA 5DKLA 2VKSA 4CPKA 5J8XA 5L07A 1VQQA 3S7OA 1PI5A 1K4EA 5AVEA 4GKUA 4EBNA 1IOUA 1EI5A 1E3UD 1TD5A 4MN7A 1G5UA 4JPMA 3FKVA 3ZQ5A 4QD4A 2XR0A 4R38A 4M4XA 1VETA 3TOIA 2Y2MA 3VE3A 3W4QA 5CECA 3P09A 1ZHHB 2A49A 3HLFA 5GL9A 1OTAA 1HVBA 5EM0A 4AFIA 1ERMA 3GDIA 5CHMA 4R1GA 4BBTA 4MN6A 3C7VA 2WADA 1UGUA 2HJEA 5A92A 4JXVA 3Q7VA 3OLOA 5A91A 3T50A 2P74A 4MBKA 3VP0A 5GLAA 3SZTA 1N9NA 4WLAA 5DFYA 1MWSA 4CQHA 2R9XA 1H8MA 1LL9A 2O0YA 3HLBA 2WAFA 2PHYA 2ZQAA 4KUOA 1FSYA 4QJGA 3UB7A 1YLYA 3IH8A 3KYEA 1LSXA 2OOLA 2PD8A 1K6RA 1V9YA 2G7UA 5LBRA 3CLOA 2ZL1B 1WYBA 3L9KA 4IJGA 2JCHA 2EX9A 4DE3A 3E2LA 3C8CA 1K56D 3HLCA 4IUHA 4E3OA 1JNUA 1BUEA 3LUQA 1BZAA 2WGIA 3M6BA 4S2PA 4WN5A 4K91A 3LI8A 4BLMA 3ZGAB 1OT6A 5CGXA 1T1CA 5KIZA 1LLBA 3LY4A 5AQ7A 2JKRM 2PU4A 1IYPA 1ZKJA 5FQMA 4WZ4A 3V3RA 1KGGA 3MQOA 5EVLA 2GJ3A 3UY6A 3GECA 2ZQDA 4OOYA 4C3QA 3PBQA 4LCLA 4JKTA 2M7VA 3ZNYA 1S6RA 2O99A 2I9VA 1ES5A 3EQUA 2J3TC 3DAVA 1BLCA 3F1OA 2B95A 2XSSA 3MZDA 1W63M 4OOMA 4XT2A 2QPNA 4GOGA 3LR4A 1XJ4A 4XUXA 2V2FF 3FV7A 1CI8A 2V0UA 3BY9A 4IVIA 4R23A 2H5SA 3DW0A 2DMWA 4PM5A 3WS2A 3NULA 2Y91A 1N9LA 3LO7A 2HDSA 4GHIA 2L1MA 3NOPC 3G6OA 3CG5A 3SH9A 4L0LA 3Q82A 4X68A 1UWPX 4YFMA 4PM6A 1S1ZA 5AQ9A 3S7PA 4ESPA 3BEBA 1I5QA 3D72A 2QJ5A 4LCMA 4HOIA 4X55A 4P6BA 2E8IA 3NI9A 3OPPA 1K38A 1NWZA 3ZFZA 1SDNA 1FSWA 1K25A 5L09A 4IHQA 3L7HA 5EECA 3ZHHA 2D02A 2YKHA 4MEZA 1BSGA 1W79A 2I72A 2NUPC 4HJ6A 4MNRA 2XRNA 4KZ3A 4P87A 1CI9A 1IYOA 4FCFA 3IXDA 1NY0A 4DMZA 1S0WA 4OLGA 3JPUA 2XA7M 1YLPA 4EQ1A 5D3OA 2W0NA 4E3LA 3IXGA 2PDRA 4LGWA 1PRQA 3A3DA 5M19A 3E4OA 2Y2NA 5DJTA 3B3XA 1XGJA 3IF5A 4X25A 1ES3A 4X6TA 1I2WA 3A0VA 3K3CA 4E3NA 3E98A 1M6KA 2XFSA 4JF5A 3QNCA 2Y2GA 4EBPA 1PZOA 5TGFA 5L10A 2WKRA 3G30A 2P04A 3EQVA 3PHYA 1G68A 1KGFA 4JLFA 1XFNA 3PBOA 3QP1A 1L0FA 4ZTKA 4EESA 4BBUA 1NYYA 2BTFP 1KVMA 1H3QA 4N1HA 5L8MA 3VOZA 3GVBA 3ZG0A 3FC7A 3N6IA 3CMZA 4CJNA 3PAEA 3V50A 3MR0A 4GZBA 1D1JA 4Y0OA 4PAUA 2VV6A 5FAPA 3TRCA 1Q2QA 4E3MA 5DTTA 3C4PA 5CGSA 5AVFA 5CEDA 5EOOA 5HAPA 2B18A 5HW3A 5E2HA 4LV0A 2VGLM 2KOIA 3HREA 2EWVA 4DRTA 1W8YA 3ICYA 3F1NB 4X53A 3NDGA 4ZJ1A 5FASA 3WRZA 3LYXA 2XDMA 1L0DA 4ZRRA 1NZOA 1CF0A 3KSIA 3E2KA 3BRMA 3BLSA 3F1PB 1GA9A 2ZL1A 4P0MA 3C4OA 1GHMA 3RJUA 1SKFA 3C5AA 3PBNA 5J4EA 1TEMA 1NRJA 3DTMA 5HWWA 3MXQA 3QP6A 1XFQA 3BFGA 1W7FA 3IHBA 1ACFA 4FTXA 2QHKA 1OJGA 1EWZA 2Z6CA 1Z6FA 1WA9A 4EW7A 4LENA 3MZEA 4Y0UA 4R4SA 3T4OA 1L2SA 3P01A 3UDIA 3T1XA 3N8LA 5L2FA 3GSGA 1PWCA 2OLVA 5BOHA 3GRJA 5CGWA 5DFXA 1BULA 1OT9A 1KDWA 4BWIA 1EW0A 3EWKA 3T1RA 2L4RA 1XKZA 3KYQA 3IF6B 3BW6A 4MDZA 4N92A 2OWHA 3S7NA 3V39A 2Y59A 3T12B 2XF3A 4O8GA 4QWOA 4HH3A 1RCJA 1SHVA 4GD6A 2O9BA 4DXBA 1GCEA 2DRWA 2RCXA 3AGFA 5HDSA 3KO6A 4I3IA 4S2NA 5G18A 2VK3A 1D7EA 2C6WB 1K55C 3IT9A 1K0KA 4UA6A 2ZM0A 3IBJA 3W8KA 4I3JA 2D01A 1OTIA 4PKYG 3NOTC 1SCWA 3WS0A 2PT7A 1ONGA 3VP2A 1GSWA 4Q0JA 1XXMA 2R9WA 2M7UA 4WELA 4LRYC 4IBRA 2XROA 2ZLYA 3NECA 2ZC3B 3HLEA 1Y4OA 3HJKA 3VV4A 4QY5A 1T1BA 2IA2A 2ZMVA 5GHYA 1IEMA 2VLGA 3TE8A 4N1XA 2Z2LB 2EFUA 4Y17A 1DJCA 4Q8IA 2V9AA 2WYXA 4RA7A 3PTEA 4X56A 2WUQA 3G35A 5FAQA 4EEUA 3VP1A 2ZQ7A 5HWVA 3V3SA 1CQAA 1SZVA 2BLSA 2HP5A 4GD8A 2HDQA 4GLQA 2LB5A 3BFDA 4HH2A 1NLZA 4X1LA 2FFFB 4IBXA 4H6JA 1DJBA 5EV0A 1S4SA 4GS9B 4RX2A 5E2FA 4BD1A 3MXRA 3LEQA 3T4JA 5EOEA 4ETXA 4EWFA 4K08A 4CLCC 3DTEA 4DE1A 1ZG4A 5FSRA 4FUWA 1TS0A 3LI9A 2HP6A 3HUNA 3SH7A 4QPRA 1T1AA 2V1ZA 3D4FA 3E4QA 4GCZA 3V5MA 2Y2IA 5DKKA 1AWIA 2Z6DA 3NOUC 2W3FA 4EEPA 4OP8A 1M40A 3TJZC 4BMWA 3H9WA 4OPZA 4BJPA 3E4PA 3NHQA 5EVID 3DWKA 2HDRA 4EUVA 1YKDA 1T18A 2W3HA 2IWDA 1F2KA 4KQRA 2XK1A 1MXOA 1MWRA 4JGOA 4LV2A 4P6ZM 1XPBA 2W3DA 4DE0A 2ZBBA 1WE4A 3QHYA 2JKTI 3F1PA 2ZQ9A 1OTEA 1L0GA 4RX3A 1G6AA 1ESUA 1YM1A 4LLOB 3ZG9B 2HV1A 3Q81A 3QP8A 4ZJ2A 4OPRA 5GLBA 5A8BA 1TS6A 1E25A 2PR6A 3MBZA 1JWVA 2A2LA 3P98A 1YSQA 1QMFA 3HVFA 4Z1WA 2GX5A 5IS1A 3S22A 3W2ZA 4RYEA 1LSWA 1FCMA 3ITAA 2P08A 3W4PA 1LI9A 3IF6A 2W1TB 5CERA 4D2OA 4O01A 4UA7A 2PYPA 3IF6C 4GN2A 4E3IA 3VSKA 3RFBA 4K0WA 1STZA 4OQGA 2H0TA 4MCWA 1VEUB 3G31A 1U60A 4KZ8A 3HLDA 3JVVA 4B93A 1FR6A 3PXPA 1TS7A 4HIAA 3RTYA 4LPZA 3K3DA 4C75A 3BECA 2J80A 5IU1A 2Y2HA 4EQIA 1ESIA 2J9OA 1XP4A 3I7JA 5M1AA 2WZZA 3A3FA 5F1FA 4DXCA 1G6OA 1XA7A 3VOLA 4KENB 4HBTA 1D06A 1BT5A 2ZOIA 1O07A 4HP9A 2XLNA 2XD1A 4S2LA 5HWTA 3CZDA 2V1BA 5CHJA 3G4PA 1BLSA 1W8QA 2BASA 4PKYA 1S66L 4GDBA 2XH9A 4WEKA 3MFXA 3JYIA 4CLCE 5HD5A 4O0PA 5TR7A 2HP9A 4ARZB 1BLPA 2PRFA 2VX8A 4D60A 4UA9A 2MJ6A 2JKFA 3IXHA 4I38A 1ONHA 2XD5A 4HJ3A 4NKPA 4P6ZS 4OP5A 4NEED 1IELA 2W1RA 1FR1A 5FQQA 4GS9A 5FQJA 1L0EA 4KZBA 4KQOA 4KZAA 1RGYA 1K54A 3BJNA 2Q0OA 2J9PA 1TVFA 3E0YA 1K54C 2JE5A 2PR5A 3NJAA 3IX4A 5HX9A 5EE8A 2WGVA 4ZDXA 5J3WA 2O9AA 4ZJ3A 2O9CA 5AJGA 1PYYA 4B4ZA 1S4RA 1X0OA 3IS2A 4WBGA 2R78A 5F68A 5FL3A 4OLDA 1YLZA 2GZAA 2IWBA 3CHWP 4KZ4A 2EWWA 2HDUA 3UNWA 3W4OA 4CLCB 2ZJ9A 3AGEA 2OAP1 2Y2KA 2K7SA 3UDFA 2AVXA 2B02A 4YWZA 1P9WA 3IQAA 2B5RA 2XEPA 1Q2PA 3JVUA 3V67A 2H10A 3B42A 4OONA 4R3JA 2A3UA 1PW8A 1MC0A 5FDSA 3O88A 5FA7A 5HD3A 1LL5A 3UO9A 3WS1A 4Y3IA 4ZAMA 3VFFA 5EVIB 4U0XA 1SDEA 4IVKA 1XA1A 3N8RA 4L9EA 2QZ6A 3N8SA 1J3WA 2PBYA 1I2SA 4K0XA 1DY6A 3GTCA 4YOFA 2V20A 5EPHA 1KE0A 3C38A 2Y2PA 5HL1A 3NIAA 3RXXA 3HUOA 4PM7A 4MLLA 2A24B 2WK0A 2VA0A 3MKFA 1LI0A 4R3AA 4EUZA 3LCEA 5CTMA 4LRZE 2FZ0A 3G2YA 1CK3A 2VGKA 1K4FA 4C6YA 3FPWA 4B88A 3PBRA 2HGVA 3ZVTA 1KVLA 3OCNA 1NJ4A 1XX2A 1MBLA 4MBFA 1BYWA 5EFWA 1UWNX 3O5YA 2OWJA 5HZHA 1F5MA 1O7EA 4OPQA
chains in the Genus database with same CATH topology
3C30A 5MC7A 4H6JA 4DJ3A 4F3LB 3CUEA 1LSXA 2OOLA 4HI4A 1DP6A 3LIFA 2PD8A 3KX0X 1S4SA 1V9YA 4NXBA 3KSFA 2G7UA 4GS9B 2Y8HA 1XJ3A 5LBRA 3CUEC 3MQQA 3LFVA 3CLOA 3T4JA 4ETXA 4K08A 3BY8A 1G28A 3BWLA 4IJGA 4CLCC 4ME4A 3T4KA 1S1YA 3C8CA 3OC2A 4IUHA 1JNUA 3LUQA 1TS0A 3LI9A 5CX7A 4HHDA 4WN5A 3LI8A 2QKPA 4QPRA 1OT6A 4HP4A 3UB6A 4IUKA 1T1CA 1T1AA 5KIZA 4H6JB 5I5LA 3E4QA 4GCZA 2EA9A 1LT0A 5DKKA 4I5SA 1N9OA 2JKRM 3U2AA 2Z6DA 3NOUC 2W3FA 2NUTC 4EEPA 1DRMA 3CWFA 3R7WB 4G3WA 3MQOA 3TJZC 2WKQA 4BMWA 3H9WA 2GJ3A 1MKMA 3UB8A 3GECA 2J3WA 4BJPA 3E4PA 4MN5A 3PBQA 3NHQA 2M7VA 2HF6A 4EUVA 1YKDA 4ARZA 2O99A 1T18A 2I9VA 2W3HA 3EQUA 5J7EA 4G3VA 2JN7A 2QWSA 2J3TC 2QYBA 4JGOA 4P6ZM 3MF0A 3F1OA 4WUJA 3LIEA 1P9RA 2XSSA 5HPFA 3CAXA 2W3DA 1W63M 4OOMA 5F5YA 4XT2A 2ZBBA 2V1AA 3T4QA 3T4LA 3LR4A 2JKTI 4II7A 1XJ4A 3F1PA 4OOLA 2V0UA 3DBAA 3BY9A 3K2NA 1OTEA 1S67L 2LB9A 3KSHA 2W3GA 3B47A 3UB9A 2DMWA 5DF9A 3PBSA 2VZWA 1N9LA 4GHIA 5G4ZA 4LLOB 2L1MA 3NOPC 4KUKA 2HV1A 3G6OA 2L0WA 4L0LA 1UWPX 4Y5FA 1S1ZA 1P97A 4I3AA 5TBMB 2W1TA 3S7PA 3BQAA 5A8BA 1YAXA 3D72A 3OCLA 4XT2B 2QJ5A 3A0RA 4HOIA 5HDDA 1TS6A 2ZMFA 1NWZA 2INWA 2PR6A 1GSXA 4BBVA 5F69A 2A2LA 3SW1A 3H7WB 4IHQA 1YSQA 4R6LA 4Z1WA 2D02A 2YKHA 1YSPA 4HY8A 2HJ9C 2GX5A 5IS1A 2PD7A 4GW9A 3W2ZA 2NUPC 4HJ6A 2XRNA 1XJ6A 1LSWA 4CLCA 4E04A 3TW8A 3HJIA 2P08A 3HCYA 4DMZA 2W1TB 5C5KA 2XA7M 4O01A 3LR0A 1OJ5A 4EQ1A 4MMNA 4WL9A 3MJQA 2PYPA 1TS8A 2W0NA 2PDRA 4HQAA 2VV8A 3RFBA 3H82A 1STZA 4DJ2A 3E4OA 2GNXA 3B33A 4MCWA 3LR5A 5DJTA 2ZOHA 5DJUA 3JVVA 4B93A 3A0VA 3K3CA 3E98A 3PXPA 1TS7A 2WKPA 2V0WA 4HIAA 3RTYA 3UE3A 1OTDA 4LPZA 2WKRA 2P04A 3K3DA 2P7JA 5HPIA 4HJ4A 3EQVA 3PHYA 2J80A 5IU1A 4LRXC 1XFNA 3PBOA 1DP9A 3PYPA 4EESA 4JGPA 4WEJA 4BBUA 2XA7S 3CITA 1H3QA 5IT5A 1W63Q 5L8MA 1G6OA 3CI6A 3VOLA 1D06A 2ZOIA 3R4KA 3F1NA 3FC7A 4HP9A 4L9GA 4ETZA 3S7QA 1NLYA 3UMDA 2VJWA 1OTBA 3IBRA 2A24A 2M1CA 3MR0A 5HWTA 2YKFA 5TJJA 1OPXA 2V1BA 1VHMA 4PAUA 2VV6A 4L9FA 1DP8A 2BASA 4PKYA 2VV7A 3TRCA 1S66L 3EEAA 5K5BA 1ZTUA 5AVFA 4WEKA 2B18A 2OAQ1 3MFXA 1GSVA 5HD5A 4CLCE 4KQDA 4O0PA 2VEAA 3T4SA 2JHEA 2VGLM 2KOIA 1Y28A 4ARZB 2JKRI 4DN0A 2KX6A 1F9IA 4Q0HA 2EWVA 2VX8A 3ICYA 3F1NB 1TF1A 4EU0A 5G4YA 2MJ6A 3F1OB 3LIAA 3KSGA 4I38A 2QJ7A 4HJ3A 4NKPA 4P6ZS 1V9ZA 3LYXA 4F3LA 4NEED 2W1RA 4ZRRA 3P7NA 3KSIA 3EOIA 2KDKA 4GS9A 3F1PB 4KQOA 3MQ0A 2W27A 1T19A 3C2WA 3BJNA 3PBNA 2Y79A 1MZUA 2KLIA 5J4EA 4GHIB 3E0YA 1NRJA 5HDCA 5HWWA 2PR5A 3NJAA 4UQIM 3MXQA 2VGLS 1XFQA 3OBFA 1KOUA 4NXEA 4G3KA 5J3WA 2O9AA 5HSQA 3PR6A 5F6AA 1XJ2A 2O9CA 3LIDA 5AJGA 2QHKA 1OJGA 2Z6CA 3RH8B 3MMHA 1S4RA 1WA9A 1X0OA 4EW7A 4I39A 2CMNA 3IS2A 2W3EA 3T4OA 2R78A 3T4TA 3P01A 5F68A 3ZYTA 5FL3A 3R7WA 3PBTA 2GZAA 1LL8A 1ODVA 2K2NA 4NXFA 4CLCD 2EWWA 3EGXC 4EERA 4EETB 4RQ9A 5DFXA 1OT9A 4NXGA 4BWIA 4CLCB 2FH5A 1EW0A 3EWKA 4EXOA 1F98A 2OAP1 1IFQA 2JKTM 2L4RA 2K7SA 2H28A 3LIBA 3KYQA 4UQIS 3BW6A 4MDZA 2OWHA 3S7NA 2B02A 4O8GA 4YWZA 1P9WA 4HH3A 3JVUA 4Y2FA 3ULFA 2O9BA 3IS2B 3V67A 4WF0A 4R70A 3B42A 4JGQA 3H82B 5DKLA 2VKSA 5HDSA 3KO6A 4I3IA 1D7EA 1MC0A 4Q0IA 3S7OA 5AVEA 5HD3A 3IBJA 1IOUA 4I3JA 4Y3IA 3OOVA 2D01A 1OTIA 4PKYG 1TD5A 4MN7A 3NOTC 2PYRA 2PT7A 1VB6A 3ZQ5A 4L9EA 1GSWA 2K31A 2J3TD 4Q0JA 5TBMA 4R38A 4M4XA 2M7UA 3EEHA 4WELA 3VE3A 4LRYC 3FG8A 2XROA 1ZHHB 4YOFA 3LR3A 4FSFA 4UEYA 1OTAA 4AFIA 3C38A 3GDIA 3HJKA 3VV4A 4BBTA 1T1BA 4MN6A 2IA2A 3H7WA 2ZMVA 2A24B 2VLGA 2VA0A 1UGUA 3TE8A 4R3AA 2HJEA 3EGDC 4B9OA 4LRZE 1LSVA 2FZ0A 4GJ4A 3OLOA 3KYZA 2V9AA 4HNBA 3UMEA 3T50A 3FPWA 3PBRA 2HGVA 3UE6A 1N9NA 3FPVA 3BQ8A 4WLAA 4JGRA 4EEUA 5DFYA 4FOFA 5HWVA 4CQHA 3LICA 3OCNA 3VE4A 3D3OA 1H8MA 4GLQA 2O0YA 4YNRA 1BYWA 2LB5A 5EFWA 4PHTA 2PHYA 5KSHA 1UWNX 3O5YA 2OWJA 4HH2A 1NLZA 1P0ZA 4KUOA 5HL6A 5HZHA 1F5MA 3UB7A 3A0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6J A;  4DJ3 A;  4F3L B;  1LSX A;  2OOL A;  4HI4 A;  1DP6 A;  3LIF A;  2PD8 A;  3KX0 X;  1S4S A;  1V9Y A;  4NXB A;  4GS9 B;  1XJ3 A;  3MQQ A;  3CLO A;  4K08 A;  3BY8 A;  1G28 A;  3BWL A;  1S1Y A;  3C8C A;  1JNU A;  3LUQ A;  1TS0 A;  3LI9 A;  4HHD A;  4WN5 A;  3LI8 A;  2QKP A;  1OT6 A;  4HP4 A;  3UB6 A;  1T1C A;  1T1A A;  5KIZ A;  4H6J B;  5I5L A;  3E4Q A;  4GCZ A;  2EA9 A;  1LT0 A;  5DKK A;  4I5S A;  1N9O A;  2Z6D A;  3NOU C;  4EEP A;  1DRM A;  3CWF A;  3MQO A;  2WKQ A;  3H9W A;  2GJ3 A;  3UB8 A;  3GEC A;  3E4P A;  4MN5 A;  3NHQ A;  1T18 A;  2I9V A;  5J7E A;  2JN7 A;  2QWS A;  4JGO A;  3F1O A;  4WUJ A;  3LIE A;  3CAX A;  5F5Y A;  4XT2 A;  2ZBB A;  2V1A A;  1XJ4 A;  3F1P A;  2V0U A;  3BY9 A;  1OTE A;  1S67 L;  3UB9 A;  1N9L A;  4GHI A;  5G4Z A;  4LLO B;  2L1M A;  3NOP C;  4KUK A;  2HV1 A;  3G6O A;  2L0W A;  1UWP X;  1S1Z A;  1P97 A;  4I3A A;  5TBM B;  5A8B A;  3D72 A;  4XT2 B;  2QJ5 A;  3A0R A;  4HOI A;  5HDD A;  1TS6 A;  1NWZ A;  2INW A;  2PR6 A;  1GSX A;  4BBV A;  5F69 A;  3SW1 A;  3H7W B;  4R6L A;  2D02 A;  2YKH A;  4HY8 A;  5IS1 A;  2PD7 A;  4GW9 A;  4HJ6 A;  1XJ6 A;  1LSW A;  4E04 A;  3HJI A;  1OJ5 A;  4EQ1 A;  4WL9 A;  3MJQ A;  2PYP A;  1TS8 A;  2W0N A;  2PDR A;  4HQA A;  2VV8 A;  3H82 A;  4DJ2 A;  3E4O A;  3B33 A;  5DJT A;  2ZOH A;  5DJU A;  3A0V A;  3K3C A;  1TS7 A;  2WKP A;  2V0W A;  4HIA A;  3RTY A;  1OTD A;  4LPZ A;  2WKR A;  3K3D A;  2P7J A;  4HJ4 A;  3PHY A;  2J80 A;  5IU1 A;  4LRX C;  1XFN A;  1DP9 A;  3PYP A;  4EES A;  4JGP A;  4BBU A;  3VOL A;  1D06 A;  2ZOI A;  3F1N A;  3FC7 A;  4HP9 A;  4L9G A;  3UMD A;  1OTB A;  3IBR A;  2A24 A;  2M1C A;  3MR0 A;  5HWT A;  2YKF A;  2V1B A;  2VV6 A;  4L9F A;  1DP8 A;  2BAS A;  4PKY A;  2VV7 A;  1S66 L;  5AVF A;  3MFX A;  1GSV A;  5HD5 A;  4KQD A;  2VEA A;  2JHE A;  1Y28 A;  2KX6 A;  1F9I A;  3ICY A;  3F1N B;  5G4Y A;  3F1O B;  3LIA A;  4I38 A;  2QJ7 A;  4HJ3 A;  1V9Z A;  3LYX A;  4F3L A;  3P7N A;  2KDK A;  4GS9 A;  3F1P B;  2W27 A;  1T19 A;  3C2W A;  1MZU A;  5J4E A;  4GHI B;  5HDC A;  5HWW A;  2PR5 A;  3NJA A;  3MXQ A;  1XFQ A;  1KOU A;  4NXE A;  5J3W A;  5HSQ A;  5F6A A;  1XJ2 A;  3LID A;  2QHK A;  1OJG A;  2Z6C A;  3RH8 B;  1S4R A;  1WA9 A;  1X0O A;  4EW7 A;  4I39 A;  2CMN A;  3IS2 A;  2R78 A;  5F68 A;  1LL8 A;  1ODV A;  4NXF A;  4EER A;  4EET B;  4RQ9 A;  1OT9 A;  4NXG A;  4EXO A;  1EW0 A;  3EWK A;  1F98 A;  2L4R A;  2K7S A;  2H28 A;  3LIB A;  2OWH A;  2B02 A;  4YWZ A;  4HH3 A;  3ULF A;  3IS2 B;  4WF0 A;  4R70 A;  4JGQ A;  3H82 B;  5DKL A;  5HDS A;  4I3I A;  1D7E A;  5AVE A;  5HD3 A;  4I3J A;  2D01 A;  1OTI A;  4PKY G;  3NOT C;  2PYR A;  1VB6 A;  3ZQ5 A;  4L9E A;  1GSW A;  5TBM A;  4R38 A;  4M4X A;  3EEH A;  3VE3 A;  4LRY C;  3FG8 A;  1OTA A;  3GDI A;  3HJK A;  4BBT A;  1T1B A;  4MN6 A;  3H7W A;  2A24 B;  2VLG A;  1UGU A;  4R3A A;  4B9O A;  4LRZ E;  1LSV A;  3OLO A;  2V9A A;  4HNB A;  3UME A;  3T50 A;  3UE6 A;  1N9N A;  4WLA A;  4EEU A;  4JGR A;  5HWV A;  3LIC A;  3VE4 A;  1BYW A;  5EFW A;  2PHY A;  1UWN X;  2OWJ A;  4HH2 A;  1P0Z A;  4KUO A;  5HZH A;  3UB7 A;  3A0S A; 
#chains in the Genus database with same CATH topology
 3C30 A;  1VEU A;  4DJ3 A;  3M2J A;  3WRT A;  5GHX A;  4HI4 A;  1DP6 A;  4IED A;  3KX0 X;  3NBL A;  3Q7V B;  3KSF A;  1XJ3 A;  4LV3 A;  4WZ5 A;  1G28 A;  3BWL A;  4ME4 A;  5I94 A;  3T4K A;  4WZ5 C;  3DTK A;  1ERO A;  4HES A;  1YMX A;  5CX7 A;  4PMA A;  5GLC A;  4BL3 A;  1H8Y A;  1JTD A;  1KE4 A;  4IUK A;  2EA9 A;  4I5S A;  3VMA A;  1N9O A;  1MKI A;  3BFF A;  3O86 A;  1K55 A;  5FEG A;  1DRM A;  3CWF A;  4S2J A;  4QHC A;  5HAR A;  2HZ5 A;  4MN5 A;  3MFD A;  3BYD A;  2HF6 A;  3MS6 A;  4ARZ A;  1H0M A;  1NRF A;  5J7E A;  4G3V A;  2Y55 A;  2QYB A;  2Y2O A;  4JBF A;  4E3K A;  3OPR A;  4JXS A;  1P9R A;  5HPF A;  3CAX A;  5DVA A;  4LFU A;  4F94 A;  4MBH A;  3ITB A;  5FQI A;  4II7 A;  1JVJ A;  5CEB A;  1PI4 A;  5KZH A;  2LB9 A;  3KSH A;  5M18 A;  1YQS A;  2W3G A;  3ZVW A;  1ERQ A;  3HUM A;  4WMC A;  5G4Z A;  4KUK A;  1JTG A;  4OPY A;  4O7D A;  2WKE A;  2L0W A;  4JF6 A;  3QP5 A;  4Y5F A;  1NXY A;  3ZDJ A;  1P97 A;  3IX8 A;  5TBM B;  1PIO A;  1J9M A;  1FIL A;  2ZM2 A;  3BQA A;  1YAX A;  3OCL A;  4XT2 B;  5HDD A;  2Q9M A;  1HZO A;  2ZMF A;  3TSG A;  3U4L P;  3N4I A;  3SW1 A;  5A90 A;  3H7W B;  5DF8 A;  3UPO A;  3FZC A;  4R6L A;  3NC8 A;  1XGI A;  4HY8 A;  1YSP A;  1GHI A;  3Q07 A;  3VP3 A;  2PD7 A;  4GW9 A;  2PBD P;  3CPT B;  1XJ6 A;  1MWT A;  3G34 A;  5AQB A;  4CLC A;  4ZBE A;  3GQZ A;  2BG1 A;  2CC1 A;  3HCY A;  2G2W A;  5C5K A;  5F83 A;  4S2K A;  3LR0 A;  1OJ5 A;  1K6S A;  4WL9 A;  1TS8 A;  4DE2 A;  3UDX A;  4X1M A;  1MPL A;  4DJ2 A;  1L3L A;  2GNX A;  3B33 A;  3LR5 A;  2ZOH A;  4NET A;  5DJU A;  4Y13 A;  2UWX A;  2JKG A;  3SS3 A;  1OTD A;  3M2K A;  1KGE A;  5EVI A;  2P7J A;  5HPI A;  4KG2 A;  3BM6 A;  1E3U A;  3UN7 A;  2RL3 A;  1Z09 A;  1DP9 A;  5EVI C;  3PYP A;  1KDS A;  3SS4 A;  4JGP A;  4S2O A;  2P9V B;  5IT5 A;  5DF7 A;  1YPR A;  4KQQ A;  4KG5 A;  3F1N A;  1ES2 A;  4EV4 A;  4L9G A;  4ETZ A;  5JYP A;  3S7Q A;  1NLY A;  3UMD A;  1ZC2 A;  2EXB A;  2VJW A;  3GR2 A;  3IBR A;  2A24 A;  4WYY A;  2M1C A;  5TJJ A;  1OPX A;  3LGO A;  5HAI A;  2VV7 A;  5FAO A;  5FI7 A;  1VM1 A;  5K5B A;  4OKP A;  1QME A;  4Y0T A;  4KQD A;  4FH2 A;  2VEA A;  2JHE A;  2JKR I;  4DN0 A;  2KX6 A;  4NK3 A;  4Q0H A;  1JWP A;  4EU0 A;  5G4Y A;  4KZ9 A;  3LIA A;  1OME A;  1SKO B;  3A3I A;  3QP4 A;  4Y7P A;  3P7N A;  3EOI A;  4OVD A;  2KDK A;  5TFQ A;  3VOY A;  3MQ0 A;  2W27 A;  3C2W A;  4GDN A;  2ZQ8 A;  2ZM8 A;  3MSH A;  1K56 A;  3N7W A;  3OBF A;  4KZ7 A;  3MZF A;  5F6A A;  1XJ2 A;  3RXW A;  1Y54 A;  4DDS A;  2X01 A;  2W3E A;  2X71 A;  1DJA A;  1PZP A;  4LV1 A;  3ZYT A;  5EVE A;  1YLW A;  4P85 A;  1MWU A;  4EER A;  3EGX C;  4GNU A;  1GA0 A;  1FCN A;  2FH5 A;  2ZQC A;  4E3J A;  4QU3 A;  4OQI A;  4R4R A;  1IFQ A;  2JKT M;  2G2U A;  1YT4 A;  2XGN A;  4JF4 A;  2H28 A;  4UQI S;  4NG2 A;  4U0T A;  5CHU A;  3FWL A;  5EM1 A;  4R70 A;  3H82 B;  1CEG A;  2OV5 A;  5CRF A;  4Q0I A;  4PM9 A;  3S1Y A;  4XUZ A;  3OOV A;  1CEF A;  1W5D A;  3TG9 A;  5E2G A;  4A5R A;  3VP4 A;  1IYQ A;  2PYR A;  3ZG8 B;  4ID4 A;  1VB6 A;  4EBL A;  2K31 A;  2J3T D;  5IHV A;  5TBM A;  3EEH A;  3FG8 A;  5GLD A;  3T1Q B;  3LR3 A;  1HLU P;  4FSF A;  4UEY A;  1ZG6 A;  2ZC7 A;  3H7W A;  1A0K A;  5DTK A;  3IWO A;  4UHU A;  4JXW A;  3EGD C;  4B9O A;  3CPT A;  2EXA A;  1LSV A;  4GJ4 A;  3KYZ A;  3DTI A;  4HNB A;  3UME A;  2PU2 A;  2Q9N A;  2GDN A;  3UE6 A;  4RVA A;  2ZC4 B;  3FPV A;  3BQ8 A;  4JGR A;  4FOF A;  3LIC A;  1KE3 A;  4UAA A;  4KZ5 A;  2HPB A;  3GMW A;  3VE4 A;  3D3O A;  5U47 A;  4YNR A;  4PHT A;  5KSH A;  3WS4 A;  1P0Z A;  5HL6 A;  1K57 A;  5MC7 A;  1FOF A;  5E2E A;  4F3L B;  3CUE A;  1K57 C;  1E4D A;  3LIF A;  4NXB A;  5CXW A;  4E6X A;  1PNE A;  2Y8H A;  2Z2M B;  3HL9 A;  3CUE C;  3MQQ A;  3LFV A;  5A93 A;  3O3V A;  3BY8 A;  5HAQ A;  1NYM A;  4BL2 A;  1S1Y A;  3OC2 A;  5FQ9 A;  1BLH A;  1JWZ A;  1AXB A;  4HHD A;  2P9V A;  5F1G A;  3ZNT A;  5KSC A;  2QKP A;  4HP4 A;  3UB6 A;  2PAV P;  1FIK A;  3LEZ A;  5DTS A;  4H6J B;  1IKG A;  5I5L A;  1LT0 A;  1RGZ A;  2ZD8 A;  3U2A A;  3O87 A;  2JC7 A;  3A0S A;  2WAE A;  2NUT C;  3BFE A;  3NCK A;  1GHP A;  3GV9 A;  3R7W B;  4G3W A;  1N9B A;  4OQH A;  2WKQ A;  4FH4 A;  1MKM A;  2OSU A;  3UB8 A;  2J3W A;  4S2I A;  2JN7 A;  2WGW B;  2QMI A;  2QWS A;  2WKI A;  3MF0 A;  4WUJ A;  3LIE A;  2X02 A;  2UV0 E;  1SKO A;  3FKW A;  5F5Y A;  2DNS A;  2V1A A;  3T4Q A;  3T4L A;  4E6W A;  2J8Y A;  4DF6 A;  1PWD A;  3DWZ A;  4OOL A;  3T1S A;  3DBA A;  3K2N A;  1S67 L;  5FI6 A;  3G32 A;  3B47 A;  3UB9 A;  5DF9 A;  2ZC5 B;  3PBS A;  2VZW A;  4KZ6 A;  4BQM A;  3LY3 A;  2EFX A;  3UE1 A;  3SS5 A;  5HFO A;  3NY4 A;  3Q7Z A;  2WZX A;  4PM8 A;  4I3A A;  2W1T A;  1VET B;  5E43 A;  3NDE A;  3A0R A;  1H5X A;  2OLU A;  3CJM A;  2INW A;  1GSX A;  3UE0 A;  4BBV A;  5F69 A;  3ZCZ A;  4DKI A;  5CTN A;  2HJ9 C;  4X69 A;  5FAT A;  1NZU A;  3AGD A;  4WM9 A;  4E04 A;  3TW8 A;  1BTL A;  2JBF A;  3HJI A;  3ZG5 A;  4N9L A;  3IHA A;  3S4X A;  3IX3 A;  1IYS A;  4MMN A;  3MJQ A;  4H8R A;  5JYO A;  2Y2L A;  3OPL A;  5FDH A;  4HQA A;  4QB8 A;  2VV8 A;  1WYC A;  3MXS A;  1YLT A;  5FQK A;  3H82 A;  4BD0 A;  2ZMA A;  4Z9Q A;  2Y2Q A;  4M3K A;  2EX8 A;  2IWC A;  3WWX A;  3MKE A;  3QNB A;  3VFH A;  3A3J A;  2WKP A;  2V0W A;  3UE3 A;  1FCO A;  3ISG A;  2E8J A;  5F82 A;  4OQ0 A;  5AQA A;  4HJ4 A;  2EX2 A;  3Q1F A;  4LRX C;  2EX6 A;  4XXR A;  4WEJ A;  2XA7 S;  3HBR A;  1C3B A;  3CIT A;  5EUA A;  1W63 Q;  3UPP A;  2FFY A;  3CI6 A;  3D9Y A;  3R4K A;  3HLG A;  1OTB A;  4S2N C;  2YKF A;  3HLW A;  1HD8 A;  4R0Q A;  1VHM A;  4Y15 A;  3QP2 A;  4L9F A;  1DP8 A;  4HBU A;  3OZH A;  4S2M A;  3EEA A;  1ZTU A;  2OAQ 1;  1GSV A;  3IXB A;  3T4S A;  4YIN A;  3IWQ A;  1Y28 A;  3SH8 A;  1F9I A;  2ZC6 B;  4PPR A;  1TF1 A;  4HEF A;  3F1O B;  2Y4A A;  3KSG A;  2QJ7 A;  1V9Z A;  3PAG A;  4F3L A;  5FI2 A;  1PW1 A;  4R3B A;  2V8C A;  4BEN A;  3BFC A;  1N4O A;  4FD8 A;  1T19 A;  4DDY A;  4WMC D;  1ALQ A;  1FQG A;  2Y2J A;  2Y79 A;  1MZU A;  2KLI A;  3A3E A;  3UB5 P;  2DCF A;  4GHI B;  5HDC A;  1PWG A;  4UQI M;  4QY6 A;  1YMS A;  2VGL S;  1KOU A;  4NXE A;  2VGJ A;  3FYZ A;  1TDG A;  4G3K A;  1H8Z A;  5HSQ A;  4JXG A;  3PR6 A;  2XFT A;  2V8F A;  3LID A;  4B4X A;  3RH8 B;  3MMH A;  3BLM A;  3IH9 A;  3OPH A;  4I39 A;  2CMN A;  3T4T A;  1CJF A;  2C5W B;  3UPN A;  1LHY A;  5GHZ A;  1YLJ A;  1MY8 A;  1TDL A;  1ES4 A;  3R7W A;  3PBT A;  1LL8 A;  3SOI A;  4KG6 A;  5KMW A;  1ODV A;  4OH0 A;  2K2N A;  4NXF A;  4U3T A;  4CLC D;  4EET B;  2XQZ A;  4GB7 A;  4RQ9 A;  5FEF A;  3IWI A;  4NXG A;  2H0Y A;  3VSL A;  4EXO A;  1F98 A;  1PFL A;  1IKI A;  3C7U A;  2WGW A;  3LIB A;  3ZG7 B;  4N9K A;  1HTZ A;  3WS5 A;  2J7V A;  2ACG A;  2WKH A;  3G2Z A;  4Y2F A;  3ULF A;  3IS2 B;  4WF0 A;  1RP5 A;  4JGQ A;  3M6H A;  5DKL A;  2VKS A;  4CPK A;  5J8X A;  5L07 A;  1VQQ A;  3S7O A;  1PI5 A;  1K4E A;  5AVE A;  4GKU A;  4EBN A;  1IOU A;  1EI5 A;  1E3U D;  1TD5 A;  4MN7 A;  1G5U A;  4JPM A;  3FKV A;  3ZQ5 A;  4QD4 A;  2XR0 A;  4R38 A;  4M4X A;  1VET A;  3TOI A;  2Y2M A;  3VE3 A;  3W4Q A;  5CEC A;  3P09 A;  1ZHH B;  2A49 A;  3HLF A;  5GL9 A;  1OTA A;  1HVB A;  5EM0 A;  4AFI A;  1ERM A;  3GDI A;  5CHM A;  4R1G A;  4BBT A;  4MN6 A;  3C7V A;  2WAD A;  1UGU A;  2HJE A;  5A92 A;  4JXV A;  3Q7V A;  3OLO A;  5A91 A;  3T50 A;  2P74 A;  4MBK A;  3VP0 A;  5GLA A;  3SZT A;  1N9N A;  4WLA A;  5DFY A;  1MWS A;  4CQH A;  2R9X A;  1H8M A;  1LL9 A;  2O0Y A;  3HLB A;  2WAF A;  2PHY A;  2ZQA A;  4KUO A;  1FSY A;  4QJG A;  3UB7 A;  1YLY A;  3IH8 A;  3KYE A;  1LSX A;  2OOL A;  2PD8 A;  1K6R A;  1V9Y A;  2G7U A;  5LBR A;  3CLO A;  2ZL1 B;  1WYB A;  3L9K A;  4IJG A;  2JCH A;  2EX9 A;  4DE3 A;  3E2L A;  3C8C A;  1K56 D;  3HLC A;  4IUH A;  4E3O A;  1JNU A;  1BUE A;  3LUQ A;  1BZA A;  2WGI A;  3M6B A;  4S2P A;  4WN5 A;  4K91 A;  3LI8 A;  4BLM A;  3ZGA B;  1OT6 A;  5CGX A;  1T1C A;  5KIZ A;  1LLB A;  3LY4 A;  5AQ7 A;  2JKR M;  2PU4 A;  1IYP A;  1ZKJ A;  5FQM A;  4WZ4 A;  3V3R A;  1KGG A;  3MQO A;  5EVL A;  2GJ3 A;  3UY6 A;  3GEC A;  2ZQD A;  4OOY A;  4C3Q A;  3PBQ A;  4LCL A;  4JKT A;  2M7V A;  3ZNY A;  1S6R A;  2O99 A;  2I9V A;  1ES5 A;  3EQU A;  2J3T C;  3DAV A;  1BLC A;  3F1O A;  2B95 A;  2XSS A;  3MZD A;  1W63 M;  4OOM A;  4XT2 A;  2QPN A;  4GOG A;  3LR4 A;  1XJ4 A;  4XUX A;  2V2F F;  3FV7 A;  1CI8 A;  2V0U A;  3BY9 A;  4IVI A;  4R23 A;  2H5S A;  3DW0 A;  2DMW A;  4PM5 A;  3WS2 A;  3NUL A;  2Y91 A;  1N9L A;  3LO7 A;  2HDS A;  4GHI A;  2L1M A;  3NOP C;  3G6O A;  3CG5 A;  3SH9 A;  4L0L A;  3Q82 A;  4X68 A;  1UWP X;  4YFM A;  4PM6 A;  1S1Z A;  5AQ9 A;  3S7P A;  4ESP A;  3BEB A;  1I5Q A;  3D72 A;  2QJ5 A;  4LCM A;  4HOI A;  4X55 A;  4P6B A;  2E8I A;  3NI9 A;  3OPP A;  1K38 A;  1NWZ A;  3ZFZ A;  1SDN A;  1FSW A;  1K25 A;  5L09 A;  4IHQ A;  3L7H A;  5EEC A;  3ZHH A;  2D02 A;  2YKH A;  4MEZ A;  1BSG A;  1W79 A;  2I72 A;  2NUP C;  4HJ6 A;  4MNR A;  2XRN A;  4KZ3 A;  4P87 A;  1CI9 A;  1IYO A;  4FCF A;  3IXD A;  1NY0 A;  4DMZ A;  1S0W A;  4OLG A;  3JPU A;  2XA7 M;  1YLP A;  4EQ1 A;  5D3O A;  2W0N A;  4E3L A;  3IXG A;  2PDR A;  4LGW A;  1PRQ A;  3A3D A;  5M19 A;  3E4O A;  2Y2N A;  5DJT A;  3B3X A;  1XGJ A;  3IF5 A;  4X25 A;  1ES3 A;  4X6T A;  1I2W A;  3A0V A;  3K3C A;  4E3N A;  3E98 A;  1M6K A;  2XFS A;  4JF5 A;  3QNC A;  2Y2G A;  4EBP A;  1PZO A;  5TGF A;  5L10 A;  2WKR A;  3G30 A;  2P04 A;  3EQV A;  3PHY A;  1G68 A;  1KGF A;  4JLF A;  1XFN A;  3PBO A;  3QP1 A;  1L0F A;  4ZTK A;  4EES A;  4BBU A;  1NYY A;  2BTF P;  1KVM A;  1H3Q A;  4N1H A;  5L8M A;  3VOZ A;  3GVB A;  3ZG0 A;  3FC7 A;  3N6I A;  3CMZ A;  4CJN A;  3PAE A;  3V50 A;  3MR0 A;  4GZB A;  1D1J A;  4Y0O A;  4PAU A;  2VV6 A;  5FAP A;  3TRC A;  1Q2Q A;  4E3M A;  5DTT A;  3C4P A;  5CGS A;  5AVF A;  5CED A;  5EOO A;  5HAP A;  2B18 A;  5HW3 A;  5E2H A;  4LV0 A;  2VGL M;  2KOI A;  3HRE A;  2EWV A;  4DRT A;  1W8Y A;  3ICY A;  3F1N B;  4X53 A;  3NDG A;  4ZJ1 A;  5FAS A;  3WRZ A;  3LYX A;  2XDM A;  1L0D A;  4ZRR A;  1NZO A;  1CF0 A;  3KSI A;  3E2K A;  3BRM A;  3BLS A;  3F1P B;  1GA9 A;  2ZL1 A;  4P0M A;  3C4O A;  1GHM A;  3RJU A;  1SKF A;  3C5A A;  3PBN A;  5J4E A;  1TEM A;  1NRJ A;  3DTM A;  5HWW A;  3MXQ A;  3QP6 A;  1XFQ A;  3BFG A;  1W7F A;  3IHB A;  1ACF A;  4FTX A;  2QHK A;  1OJG A;  1EWZ A;  2Z6C A;  1Z6F A;  1WA9 A;  4EW7 A;  4LEN A;  3MZE A;  4Y0U A;  4R4S A;  3T4O A;  1L2S A;  3P01 A;  3UDI A;  3T1X A;  3N8L A;  5L2F A;  3GSG A;  1PWC A;  2OLV A;  5BOH A;  3GRJ A;  5CGW A;  5DFX A;  1BUL A;  1OT9 A;  1KDW A;  4BWI A;  1EW0 A;  3EWK A;  3T1R A;  2L4R A;  1XKZ A;  3KYQ A;  3IF6 B;  3BW6 A;  4MDZ A;  4N92 A;  2OWH A;  3S7N A;  3V39 A;  2Y59 A;  3T12 B;  2XF3 A;  4O8G A;  4QWO A;  4HH3 A;  1RCJ A;  1SHV A;  4GD6 A;  2O9B A;  4DXB A;  1GCE A;  2DRW A;  2RCX A;  3AGF A;  5HDS A;  3KO6 A;  4I3I A;  4S2N A;  5G18 A;  2VK3 A;  1D7E A;  2C6W B;  1K55 C;  3IT9 A;  1K0K A;  4UA6 A;  2ZM0 A;  3IBJ A;  3W8K A;  4I3J A;  2D01 A;  1OTI A;  4PKY G;  3NOT C;  1SCW A;  3WS0 A;  2PT7 A;  1ONG A;  3VP2 A;  1GSW A;  4Q0J A;  1XXM A;  2R9W A;  2M7U A;  4WEL A;  4LRY C;  4IBR A;  2XRO A;  2ZLY A;  3NEC A;  2ZC3 B;  3HLE A;  1Y4O A;  3HJK A;  3VV4 A;  4QY5 A;  1T1B A;  2IA2 A;  2ZMV A;  5GHY A;  1IEM A;  2VLG A;  3TE8 A;  4N1X A;  2Z2L B;  2EFU A;  4Y17 A;  1DJC A;  4Q8I A;  2V9A A;  2WYX A;  4RA7 A;  3PTE A;  4X56 A;  2WUQ A;  3G35 A;  5FAQ A;  4EEU A;  3VP1 A;  2ZQ7 A;  5HWV A;  3V3S A;  1CQA A;  1SZV A;  2BLS A;  2HP5 A;  4GD8 A;  2HDQ A;  4GLQ A;  2LB5 A;  3BFD A;  4HH2 A;  1NLZ A;  4X1L A;  2FFF B;  4IBX A;  4H6J A;  1DJB A;  5EV0 A;  1S4S A;  4GS9 B;  4RX2 A;  5E2F A;  4BD1 A;  3MXR A;  3LEQ A;  3T4J A;  5EOE A;  4ETX A;  4EWF A;  4K08 A;  4CLC C;  3DTE A;  4DE1 A;  1ZG4 A;  5FSR A;  4FUW A;  1TS0 A;  3LI9 A;  2HP6 A;  3HUN A;  3SH7 A;  4QPR A;  1T1A A;  2V1Z A;  3D4F A;  3E4Q A;  4GCZ A;  3V5M A;  2Y2I A;  5DKK A;  1AWI A;  2Z6D A;  3NOU C;  2W3F A;  4EEP A;  4OP8 A;  1M40 A;  3TJZ C;  4BMW A;  3H9W A;  4OPZ A;  4BJP A;  3E4P A;  3NHQ A;  5EVI D;  3DWK A;  2HDR A;  4EUV A;  1YKD A;  1T18 A;  2W3H A;  2IWD A;  1F2K A;  4KQR A;  2XK1 A;  1MXO A;  1MWR A;  4JGO A;  4LV2 A;  4P6Z M;  1XPB A;  2W3D A;  4DE0 A;  2ZBB A;  1WE4 A;  3QHY A;  2JKT I;  3F1P A;  2ZQ9 A;  1OTE A;  1L0G A;  4RX3 A;  1G6A A;  1ESU A;  1YM1 A;  4LLO B;  3ZG9 B;  2HV1 A;  3Q81 A;  3QP8 A;  4ZJ2 A;  4OPR A;  5GLB A;  5A8B A;  1TS6 A;  1E25 A;  2PR6 A;  3MBZ A;  1JWV A;  2A2L A;  3P98 A;  1YSQ A;  1QMF A;  3HVF A;  4Z1W A;  2GX5 A;  5IS1 A;  3S22 A;  3W2Z A;  4RYE A;  1LSW A;  1FCM A;  3ITA A;  2P08 A;  3W4P A;  1LI9 A;  3IF6 A;  2W1T B;  5CER A;  4D2O A;  4O01 A;  4UA7 A;  2PYP A;  3IF6 C;  4GN2 A;  4E3I A;  3VSK A;  3RFB A;  4K0W A;  1STZ A;  4OQG A;  2H0T A;  4MCW A;  1VEU B;  3G31 A;  1U60 A;  4KZ8 A;  3HLD A;  3JVV A;  4B93 A;  1FR6 A;  3PXP A;  1TS7 A;  4HIA A;  3RTY A;  4LPZ A;  3K3D A;  4C75 A;  3BEC A;  2J80 A;  5IU1 A;  2Y2H A;  4EQI A;  1ESI A;  2J9O A;  1XP4 A;  3I7J A;  5M1A A;  2WZZ A;  3A3F A;  5F1F A;  4DXC A;  1G6O A;  1XA7 A;  3VOL A;  4KEN B;  4HBT A;  1D06 A;  1BT5 A;  2ZOI A;  1O07 A;  4HP9 A;  2XLN A;  2XD1 A;  4S2L A;  5HWT A;  3CZD A;  2V1B A;  5CHJ A;  3G4P A;  1BLS A;  1W8Q A;  2BAS A;  4PKY A;  1S66 L;  4GDB A;  2XH9 A;  4WEK A;  3MFX A;  3JYI A;  4CLC E;  5HD5 A;  4O0P A;  5TR7 A;  2HP9 A;  4ARZ B;  1BLP A;  2PRF A;  2VX8 A;  4D60 A;  4UA9 A;  2MJ6 A;  2JKF A;  3IXH A;  4I38 A;  1ONH A;  2XD5 A;  4HJ3 A;  4NKP A;  4P6Z S;  4OP5 A;  4NEE D;  1IEL A;  2W1R A;  1FR1 A;  5FQQ A;  4GS9 A;  5FQJ A;  1L0E A;  4KZB A;  4KQO A;  4KZA A;  1RGY A;  1K54 A;  3BJN A;  2Q0O A;  2J9P A;  1TVF A;  3E0Y A;  1K54 C;  2JE5 A;  2PR5 A;  3NJA A;  3IX4 A;  5HX9 A;  5EE8 A;  2WGV A;  4ZDX A;  5J3W A;  2O9A A;  4ZJ3 A;  2O9C A;  5AJG A;  1PYY A;  4B4Z A;  1S4R A;  1X0O A;  3IS2 A;  4WBG A;  2R78 A;  5F68 A;  5FL3 A;  4OLD A;  1YLZ A;  2GZA A;  2IWB A;  3CHW P;  4KZ4 A;  2EWW A;  2HDU A;  3UNW A;  3W4O A;  4CLC B;  2ZJ9 A;  3AGE A;  2OAP 1;  2Y2K A;  2K7S A;  3UDF A;  2AVX A;  2B02 A;  4YWZ A;  1P9W A;  3IQA A;  2B5R A;  2XEP A;  1Q2P A;  3JVU A;  3V67 A;  2H10 A;  3B42 A;  4OON A;  4R3J A;  2A3U A;  1PW8 A;  1MC0 A;  5FDS A;  3O88 A;  5FA7 A;  5HD3 A;  1LL5 A;  3UO9 A;  3WS1 A;  4Y3I A;  4ZAM A;  3VFF A;  5EVI B;  4U0X A;  1SDE A;  4IVK A;  1XA1 A;  3N8R A;  4L9E A;  2QZ6 A;  3N8S A;  1J3W A;  2PBY A;  1I2S A;  4K0X A;  1DY6 A;  3GTC A;  4YOF A;  2V20 A;  5EPH A;  1KE0 A;  3C38 A;  2Y2P A;  5HL1 A;  3NIA A;  3RXX A;  3HUO A;  4PM7 A;  4MLL A;  2A24 B;  2WK0 A;  2VA0 A;  3MKF A;  1LI0 A;  4R3A A;  4EUZ A;  3LCE A;  5CTM A;  4LRZ E;  2FZ0 A;  3G2Y A;  1CK3 A;  2VGK A;  1K4F A;  4C6Y A;  3FPW A;  4B88 A;  3PBR A;  2HGV A;  3ZVT A;  1KVL A;  3OCN A;  1NJ4 A;  1XX2 A;  1MBL A;  4MBF A;  1BYW A;  5EFW A;  1UWN X;  3O5Y A;  2OWJ A;  5HZH A;  1F5M A;  1O7E A;  4OPQ A; 
#chains in the Genus database with same CATH homology
 3C30 A;  5MC7 A;  4H6J A;  4DJ3 A;  4F3L B;  3CUE A;  1LSX A;  2OOL A;  4HI4 A;  1DP6 A;  3LIF A;  2PD8 A;  3KX0 X;  1S4S A;  1V9Y A;  4NXB A;  3KSF A;  2G7U A;  4GS9 B;  2Y8H A;  1XJ3 A;  5LBR A;  3CUE C;  3MQQ A;  3LFV A;  3CLO A;  3T4J A;  4ETX A;  4K08 A;  3BY8 A;  1G28 A;  3BWL A;  4IJG A;  4CLC C;  4ME4 A;  3T4K A;  1S1Y A;  3C8C A;  3OC2 A;  4IUH A;  1JNU A;  3LUQ A;  1TS0 A;  3LI9 A;  5CX7 A;  4HHD A;  4WN5 A;  3LI8 A;  2QKP A;  4QPR A;  1OT6 A;  4HP4 A;  3UB6 A;  4IUK A;  1T1C A;  1T1A A;  5KIZ A;  4H6J B;  5I5L A;  3E4Q A;  4GCZ A;  2EA9 A;  1LT0 A;  5DKK A;  4I5S A;  1N9O A;  2JKR M;  3U2A A;  2Z6D A;  3NOU C;  2W3F A;  2NUT C;  4EEP A;  1DRM A;  3CWF A;  3R7W B;  4G3W A;  3MQO A;  3TJZ C;  2WKQ A;  4BMW A;  3H9W A;  2GJ3 A;  1MKM A;  3UB8 A;  3GEC A;  2J3W A;  4BJP A;  3E4P A;  4MN5 A;  3PBQ A;  3NHQ A;  2M7V A;  2HF6 A;  4EUV A;  1YKD A;  4ARZ A;  2O99 A;  1T18 A;  2I9V A;  2W3H A;  3EQU A;  5J7E A;  4G3V A;  2JN7 A;  2QWS A;  2J3T C;  2QYB A;  4JGO A;  4P6Z M;  3MF0 A;  3F1O A;  4WUJ A;  3LIE A;  1P9R A;  2XSS A;  5HPF A;  3CAX A;  2W3D A;  1W63 M;  4OOM A;  5F5Y A;  4XT2 A;  2ZBB A;  2V1A A;  3T4Q A;  3T4L A;  3LR4 A;  2JKT I;  4II7 A;  1XJ4 A;  3F1P A;  4OOL A;  2V0U A;  3DBA A;  3BY9 A;  3K2N A;  1OTE A;  1S67 L;  2LB9 A;  3KSH A;  2W3G A;  3B47 A;  3UB9 A;  2DMW A;  5DF9 A;  3PBS A;  2VZW A;  1N9L A;  4GHI A;  5G4Z A;  4LLO B;  2L1M A;  3NOP C;  4KUK A;  2HV1 A;  3G6O A;  2L0W A;  4L0L A;  1UWP X;  4Y5F A;  1S1Z A;  1P97 A;  4I3A A;  5TBM B;  2W1T A;  3S7P A;  3BQA A;  5A8B A;  1YAX A;  3D72 A;  3OCL A;  4XT2 B;  2QJ5 A;  3A0R A;  4HOI A;  5HDD A;  1TS6 A;  2ZMF A;  1NWZ A;  2INW A;  2PR6 A;  1GSX A;  4BBV A;  5F69 A;  2A2L A;  3SW1 A;  3H7W B;  4IHQ A;  1YSQ A;  4R6L A;  4Z1W A;  2D02 A;  2YKH A;  1YSP A;  4HY8 A;  2HJ9 C;  2GX5 A;  5IS1 A;  2PD7 A;  4GW9 A;  3W2Z A;  2NUP C;  4HJ6 A;  2XRN A;  1XJ6 A;  1LSW A;  4CLC A;  4E04 A;  3TW8 A;  3HJI A;  2P08 A;  3HCY A;  4DMZ A;  2W1T B;  5C5K A;  2XA7 M;  4O01 A;  3LR0 A;  1OJ5 A;  4EQ1 A;  4MMN A;  4WL9 A;  3MJQ A;  2PYP A;  1TS8 A;  2W0N A;  2PDR A;  4HQA A;  2VV8 A;  3RFB A;  3H82 A;  1STZ A;  4DJ2 A;  3E4O A;  2GNX A;  3B33 A;  4MCW A;  3LR5 A;  5DJT A;  2ZOH A;  5DJU A;  3JVV A;  4B93 A;  3A0V A;  3K3C A;  3E98 A;  3PXP A;  1TS7 A;  2WKP A;  2V0W A;  4HIA A;  3RTY A;  3UE3 A;  1OTD A;  4LPZ A;  2WKR A;  2P04 A;  3K3D A;  2P7J A;  5HPI A;  4HJ4 A;  3EQV A;  3PHY A;  2J80 A;  5IU1 A;  4LRX C;  1XFN A;  3PBO A;  1DP9 A;  3PYP A;  4EES A;  4JGP A;  4WEJ A;  4BBU A;  2XA7 S;  3CIT A;  1H3Q A;  5IT5 A;  1W63 Q;  5L8M A;  1G6O A;  3CI6 A;  3VOL A;  1D06 A;  2ZOI A;  3R4K A;  3F1N A;  3FC7 A;  4HP9 A;  4L9G A;  4ETZ A;  3S7Q A;  1NLY A;  3UMD A;  2VJW A;  1OTB A;  3IBR A;  2A24 A;  2M1C A;  3MR0 A;  5HWT A;  2YKF A;  5TJJ A;  1OPX A;  2V1B A;  1VHM A;  4PAU A;  2VV6 A;  4L9F A;  1DP8 A;  2BAS A;  4PKY A;  2VV7 A;  3TRC A;  1S66 L;  3EEA A;  5K5B A;  1ZTU A;  5AVF A;  4WEK A;  2B18 A;  2OAQ 1;  3MFX A;  1GSV A;  5HD5 A;  4CLC E;  4KQD A;  4O0P A;  2VEA A;  3T4S A;  2JHE A;  2VGL M;  2KOI A;  1Y28 A;  4ARZ B;  2JKR I;  4DN0 A;  2KX6 A;  1F9I A;  4Q0H A;  2EWV A;  2VX8 A;  3ICY A;  3F1N B;  1TF1 A;  4EU0 A;  5G4Y A;  2MJ6 A;  3F1O B;  3LIA A;  3KSG A;  4I38 A;  2QJ7 A;  4HJ3 A;  4NKP A;  4P6Z S;  1V9Z A;  3LYX A;  4F3L A;  4NEE D;  2W1R A;  4ZRR A;  3P7N A;  3KSI A;  3EOI A;  2KDK A;  4GS9 A;  3F1P B;  4KQO A;  3MQ0 A;  2W27 A;  1T19 A;  3C2W A;  3BJN A;  3PBN A;  2Y79 A;  1MZU A;  2KLI A;  5J4E A;  4GHI B;  3E0Y A;  1NRJ A;  5HDC A;  5HWW A;  2PR5 A;  3NJA A;  4UQI M;  3MXQ A;  2VGL S;  1XFQ A;  3OBF A;  1KOU A;  4NXE A;  4G3K A;  5J3W A;  2O9A A;  5HSQ A;  3PR6 A;  5F6A A;  1XJ2 A;  2O9C A;  3LID A;  5AJG A;  2QHK A;  1OJG A;  2Z6C A;  3RH8 B;  3MMH A;  1S4R A;  1WA9 A;  1X0O A;  4EW7 A;  4I39 A;  2CMN A;  3IS2 A;  2W3E A;  3T4O A;  2R78 A;  3T4T A;  3P01 A;  5F68 A;  3ZYT A;  5FL3 A;  3R7W A;  3PBT A;  2GZA A;  1LL8 A;  1ODV A;  2K2N A;  4NXF A;  4CLC D;  2EWW A;  3EGX C;  4EER A;  4EET B;  4RQ9 A;  5DFX A;  1OT9 A;  4NXG A;  4BWI A;  4CLC B;  2FH5 A;  1EW0 A;  3EWK A;  4EXO A;  1F98 A;  2OAP 1;  1IFQ A;  2JKT M;  2L4R A;  2K7S A;  2H28 A;  3LIB A;  3KYQ A;  4UQI S;  3BW6 A;  4MDZ A;  2OWH A;  3S7N A;  2B02 A;  4O8G A;  4YWZ A;  1P9W A;  4HH3 A;  3JVU A;  4Y2F A;  3ULF A;  2O9B A;  3IS2 B;  3V67 A;  4WF0 A;  4R70 A;  3B42 A;  4JGQ A;  3H82 B;  5DKL A;  2VKS A;  5HDS A;  3KO6 A;  4I3I A;  1D7E A;  1MC0 A;  4Q0I A;  3S7O A;  5AVE A;  5HD3 A;  3IBJ A;  1IOU A;  4I3J A;  4Y3I A;  3OOV A;  2D01 A;  1OTI A;  4PKY G;  1TD5 A;  4MN7 A;  3NOT C;  2PYR A;  2PT7 A;  1VB6 A;  3ZQ5 A;  4L9E A;  1GSW A;  2K31 A;  2J3T D;  4Q0J A;  5TBM A;  4R38 A;  4M4X A;  2M7U A;  3EEH A;  4WEL A;  3VE3 A;  4LRY C;  3FG8 A;  2XRO A;  1ZHH B;  4YOF A;  3LR3 A;  4FSF A;  4UEY A;  1OTA A;  4AFI A;  3C38 A;  3GDI A;  3HJK A;  3VV4 A;  4BBT A;  1T1B A;  4MN6 A;  2IA2 A;  3H7W A;  2ZMV A;  2A24 B;  2VLG A;  2VA0 A;  1UGU A;  3TE8 A;  4R3A A;  2HJE A;  3EGD C;  4B9O A;  4LRZ E;  1LSV A;  2FZ0 A;  4GJ4 A;  3OLO A;  3KYZ A;  2V9A A;  4HNB A;  3UME A;  3T50 A;  3FPW A;  3PBR A;  2HGV A;  3UE6 A;  1N9N A;  3FPV A;  3BQ8 A;  4WLA A;  4JGR A;  4EEU A;  5DFY A;  4FOF A;  5HWV A;  4CQH A;  3LIC A;  3OCN A;  3VE4 A;  3D3O A;  1H8M A;  4GLQ A;  2O0Y A;  4YNR A;  1BYW A;  2LB5 A;  5EFW A;  4PHT A;  2PHY A;  5KSH A;  1UWN X;  3O5Y A;  2OWJ A;  4HH2 A;  1NLZ A;  1P0Z A;  4KUO A;  5HL6 A;  5HZH A;  1F5M A;  3UB7 A;  3A0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...