1W7FA

Crystal structure of the class a beta-lactamase bs3 inhibited with isocitrate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
molecule tags Hydrolase
publication title Crystal Structure of the Class a Beta-Lactamase Bs3 Bs3 Inhibited with Isocitrate
rcsb
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1w7fA00
1PIOA 4EWFA 5FSRA 3Q7ZA 2HDUA 4E3NA 3N6IA 3WS4A 2VGJA 3WS2A 1W8YA 3UE0A 4S2LA 1TVFA 4X56A 4MLLA 3CJMA 1EWZA 5FQJA 5HW3A 2I72A 1RGZA 3PAGA 4GNUA 4P0MA 5D3OA 4GDNA 1JTGA 3SS3A 4JXSA 5G18A 4ZAMA 5E2EA 2WAFA 4OPQA 4IBXA 3UPOA 5IHVA 3D4FA 3JYIA 1K57A 2XD1A 5L2FA 5DTSA 5TFQA 4BQMA 4WM9A 2Y2LA 3NY4A 4EUZA 1DJAA 1KGEA 3CZDA 5FDHA 2Z2LB 3GSGA 4BD0A 4LV1A 2ZC7A 3HLBA 4WMCD 3PBRA 4KZ3A 1NZOA 4PMAA 4B88A 5EVIC 1ZKJA 4ZJ2A 3GVBA 2WGWA 1GA9A 4JXGA 4LCLA 4OPRA 4HBUA 4E3MA 1W7FA 5EVLA 1O7EA 2A49A 5CHUA 3M2KA 4CPKA 3IQAA 4UA7A 5CECA 1AXBA 4UA9A 3C7UA 4K0WA 4WMCA 4OLDA 4RX3A 4UAAA 4KZ5A 5HL1A 3CMZA 4JF4A 1JWZA 5EOOA 2JE5A 3SH9A 1K55A 3EQVA 4A5RA 1YQSA 2ZQAA 3UPPA 3FYZA 4M3KA 4OKPA 5DF9A 2Y2KA 4N1HA 3BECA 3Q81A 1K6SA 2Y2IA 4GD6A 5CEDA 1SHVA 1Q2PA 3FV7A 1MKIA 1YLZA 4K91A 1ERMA 4WEJA 3W4PA 4C6YA 4OQIA 1H8YA 4WBGA 3IWIA 1ESUA 3FWLA 4OONA 1BUEA 4ZJ1A 4BD1A 1NY0A 4WYYA 1K38A 4C75A 4L0LA 1FQGA 4R4RA 3ZG7B 2A3UA 2ZQ8A 3ZG9B 1GCEA 3OCNA 2EX6A 3V50A 3W4QA 4MEZA 1GHPA 3TSGA 3UE1A 1SDNA 4B4XA 5FAOA 5M18A 5GLAA 4S2KA 1Y54A 1CEGA 1NJ4A 1ZG6A 3BLMA 1YMXA 4KZ9A 4OQ0A 5F1GA 4E3IA 3FKWA 2Y4AA 5HAIA 1G6AA 1RP5A 4D2OA 4N1XA 1NXYA 1TEMA 5GLCA 1BULA 1Z6FA 4UHUA 1BSGA 1VQQA 4DE1A 4EBLA 2Q9MA 4GDBA 2BLSA 3W8KA 4LENA 5CXWA 4ZTKA 3UE3A 3WWXA 3VP1A 3VSKA 2WGIA 4KENB 4KZAA 4O7DA 2HP6A 5KZHA 5FQKA 3HLFA 1I5QA 3DW0A 3IF6A 5FATA 2OV5A 3ZG5A 3Q82A 4KG6A 4OLGA 3V3RA 5KSCA 1KGGA 2ZQ9A 4S2NA 5FQ9A 2Z2MB 1ES2A 4QHCA 5DTTA 5AQ9A 1PYYA 3VMAA 5E43A 2HP9A 3ZGAB 1WYBA 4X6TA 5GHYA 1K56D 3A3IA 4JXVA 3C5AA 2Y59A 4PM9A 1FOFA 4MBKA 3LEZA 1FCMA 4E3OA 3HL9A 2EXBA 4DDYA 3IF6C 4JLFA 3M2JA 5TGFA 3VFHA 3IXBA 4OP5A 1JWVA 4KZ8A 3N8LA 1TDGA 2XR0A 1IELA 1S0WA 3IHBA 3M6HA 4NETA 1K6RA 4EQIA 5FAQA 5FQMA 4Y0TA 2ZQ7A 1BZAA 3MZEA 2XD5A 5EECA 2EX2A 3DWKA 3E2LA 1GA0A 5HARA 2IWCA 3IXGA 1NYYA 5I94A 4ZBEA 5CTMA 3OPRA 5AQAA 4E3JA 1DY6A 3Q07A 3ZG8B 4S2MA 2QZ6A 1C3BA 1XA7A 4OVDA 4FCFA 1CI9A 3BFFA 3V5MA 2J9OA 4PM6A 4DE3A 5KSHA 3IF6B 2FFYA 3N7WA 2H0YA 2OLUA 1XKZA 4PM5A 3GQZA 1N9BA 4H8RA 3FKVA 1WYCA 4WZ4A 5GHZA 3UDIA 3HLDA 1ZG4A 1E3UD 4X69A 4QB8A 1O07A 5HAPA 2WKIA 4DRTA 4FH4A 1IKIA 2EFXA 4JF6A 3BRMA 5J8XA 3QHYA 2J8YA 2X01A 5FASA 1MBLA 4IBRA 1XXMA 2Y55A 3NIAA 1FR1A 1LL9A 2Y2OA 5FQIA 4N9KA 3LO7A 1YT4A 4OQGA 3BM6A 4R3JA 3WS0A 2E8IA 2XQZA 4WZ5C 5CHMA 1L2SA 5FAPA 5BOHA 3OPHA 4U3TA 1PI5A 3A3JA 1DJCA 3AGDA 2WADA 1FR6A 2X02A 3IT9A 4FH2A 1LL5A 2Q9NA 5M1AA 4Z9QA 4KG2A 1XGIA 1IYOA 3PBNA 5AQ7A 3G34A 3N8RA 5E2HA 2H10A 2ZC3B 3ITAA 3CG5A 3DTMA 1LI0A 1BLHA 2X71A 4WZ5A 3WS1A 3DWZA 5EVIA 1H5XA 5FI6A 5CRFA 4JBFA 4OP8A 5EVID 1JWPA 4YINA 2WK0A 1HZOA 4S2PA 1MWTA 1PW1A 1ES3A 3O88A 4Y7PA 3SOIA 3UO9A 3ZNYA 1EI5A 1W79A 3VP2A 5FA7A 4DE0A 2Y2PA 4GKUA 2V1ZA 4KZBA 3MKFA 4C3QA 3W4OA 3UN7A 1XX2A 3GTCA 4WEKA 2XH9A 4DE2A 4UA6A 2ZQCA 2ZLYA 2ZMAA 1YLTA 3BYDA 4R3BA 3RXXA 5M19A 1ALQA 2ZC6B 2WYXA 2WGVA 1LI9A 3NDEA 4HESA 4RYEA 1WE4A 3S1YA 5A91A 1PZPA 4R1GA 1IKGA 4KQOA 5FI7A 5HAQA 1K54A 2WZZA 1EROA 4EBPA 4GD8A 2XFTA 4K0XA 1L0EA 5CTNA 1FSYA 2J7VA 4LV0A 3IHAA 1CEFA 3ZNTA 1NZUA 3IH9A 4MNRA 3HREA 3O3VA 1HD8A 2H5SA 1XGJA 3VP3A 3UPNA 1KDWA 3VFFA 3MXRA 3UDXA 3NBLA 1BLPA 4XUZA 2XDMA 1K54C 2ZM8A 4MBHA 1PWCA 1IYSA 3HLWA 1KGFA 1YLWA 3PAEA 4E6WA 2WKHA 3MBZA 3FZCA 1K25A 4KQQA 3ZDJA 1HTZA 4PM7A 4P87A 1H8ZA 2P9VB 3NDGA 2Y2GA 3ITBA 1KE4A 1K55C 5CGSA 4E3LA 3O87A 1ZC2A 2ZM0A 4R4SA 5GLDA 4WELA 3GR2A 2EXAA 4OQHA 2DNSA 5CEBA 3PBSA 1IYQA 1KDSA 4DXCA 4E6XA 1XP4A 2C5WB 3LCEA 2XGNA 3WRZA 2V20A 4JF5A 3MFDA 3B3XA 3HUNA 5EVIB 3SH8A 4LV2A 5A93A 4HBTA 4KZ7A 4Q8IA 1KVMA 2J9PA 4OH0A 5DF8A 4BL2A 5A92A 3UNWA 5F82A 3HUOA 1GHIA 3IF5A 1YLJA 5E2GA 3BEBA 5CHJA 1L0GA 1E25A 2XFSA 1K4EA 3NCKA 1K56A 2ZM2A 4DXBA 2HPBA 4KZ6A 1JVJA 4RX2A 1J9MA 3P09A 4Y0OA 3VP4A 2R9XA 1NRFA 3G35A 4S2OA 2P74A 1KE3A 1M6KA 3MZDA 4JKTA 3BFEA 3IWQA 3QNBA 4N92A 1W8QA 2G2WA 3ZG0A 3GV9A 2Y2JA 5GHXA 2HDSA 2H0TA 3IXHA 3HLCA 3V39A 4XXRA 1CI8A 3ZFZA 2ZQDA 3HLGA 1L0FA 1HVBA 3IXDA 2QMIA 4BJPA 2VGKA 4IVIA 4N9LA 3Q7VB 2C6WB 3PBQA 4QU3A 5CERA 4XUXA 4X55A 3HLEA 4LV3A 4NK3A 4BENA 5E2FA 2PU4A 3A3FA 1PWGA 2IWDA 4P85A 2B5RA 1LLBA 1ESIA 4CJNA 3OPPA 3OZHA 2FFFB 3N8SA 1PW8A 3I7JA 3N4IA 3G31A 4U0XA 1MWUA 4PPRA 4LCMA 3C7VA 3OC2A 1RCJA 4JPMA 5AQBA 3PBOA 1MXOA 2OLVA 2Y2QA 1ERQA 4OOLA 2Y2NA 5JYPA 5DTKA 1NYMA 3P98A 3ZVWA 4KG5A 5HFOA 1KVLA 3SS5A 2QPNA 3BFCA 3ZCZA 2JCHA 2JC7A 3AGFA 3TG9A 2WKEA 1I2SA 3Q7VA 4X68A 1GHMA 1BLSA 1SCWA 4B4ZA 3OPLA 4GN2A 3SH7A 2G2UA 1YLYA 1SDEA 4YFMA 2CC1A 3MKEA 3NI9A 3UY6A 2Y91A 3NC8A 4GOGA 5JYOA 1DJBA 4X53A 1RGYA 3HBRA 1LHYA 4QJGA 2ZC5B 3AGEA 2WAEA 1MY8A 5CGWA 2HP5A 3VOZA 1CK3A 3S4XA 2PU2A 5EUAA 3Q1FA 2BG1A 1ONGA 3V3SA 2P9VA 4FD8A 3M6BA 1K4FA 4MBFA 3VSLA 3TOIA 3ISGA 4PM8A 4EV4A 4JXWA 1ES4A 1ES5A 2V2FF 3A3EA 4IEDA 4KQRA 2JBFA 4QD4A 1Q2QA 4S2IA 4ZDXA 5F83A 1S6RA 5EE8A 1E3UA 1OMEA 4FSFA 2EX9A 4Y0UA 4E3KA 2OSUA 4DDSA 3IWOA 3WS5A 1YM1A 1TDLA 3S22A 1MWRA 5HX9A 5A90A 4S2NC 3A3DA 3ZVTA 4RVAA 5DVAA 2IWBA 1IYPA 2EX8A 4ID4A 4RA7A 3GRJA 1E4DA 3OCLA 3G4PA 3PBTA 1PZOA 1XA1A 1KE0A 2Y2MA 4BLMA 1FCNA 5GL9A 3VP0A 2XF3A 1BTLA 3GMWA 2XK1A 4IVKA 2DRWA 5EPHA 3ZHHA 5FI2A 2WUQA 1G68A 1FCOA 3BFGA 4BL3A 3SS4A 3O86A 1N4OA 4U0TA 1I2WA 5KMWA 1K57C 1PWDA 2HDQA 1BLCA 2PBYA 1VM1A 2HDRA 2WZXA 5F1FA 2GDNA 4OPYA 2EFUA 4OPZA 2ZD8A 3BLSA 1YLPA 1IEMA 5U47A 3E2KA 4QY5A 1U60A 3EQUA 4F94A 1JTDA 4GZBA 3BFDA 4DF6A 5FQQA 4OOYA 2R9WA 3LY4A 1PI4A 1YMSA 3LY3A 1L0DA 3PTEA 4R0QA 3G2ZA 3WRTA 3QNCA 3RJUA 4R23A 5DF7A 5GLBA 1QMFA 1MWSA 2ZC4B 1QMEA 1SKFA 2Y2HA 2WGWB 4HEFA 4S2JA 3UDFA 2ZJ9A 3G30A 3G32A 4EBNA 4DKIA 3HVFA 2DCFA 1M40A 3HUMA 4P6BA 3G2YA 5TR7A 4KZ4A 5EOEA 1BT5A 2XEPA 2RL3A 1XPBA 2RCXA 3C4PA 1FSWA 4OOMA 2UWXA 3MXSA 3MZFA 1W5DA 1ONHA 5CGXA 3VOYA 4GB7A 3C4OA 1MPLA 3IH8A 3RXWA 2XLNA 4ZJ3A 4QY6A
chains in the Genus database with same CATH superfamily
2YKFA 3Q7ZA 3TW8A 3U4LP 4NXFA 3WS2A 4HNBA 5HW3A 5FQJA 2HJ9C 2P7JA 3PAGA 2K2NA 5D3OA 4GDNA 1JTGA 5HDSA 3JYIA 3DBAA 4EUZA 3CZDA 5FDHA 2Z2LB 3GSGA 4UQIM 3QP5A 4LV1A 2BTFP 4KZ3A 4PMAA 4H6JA 4Y5FA 1BYWA 4R38A 1UGUA 4Y2FA 3KSFA 5FL3A 5CHUA 3M2KA 4HP4A 3IQAA 4CPKA 2WKPA 3C7UA 4Y15A 3CMZA 3F1PA 1JWZA 3UMEA 2JE5A 1YSQA 1K55A 3EQVA 1YQSA 5DF9A 2Y2KA 4N1HA 3BECA 5AVFA 2Y2IA 3KYEA 4GD6A 1SHVA 1ERMA 3W4PA 4OQIA 4ARZA 3FWLA 4R4RA 2A3UA 2L1MA 3ZG9B 3OCNA 4UEYA 4MEZA 1GHPA 3TSGA 3UE1A 1SDNA 1J3WA 5FAOA 3S7QA 2O9BA 1NJ4A 4BBTA 2Y4AA 5HAIA 4N1XA 2ZMVA 3H9WA 1Z6FA 5GLCA 1OT6A 4CLCD 3F1OA 3C2WA 2VJWA 5AJGA 3A0VA 3VSKA 3R7WB 1ZHHB 1I5QA 3ZG5A 2ZQ9A 2PR5A 5AQ9A 1PYYA 2E8JA 3H7WA 3C5AA 4PM9A 1FOFA 3U2AA 3NJAA 2ZBBA 3IF6C 1TF1A 2WKQA 3M2JA 4ME4A 2XA7S 3IXBA 1JWVA 3T1SA 3IHBA 3M6HA 4EQIA 4Y0TA 2EX2A 3E2LA 2OWHA 3EOIA 2VV7A 3KX0X 4E3JA 3LIEA 1DY6A 4EUVA 4S2MA 2QZ6A 1XA7A 4OVDA 2CMNA 5KSHA 1NRJA 3MQOA 3N7WA 3MS6A 4EW7A 1XKZA 3FKVA 5GHZA 3OLOA 3UDIA 1ZG4A 1MZUA 2JKRM 4JF6A 2PD8A 2Y55A 1G6OA 5FQIA 4N9KA 3LO7A 3BM6A 5J3WA 5CHMA 2A2LA 4U3TA 1IYOA 3N8RA 1GSWA 3PHYA 5E2HA 2ZC3B 2I9VA 3CG5A 1MWTA 3G6OA 4D60A 1EI5A 1N9LA 2O99A 2V1ZA 4JGRA 4NEED 1XX2A 2W3EA 4DE2A 2ZQCA 2ZLYA 1HLUP 5M19A 2ZC6B 2ZOHA 4EXOA 3NDEA 1YSPA 3S1YA 3DAVA 2WZZA 4EBPA 2XFTA 4K0XA 1UWPX 4G3WA 3ZNTA 1NZUA 5F6AA 4MNRA 1W63M 2K7SA 3VP3A 1KDWA 3UDXA 4WLAA 4XUZA 2XDMA 2ZM8A 4BMWA 4MBHA 1PWCA 3FZCA 5TJJA 2W3FA 4P87A 3KO6A 1KE4A 1CF0A 2EWVA 4OQHA 3E0YA 3WRZA 3BQAA 3KSIA 3IS2B 3B3XA 4LV2A 2GX5A 5A92A 5F82A 3S7OA 1GHIA 2FZ0A 1L0GA 1E25A 1K4EA 3NCKA 4Y0OA 1FIKA 2R9XA 4S2OA 2P74A 1W8QA 2G2WA 3ZG0A 3GV9A 3IXHA 1CI8A 2P04A 4KQDA 3IXDA 3UB5P 4N9LA 4ETXA 2C6WB 3NOUC 1D1JA 3H7WB 4CJNA 2FFFB 1PW8A 3ULFA 1D7EA 3D3OA 4PPRA 3C7VA 1LSXA 3PBOA 3ZVWA 2A24B 1KVLA 3ZCZA 2JCHA 2JC7A 3TG9A 1I2SA 3Q7VA 1GHMA 3NHQA 4B93A 2V8FA 4YFMA 3SW1A 1T19A 3UY6A 5JYOA 4HJ3A 1RGYA 2HZ5A 2WAEA 3VOZA 4FTXA 3Q1FA 2XA7M 2BG1A 3V3SA 1K4FA 4LLOB 3ISGA 1OTIA 4FUWA 4EV4A 1VB6A 2NUPC 1ES4A 4IEDA 1Z09A 4GCZA 1S6RA 5J4EA 5EE8A 1E3UA 1OMEA 3C8CA 4E3KA 2OSUA 4DDSA 1TDLA 3K3DA 4S2NC 5DVAA 2J3TC 3QP2A 2HV1A 3PBTA 3O5YA 3OBFA 3VP0A 2XK1A 3ZHHA 5FI2A 2PRFA 2WUQA 4B9OA 1T1CA 4R3AA 3A0SA 3C38A 1VHMA 1LSVA 5F1FA 4X25A 5U47A 5LBRA 2PDRA 3E2KA 1U60A 3NOTC 2R9WA 3T4JA 3LY4A 4EEPA 1PI4A 5L07A 3LY3A 1L0DA 3G2ZA 3WRTA 3RJUA 4R23A 2IA2A 1MWSA 1QMEA 1SKFA 3HJKA 4S2JA 3T12B 4EBNA 3HVFA 5EOEA 2XEPA 2V9AA 3B33A 2VV6A 3LI8A 4X1MA 4YWZA 4HOIA 4NXBA 1ONHA 4R3JA 4ZJ3A 4QY6A 3BQ8A 4E3NA 3N6IA 3WS4A 3QP4A 4S2LA 3LEQA 4MLLA 3CJMA 4WN5A 2I72A 4P0MA 3SS3A 4ZAMA 3UPOA 5TFQA 3E4OA 4WM9A 1N9OA 4I38A 4EESA 4O0PA 4BD0A 4WMCD 3PBRA 4CLCE 4B88A 3CLOA 4JXGA 4HBUA 4ETZA 4UA7A 4UA9A 4OLDA 1ZTUA 4DMZA 5G4ZA 5F69A 3SH9A 2ZQAA 3UPPA 4OKPA 3Q81A 1K6SA 5CEDA 1Q2PA 1MKIA 3SZTA 4C6YA 4WBGA 1ESUA 3LIAA 4WYYA 4C75A 5DJUA 2ZQ8A 1GCEA 2EX6A 3V50A 2W1TA 1SZVA 4S2KA 1CEGA 4KZ9A 3BLMA 4NKPA 1YMXA 2VGLM 4E3IA 1G6AA 1RP5A 1NXYA 1TEMA 1LT0A 4UHUA 1VQQA 3LR0A 4NG2A 4YNRA 3QP1A 3W8KA 1CQAA 5F68A 4ZTKA 3WWXA 3VP1A 4KENB 2HP6A 5FQKA 3HLFA 2OV5A 5FATA 4KUKA 4X1LA 5KSCA 4S2NA 2Z2MB 2K31A 5E43A 3ZGAB 1WYBA 5GHYA 1K56D 3NOPC 2Y59A 3UB8A 3W2ZA 1VETB 1FCMA 2EXBA 4JLFA 5TGFA 2J3WA 5HWVA 1FILA 4GLQA 1CJFA 4MCWA 4KZ8A 3N8LA 2A24A 1XJ2A 4NETA 1TD5A 5FAQA 3KSGA 2XD5A 5EECA 1GA0A 5HARA 5AQAA 3BFFA 4DE3A 3UB7A 3IF6B 4Y13A 2H0YA 1N9BA 3HLDA 4X69A 1E3UD 4QB8A 4I5SA 1O07A 5HAPA 1N9NA 4DRTA 5EFWA 2EFXA 2W27A 3BRMA 1L3LA 5J8XA 4LRYC 2XQZA 4WZ5C 3EEAA 3OPHA 3A3JA 1DJCA 4FH2A 2Q9NA 1XGIA 5AQ7A 5HSQA 3S7PA 2H10A 3ITAA 2X71A 1H5XA 5EVID 4YINA 2WK0A 4S2PA 3SOIA 3O88A 3UO9A 2VLGA 4HIAA 1W79A 3VP2A 5FA7A 3PYPA 5HPFA 4GKUA 2PAVP 3UN7A 1YLTA 4R3BA 4NXEA 1LI9A 1WE4A 1MKMA 4R1GA 4KQOA 5FI7A 1K54A 1ACFA 5DJTA 4LV0A 5HWTA 1CEFA 1HD8A 3KYZA 3VFFA 3MXRA 3NBLA 1BLPA 5L10A 1KGFA 1K25A 4PM7A 2V1BA 1H8ZA 2J3TD 2Y2GA 5I5LA 1K55C 3O87A 2ZM0A 3K3CA 5GLDA 1S67L 4HI4A 1WA9A 1KDSA 1XP4A 2XGNA 1A0KA 3MFDA 1H3QA 3HUNA 4GHIB 5EVIB 3TE8A 4Q8IA 5DF8A 4OH0A 5EV0A 5DKKA 1YLJA 4HP9A 5CHJA 4R70A 1JVJA 3P09A 1TS7A 1KE3A 1M6KA 3BFEA 3IWQA 4HHDA 2HF6A 2Y2JA 4XXRA 5AVEA 2VGKA 4F3LA 4QU3A 5CERA 4XUXA 4X55A 3HLEA 3CI6A 4LV3A 3A3FA 1STZA 1S66L 1PWGA 2IWDA 4IJGA 2V0UA 1LLBA 3VE3A 2ZL1B 1MWUA 4LCMA 1RCJA 5AQBA 1MXOA 4OOLA 3FC7A 3MJQA 5HFOA 4GS9B 3BFCA 2WKEA 3SH7A 1TS8A 1YLYA 2Y91A 3NC8A 4QJGA 3AGEA 3MXQA 2L4RA 4L9EA 3IBRA 1ONGA 2XSSA 3VSLA 3TOIA 2PHYA 4JXWA 3A3EA 3P01A 4QD4A 4S2IA 1S1YA 4HH2A 2EX9A 4Y0UA 4JGPA 1YM1A 3S22A 5HX9A 5A90A 3ZVTA 2VGLS 1IYPA 3F1PB 1T1BA 1SKOB 3G4PA 4BLMA 1XA1A 2Y2MA 2DRWA 2Q0OA 1G68A 3LGOA 2VV8A 1T18A 3BFGA 4BL3A 1S4SA 5FEFA 1PWDA 1DP9A 1ODVA 2HDRA 5L8MA 2GDNA 4OPZA 4L9GA 3NULA 3PR6A 3JVVA 3EQUA 4F94A 1JTDA 4DF6A 1F5MA 1GSXA 4OOYA 4XT2B 1YMSA 3E98A 4R0QA 4M4XA 1QMFA 3UDFA 3JVUA 4NXGA 3ZYTA 2DCFA 2JKTI 3HUMA 2LB9A 1DP6A 5KIZA 1OTDA 4PKYA 4Z1WA 2UWXA 2EWWA 5CGXA 4GB7A 4QPRA 3IH8A 3JPUA 1PIOA 5FSRA 2XRNA 2HDUA 2VGJA 1W8YA 4DN0A 4X56A 3IX4A 1RGZA 2G7UA 5HDDA 4GNUA 3T4TA 4JXSA 3VV4A 4JGOA 1IFQA 3EGXC 3EEHA 3D4FA 2XD1A 5L2FA 5DTSA 4BQMA 1DJAA 1PFLA 1KGEA 1Y4OA 3QP6A 4PHTA 2PD7A 5FEGA 1NZOA 5HD3A 4IHQA 1ZKJA 3GVBA 1GA9A 4I3IA 4LCLA 4OPRA 4E3MA 5EVLA 1O7EA 2PYPA 3MFXA 4WMCA 4RX3A 4KZ5A 4JF4A 3FYZA 3EWKA 3FV7A 4K91A 1F9IA 4EERA 4WEJA 3IWIA 2VK3A 4ZJ1A 1NY0A 4MMNA 1K38A 3LI9A 4L0LA 1YKDA 3VOLA 3LR3A 5M18A 1Y54A 5F1GA 4OQ0A 4D2OA 3F1OB 1BULA 3LR5A 4EBLA 1BSGA 4GDBA 4E04A 2BLSA 4LENA 2O9AA 4KZAA 1OJGA 3DW0A 3IF6A 3Q82A 4OLGA 3ICYA 1ES2A 3MR0A 2HP9A 4X6TA 4EEUA 4JXVA 3DTEA 3HL9A 3ZQ5A 3CAXA 2M7UA 1AWIA 2XR0A 5FQMA 3MZEA 2ZQ7A 1BZAA 2EA9A 1JNUA 1S4RA 3DWKA 1P9RA 3UB6A 5I94A 3OPRA 3Q07A 2PBDP 3ZG8B 3KSHA 1C3BA 4HJ6A 2J9OA 3E4PA 2FFYA 2OLUA 4PM5A 4H8RA 4WZ4A 1T1AA 2JKGA 4Q0IA 4KUOA 3LUQA 2WKIA 1OTEA 2PYRA 2INWA 4FH4A 1IKIA 3QHYA 2J8YA 2X01A 5FASA 1MBLA 5IT5A 4IBRA 1FR1A 1YT4A 3WS0A 4O01A 1XJ3A 1L2SA 5BOHA 3AGDA 2VEAA 1FR6A 2WADA 2X02A 3IT9A 4Z9QA 5DFYA 3PBNA 1UWNX 3G34A 2KDKA 4EQ1A 3R7WA 3RTYA 1LSWA 2YKHA 1BLHA 4WZ5A 3WS1A 5FI6A 5CRFA 1ES3A 3T4KA 3ZNYA 2L0WA 3BY8A 4DE0A 2QWSA 4KZBA 4C3QA 3MKFA 3GTCA 2QHKA 4LPZA 2D01A 4UA6A 2B95A 2JKFA 3BYDA 1ALQA 2WGVA 4RYEA 5A91A 5HAQA 1EROA 1TS6A 1L0EA 5CTNA 1YAXA 2QJ7A 2J7VA 3IHAA 4CLCA 3O3VA 1K54C 2R78A 3PAEA 2WKHA 1HTZA 3LIBA 3ITBA 5CGSA 4E3LA 5FDSA 4WELA 3GR2A 1IYQA 4DXCA 4E6XA 1V9ZA 3SH8A 3CPTA 5A93A 4KZ7A 4BL2A 3UNWA 3HUOA 3IF5A 5E2GA 3DTKA 3BEBA 3L7HA 1K56A 2HPBA 3IX3A 3VP4A 2Z6CA 3G35A 3LICA 4Q0HA 2KLIA 3MZDA 4ARZB 5GHXA 3V39A 3HLCA 3ZFZA 2ZQDA 1L0FA 2QMIA 4BJPA 3Q7VB 3PBQA 1W63Q 3PXPA 4MN5A 2B5RA 2QYBA 3B47A 3N8SA 4HH3A 3I7JA 3N4IA 3T1QB 5G4YA 4UQIS 3RH8B 2Y2QA 5JYPA 5DTKA 1NYMA 4KG5A 3SS5A 2QPNA 3LYXA 1PRQA 5IU1A 4X68A 1BLSA 1SCWA 1SDEA 4DJ2A 4L9FA 2CC1A 3MKEA 3NI9A 5HZHA 2HP5A 3S4XA 2PU2A 5EUAA 1OTAA 2P9VA 4FD8A 3M6BA 3L9KA 1OT9A 4MBFA 4PM8A 3CUEA 1ES5A 4KQRA 1Q2QA 2M7VA 3IS2A 4GHIA 3WS5A 4WUJA 2Y79A 1MWRA 3A3DA 2IWBA 2QKPA 4ID4A 3GRJA 3MSHA 4HQAA 1PZOA 1KE0A 4GJ4A 1IOUA 3GMWA 4IVKA 5EPHA 2ZL1A 5IS1A 3O86A 4II7A 2B18A 4U0TA 5KMWA 1K57C 1OPXA 3CITA 2HDQA 2PBYA 5C5KA 4CQHA 2ZD8A 4LGWA 1IEMA 2HGVA 3TRCA 4F3LB 4QY5A 3BFDA 5FQQA 1VEUB 4I39A 1LL8A 2Z6DA 3UB9A 5DF7A 2WGWB 4HEFA 2Y8HA 4QWOA 2ZJ9A 1M40A 5TR7A 2OOLA 4KZ4A 1BT5A 2RL3A 1TS0A 3K2NA 2ZMFA 1FSWA 4OOMA 2FH5A 1P9WA 3S7NA 3T4OA 3MXSA 3MZFA 2QJ5A 1KOUA 1MPLA 4LFUA 2XLNA 4EWFA 2M1CA 4R6LA 3UE0A 4I3AA 2HJEA 4HJ4A 1TVFA 1EWZA 3KYQA 4BBUA 2AVXA 2VX8A 5L09A 4FOFA 4BWIA 5G18A 3NECA 5E2EA 2WAFA 5TBMB 4OPQA 4IBXA 5IHVA 1K57A 2W3GA 3CWFA 2Y2LA 5DKLA 3NY4A 2OWJA 4IUHA 5A8BA 1F98A 3R4KA 4WF0A 2ZC7A 3HLBA 5EVIC 4ZJ2A 2WGWA 1W7FA 2A49A 3P7NA 5CECA 1AXBA 3A0RA 4K0WA 5HL1A 1P97A 4UAAA 5EOOA 2JKRI 4A5RA 2V0WA 4M3KA 1G5UA 3OOVA 3VE4A 1YLZA 1P0ZA 1H8YA 2DMWA 4OONA 1BUEA 4BD1A 1FQGA 3ZG7B 2KX6A 3W4QA 4B4XA 3UMDA 5GLAA 1ZG6A 3FKWA 3D72A 2W0NA 2GZAA 4Y3IA 4LRZE 4DE1A 2Q9MA 1V9YA 4BBVA 5CXWA 4GS9A 3UE3A 2WKRA 2WGIA 3H82B 4O7DA 4P6ZM 4AFIA 5HWWA 2GNXA 5KZHA 2VA0A 4KG6A 3V3RA 1KGGA 3GDIA 5FQ9A 4QHCA 5DTTA 3UE6A 1XJ6A 3T4QA 2JHEA 3VMAA 4IUKA 3A3IA 5EVEA 1OJ5A 4MBKA 1X0OA 3LEZA 4E3OA 4DDYA 2V8CA 3VFHA 5HL6A 4ESPA 4OP5A 1TDGA 1IELA 1S0WA 1K6RA 3T4LA 2V1AA 5EM0A 2IWCA 3IXGA 1NYYA 3LIDA 4ZBEA 5CTMA 2PR6A 4MN7A 4FCFA 1CI9A 3V5MA 4G3VA 4PM6A 3GQZA 2OAP1 3MF0A 4YOFA 1WYCA 2J80A 1XFNA 3LIFA 1XFQA 3EGDC 3CUEC 3FPWA 1XXMA 2XROA 3NIAA 1LL9A 2Y2OA 4OQGA 2E8IA 4ZRRA 3F1NA 5FAPA 1PI5A 3D9YA 5M1AA 1LL5A 3E4QA 4CLCC 4KG2A 3FG8A 1NLZA 3DTIA 1GSVA 4GW9A 3DTMA 1LI0A 2VZWA 3DWZA 5EVIA 4CLCB 4JBFA 4OP8A 1JWPA 1HZOA 1PW1A 4Y7PA 3BW6A 2Y2PA 3W4OA 4WEKA 2XH9A 4G3KA 2ZMAA 3RXXA 4K08A 2WYXA 4HESA 1PZPA 1IKGA 2H28A 4GD8A 4H6JB 2BASA 1FSYA 3IH9A 3HREA 2H5SA 3V67A 1XGJA 2B02A 3UPNA 4PAUA 2KOIA 1IYSA 3HLWA 1YLWA 4E6WA 3MBZA 2ZOIA 4KQQA 3F1NB 3ZDJA 2P9VB 4EETB 3NDGA 1XJ4A 1ZC2A 4R4SA 3FPVA 2EXAA 5CEBA 2DNSA 3PBSA 2C5WB 3LCEA 4Y17A 2V20A 4JF5A 3HCYA 3BJNA 4HBTA 5J7EA 1KVMA 2J9PA 5DFXA 2W3HA 1YPRA 2W1TB 4DJ3A 2XFSA 4HY8A 4O8GA 2NUTC 2ZM2A 4DXBA 4KZ6A 4RX2A 1J9MA 1NRFA 3C30A 4JKTA 3QNBA 4N92A 4I3JA 2HDSA 2H0TA 2JN7A 3MQ0A 3HLGA 1MC0A 1HVBA 2D02A 4XT2A 1PNEA 3BY9A 5EM1A 4IVIA 3CHWP 1VETA 4NK3A 4LRXC 4BENA 4RQ9A 5E2FA 2PU4A 4EU0A 4P85A 2W1RA 4Q0JA 1ESIA 3OPPA 3OZHA 3G31A 4U0XA 4PKYG 3OC2A 4JPMA 1D06A 2OLVA 1ERQA 2P08A 2Y2NA 2UV0E 4JGQA 5HPIA 1DP8A 3P98A 4MN6A 1NLYA 1K0KA 1VEUA 3AGFA 3T1XA 3LR4A 4B4ZA 3OPLA 3GECA 5TBMA 4GN2A 2G2UA 3TJZC 3T4SA 3IBJA 4GOGA 1DJBA 4X53A 3HBRA 1LHYA 2ZC5B 1MY8A 5CGWA 1OTBA 5HDCA 1CK3A 2W3DA 3BWLA 1F2KA 3RFBA 3H82A 2V2FF 2MJ6A 4P6ZS 2JBFA 3HJIA 4ZDXA 5F83A 3QP8A 5F5YA 4FSFA 1H0MA 3CPTB 2GJ3A 2LB5A 3IWOA 1Y28A 2ACGA 2VKSA 1EW0A 4RVAA 2EX8A 4RA7A 1E4DA 3OCLA 1FCNA 5HD5A 2PT7A 5GL9A 1H8MA 1BTLA 2XF3A 4WL9A 3T50A 2O0YA 1FCOA 3SS4A 1N4OA 1I2WA 2O9CA 2OAQ1 3T1RA 1BLCA 1VM1A 2WZXA 4OPYA 2EFUA 3B42A 1NWZA 3BLSA 1YLPA 1G28A 4GZBA 1SKOA 3PTEA 3QNCA 1S1ZA 5GLBA 2ZC4B 2Y2HA 3G30A 3G32A 3LFVA 4DKIA 5MC7A 2JKTM 3MQQA 4P6BA 3G2YA 3IX8A 5CX7A 1XPBA 2RCXA 3C4PA 1DRMA 3MMHA 4MDZA 1W5DA 5K5BA 3VOYA 3C4OA 3RXWA
chains in the Genus database with same CATH topology
1PIOA 4EWFA 5FSRA 3Q7ZA 2HDUA 4E3NA 3N6IA 3WS4A 2VGJA 3WS2A 1W8YA 3UE0A 4S2LA 1TVFA 4X56A 4MLLA 3CJMA 1EWZA 5FQJA 5HW3A 2I72A 1RGZA 3PAGA 4GNUA 4P0MA 5D3OA 4GDNA 1JTGA 3SS3A 4JXSA 5G18A 4ZAMA 5E2EA 2WAFA 4OPQA 4IBXA 3UPOA 5IHVA 3D4FA 3JYIA 1K57A 2XD1A 5L2FA 5DTSA 5TFQA 4BQMA 4WM9A 2Y2LA 3NY4A 4EUZA 1DJAA 1KGEA 3CZDA 5FDHA 2Z2LB 3GSGA 4BD0A 4LV1A 2ZC7A 3HLBA 4WMCD 3PBRA 4KZ3A 1NZOA 4PMAA 4B88A 5EVIC 1ZKJA 4ZJ2A 3GVBA 2WGWA 1GA9A 4JXGA 4LCLA 4OPRA 4HBUA 4E3MA 1W7FA 5EVLA 1O7EA 2A49A 5CHUA 3M2KA 4CPKA 3IQAA 4UA7A 5CECA 1AXBA 4UA9A 3C7UA 4K0WA 4WMCA 4OLDA 4RX3A 4UAAA 4KZ5A 5HL1A 3CMZA 4JF4A 1JWZA 5EOOA 2JE5A 3SH9A 1K55A 3EQVA 4A5RA 1YQSA 2ZQAA 3UPPA 3FYZA 4M3KA 4OKPA 5DF9A 2Y2KA 4N1HA 3BECA 3Q81A 1K6SA 2Y2IA 4GD6A 5CEDA 1SHVA 1Q2PA 3FV7A 1MKIA 1YLZA 4K91A 1ERMA 4WEJA 3W4PA 4C6YA 4OQIA 1H8YA 4WBGA 3IWIA 1ESUA 3FWLA 4OONA 1BUEA 4ZJ1A 4BD1A 1NY0A 4WYYA 1K38A 4C75A 4L0LA 1FQGA 4R4RA 3ZG7B 2A3UA 2ZQ8A 3ZG9B 1GCEA 3OCNA 2EX6A 3V50A 3W4QA 4MEZA 1GHPA 3TSGA 3UE1A 1SDNA 4B4XA 5FAOA 5M18A 5GLAA 4S2KA 1Y54A 1CEGA 1NJ4A 1ZG6A 3BLMA 1YMXA 4KZ9A 4OQ0A 5F1GA 4E3IA 3FKWA 2Y4AA 5HAIA 1G6AA 1RP5A 4D2OA 4N1XA 1NXYA 1TEMA 5GLCA 1BULA 1Z6FA 4UHUA 1BSGA 1VQQA 4DE1A 4EBLA 2Q9MA 4GDBA 2BLSA 3W8KA 4LENA 5CXWA 4ZTKA 3UE3A 3WWXA 3VP1A 3VSKA 2WGIA 4KENB 4KZAA 4O7DA 2HP6A 5KZHA 5FQKA 3HLFA 1I5QA 3DW0A 3IF6A 5FATA 2OV5A 3ZG5A 3Q82A 4KG6A 4OLGA 3V3RA 5KSCA 1KGGA 2ZQ9A 4S2NA 5FQ9A 2Z2MB 1ES2A 4QHCA 5DTTA 5AQ9A 1PYYA 3VMAA 5E43A 2HP9A 3ZGAB 1WYBA 4X6TA 5GHYA 1K56D 3A3IA 4JXVA 3C5AA 2Y59A 4PM9A 1FOFA 4MBKA 3LEZA 1FCMA 4E3OA 3HL9A 2EXBA 4DDYA 3IF6C 4JLFA 3M2JA 5TGFA 3VFHA 3IXBA 4OP5A 1JWVA 4KZ8A 3N8LA 1TDGA 2XR0A 1IELA 1S0WA 3IHBA 3M6HA 4NETA 1K6RA 4EQIA 5FAQA 5FQMA 4Y0TA 2ZQ7A 1BZAA 3MZEA 2XD5A 5EECA 2EX2A 3DWKA 3E2LA 1GA0A 5HARA 2IWCA 3IXGA 1NYYA 5I94A 4ZBEA 5CTMA 3OPRA 5AQAA 4E3JA 1DY6A 3Q07A 3ZG8B 4S2MA 2QZ6A 1C3BA 1XA7A 4OVDA 4FCFA 1CI9A 3BFFA 3V5MA 2J9OA 4PM6A 4DE3A 5KSHA 3IF6B 2FFYA 3N7WA 2H0YA 2OLUA 1XKZA 4PM5A 3GQZA 1N9BA 4H8RA 3FKVA 1WYCA 4WZ4A 5GHZA 3UDIA 3HLDA 1ZG4A 1E3UD 4X69A 4QB8A 1O07A 5HAPA 2WKIA 4DRTA 4FH4A 1IKIA 2EFXA 4JF6A 3BRMA 5J8XA 3QHYA 2J8YA 2X01A 5FASA 1MBLA 4IBRA 1XXMA 2Y55A 3NIAA 1FR1A 1LL9A 2Y2OA 5FQIA 4N9KA 3LO7A 1YT4A 4OQGA 3BM6A 4R3JA 3WS0A 2E8IA 2XQZA 4WZ5C 5CHMA 1L2SA 5FAPA 5BOHA 3OPHA 4U3TA 1PI5A 3A3JA 1DJCA 3AGDA 2WADA 1FR6A 2X02A 3IT9A 4FH2A 1LL5A 2Q9NA 5M1AA 4Z9QA 4KG2A 1XGIA 1IYOA 3PBNA 5AQ7A 3G34A 3N8RA 5E2HA 2H10A 2ZC3B 3ITAA 3CG5A 3DTMA 1LI0A 1BLHA 2X71A 4WZ5A 3WS1A 3DWZA 5EVIA 1H5XA 5FI6A 5CRFA 4JBFA 4OP8A 5EVID 1JWPA 4YINA 2WK0A 1HZOA 4S2PA 1MWTA 1PW1A 1ES3A 3O88A 4Y7PA 3SOIA 3UO9A 3ZNYA 1EI5A 1W79A 3VP2A 5FA7A 4DE0A 2Y2PA 4GKUA 2V1ZA 4KZBA 3MKFA 4C3QA 3W4OA 3UN7A 1XX2A 3GTCA 4WEKA 2XH9A 4DE2A 4UA6A 2ZQCA 2ZLYA 2ZMAA 1YLTA 3BYDA 4R3BA 3RXXA 5M19A 1ALQA 2ZC6B 2WYXA 2WGVA 1LI9A 3NDEA 4HESA 4RYEA 1WE4A 3S1YA 5A91A 1PZPA 4R1GA 1IKGA 4KQOA 5FI7A 5HAQA 1K54A 2WZZA 1EROA 4EBPA 4GD8A 2XFTA 4K0XA 1L0EA 5CTNA 1FSYA 2J7VA 4LV0A 3IHAA 1CEFA 3ZNTA 1NZUA 3IH9A 4MNRA 3HREA 3O3VA 1HD8A 2H5SA 1XGJA 3VP3A 3UPNA 1KDWA 3VFFA 3MXRA 3UDXA 3NBLA 1BLPA 4XUZA 2XDMA 1K54C 2ZM8A 4MBHA 1PWCA 1IYSA 3HLWA 1KGFA 1YLWA 3PAEA 4E6WA 2WKHA 3MBZA 3FZCA 1K25A 4KQQA 3ZDJA 1HTZA 4PM7A 4P87A 1H8ZA 2P9VB 3NDGA 2Y2GA 3ITBA 1KE4A 1K55C 5CGSA 4E3LA 3O87A 1ZC2A 2ZM0A 4R4SA 5GLDA 4WELA 3GR2A 2EXAA 4OQHA 2DNSA 5CEBA 3PBSA 1IYQA 1KDSA 4DXCA 4E6XA 1XP4A 2C5WB 3LCEA 2XGNA 3WRZA 2V20A 4JF5A 3MFDA 3B3XA 3HUNA 5EVIB 3SH8A 4LV2A 5A93A 4HBTA 4KZ7A 4Q8IA 1KVMA 2J9PA 4OH0A 5DF8A 4BL2A 5A92A 3UNWA 5F82A 3HUOA 1GHIA 3IF5A 1YLJA 5E2GA 3BEBA 5CHJA 1L0GA 1E25A 2XFSA 1K4EA 3NCKA 1K56A 2ZM2A 4DXBA 2HPBA 4KZ6A 1JVJA 4RX2A 1J9MA 3P09A 4Y0OA 3VP4A 2R9XA 1NRFA 3G35A 4S2OA 2P74A 1KE3A 1M6KA 3MZDA 4JKTA 3BFEA 3IWQA 3QNBA 4N92A 1W8QA 2G2WA 3ZG0A 3GV9A 2Y2JA 5GHXA 2HDSA 2H0TA 3IXHA 3HLCA 3V39A 4XXRA 1CI8A 3ZFZA 2ZQDA 3HLGA 1L0FA 1HVBA 3IXDA 2QMIA 4BJPA 2VGKA 4IVIA 4N9LA 3Q7VB 2C6WB 3PBQA 4QU3A 5CERA 4XUXA 4X55A 3HLEA 4LV3A 4NK3A 4BENA 5E2FA 2PU4A 3A3FA 1PWGA 2IWDA 4P85A 2B5RA 1LLBA 1ESIA 4CJNA 3OPPA 3OZHA 2FFFB 3N8SA 1PW8A 3I7JA 3N4IA 3G31A 4U0XA 1MWUA 4PPRA 4LCMA 3C7VA 3OC2A 1RCJA 4JPMA 5AQBA 3PBOA 1MXOA 2OLVA 2Y2QA 1ERQA 4OOLA 2Y2NA 5JYPA 5DTKA 1NYMA 3P98A 3ZVWA 4KG5A 5HFOA 1KVLA 3SS5A 2QPNA 3BFCA 3ZCZA 2JCHA 2JC7A 3AGFA 3TG9A 2WKEA 1I2SA 3Q7VA 4X68A 1GHMA 1BLSA 1SCWA 4B4ZA 3OPLA 4GN2A 3SH7A 2G2UA 1YLYA 1SDEA 4YFMA 2CC1A 3MKEA 3NI9A 3UY6A 2Y91A 3NC8A 4GOGA 5JYOA 1DJBA 4X53A 1RGYA 3HBRA 1LHYA 4QJGA 2ZC5B 3AGEA 2WAEA 1MY8A 5CGWA 2HP5A 3VOZA 1CK3A 3S4XA 2PU2A 5EUAA 3Q1FA 2BG1A 1ONGA 3V3SA 2P9VA 4FD8A 3M6BA 1K4FA 4MBFA 3VSLA 3TOIA 3ISGA 4PM8A 4EV4A 4JXWA 1ES4A 1ES5A 2V2FF 3A3EA 4IEDA 4KQRA 2JBFA 4QD4A 1Q2QA 4S2IA 4ZDXA 5F83A 1S6RA 5EE8A 1E3UA 1OMEA 4FSFA 2EX9A 4Y0UA 4E3KA 2OSUA 4DDSA 3IWOA 3WS5A 1YM1A 1TDLA 3S22A 1MWRA 5HX9A 5A90A 4S2NC 3A3DA 3ZVTA 4RVAA 5DVAA 2IWBA 1IYPA 2EX8A 4ID4A 4RA7A 3GRJA 1E4DA 3OCLA 3G4PA 3PBTA 1PZOA 1XA1A 1KE0A 2Y2MA 4BLMA 1FCNA 5GL9A 3VP0A 2XF3A 1BTLA 3GMWA 2XK1A 4IVKA 2DRWA 5EPHA 3ZHHA 5FI2A 2WUQA 1G68A 1FCOA 3BFGA 4BL3A 3SS4A 3O86A 1N4OA 4U0TA 1I2WA 5KMWA 1K57C 1PWDA 2HDQA 1BLCA 2PBYA 1VM1A 2HDRA 2WZXA 5F1FA 2GDNA 4OPYA 2EFUA 4OPZA 2ZD8A 3BLSA 1YLPA 1IEMA 5U47A 3E2KA 4QY5A 1U60A 3EQUA 4F94A 1JTDA 4GZBA 3BFDA 4DF6A 5FQQA 4OOYA 2R9WA 3LY4A 1PI4A 1YMSA 3LY3A 1L0DA 3PTEA 4R0QA 3G2ZA 3WRTA 3QNCA 3RJUA 4R23A 5DF7A 5GLBA 1QMFA 1MWSA 2ZC4B 1QMEA 1SKFA 2Y2HA 2WGWB 4HEFA 4S2JA 3UDFA 2ZJ9A 3G30A 3G32A 4EBNA 4DKIA 3HVFA 2DCFA 1M40A 3HUMA 4P6BA 3G2YA 5TR7A 4KZ4A 5EOEA 1BT5A 2XEPA 2RL3A 1XPBA 2RCXA 3C4PA 1FSWA 4OOMA 2UWXA 3MXSA 3MZFA 1W5DA 1ONHA 5CGXA 3VOYA 4GB7A 3C4OA 1MPLA 3IH8A 3RXWA 2XLNA 4ZJ3A 4QY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIO A;  4EWF A;  5FSR A;  3Q7Z A;  2HDU A;  4E3N A;  3N6I A;  3WS4 A;  2VGJ A;  3WS2 A;  1W8Y A;  3UE0 A;  4S2L A;  1TVF A;  4X56 A;  4MLL A;  3CJM A;  1EWZ A;  5FQJ A;  5HW3 A;  2I72 A;  1RGZ A;  3PAG A;  4GNU A;  4P0M A;  5D3O A;  4GDN A;  1JTG A;  3SS3 A;  4JXS A;  5G18 A;  4ZAM A;  5E2E A;  2WAF A;  4OPQ A;  4IBX A;  3UPO A;  5IHV A;  3D4F A;  3JYI A;  1K57 A;  2XD1 A;  5L2F A;  5DTS A;  5TFQ A;  4BQM A;  4WM9 A;  2Y2L A;  3NY4 A;  4EUZ A;  1DJA A;  1KGE A;  3CZD A;  5FDH A;  2Z2L B;  3GSG A;  4BD0 A;  4LV1 A;  2ZC7 A;  3HLB A;  4WMC D;  3PBR A;  4KZ3 A;  1NZO A;  4PMA A;  4B88 A;  5EVI C;  1ZKJ A;  4ZJ2 A;  3GVB A;  2WGW A;  1GA9 A;  4JXG A;  4LCL A;  4OPR A;  4HBU A;  4E3M A;  1W7F A;  5EVL A;  1O7E A;  2A49 A;  5CHU A;  3M2K A;  4CPK A;  3IQA A;  4UA7 A;  5CEC A;  1AXB A;  4UA9 A;  3C7U A;  4K0W A;  4WMC A;  4OLD A;  4RX3 A;  4UAA A;  4KZ5 A;  5HL1 A;  3CMZ A;  4JF4 A;  1JWZ A;  5EOO A;  2JE5 A;  3SH9 A;  1K55 A;  3EQV A;  4A5R A;  1YQS A;  2ZQA A;  3UPP A;  3FYZ A;  4M3K A;  4OKP A;  5DF9 A;  2Y2K A;  4N1H A;  3BEC A;  3Q81 A;  1K6S A;  2Y2I A;  4GD6 A;  5CED A;  1SHV A;  1Q2P A;  3FV7 A;  1MKI A;  1YLZ A;  4K91 A;  1ERM A;  4WEJ A;  3W4P A;  4C6Y A;  4OQI A;  1H8Y A;  4WBG A;  3IWI A;  1ESU A;  3FWL A;  4OON A;  1BUE A;  4ZJ1 A;  4BD1 A;  1NY0 A;  4WYY A;  1K38 A;  4C75 A;  4L0L A;  1FQG A;  4R4R A;  3ZG7 B;  2A3U A;  2ZQ8 A;  3ZG9 B;  1GCE A;  3OCN A;  2EX6 A;  3V50 A;  3W4Q A;  4MEZ A;  1GHP A;  3TSG A;  3UE1 A;  1SDN A;  4B4X A;  5FAO A;  5M18 A;  5GLA A;  4S2K A;  1Y54 A;  1CEG A;  1NJ4 A;  1ZG6 A;  3BLM A;  1YMX A;  4KZ9 A;  4OQ0 A;  5F1G A;  4E3I A;  3FKW A;  2Y4A A;  5HAI A;  1G6A A;  1RP5 A;  4D2O A;  4N1X A;  1NXY A;  1TEM A;  5GLC A;  1BUL A;  1Z6F A;  4UHU A;  1BSG A;  1VQQ A;  4DE1 A;  4EBL A;  2Q9M A;  4GDB A;  2BLS A;  3W8K A;  4LEN A;  5CXW A;  4ZTK A;  3UE3 A;  3WWX A;  3VP1 A;  3VSK A;  2WGI A;  4KEN B;  4KZA A;  4O7D A;  2HP6 A;  5KZH A;  5FQK A;  3HLF A;  1I5Q A;  3DW0 A;  3IF6 A;  5FAT A;  2OV5 A;  3ZG5 A;  3Q82 A;  4KG6 A;  4OLG A;  3V3R A;  5KSC A;  1KGG A;  2ZQ9 A;  4S2N A;  5FQ9 A;  2Z2M B;  1ES2 A;  4QHC A;  5DTT A;  5AQ9 A;  1PYY A;  3VMA A;  5E43 A;  2HP9 A;  3ZGA B;  1WYB A;  4X6T A;  5GHY A;  1K56 D;  3A3I A;  4JXV A;  3C5A A;  2Y59 A;  4PM9 A;  1FOF A;  4MBK A;  3LEZ A;  1FCM A;  4E3O A;  3HL9 A;  2EXB A;  4DDY A;  3IF6 C;  4JLF A;  3M2J A;  5TGF A;  3VFH A;  3IXB A;  4OP5 A;  1JWV A;  4KZ8 A;  3N8L A;  1TDG A;  2XR0 A;  1IEL A;  1S0W A;  3IHB A;  3M6H A;  4NET A;  1K6R A;  4EQI A;  5FAQ A;  5FQM A;  4Y0T A;  2ZQ7 A;  1BZA A;  3MZE A;  2XD5 A;  5EEC A;  2EX2 A;  3DWK A;  3E2L A;  1GA0 A;  5HAR A;  2IWC A;  3IXG A;  1NYY A;  5I94 A;  4ZBE A;  5CTM A;  3OPR A;  5AQA A;  4E3J A;  1DY6 A;  3Q07 A;  3ZG8 B;  4S2M A;  2QZ6 A;  1C3B A;  1XA7 A;  4OVD A;  4FCF A;  1CI9 A;  3BFF A;  3V5M A;  2J9O A;  4PM6 A;  4DE3 A;  5KSH A;  3IF6 B;  2FFY A;  3N7W A;  2H0Y A;  2OLU A;  1XKZ A;  4PM5 A;  3GQZ A;  1N9B A;  4H8R A;  3FKV A;  1WYC A;  4WZ4 A;  5GHZ A;  3UDI A;  3HLD A;  1ZG4 A;  1E3U D;  4X69 A;  4QB8 A;  1O07 A;  5HAP A;  2WKI A;  4DRT A;  4FH4 A;  1IKI A;  2EFX A;  4JF6 A;  3BRM A;  5J8X A;  3QHY A;  2J8Y A;  2X01 A;  5FAS A;  1MBL A;  4IBR A;  1XXM A;  2Y55 A;  3NIA A;  1FR1 A;  1LL9 A;  2Y2O A;  5FQI A;  4N9K A;  3LO7 A;  1YT4 A;  4OQG A;  3BM6 A;  4R3J A;  3WS0 A;  2E8I A;  2XQZ A;  4WZ5 C;  5CHM A;  1L2S A;  5FAP A;  5BOH A;  3OPH A;  4U3T A;  1PI5 A;  3A3J A;  1DJC A;  3AGD A;  2WAD A;  1FR6 A;  2X02 A;  3IT9 A;  4FH2 A;  1LL5 A;  2Q9N A;  5M1A A;  4Z9Q A;  4KG2 A;  1XGI A;  1IYO A;  3PBN A;  5AQ7 A;  3G34 A;  3N8R A;  5E2H A;  2H10 A;  2ZC3 B;  3ITA A;  3CG5 A;  3DTM A;  1LI0 A;  1BLH A;  2X71 A;  4WZ5 A;  3WS1 A;  3DWZ A;  5EVI A;  1H5X A;  5FI6 A;  5CRF A;  4JBF A;  4OP8 A;  5EVI D;  1JWP A;  4YIN A;  2WK0 A;  1HZO A;  4S2P A;  1MWT A;  1PW1 A;  1ES3 A;  3O88 A;  4Y7P A;  3SOI A;  3UO9 A;  3ZNY A;  1EI5 A;  1W79 A;  3VP2 A;  5FA7 A;  4DE0 A;  2Y2P A;  4GKU A;  2V1Z A;  4KZB A;  3MKF A;  4C3Q A;  3W4O A;  3UN7 A;  1XX2 A;  3GTC A;  4WEK A;  2XH9 A;  4DE2 A;  4UA6 A;  2ZQC A;  2ZLY A;  2ZMA A;  1YLT A;  3BYD A;  4R3B A;  3RXX A;  5M19 A;  1ALQ A;  2ZC6 B;  2WYX A;  2WGV A;  1LI9 A;  3NDE A;  4HES A;  4RYE A;  1WE4 A;  3S1Y A;  5A91 A;  1PZP A;  4R1G A;  1IKG A;  4KQO A;  5FI7 A;  5HAQ A;  1K54 A;  2WZZ A;  1ERO A;  4EBP A;  4GD8 A;  2XFT A;  4K0X A;  1L0E A;  5CTN A;  1FSY A;  2J7V A;  4LV0 A;  3IHA A;  1CEF A;  3ZNT A;  1NZU A;  3IH9 A;  4MNR A;  3HRE A;  3O3V A;  1HD8 A;  2H5S A;  1XGJ A;  3VP3 A;  3UPN A;  1KDW A;  3VFF A;  3MXR A;  3UDX A;  3NBL A;  1BLP A;  4XUZ A;  2XDM A;  1K54 C;  2ZM8 A;  4MBH A;  1PWC A;  1IYS A;  3HLW A;  1KGF A;  1YLW A;  3PAE A;  4E6W A;  2WKH A;  3MBZ A;  3FZC A;  1K25 A;  4KQQ A;  3ZDJ A;  1HTZ A;  4PM7 A;  4P87 A;  1H8Z A;  2P9V B;  3NDG A;  2Y2G A;  3ITB A;  1KE4 A;  1K55 C;  5CGS A;  4E3L A;  3O87 A;  1ZC2 A;  2ZM0 A;  4R4S A;  5GLD A;  4WEL A;  3GR2 A;  2EXA A;  4OQH A;  2DNS A;  5CEB A;  3PBS A;  1IYQ A;  1KDS A;  4DXC A;  4E6X A;  1XP4 A;  2C5W B;  3LCE A;  2XGN A;  3WRZ A;  2V20 A;  4JF5 A;  3MFD A;  3B3X A;  3HUN A;  5EVI B;  3SH8 A;  4LV2 A;  5A93 A;  4HBT A;  4KZ7 A;  4Q8I A;  1KVM A;  2J9P A;  4OH0 A;  5DF8 A;  4BL2 A;  5A92 A;  3UNW A;  5F82 A;  3HUO A;  1GHI A;  3IF5 A;  1YLJ A;  5E2G A;  3BEB A;  5CHJ A;  1L0G A;  1E25 A;  2XFS A;  1K4E A;  3NCK A;  1K56 A;  2ZM2 A;  4DXB A;  2HPB A;  4KZ6 A;  1JVJ A;  4RX2 A;  1J9M A;  3P09 A;  4Y0O A;  3VP4 A;  2R9X A;  1NRF A;  3G35 A;  4S2O A;  2P74 A;  1KE3 A;  1M6K A;  3MZD A;  4JKT A;  3BFE A;  3IWQ A;  3QNB A;  4N92 A;  1W8Q A;  2G2W A;  3ZG0 A;  3GV9 A;  2Y2J A;  5GHX A;  2HDS A;  2H0T A;  3IXH A;  3HLC A;  3V39 A;  4XXR A;  1CI8 A;  3ZFZ A;  2ZQD A;  3HLG A;  1L0F A;  1HVB A;  3IXD A;  2QMI A;  4BJP A;  2VGK A;  4IVI A;  4N9L A;  3Q7V B;  2C6W B;  3PBQ A;  4QU3 A;  5CER A;  4XUX A;  4X55 A;  3HLE A;  4LV3 A;  4NK3 A;  4BEN A;  5E2F A;  2PU4 A;  3A3F A;  1PWG A;  2IWD A;  4P85 A;  2B5R A;  1LLB A;  1ESI A;  4CJN A;  3OPP A;  3OZH A;  2FFF B;  3N8S A;  1PW8 A;  3I7J A;  3N4I A;  3G31 A;  4U0X A;  1MWU A;  4PPR A;  4LCM A;  3C7V A;  3OC2 A;  1RCJ A;  4JPM A;  5AQB A;  3PBO A;  1MXO A;  2OLV A;  2Y2Q A;  1ERQ A;  4OOL A;  2Y2N A;  5JYP A;  5DTK A;  1NYM A;  3P98 A;  3ZVW A;  4KG5 A;  5HFO A;  1KVL A;  3SS5 A;  2QPN A;  3BFC A;  3ZCZ A;  2JCH A;  2JC7 A;  3AGF A;  3TG9 A;  2WKE A;  1I2S A;  3Q7V A;  4X68 A;  1GHM A;  1BLS A;  1SCW A;  4B4Z A;  3OPL A;  4GN2 A;  3SH7 A;  2G2U A;  1YLY A;  1SDE A;  4YFM A;  2CC1 A;  3MKE A;  3NI9 A;  3UY6 A;  2Y91 A;  3NC8 A;  4GOG A;  5JYO A;  1DJB A;  4X53 A;  1RGY A;  3HBR A;  1LHY A;  4QJG A;  2ZC5 B;  3AGE A;  2WAE A;  1MY8 A;  5CGW A;  2HP5 A;  3VOZ A;  1CK3 A;  3S4X A;  2PU2 A;  5EUA A;  3Q1F A;  2BG1 A;  1ONG A;  3V3S A;  2P9V A;  4FD8 A;  3M6B A;  1K4F A;  4MBF A;  3VSL A;  3TOI A;  3ISG A;  4PM8 A;  4EV4 A;  4JXW A;  1ES4 A;  1ES5 A;  2V2F F;  3A3E A;  4IED A;  4KQR A;  2JBF A;  4QD4 A;  1Q2Q A;  4S2I A;  4ZDX A;  5F83 A;  1S6R A;  5EE8 A;  1E3U A;  1OME A;  4FSF A;  2EX9 A;  4Y0U A;  4E3K A;  2OSU A;  4DDS A;  3IWO A;  3WS5 A;  1YM1 A;  1TDL A;  3S22 A;  1MWR A;  5HX9 A;  5A90 A;  4S2N C;  3A3D A;  3ZVT A;  4RVA A;  5DVA A;  2IWB A;  1IYP A;  2EX8 A;  4ID4 A;  4RA7 A;  3GRJ A;  1E4D A;  3OCL A;  3G4P A;  3PBT A;  1PZO A;  1XA1 A;  1KE0 A;  2Y2M A;  4BLM A;  1FCN A;  5GL9 A;  3VP0 A;  2XF3 A;  1BTL A;  3GMW A;  2XK1 A;  4IVK A;  2DRW A;  5EPH A;  3ZHH A;  5FI2 A;  2WUQ A;  1G68 A;  1FCO A;  3BFG A;  4BL3 A;  3SS4 A;  3O86 A;  1N4O A;  4U0T A;  1I2W A;  5KMW A;  1K57 C;  1PWD A;  2HDQ A;  1BLC A;  2PBY A;  1VM1 A;  2HDR A;  2WZX A;  5F1F A;  2GDN A;  4OPY A;  2EFU A;  4OPZ A;  2ZD8 A;  3BLS A;  1YLP A;  1IEM A;  5U47 A;  3E2K A;  4QY5 A;  1U60 A;  3EQU A;  4F94 A;  1JTD A;  4GZB A;  3BFD A;  4DF6 A;  5FQQ A;  4OOY A;  2R9W A;  3LY4 A;  1PI4 A;  1YMS A;  3LY3 A;  1L0D A;  3PTE A;  4R0Q A;  3G2Z A;  3WRT A;  3QNC A;  3RJU A;  4R23 A;  5DF7 A;  5GLB A;  1QMF A;  1MWS A;  2ZC4 B;  1QME A;  1SKF A;  2Y2H A;  2WGW B;  4HEF A;  4S2J A;  3UDF A;  2ZJ9 A;  3G30 A;  3G32 A;  4EBN A;  4DKI A;  3HVF A;  2DCF A;  1M40 A;  3HUM A;  4P6B A;  3G2Y A;  5TR7 A;  4KZ4 A;  5EOE A;  1BT5 A;  2XEP A;  2RL3 A;  1XPB A;  2RCX A;  3C4P A;  1FSW A;  4OOM A;  2UWX A;  3MXS A;  3MZF A;  1W5D A;  1ONH A;  5CGX A;  3VOY A;  4GB7 A;  3C4O A;  1MPL A;  3IH8 A;  3RXW A;  2XLN A;  4ZJ3 A;  4QY6 A; 
#chains in the Genus database with same CATH topology
 2YKF A;  3Q7Z A;  3TW8 A;  3U4L P;  4NXF A;  3WS2 A;  4HNB A;  5HW3 A;  5FQJ A;  2HJ9 C;  2P7J A;  3PAG A;  2K2N A;  5D3O A;  4GDN A;  1JTG A;  5HDS A;  3JYI A;  3DBA A;  4EUZ A;  3CZD A;  5FDH A;  2Z2L B;  3GSG A;  4UQI M;  3QP5 A;  4LV1 A;  2BTF P;  4KZ3 A;  4PMA A;  4H6J A;  4Y5F A;  1BYW A;  4R38 A;  1UGU A;  4Y2F A;  3KSF A;  5FL3 A;  5CHU A;  3M2K A;  4HP4 A;  3IQA A;  4CPK A;  2WKP A;  3C7U A;  4Y15 A;  3CMZ A;  3F1P A;  1JWZ A;  3UME A;  2JE5 A;  1YSQ A;  1K55 A;  3EQV A;  1YQS A;  5DF9 A;  2Y2K A;  4N1H A;  3BEC A;  5AVF A;  2Y2I A;  3KYE A;  4GD6 A;  1SHV A;  1ERM A;  3W4P A;  4OQI A;  4ARZ A;  3FWL A;  4R4R A;  2A3U A;  2L1M A;  3ZG9 B;  3OCN A;  4UEY A;  4MEZ A;  1GHP A;  3TSG A;  3UE1 A;  1SDN A;  1J3W A;  5FAO A;  3S7Q A;  2O9B A;  1NJ4 A;  4BBT A;  2Y4A A;  5HAI A;  4N1X A;  2ZMV A;  3H9W A;  1Z6F A;  5GLC A;  1OT6 A;  4CLC D;  3F1O A;  3C2W A;  2VJW A;  5AJG A;  3A0V A;  3VSK A;  3R7W B;  1ZHH B;  1I5Q A;  3ZG5 A;  2ZQ9 A;  2PR5 A;  5AQ9 A;  1PYY A;  2E8J A;  3H7W A;  3C5A A;  4PM9 A;  1FOF A;  3U2A A;  3NJA A;  2ZBB A;  3IF6 C;  1TF1 A;  2WKQ A;  3M2J A;  4ME4 A;  2XA7 S;  3IXB A;  1JWV A;  3T1S A;  3IHB A;  3M6H A;  4EQI A;  4Y0T A;  2EX2 A;  3E2L A;  2OWH A;  3EOI A;  2VV7 A;  3KX0 X;  4E3J A;  3LIE A;  1DY6 A;  4EUV A;  4S2M A;  2QZ6 A;  1XA7 A;  4OVD A;  2CMN A;  5KSH A;  1NRJ A;  3MQO A;  3N7W A;  3MS6 A;  4EW7 A;  1XKZ A;  3FKV A;  5GHZ A;  3OLO A;  3UDI A;  1ZG4 A;  1MZU A;  2JKR M;  4JF6 A;  2PD8 A;  2Y55 A;  1G6O A;  5FQI A;  4N9K A;  3LO7 A;  3BM6 A;  5J3W A;  5CHM A;  2A2L A;  4U3T A;  1IYO A;  3N8R A;  1GSW A;  3PHY A;  5E2H A;  2ZC3 B;  2I9V A;  3CG5 A;  1MWT A;  3G6O A;  4D60 A;  1EI5 A;  1N9L A;  2O99 A;  2V1Z A;  4JGR A;  4NEE D;  1XX2 A;  2W3E A;  4DE2 A;  2ZQC A;  2ZLY A;  1HLU P;  5M19 A;  2ZC6 B;  2ZOH A;  4EXO A;  3NDE A;  1YSP A;  3S1Y A;  3DAV A;  2WZZ A;  4EBP A;  2XFT A;  4K0X A;  1UWP X;  4G3W A;  3ZNT A;  1NZU A;  5F6A A;  4MNR A;  1W63 M;  2K7S A;  3VP3 A;  1KDW A;  3UDX A;  4WLA A;  4XUZ A;  2XDM A;  2ZM8 A;  4BMW A;  4MBH A;  1PWC A;  3FZC A;  5TJJ A;  2W3F A;  4P87 A;  3KO6 A;  1KE4 A;  1CF0 A;  2EWV A;  4OQH A;  3E0Y A;  3WRZ A;  3BQA A;  3KSI A;  3IS2 B;  3B3X A;  4LV2 A;  2GX5 A;  5A92 A;  5F82 A;  3S7O A;  1GHI A;  2FZ0 A;  1L0G A;  1E25 A;  1K4E A;  3NCK A;  4Y0O A;  1FIK A;  2R9X A;  4S2O A;  2P74 A;  1W8Q A;  2G2W A;  3ZG0 A;  3GV9 A;  3IXH A;  1CI8 A;  2P04 A;  4KQD A;  3IXD A;  3UB5 P;  4N9L A;  4ETX A;  2C6W B;  3NOU C;  1D1J A;  3H7W B;  4CJN A;  2FFF B;  1PW8 A;  3ULF A;  1D7E A;  3D3O A;  4PPR A;  3C7V A;  1LSX A;  3PBO A;  3ZVW A;  2A24 B;  1KVL A;  3ZCZ A;  2JCH A;  2JC7 A;  3TG9 A;  1I2S A;  3Q7V A;  1GHM A;  3NHQ A;  4B93 A;  2V8F A;  4YFM A;  3SW1 A;  1T19 A;  3UY6 A;  5JYO A;  4HJ3 A;  1RGY A;  2HZ5 A;  2WAE A;  3VOZ A;  4FTX A;  3Q1F A;  2XA7 M;  2BG1 A;  3V3S A;  1K4F A;  4LLO B;  3ISG A;  1OTI A;  4FUW A;  4EV4 A;  1VB6 A;  2NUP C;  1ES4 A;  4IED A;  1Z09 A;  4GCZ A;  1S6R A;  5J4E A;  5EE8 A;  1E3U A;  1OME A;  3C8C A;  4E3K A;  2OSU A;  4DDS A;  1TDL A;  3K3D A;  4S2N C;  5DVA A;  2J3T C;  3QP2 A;  2HV1 A;  3PBT A;  3O5Y A;  3OBF A;  3VP0 A;  2XK1 A;  3ZHH A;  5FI2 A;  2PRF A;  2WUQ A;  4B9O A;  1T1C A;  4R3A A;  3A0S A;  3C38 A;  1VHM A;  1LSV A;  5F1F A;  4X25 A;  5U47 A;  5LBR A;  2PDR A;  3E2K A;  1U60 A;  3NOT C;  2R9W A;  3T4J A;  3LY4 A;  4EEP A;  1PI4 A;  5L07 A;  3LY3 A;  1L0D A;  3G2Z A;  3WRT A;  3RJU A;  4R23 A;  2IA2 A;  1MWS A;  1QME A;  1SKF A;  3HJK A;  4S2J A;  3T12 B;  4EBN A;  3HVF A;  5EOE A;  2XEP A;  2V9A A;  3B33 A;  2VV6 A;  3LI8 A;  4X1M A;  4YWZ A;  4HOI A;  4NXB A;  1ONH A;  4R3J A;  4ZJ3 A;  4QY6 A;  3BQ8 A;  4E3N A;  3N6I A;  3WS4 A;  3QP4 A;  4S2L A;  3LEQ A;  4MLL A;  3CJM A;  4WN5 A;  2I72 A;  4P0M A;  3SS3 A;  4ZAM A;  3UPO A;  5TFQ A;  3E4O A;  4WM9 A;  1N9O A;  4I38 A;  4EES A;  4O0P A;  4BD0 A;  4WMC D;  3PBR A;  4CLC E;  4B88 A;  3CLO A;  4JXG A;  4HBU A;  4ETZ A;  4UA7 A;  4UA9 A;  4OLD A;  1ZTU A;  4DMZ A;  5G4Z A;  5F69 A;  3SH9 A;  2ZQA A;  3UPP A;  4OKP A;  3Q81 A;  1K6S A;  5CED A;  1Q2P A;  1MKI A;  3SZT A;  4C6Y A;  4WBG A;  1ESU A;  3LIA A;  4WYY A;  4C75 A;  5DJU A;  2ZQ8 A;  1GCE A;  2EX6 A;  3V50 A;  2W1T A;  1SZV A;  4S2K A;  1CEG A;  4KZ9 A;  3BLM A;  4NKP A;  1YMX A;  2VGL M;  4E3I A;  1G6A A;  1RP5 A;  1NXY A;  1TEM A;  1LT0 A;  4UHU A;  1VQQ A;  3LR0 A;  4NG2 A;  4YNR A;  3QP1 A;  3W8K A;  1CQA A;  5F68 A;  4ZTK A;  3WWX A;  3VP1 A;  4KEN B;  2HP6 A;  5FQK A;  3HLF A;  2OV5 A;  5FAT A;  4KUK A;  4X1L A;  5KSC A;  4S2N A;  2Z2M B;  2K31 A;  5E43 A;  3ZGA B;  1WYB A;  5GHY A;  1K56 D;  3NOP C;  2Y59 A;  3UB8 A;  3W2Z A;  1VET B;  1FCM A;  2EXB A;  4JLF A;  5TGF A;  2J3W A;  5HWV A;  1FIL A;  4GLQ A;  1CJF A;  4MCW A;  4KZ8 A;  3N8L A;  2A24 A;  1XJ2 A;  4NET A;  1TD5 A;  5FAQ A;  3KSG A;  2XD5 A;  5EEC A;  1GA0 A;  5HAR A;  5AQA A;  3BFF A;  4DE3 A;  3UB7 A;  3IF6 B;  4Y13 A;  2H0Y A;  1N9B A;  3HLD A;  4X69 A;  1E3U D;  4QB8 A;  4I5S A;  1O07 A;  5HAP A;  1N9N A;  4DRT A;  5EFW A;  2EFX A;  2W27 A;  3BRM A;  1L3L A;  5J8X A;  4LRY C;  2XQZ A;  4WZ5 C;  3EEA A;  3OPH A;  3A3J A;  1DJC A;  4FH2 A;  2Q9N A;  1XGI A;  5AQ7 A;  5HSQ A;  3S7P A;  2H10 A;  3ITA A;  2X71 A;  1H5X A;  5EVI D;  4YIN A;  2WK0 A;  4S2P A;  3SOI A;  3O88 A;  3UO9 A;  2VLG A;  4HIA A;  1W79 A;  3VP2 A;  5FA7 A;  3PYP A;  5HPF A;  4GKU A;  2PAV P;  3UN7 A;  1YLT A;  4R3B A;  4NXE A;  1LI9 A;  1WE4 A;  1MKM A;  4R1G A;  4KQO A;  5FI7 A;  1K54 A;  1ACF A;  5DJT A;  4LV0 A;  5HWT A;  1CEF A;  1HD8 A;  3KYZ A;  3VFF A;  3MXR A;  3NBL A;  1BLP A;  5L10 A;  1KGF A;  1K25 A;  4PM7 A;  2V1B A;  1H8Z A;  2J3T D;  2Y2G A;  5I5L A;  1K55 C;  3O87 A;  2ZM0 A;  3K3C A;  5GLD A;  1S67 L;  4HI4 A;  1WA9 A;  1KDS A;  1XP4 A;  2XGN A;  1A0K A;  3MFD A;  1H3Q A;  3HUN A;  4GHI B;  5EVI B;  3TE8 A;  4Q8I A;  5DF8 A;  4OH0 A;  5EV0 A;  5DKK A;  1YLJ A;  4HP9 A;  5CHJ A;  4R70 A;  1JVJ A;  3P09 A;  1TS7 A;  1KE3 A;  1M6K A;  3BFE A;  3IWQ A;  4HHD A;  2HF6 A;  2Y2J A;  4XXR A;  5AVE A;  2VGK A;  4F3L A;  4QU3 A;  5CER A;  4XUX A;  4X55 A;  3HLE A;  3CI6 A;  4LV3 A;  3A3F A;  1STZ A;  1S66 L;  1PWG A;  2IWD A;  4IJG A;  2V0U A;  1LLB A;  3VE3 A;  2ZL1 B;  1MWU A;  4LCM A;  1RCJ A;  5AQB A;  1MXO A;  4OOL A;  3FC7 A;  3MJQ A;  5HFO A;  4GS9 B;  3BFC A;  2WKE A;  3SH7 A;  1TS8 A;  1YLY A;  2Y91 A;  3NC8 A;  4QJG A;  3AGE A;  3MXQ A;  2L4R A;  4L9E A;  3IBR A;  1ONG A;  2XSS A;  3VSL A;  3TOI A;  2PHY A;  4JXW A;  3A3E A;  3P01 A;  4QD4 A;  4S2I A;  1S1Y A;  4HH2 A;  2EX9 A;  4Y0U A;  4JGP A;  1YM1 A;  3S22 A;  5HX9 A;  5A90 A;  3ZVT A;  2VGL S;  1IYP A;  3F1P B;  1T1B A;  1SKO B;  3G4P A;  4BLM A;  1XA1 A;  2Y2M A;  2DRW A;  2Q0O A;  1G68 A;  3LGO A;  2VV8 A;  1T18 A;  3BFG A;  4BL3 A;  1S4S A;  5FEF A;  1PWD A;  1DP9 A;  1ODV A;  2HDR A;  5L8M A;  2GDN A;  4OPZ A;  4L9G A;  3NUL A;  3PR6 A;  3JVV A;  3EQU A;  4F94 A;  1JTD A;  4DF6 A;  1F5M A;  1GSX A;  4OOY A;  4XT2 B;  1YMS A;  3E98 A;  4R0Q A;  4M4X A;  1QMF A;  3UDF A;  3JVU A;  4NXG A;  3ZYT A;  2DCF A;  2JKT I;  3HUM A;  2LB9 A;  1DP6 A;  5KIZ A;  1OTD A;  4PKY A;  4Z1W A;  2UWX A;  2EWW A;  5CGX A;  4GB7 A;  4QPR A;  3IH8 A;  3JPU A;  1PIO A;  5FSR A;  2XRN A;  2HDU A;  2VGJ A;  1W8Y A;  4DN0 A;  4X56 A;  3IX4 A;  1RGZ A;  2G7U A;  5HDD A;  4GNU A;  3T4T A;  4JXS A;  3VV4 A;  4JGO A;  1IFQ A;  3EGX C;  3EEH A;  3D4F A;  2XD1 A;  5L2F A;  5DTS A;  4BQM A;  1DJA A;  1PFL A;  1KGE A;  1Y4O A;  3QP6 A;  4PHT A;  2PD7 A;  5FEG A;  1NZO A;  5HD3 A;  4IHQ A;  1ZKJ A;  3GVB A;  1GA9 A;  4I3I A;  4LCL A;  4OPR A;  4E3M A;  5EVL A;  1O7E A;  2PYP A;  3MFX A;  4WMC A;  4RX3 A;  4KZ5 A;  4JF4 A;  3FYZ A;  3EWK A;  3FV7 A;  4K91 A;  1F9I A;  4EER A;  4WEJ A;  3IWI A;  2VK3 A;  4ZJ1 A;  1NY0 A;  4MMN A;  1K38 A;  3LI9 A;  4L0L A;  1YKD A;  3VOL A;  3LR3 A;  5M18 A;  1Y54 A;  5F1G A;  4OQ0 A;  4D2O A;  3F1O B;  1BUL A;  3LR5 A;  4EBL A;  1BSG A;  4GDB A;  4E04 A;  2BLS A;  4LEN A;  2O9A A;  4KZA A;  1OJG A;  3DW0 A;  3IF6 A;  3Q82 A;  4OLG A;  3ICY A;  1ES2 A;  3MR0 A;  2HP9 A;  4X6T A;  4EEU A;  4JXV A;  3DTE A;  3HL9 A;  3ZQ5 A;  3CAX A;  2M7U A;  1AWI A;  2XR0 A;  5FQM A;  3MZE A;  2ZQ7 A;  1BZA A;  2EA9 A;  1JNU A;  1S4R A;  3DWK A;  1P9R A;  3UB6 A;  5I94 A;  3OPR A;  3Q07 A;  2PBD P;  3ZG8 B;  3KSH A;  1C3B A;  4HJ6 A;  2J9O A;  3E4P A;  2FFY A;  2OLU A;  4PM5 A;  4H8R A;  4WZ4 A;  1T1A A;  2JKG A;  4Q0I A;  4KUO A;  3LUQ A;  2WKI A;  1OTE A;  2PYR A;  2INW A;  4FH4 A;  1IKI A;  3QHY A;  2J8Y A;  2X01 A;  5FAS A;  1MBL A;  5IT5 A;  4IBR A;  1FR1 A;  1YT4 A;  3WS0 A;  4O01 A;  1XJ3 A;  1L2S A;  5BOH A;  3AGD A;  2VEA A;  1FR6 A;  2WAD A;  2X02 A;  3IT9 A;  4Z9Q A;  5DFY A;  3PBN A;  1UWN X;  3G34 A;  2KDK A;  4EQ1 A;  3R7W A;  3RTY A;  1LSW A;  2YKH A;  1BLH A;  4WZ5 A;  3WS1 A;  5FI6 A;  5CRF A;  1ES3 A;  3T4K A;  3ZNY A;  2L0W A;  3BY8 A;  4DE0 A;  2QWS A;  4KZB A;  4C3Q A;  3MKF A;  3GTC A;  2QHK A;  4LPZ A;  2D01 A;  4UA6 A;  2B95 A;  2JKF A;  3BYD A;  1ALQ A;  2WGV A;  4RYE A;  5A91 A;  5HAQ A;  1ERO A;  1TS6 A;  1L0E A;  5CTN A;  1YAX A;  2QJ7 A;  2J7V A;  3IHA A;  4CLC A;  3O3V A;  1K54 C;  2R78 A;  3PAE A;  2WKH A;  1HTZ A;  3LIB A;  3ITB A;  5CGS A;  4E3L A;  5FDS A;  4WEL A;  3GR2 A;  1IYQ A;  4DXC A;  4E6X A;  1V9Z A;  3SH8 A;  3CPT A;  5A93 A;  4KZ7 A;  4BL2 A;  3UNW A;  3HUO A;  3IF5 A;  5E2G A;  3DTK A;  3BEB A;  3L7H A;  1K56 A;  2HPB A;  3IX3 A;  3VP4 A;  2Z6C A;  3G35 A;  3LIC A;  4Q0H A;  2KLI A;  3MZD A;  4ARZ B;  5GHX A;  3V39 A;  3HLC A;  3ZFZ A;  2ZQD A;  1L0F A;  2QMI A;  4BJP A;  3Q7V B;  3PBQ A;  1W63 Q;  3PXP A;  4MN5 A;  2B5R A;  2QYB A;  3B47 A;  3N8S A;  4HH3 A;  3I7J A;  3N4I A;  3T1Q B;  5G4Y A;  4UQI S;  3RH8 B;  2Y2Q A;  5JYP A;  5DTK A;  1NYM A;  4KG5 A;  3SS5 A;  2QPN A;  3LYX A;  1PRQ A;  5IU1 A;  4X68 A;  1BLS A;  1SCW A;  1SDE A;  4DJ2 A;  4L9F A;  2CC1 A;  3MKE A;  3NI9 A;  5HZH A;  2HP5 A;  3S4X A;  2PU2 A;  5EUA A;  1OTA A;  2P9V A;  4FD8 A;  3M6B A;  3L9K A;  1OT9 A;  4MBF A;  4PM8 A;  3CUE A;  1ES5 A;  4KQR A;  1Q2Q A;  2M7V A;  3IS2 A;  4GHI A;  3WS5 A;  4WUJ A;  2Y79 A;  1MWR A;  3A3D A;  2IWB A;  2QKP A;  4ID4 A;  3GRJ A;  3MSH A;  4HQA A;  1PZO A;  1KE0 A;  4GJ4 A;  1IOU A;  3GMW A;  4IVK A;  5EPH A;  2ZL1 A;  5IS1 A;  3O86 A;  4II7 A;  2B18 A;  4U0T A;  5KMW A;  1K57 C;  1OPX A;  3CIT A;  2HDQ A;  2PBY A;  5C5K A;  4CQH A;  2ZD8 A;  4LGW A;  1IEM A;  2HGV A;  3TRC A;  4F3L B;  4QY5 A;  3BFD A;  5FQQ A;  1VEU B;  4I39 A;  1LL8 A;  2Z6D A;  3UB9 A;  5DF7 A;  2WGW B;  4HEF A;  2Y8H A;  4QWO A;  2ZJ9 A;  1M40 A;  5TR7 A;  2OOL A;  4KZ4 A;  1BT5 A;  2RL3 A;  1TS0 A;  3K2N A;  2ZMF A;  1FSW A;  4OOM A;  2FH5 A;  1P9W A;  3S7N A;  3T4O A;  3MXS A;  3MZF A;  2QJ5 A;  1KOU A;  1MPL A;  4LFU A;  2XLN A;  4EWF A;  2M1C A;  4R6L A;  3UE0 A;  4I3A A;  2HJE A;  4HJ4 A;  1TVF A;  1EWZ A;  3KYQ A;  4BBU A;  2AVX A;  2VX8 A;  5L09 A;  4FOF A;  4BWI A;  5G18 A;  3NEC A;  5E2E A;  2WAF A;  5TBM B;  4OPQ A;  4IBX A;  5IHV A;  1K57 A;  2W3G A;  3CWF A;  2Y2L A;  5DKL A;  3NY4 A;  2OWJ A;  4IUH A;  5A8B A;  1F98 A;  3R4K A;  4WF0 A;  2ZC7 A;  3HLB A;  5EVI C;  4ZJ2 A;  2WGW A;  1W7F A;  2A49 A;  3P7N A;  5CEC A;  1AXB A;  3A0R A;  4K0W A;  5HL1 A;  1P97 A;  4UAA A;  5EOO A;  2JKR I;  4A5R A;  2V0W A;  4M3K A;  1G5U A;  3OOV A;  3VE4 A;  1YLZ A;  1P0Z A;  1H8Y A;  2DMW A;  4OON A;  1BUE A;  4BD1 A;  1FQG A;  3ZG7 B;  2KX6 A;  3W4Q A;  4B4X A;  3UMD A;  5GLA A;  1ZG6 A;  3FKW A;  3D72 A;  2W0N A;  2GZA A;  4Y3I A;  4LRZ E;  4DE1 A;  2Q9M A;  1V9Y A;  4BBV A;  5CXW A;  4GS9 A;  3UE3 A;  2WKR A;  2WGI A;  3H82 B;  4O7D A;  4P6Z M;  4AFI A;  5HWW A;  2GNX A;  5KZH A;  2VA0 A;  4KG6 A;  3V3R A;  1KGG A;  3GDI A;  5FQ9 A;  4QHC A;  5DTT A;  3UE6 A;  1XJ6 A;  3T4Q A;  2JHE A;  3VMA A;  4IUK A;  3A3I A;  5EVE A;  1OJ5 A;  4MBK A;  1X0O A;  3LEZ A;  4E3O A;  4DDY A;  2V8C A;  3VFH A;  5HL6 A;  4ESP A;  4OP5 A;  1TDG A;  1IEL A;  1S0W A;  1K6R A;  3T4L A;  2V1A A;  5EM0 A;  2IWC A;  3IXG A;  1NYY A;  3LID A;  4ZBE A;  5CTM A;  2PR6 A;  4MN7 A;  4FCF A;  1CI9 A;  3V5M A;  4G3V A;  4PM6 A;  3GQZ A;  2OAP 1;  3MF0 A;  4YOF A;  1WYC A;  2J80 A;  1XFN A;  3LIF A;  1XFQ A;  3EGD C;  3CUE C;  3FPW A;  1XXM A;  2XRO A;  3NIA A;  1LL9 A;  2Y2O A;  4OQG A;  2E8I A;  4ZRR A;  3F1N A;  5FAP A;  1PI5 A;  3D9Y A;  5M1A A;  1LL5 A;  3E4Q A;  4CLC C;  4KG2 A;  3FG8 A;  1NLZ A;  3DTI A;  1GSV A;  4GW9 A;  3DTM A;  1LI0 A;  2VZW A;  3DWZ A;  5EVI A;  4CLC B;  4JBF A;  4OP8 A;  1JWP A;  1HZO A;  1PW1 A;  4Y7P A;  3BW6 A;  2Y2P A;  3W4O A;  4WEK A;  2XH9 A;  4G3K A;  2ZMA A;  3RXX A;  4K08 A;  2WYX A;  4HES A;  1PZP A;  1IKG A;  2H28 A;  4GD8 A;  4H6J B;  2BAS A;  1FSY A;  3IH9 A;  3HRE A;  2H5S A;  3V67 A;  1XGJ A;  2B02 A;  3UPN A;  4PAU A;  2KOI A;  1IYS A;  3HLW A;  1YLW A;  4E6W A;  3MBZ A;  2ZOI A;  4KQQ A;  3F1N B;  3ZDJ A;  2P9V B;  4EET B;  3NDG A;  1XJ4 A;  1ZC2 A;  4R4S A;  3FPV A;  2EXA A;  5CEB A;  2DNS A;  3PBS A;  2C5W B;  3LCE A;  4Y17 A;  2V20 A;  4JF5 A;  3HCY A;  3BJN A;  4HBT A;  5J7E A;  1KVM A;  2J9P A;  5DFX A;  2W3H A;  1YPR A;  2W1T B;  4DJ3 A;  2XFS A;  4HY8 A;  4O8G A;  2NUT C;  2ZM2 A;  4DXB A;  4KZ6 A;  4RX2 A;  1J9M A;  1NRF A;  3C30 A;  4JKT A;  3QNB A;  4N92 A;  4I3J A;  2HDS A;  2H0T A;  2JN7 A;  3MQ0 A;  3HLG A;  1MC0 A;  1HVB A;  2D02 A;  4XT2 A;  1PNE A;  3BY9 A;  5EM1 A;  4IVI A;  3CHW P;  1VET A;  4NK3 A;  4LRX C;  4BEN A;  4RQ9 A;  5E2F A;  2PU4 A;  4EU0 A;  4P85 A;  2W1R A;  4Q0J A;  1ESI A;  3OPP A;  3OZH A;  3G31 A;  4U0X A;  4PKY G;  3OC2 A;  4JPM A;  1D06 A;  2OLV A;  1ERQ A;  2P08 A;  2Y2N A;  2UV0 E;  4JGQ A;  5HPI A;  1DP8 A;  3P98 A;  4MN6 A;  1NLY A;  1K0K A;  1VEU A;  3AGF A;  3T1X A;  3LR4 A;  4B4Z A;  3OPL A;  3GEC A;  5TBM A;  4GN2 A;  2G2U A;  3TJZ C;  3T4S A;  3IBJ A;  4GOG A;  1DJB A;  4X53 A;  3HBR A;  1LHY A;  2ZC5 B;  1MY8 A;  5CGW A;  1OTB A;  5HDC A;  1CK3 A;  2W3D A;  3BWL A;  1F2K A;  3RFB A;  3H82 A;  2V2F F;  2MJ6 A;  4P6Z S;  2JBF A;  3HJI A;  4ZDX A;  5F83 A;  3QP8 A;  5F5Y A;  4FSF A;  1H0M A;  3CPT B;  2GJ3 A;  2LB5 A;  3IWO A;  1Y28 A;  2ACG A;  2VKS A;  1EW0 A;  4RVA A;  2EX8 A;  4RA7 A;  1E4D A;  3OCL A;  1FCN A;  5HD5 A;  2PT7 A;  5GL9 A;  1H8M A;  1BTL A;  2XF3 A;  4WL9 A;  3T50 A;  2O0Y A;  1FCO A;  3SS4 A;  1N4O A;  1I2W A;  2O9C A;  2OAQ 1;  3T1R A;  1BLC A;  1VM1 A;  2WZX A;  4OPY A;  2EFU A;  3B42 A;  1NWZ A;  3BLS A;  1YLP A;  1G28 A;  4GZB A;  1SKO A;  3PTE A;  3QNC A;  1S1Z A;  5GLB A;  2ZC4 B;  2Y2H A;  3G30 A;  3G32 A;  3LFV A;  4DKI A;  5MC7 A;  2JKT M;  3MQQ A;  4P6B A;  3G2Y A;  3IX8 A;  5CX7 A;  1XPB A;  2RCX A;  3C4P A;  1DRM A;  3MMH A;  4MDZ A;  1W5D A;  5K5B A;  3VOY A;  3C4O A;  3RXW A; 
#chains in the Genus database with same CATH homology
 1PIO A;  4EWF A;  5FSR A;  3Q7Z A;  2HDU A;  4E3N A;  3N6I A;  3WS4 A;  2VGJ A;  3WS2 A;  1W8Y A;  3UE0 A;  4S2L A;  1TVF A;  4X56 A;  4MLL A;  3CJM A;  1EWZ A;  5FQJ A;  5HW3 A;  2I72 A;  1RGZ A;  3PAG A;  4GNU A;  4P0M A;  5D3O A;  4GDN A;  1JTG A;  3SS3 A;  4JXS A;  5G18 A;  4ZAM A;  5E2E A;  2WAF A;  4OPQ A;  4IBX A;  3UPO A;  5IHV A;  3D4F A;  3JYI A;  1K57 A;  2XD1 A;  5L2F A;  5DTS A;  5TFQ A;  4BQM A;  4WM9 A;  2Y2L A;  3NY4 A;  4EUZ A;  1DJA A;  1KGE A;  3CZD A;  5FDH A;  2Z2L B;  3GSG A;  4BD0 A;  4LV1 A;  2ZC7 A;  3HLB A;  4WMC D;  3PBR A;  4KZ3 A;  1NZO A;  4PMA A;  4B88 A;  5EVI C;  1ZKJ A;  4ZJ2 A;  3GVB A;  2WGW A;  1GA9 A;  4JXG A;  4LCL A;  4OPR A;  4HBU A;  4E3M A;  1W7F A;  5EVL A;  1O7E A;  2A49 A;  5CHU A;  3M2K A;  4CPK A;  3IQA A;  4UA7 A;  5CEC A;  1AXB A;  4UA9 A;  3C7U A;  4K0W A;  4WMC A;  4OLD A;  4RX3 A;  4UAA A;  4KZ5 A;  5HL1 A;  3CMZ A;  4JF4 A;  1JWZ A;  5EOO A;  2JE5 A;  3SH9 A;  1K55 A;  3EQV A;  4A5R A;  1YQS A;  2ZQA A;  3UPP A;  3FYZ A;  4M3K A;  4OKP A;  5DF9 A;  2Y2K A;  4N1H A;  3BEC A;  3Q81 A;  1K6S A;  2Y2I A;  4GD6 A;  5CED A;  1SHV A;  1Q2P A;  3FV7 A;  1MKI A;  1YLZ A;  4K91 A;  1ERM A;  4WEJ A;  3W4P A;  4C6Y A;  4OQI A;  1H8Y A;  4WBG A;  3IWI A;  1ESU A;  3FWL A;  4OON A;  1BUE A;  4ZJ1 A;  4BD1 A;  1NY0 A;  4WYY A;  1K38 A;  4C75 A;  4L0L A;  1FQG A;  4R4R A;  3ZG7 B;  2A3U A;  2ZQ8 A;  3ZG9 B;  1GCE A;  3OCN A;  2EX6 A;  3V50 A;  3W4Q A;  4MEZ A;  1GHP A;  3TSG A;  3UE1 A;  1SDN A;  4B4X A;  5FAO A;  5M18 A;  5GLA A;  4S2K A;  1Y54 A;  1CEG A;  1NJ4 A;  1ZG6 A;  3BLM A;  1YMX A;  4KZ9 A;  4OQ0 A;  5F1G A;  4E3I A;  3FKW A;  2Y4A A;  5HAI A;  1G6A A;  1RP5 A;  4D2O A;  4N1X A;  1NXY A;  1TEM A;  5GLC A;  1BUL A;  1Z6F A;  4UHU A;  1BSG A;  1VQQ A;  4DE1 A;  4EBL A;  2Q9M A;  4GDB A;  2BLS A;  3W8K A;  4LEN A;  5CXW A;  4ZTK A;  3UE3 A;  3WWX A;  3VP1 A;  3VSK A;  2WGI A;  4KEN B;  4KZA A;  4O7D A;  2HP6 A;  5KZH A;  5FQK A;  3HLF A;  1I5Q A;  3DW0 A;  3IF6 A;  5FAT A;  2OV5 A;  3ZG5 A;  3Q82 A;  4KG6 A;  4OLG A;  3V3R A;  5KSC A;  1KGG A;  2ZQ9 A;  4S2N A;  5FQ9 A;  2Z2M B;  1ES2 A;  4QHC A;  5DTT A;  5AQ9 A;  1PYY A;  3VMA A;  5E43 A;  2HP9 A;  3ZGA B;  1WYB A;  4X6T A;  5GHY A;  1K56 D;  3A3I A;  4JXV A;  3C5A A;  2Y59 A;  4PM9 A;  1FOF A;  4MBK A;  3LEZ A;  1FCM A;  4E3O A;  3HL9 A;  2EXB A;  4DDY A;  3IF6 C;  4JLF A;  3M2J A;  5TGF A;  3VFH A;  3IXB A;  4OP5 A;  1JWV A;  4KZ8 A;  3N8L A;  1TDG A;  2XR0 A;  1IEL A;  1S0W A;  3IHB A;  3M6H A;  4NET A;  1K6R A;  4EQI A;  5FAQ A;  5FQM A;  4Y0T A;  2ZQ7 A;  1BZA A;  3MZE A;  2XD5 A;  5EEC A;  2EX2 A;  3DWK A;  3E2L A;  1GA0 A;  5HAR A;  2IWC A;  3IXG A;  1NYY A;  5I94 A;  4ZBE A;  5CTM A;  3OPR A;  5AQA A;  4E3J A;  1DY6 A;  3Q07 A;  3ZG8 B;  4S2M A;  2QZ6 A;  1C3B A;  1XA7 A;  4OVD A;  4FCF A;  1CI9 A;  3BFF A;  3V5M A;  2J9O A;  4PM6 A;  4DE3 A;  5KSH A;  3IF6 B;  2FFY A;  3N7W A;  2H0Y A;  2OLU A;  1XKZ A;  4PM5 A;  3GQZ A;  1N9B A;  4H8R A;  3FKV A;  1WYC A;  4WZ4 A;  5GHZ A;  3UDI A;  3HLD A;  1ZG4 A;  1E3U D;  4X69 A;  4QB8 A;  1O07 A;  5HAP A;  2WKI A;  4DRT A;  4FH4 A;  1IKI A;  2EFX A;  4JF6 A;  3BRM A;  5J8X A;  3QHY A;  2J8Y A;  2X01 A;  5FAS A;  1MBL A;  4IBR A;  1XXM A;  2Y55 A;  3NIA A;  1FR1 A;  1LL9 A;  2Y2O A;  5FQI A;  4N9K A;  3LO7 A;  1YT4 A;  4OQG A;  3BM6 A;  4R3J A;  3WS0 A;  2E8I A;  2XQZ A;  4WZ5 C;  5CHM A;  1L2S A;  5FAP A;  5BOH A;  3OPH A;  4U3T A;  1PI5 A;  3A3J A;  1DJC A;  3AGD A;  2WAD A;  1FR6 A;  2X02 A;  3IT9 A;  4FH2 A;  1LL5 A;  2Q9N A;  5M1A A;  4Z9Q A;  4KG2 A;  1XGI A;  1IYO A;  3PBN A;  5AQ7 A;  3G34 A;  3N8R A;  5E2H A;  2H10 A;  2ZC3 B;  3ITA A;  3CG5 A;  3DTM A;  1LI0 A;  1BLH A;  2X71 A;  4WZ5 A;  3WS1 A;  3DWZ A;  5EVI A;  1H5X A;  5FI6 A;  5CRF A;  4JBF A;  4OP8 A;  5EVI D;  1JWP A;  4YIN A;  2WK0 A;  1HZO A;  4S2P A;  1MWT A;  1PW1 A;  1ES3 A;  3O88 A;  4Y7P A;  3SOI A;  3UO9 A;  3ZNY A;  1EI5 A;  1W79 A;  3VP2 A;  5FA7 A;  4DE0 A;  2Y2P A;  4GKU A;  2V1Z A;  4KZB A;  3MKF A;  4C3Q A;  3W4O A;  3UN7 A;  1XX2 A;  3GTC A;  4WEK A;  2XH9 A;  4DE2 A;  4UA6 A;  2ZQC A;  2ZLY A;  2ZMA A;  1YLT A;  3BYD A;  4R3B A;  3RXX A;  5M19 A;  1ALQ A;  2ZC6 B;  2WYX A;  2WGV A;  1LI9 A;  3NDE A;  4HES A;  4RYE A;  1WE4 A;  3S1Y A;  5A91 A;  1PZP A;  4R1G A;  1IKG A;  4KQO A;  5FI7 A;  5HAQ A;  1K54 A;  2WZZ A;  1ERO A;  4EBP A;  4GD8 A;  2XFT A;  4K0X A;  1L0E A;  5CTN A;  1FSY A;  2J7V A;  4LV0 A;  3IHA A;  1CEF A;  3ZNT A;  1NZU A;  3IH9 A;  4MNR A;  3HRE A;  3O3V A;  1HD8 A;  2H5S A;  1XGJ A;  3VP3 A;  3UPN A;  1KDW A;  3VFF A;  3MXR A;  3UDX A;  3NBL A;  1BLP A;  4XUZ A;  2XDM A;  1K54 C;  2ZM8 A;  4MBH A;  1PWC A;  1IYS A;  3HLW A;  1KGF A;  1YLW A;  3PAE A;  4E6W A;  2WKH A;  3MBZ A;  3FZC A;  1K25 A;  4KQQ A;  3ZDJ A;  1HTZ A;  4PM7 A;  4P87 A;  1H8Z A;  2P9V B;  3NDG A;  2Y2G A;  3ITB A;  1KE4 A;  1K55 C;  5CGS A;  4E3L A;  3O87 A;  1ZC2 A;  2ZM0 A;  4R4S A;  5GLD A;  4WEL A;  3GR2 A;  2EXA A;  4OQH A;  2DNS A;  5CEB A;  3PBS A;  1IYQ A;  1KDS A;  4DXC A;  4E6X A;  1XP4 A;  2C5W B;  3LCE A;  2XGN A;  3WRZ A;  2V20 A;  4JF5 A;  3MFD A;  3B3X A;  3HUN A;  5EVI B;  3SH8 A;  4LV2 A;  5A93 A;  4HBT A;  4KZ7 A;  4Q8I A;  1KVM A;  2J9P A;  4OH0 A;  5DF8 A;  4BL2 A;  5A92 A;  3UNW A;  5F82 A;  3HUO A;  1GHI A;  3IF5 A;  1YLJ A;  5E2G A;  3BEB A;  5CHJ A;  1L0G A;  1E25 A;  2XFS A;  1K4E A;  3NCK A;  1K56 A;  2ZM2 A;  4DXB A;  2HPB A;  4KZ6 A;  1JVJ A;  4RX2 A;  1J9M A;  3P09 A;  4Y0O A;  3VP4 A;  2R9X A;  1NRF A;  3G35 A;  4S2O A;  2P74 A;  1KE3 A;  1M6K A;  3MZD A;  4JKT A;  3BFE A;  3IWQ A;  3QNB A;  4N92 A;  1W8Q A;  2G2W A;  3ZG0 A;  3GV9 A;  2Y2J A;  5GHX A;  2HDS A;  2H0T A;  3IXH A;  3HLC A;  3V39 A;  4XXR A;  1CI8 A;  3ZFZ A;  2ZQD A;  3HLG A;  1L0F A;  1HVB A;  3IXD A;  2QMI A;  4BJP A;  2VGK A;  4IVI A;  4N9L A;  3Q7V B;  2C6W B;  3PBQ A;  4QU3 A;  5CER A;  4XUX A;  4X55 A;  3HLE A;  4LV3 A;  4NK3 A;  4BEN A;  5E2F A;  2PU4 A;  3A3F A;  1PWG A;  2IWD A;  4P85 A;  2B5R A;  1LLB A;  1ESI A;  4CJN A;  3OPP A;  3OZH A;  2FFF B;  3N8S A;  1PW8 A;  3I7J A;  3N4I A;  3G31 A;  4U0X A;  1MWU A;  4PPR A;  4LCM A;  3C7V A;  3OC2 A;  1RCJ A;  4JPM A;  5AQB A;  3PBO A;  1MXO A;  2OLV A;  2Y2Q A;  1ERQ A;  4OOL A;  2Y2N A;  5JYP A;  5DTK A;  1NYM A;  3P98 A;  3ZVW A;  4KG5 A;  5HFO A;  1KVL A;  3SS5 A;  2QPN A;  3BFC A;  3ZCZ A;  2JCH A;  2JC7 A;  3AGF A;  3TG9 A;  2WKE A;  1I2S A;  3Q7V A;  4X68 A;  1GHM A;  1BLS A;  1SCW A;  4B4Z A;  3OPL A;  4GN2 A;  3SH7 A;  2G2U A;  1YLY A;  1SDE A;  4YFM A;  2CC1 A;  3MKE A;  3NI9 A;  3UY6 A;  2Y91 A;  3NC8 A;  4GOG A;  5JYO A;  1DJB A;  4X53 A;  1RGY A;  3HBR A;  1LHY A;  4QJG A;  2ZC5 B;  3AGE A;  2WAE A;  1MY8 A;  5CGW A;  2HP5 A;  3VOZ A;  1CK3 A;  3S4X A;  2PU2 A;  5EUA A;  3Q1F A;  2BG1 A;  1ONG A;  3V3S A;  2P9V A;  4FD8 A;  3M6B A;  1K4F A;  4MBF A;  3VSL A;  3TOI A;  3ISG A;  4PM8 A;  4EV4 A;  4JXW A;  1ES4 A;  1ES5 A;  2V2F F;  3A3E A;  4IED A;  4KQR A;  2JBF A;  4QD4 A;  1Q2Q A;  4S2I A;  4ZDX A;  5F83 A;  1S6R A;  5EE8 A;  1E3U A;  1OME A;  4FSF A;  2EX9 A;  4Y0U A;  4E3K A;  2OSU A;  4DDS A;  3IWO A;  3WS5 A;  1YM1 A;  1TDL A;  3S22 A;  1MWR A;  5HX9 A;  5A90 A;  4S2N C;  3A3D A;  3ZVT A;  4RVA A;  5DVA A;  2IWB A;  1IYP A;  2EX8 A;  4ID4 A;  4RA7 A;  3GRJ A;  1E4D A;  3OCL A;  3G4P A;  3PBT A;  1PZO A;  1XA1 A;  1KE0 A;  2Y2M A;  4BLM A;  1FCN A;  5GL9 A;  3VP0 A;  2XF3 A;  1BTL A;  3GMW A;  2XK1 A;  4IVK A;  2DRW A;  5EPH A;  3ZHH A;  5FI2 A;  2WUQ A;  1G68 A;  1FCO A;  3BFG A;  4BL3 A;  3SS4 A;  3O86 A;  1N4O A;  4U0T A;  1I2W A;  5KMW A;  1K57 C;  1PWD A;  2HDQ A;  1BLC A;  2PBY A;  1VM1 A;  2HDR A;  2WZX A;  5F1F A;  2GDN A;  4OPY A;  2EFU A;  4OPZ A;  2ZD8 A;  3BLS A;  1YLP A;  1IEM A;  5U47 A;  3E2K A;  4QY5 A;  1U60 A;  3EQU A;  4F94 A;  1JTD A;  4GZB A;  3BFD A;  4DF6 A;  5FQQ A;  4OOY A;  2R9W A;  3LY4 A;  1PI4 A;  1YMS A;  3LY3 A;  1L0D A;  3PTE A;  4R0Q A;  3G2Z A;  3WRT A;  3QNC A;  3RJU A;  4R23 A;  5DF7 A;  5GLB A;  1QMF A;  1MWS A;  2ZC4 B;  1QME A;  1SKF A;  2Y2H A;  2WGW B;  4HEF A;  4S2J A;  3UDF A;  2ZJ9 A;  3G30 A;  3G32 A;  4EBN A;  4DKI A;  3HVF A;  2DCF A;  1M40 A;  3HUM A;  4P6B A;  3G2Y A;  5TR7 A;  4KZ4 A;  5EOE A;  1BT5 A;  2XEP A;  2RL3 A;  1XPB A;  2RCX A;  3C4P A;  1FSW A;  4OOM A;  2UWX A;  3MXS A;  3MZF A;  1W5D A;  1ONH A;  5CGX A;  3VOY A;  4GB7 A;  3C4O A;  1MPL A;  3IH8 A;  3RXW A;  2XLN A;  4ZJ3 A;  4QY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...