1W7FA

Crystal structure of the class a beta-lactamase bs3 inhibited with isocitrate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Crystal Structure of the Class a Beta-Lactamase Bs3 Bs3 Inhibited with Isocitrate
rcsb
molecule tags Hydrolase
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1w7fA00
1KGFA 1O7EA 4HEFA 3IWQA 4C6YA 2ZM0A 5TGFA 3UDIA 1KVMA 1FSWA 4HBTA 4GD8A 3AGEA 2QZ6A 2XFSA 4GKUA 4PM7A 3UO9A 1OMEA 2XH9A 3HBRA 1ERQA 2Q9NA 4LV3A 5FA7A 1ONGA 2VGKA 3BRMA 3M6BA 4NETA 2DRWA 5AQ9A 2XD1A 4OKPA 3S4XA 3WRTA 3A3FA 2Y2HA 5EPHA 1HD8A 3A3JA 5EVIB 4B4ZA 2WKIA 2ZM8A 2QPNA 4S2JA 1I2WA 2WYXA 3Q7ZA 3CG5A 4H8RA 4NK3A 1O07A 4BL2A 1YLJA 1CI8A 4S2OA 4PM6A 4FSFA 1BLCA 3RJUA 4MBHA 2XEPA 5FAPA 4XUZA 3PBQA 3PAGA 5IHVA 3SH7A 4E6XA 4OONA 3ZG5A 2ZQCA 4D2OA 3UN7A 2HPBA 2WKHA 1IEMA 4CJNA 3WS0A 4PMAA 3MKEA 2EXAA 4S2MA 3IHBA 5EOOA 4X56A 4R4SA 1MBLA 1BZAA 1HTZA 4HESA 2XGNA 1PI4A 4KG2A 1VQQA 3CMZA 5EVIA 4R4RA 3OPLA 3GRJA 1W7FA 4R23A 4FH4A 2WZZA 5FQ9A 2V1ZA 3ZDJA 4HBUA 3WS5A 4X53A 3ZFZA 2J9OA 1WE4A 3MZEA 3RXXA 3E2KA 3ZVTA 4OQIA 3VP2A 2WADA 3V50A 3HUMA 3M2JA 1IYQA 4ZAMA 1K25A 4KG5A 1Q2QA 3FYZA 2OV5A 4IVIA 4KZ5A 5EVIC 4GN2A 2H5SA 2HDSA 2X71A 3O3VA 3W4QA 3MFDA 1KE4A 5CECA 1DJCA 4U0TA 3GTCA 1IYSA 4CPKA 4F94A 4KZ3A 1BT5A 1ERMA 1JWPA 2Y4AA 1GA0A 3MXSA 4P85A 4UHUA 3UNWA 3HLEA 4E3KA 3NBLA 3TOIA 3N8RA 3OPRA 3OZHA 3C7VA 5HAIA 2P9VB 4RX3A 1K56A 4QB8A 3P98A 4BQMA 4ZJ2A 3VFHA 3HLWA 4KZBA 5GHXA 4JXVA 2Y2OA 5BOHA 4WMCA 2ZC3B 3ZG9B 4QD4A 1ESIA 2XLNA 5F82A 1PWCA 2ZMAA 4DE1A 3IXGA 4LENA 4DF6A 5M19A 1ES4A 4JLFA 4P6BA 4GD6A 5CGXA 1KE0A 1IELA 3Q1FA 5HW3A 3BYDA 3HLGA 3G34A 4KZ6A 4GDBA 3UPPA 4JF5A 4DE3A 5GLDA 4KZAA 5GLCA 3VOZA 4OP8A 5E2HA 3ZVWA 4QJGA 1ZG4A 1IYPA 2Y2GA 5FQIA 3VOYA 4U0XA 3NCKA 4OPZA 1G6AA 4RVAA 3N4IA 5CHUA 5CRFA 4Y7PA 2X01A 3IQAA 5CTMA 5DF9A 4Z9QA 1KDWA 1FR6A 3PBNA 1KGGA 3NC8A 5FAOA 4QU3A 4KG6A 4QHCA 1LL9A 1PZOA 4EQIA 2ZD8A 3Q81A 3UE0A 1EWZA 1K54A 2PBYA 1XGIA 1CI9A 2ZC4B 3FV7A 4QY6A 1SKFA 1S6RA 5E2FA 5M18A 3WWXA 3O86A 5HX9A 5DF8A 4C3QA 1TDLA 3HLCA 4KZ7A 3BLSA 2BLSA 4JKTA 1K56D 1Z6FA 2WAFA 4P0MA 4C75A 5HARA 4OLGA 2WZXA 3GV9A 2ZQAA 1LI9A 2Z2MB 1E4DA 2EXBA 3VP4A 4WMCD 2HDUA 3BLMA 1E3UD 5DVAA 5EE8A 2FFFB 4GDNA 3DW0A 1IYOA 5FATA 5CEBA 1H8ZA 1BLSA 4X55A 2HP9A 3OCNA 4MEZA 5CHJA 4OP5A 4UA6A 4S2PA 3VFFA 3ZNTA 1YLZA 3WS4A 2WUQA 5EUAA 1NZUA 3PBTA 3NIAA 2WGWA 3BEBA 3A3EA 1KVLA 3DWKA 4IBXA 2RCXA 4PM8A 4YINA 3NDGA 4OLDA 2JC7A 3IF6A 2EFUA 3FKVA 1KE3A 1FOFA 2XK1A 4WZ4A 5A91A 1LI0A 2IWDA 4LCLA 4X69A 5AQAA 5CERA 3V3RA 3Q7VA 5KSHA 2DCFA 5G18A 4X6TA 3HLDA 5GHZA 4OH0A 1LHYA 4XUXA 5FQKA 2WGVA 1YT4A 3OC2A 1YMXA 1BULA 3N8LA 5L2FA 1FR1A 3A3DA 1JTDA 1S0WA 2ZC6B 3IHAA 5U47A 3WRZA 3DTMA 4OVDA 3ZG0A 3G30A 4R3JA 5EOEA 5FI6A 1L0GA 1DJAA 5FQJA 4OOLA 4OPYA 1KGEA 1JWVA 1LL5A 3G2YA 3LO7A 4B88A 5FASA 5GLBA 5JYOA 3ZCZA 4ZJ3A 4JXSA 3ITBA 1SCWA 1XGJA 3PBSA 4UAAA 4GB7A 2Y2KA 1W5DA 4GOGA 5DF7A 5F83A 2Y91A 3ZNYA 4OPQA 4FCFA 1EROA 4IEDA 3VSLA 3C7UA 1PIOA 5F1GA 4KQOA 1IKIA 4S2LA 2BG1A 4Q8IA 5KMWA 3FKWA 5CEDA 5M1AA 5GLAA 5EECA 3W8KA 2R9XA 3ITAA 2RL3A 3MKFA 4K91A 4GNUA 3G32A 4JF4A 1BUEA 1NYYA 3GR2A 5CGSA 3HLFA 2WK0A 1L0DA 1YLTA 3HVFA 1M6KA 2OSUA 3IXBA 4JF6A 3SS5A 5J8XA 3W4PA 1LLBA 4JXWA 2Q9MA 4FH2A 1FCOA 1PI5A 4S2NA 1AXBA 2HP5A 1ZKJA 3GQZA 5E2EA 3HUNA 4O7DA 1E3UA 4BD1A 4WZ5A 1M40A 3P09A 5AQ7A 3QNCA 3VP0A 4GZBA 1XKZA 3TG9A 3GSGA 2EX6A 2Y2MA 3O88A 3G2ZA 3C4PA 3ZG8B 3GMWA 4MBKA 1C3BA 1RP5A 3M6HA 1WYCA 1PZPA 3QHYA 5HL1A 1I2SA 2ZQ9A 5TR7A 4N1HA 2V20A 3PBOA 4ZJ1A 3WS1A 1YQSA 1ES3A 5HFOA 4OOMA 1MWRA 2J7VA 3BECA 4UA7A 5CXWA 3VP1A 3MBZA 4WEJA 1L0EA 2R9WA 4S2IA 1TEMA 1NJ4A 4IVKA 3BFEA 4U3TA 3MXRA 4Y0UA 2P74A 1VM1A 4DE0A 2ZLYA 3OCLA 4Y0TA 1NXYA 3SS4A 4KQQA 4DXBA 2XDMA 1TVFA 3HREA 4P87A 1MPLA 1FCNA 2JCHA 1NZOA 4KQRA 2WGWB 1XP4A 1CK3A 1NY0A 4OQ0A 1QMEA 4RYEA 3VP3A 4E3IA 5EVLA 5F1FA 1E25A 1K4EA 5CGWA 5DTKA 3C5AA 4BL3A 1GCEA 2WKEA 3IF6B 5A90A 5GL9A 3OPHA 4MNRA 2FFYA 3BFFA 2Y2IA 3FWLA 4DRTA 3Q7VB 1BTLA 1MKIA 4L0LA 1NYMA 2WGIA 3PTEA 1XPBA 3UDXA 2C6WB 4LCMA 2WAEA 5I94A 3HLBA 4OOYA 4OQHA 1ONHA 2Y2LA 1K54C 2QMIA 1MWSA 2OLUA 4PPRA 1ES5A 2H0YA 3O87A 4K0WA 2G2WA 4YFMA 2XFTA 3BFDA 3D4FA 3N8SA 2HP6A 2C5WB 1ESUA 3S1YA 2G2UA 4K0XA 2J9PA 2Y2PA 4JPMA 4R3BA 4XXRA 3ISGA 1JVJA 1U60A 1YMSA 2HDRA 1Q2PA 4BLMA 3WS2A 4DDYA 1ALQA 4JBFA 1PWDA 1K6RA 3SH9A 4LV2A 2I72A 4ZDXA 3RXWA 1EI5A 3UY6A 1H5XA 1XX2A 4KZ8A 2ZC7A 2EX8A 1XXMA 4E3MA 5KSCA 5HAQA 4R0QA 5FQMA 4PM9A 3PAEA 3BFCA 4E3LA 3G31A 1L2SA 1I5QA 4BENA 3E2LA 3IF6C 1J9MA 5D3OA 1YLPA 3LEZA 3DWZA 4DXCA 1PW1A 1ES2A 2GDNA 3PBRA 3IXHA 1YLYA 3SOIA 2ZC5B 1H8YA 3TSGA 3OPPA 2CC1A 5FI2A 1SDNA 2ZQDA 1GA9A 1YM1A 4JXGA 3SH8A 4EBLA 3LY4A 1PWGA 4IBRA 5GHYA 3UDFA 5E43A 2IWBA 4BJPA 2ZM2A 3M2KA 4LV1A 4DKIA 1GHPA 2Z2LB 2A49A 1XA1A 1N9BA 3VMAA 1K57A 1DJBA 2A3UA 3IH9A 3NDEA 3V3SA 1FCMA 1GHIA 2PU4A 4N92A 2OLVA 3N7WA 3QNBA 3NY4A 4N9KA 3EQUA 2Y2QA 2Y59A 4EV4A 2PU2A 3Q07A 3BM6A 3ZHHA 2J8YA 2UWXA 3G35A 3IH8A 3ZG7B 1G68A 2ZQ8A 4X68A 1MWUA 4E3OA 5AQBA 1MXOA 5CHMA 2VGJA 4ID4A 3S22A 1K57C 3CZDA 1SDEA 3MZDA 3G4PA 4ZBEA 1HZOA 1N4OA 3GVBA 1W79A 4UA9A 2B5RA 3IT9A 1ZC2A 2Y2NA 1KDSA 1SHVA 4EUZA 3CJMA 1RCJA 3IWOA 4MBFA 2ZQ7A 3I7JA 1L0FA 1RGYA 2JBFA 3N6IA 4OQGA 4E3JA 4R1GA 4FD8A 4LV0A 3C4OA 3IXDA 5DTTA 3HL9A 4ZTKA 5FSRA 3EQVA 3UE1A 1PYYA 1K55A 3MZFA 1GHMA 4S2NC 3UE3A 4E6WA 1FQGA 1NRFA 3VSKA 1PW8A 3ZGAB 3IF5A 5TFQA 2DNSA 3A3IA 2JE5A 4WZ5C 1W8QA 1YLWA 4B4XA 4A5RA 1ZG6A 4DE2A 1WYBA 4WBGA 1W8YA 5A93A 2E8IA 2EFXA 5JYPA 4M3KA 1MY8A 1K4FA 3LCEA 2H10A 5FQQA 3AGDA 5A92A 1JWZA 3W4OA 1K55C 5DTSA 1CEFA 5EVID 2IWCA 3B3XA 2XF3A 4WEKA 2HDQA 5HAPA 4EBPA 1CEGA 1RGZA 1BSGA 4KZ4A 4WM9A 4EBNA 4EWFA 1QMFA 3FZCA 3UPNA 3V5MA 4BD0A 3AGFA 4PM5A 4S2KA 1XA7A 1BLHA 2P9VA 1MWTA 2EX9A 2ZJ9A 4QY5A 2V2FF 3IWIA 1TDGA 4N9LA 5FAQA 3V39A 4N1XA 3HUOA 4E3NA 1DY6A 5E2GA 4KENB 3JYIA 1JTGA 4WYYA 1BLPA 2EX2A 2H0TA 2XQZA 2Y55A 4WELA 1FSYA 3NI9A 4KZ9A 4Y0OA 5CTNA 4RA7A 4DDSA 5FDHA 3BFGA 2XD5A 1IKGA 3LY3A 5KZHA 1HVBA 1Y54A 2Y2JA 1K38A 2XR0A 3Q82A 4MLLA 4OPRA 4RX2A 3UPOA 1K6SA 5FI7A 3SS3A 2X02A
chains in the Genus database with same CATH superfamily
4HJ4A 1O7EA 3IWQA 4C6YA 5TGFA 3UDIA 3NHQA 3MF0A 3HCYA 3AGEA 2QZ6A 2XFSA 3FPVA 2XH9A 1ERQA 2Q9NA 5F69A 2VGKA 3M6BA 4HH2A 2XD1A 4OKPA 3A3JA 4B4ZA 2WKIA 5L10A 2A24B 4II7A 5F5YA 3R7WA 4H8RA 1D7EA 3DTKA 3NOUC 3KYQA 3D9YA 3PBQA 3PAGA 4XUZA 4GW9A 2ZQCA 3UN7A 2HPBA 4CJNA 2JKFA 4UQIS 2EXAA 5EM1A 4R4SA 2ACGA 4KG2A 1PI4A 4R23A 4FH4A 2WZZA 5FQ9A 5TBMA 1WE4A 2WKPA 2K2NA 3E2KA 4Y3IA 3EGXC 4JGRA 1P9RA 2WADA 3OOVA 4JGOA 4ZAMA 1Q2QA 3F1NB 3FC7A 4GHIA 4EESA 3O3VA 3MFDA 1SKOA 1VETB 3P01A 1IYSA 4X1LA 3LYXA 4O0PA 1YSQA 4F94A 1JWPA 1T19A 4E3KA 3NBLA 2W27A 3QP2A 1F9IA 2V9AA 3T1SA 4QB8A 1T18A 3T4KA 4PKYA 2Y2OA 3ZG9B 1ESIA 2XLNA 3K3CA 2W1TA 2VV6A 1N9LA 1PWCA 3QP6A 1JNUA 3T4OA 4DE1A 4LPZA 4JLFA 4GD6A 4KUKA 5CGXA 5HW3A 3HLGA 1T1CA 4KZ6A 4EXOA 1FILA 3T1XA 1OTEA 4AFIA 4EERA 3VOYA 4RVAA 3IQAA 1YPRA 1KDWA 3NC8A 1PZOA 3T4TA 4I5SA 1XGIA 1CI9A 3FV7A 4QY6A 3O86A 4C3QA 4I38A 1T1BA 3BLSA 4JKTA 2WZXA 1LI9A 1E4DA 1N9NA 5EE8A 4EEPA 3MFXA 2WKQA 5CEBA 4X55A 2HP9A 3VFFA 4OP5A 3LFVA 3T12B 2K7SA 2GNXA 4YOFA 3A3EA 2O9CA 4YINA 3NDGA 2JC7A 3TRCA 2EFUA 1KE3A 4DJ3A 1FOFA 3D72A 1LI0A 5AQAA 5EFWA 3BWLA 2DCFA 1EW0A 2WGVA 3K3DA 5L2FA 4GLQA 3ZG0A 4R3JA 1L0GA 1KGEA 1LL5A 1OJ5A 4B88A 5JYOA 2O9BA 1XGJA 5DF7A 4FCFA 1IKIA 4S2LA 4Y15A 3FKWA 4DJ2A 4CQHA 2J3TC 3W8KA 2XA7M 3PHYA 3G32A 3H7WA 3HLFA 1YLTA 1LSWA 3W4PA 4QWOA 1LLBA 1FCOA 1PI5A 5IS1A 4Y17A 3MS6A 3GQZA 3UMEA 1E3UA 2WKRA 3VP0A 2OOLA 1XKZA 1TS8A 2ZL1B 3O88A 3GMWA 2PD7A 3CUEA 2Z6DA 5DFXA 2VA0A 5TR7A 4N1HA 4ZJ1A 1ES3A 3FPWA 2M7UA 4KQDA 5EM0A 4S2IA 1TEMA 1NJ4A 1KOUA 3FG8A 2ZLYA 3LI9A 3HJIA 3CUEC 1FCNA 1K0KA 2WGWB 3LI8A 4OQ0A 4NXBA 4RYEA 3BQ8A 1MZUA 5DTKA 3OPHA 4MNRA 2FFYA 2Y2IA 3UB6A 3Q7VB 4I3IA 2P08A 3MMHA 3UB8A 2C6WB 5L8MA 3HLBA 4OOYA 2Y2LA 2H0YA 2G2WA 3VOLA 3EEHA 2D01A 1Z09A 3MQ0A 1VHMA 1AWIA 3R4KA 2HP6A 1TS0A 1ESUA 3D3OA 4K0XA 4JPMA 3ICYA 2VJWA 1JVJA 1U60A 5A8BA 4ESPA 1P9WA 3SH9A 4KZ8A 5L09A 3H82A 3LIAA 3LIEA 4R0QA 3QP5A 1G5UA 1OPXA 3PAEA 4E3LA 5IT5A 1VEUA 3IF6C 5D3OA 3LEZA 3EOIA 3PBRA 5K5BA 3ZQ5A 2QJ7A 2CC1A 1SDNA 3F1OB 1YM1A 3MJQA 4IBRA 5E43A 4LV1A 4L9FA 2VV7A 3VMAA 4CLCB 1DJBA 4LGWA 3ZYTA 2OLVA 3N7WA 2EWWA 3NY4A 2Y2QA 3KSHA 3ZHHA 3BM6A 3IH8A 1MWUA 5AQBA 1H8MA 5CHMA 4ID4A 3LIFA 3CZDA 3CPTA 1N4OA 2BASA 4WL9A 3CHWP 2B5RA 3IT9A 3HJKA 1DP9A 3CJMA 1RCJA 4HP4A 2ZQ7A 4E3JA 2GJ3A 4FD8A 4HJ3A 5DTTA 3S7QA 5LBRA 3IX8A 3UE1A 1PYYA 4E6WA 5MC7A 2DNSA 4WZ5C 5F6AA 1YLWA 4DE2A 1W8YA 2E8IA 2EFXA 1MY8A 3AGDA 1CEFA 2IWCA 3QP1A 4WEKA 5HAPA 1BYWA 1CEGA 1RGZA 1BSGA 4KZ4A 3MXQA 4EWFA 1GSVA 3O5YA 2JKRI 2B18A 4HHDA 1XA7A 4I39A 4ARZA 5FAQA 3V39A 4N9LA 1BLPA 2EX2A 2H0TA 2XQZA 4KZ9A 2Q0OA 3NI9A 4Y0OA 4RA7A 3R7WB 3LIBA 2XD5A 2Y2JA 2XR0A 3RH8B 3Q82A 4OPRA 4RX2A 4UEYA 4P6ZM 2X02A 1KGFA 4HEFA 5DKKA 4NXEA 4HBTA 3CAXA 3S7NA 4PM7A 1OMEA 4LV3A 5FA7A 2DRWA 3S4XA 3U4LP 4EQ1A 5TBMB 1W63Q 3RJUA 5IHVA 1XFNA 4D2OA 4GHIB 2WKHA 3T50A 4L9GA 2VV8A 3MKEA 4S2MA 3SZTA 4IUKA 1VQQA 3CMZA 5EVIA 4R4RA 4HBUA 2JKGA 3BY9A 4X53A 3S7PA 2HGVA 3JPUA 2Y8HA 3HUMA 3M2JA 5HPIA 5EVIC 4KZ5A 2PYPA 2H5SA 2HDSA 4IJGA 1NLYA 1ERMA 3UNWA 3MXSA 4R3AA 3HLEA 3TOIA 3QP4A 5AJGA 2P9VB 4RX3A 1K56A 3P98A 4BQMA 4ZJ2A 4WN5A 1YAXA 4KZBA 5GHXA 4WMCA 4QD4A 3DAVA 2PRFA 3IXGA 5M19A 1ES4A 3Q1FA 3BYDA 3NULA 4BWIA 5HSQA 3G34A 4GDBA 3UPPA 4DE3A 1F98A 5GLDA 3PYPA 5GLCA 2OAP1 5E2HA 4YWZA 3ZVWA 1ZG4A 1IYPA 2Y2GA 1XJ3A 4U0XA 2X01A 4Z9QA 1FR6A 3PBNA 1KGGA 4QU3A 3EEAA 5E2FA 1SKFA 5M18A 3WWXA 5HX9A 1TDLA 1GSXA 1K56D 1S1ZA 1Z6FA 3MR0A 4P0MA 3T1QB 2A2LA 2FH5A 2ZOIA 3GV9A 3VP4A 4WMCD 2JKTI 4GDNA 3RFBA 5FATA 1H8ZA 1BLSA 4MEZA 5CHJA 3ZNTA 4PKYG 2WUQA 4F3LB 3BW6A 3NIAA 3PBTA 2OWHA 3DWKA 2Z6CA 3F1PA 4LCLA 4X69A 4HQAA 2PHYA 1IOUA 3HLDA 1LHYA 3OC2A 1YMXA 3N8LA 1FR1A 3A3DA 3C38A 2ZC6B 3IHAA 4OVDA 5FI6A 3NOTC 5FQJA 1DP6A 4OPYA 1JWVA 3LO7A 1P97A 5FASA 3KYEA 4HIAA 4ZJ3A 1J3WA 4JXSA 4UAAA 1ACFA 3V67A 4GB7A 2Y2KA 2ZMVA 3ZNYA 4OPQA 1EROA 3CLOA 3PR6A 5DJUA 4EU0A 1V9YA 2RL3A 4K91A 2PYRA 1S4SA 4JF4A 4I3AA 3GR2A 1L0DA 3SS5A 3HVFA 1M6KA 5J8XA 3LICA 2Q9MA 4FH2A 4S2NA 1AXBA 1D1JA 5EVEA 3P09A 2KX6A 3QNCA 3SW1A 2E8JA 2EX6A 5HD5A 3G2ZA 3C4PA 4GS9B 2HF6A 3M6HA 3QHYA 3GECA 2ZQ9A 4XT2B 4OOMA 2G7UA 4EUVA 2R9WA 4IVKA 4U3TA 3MXRA 2P74A 1F5MA 1NXYA 2P04A 2INWA 3SS4A 2K31A 4DXBA 4P87A 3ULFA 1XP4A 4E3IA 2NUPC 5F1FA 1GSWA 5CGWA 3C5AA 4BL3A 1GCEA 3IF6B 3IS2A 3QP8A 1FIKA 1MKIA 1D06A 4FUWA 1XPBA 1MKMA 4LCMA 4Y2FA 2HJ9C 1ONHA 1MWSA 2QMIA 1VEUB 3O87A 3H9WA 3LR4A 5HDSA 3CITA 4R3BA 2Y2PA 5FL3A 4BLMA 3WS2A 4DDYA 4JBFA 1PWDA 1N9OA 5G4ZA 3UY6A 1XX2A 4G3KA 2V8CA 5FQMA 1H3QA 5DJTA 1WA9A 3G31A 1L2SA 1I5QA 3E2LA 2B95A 1YLPA 4DXCA 1PW1A 2GDNA 3IXHA 1OTBA 1OJGA 3CPTB 2ZQDA 4EBLA 1PWGA 3UDFA 5GHYA 1LSXA 1N9BA 1G6OA 2A3UA 3IH9A 3NDEA 2VGLS 3V3SA 1GHIA 3NECA 2Y59A 3KO6A 3Q07A 2ZQ8A 3L9KA 3GDIA 2P7JA 3S22A 3G4PA 2W0NA 1W79A 3E4QA 3I7JA 1L0FA 4MMNA 1RGYA 2JBFA 2JHEA 2VK3A 3C4OA 5FSRA 5CX7A 3MZFA 2V0UA 3UE3A 3VSKA 3ZGAB 1PW8A 5TFQA 4ETZA 1S1YA 2PBDP 2JE5A 3MSHA 1WYBA 3F1NA 2NUTC 2W3DA 3UB5P 5JYPA 3LCEA 5FQQA 3W4OA 1VETA 2HDQA 2HV1A 5AVEA 3B42A 4EBNA 3FZCA 3V5MA 1XJ6A 4R38A 2ZJ9A 3IWIA 1TDGA 4E3NA 1JTGA 4EEUA 3BFGA 1HVBA 1Y54A 1K38A 4MLLA 3SS3A 4DN0A 4BBTA 1NLZA 1X0OA 2ZM0A 2PR5A 3UO9A 5KIZA 4NETA 3BRMA 5AQ9A 3G6OA 3WRTA 3A3FA 1LT0A 2Y2HA 5EVIB 4S2JA 1I2WA 3Q7ZA 3CG5A 4PAUA 4BL2A 1YLJA 2O0YA 3L7HA 3LR3A 1CI8A 3RTYA 4S2OA 4FSFA 2J3WA 2XEPA 4E6XA 3SH7A 3UB9A 4OONA 3ZG5A 3B33A 3WS0A 3IHBA 5EOOA 1HTZA 4HESA 2XGNA 2LB9A 1W7FA 3WS5A 3JVUA 1VB6A 3MZEA 3RXXA 3ZVTA 3E4PA 1UWPX 2AVXA 3VP2A 3V50A 3LUQA 1K25A 3LR0A 4GCZA 2W3GA 4IVIA 1T1AA 2X71A 1KE4A 4U0TA 3IBRA 4CPKA 4KZ3A 1BT5A 4UHUA 1GA0A 4P85A 5TJJA 4LRZE 4KUOA 4YNRA 3OZHA 4PHTA 3TW8A 3HLWA 1IFQA 2V1BA 4JXVA 5BOHA 3BY8A 2ZC3B 2HJEA 2VZWA 4P6BA 1KE0A 1IELA 3T4SA 5HWWA 4JF5A 4KZAA 4O8GA 2UV0E 4QJGA 4FOFA 5J7EA 4WUJA 3LEQA 4OPZA 3N4IA 5CHUA 3T1RA 5CTMA 5DF9A 4HP9A 5FAOA 3OLOA 4EQIA 3VE3A 1K54A 2PBYA 4MDZA 1NRJA 1S6RA 2ZL1A 3HLCA 2L1MA 2QHKA 1STZA 4OLGA 2EXBA 2HDUA 1IYOA 3EGDC 3OCNA 4MN7A 4S2PA 1YLZA 3WS4A 3IBJA 1TF1A 2R78A 2WGWA 3BEBA 1KVLA 1YKDA 4PM8A 4H6JA 3FKVA 3V3RA 3Q7VA 4P6ZS 5G18A 4X6TA 5GHZA 1SKOB 4OH0A 4XUXA 5FQKA 3LIDA 2PR6A 3CWFA 1BULA 2PT7A 2YKFA 1S66L 3WRZA 2J80A 2PD8A 3NJAA 4OOLA 1OT9A 3G2YA 5IU1A 2M1CA 2Y79A 5GLBA 3ITBA 4GOGA 1W5DA 2W1TB 4IEDA 3C7UA 5F1GA 4KQOA 4LLOB 2BG1A 5KMWA 2ZMFA 5EV0A 5FEGA 3E0YA 5M1AA 1LSVA 5EECA 3MKFA 3NOPC 4GNUA 1BUEA 1NYYA 5CGSA 3PXPA 4NXGA 3IXBA 4JF6A 2OSUA 5FDSA 2V8FA 5I5LA 2HP5A 1ZKJA 4BD1A 4MCWA 5AQ7A 1SZVA 2FZ0A 4GZBA 3TG9A 4I3JA 3ZG8B 1RP5A 5HL1A 2V20A 3WS1A 1YQSA 2J7VA 3VP1A 3T4LA 3MBZA 3IX4A 3VV4A 2V1AA 3OCLA 4HNBA 3KSFA 3HREA 2JCHA 1QMEA 3TE8A 2XROA 1OTAA 2WKEA 1MC0A 5GL9A 3BFFA 2VLGA 3FWLA 4L0LA 1NYMA 2WGIA 3PTEA 3UDXA 4RQ9A 2WAEA 4PPRA 2OLUA 4K0WA 2O9AA 4YFMA 4CLCD 3BFDA 3D4FA 3N8SA 1XJ4A 3S1YA 2J9PA 4XXRA 4UQIM 3ISGA 4MN5A 1YMSA 2HDRA 1TD5A 2I72A 4ZDXA 3RXWA 1H5XA 2EX8A 5KSCA 2D02A 4G3WA 4X1MA 1J9MA 3VE4A 1ES2A 3H7WB 1YLYA 3SOIA 1H8YA 3TSGA 4IHQA 4BBVA 1GA9A 3LY4A 2VEAA 2IWBA 3M2KA 5HPFA 2PU4A 4R70A 2VX8A 3QNBA 4N9KA 4EV4A 3EQUA 2PU2A 2V0WA 2J8YA 3G35A 4Z1WA 3ZG7B 4B9OA 4X68A 1CF0A 1MXOA 2VGJA 1LL8A 3MZDA 4Y5FA 4UA9A 2ZOHA 1SHVA 4EUZA 2GX5A 3IWOA 4MBFA 1V9ZA 4LV0A 4IUHA 4S2NC 4HJ6A 4R6LA 3B47A 3IF5A 1F2KA 3S7OA 1W8QA 5AVFA 4A5RA 2JKRM 1ZG6A 4ZRRA 5A93A 5HL6A 4M3KA 4Y13A 3K2NA 5DTSA 3B3XA 5DKLA 2XF3A 2KLIA 2YKHA 4WM9A 1QMFA 3AGFA 4PM5A 1BLHA 2P9VA 2V2FF 3U2AA 3HUOA 5E2GA 3H82B 4WELA 1FSYA 4DDSA 2DMWA 2O99A 4L9EA 1PNEA 5HWVA 4NEED 3UPOA 5FI7A 2QJ5A 4JGQA 1KVMA 1FSWA 4GD8A 1ODVA 4GKUA 3HBRA 4JGPA 1ONGA 5EPHA 1HD8A 1UGUA 1HLUP 2ZM8A 2QPNA 2CMNA 4Q0HA 2WYXA 4NK3A 1O07A 2W3HA 3E98A 2IA2A 4PM6A 1BLCA 4MBHA 3UE6A 5FAPA 1CJFA 2VGLM 1IEMA 3KX0X 1XFQA 4PMAA 4GJ4A 2W3EA 5G4YA 4X56A 1MBLA 1BZAA 3W2ZA 5HD3A 3OPLA 3GRJA 3IX3A 2A24A 2V1ZA 3ZDJA 1L3LA 3MQOA 4F3LA 1DRMA 3ZFZA 2J9OA 4OQIA 1IYQA 1PFLA 4KG5A 3FYZA 3UMDA 1G28A 2OV5A 4GN2A 3W4QA 5CECA 2QYBA 1DJCA 5C5KA 3GTCA 1P0ZA 2Y4AA 3N8RA 3OPRA 4LRYC 3C7VA 4CLCE 4ARZB 5HAIA 3DTEA 1OTDA 3VFHA 2XA7S 5F82A 2ZMAA 4LENA 4DF6A 3C8CA 2J3TD 3VOZA 4OP8A 4ETXA 5FQIA 3NCKA 3C30A 1XJ2A 1G6AA 2I9VA 4HH3A 5CRFA 4Y7PA 4Q0IA 4NG2A 1W63M 4KG6A 4QHCA 1LL9A 1OT6A 2ZD8A 3Q81A 2JKTM 1EWZA 3UE0A 2KOIA 2ZC4B 4O01A 4H6JB 4GS9A 5DF8A 4KZ7A 2BLSA 2WAFA 4C75A 5HARA 4XT2A 2ZQAA 2Z2MB 4WLAA 1YSPA 3BLMA 1E3UD 5DVAA 2FFFB 2L4RA 3DW0A 5J3WA 3A0VA 4UA6A 5EUAA 1NZUA 4IBXA 2RCXA 4OLDA 3TJZC 2L0WA 3IF6A 4WZ4A 2XK1A 5A91A 5CERA 2IWDA 2BTFP 1H0MA 5KSHA 1TS6A 1YT4A 1CQAA 2XSSA 4G3VA 1OTIA 1JTDA 1S0WA 1S4RA 5U47A 3DTMA 2B02A 2EA9A 3G30A 5EOEA 1DJAA 4DMZA 3ZCZA 2EWVA 4FTXA 1A0KA 1SCWA 3PBSA 5F83A 2Y91A 3BQAA 3DTIA 3VSLA 3KSGA 1PIOA 4D60A 2VKSA 3JVVA 4Q8IA 5CEDA 5GLAA 2R9XA 3ITAA 4BBUA 2WK0A 3A0SA 4K08A 2W3FA 4JXWA 5E2EA 3HUNA 4O7DA 5DFYA 4WZ5A 1M40A 5HDCA 4WF0A 3GSGA 2Y2MA 4MBKA 1C3BA 1WYCA 1PZPA 4QPRA 1I2SA 5HZHA 3PBOA 5HFOA 1MWRA 4NXFA 3BECA 4UA7A 2GZAA 5CXWA 4EW7A 4WEJA 1L0EA 3BFEA 4Y0UA 3T4QA 1VM1A 4DE0A 4Y0TA 1S67L 4KQQA 2XDMA 4E04A 1TVFA 3P7NA 1MPLA 3KSIA 1NZOA 4KQRA 1CK3A 1NY0A 3VP3A 5EVLA 1E25A 1K4EA 2OAQ1 5A90A 1DP8A 2HZ5A 3F1PB 4HY8A 4DRTA 1BTLA 2H28A 2QWSA 4LRXC 3T4JA 5I94A 4OQHA 1K54C 5FEFA 1ES5A 3EWKA 2XFTA 2C5WB 3LGOA 2G2UA 1Q2PA 1ALQA 2MJ6A 1K6RA 4LV2A 4HI4A 1EI5A 2ZC7A 1XXMA 2ZBBA 4E3MA 1TS7A 1Y4OA 5HAQA 4PM9A 3BFCA 4LFUA 4BENA 3BJNA 3DWZA 3UB7A 4ME4A 2ZC5B 4Q0JA 3OPPA 5FI2A 3A0RA 4JXGA 1NWZA 3SH8A 2W1RA 4BJPA 2ZM2A 4DKIA 1GHPA 2Z2LB 2A49A 1XA1A 1K57A 5J4EA 1FCMA 2PAVP 4N92A 3CI6A 2UWXA 1G68A 4B93A 4E3OA 2QKPA 1K57C 1SDEA 4ZBEA 1HZOA 3F1OA 3GVBA 2XRNA 1ZC2A 2Y2NA 1KDSA 4CLCA 1UWNX 3LR5A 3N6IA 4OQGA 4R1GA 3IS2B 4X25A 3IXDA 4ZTKA 3HL9A 5HWTA 3EQVA 3OBFA 2M7VA 3C2WA 1Y28A 2KDKA 5L07A 1K55A 1GHMA 1PRQA 1FQGA 1NRFA 3A3IA 4B4XA 4WBGA 4CLCC 1ZHHB 1K4FA 2H10A 5A92A 1JWZA 1K55C 5EVID 1ZTUA 3KYZA 4EBPA 4MN6A 3UPNA 4BD0A 4S2KA 4HOIA 4M4XA 4BMWA 5HDDA 1MWTA 2EX9A 5F68A 4QY5A 3DBAA 4N1XA 1DY6A 4KENB 3JYIA 2PDRA 4NKPA 4WYYA 2OWJA 2Y55A 5CTNA 5FDHA 2JN7A 1IKGA 3LY3A 5KZHA 3E4OA 3MQQA 1K6SA 4EETB 2LB5A
chains in the Genus database with same CATH topology
1KGFA 1O7EA 4HEFA 3IWQA 4C6YA 2ZM0A 5TGFA 3UDIA 1KVMA 1FSWA 4HBTA 4GD8A 3AGEA 2QZ6A 2XFSA 4GKUA 4PM7A 3UO9A 1OMEA 2XH9A 3HBRA 1ERQA 2Q9NA 4LV3A 5FA7A 1ONGA 2VGKA 3BRMA 3M6BA 4NETA 2DRWA 5AQ9A 2XD1A 4OKPA 3S4XA 3WRTA 3A3FA 2Y2HA 5EPHA 1HD8A 3A3JA 5EVIB 4B4ZA 2WKIA 2ZM8A 2QPNA 4S2JA 1I2WA 2WYXA 3Q7ZA 3CG5A 4H8RA 4NK3A 1O07A 4BL2A 1YLJA 1CI8A 4S2OA 4PM6A 4FSFA 1BLCA 3RJUA 4MBHA 2XEPA 5FAPA 4XUZA 3PBQA 3PAGA 5IHVA 3SH7A 4E6XA 4OONA 3ZG5A 2ZQCA 4D2OA 3UN7A 2HPBA 2WKHA 1IEMA 4CJNA 3WS0A 4PMAA 3MKEA 2EXAA 4S2MA 3IHBA 5EOOA 4X56A 4R4SA 1MBLA 1BZAA 1HTZA 4HESA 2XGNA 1PI4A 4KG2A 1VQQA 3CMZA 5EVIA 4R4RA 3OPLA 3GRJA 1W7FA 4R23A 4FH4A 2WZZA 5FQ9A 2V1ZA 3ZDJA 4HBUA 3WS5A 4X53A 3ZFZA 2J9OA 1WE4A 3MZEA 3RXXA 3E2KA 3ZVTA 4OQIA 3VP2A 2WADA 3V50A 3HUMA 3M2JA 1IYQA 4ZAMA 1K25A 4KG5A 1Q2QA 3FYZA 2OV5A 4IVIA 4KZ5A 5EVIC 4GN2A 2H5SA 2HDSA 2X71A 3O3VA 3W4QA 3MFDA 1KE4A 5CECA 1DJCA 4U0TA 3GTCA 1IYSA 4CPKA 4F94A 4KZ3A 1BT5A 1ERMA 1JWPA 2Y4AA 1GA0A 3MXSA 4P85A 4UHUA 3UNWA 3HLEA 4E3KA 3NBLA 3TOIA 3N8RA 3OPRA 3OZHA 3C7VA 5HAIA 2P9VB 4RX3A 1K56A 4QB8A 3P98A 4BQMA 4ZJ2A 3VFHA 3HLWA 4KZBA 5GHXA 4JXVA 2Y2OA 5BOHA 4WMCA 2ZC3B 3ZG9B 4QD4A 1ESIA 2XLNA 5F82A 1PWCA 2ZMAA 4DE1A 3IXGA 4LENA 4DF6A 5M19A 1ES4A 4JLFA 4P6BA 4GD6A 5CGXA 1KE0A 1IELA 3Q1FA 5HW3A 3BYDA 3HLGA 3G34A 4KZ6A 4GDBA 3UPPA 4JF5A 4DE3A 5GLDA 4KZAA 5GLCA 3VOZA 4OP8A 5E2HA 3ZVWA 4QJGA 1ZG4A 1IYPA 2Y2GA 5FQIA 3VOYA 4U0XA 3NCKA 4OPZA 1G6AA 4RVAA 3N4IA 5CHUA 5CRFA 4Y7PA 2X01A 3IQAA 5CTMA 5DF9A 4Z9QA 1KDWA 1FR6A 3PBNA 1KGGA 3NC8A 5FAOA 4QU3A 4KG6A 4QHCA 1LL9A 1PZOA 4EQIA 2ZD8A 3Q81A 3UE0A 1EWZA 1K54A 2PBYA 1XGIA 1CI9A 2ZC4B 3FV7A 4QY6A 1SKFA 1S6RA 5E2FA 5M18A 3WWXA 3O86A 5HX9A 5DF8A 4C3QA 1TDLA 3HLCA 4KZ7A 3BLSA 2BLSA 4JKTA 1K56D 1Z6FA 2WAFA 4P0MA 4C75A 5HARA 4OLGA 2WZXA 3GV9A 2ZQAA 1LI9A 2Z2MB 1E4DA 2EXBA 3VP4A 4WMCD 2HDUA 3BLMA 1E3UD 5DVAA 5EE8A 2FFFB 4GDNA 3DW0A 1IYOA 5FATA 5CEBA 1H8ZA 1BLSA 4X55A 2HP9A 3OCNA 4MEZA 5CHJA 4OP5A 4UA6A 4S2PA 3VFFA 3ZNTA 1YLZA 3WS4A 2WUQA 5EUAA 1NZUA 3PBTA 3NIAA 2WGWA 3BEBA 3A3EA 1KVLA 3DWKA 4IBXA 2RCXA 4PM8A 4YINA 3NDGA 4OLDA 2JC7A 3IF6A 2EFUA 3FKVA 1KE3A 1FOFA 2XK1A 4WZ4A 5A91A 1LI0A 2IWDA 4LCLA 4X69A 5AQAA 5CERA 3V3RA 3Q7VA 5KSHA 2DCFA 5G18A 4X6TA 3HLDA 5GHZA 4OH0A 1LHYA 4XUXA 5FQKA 2WGVA 1YT4A 3OC2A 1YMXA 1BULA 3N8LA 5L2FA 1FR1A 3A3DA 1JTDA 1S0WA 2ZC6B 3IHAA 5U47A 3WRZA 3DTMA 4OVDA 3ZG0A 3G30A 4R3JA 5EOEA 5FI6A 1L0GA 1DJAA 5FQJA 4OOLA 4OPYA 1KGEA 1JWVA 1LL5A 3G2YA 3LO7A 4B88A 5FASA 5GLBA 5JYOA 3ZCZA 4ZJ3A 4JXSA 3ITBA 1SCWA 1XGJA 3PBSA 4UAAA 4GB7A 2Y2KA 1W5DA 4GOGA 5DF7A 5F83A 2Y91A 3ZNYA 4OPQA 4FCFA 1EROA 4IEDA 3VSLA 3C7UA 1PIOA 5F1GA 4KQOA 1IKIA 4S2LA 2BG1A 4Q8IA 5KMWA 3FKWA 5CEDA 5M1AA 5GLAA 5EECA 3W8KA 2R9XA 3ITAA 2RL3A 3MKFA 4K91A 4GNUA 3G32A 4JF4A 1BUEA 1NYYA 3GR2A 5CGSA 3HLFA 2WK0A 1L0DA 1YLTA 3HVFA 1M6KA 2OSUA 3IXBA 4JF6A 3SS5A 5J8XA 3W4PA 1LLBA 4JXWA 2Q9MA 4FH2A 1FCOA 1PI5A 4S2NA 1AXBA 2HP5A 1ZKJA 3GQZA 5E2EA 3HUNA 4O7DA 1E3UA 4BD1A 4WZ5A 1M40A 3P09A 5AQ7A 3QNCA 3VP0A 4GZBA 1XKZA 3TG9A 3GSGA 2EX6A 2Y2MA 3O88A 3G2ZA 3C4PA 3ZG8B 3GMWA 4MBKA 1C3BA 1RP5A 3M6HA 1WYCA 1PZPA 3QHYA 5HL1A 1I2SA 2ZQ9A 5TR7A 4N1HA 2V20A 3PBOA 4ZJ1A 3WS1A 1YQSA 1ES3A 5HFOA 4OOMA 1MWRA 2J7VA 3BECA 4UA7A 5CXWA 3VP1A 3MBZA 4WEJA 1L0EA 2R9WA 4S2IA 1TEMA 1NJ4A 4IVKA 3BFEA 4U3TA 3MXRA 4Y0UA 2P74A 1VM1A 4DE0A 2ZLYA 3OCLA 4Y0TA 1NXYA 3SS4A 4KQQA 4DXBA 2XDMA 1TVFA 3HREA 4P87A 1MPLA 1FCNA 2JCHA 1NZOA 4KQRA 2WGWB 1XP4A 1CK3A 1NY0A 4OQ0A 1QMEA 4RYEA 3VP3A 4E3IA 5EVLA 5F1FA 1E25A 1K4EA 5CGWA 5DTKA 3C5AA 4BL3A 1GCEA 2WKEA 3IF6B 5A90A 5GL9A 3OPHA 4MNRA 2FFYA 3BFFA 2Y2IA 3FWLA 4DRTA 3Q7VB 1BTLA 1MKIA 4L0LA 1NYMA 2WGIA 3PTEA 1XPBA 3UDXA 2C6WB 4LCMA 2WAEA 5I94A 3HLBA 4OOYA 4OQHA 1ONHA 2Y2LA 1K54C 2QMIA 1MWSA 2OLUA 4PPRA 1ES5A 2H0YA 3O87A 4K0WA 2G2WA 4YFMA 2XFTA 3BFDA 3D4FA 3N8SA 2HP6A 2C5WB 1ESUA 3S1YA 2G2UA 4K0XA 2J9PA 2Y2PA 4JPMA 4R3BA 4XXRA 3ISGA 1JVJA 1U60A 1YMSA 2HDRA 1Q2PA 4BLMA 3WS2A 4DDYA 1ALQA 4JBFA 1PWDA 1K6RA 3SH9A 4LV2A 2I72A 4ZDXA 3RXWA 1EI5A 3UY6A 1H5XA 1XX2A 4KZ8A 2ZC7A 2EX8A 1XXMA 4E3MA 5KSCA 5HAQA 4R0QA 5FQMA 4PM9A 3PAEA 3BFCA 4E3LA 3G31A 1L2SA 1I5QA 4BENA 3E2LA 3IF6C 1J9MA 5D3OA 1YLPA 3LEZA 3DWZA 4DXCA 1PW1A 1ES2A 2GDNA 3PBRA 3IXHA 1YLYA 3SOIA 2ZC5B 1H8YA 3TSGA 3OPPA 2CC1A 5FI2A 1SDNA 2ZQDA 1GA9A 1YM1A 4JXGA 3SH8A 4EBLA 3LY4A 1PWGA 4IBRA 5GHYA 3UDFA 5E43A 2IWBA 4BJPA 2ZM2A 3M2KA 4LV1A 4DKIA 1GHPA 2Z2LB 2A49A 1XA1A 1N9BA 3VMAA 1K57A 1DJBA 2A3UA 3IH9A 3NDEA 3V3SA 1FCMA 1GHIA 2PU4A 4N92A 2OLVA 3N7WA 3QNBA 3NY4A 4N9KA 3EQUA 2Y2QA 2Y59A 4EV4A 2PU2A 3Q07A 3BM6A 3ZHHA 2J8YA 2UWXA 3G35A 3IH8A 3ZG7B 1G68A 2ZQ8A 4X68A 1MWUA 4E3OA 5AQBA 1MXOA 5CHMA 2VGJA 4ID4A 3S22A 1K57C 3CZDA 1SDEA 3MZDA 3G4PA 4ZBEA 1HZOA 1N4OA 3GVBA 1W79A 4UA9A 2B5RA 3IT9A 1ZC2A 2Y2NA 1KDSA 1SHVA 4EUZA 3CJMA 1RCJA 3IWOA 4MBFA 2ZQ7A 3I7JA 1L0FA 1RGYA 2JBFA 3N6IA 4OQGA 4E3JA 4R1GA 4FD8A 4LV0A 3C4OA 3IXDA 5DTTA 3HL9A 4ZTKA 5FSRA 3EQVA 3UE1A 1PYYA 1K55A 3MZFA 1GHMA 4S2NC 3UE3A 4E6WA 1FQGA 1NRFA 3VSKA 1PW8A 3ZGAB 3IF5A 5TFQA 2DNSA 3A3IA 2JE5A 4WZ5C 1W8QA 1YLWA 4B4XA 4A5RA 1ZG6A 4DE2A 1WYBA 4WBGA 1W8YA 5A93A 2E8IA 2EFXA 5JYPA 4M3KA 1MY8A 1K4FA 3LCEA 2H10A 5FQQA 3AGDA 5A92A 1JWZA 3W4OA 1K55C 5DTSA 1CEFA 5EVID 2IWCA 3B3XA 2XF3A 4WEKA 2HDQA 5HAPA 4EBPA 1CEGA 1RGZA 1BSGA 4KZ4A 4WM9A 4EBNA 4EWFA 1QMFA 3FZCA 3UPNA 3V5MA 4BD0A 3AGFA 4PM5A 4S2KA 1XA7A 1BLHA 2P9VA 1MWTA 2EX9A 2ZJ9A 4QY5A 2V2FF 3IWIA 1TDGA 4N9LA 5FAQA 3V39A 4N1XA 3HUOA 4E3NA 1DY6A 5E2GA 4KENB 3JYIA 1JTGA 4WYYA 1BLPA 2EX2A 2H0TA 2XQZA 2Y55A 4WELA 1FSYA 3NI9A 4KZ9A 4Y0OA 5CTNA 4RA7A 4DDSA 5FDHA 3BFGA 2XD5A 1IKGA 3LY3A 5KZHA 1HVBA 1Y54A 2Y2JA 1K38A 2XR0A 3Q82A 4MLLA 4OPRA 4RX2A 3UPOA 1K6SA 5FI7A 3SS3A 2X02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGF A;  1O7E A;  4HEF A;  3IWQ A;  4C6Y A;  2ZM0 A;  5TGF A;  3UDI A;  1KVM A;  1FSW A;  4HBT A;  4GD8 A;  3AGE A;  2QZ6 A;  2XFS A;  4GKU A;  4PM7 A;  3UO9 A;  1OME A;  2XH9 A;  3HBR A;  1ERQ A;  2Q9N A;  4LV3 A;  5FA7 A;  1ONG A;  2VGK A;  3BRM A;  3M6B A;  4NET A;  2DRW A;  5AQ9 A;  2XD1 A;  4OKP A;  3S4X A;  3WRT A;  3A3F A;  2Y2H A;  5EPH A;  1HD8 A;  3A3J A;  5EVI B;  4B4Z A;  2WKI A;  2ZM8 A;  2QPN A;  4S2J A;  1I2W A;  2WYX A;  3Q7Z A;  3CG5 A;  4H8R A;  4NK3 A;  1O07 A;  4BL2 A;  1YLJ A;  1CI8 A;  4S2O A;  4PM6 A;  4FSF A;  1BLC A;  3RJU A;  4MBH A;  2XEP A;  5FAP A;  4XUZ A;  3PBQ A;  3PAG A;  5IHV A;  3SH7 A;  4E6X A;  4OON A;  3ZG5 A;  2ZQC A;  4D2O A;  3UN7 A;  2HPB A;  2WKH A;  1IEM A;  4CJN A;  3WS0 A;  4PMA A;  3MKE A;  2EXA A;  4S2M A;  3IHB A;  5EOO A;  4X56 A;  4R4S A;  1MBL A;  1BZA A;  1HTZ A;  4HES A;  2XGN A;  1PI4 A;  4KG2 A;  1VQQ A;  3CMZ A;  5EVI A;  4R4R A;  3OPL A;  3GRJ A;  1W7F A;  4R23 A;  4FH4 A;  2WZZ A;  5FQ9 A;  2V1Z A;  3ZDJ A;  4HBU A;  3WS5 A;  4X53 A;  3ZFZ A;  2J9O A;  1WE4 A;  3MZE A;  3RXX A;  3E2K A;  3ZVT A;  4OQI A;  3VP2 A;  2WAD A;  3V50 A;  3HUM A;  3M2J A;  1IYQ A;  4ZAM A;  1K25 A;  4KG5 A;  1Q2Q A;  3FYZ A;  2OV5 A;  4IVI A;  4KZ5 A;  5EVI C;  4GN2 A;  2H5S A;  2HDS A;  2X71 A;  3O3V A;  3W4Q A;  3MFD A;  1KE4 A;  5CEC A;  1DJC A;  4U0T A;  3GTC A;  1IYS A;  4CPK A;  4F94 A;  4KZ3 A;  1BT5 A;  1ERM A;  1JWP A;  2Y4A A;  1GA0 A;  3MXS A;  4P85 A;  4UHU A;  3UNW A;  3HLE A;  4E3K A;  3NBL A;  3TOI A;  3N8R A;  3OPR A;  3OZH A;  3C7V A;  5HAI A;  2P9V B;  4RX3 A;  1K56 A;  4QB8 A;  3P98 A;  4BQM A;  4ZJ2 A;  3VFH A;  3HLW A;  4KZB A;  5GHX A;  4JXV A;  2Y2O A;  5BOH A;  4WMC A;  2ZC3 B;  3ZG9 B;  4QD4 A;  1ESI A;  2XLN A;  5F82 A;  1PWC A;  2ZMA A;  4DE1 A;  3IXG A;  4LEN A;  4DF6 A;  5M19 A;  1ES4 A;  4JLF A;  4P6B A;  4GD6 A;  5CGX A;  1KE0 A;  1IEL A;  3Q1F A;  5HW3 A;  3BYD A;  3HLG A;  3G34 A;  4KZ6 A;  4GDB A;  3UPP A;  4JF5 A;  4DE3 A;  5GLD A;  4KZA A;  5GLC A;  3VOZ A;  4OP8 A;  5E2H A;  3ZVW A;  4QJG A;  1ZG4 A;  1IYP A;  2Y2G A;  5FQI A;  3VOY A;  4U0X A;  3NCK A;  4OPZ A;  1G6A A;  4RVA A;  3N4I A;  5CHU A;  5CRF A;  4Y7P A;  2X01 A;  3IQA A;  5CTM A;  5DF9 A;  4Z9Q A;  1KDW A;  1FR6 A;  3PBN A;  1KGG A;  3NC8 A;  5FAO A;  4QU3 A;  4KG6 A;  4QHC A;  1LL9 A;  1PZO A;  4EQI A;  2ZD8 A;  3Q81 A;  3UE0 A;  1EWZ A;  1K54 A;  2PBY A;  1XGI A;  1CI9 A;  2ZC4 B;  3FV7 A;  4QY6 A;  1SKF A;  1S6R A;  5E2F A;  5M18 A;  3WWX A;  3O86 A;  5HX9 A;  5DF8 A;  4C3Q A;  1TDL A;  3HLC A;  4KZ7 A;  3BLS A;  2BLS A;  4JKT A;  1K56 D;  1Z6F A;  2WAF A;  4P0M A;  4C75 A;  5HAR A;  4OLG A;  2WZX A;  3GV9 A;  2ZQA A;  1LI9 A;  2Z2M B;  1E4D A;  2EXB A;  3VP4 A;  4WMC D;  2HDU A;  3BLM A;  1E3U D;  5DVA A;  5EE8 A;  2FFF B;  4GDN A;  3DW0 A;  1IYO A;  5FAT A;  5CEB A;  1H8Z A;  1BLS A;  4X55 A;  2HP9 A;  3OCN A;  4MEZ A;  5CHJ A;  4OP5 A;  4UA6 A;  4S2P A;  3VFF A;  3ZNT A;  1YLZ A;  3WS4 A;  2WUQ A;  5EUA A;  1NZU A;  3PBT A;  3NIA A;  2WGW A;  3BEB A;  3A3E A;  1KVL A;  3DWK A;  4IBX A;  2RCX A;  4PM8 A;  4YIN A;  3NDG A;  4OLD A;  2JC7 A;  3IF6 A;  2EFU A;  3FKV A;  1KE3 A;  1FOF A;  2XK1 A;  4WZ4 A;  5A91 A;  1LI0 A;  2IWD A;  4LCL A;  4X69 A;  5AQA A;  5CER A;  3V3R A;  3Q7V A;  5KSH A;  2DCF A;  5G18 A;  4X6T A;  3HLD A;  5GHZ A;  4OH0 A;  1LHY A;  4XUX A;  5FQK A;  2WGV A;  1YT4 A;  3OC2 A;  1YMX A;  1BUL A;  3N8L A;  5L2F A;  1FR1 A;  3A3D A;  1JTD A;  1S0W A;  2ZC6 B;  3IHA A;  5U47 A;  3WRZ A;  3DTM A;  4OVD A;  3ZG0 A;  3G30 A;  4R3J A;  5EOE A;  5FI6 A;  1L0G A;  1DJA A;  5FQJ A;  4OOL A;  4OPY A;  1KGE A;  1JWV A;  1LL5 A;  3G2Y A;  3LO7 A;  4B88 A;  5FAS A;  5GLB A;  5JYO A;  3ZCZ A;  4ZJ3 A;  4JXS A;  3ITB A;  1SCW A;  1XGJ A;  3PBS A;  4UAA A;  4GB7 A;  2Y2K A;  1W5D A;  4GOG A;  5DF7 A;  5F83 A;  2Y91 A;  3ZNY A;  4OPQ A;  4FCF A;  1ERO A;  4IED A;  3VSL A;  3C7U A;  1PIO A;  5F1G A;  4KQO A;  1IKI A;  4S2L A;  2BG1 A;  4Q8I A;  5KMW A;  3FKW A;  5CED A;  5M1A A;  5GLA A;  5EEC A;  3W8K A;  2R9X A;  3ITA A;  2RL3 A;  3MKF A;  4K91 A;  4GNU A;  3G32 A;  4JF4 A;  1BUE A;  1NYY A;  3GR2 A;  5CGS A;  3HLF A;  2WK0 A;  1L0D A;  1YLT A;  3HVF A;  1M6K A;  2OSU A;  3IXB A;  4JF6 A;  3SS5 A;  5J8X A;  3W4P A;  1LLB A;  4JXW A;  2Q9M A;  4FH2 A;  1FCO A;  1PI5 A;  4S2N A;  1AXB A;  2HP5 A;  1ZKJ A;  3GQZ A;  5E2E A;  3HUN A;  4O7D A;  1E3U A;  4BD1 A;  4WZ5 A;  1M40 A;  3P09 A;  5AQ7 A;  3QNC A;  3VP0 A;  4GZB A;  1XKZ A;  3TG9 A;  3GSG A;  2EX6 A;  2Y2M A;  3O88 A;  3G2Z A;  3C4P A;  3ZG8 B;  3GMW A;  4MBK A;  1C3B A;  1RP5 A;  3M6H A;  1WYC A;  1PZP A;  3QHY A;  5HL1 A;  1I2S A;  2ZQ9 A;  5TR7 A;  4N1H A;  2V20 A;  3PBO A;  4ZJ1 A;  3WS1 A;  1YQS A;  1ES3 A;  5HFO A;  4OOM A;  1MWR A;  2J7V A;  3BEC A;  4UA7 A;  5CXW A;  3VP1 A;  3MBZ A;  4WEJ A;  1L0E A;  2R9W A;  4S2I A;  1TEM A;  1NJ4 A;  4IVK A;  3BFE A;  4U3T A;  3MXR A;  4Y0U A;  2P74 A;  1VM1 A;  4DE0 A;  2ZLY A;  3OCL A;  4Y0T A;  1NXY A;  3SS4 A;  4KQQ A;  4DXB A;  2XDM A;  1TVF A;  3HRE A;  4P87 A;  1MPL A;  1FCN A;  2JCH A;  1NZO A;  4KQR A;  2WGW B;  1XP4 A;  1CK3 A;  1NY0 A;  4OQ0 A;  1QME A;  4RYE A;  3VP3 A;  4E3I A;  5EVL A;  5F1F A;  1E25 A;  1K4E A;  5CGW A;  5DTK A;  3C5A A;  4BL3 A;  1GCE A;  2WKE A;  3IF6 B;  5A90 A;  5GL9 A;  3OPH A;  4MNR A;  2FFY A;  3BFF A;  2Y2I A;  3FWL A;  4DRT A;  3Q7V B;  1BTL A;  1MKI A;  4L0L A;  1NYM A;  2WGI A;  3PTE A;  1XPB A;  3UDX A;  2C6W B;  4LCM A;  2WAE A;  5I94 A;  3HLB A;  4OOY A;  4OQH A;  1ONH A;  2Y2L A;  1K54 C;  2QMI A;  1MWS A;  2OLU A;  4PPR A;  1ES5 A;  2H0Y A;  3O87 A;  4K0W A;  2G2W A;  4YFM A;  2XFT A;  3BFD A;  3D4F A;  3N8S A;  2HP6 A;  2C5W B;  1ESU A;  3S1Y A;  2G2U A;  4K0X A;  2J9P A;  2Y2P A;  4JPM A;  4R3B A;  4XXR A;  3ISG A;  1JVJ A;  1U60 A;  1YMS A;  2HDR A;  1Q2P A;  4BLM A;  3WS2 A;  4DDY A;  1ALQ A;  4JBF A;  1PWD A;  1K6R A;  3SH9 A;  4LV2 A;  2I72 A;  4ZDX A;  3RXW A;  1EI5 A;  3UY6 A;  1H5X A;  1XX2 A;  4KZ8 A;  2ZC7 A;  2EX8 A;  1XXM A;  4E3M A;  5KSC A;  5HAQ A;  4R0Q A;  5FQM A;  4PM9 A;  3PAE A;  3BFC A;  4E3L A;  3G31 A;  1L2S A;  1I5Q A;  4BEN A;  3E2L A;  3IF6 C;  1J9M A;  5D3O A;  1YLP A;  3LEZ A;  3DWZ A;  4DXC A;  1PW1 A;  1ES2 A;  2GDN A;  3PBR A;  3IXH A;  1YLY A;  3SOI A;  2ZC5 B;  1H8Y A;  3TSG A;  3OPP A;  2CC1 A;  5FI2 A;  1SDN A;  2ZQD A;  1GA9 A;  1YM1 A;  4JXG A;  3SH8 A;  4EBL A;  3LY4 A;  1PWG A;  4IBR A;  5GHY A;  3UDF A;  5E43 A;  2IWB A;  4BJP A;  2ZM2 A;  3M2K A;  4LV1 A;  4DKI A;  1GHP A;  2Z2L B;  2A49 A;  1XA1 A;  1N9B A;  3VMA A;  1K57 A;  1DJB A;  2A3U A;  3IH9 A;  3NDE A;  3V3S A;  1FCM A;  1GHI A;  2PU4 A;  4N92 A;  2OLV A;  3N7W A;  3QNB A;  3NY4 A;  4N9K A;  3EQU A;  2Y2Q A;  2Y59 A;  4EV4 A;  2PU2 A;  3Q07 A;  3BM6 A;  3ZHH A;  2J8Y A;  2UWX A;  3G35 A;  3IH8 A;  3ZG7 B;  1G68 A;  2ZQ8 A;  4X68 A;  1MWU A;  4E3O A;  5AQB A;  1MXO A;  5CHM A;  2VGJ A;  4ID4 A;  3S22 A;  1K57 C;  3CZD A;  1SDE A;  3MZD A;  3G4P A;  4ZBE A;  1HZO A;  1N4O A;  3GVB A;  1W79 A;  4UA9 A;  2B5R A;  3IT9 A;  1ZC2 A;  2Y2N A;  1KDS A;  1SHV A;  4EUZ A;  3CJM A;  1RCJ A;  3IWO A;  4MBF A;  2ZQ7 A;  3I7J A;  1L0F A;  1RGY A;  2JBF A;  3N6I A;  4OQG A;  4E3J A;  4R1G A;  4FD8 A;  4LV0 A;  3C4O A;  3IXD A;  5DTT A;  3HL9 A;  4ZTK A;  5FSR A;  3EQV A;  3UE1 A;  1PYY A;  1K55 A;  3MZF A;  1GHM A;  4S2N C;  3UE3 A;  4E6W A;  1FQG A;  1NRF A;  3VSK A;  1PW8 A;  3ZGA B;  3IF5 A;  5TFQ A;  2DNS A;  3A3I A;  2JE5 A;  4WZ5 C;  1W8Q A;  1YLW A;  4B4X A;  4A5R A;  1ZG6 A;  4DE2 A;  1WYB A;  4WBG A;  1W8Y A;  5A93 A;  2E8I A;  2EFX A;  5JYP A;  4M3K A;  1MY8 A;  1K4F A;  3LCE A;  2H10 A;  5FQQ A;  3AGD A;  5A92 A;  1JWZ A;  3W4O A;  1K55 C;  5DTS A;  1CEF A;  5EVI D;  2IWC A;  3B3X A;  2XF3 A;  4WEK A;  2HDQ A;  5HAP A;  4EBP A;  1CEG A;  1RGZ A;  1BSG A;  4KZ4 A;  4WM9 A;  4EBN A;  4EWF A;  1QMF A;  3FZC A;  3UPN A;  3V5M A;  4BD0 A;  3AGF A;  4PM5 A;  4S2K A;  1XA7 A;  1BLH A;  2P9V A;  1MWT A;  2EX9 A;  2ZJ9 A;  4QY5 A;  2V2F F;  3IWI A;  1TDG A;  4N9L A;  5FAQ A;  3V39 A;  4N1X A;  3HUO A;  4E3N A;  1DY6 A;  5E2G A;  4KEN B;  3JYI A;  1JTG A;  4WYY A;  1BLP A;  2EX2 A;  2H0T A;  2XQZ A;  2Y55 A;  4WEL A;  1FSY A;  3NI9 A;  4KZ9 A;  4Y0O A;  5CTN A;  4RA7 A;  4DDS A;  5FDH A;  3BFG A;  2XD5 A;  1IKG A;  3LY3 A;  5KZH A;  1HVB A;  1Y54 A;  2Y2J A;  1K38 A;  2XR0 A;  3Q82 A;  4MLL A;  4OPR A;  4RX2 A;  3UPO A;  1K6S A;  5FI7 A;  3SS3 A;  2X02 A; 
#chains in the Genus database with same CATH topology
 4HJ4 A;  1O7E A;  3IWQ A;  4C6Y A;  5TGF A;  3UDI A;  3NHQ A;  3MF0 A;  3HCY A;  3AGE A;  2QZ6 A;  2XFS A;  3FPV A;  2XH9 A;  1ERQ A;  2Q9N A;  5F69 A;  2VGK A;  3M6B A;  4HH2 A;  2XD1 A;  4OKP A;  3A3J A;  4B4Z A;  2WKI A;  5L10 A;  2A24 B;  4II7 A;  5F5Y A;  3R7W A;  4H8R A;  1D7E A;  3DTK A;  3NOU C;  3KYQ A;  3D9Y A;  3PBQ A;  3PAG A;  4XUZ A;  4GW9 A;  2ZQC A;  3UN7 A;  2HPB A;  4CJN A;  2JKF A;  4UQI S;  2EXA A;  5EM1 A;  4R4S A;  2ACG A;  4KG2 A;  1PI4 A;  4R23 A;  4FH4 A;  2WZZ A;  5FQ9 A;  5TBM A;  1WE4 A;  2WKP A;  2K2N A;  3E2K A;  4Y3I A;  3EGX C;  4JGR A;  1P9R A;  2WAD A;  3OOV A;  4JGO A;  4ZAM A;  1Q2Q A;  3F1N B;  3FC7 A;  4GHI A;  4EES A;  3O3V A;  3MFD A;  1SKO A;  1VET B;  3P01 A;  1IYS A;  4X1L A;  3LYX A;  4O0P A;  1YSQ A;  4F94 A;  1JWP A;  1T19 A;  4E3K A;  3NBL A;  2W27 A;  3QP2 A;  1F9I A;  2V9A A;  3T1S A;  4QB8 A;  1T18 A;  3T4K A;  4PKY A;  2Y2O A;  3ZG9 B;  1ESI A;  2XLN A;  3K3C A;  2W1T A;  2VV6 A;  1N9L A;  1PWC A;  3QP6 A;  1JNU A;  3T4O A;  4DE1 A;  4LPZ A;  4JLF A;  4GD6 A;  4KUK A;  5CGX A;  5HW3 A;  3HLG A;  1T1C A;  4KZ6 A;  4EXO A;  1FIL A;  3T1X A;  1OTE A;  4AFI A;  4EER A;  3VOY A;  4RVA A;  3IQA A;  1YPR A;  1KDW A;  3NC8 A;  1PZO A;  3T4T A;  4I5S A;  1XGI A;  1CI9 A;  3FV7 A;  4QY6 A;  3O86 A;  4C3Q A;  4I38 A;  1T1B A;  3BLS A;  4JKT A;  2WZX A;  1LI9 A;  1E4D A;  1N9N A;  5EE8 A;  4EEP A;  3MFX A;  2WKQ A;  5CEB A;  4X55 A;  2HP9 A;  3VFF A;  4OP5 A;  3LFV A;  3T12 B;  2K7S A;  2GNX A;  4YOF A;  3A3E A;  2O9C A;  4YIN A;  3NDG A;  2JC7 A;  3TRC A;  2EFU A;  1KE3 A;  4DJ3 A;  1FOF A;  3D72 A;  1LI0 A;  5AQA A;  5EFW A;  3BWL A;  2DCF A;  1EW0 A;  2WGV A;  3K3D A;  5L2F A;  4GLQ A;  3ZG0 A;  4R3J A;  1L0G A;  1KGE A;  1LL5 A;  1OJ5 A;  4B88 A;  5JYO A;  2O9B A;  1XGJ A;  5DF7 A;  4FCF A;  1IKI A;  4S2L A;  4Y15 A;  3FKW A;  4DJ2 A;  4CQH A;  2J3T C;  3W8K A;  2XA7 M;  3PHY A;  3G32 A;  3H7W A;  3HLF A;  1YLT A;  1LSW A;  3W4P A;  4QWO A;  1LLB A;  1FCO A;  1PI5 A;  5IS1 A;  4Y17 A;  3MS6 A;  3GQZ A;  3UME A;  1E3U A;  2WKR A;  3VP0 A;  2OOL A;  1XKZ A;  1TS8 A;  2ZL1 B;  3O88 A;  3GMW A;  2PD7 A;  3CUE A;  2Z6D A;  5DFX A;  2VA0 A;  5TR7 A;  4N1H A;  4ZJ1 A;  1ES3 A;  3FPW A;  2M7U A;  4KQD A;  5EM0 A;  4S2I A;  1TEM A;  1NJ4 A;  1KOU A;  3FG8 A;  2ZLY A;  3LI9 A;  3HJI A;  3CUE C;  1FCN A;  1K0K A;  2WGW B;  3LI8 A;  4OQ0 A;  4NXB A;  4RYE A;  3BQ8 A;  1MZU A;  5DTK A;  3OPH A;  4MNR A;  2FFY A;  2Y2I A;  3UB6 A;  3Q7V B;  4I3I A;  2P08 A;  3MMH A;  3UB8 A;  2C6W B;  5L8M A;  3HLB A;  4OOY A;  2Y2L A;  2H0Y A;  2G2W A;  3VOL A;  3EEH A;  2D01 A;  1Z09 A;  3MQ0 A;  1VHM A;  1AWI A;  3R4K A;  2HP6 A;  1TS0 A;  1ESU A;  3D3O A;  4K0X A;  4JPM A;  3ICY A;  2VJW A;  1JVJ A;  1U60 A;  5A8B A;  4ESP A;  1P9W A;  3SH9 A;  4KZ8 A;  5L09 A;  3H82 A;  3LIA A;  3LIE A;  4R0Q A;  3QP5 A;  1G5U A;  1OPX A;  3PAE A;  4E3L A;  5IT5 A;  1VEU A;  3IF6 C;  5D3O A;  3LEZ A;  3EOI A;  3PBR A;  5K5B A;  3ZQ5 A;  2QJ7 A;  2CC1 A;  1SDN A;  3F1O B;  1YM1 A;  3MJQ A;  4IBR A;  5E43 A;  4LV1 A;  4L9F A;  2VV7 A;  3VMA A;  4CLC B;  1DJB A;  4LGW A;  3ZYT A;  2OLV A;  3N7W A;  2EWW A;  3NY4 A;  2Y2Q A;  3KSH A;  3ZHH A;  3BM6 A;  3IH8 A;  1MWU A;  5AQB A;  1H8M A;  5CHM A;  4ID4 A;  3LIF A;  3CZD A;  3CPT A;  1N4O A;  2BAS A;  4WL9 A;  3CHW P;  2B5R A;  3IT9 A;  3HJK A;  1DP9 A;  3CJM A;  1RCJ A;  4HP4 A;  2ZQ7 A;  4E3J A;  2GJ3 A;  4FD8 A;  4HJ3 A;  5DTT A;  3S7Q A;  5LBR A;  3IX8 A;  3UE1 A;  1PYY A;  4E6W A;  5MC7 A;  2DNS A;  4WZ5 C;  5F6A A;  1YLW A;  4DE2 A;  1W8Y A;  2E8I A;  2EFX A;  1MY8 A;  3AGD A;  1CEF A;  2IWC A;  3QP1 A;  4WEK A;  5HAP A;  1BYW A;  1CEG A;  1RGZ A;  1BSG A;  4KZ4 A;  3MXQ A;  4EWF A;  1GSV A;  3O5Y A;  2JKR I;  2B18 A;  4HHD A;  1XA7 A;  4I39 A;  4ARZ A;  5FAQ A;  3V39 A;  4N9L A;  1BLP A;  2EX2 A;  2H0T A;  2XQZ A;  4KZ9 A;  2Q0O A;  3NI9 A;  4Y0O A;  4RA7 A;  3R7W B;  3LIB A;  2XD5 A;  2Y2J A;  2XR0 A;  3RH8 B;  3Q82 A;  4OPR A;  4RX2 A;  4UEY A;  4P6Z M;  2X02 A;  1KGF A;  4HEF A;  5DKK A;  4NXE A;  4HBT A;  3CAX A;  3S7N A;  4PM7 A;  1OME A;  4LV3 A;  5FA7 A;  2DRW A;  3S4X A;  3U4L P;  4EQ1 A;  5TBM B;  1W63 Q;  3RJU A;  5IHV A;  1XFN A;  4D2O A;  4GHI B;  2WKH A;  3T50 A;  4L9G A;  2VV8 A;  3MKE A;  4S2M A;  3SZT A;  4IUK A;  1VQQ A;  3CMZ A;  5EVI A;  4R4R A;  4HBU A;  2JKG A;  3BY9 A;  4X53 A;  3S7P A;  2HGV A;  3JPU A;  2Y8H A;  3HUM A;  3M2J A;  5HPI A;  5EVI C;  4KZ5 A;  2PYP A;  2H5S A;  2HDS A;  4IJG A;  1NLY A;  1ERM A;  3UNW A;  3MXS A;  4R3A A;  3HLE A;  3TOI A;  3QP4 A;  5AJG A;  2P9V B;  4RX3 A;  1K56 A;  3P98 A;  4BQM A;  4ZJ2 A;  4WN5 A;  1YAX A;  4KZB A;  5GHX A;  4WMC A;  4QD4 A;  3DAV A;  2PRF A;  3IXG A;  5M19 A;  1ES4 A;  3Q1F A;  3BYD A;  3NUL A;  4BWI A;  5HSQ A;  3G34 A;  4GDB A;  3UPP A;  4DE3 A;  1F98 A;  5GLD A;  3PYP A;  5GLC A;  2OAP 1;  5E2H A;  4YWZ A;  3ZVW A;  1ZG4 A;  1IYP A;  2Y2G A;  1XJ3 A;  4U0X A;  2X01 A;  4Z9Q A;  1FR6 A;  3PBN A;  1KGG A;  4QU3 A;  3EEA A;  5E2F A;  1SKF A;  5M18 A;  3WWX A;  5HX9 A;  1TDL A;  1GSX A;  1K56 D;  1S1Z A;  1Z6F A;  3MR0 A;  4P0M A;  3T1Q B;  2A2L A;  2FH5 A;  2ZOI A;  3GV9 A;  3VP4 A;  4WMC D;  2JKT I;  4GDN A;  3RFB A;  5FAT A;  1H8Z A;  1BLS A;  4MEZ A;  5CHJ A;  3ZNT A;  4PKY G;  2WUQ A;  4F3L B;  3BW6 A;  3NIA A;  3PBT A;  2OWH A;  3DWK A;  2Z6C A;  3F1P A;  4LCL A;  4X69 A;  4HQA A;  2PHY A;  1IOU A;  3HLD A;  1LHY A;  3OC2 A;  1YMX A;  3N8L A;  1FR1 A;  3A3D A;  3C38 A;  2ZC6 B;  3IHA A;  4OVD A;  5FI6 A;  3NOT C;  5FQJ A;  1DP6 A;  4OPY A;  1JWV A;  3LO7 A;  1P97 A;  5FAS A;  3KYE A;  4HIA A;  4ZJ3 A;  1J3W A;  4JXS A;  4UAA A;  1ACF A;  3V67 A;  4GB7 A;  2Y2K A;  2ZMV A;  3ZNY A;  4OPQ A;  1ERO A;  3CLO A;  3PR6 A;  5DJU A;  4EU0 A;  1V9Y A;  2RL3 A;  4K91 A;  2PYR A;  1S4S A;  4JF4 A;  4I3A A;  3GR2 A;  1L0D A;  3SS5 A;  3HVF A;  1M6K A;  5J8X A;  3LIC A;  2Q9M A;  4FH2 A;  4S2N A;  1AXB A;  1D1J A;  5EVE A;  3P09 A;  2KX6 A;  3QNC A;  3SW1 A;  2E8J A;  2EX6 A;  5HD5 A;  3G2Z A;  3C4P A;  4GS9 B;  2HF6 A;  3M6H A;  3QHY A;  3GEC A;  2ZQ9 A;  4XT2 B;  4OOM A;  2G7U A;  4EUV A;  2R9W A;  4IVK A;  4U3T A;  3MXR A;  2P74 A;  1F5M A;  1NXY A;  2P04 A;  2INW A;  3SS4 A;  2K31 A;  4DXB A;  4P87 A;  3ULF A;  1XP4 A;  4E3I A;  2NUP C;  5F1F A;  1GSW A;  5CGW A;  3C5A A;  4BL3 A;  1GCE A;  3IF6 B;  3IS2 A;  3QP8 A;  1FIK A;  1MKI A;  1D06 A;  4FUW A;  1XPB A;  1MKM A;  4LCM A;  4Y2F A;  2HJ9 C;  1ONH A;  1MWS A;  2QMI A;  1VEU B;  3O87 A;  3H9W A;  3LR4 A;  5HDS A;  3CIT A;  4R3B A;  2Y2P A;  5FL3 A;  4BLM A;  3WS2 A;  4DDY A;  4JBF A;  1PWD A;  1N9O A;  5G4Z A;  3UY6 A;  1XX2 A;  4G3K A;  2V8C A;  5FQM A;  1H3Q A;  5DJT A;  1WA9 A;  3G31 A;  1L2S A;  1I5Q A;  3E2L A;  2B95 A;  1YLP A;  4DXC A;  1PW1 A;  2GDN A;  3IXH A;  1OTB A;  1OJG A;  3CPT B;  2ZQD A;  4EBL A;  1PWG A;  3UDF A;  5GHY A;  1LSX A;  1N9B A;  1G6O A;  2A3U A;  3IH9 A;  3NDE A;  2VGL S;  3V3S A;  1GHI A;  3NEC A;  2Y59 A;  3KO6 A;  3Q07 A;  2ZQ8 A;  3L9K A;  3GDI A;  2P7J A;  3S22 A;  3G4P A;  2W0N A;  1W79 A;  3E4Q A;  3I7J A;  1L0F A;  4MMN A;  1RGY A;  2JBF A;  2JHE A;  2VK3 A;  3C4O A;  5FSR A;  5CX7 A;  3MZF A;  2V0U A;  3UE3 A;  3VSK A;  3ZGA B;  1PW8 A;  5TFQ A;  4ETZ A;  1S1Y A;  2PBD P;  2JE5 A;  3MSH A;  1WYB A;  3F1N A;  2NUT C;  2W3D A;  3UB5 P;  5JYP A;  3LCE A;  5FQQ A;  3W4O A;  1VET A;  2HDQ A;  2HV1 A;  5AVE A;  3B42 A;  4EBN A;  3FZC A;  3V5M A;  1XJ6 A;  4R38 A;  2ZJ9 A;  3IWI A;  1TDG A;  4E3N A;  1JTG A;  4EEU A;  3BFG A;  1HVB A;  1Y54 A;  1K38 A;  4MLL A;  3SS3 A;  4DN0 A;  4BBT A;  1NLZ A;  1X0O A;  2ZM0 A;  2PR5 A;  3UO9 A;  5KIZ A;  4NET A;  3BRM A;  5AQ9 A;  3G6O A;  3WRT A;  3A3F A;  1LT0 A;  2Y2H A;  5EVI B;  4S2J A;  1I2W A;  3Q7Z A;  3CG5 A;  4PAU A;  4BL2 A;  1YLJ A;  2O0Y A;  3L7H A;  3LR3 A;  1CI8 A;  3RTY A;  4S2O A;  4FSF A;  2J3W A;  2XEP A;  4E6X A;  3SH7 A;  3UB9 A;  4OON A;  3ZG5 A;  3B33 A;  3WS0 A;  3IHB A;  5EOO A;  1HTZ A;  4HES A;  2XGN A;  2LB9 A;  1W7F A;  3WS5 A;  3JVU A;  1VB6 A;  3MZE A;  3RXX A;  3ZVT A;  3E4P A;  1UWP X;  2AVX A;  3VP2 A;  3V50 A;  3LUQ A;  1K25 A;  3LR0 A;  4GCZ A;  2W3G A;  4IVI A;  1T1A A;  2X71 A;  1KE4 A;  4U0T A;  3IBR A;  4CPK A;  4KZ3 A;  1BT5 A;  4UHU A;  1GA0 A;  4P85 A;  5TJJ A;  4LRZ E;  4KUO A;  4YNR A;  3OZH A;  4PHT A;  3TW8 A;  3HLW A;  1IFQ A;  2V1B A;  4JXV A;  5BOH A;  3BY8 A;  2ZC3 B;  2HJE A;  2VZW A;  4P6B A;  1KE0 A;  1IEL A;  3T4S A;  5HWW A;  4JF5 A;  4KZA A;  4O8G A;  2UV0 E;  4QJG A;  4FOF A;  5J7E A;  4WUJ A;  3LEQ A;  4OPZ A;  3N4I A;  5CHU A;  3T1R A;  5CTM A;  5DF9 A;  4HP9 A;  5FAO A;  3OLO A;  4EQI A;  3VE3 A;  1K54 A;  2PBY A;  4MDZ A;  1NRJ A;  1S6R A;  2ZL1 A;  3HLC A;  2L1M A;  2QHK A;  1STZ A;  4OLG A;  2EXB A;  2HDU A;  1IYO A;  3EGD C;  3OCN A;  4MN7 A;  4S2P A;  1YLZ A;  3WS4 A;  3IBJ A;  1TF1 A;  2R78 A;  2WGW A;  3BEB A;  1KVL A;  1YKD A;  4PM8 A;  4H6J A;  3FKV A;  3V3R A;  3Q7V A;  4P6Z S;  5G18 A;  4X6T A;  5GHZ A;  1SKO B;  4OH0 A;  4XUX A;  5FQK A;  3LID A;  2PR6 A;  3CWF A;  1BUL A;  2PT7 A;  2YKF A;  1S66 L;  3WRZ A;  2J80 A;  2PD8 A;  3NJA A;  4OOL A;  1OT9 A;  3G2Y A;  5IU1 A;  2M1C A;  2Y79 A;  5GLB A;  3ITB A;  4GOG A;  1W5D A;  2W1T B;  4IED A;  3C7U A;  5F1G A;  4KQO A;  4LLO B;  2BG1 A;  5KMW A;  2ZMF A;  5EV0 A;  5FEG A;  3E0Y A;  5M1A A;  1LSV A;  5EEC A;  3MKF A;  3NOP C;  4GNU A;  1BUE A;  1NYY A;  5CGS A;  3PXP A;  4NXG A;  3IXB A;  4JF6 A;  2OSU A;  5FDS A;  2V8F A;  5I5L A;  2HP5 A;  1ZKJ A;  4BD1 A;  4MCW A;  5AQ7 A;  1SZV A;  2FZ0 A;  4GZB A;  3TG9 A;  4I3J A;  3ZG8 B;  1RP5 A;  5HL1 A;  2V20 A;  3WS1 A;  1YQS A;  2J7V A;  3VP1 A;  3T4L A;  3MBZ A;  3IX4 A;  3VV4 A;  2V1A A;  3OCL A;  4HNB A;  3KSF A;  3HRE A;  2JCH A;  1QME A;  3TE8 A;  2XRO A;  1OTA A;  2WKE A;  1MC0 A;  5GL9 A;  3BFF A;  2VLG A;  3FWL A;  4L0L A;  1NYM A;  2WGI A;  3PTE A;  3UDX A;  4RQ9 A;  2WAE A;  4PPR A;  2OLU A;  4K0W A;  2O9A A;  4YFM A;  4CLC D;  3BFD A;  3D4F A;  3N8S A;  1XJ4 A;  3S1Y A;  2J9P A;  4XXR A;  4UQI M;  3ISG A;  4MN5 A;  1YMS A;  2HDR A;  1TD5 A;  2I72 A;  4ZDX A;  3RXW A;  1H5X A;  2EX8 A;  5KSC A;  2D02 A;  4G3W A;  4X1M A;  1J9M A;  3VE4 A;  1ES2 A;  3H7W B;  1YLY A;  3SOI A;  1H8Y A;  3TSG A;  4IHQ A;  4BBV A;  1GA9 A;  3LY4 A;  2VEA A;  2IWB A;  3M2K A;  5HPF A;  2PU4 A;  4R70 A;  2VX8 A;  3QNB A;  4N9K A;  4EV4 A;  3EQU A;  2PU2 A;  2V0W A;  2J8Y A;  3G35 A;  4Z1W A;  3ZG7 B;  4B9O A;  4X68 A;  1CF0 A;  1MXO A;  2VGJ A;  1LL8 A;  3MZD A;  4Y5F A;  4UA9 A;  2ZOH A;  1SHV A;  4EUZ A;  2GX5 A;  3IWO A;  4MBF A;  1V9Z A;  4LV0 A;  4IUH A;  4S2N C;  4HJ6 A;  4R6L A;  3B47 A;  3IF5 A;  1F2K A;  3S7O A;  1W8Q A;  5AVF A;  4A5R A;  2JKR M;  1ZG6 A;  4ZRR A;  5A93 A;  5HL6 A;  4M3K A;  4Y13 A;  3K2N A;  5DTS A;  3B3X A;  5DKL A;  2XF3 A;  2KLI A;  2YKH A;  4WM9 A;  1QMF A;  3AGF A;  4PM5 A;  1BLH A;  2P9V A;  2V2F F;  3U2A A;  3HUO A;  5E2G A;  3H82 B;  4WEL A;  1FSY A;  4DDS A;  2DMW A;  2O99 A;  4L9E A;  1PNE A;  5HWV A;  4NEE D;  3UPO A;  5FI7 A;  2QJ5 A;  4JGQ A;  1KVM A;  1FSW A;  4GD8 A;  1ODV A;  4GKU A;  3HBR A;  4JGP A;  1ONG A;  5EPH A;  1HD8 A;  1UGU A;  1HLU P;  2ZM8 A;  2QPN A;  2CMN A;  4Q0H A;  2WYX A;  4NK3 A;  1O07 A;  2W3H A;  3E98 A;  2IA2 A;  4PM6 A;  1BLC A;  4MBH A;  3UE6 A;  5FAP A;  1CJF A;  2VGL M;  1IEM A;  3KX0 X;  1XFQ A;  4PMA A;  4GJ4 A;  2W3E A;  5G4Y A;  4X56 A;  1MBL A;  1BZA A;  3W2Z A;  5HD3 A;  3OPL A;  3GRJ A;  3IX3 A;  2A24 A;  2V1Z A;  3ZDJ A;  1L3L A;  3MQO A;  4F3L A;  1DRM A;  3ZFZ A;  2J9O A;  4OQI A;  1IYQ A;  1PFL A;  4KG5 A;  3FYZ A;  3UMD A;  1G28 A;  2OV5 A;  4GN2 A;  3W4Q A;  5CEC A;  2QYB A;  1DJC A;  5C5K A;  3GTC A;  1P0Z A;  2Y4A A;  3N8R A;  3OPR A;  4LRY C;  3C7V A;  4CLC E;  4ARZ B;  5HAI A;  3DTE A;  1OTD A;  3VFH A;  2XA7 S;  5F82 A;  2ZMA A;  4LEN A;  4DF6 A;  3C8C A;  2J3T D;  3VOZ A;  4OP8 A;  4ETX A;  5FQI A;  3NCK A;  3C30 A;  1XJ2 A;  1G6A A;  2I9V A;  4HH3 A;  5CRF A;  4Y7P A;  4Q0I A;  4NG2 A;  1W63 M;  4KG6 A;  4QHC A;  1LL9 A;  1OT6 A;  2ZD8 A;  3Q81 A;  2JKT M;  1EWZ A;  3UE0 A;  2KOI A;  2ZC4 B;  4O01 A;  4H6J B;  4GS9 A;  5DF8 A;  4KZ7 A;  2BLS A;  2WAF A;  4C75 A;  5HAR A;  4XT2 A;  2ZQA A;  2Z2M B;  4WLA A;  1YSP A;  3BLM A;  1E3U D;  5DVA A;  2FFF B;  2L4R A;  3DW0 A;  5J3W A;  3A0V A;  4UA6 A;  5EUA A;  1NZU A;  4IBX A;  2RCX A;  4OLD A;  3TJZ C;  2L0W A;  3IF6 A;  4WZ4 A;  2XK1 A;  5A91 A;  5CER A;  2IWD A;  2BTF P;  1H0M A;  5KSH A;  1TS6 A;  1YT4 A;  1CQA A;  2XSS A;  4G3V A;  1OTI A;  1JTD A;  1S0W A;  1S4R A;  5U47 A;  3DTM A;  2B02 A;  2EA9 A;  3G30 A;  5EOE A;  1DJA A;  4DMZ A;  3ZCZ A;  2EWV A;  4FTX A;  1A0K A;  1SCW A;  3PBS A;  5F83 A;  2Y91 A;  3BQA A;  3DTI A;  3VSL A;  3KSG A;  1PIO A;  4D60 A;  2VKS A;  3JVV A;  4Q8I A;  5CED A;  5GLA A;  2R9X A;  3ITA A;  4BBU A;  2WK0 A;  3A0S A;  4K08 A;  2W3F A;  4JXW A;  5E2E A;  3HUN A;  4O7D A;  5DFY A;  4WZ5 A;  1M40 A;  5HDC A;  4WF0 A;  3GSG A;  2Y2M A;  4MBK A;  1C3B A;  1WYC A;  1PZP A;  4QPR A;  1I2S A;  5HZH A;  3PBO A;  5HFO A;  1MWR A;  4NXF A;  3BEC A;  4UA7 A;  2GZA A;  5CXW A;  4EW7 A;  4WEJ A;  1L0E A;  3BFE A;  4Y0U A;  3T4Q A;  1VM1 A;  4DE0 A;  4Y0T A;  1S67 L;  4KQQ A;  2XDM A;  4E04 A;  1TVF A;  3P7N A;  1MPL A;  3KSI A;  1NZO A;  4KQR A;  1CK3 A;  1NY0 A;  3VP3 A;  5EVL A;  1E25 A;  1K4E A;  2OAQ 1;  5A90 A;  1DP8 A;  2HZ5 A;  3F1P B;  4HY8 A;  4DRT A;  1BTL A;  2H28 A;  2QWS A;  4LRX C;  3T4J A;  5I94 A;  4OQH A;  1K54 C;  5FEF A;  1ES5 A;  3EWK A;  2XFT A;  2C5W B;  3LGO A;  2G2U A;  1Q2P A;  1ALQ A;  2MJ6 A;  1K6R A;  4LV2 A;  4HI4 A;  1EI5 A;  2ZC7 A;  1XXM A;  2ZBB A;  4E3M A;  1TS7 A;  1Y4O A;  5HAQ A;  4PM9 A;  3BFC A;  4LFU A;  4BEN A;  3BJN A;  3DWZ A;  3UB7 A;  4ME4 A;  2ZC5 B;  4Q0J A;  3OPP A;  5FI2 A;  3A0R A;  4JXG A;  1NWZ A;  3SH8 A;  2W1R A;  4BJP A;  2ZM2 A;  4DKI A;  1GHP A;  2Z2L B;  2A49 A;  1XA1 A;  1K57 A;  5J4E A;  1FCM A;  2PAV P;  4N92 A;  3CI6 A;  2UWX A;  1G68 A;  4B93 A;  4E3O A;  2QKP A;  1K57 C;  1SDE A;  4ZBE A;  1HZO A;  3F1O A;  3GVB A;  2XRN A;  1ZC2 A;  2Y2N A;  1KDS A;  4CLC A;  1UWN X;  3LR5 A;  3N6I A;  4OQG A;  4R1G A;  3IS2 B;  4X25 A;  3IXD A;  4ZTK A;  3HL9 A;  5HWT A;  3EQV A;  3OBF A;  2M7V A;  3C2W A;  1Y28 A;  2KDK A;  5L07 A;  1K55 A;  1GHM A;  1PRQ A;  1FQG A;  1NRF A;  3A3I A;  4B4X A;  4WBG A;  4CLC C;  1ZHH B;  1K4F A;  2H10 A;  5A92 A;  1JWZ A;  1K55 C;  5EVI D;  1ZTU A;  3KYZ A;  4EBP A;  4MN6 A;  3UPN A;  4BD0 A;  4S2K A;  4HOI A;  4M4X A;  4BMW A;  5HDD A;  1MWT A;  2EX9 A;  5F68 A;  4QY5 A;  3DBA A;  4N1X A;  1DY6 A;  4KEN B;  3JYI A;  2PDR A;  4NKP A;  4WYY A;  2OWJ A;  2Y55 A;  5CTN A;  5FDH A;  2JN7 A;  1IKG A;  3LY3 A;  5KZH A;  3E4O A;  3MQQ A;  1K6S A;  4EET B;  2LB5 A; 
#chains in the Genus database with same CATH homology
 1KGF A;  1O7E A;  4HEF A;  3IWQ A;  4C6Y A;  2ZM0 A;  5TGF A;  3UDI A;  1KVM A;  1FSW A;  4HBT A;  4GD8 A;  3AGE A;  2QZ6 A;  2XFS A;  4GKU A;  4PM7 A;  3UO9 A;  1OME A;  2XH9 A;  3HBR A;  1ERQ A;  2Q9N A;  4LV3 A;  5FA7 A;  1ONG A;  2VGK A;  3BRM A;  3M6B A;  4NET A;  2DRW A;  5AQ9 A;  2XD1 A;  4OKP A;  3S4X A;  3WRT A;  3A3F A;  2Y2H A;  5EPH A;  1HD8 A;  3A3J A;  5EVI B;  4B4Z A;  2WKI A;  2ZM8 A;  2QPN A;  4S2J A;  1I2W A;  2WYX A;  3Q7Z A;  3CG5 A;  4H8R A;  4NK3 A;  1O07 A;  4BL2 A;  1YLJ A;  1CI8 A;  4S2O A;  4PM6 A;  4FSF A;  1BLC A;  3RJU A;  4MBH A;  2XEP A;  5FAP A;  4XUZ A;  3PBQ A;  3PAG A;  5IHV A;  3SH7 A;  4E6X A;  4OON A;  3ZG5 A;  2ZQC A;  4D2O A;  3UN7 A;  2HPB A;  2WKH A;  1IEM A;  4CJN A;  3WS0 A;  4PMA A;  3MKE A;  2EXA A;  4S2M A;  3IHB A;  5EOO A;  4X56 A;  4R4S A;  1MBL A;  1BZA A;  1HTZ A;  4HES A;  2XGN A;  1PI4 A;  4KG2 A;  1VQQ A;  3CMZ A;  5EVI A;  4R4R A;  3OPL A;  3GRJ A;  1W7F A;  4R23 A;  4FH4 A;  2WZZ A;  5FQ9 A;  2V1Z A;  3ZDJ A;  4HBU A;  3WS5 A;  4X53 A;  3ZFZ A;  2J9O A;  1WE4 A;  3MZE A;  3RXX A;  3E2K A;  3ZVT A;  4OQI A;  3VP2 A;  2WAD A;  3V50 A;  3HUM A;  3M2J A;  1IYQ A;  4ZAM A;  1K25 A;  4KG5 A;  1Q2Q A;  3FYZ A;  2OV5 A;  4IVI A;  4KZ5 A;  5EVI C;  4GN2 A;  2H5S A;  2HDS A;  2X71 A;  3O3V A;  3W4Q A;  3MFD A;  1KE4 A;  5CEC A;  1DJC A;  4U0T A;  3GTC A;  1IYS A;  4CPK A;  4F94 A;  4KZ3 A;  1BT5 A;  1ERM A;  1JWP A;  2Y4A A;  1GA0 A;  3MXS A;  4P85 A;  4UHU A;  3UNW A;  3HLE A;  4E3K A;  3NBL A;  3TOI A;  3N8R A;  3OPR A;  3OZH A;  3C7V A;  5HAI A;  2P9V B;  4RX3 A;  1K56 A;  4QB8 A;  3P98 A;  4BQM A;  4ZJ2 A;  3VFH A;  3HLW A;  4KZB A;  5GHX A;  4JXV A;  2Y2O A;  5BOH A;  4WMC A;  2ZC3 B;  3ZG9 B;  4QD4 A;  1ESI A;  2XLN A;  5F82 A;  1PWC A;  2ZMA A;  4DE1 A;  3IXG A;  4LEN A;  4DF6 A;  5M19 A;  1ES4 A;  4JLF A;  4P6B A;  4GD6 A;  5CGX A;  1KE0 A;  1IEL A;  3Q1F A;  5HW3 A;  3BYD A;  3HLG A;  3G34 A;  4KZ6 A;  4GDB A;  3UPP A;  4JF5 A;  4DE3 A;  5GLD A;  4KZA A;  5GLC A;  3VOZ A;  4OP8 A;  5E2H A;  3ZVW A;  4QJG A;  1ZG4 A;  1IYP A;  2Y2G A;  5FQI A;  3VOY A;  4U0X A;  3NCK A;  4OPZ A;  1G6A A;  4RVA A;  3N4I A;  5CHU A;  5CRF A;  4Y7P A;  2X01 A;  3IQA A;  5CTM A;  5DF9 A;  4Z9Q A;  1KDW A;  1FR6 A;  3PBN A;  1KGG A;  3NC8 A;  5FAO A;  4QU3 A;  4KG6 A;  4QHC A;  1LL9 A;  1PZO A;  4EQI A;  2ZD8 A;  3Q81 A;  3UE0 A;  1EWZ A;  1K54 A;  2PBY A;  1XGI A;  1CI9 A;  2ZC4 B;  3FV7 A;  4QY6 A;  1SKF A;  1S6R A;  5E2F A;  5M18 A;  3WWX A;  3O86 A;  5HX9 A;  5DF8 A;  4C3Q A;  1TDL A;  3HLC A;  4KZ7 A;  3BLS A;  2BLS A;  4JKT A;  1K56 D;  1Z6F A;  2WAF A;  4P0M A;  4C75 A;  5HAR A;  4OLG A;  2WZX A;  3GV9 A;  2ZQA A;  1LI9 A;  2Z2M B;  1E4D A;  2EXB A;  3VP4 A;  4WMC D;  2HDU A;  3BLM A;  1E3U D;  5DVA A;  5EE8 A;  2FFF B;  4GDN A;  3DW0 A;  1IYO A;  5FAT A;  5CEB A;  1H8Z A;  1BLS A;  4X55 A;  2HP9 A;  3OCN A;  4MEZ A;  5CHJ A;  4OP5 A;  4UA6 A;  4S2P A;  3VFF A;  3ZNT A;  1YLZ A;  3WS4 A;  2WUQ A;  5EUA A;  1NZU A;  3PBT A;  3NIA A;  2WGW A;  3BEB A;  3A3E A;  1KVL A;  3DWK A;  4IBX A;  2RCX A;  4PM8 A;  4YIN A;  3NDG A;  4OLD A;  2JC7 A;  3IF6 A;  2EFU A;  3FKV A;  1KE3 A;  1FOF A;  2XK1 A;  4WZ4 A;  5A91 A;  1LI0 A;  2IWD A;  4LCL A;  4X69 A;  5AQA A;  5CER A;  3V3R A;  3Q7V A;  5KSH A;  2DCF A;  5G18 A;  4X6T A;  3HLD A;  5GHZ A;  4OH0 A;  1LHY A;  4XUX A;  5FQK A;  2WGV A;  1YT4 A;  3OC2 A;  1YMX A;  1BUL A;  3N8L A;  5L2F A;  1FR1 A;  3A3D A;  1JTD A;  1S0W A;  2ZC6 B;  3IHA A;  5U47 A;  3WRZ A;  3DTM A;  4OVD A;  3ZG0 A;  3G30 A;  4R3J A;  5EOE A;  5FI6 A;  1L0G A;  1DJA A;  5FQJ A;  4OOL A;  4OPY A;  1KGE A;  1JWV A;  1LL5 A;  3G2Y A;  3LO7 A;  4B88 A;  5FAS A;  5GLB A;  5JYO A;  3ZCZ A;  4ZJ3 A;  4JXS A;  3ITB A;  1SCW A;  1XGJ A;  3PBS A;  4UAA A;  4GB7 A;  2Y2K A;  1W5D A;  4GOG A;  5DF7 A;  5F83 A;  2Y91 A;  3ZNY A;  4OPQ A;  4FCF A;  1ERO A;  4IED A;  3VSL A;  3C7U A;  1PIO A;  5F1G A;  4KQO A;  1IKI A;  4S2L A;  2BG1 A;  4Q8I A;  5KMW A;  3FKW A;  5CED A;  5M1A A;  5GLA A;  5EEC A;  3W8K A;  2R9X A;  3ITA A;  2RL3 A;  3MKF A;  4K91 A;  4GNU A;  3G32 A;  4JF4 A;  1BUE A;  1NYY A;  3GR2 A;  5CGS A;  3HLF A;  2WK0 A;  1L0D A;  1YLT A;  3HVF A;  1M6K A;  2OSU A;  3IXB A;  4JF6 A;  3SS5 A;  5J8X A;  3W4P A;  1LLB A;  4JXW A;  2Q9M A;  4FH2 A;  1FCO A;  1PI5 A;  4S2N A;  1AXB A;  2HP5 A;  1ZKJ A;  3GQZ A;  5E2E A;  3HUN A;  4O7D A;  1E3U A;  4BD1 A;  4WZ5 A;  1M40 A;  3P09 A;  5AQ7 A;  3QNC A;  3VP0 A;  4GZB A;  1XKZ A;  3TG9 A;  3GSG A;  2EX6 A;  2Y2M A;  3O88 A;  3G2Z A;  3C4P A;  3ZG8 B;  3GMW A;  4MBK A;  1C3B A;  1RP5 A;  3M6H A;  1WYC A;  1PZP A;  3QHY A;  5HL1 A;  1I2S A;  2ZQ9 A;  5TR7 A;  4N1H A;  2V20 A;  3PBO A;  4ZJ1 A;  3WS1 A;  1YQS A;  1ES3 A;  5HFO A;  4OOM A;  1MWR A;  2J7V A;  3BEC A;  4UA7 A;  5CXW A;  3VP1 A;  3MBZ A;  4WEJ A;  1L0E A;  2R9W A;  4S2I A;  1TEM A;  1NJ4 A;  4IVK A;  3BFE A;  4U3T A;  3MXR A;  4Y0U A;  2P74 A;  1VM1 A;  4DE0 A;  2ZLY A;  3OCL A;  4Y0T A;  1NXY A;  3SS4 A;  4KQQ A;  4DXB A;  2XDM A;  1TVF A;  3HRE A;  4P87 A;  1MPL A;  1FCN A;  2JCH A;  1NZO A;  4KQR A;  2WGW B;  1XP4 A;  1CK3 A;  1NY0 A;  4OQ0 A;  1QME A;  4RYE A;  3VP3 A;  4E3I A;  5EVL A;  5F1F A;  1E25 A;  1K4E A;  5CGW A;  5DTK A;  3C5A A;  4BL3 A;  1GCE A;  2WKE A;  3IF6 B;  5A90 A;  5GL9 A;  3OPH A;  4MNR A;  2FFY A;  3BFF A;  2Y2I A;  3FWL A;  4DRT A;  3Q7V B;  1BTL A;  1MKI A;  4L0L A;  1NYM A;  2WGI A;  3PTE A;  1XPB A;  3UDX A;  2C6W B;  4LCM A;  2WAE A;  5I94 A;  3HLB A;  4OOY A;  4OQH A;  1ONH A;  2Y2L A;  1K54 C;  2QMI A;  1MWS A;  2OLU A;  4PPR A;  1ES5 A;  2H0Y A;  3O87 A;  4K0W A;  2G2W A;  4YFM A;  2XFT A;  3BFD A;  3D4F A;  3N8S A;  2HP6 A;  2C5W B;  1ESU A;  3S1Y A;  2G2U A;  4K0X A;  2J9P A;  2Y2P A;  4JPM A;  4R3B A;  4XXR A;  3ISG A;  1JVJ A;  1U60 A;  1YMS A;  2HDR A;  1Q2P A;  4BLM A;  3WS2 A;  4DDY A;  1ALQ A;  4JBF A;  1PWD A;  1K6R A;  3SH9 A;  4LV2 A;  2I72 A;  4ZDX A;  3RXW A;  1EI5 A;  3UY6 A;  1H5X A;  1XX2 A;  4KZ8 A;  2ZC7 A;  2EX8 A;  1XXM A;  4E3M A;  5KSC A;  5HAQ A;  4R0Q A;  5FQM A;  4PM9 A;  3PAE A;  3BFC A;  4E3L A;  3G31 A;  1L2S A;  1I5Q A;  4BEN A;  3E2L A;  3IF6 C;  1J9M A;  5D3O A;  1YLP A;  3LEZ A;  3DWZ A;  4DXC A;  1PW1 A;  1ES2 A;  2GDN A;  3PBR A;  3IXH A;  1YLY A;  3SOI A;  2ZC5 B;  1H8Y A;  3TSG A;  3OPP A;  2CC1 A;  5FI2 A;  1SDN A;  2ZQD A;  1GA9 A;  1YM1 A;  4JXG A;  3SH8 A;  4EBL A;  3LY4 A;  1PWG A;  4IBR A;  5GHY A;  3UDF A;  5E43 A;  2IWB A;  4BJP A;  2ZM2 A;  3M2K A;  4LV1 A;  4DKI A;  1GHP A;  2Z2L B;  2A49 A;  1XA1 A;  1N9B A;  3VMA A;  1K57 A;  1DJB A;  2A3U A;  3IH9 A;  3NDE A;  3V3S A;  1FCM A;  1GHI A;  2PU4 A;  4N92 A;  2OLV A;  3N7W A;  3QNB A;  3NY4 A;  4N9K A;  3EQU A;  2Y2Q A;  2Y59 A;  4EV4 A;  2PU2 A;  3Q07 A;  3BM6 A;  3ZHH A;  2J8Y A;  2UWX A;  3G35 A;  3IH8 A;  3ZG7 B;  1G68 A;  2ZQ8 A;  4X68 A;  1MWU A;  4E3O A;  5AQB A;  1MXO A;  5CHM A;  2VGJ A;  4ID4 A;  3S22 A;  1K57 C;  3CZD A;  1SDE A;  3MZD A;  3G4P A;  4ZBE A;  1HZO A;  1N4O A;  3GVB A;  1W79 A;  4UA9 A;  2B5R A;  3IT9 A;  1ZC2 A;  2Y2N A;  1KDS A;  1SHV A;  4EUZ A;  3CJM A;  1RCJ A;  3IWO A;  4MBF A;  2ZQ7 A;  3I7J A;  1L0F A;  1RGY A;  2JBF A;  3N6I A;  4OQG A;  4E3J A;  4R1G A;  4FD8 A;  4LV0 A;  3C4O A;  3IXD A;  5DTT A;  3HL9 A;  4ZTK A;  5FSR A;  3EQV A;  3UE1 A;  1PYY A;  1K55 A;  3MZF A;  1GHM A;  4S2N C;  3UE3 A;  4E6W A;  1FQG A;  1NRF A;  3VSK A;  1PW8 A;  3ZGA B;  3IF5 A;  5TFQ A;  2DNS A;  3A3I A;  2JE5 A;  4WZ5 C;  1W8Q A;  1YLW A;  4B4X A;  4A5R A;  1ZG6 A;  4DE2 A;  1WYB A;  4WBG A;  1W8Y A;  5A93 A;  2E8I A;  2EFX A;  5JYP A;  4M3K A;  1MY8 A;  1K4F A;  3LCE A;  2H10 A;  5FQQ A;  3AGD A;  5A92 A;  1JWZ A;  3W4O A;  1K55 C;  5DTS A;  1CEF A;  5EVI D;  2IWC A;  3B3X A;  2XF3 A;  4WEK A;  2HDQ A;  5HAP A;  4EBP A;  1CEG A;  1RGZ A;  1BSG A;  4KZ4 A;  4WM9 A;  4EBN A;  4EWF A;  1QMF A;  3FZC A;  3UPN A;  3V5M A;  4BD0 A;  3AGF A;  4PM5 A;  4S2K A;  1XA7 A;  1BLH A;  2P9V A;  1MWT A;  2EX9 A;  2ZJ9 A;  4QY5 A;  2V2F F;  3IWI A;  1TDG A;  4N9L A;  5FAQ A;  3V39 A;  4N1X A;  3HUO A;  4E3N A;  1DY6 A;  5E2G A;  4KEN B;  3JYI A;  1JTG A;  4WYY A;  1BLP A;  2EX2 A;  2H0T A;  2XQZ A;  2Y55 A;  4WEL A;  1FSY A;  3NI9 A;  4KZ9 A;  4Y0O A;  5CTN A;  4RA7 A;  4DDS A;  5FDH A;  3BFG A;  2XD5 A;  1IKG A;  3LY3 A;  5KZH A;  1HVB A;  1Y54 A;  2Y2J A;  1K38 A;  2XR0 A;  3Q82 A;  4MLL A;  4OPR A;  4RX2 A;  3UPO A;  1K6S A;  5FI7 A;  3SS3 A;  2X02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...