1W7FA

Crystal structure of the class a beta-lactamase bs3 inhibited with isocitrate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Crystal Structure of the Class a Beta-Lactamase Bs3 Bs3 Inhibited with Isocitrate
rcsb
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1w7fA00
3OC2A 1Q2PA 3ZFZA 3IQAA 5FA7A 3ZVWA 3UY6A 1L0EA 1MY8A 2QPNA 1NXYA 1E4DA 3OZHA 1K6RA 4D2OA 1Z6FA 2EX6A 4LV0A 1S0WA 1M40A 1YT4A 1KDSA 1GA0A 1YLYA 4FSFA 1FSWA 4S2KA 3S4XA 4WELA 5KZHA 5HAQA 5FQIA 1HTZA 4LV1A 1XA1A 4NK3A 1BLCA 3BFCA 1YLJA 2OLVA 1MPLA 4JF6A 3IT9A 2ZC3B 5FSRA 3IF6C 1XGJA 5EOOA 2FFYA 1K54C 1NYYA 3LO7A 5FAPA 1ZG6A 3VMAA 1KVMA 4OLGA 3E2LA 4IBRA 2ZC5B 2ZM0A 4B4XA 4GOGA 1H5XA 5CGXA 2WGIA 1K56A 4WEKA 3DW0A 1TDLA 1JVJA 3UPOA 3WWXA 4GNUA 3ZG7B 1KGGA 2EXAA 1W8YA 3FZCA 1L2SA 3G4PA 2B5RA 3MZDA 1HVBA 4B88A 5GLDA 1E3UA 5CERA 3GRJA 3N8RA 4E3LA 3FWLA 2PU4A 2P9VA 1H8YA 4DE3A 4HBTA 1BULA 1PW8A 2EFXA 4RX3A 5A90A 2Y2KA 3G32A 2HDUA 4K0XA 1TEMA 2WUQA 3Q7VA 4DF6A 1XA7A 1PZOA 4KQOA 2WAEA 4JPMA 4EBNA 1W79A 3MKFA 4HESA 4JXSA 4KZ7A 4PPRA 4M3KA 4WZ5A 3GMWA 4X55A 3UDIA 3UE0A 3N4IA 4IBXA 2EXBA 1K55C 5KMWA 5KSHA 2IWBA 3HLCA 1BSGA 4MBFA 5E2EA 1TDGA 3VOZA 3IXGA 4IVKA 1KGEA 4QY6A 3SS5A 1K25A 2XF3A 2E8IA 3SH8A 3VP3A 3LY3A 1PI4A 3OCNA 4OQGA 4E3MA 2OSUA 4P0MA 4S2OA 5HARA 3IF5A 1K38A 3OPHA 4CPKA 3PAGA 5GHYA 3Q7ZA 4C75A 5A92A 4CJNA 3M6BA 1AXBA 3W8KA 5M1AA 2VGKA 1YLWA 5M18A 2WKEA 4RA7A 3WS5A 5FI2A 4X56A 1XXMA 3HUOA 2H0YA 1J9MA 3G31A 1L0DA 3SH7A 1JTDA 2ZC6B 3ZG5A 1JWPA 1XKZA 1MWSA 3ZCZA 5JYPA 4WMCD 1FR6A 2WGWA 1XGIA 5A93A 4MEZA 5CEDA 4P87A 1KE4A 1I2SA 4JXGA 5EUAA 4KZ4A 2ZM8A 3IHBA 3ITBA 4R0QA 4E3JA 4KQRA 4PMAA 2EX9A 4LV2A 4Y0UA 5TR7A 1G6AA 3DTMA 2DRWA 3OCLA 3A3DA 4ZAMA 4WYYA 4OPZA 5EVIA 3Q81A 1PI5A 3Q82A 3A3IA 3W4OA 4X53A 4X6TA 3N7WA 1S6RA 3CG5A 1YMSA 1RGZA 3CJMA 4LCLA 5DTSA 5J8XA 1BLHA 3WS1A 5CEBA 1ZKJA 3MKEA 2RCXA 3TOIA 3ZGAB 3QHYA 1CI8A 4ZDXA 4GKUA 5FI6A 3HUNA 1PWCA 3IF6B 3IWIA 1BZAA 4BENA 3MXRA 3C5AA 4BLMA 3IH9A 5GL9A 1OMEA 5HAIA 1W8QA 5E2HA 5IHVA 3IWOA 1ERMA 5HAPA 3C4OA 4UA6A 2ZD8A 3ZG0A 1FSYA 1YMXA 2VGJA 4OPYA 3VFFA 3BLMA 1DJAA 5HFOA 4R4SA 3G2ZA 5EVID 3IWQA 4OH0A 4ZBEA 3O88A 4XUZA 4KZ6A 3P09A 4XUXA 5AQBA 4JLFA 2Q9NA 1HZOA 3HLFA 2V20A 3Q1FA 4KZ3A 2ZQCA 3EQVA 4WEJA 3BRMA 3GVBA 2XDMA 1NY0A 4C6YA 4ZTKA 3BFEA 4LENA 2WK0A 1PWGA 3S22A 1LLBA 2XK1A 5EVLA 3VOYA 4Q8IA 3C7UA 1N9BA 1KE0A 3A3JA 5BOHA 4Y7PA 1PZPA 2Y2LA 1EWZA 2V2FF 1IYOA 2Y2MA 2WADA 4QU3A 4JF5A 3UN7A 2JC7A 4JF4A 1FCMA 2Y2NA 5GLCA 3G30A 2ZQDA 3W4PA 2PU2A 3C4PA 2J7VA 4QB8A 1WE4A 1YLPA 2IWCA 2X02A 5FAQA 4R3JA 5EPHA 2JCHA 2XEPA 1JWZA 4DRTA 5E43A 1ONHA 3WRZA 1MKIA 5GLAA 3PTEA 2J8YA 4S2IA 4WMCA 5CGWA 1SHVA 3IXHA 5KSCA 2Y59A 5CECA 2P9VB 3HREA 3PBTA 5CRFA 1WYBA 2HP6A 4X69A 2XGNA 4RVAA 1PYYA 5FAOA 3GR2A 3Q7VB 1SDEA 1ES4A 2WGVA 4GD8A 3ISGA 1GHMA 1DY6A 4DXBA 4EBPA 1RGYA 2WKIA 4U0XA 4ZJ1A 4Y0TA 3ITAA 2Q9MA 2XQZA 1ZC2A 1GHPA 4KZ9A 2Y2HA 1IELA 3HLBA 3VP0A 3ZNYA 4XXRA 2Y2JA 4U3TA 2IWDA 1NRFA 2H10A 4GZBA 1LHYA 1Y54A 3V50A 4A5RA 3ZVTA 5GLBA 1ES3A 4OVDA 4PM8A 3I7JA 4DKIA 3A3FA 5DF9A 4E3IA 1N4OA 3UNWA 4FCFA 1ALQA 2ZQAA 4FH4A 4JBFA 4WM9A 4F94A 3BFDA 1EROA 4N1XA 3V3RA 2JBFA 2Z2MB 1NZUA 3SOIA 1JWVA 4KQQA 4E3KA 4KG5A 2WAFA 3HLGA 3HVFA 3WS0A 3QNCA 3NBLA 1K57A 3IHAA 1CI9A 4WZ5C 2EX2A 2X01A 3N6IA 1FR1A 2G2WA 5EOEA 1ES2A 1BTLA 2DCFA 2WGWB 4KENB 1RP5A 2EX8A 5TFQA 3O3VA 2ZJ9A 5FASA 1CEFA 2OLUA 3VSKA 3OPRA 3PBOA 4WBGA 1L0GA 4QJGA 1CEGA 4UHUA 1PW1A 1KDWA 3MXSA 4R3BA 2GDNA 2ZLYA 5L2FA 5F1FA 1Q2QA 4S2NA 5EVIB 2FFFB 3JYIA 5F82A 3VP4A 1QMEA 1SKFA 2Y2OA 5AQ7A 3WS2A 3GV9A 2ZQ9A 3N8SA 2OV5A 3NC8A 3N8LA 3SS4A 3UO9A 3AGDA 3V3SA 1NZOA 2V1ZA 2BLSA 2ZC7A 5DTTA 4OP5A 2QZ6A 3E2KA 1LI9A 4R1GA 1BLPA 4OOYA 1K4FA 3FKWA 5TGFA 2DNSA 1SCWA 3OPPA 3G34A 5CHUA 2HDQA 1K57C 4DXCA 1ESUA 4KG2A 3VSLA 4DDSA 1GCEA 3PBRA 1IKIA 2H0TA 2C6WB 1IEMA 4UAAA 1IKGA 4JXWA 1TVFA 1WYCA 3UPPA 4S2MA 2WZZA 1U60A 3M2KA 4GD6A 4ID4A 2Y2IA 5EVIC 1YQSA 3CMZA 4RX2A 3ZDJA 3QNBA 3M6HA 4P6BA 1O7EA 2HDRA 3AGFA 3V39A 4BJPA 4HEFA 1RCJA 1ZG4A 4ZJ2A 4UA9A 3TG9A 3C7VA 3D4FA 4IVIA 5AQAA 3NI9A 4JXVA 1W7FA 1LL9A 2Y91A 4S2NC 5F1GA 4JKTA 1PWDA 4WZ4A 3PBSA 3G35A 3MBZA 5GHXA 3LCEA 1GA9A 2UWXA 2EFUA 1YM1A 4OOLA 4PM6A 5D3OA 1W5DA 3HLDA 3BEBA 1IYSA 4GDBA 4KZ5A 3RXXA 4KG6A 3WRTA 1CK3A 2ZMAA 4R4RA 3UPNA 4PM5A 3LEZA 4BL3A 3BFGA 5CHMA 3AGEA 1MWRA 3GQZA 1FCOA 3GTCA 4MBKA 1IYPA 2XLNA 4N9LA 3V5MA 2J9PA 5AQ9A 3FKVA 4B4ZA 3NDGA 2PBYA 4NETA 3WS4A 1SDNA 4QHCA 3PBQA 5DF8A 1K55A 1QMFA 5CHJA 4UA7A 3BM6A 3VFHA 3A3EA 5E2GA 2Z2LB 5HW3A 3NDEA 1VQQA 4MBHA 4GDNA 4KZ8A 5M19A 4HBUA 1O07A 4P85A 4K91A 1MXOA 2XD5A 5DTKA 2WKHA 1KGFA 4DE2A 3ZG8B 3IH8A 3S1YA 3NY4A 4KZAA 4QD4A 4BD0A 4IEDA 5E2FA 3BLSA 3LY4A 5FQQA 4O7DA 1ERQA 2WZXA 4OKPA 5HX9A 4OQ0A 4ZJ3A 3ZHHA 2XH9A 1ES5A 4C3QA 2BG1A 2JE5A 3IXDA 5GHZA 3ZG9B 5FQMA 3PBNA 4OONA 4U0TA 2ZQ8A 4S2JA 4DE1A 4BQMA 5FATA 4E3NA 2ZM2A 5CTNA 3O86A 5CGSA 2X71A 2XR0A 4OPQA 3MZEA 4LV3A 4Z9QA 3EQUA 3FV7A 1BUEA 4BL2A 4R23A 1C3BA 2RL3A 4QY5A 1JTGA 1HD8A 4MNRA 3RJUA 3HLEA 4BD1A 4EWFA 2HP5A 5HL1A 3BECA 5FI7A 5FDHA 3HLWA 3TSGA 3Q07A 4PM9A 1DJBA 4L0LA 4EUZA 2A3UA 2HDSA 5JYOA 3O87A 4S2LA 1FQGA 2ZC4B 3G2YA 4GN2A 4LCMA 1BLSA 3IXBA 1K56D 1FOFA 2P74A 4KZBA 4DE0A 3UDFA 2C5WB 4N9KA 1H8ZA 1YLTA 1MWTA 2XFTA 3MZFA 4N1HA 3UDXA 4OQIA 1KVLA 4K0WA 1ESIA 1E3UD 1XPBA 4FH2A 5DVAA 2Y2QA 4X68A 3RXWA 5A91A 3W4QA 1L0FA 3FYZA 4E6WA 3UE3A 1DJCA 4EV4A 1EI5A 2R9WA 3SS3A 3VP1A 4OQHA 3CZDA 3HBRA 3ZNTA 1K6SA 4YFMA 2HP9A 5FQKA 3HUMA 3B3XA 2J9OA 3DWKA 1GHIA 3HL9A 1PIOA 4GB7A 2HPBA 1FCNA 1I2WA 3MFDA 4YINA 5FQ9A 1LI0A 1LL5A 4E6XA 5DF7A 1XX2A 3VP2A 1NJ4A 5G18A 2R9XA 1NYMA 3BFFA 2Y4AA 1YLZA 3SH9A 5EECA 1VM1A 1G68A 2Y2GA 3UE1A 3GSGA 2Y2PA 1E25A 2WYXA 3M2JA 2QMIA 2XFSA 1IYQA 4EQIA 1MWUA 2A49A 3IF6A 4OPRA 4E3OA 2H5SA 4RYEA 4DDYA 4FD8A 4OLDA 1K54A 4OOMA 4N92A 1XP4A 3NCKA 5EE8A 3OPLA 5F83A 5U47A 3NIAA 1BT5A 3PAEA 5I94A 3DWZA 2ZQ7A 1KE3A 4PM7A 2G2UA 1MBLA 3BYDA 4H8RA 4OP8A 5FQJA 2CC1A 2I72A 3P98A 1K4EA 1ONGA 2Y55A 4S2PA 4MLLA 4Y0OA 5CXWA 5CTMA 4EBLA 1M6KA 2XD1A 1I5QA
chains in the Genus database with same CATH superfamily
1MKMA 1Q2PA 2J3WA 1NXYA 3OZHA 1M40A 1KDSA 4MCWA 5HSQA 1CJFA 3S4XA 3QP1A 1HTZA 4NK3A 3B33A 5AVFA 4G3WA 1BLCA 1S67L 4JF6A 2D02A 5FSRA 4UQIS 4Y5FA 1K54C 1OJ5A 2ZL1A 3BY8A 1ZG6A 4OLGA 3E2LA 2ZC5B 4GS9A 4GOGA 4WEKA 3DW0A 2WKRA 4HP4A 4MMNA 3WWXA 3ZG7B 1KGGA 2EXAA 3FZCA 1L2SA 5F5YA 3CAXA 5CERA 3GRJA 2PU4A 2P9VA 4R38A 4HBTA 2EFXA 5A90A 4K0XA 1GSVA 2WUQA 1OTEA 1PZOA 4KQOA 4EBNA 4WZ5A 2HV1A 4PPRA 4X55A 5TBMB 4IBXA 2EXBA 5KSHA 1CF0A 2IWBA 4WUJA 3VOZA 3IXGA 3TRCA 3FG8A 3BW6A 2WKQA 4E3MA 3EGXC 2DMWA 4P0MA 5HARA 1K38A 3Q7ZA 4CJNA 3M6BA 3VE4A 5M18A 2WKEA 2H0YA 3ZG5A 1LL8A 3ZCZA 5JYPA 4WMCD 1FR6A 3R7WB 4JXGA 5EUAA 4R0QA 3PXPA 4KQRA 4PMAA 5TR7A 4LV2A 3T4KA 1T1AA 2A24B 2DRWA 2V0WA 1PI5A 4X6TA 2BASA 3CJMA 4LCLA 1BLHA 1NLYA 1P9RA 4NXEA 1ZKJA 2RCXA 3BJNA 3ZGAB 4GW9A 1HLUP 3FPVA 4Q0JA 1PWCA 3IWIA 4HJ3A 5E2HA 2GJ3A 3C4OA 4UA6A 2W3GA 3H82A 1FSYA 3VFFA 3BLMA 1DJAA 3A0RA 2VA0A 4E04A 5HPFA 4ZBEA 3U2AA 4KZ6A 3P09A 4JLFA 3H7WB 1HZOA 3HLFA 2V20A 3D3OA 3GVBA 1W63M 2WK0A 1LLBA 5EVLA 3E98A 5HD3A 5FL3A 1EWZA 2WKPA 4NKPA 2LB5A 4HQAA 1IYOA 3UN7A 5GLCA 4JF4A 4P6ZM 5HDCA 2VK3A 3C4PA 5FDSA 4R3JA 2XEPA 1JWZA 4DRTA 3MS6A 2O99A 5GLAA 5CGWA 5KSCA 3IXHA 3DBAA 3EGDC 2O0YA 4MDZA 5DFXA 3PBTA 2HP6A 1PYYA 3KSIA 3GR2A 1SDEA 2WGVA 4EBPA 2Q9MA 1ZC2A 2GNXA 1IELA 3HLBA 4MN7A 2VV6A 3ZVTA 4I38A 1ES3A 4LFUA 5IS1A 3UNWA 3DTKA 4O0PA 4FH4A 4F94A 1GSWA 3MSHA 3HCYA 2V1AA 2PYPA 2X01A 2EX2A 2EX8A 5FASA 2OLUA 3OPRA 4WBGA 1L0GA 1CEGA 4UHUA 4YWZA 4R3BA 2ZLYA 5J3WA 5F1FA 2P04A 5EVIB 4S2NA 5F82A 4HNBA 3GV9A 4JGRA 1PNEA 1NZOA 3PR6A 4HOIA 1UWPX 2ZC7A 4R1GA 3UB8A 1BLPA 2Y8HA 2HDQA 4DXCA 1ESUA 4DDSA 1GCEA 3PBRA 1F9IA 1SKOB 2C6WB 3KX0X 1WYCA 5F6AA 4S2MA 2WZZA 3M2KA 3ULFA 5EVIC 1YQSA 3CMZA 4Y15A 4P6BA 3AGFA 4BJPA 1ZG4A 2V1BA 3NI9A 5F69A 2EWWA 3MBZA 1GA9A 4OOLA 3S7OA 1W5DA 1TS6A 3WRTA 1CK3A 2ZMAA 4PM5A 3LEZA 3QP8A 3ICYA 5CHMA 3AGEA 4N9LA 3GTCA 1ODVA 4B4ZA 5AQ9A 3FKVA 4I3JA 1SDNA 4QHCA 3S7NA 5DF8A 1K55A 2W1TB 3F1PA 4MBHA 4IUKA 2XA7S 5DTKA 4Y3IA 1H0MA 2M1CA 4DE2A 3S1YA 4KZAA 3BLSA 2HJEA 3D9YA 3LY4A 4GLQA 5HX9A 2PD8A 4FUWA 4ZJ3A 3ZG9B 3PBNA 4BQMA 3E4QA 3B42A 5C5KA 4OPQA 3MZEA 4R23A 3T4OA 2RL3A 1NRJA 4MNRA 5G4YA 1S4SA 3A0VA 3KYEA 4MN5A 4EUZA 3O87A 2ZC4B 2W0NA 1OT6A 3G2YA 2V0UA 1BLSA 3JVVA 3GECA 4XT2A 1MWTA 5HZHA 4EUVA 3MZFA 4N1HA 2FZ0A 4OQIA 5L07A 2AVXA 1XPBA 5DVAA 2JHEA 5A91A 2NUTC 3FYZA 2OOLA 2V8FA 3ZNTA 1MZUA 3C2WA 4WL9A 5A8BA 4DJ2A 1GHIA 3HL9A 4EQ1A 2HPBA 4HHDA 1I2WA 2PYRA 5FQ9A 1LI0A 5KIZA 1XX2A 4F3LA 4LLOB 2Y4AA 3LI8A 1YLZA 3OOVA 2QMIA 4DMZA 1IYQA 4EQIA 2H5SA 4RYEA 4OOMA 3NCKA 5F83A 4B93A 1BT5A 5FQJA 3BYDA 2CC1A 3P98A 5CXWA 4EBLA 4MLLA 5CTMA 1I5QA 3IQAA 1H3QA 3UY6A 1L0EA 2QPNA 4MN6A 5FEGA 2EX6A 1S0WA 2ZBBA 3CUEC 3U4LP 1GA0A 4WELA 1IOUA 4LV1A 3F1OA 3BFCA 1MPLA 2Q0OA 3IF6C 1NYYA 5FAPA 1K56A 1TDLA 3CHWP 1JVJA 3UPOA 2FH5A 3H9WA 4E3LA 3N8RA 2ZMFA 4CLCA 3E4PA 1BULA 1PW8A 2Y2KA 2HDUA 5DJTA 4HESA 3N4IA 2PDRA 1TDGA 5FEFA 4IVKA 1V9YA 4FOFA 4JGPA 3NOUC 3SH8A 3VP3A 3LY3A 1PI4A 4OQGA 3UMEA 1A0KA 3IF5A 3PAGA 2KDKA 1AXBA 3W8KA 3JVUA 5M1AA 3TJZC 3WS5A 3G31A 1J9MA 1JTDA 2ZC6B 1NLZA 1XKZA 4EU0A 2WGWA 1XGIA 5A93A 1DRMA 4KZ4A 4HH3A 2HGVA 1Y28A 4ZAMA 3NULA 1YSPA 4OPZA 4WYYA 3CLOA 3Q82A 3MQ0A 1RGZA 1TS8A 5CEBA 3MKEA 3TOIA 2PD7A 4GKUA 5FI6A 1BZAA 1DP9A 3MXRA 3C5AA 5GL9A 2M7VA 1ERMA 2ZD8A 1DP8A 3ZG0A 1YMXA 3MR0A 2JKFA 4BBTA 4OH0A 3O88A 4XUZA 1PFLA 1D06A 3T50A 4XUXA 5AQBA 2BTFP 3Q1FA 4WEJA 4ZTKA 4GCZA 3BFEA 4HI4A 1PWGA 3S7QA 2JKGA 3T4JA 2VJWA 3C7UA 1KE0A 3A3JA 5BOHA 4KQDA 2V2FF 3LI9A 2Y2NA 1LT0A 2KLIA 2PU2A 1UGUA 1YLPA 2IWCA 5EPHA 5I5LA 3WRZA 3T1XA 1OTAA 3PTEA 4WMCA 3HREA 5CRFA 2W3HA 4X69A 4RVAA 3Q7VB 3V67A 1ES4A 4GD8A 3ISGA 1DY6A 3C38A 3LYXA 4Y0TA 2XQZA 5DKLA 2QJ5A 3IS2B 3VP0A 5EFWA 4XXRA 2Y2JA 4NEED 4U3TA 2H10A 4GZBA 3V50A 3LR0A 3LIEA 4PM8A 4QWOA 5DF9A 4E3IA 1N4OA 4FCFA 4WM9A 1LSWA 1EW0A 1N9OA 4R3AA 1H8MA 3QNCA 3SW1A 3T1SA 1FR1A 4K08A 1JNUA 4M4XA 2ZJ9A 3O5YA 4HJ4A 4QJGA 1ZHHB 1KDWA 5L8MA 3DAVA 2GDNA 1Q2QA 4H6JB 2FFFB 1QMEA 2EA9A 5AQ7A 1SZVA 2ZQ9A 3N8SA 4IUHA 3SS4A 1S1YA 3UO9A 3AGDA 3V3SA 2V1ZA 2BLSA 4LGWA 5DTTA 3LICA 1LI9A 1N9LA 2VGLS 3FKWA 2K7SA 5LBRA 4EW7A 4HIAA 3L7HA 3UPPA 3R4KA 1U60A 4GD6A 3ZDJA 5HAPA 3M6HA 5HDDA 1O7EA 4HEFA 1RCJA 4ZJ2A 4UA9A 3TG9A 3D4FA 4IVIA 5AQAA 1W7FA 4S2NC 4LRYC 5F1GA 3OLOA 1IFQA 4JKTA 1PWDA 3PBSA 5GHXA 1S1ZA 4GDBA 3RXXA 4R4RA 2XLNA 3NDGA 1W63Q 1QMFA 1VB6A 5CHJA 2XSSA 3T12B 3K2NA 3NDEA 1VQQA 5IT5A 4HBUA 2ZMVA 2QHKA 4WLAA 5HWTA 2E8JA 1MXOA 2XD5A 3IH8A 2J3TC 4BD0A 4IEDA 2B18A 2JKTI 2HZ5A 4O7DA 1ERQA 2WZXA 4OKPA 1G28A 4C3QA 2JE5A 5GHZA 5FQMA 4OONA 4S2JA 1VETB 5TBMA 1GSXA 4B9OA 3O86A 3F1NB 4LV3A 3EQUA 1L3LA 2R78A 4R70A 1X0OA 1C3BA 3RJUA 3HLEA 4BD1A 2HP5A 3BECA 3GDIA 5FI7A 3HLWA 4PM9A 1DJBA 4L0LA 4NXBA 3CPTB 4S2LA 4KZBA 4N9KA 1YLTA 2XFTA 3UDXA 1KVLA 1Y4OA 3R7WA 1E3UD 4HH2A 2Y2QA 4X68A 3RXWA 1L0FA 3PYPA 1DJCA 1EI5A 3SS3A 3VP1A 3CZDA 1K6SA 2A24A 2HP9A 4GHIB 5FQKA 2W3EA 3HUMA 4BWIA 4GB7A 3MFDA 4YINA 1BYWA 5DF7A 1NJ4A 3BFFA 1P97A 5EECA 2Y2GA 3UE1A 1MC0A 2WYXA 2A49A 4I3AA 4N92A 3OPLA 4G3KA 4Y2FA 1XJ3A 3DWZA 4DN0A 1ONGA 4S2PA 4Y0OA 3NHQA 4Z1WA 4L9FA 3A0SA 3BWLA 4ESPA 5FA7A 3ZVWA 3JPUA 1MY8A 1TD5A 1E4DA 3H7WA 4LPZA 4LV0A 1YT4A 4CLCE 4FSFA 1FSWA 5KZHA 4I39A 4R6LA 1S4RA 5FQIA 3KSFA 5J7EA 4UQIM 2GZAA 2OLVA 3LUQA 2OWHA 3IT9A 2ZC3B 3LIDA 3VMAA 1KVMA 4IBRA 2ZM0A 4B4XA 1XFQA 1OPXA 1H5XA 4ETZA 3G4PA 2B5RA 5GLDA 3E0YA 3QP4A 4RX3A 2VZWA 1TEMA 2OWJA 4DF6A 2JKRI 4ME4A 3LFVA 2WAEA 5G4ZA 3MKFA 2B02A 3NECA 4KZ7A 2JN7A 4M3KA 3UDIA 3MFXA 3UE0A 2J3TD 4NG2A 5KMWA 4EEUA 3HLCA 1BSGA 3QP2A 4MBFA 3SS5A 1KGEA 4QY6A 1K25A 2E8IA 5HL6A 3OCNA 4CQHA 2L1MA 2OSUA 1WA9A 4S2OA 3KYQA 3OPHA 4CPKA 3CI6A 5GHYA 5HWVA 4C75A 5A92A 1G5UA 1T1CA 4RA7A 4X56A 1XXMA 3HUOA 1L0DA 3SH7A 2PRFA 3S7PA 4CLCC 4MEZA 5CEDA 3C8CA 1I2SA 5DJUA 4E3JA 2EX9A 4Y0UA 3HJKA 3DTMA 2ZOHA 3A3DA 5EVIA 3Q81A 1LSXA 4YNRA 3A3IA 2L0WA 3VOLA 4X53A 1S6RA 2W3FA 3KYZA 3CG5A 1YMSA 5DTSA 5J8XA 3QP6A 3E4OA 3QHYA 2VGLM 1CI8A 4ZDXA 3HUNA 3IF6B 1SKOA 4BENA 1VEUB 5L09A 1W8QA 3IWOA 2JKTM 2VGJA 5HFOA 4EERA 2MJ6A 2QWSA 5EVID 3DTEA 3LIBA 1YAXA 4YOFA 1G6OA 2Q9NA 1P0ZA 1F2KA 1XJ4A 2ZQCA 4ARZA 1NY0A 2PR5A 2KX6A 4QPRA 2XK1A 3VOYA 4Q8IA 1N9BA 5F68A 4Y7PA 2QJ7A 2WADA 4EETB 4JF5A 2JC7A 2ZQDA 2ZL1B 4NXFA 2W1TA 4PHTA 4BMWA 2X02A 4P6ZS 4GS9B 2JCHA 5E43A 1MKIA 1TF1A 2Y59A 5CECA 2P9VB 3CITA 4X25A 1TS0A 4DXBA 4U0XA 1J3WA 3ZNYA 2IWDA 1NRFA 2Y79A 1LHYA 1Y54A 4WN5A 4A5RA 2CMNA 2P7JA 5GLBA 4OVDA 1ALQA 3PHYA 3EEHA 1EROA 4N1XA 3V3RA 2JBFA 2Z2MB 1NZUA 3SOIA 4KQQA 2WAFA 3WS0A 1K57A 1OJGA 2P08A 4L9EA 2LB9A 4WZ5C 2DCFA 1BTLA 4KENB 1RP5A 3MQQA 3VSKA 1T18A 3PBOA 4KUKA 3MXSA 2Z6CA 5L2FA 3KO6A 1SKFA 3WS2A 3ZQ5A 1NWZA 2OV5A 3NC8A 3N8LA 2W27A 4HY8A 4OP5A 2PT7A 2QZ6A 3E2KA 5TGFA 1YKDA 2DNSA 2A2LA 3TE8A 3LGOA 4HP9A 3EEAA 5CHUA 3VSLA 2H0TA 4JXWA 1TVFA 4ID4A 2Y2IA 3H82B 4RX2A 5AVEA 2JKRM 1ACFA 2J80A 2G7UA 4WZ4A 2UWXA 3EWKA 1IYSA 4KZ5A 4BL3A 3BFGA 1MWRA 3V5MA 1FCOA 4MBKA 2J9PA 2PBYA 3UB9A 3BM6A 3VFHA 3A3EA 5E2GA 5HW3A 2XA7M 4WF0A 5M19A 1O07A 5HDSA 4P85A 4I3IA 4NXGA 2WKHA 3ZG8B 2K31A 4BBUA 3LEQA 5FQQA 2HJ9C 4OQ0A 3ZHHA 4EXOA 4X1MA 2XH9A 4U0TA 2ZQ8A 2KOIA 4DE1A 4E3NA 5EM0A 4IHQA 5CGSA 2XR0A 4Z9QA 5K5BA 4EEPA 4BL2A 4QY5A 1JTGA 1HD8A 5HL1A 1VHMA 1DP6A 3TSGA 3Q07A 2HDSA 3T4SA 5J4EA 4OP8A 3LR5A 4GN2A 3IXBA 1FOFA 2P74A 5TJJA 4ETXA 3IX8A 1ESIA 2K2NA 3LIAA 3W4QA 3TW8A 3B47A 3L9KA 4EV4A 4JGOA 2R9WA 3HBRA 4YFMA 3LIFA 3DWKA 4O8GA 1UWNX 1FCNA 1LL5A 4AFIA 2M7UA 3DTIA 3VP2A 2R9XA 3T4QA 1NYMA 3BQAA 1F5MA 4HJ6A 3GSGA 1XJ6A 2Y2PA 1E25A 3M2JA 1TS7A 1MWUA 4OPRA 4E3OA 4DDYA 4OLDA 1K54A 2EWVA 2O9BA 5EE8A 4Q0HA 1XFNA 2VV7A 3PAEA 1KE3A 1OTDA 4PM7A 2G2UA 3LR3A 2I72A 2YKHA 3K3DA 2OAQ1 1M6KA 3OC2A 3ZFZA 1PRQA 1K6RA 3NOPC 4D2OA 1Z6FA 1YLYA 2YKFA 4S2KA 5HAQA 4Q0IA 1XA1A 1YLJA 1XGJA 5EOOA 2FFYA 3T4TA 3LO7A 1XJ2A 3F1PB 4IJGA 5CGXA 2WGIA 1V9ZA 4GNUA 1W8YA 2XRNA 2VX8A 3MZDA 1HVBA 4B88A 1E3UA 5EVEA 3FWLA 1H8YA 4DE3A 3G32A 3Q7VA 3BQ8A 1XA7A 4JPMA 2PHYA 1W79A 4JXSA 3GMWA 3KSHA 2V9AA 3IS2A 5L10A 1CQAA 1K55C 4EESA 2PR6A 5E2EA 4II7A 4L9GA 2XF3A 3P01A 2Z6DA 2V8CA 2QKPA 4PKYG 5MC7A 2VGKA 2OAP1 1YLWA 3MF0A 2W1RA 5FI2A 4XT2B 3IX4A 1JWPA 1MWSA 4KUOA 4P87A 2PAVP 1KE4A 4LRZE 3SZTA 2ZM8A 3IHBA 3ITBA 4Y13A 4X1LA 1G6AA 2PBDP 2VKSA 3OCLA 4H6JA 2NUPC 3W4OA 3N7WA 3UB7A 4F3LB 3WS1A 3HJIA 2UV0E 4I5SA 3RFBA 4O01A 5DFYA 4BLMA 3IH9A 3IX3A 1OMEA 5HAIA 5IHVA 2VEAA 1K0KA 4OPYA 2VV8A 2W3DA 4R4SA 3G2ZA 3IWQA 1OTBA 3VE3A 2GX5A 4KZ3A 3EQVA 3BRMA 3W2ZA 2XDMA 4C6YA 4LENA 5DKKA 3S22A 4ARZB 3F1OB 1PZPA 2Y2LA 2Y2MA 3LR4A 1YPRA 1FCMA 3G30A 3W4PA 2J7VA 4QB8A 1WE4A 1P9WA 2XROA 5FAQA 1AWIA 1ONHA 2J8YA 4S2IA 1SHVA 4CLCB 4ZRRA 1FIKA 1WYBA 2XGNA 5FAOA 3MXQA 5IU1A 1ZTUA 1GHMA 1OT9A 1RGYA 2WKIA 4ZJ1A 3ITAA 1VETA 4G3VA 1GHPA 4KZ9A 2Y2HA 3F1NA 5HPIA 4BBVA 3I7JA 4DKIA 3A3FA 3CWFA 2ZQAA 4JBFA 3BFDA 2O9CA 3T4LA 3CPTA 1JWVA 4GJ4A 4E3KA 4KG5A 3G6OA 3MMHA 3HLGA 3QP5A 3HVFA 3NBLA 1T1BA 3IHAA 1CI9A 3FC7A 3N6IA 2INWA 2G2WA 5EOEA 1ES2A 2WGWB 2QYBA 3K3CA 4Y17A 3O3VA 5TFQA 4FTXA 4JGQA 1CEFA 4GHIA 3T1RA 1PW1A 3NOTC 3JYIA 3VP4A 2Y2OA 5EM1A 1N9NA 3C30A 3D72A 3KSGA 4OOYA 1K4FA 1KOUA 2ACGA 1SCWA 3OPPA 3G34A 1K57C 4KG2A 1T19A 1IKIA 4RQ9A 3UB5P 1IEMA 4UAAA 1IKGA 3RTYA 1LSVA 2ZOIA 3QNBA 2HDRA 3V39A 3UE6A 3C7VA 4JXVA 1LL9A 2Y91A 4PAUA 5AJGA 3G35A 4PKYA 3LCEA 2EFUA 1YM1A 4PM6A 5D3OA 3HLDA 4UEYA 3BEBA 4KG6A 1Z09A 3UPNA 2B95A 3IBRA 3GQZA 1F98A 1IYPA 1D1JA 3MQOA 4NETA 3WS4A 3PBQA 4UA7A 2Z2LB 1S66L 4GDNA 4KZ8A 2H28A 4K91A 3NJAA 1KGFA 3VV4A 3NY4A 4QD4A 3ZYTA 1STZA 5E2FA 3BY9A 5HD5A 1ES5A 2BG1A 3IXDA 5HWWA 2L4RA 3OBFA 5FATA 2ZM2A 5CTNA 2X71A 3FV7A 1BUEA 4EWFA 2O9AA 5EV0A 5FDHA 2A3UA 4D60A 5JYOA 4QU3A 1FQGA 4LCMA 1K56D 2D01A 4DE0A 3UDFA 2C5WB 1H8ZA 2I9VA 1D7EA 4K0WA 4FH2A 3UB6A 4CLCD 3EOIA 4E6WA 3UE3A 3T1QB 4DJ3A 1YSQA 4OQHA 3B3XA 2J9OA 3MJQA 1PIOA 3RH8B 4E6XA 5CX7A 3FPWA 3CUEA 5G18A 3UMDA 3IBJA 4LRXC 3SH9A 1VM1A 1G68A 2XFSA 2IA2A 2VLGA 3IF6A 1OTIA 4FD8A 1VEUA 1XP4A 2HF6A 1FILA 5U47A 3NIAA 5I94A 2ZQ7A 1MBLA 4H8RA 3P7NA 1K4EA 2Y55A 2XD1A
chains in the Genus database with same CATH topology
3OC2A 1Q2PA 3ZFZA 3IQAA 5FA7A 3ZVWA 3UY6A 1L0EA 1MY8A 2QPNA 1NXYA 1E4DA 3OZHA 1K6RA 4D2OA 1Z6FA 2EX6A 4LV0A 1S0WA 1M40A 1YT4A 1KDSA 1GA0A 1YLYA 4FSFA 1FSWA 4S2KA 3S4XA 4WELA 5KZHA 5HAQA 5FQIA 1HTZA 4LV1A 1XA1A 4NK3A 1BLCA 3BFCA 1YLJA 2OLVA 1MPLA 4JF6A 3IT9A 2ZC3B 5FSRA 3IF6C 1XGJA 5EOOA 2FFYA 1K54C 1NYYA 3LO7A 5FAPA 1ZG6A 3VMAA 1KVMA 4OLGA 3E2LA 4IBRA 2ZC5B 2ZM0A 4B4XA 4GOGA 1H5XA 5CGXA 2WGIA 1K56A 4WEKA 3DW0A 1TDLA 1JVJA 3UPOA 3WWXA 4GNUA 3ZG7B 1KGGA 2EXAA 1W8YA 3FZCA 1L2SA 3G4PA 2B5RA 3MZDA 1HVBA 4B88A 5GLDA 1E3UA 5CERA 3GRJA 3N8RA 4E3LA 3FWLA 2PU4A 2P9VA 1H8YA 4DE3A 4HBTA 1BULA 1PW8A 2EFXA 4RX3A 5A90A 2Y2KA 3G32A 2HDUA 4K0XA 1TEMA 2WUQA 3Q7VA 4DF6A 1XA7A 1PZOA 4KQOA 2WAEA 4JPMA 4EBNA 1W79A 3MKFA 4HESA 4JXSA 4KZ7A 4PPRA 4M3KA 4WZ5A 3GMWA 4X55A 3UDIA 3UE0A 3N4IA 4IBXA 2EXBA 1K55C 5KMWA 5KSHA 2IWBA 3HLCA 1BSGA 4MBFA 5E2EA 1TDGA 3VOZA 3IXGA 4IVKA 1KGEA 4QY6A 3SS5A 1K25A 2XF3A 2E8IA 3SH8A 3VP3A 3LY3A 1PI4A 3OCNA 4OQGA 4E3MA 2OSUA 4P0MA 4S2OA 5HARA 3IF5A 1K38A 3OPHA 4CPKA 3PAGA 5GHYA 3Q7ZA 4C75A 5A92A 4CJNA 3M6BA 1AXBA 3W8KA 5M1AA 2VGKA 1YLWA 5M18A 2WKEA 4RA7A 3WS5A 5FI2A 4X56A 1XXMA 3HUOA 2H0YA 1J9MA 3G31A 1L0DA 3SH7A 1JTDA 2ZC6B 3ZG5A 1JWPA 1XKZA 1MWSA 3ZCZA 5JYPA 4WMCD 1FR6A 2WGWA 1XGIA 5A93A 4MEZA 5CEDA 4P87A 1KE4A 1I2SA 4JXGA 5EUAA 4KZ4A 2ZM8A 3IHBA 3ITBA 4R0QA 4E3JA 4KQRA 4PMAA 2EX9A 4LV2A 4Y0UA 5TR7A 1G6AA 3DTMA 2DRWA 3OCLA 3A3DA 4ZAMA 4WYYA 4OPZA 5EVIA 3Q81A 1PI5A 3Q82A 3A3IA 3W4OA 4X53A 4X6TA 3N7WA 1S6RA 3CG5A 1YMSA 1RGZA 3CJMA 4LCLA 5DTSA 5J8XA 1BLHA 3WS1A 5CEBA 1ZKJA 3MKEA 2RCXA 3TOIA 3ZGAB 3QHYA 1CI8A 4ZDXA 4GKUA 5FI6A 3HUNA 1PWCA 3IF6B 3IWIA 1BZAA 4BENA 3MXRA 3C5AA 4BLMA 3IH9A 5GL9A 1OMEA 5HAIA 1W8QA 5E2HA 5IHVA 3IWOA 1ERMA 5HAPA 3C4OA 4UA6A 2ZD8A 3ZG0A 1FSYA 1YMXA 2VGJA 4OPYA 3VFFA 3BLMA 1DJAA 5HFOA 4R4SA 3G2ZA 5EVID 3IWQA 4OH0A 4ZBEA 3O88A 4XUZA 4KZ6A 3P09A 4XUXA 5AQBA 4JLFA 2Q9NA 1HZOA 3HLFA 2V20A 3Q1FA 4KZ3A 2ZQCA 3EQVA 4WEJA 3BRMA 3GVBA 2XDMA 1NY0A 4C6YA 4ZTKA 3BFEA 4LENA 2WK0A 1PWGA 3S22A 1LLBA 2XK1A 5EVLA 3VOYA 4Q8IA 3C7UA 1N9BA 1KE0A 3A3JA 5BOHA 4Y7PA 1PZPA 2Y2LA 1EWZA 2V2FF 1IYOA 2Y2MA 2WADA 4QU3A 4JF5A 3UN7A 2JC7A 4JF4A 1FCMA 2Y2NA 5GLCA 3G30A 2ZQDA 3W4PA 2PU2A 3C4PA 2J7VA 4QB8A 1WE4A 1YLPA 2IWCA 2X02A 5FAQA 4R3JA 5EPHA 2JCHA 2XEPA 1JWZA 4DRTA 5E43A 1ONHA 3WRZA 1MKIA 5GLAA 3PTEA 2J8YA 4S2IA 4WMCA 5CGWA 1SHVA 3IXHA 5KSCA 2Y59A 5CECA 2P9VB 3HREA 3PBTA 5CRFA 1WYBA 2HP6A 4X69A 2XGNA 4RVAA 1PYYA 5FAOA 3GR2A 3Q7VB 1SDEA 1ES4A 2WGVA 4GD8A 3ISGA 1GHMA 1DY6A 4DXBA 4EBPA 1RGYA 2WKIA 4U0XA 4ZJ1A 4Y0TA 3ITAA 2Q9MA 2XQZA 1ZC2A 1GHPA 4KZ9A 2Y2HA 1IELA 3HLBA 3VP0A 3ZNYA 4XXRA 2Y2JA 4U3TA 2IWDA 1NRFA 2H10A 4GZBA 1LHYA 1Y54A 3V50A 4A5RA 3ZVTA 5GLBA 1ES3A 4OVDA 4PM8A 3I7JA 4DKIA 3A3FA 5DF9A 4E3IA 1N4OA 3UNWA 4FCFA 1ALQA 2ZQAA 4FH4A 4JBFA 4WM9A 4F94A 3BFDA 1EROA 4N1XA 3V3RA 2JBFA 2Z2MB 1NZUA 3SOIA 1JWVA 4KQQA 4E3KA 4KG5A 2WAFA 3HLGA 3HVFA 3WS0A 3QNCA 3NBLA 1K57A 3IHAA 1CI9A 4WZ5C 2EX2A 2X01A 3N6IA 1FR1A 2G2WA 5EOEA 1ES2A 1BTLA 2DCFA 2WGWB 4KENB 1RP5A 2EX8A 5TFQA 3O3VA 2ZJ9A 5FASA 1CEFA 2OLUA 3VSKA 3OPRA 3PBOA 4WBGA 1L0GA 4QJGA 1CEGA 4UHUA 1PW1A 1KDWA 3MXSA 4R3BA 2GDNA 2ZLYA 5L2FA 5F1FA 1Q2QA 4S2NA 5EVIB 2FFFB 3JYIA 5F82A 3VP4A 1QMEA 1SKFA 2Y2OA 5AQ7A 3WS2A 3GV9A 2ZQ9A 3N8SA 2OV5A 3NC8A 3N8LA 3SS4A 3UO9A 3AGDA 3V3SA 1NZOA 2V1ZA 2BLSA 2ZC7A 5DTTA 4OP5A 2QZ6A 3E2KA 1LI9A 4R1GA 1BLPA 4OOYA 1K4FA 3FKWA 5TGFA 2DNSA 1SCWA 3OPPA 3G34A 5CHUA 2HDQA 1K57C 4DXCA 1ESUA 4KG2A 3VSLA 4DDSA 1GCEA 3PBRA 1IKIA 2H0TA 2C6WB 1IEMA 4UAAA 1IKGA 4JXWA 1TVFA 1WYCA 3UPPA 4S2MA 2WZZA 1U60A 3M2KA 4GD6A 4ID4A 2Y2IA 5EVIC 1YQSA 3CMZA 4RX2A 3ZDJA 3QNBA 3M6HA 4P6BA 1O7EA 2HDRA 3AGFA 3V39A 4BJPA 4HEFA 1RCJA 1ZG4A 4ZJ2A 4UA9A 3TG9A 3C7VA 3D4FA 4IVIA 5AQAA 3NI9A 4JXVA 1W7FA 1LL9A 2Y91A 4S2NC 5F1GA 4JKTA 1PWDA 4WZ4A 3PBSA 3G35A 3MBZA 5GHXA 3LCEA 1GA9A 2UWXA 2EFUA 1YM1A 4OOLA 4PM6A 5D3OA 1W5DA 3HLDA 3BEBA 1IYSA 4GDBA 4KZ5A 3RXXA 4KG6A 3WRTA 1CK3A 2ZMAA 4R4RA 3UPNA 4PM5A 3LEZA 4BL3A 3BFGA 5CHMA 3AGEA 1MWRA 3GQZA 1FCOA 3GTCA 4MBKA 1IYPA 2XLNA 4N9LA 3V5MA 2J9PA 5AQ9A 3FKVA 4B4ZA 3NDGA 2PBYA 4NETA 3WS4A 1SDNA 4QHCA 3PBQA 5DF8A 1K55A 1QMFA 5CHJA 4UA7A 3BM6A 3VFHA 3A3EA 5E2GA 2Z2LB 5HW3A 3NDEA 1VQQA 4MBHA 4GDNA 4KZ8A 5M19A 4HBUA 1O07A 4P85A 4K91A 1MXOA 2XD5A 5DTKA 2WKHA 1KGFA 4DE2A 3ZG8B 3IH8A 3S1YA 3NY4A 4KZAA 4QD4A 4BD0A 4IEDA 5E2FA 3BLSA 3LY4A 5FQQA 4O7DA 1ERQA 2WZXA 4OKPA 5HX9A 4OQ0A 4ZJ3A 3ZHHA 2XH9A 1ES5A 4C3QA 2BG1A 2JE5A 3IXDA 5GHZA 3ZG9B 5FQMA 3PBNA 4OONA 4U0TA 2ZQ8A 4S2JA 4DE1A 4BQMA 5FATA 4E3NA 2ZM2A 5CTNA 3O86A 5CGSA 2X71A 2XR0A 4OPQA 3MZEA 4LV3A 4Z9QA 3EQUA 3FV7A 1BUEA 4BL2A 4R23A 1C3BA 2RL3A 4QY5A 1JTGA 1HD8A 4MNRA 3RJUA 3HLEA 4BD1A 4EWFA 2HP5A 5HL1A 3BECA 5FI7A 5FDHA 3HLWA 3TSGA 3Q07A 4PM9A 1DJBA 4L0LA 4EUZA 2A3UA 2HDSA 5JYOA 3O87A 4S2LA 1FQGA 2ZC4B 3G2YA 4GN2A 4LCMA 1BLSA 3IXBA 1K56D 1FOFA 2P74A 4KZBA 4DE0A 3UDFA 2C5WB 4N9KA 1H8ZA 1YLTA 1MWTA 2XFTA 3MZFA 4N1HA 3UDXA 4OQIA 1KVLA 4K0WA 1ESIA 1E3UD 1XPBA 4FH2A 5DVAA 2Y2QA 4X68A 3RXWA 5A91A 3W4QA 1L0FA 3FYZA 4E6WA 3UE3A 1DJCA 4EV4A 1EI5A 2R9WA 3SS3A 3VP1A 4OQHA 3CZDA 3HBRA 3ZNTA 1K6SA 4YFMA 2HP9A 5FQKA 3HUMA 3B3XA 2J9OA 3DWKA 1GHIA 3HL9A 1PIOA 4GB7A 2HPBA 1FCNA 1I2WA 3MFDA 4YINA 5FQ9A 1LI0A 1LL5A 4E6XA 5DF7A 1XX2A 3VP2A 1NJ4A 5G18A 2R9XA 1NYMA 3BFFA 2Y4AA 1YLZA 3SH9A 5EECA 1VM1A 1G68A 2Y2GA 3UE1A 3GSGA 2Y2PA 1E25A 2WYXA 3M2JA 2QMIA 2XFSA 1IYQA 4EQIA 1MWUA 2A49A 3IF6A 4OPRA 4E3OA 2H5SA 4RYEA 4DDYA 4FD8A 4OLDA 1K54A 4OOMA 4N92A 1XP4A 3NCKA 5EE8A 3OPLA 5F83A 5U47A 3NIAA 1BT5A 3PAEA 5I94A 3DWZA 2ZQ7A 1KE3A 4PM7A 2G2UA 1MBLA 3BYDA 4H8RA 4OP8A 5FQJA 2CC1A 2I72A 3P98A 1K4EA 1ONGA 2Y55A 4S2PA 4MLLA 4Y0OA 5CXWA 5CTMA 4EBLA 1M6KA 2XD1A 1I5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OC2 A;  1Q2P A;  3ZFZ A;  3IQA A;  5FA7 A;  3ZVW A;  3UY6 A;  1L0E A;  1MY8 A;  2QPN A;  1NXY A;  1E4D A;  3OZH A;  1K6R A;  4D2O A;  1Z6F A;  2EX6 A;  4LV0 A;  1S0W A;  1M40 A;  1YT4 A;  1KDS A;  1GA0 A;  1YLY A;  4FSF A;  1FSW A;  4S2K A;  3S4X A;  4WEL A;  5KZH A;  5HAQ A;  5FQI A;  1HTZ A;  4LV1 A;  1XA1 A;  4NK3 A;  1BLC A;  3BFC A;  1YLJ A;  2OLV A;  1MPL A;  4JF6 A;  3IT9 A;  2ZC3 B;  5FSR A;  3IF6 C;  1XGJ A;  5EOO A;  2FFY A;  1K54 C;  1NYY A;  3LO7 A;  5FAP A;  1ZG6 A;  3VMA A;  1KVM A;  4OLG A;  3E2L A;  4IBR A;  2ZC5 B;  2ZM0 A;  4B4X A;  4GOG A;  1H5X A;  5CGX A;  2WGI A;  1K56 A;  4WEK A;  3DW0 A;  1TDL A;  1JVJ A;  3UPO A;  3WWX A;  4GNU A;  3ZG7 B;  1KGG A;  2EXA A;  1W8Y A;  3FZC A;  1L2S A;  3G4P A;  2B5R A;  3MZD A;  1HVB A;  4B88 A;  5GLD A;  1E3U A;  5CER A;  3GRJ A;  3N8R A;  4E3L A;  3FWL A;  2PU4 A;  2P9V A;  1H8Y A;  4DE3 A;  4HBT A;  1BUL A;  1PW8 A;  2EFX A;  4RX3 A;  5A90 A;  2Y2K A;  3G32 A;  2HDU A;  4K0X A;  1TEM A;  2WUQ A;  3Q7V A;  4DF6 A;  1XA7 A;  1PZO A;  4KQO A;  2WAE A;  4JPM A;  4EBN A;  1W79 A;  3MKF A;  4HES A;  4JXS A;  4KZ7 A;  4PPR A;  4M3K A;  4WZ5 A;  3GMW A;  4X55 A;  3UDI A;  3UE0 A;  3N4I A;  4IBX A;  2EXB A;  1K55 C;  5KMW A;  5KSH A;  2IWB A;  3HLC A;  1BSG A;  4MBF A;  5E2E A;  1TDG A;  3VOZ A;  3IXG A;  4IVK A;  1KGE A;  4QY6 A;  3SS5 A;  1K25 A;  2XF3 A;  2E8I A;  3SH8 A;  3VP3 A;  3LY3 A;  1PI4 A;  3OCN A;  4OQG A;  4E3M A;  2OSU A;  4P0M A;  4S2O A;  5HAR A;  3IF5 A;  1K38 A;  3OPH A;  4CPK A;  3PAG A;  5GHY A;  3Q7Z A;  4C75 A;  5A92 A;  4CJN A;  3M6B A;  1AXB A;  3W8K A;  5M1A A;  2VGK A;  1YLW A;  5M18 A;  2WKE A;  4RA7 A;  3WS5 A;  5FI2 A;  4X56 A;  1XXM A;  3HUO A;  2H0Y A;  1J9M A;  3G31 A;  1L0D A;  3SH7 A;  1JTD A;  2ZC6 B;  3ZG5 A;  1JWP A;  1XKZ A;  1MWS A;  3ZCZ A;  5JYP A;  4WMC D;  1FR6 A;  2WGW A;  1XGI A;  5A93 A;  4MEZ A;  5CED A;  4P87 A;  1KE4 A;  1I2S A;  4JXG A;  5EUA A;  4KZ4 A;  2ZM8 A;  3IHB A;  3ITB A;  4R0Q A;  4E3J A;  4KQR A;  4PMA A;  2EX9 A;  4LV2 A;  4Y0U A;  5TR7 A;  1G6A A;  3DTM A;  2DRW A;  3OCL A;  3A3D A;  4ZAM A;  4WYY A;  4OPZ A;  5EVI A;  3Q81 A;  1PI5 A;  3Q82 A;  3A3I A;  3W4O A;  4X53 A;  4X6T A;  3N7W A;  1S6R A;  3CG5 A;  1YMS A;  1RGZ A;  3CJM A;  4LCL A;  5DTS A;  5J8X A;  1BLH A;  3WS1 A;  5CEB A;  1ZKJ A;  3MKE A;  2RCX A;  3TOI A;  3ZGA B;  3QHY A;  1CI8 A;  4ZDX A;  4GKU A;  5FI6 A;  3HUN A;  1PWC A;  3IF6 B;  3IWI A;  1BZA A;  4BEN A;  3MXR A;  3C5A A;  4BLM A;  3IH9 A;  5GL9 A;  1OME A;  5HAI A;  1W8Q A;  5E2H A;  5IHV A;  3IWO A;  1ERM A;  5HAP A;  3C4O A;  4UA6 A;  2ZD8 A;  3ZG0 A;  1FSY A;  1YMX A;  2VGJ A;  4OPY A;  3VFF A;  3BLM A;  1DJA A;  5HFO A;  4R4S A;  3G2Z A;  5EVI D;  3IWQ A;  4OH0 A;  4ZBE A;  3O88 A;  4XUZ A;  4KZ6 A;  3P09 A;  4XUX A;  5AQB A;  4JLF A;  2Q9N A;  1HZO A;  3HLF A;  2V20 A;  3Q1F A;  4KZ3 A;  2ZQC A;  3EQV A;  4WEJ A;  3BRM A;  3GVB A;  2XDM A;  1NY0 A;  4C6Y A;  4ZTK A;  3BFE A;  4LEN A;  2WK0 A;  1PWG A;  3S22 A;  1LLB A;  2XK1 A;  5EVL A;  3VOY A;  4Q8I A;  3C7U A;  1N9B A;  1KE0 A;  3A3J A;  5BOH A;  4Y7P A;  1PZP A;  2Y2L A;  1EWZ A;  2V2F F;  1IYO A;  2Y2M A;  2WAD A;  4QU3 A;  4JF5 A;  3UN7 A;  2JC7 A;  4JF4 A;  1FCM A;  2Y2N A;  5GLC A;  3G30 A;  2ZQD A;  3W4P A;  2PU2 A;  3C4P A;  2J7V A;  4QB8 A;  1WE4 A;  1YLP A;  2IWC A;  2X02 A;  5FAQ A;  4R3J A;  5EPH A;  2JCH A;  2XEP A;  1JWZ A;  4DRT A;  5E43 A;  1ONH A;  3WRZ A;  1MKI A;  5GLA A;  3PTE A;  2J8Y A;  4S2I A;  4WMC A;  5CGW A;  1SHV A;  3IXH A;  5KSC A;  2Y59 A;  5CEC A;  2P9V B;  3HRE A;  3PBT A;  5CRF A;  1WYB A;  2HP6 A;  4X69 A;  2XGN A;  4RVA A;  1PYY A;  5FAO A;  3GR2 A;  3Q7V B;  1SDE A;  1ES4 A;  2WGV A;  4GD8 A;  3ISG A;  1GHM A;  1DY6 A;  4DXB A;  4EBP A;  1RGY A;  2WKI A;  4U0X A;  4ZJ1 A;  4Y0T A;  3ITA A;  2Q9M A;  2XQZ A;  1ZC2 A;  1GHP A;  4KZ9 A;  2Y2H A;  1IEL A;  3HLB A;  3VP0 A;  3ZNY A;  4XXR A;  2Y2J A;  4U3T A;  2IWD A;  1NRF A;  2H10 A;  4GZB A;  1LHY A;  1Y54 A;  3V50 A;  4A5R A;  3ZVT A;  5GLB A;  1ES3 A;  4OVD A;  4PM8 A;  3I7J A;  4DKI A;  3A3F A;  5DF9 A;  4E3I A;  1N4O A;  3UNW A;  4FCF A;  1ALQ A;  2ZQA A;  4FH4 A;  4JBF A;  4WM9 A;  4F94 A;  3BFD A;  1ERO A;  4N1X A;  3V3R A;  2JBF A;  2Z2M B;  1NZU A;  3SOI A;  1JWV A;  4KQQ A;  4E3K A;  4KG5 A;  2WAF A;  3HLG A;  3HVF A;  3WS0 A;  3QNC A;  3NBL A;  1K57 A;  3IHA A;  1CI9 A;  4WZ5 C;  2EX2 A;  2X01 A;  3N6I A;  1FR1 A;  2G2W A;  5EOE A;  1ES2 A;  1BTL A;  2DCF A;  2WGW B;  4KEN B;  1RP5 A;  2EX8 A;  5TFQ A;  3O3V A;  2ZJ9 A;  5FAS A;  1CEF A;  2OLU A;  3VSK A;  3OPR A;  3PBO A;  4WBG A;  1L0G A;  4QJG A;  1CEG A;  4UHU A;  1PW1 A;  1KDW A;  3MXS A;  4R3B A;  2GDN A;  2ZLY A;  5L2F A;  5F1F A;  1Q2Q A;  4S2N A;  5EVI B;  2FFF B;  3JYI A;  5F82 A;  3VP4 A;  1QME A;  1SKF A;  2Y2O A;  5AQ7 A;  3WS2 A;  3GV9 A;  2ZQ9 A;  3N8S A;  2OV5 A;  3NC8 A;  3N8L A;  3SS4 A;  3UO9 A;  3AGD A;  3V3S A;  1NZO A;  2V1Z A;  2BLS A;  2ZC7 A;  5DTT A;  4OP5 A;  2QZ6 A;  3E2K A;  1LI9 A;  4R1G A;  1BLP A;  4OOY A;  1K4F A;  3FKW A;  5TGF A;  2DNS A;  1SCW A;  3OPP A;  3G34 A;  5CHU A;  2HDQ A;  1K57 C;  4DXC A;  1ESU A;  4KG2 A;  3VSL A;  4DDS A;  1GCE A;  3PBR A;  1IKI A;  2H0T A;  2C6W B;  1IEM A;  4UAA A;  1IKG A;  4JXW A;  1TVF A;  1WYC A;  3UPP A;  4S2M A;  2WZZ A;  1U60 A;  3M2K A;  4GD6 A;  4ID4 A;  2Y2I A;  5EVI C;  1YQS A;  3CMZ A;  4RX2 A;  3ZDJ A;  3QNB A;  3M6H A;  4P6B A;  1O7E A;  2HDR A;  3AGF A;  3V39 A;  4BJP A;  4HEF A;  1RCJ A;  1ZG4 A;  4ZJ2 A;  4UA9 A;  3TG9 A;  3C7V A;  3D4F A;  4IVI A;  5AQA A;  3NI9 A;  4JXV A;  1W7F A;  1LL9 A;  2Y91 A;  4S2N C;  5F1G A;  4JKT A;  1PWD A;  4WZ4 A;  3PBS A;  3G35 A;  3MBZ A;  5GHX A;  3LCE A;  1GA9 A;  2UWX A;  2EFU A;  1YM1 A;  4OOL A;  4PM6 A;  5D3O A;  1W5D A;  3HLD A;  3BEB A;  1IYS A;  4GDB A;  4KZ5 A;  3RXX A;  4KG6 A;  3WRT A;  1CK3 A;  2ZMA A;  4R4R A;  3UPN A;  4PM5 A;  3LEZ A;  4BL3 A;  3BFG A;  5CHM A;  3AGE A;  1MWR A;  3GQZ A;  1FCO A;  3GTC A;  4MBK A;  1IYP A;  2XLN A;  4N9L A;  3V5M A;  2J9P A;  5AQ9 A;  3FKV A;  4B4Z A;  3NDG A;  2PBY A;  4NET A;  3WS4 A;  1SDN A;  4QHC A;  3PBQ A;  5DF8 A;  1K55 A;  1QMF A;  5CHJ A;  4UA7 A;  3BM6 A;  3VFH A;  3A3E A;  5E2G A;  2Z2L B;  5HW3 A;  3NDE A;  1VQQ A;  4MBH A;  4GDN A;  4KZ8 A;  5M19 A;  4HBU A;  1O07 A;  4P85 A;  4K91 A;  1MXO A;  2XD5 A;  5DTK A;  2WKH A;  1KGF A;  4DE2 A;  3ZG8 B;  3IH8 A;  3S1Y A;  3NY4 A;  4KZA A;  4QD4 A;  4BD0 A;  4IED A;  5E2F A;  3BLS A;  3LY4 A;  5FQQ A;  4O7D A;  1ERQ A;  2WZX A;  4OKP A;  5HX9 A;  4OQ0 A;  4ZJ3 A;  3ZHH A;  2XH9 A;  1ES5 A;  4C3Q A;  2BG1 A;  2JE5 A;  3IXD A;  5GHZ A;  3ZG9 B;  5FQM A;  3PBN A;  4OON A;  4U0T A;  2ZQ8 A;  4S2J A;  4DE1 A;  4BQM A;  5FAT A;  4E3N A;  2ZM2 A;  5CTN A;  3O86 A;  5CGS A;  2X71 A;  2XR0 A;  4OPQ A;  3MZE A;  4LV3 A;  4Z9Q A;  3EQU A;  3FV7 A;  1BUE A;  4BL2 A;  4R23 A;  1C3B A;  2RL3 A;  4QY5 A;  1JTG A;  1HD8 A;  4MNR A;  3RJU A;  3HLE A;  4BD1 A;  4EWF A;  2HP5 A;  5HL1 A;  3BEC A;  5FI7 A;  5FDH A;  3HLW A;  3TSG A;  3Q07 A;  4PM9 A;  1DJB A;  4L0L A;  4EUZ A;  2A3U A;  2HDS A;  5JYO A;  3O87 A;  4S2L A;  1FQG A;  2ZC4 B;  3G2Y A;  4GN2 A;  4LCM A;  1BLS A;  3IXB A;  1K56 D;  1FOF A;  2P74 A;  4KZB A;  4DE0 A;  3UDF A;  2C5W B;  4N9K A;  1H8Z A;  1YLT A;  1MWT A;  2XFT A;  3MZF A;  4N1H A;  3UDX A;  4OQI A;  1KVL A;  4K0W A;  1ESI A;  1E3U D;  1XPB A;  4FH2 A;  5DVA A;  2Y2Q A;  4X68 A;  3RXW A;  5A91 A;  3W4Q A;  1L0F A;  3FYZ A;  4E6W A;  3UE3 A;  1DJC A;  4EV4 A;  1EI5 A;  2R9W A;  3SS3 A;  3VP1 A;  4OQH A;  3CZD A;  3HBR A;  3ZNT A;  1K6S A;  4YFM A;  2HP9 A;  5FQK A;  3HUM A;  3B3X A;  2J9O A;  3DWK A;  1GHI A;  3HL9 A;  1PIO A;  4GB7 A;  2HPB A;  1FCN A;  1I2W A;  3MFD A;  4YIN A;  5FQ9 A;  1LI0 A;  1LL5 A;  4E6X A;  5DF7 A;  1XX2 A;  3VP2 A;  1NJ4 A;  5G18 A;  2R9X A;  1NYM A;  3BFF A;  2Y4A A;  1YLZ A;  3SH9 A;  5EEC A;  1VM1 A;  1G68 A;  2Y2G A;  3UE1 A;  3GSG A;  2Y2P A;  1E25 A;  2WYX A;  3M2J A;  2QMI A;  2XFS A;  1IYQ A;  4EQI A;  1MWU A;  2A49 A;  3IF6 A;  4OPR A;  4E3O A;  2H5S A;  4RYE A;  4DDY A;  4FD8 A;  4OLD A;  1K54 A;  4OOM A;  4N92 A;  1XP4 A;  3NCK A;  5EE8 A;  3OPL A;  5F83 A;  5U47 A;  3NIA A;  1BT5 A;  3PAE A;  5I94 A;  3DWZ A;  2ZQ7 A;  1KE3 A;  4PM7 A;  2G2U A;  1MBL A;  3BYD A;  4H8R A;  4OP8 A;  5FQJ A;  2CC1 A;  2I72 A;  3P98 A;  1K4E A;  1ONG A;  2Y55 A;  4S2P A;  4MLL A;  4Y0O A;  5CXW A;  5CTM A;  4EBL A;  1M6K A;  2XD1 A;  1I5Q A; 
#chains in the Genus database with same CATH topology
 1MKM A;  1Q2P A;  2J3W A;  1NXY A;  3OZH A;  1M40 A;  1KDS A;  4MCW A;  5HSQ A;  1CJF A;  3S4X A;  3QP1 A;  1HTZ A;  4NK3 A;  3B33 A;  5AVF A;  4G3W A;  1BLC A;  1S67 L;  4JF6 A;  2D02 A;  5FSR A;  4UQI S;  4Y5F A;  1K54 C;  1OJ5 A;  2ZL1 A;  3BY8 A;  1ZG6 A;  4OLG A;  3E2L A;  2ZC5 B;  4GS9 A;  4GOG A;  4WEK A;  3DW0 A;  2WKR A;  4HP4 A;  4MMN A;  3WWX A;  3ZG7 B;  1KGG A;  2EXA A;  3FZC A;  1L2S A;  5F5Y A;  3CAX A;  5CER A;  3GRJ A;  2PU4 A;  2P9V A;  4R38 A;  4HBT A;  2EFX A;  5A90 A;  4K0X A;  1GSV A;  2WUQ A;  1OTE A;  1PZO A;  4KQO A;  4EBN A;  4WZ5 A;  2HV1 A;  4PPR A;  4X55 A;  5TBM B;  4IBX A;  2EXB A;  5KSH A;  1CF0 A;  2IWB A;  4WUJ A;  3VOZ A;  3IXG A;  3TRC A;  3FG8 A;  3BW6 A;  2WKQ A;  4E3M A;  3EGX C;  2DMW A;  4P0M A;  5HAR A;  1K38 A;  3Q7Z A;  4CJN A;  3M6B A;  3VE4 A;  5M18 A;  2WKE A;  2H0Y A;  3ZG5 A;  1LL8 A;  3ZCZ A;  5JYP A;  4WMC D;  1FR6 A;  3R7W B;  4JXG A;  5EUA A;  4R0Q A;  3PXP A;  4KQR A;  4PMA A;  5TR7 A;  4LV2 A;  3T4K A;  1T1A A;  2A24 B;  2DRW A;  2V0W A;  1PI5 A;  4X6T A;  2BAS A;  3CJM A;  4LCL A;  1BLH A;  1NLY A;  1P9R A;  4NXE A;  1ZKJ A;  2RCX A;  3BJN A;  3ZGA B;  4GW9 A;  1HLU P;  3FPV A;  4Q0J A;  1PWC A;  3IWI A;  4HJ3 A;  5E2H A;  2GJ3 A;  3C4O A;  4UA6 A;  2W3G A;  3H82 A;  1FSY A;  3VFF A;  3BLM A;  1DJA A;  3A0R A;  2VA0 A;  4E04 A;  5HPF A;  4ZBE A;  3U2A A;  4KZ6 A;  3P09 A;  4JLF A;  3H7W B;  1HZO A;  3HLF A;  2V20 A;  3D3O A;  3GVB A;  1W63 M;  2WK0 A;  1LLB A;  5EVL A;  3E98 A;  5HD3 A;  5FL3 A;  1EWZ A;  2WKP A;  4NKP A;  2LB5 A;  4HQA A;  1IYO A;  3UN7 A;  5GLC A;  4JF4 A;  4P6Z M;  5HDC A;  2VK3 A;  3C4P A;  5FDS A;  4R3J A;  2XEP A;  1JWZ A;  4DRT A;  3MS6 A;  2O99 A;  5GLA A;  5CGW A;  5KSC A;  3IXH A;  3DBA A;  3EGD C;  2O0Y A;  4MDZ A;  5DFX A;  3PBT A;  2HP6 A;  1PYY A;  3KSI A;  3GR2 A;  1SDE A;  2WGV A;  4EBP A;  2Q9M A;  1ZC2 A;  2GNX A;  1IEL A;  3HLB A;  4MN7 A;  2VV6 A;  3ZVT A;  4I38 A;  1ES3 A;  4LFU A;  5IS1 A;  3UNW A;  3DTK A;  4O0P A;  4FH4 A;  4F94 A;  1GSW A;  3MSH A;  3HCY A;  2V1A A;  2PYP A;  2X01 A;  2EX2 A;  2EX8 A;  5FAS A;  2OLU A;  3OPR A;  4WBG A;  1L0G A;  1CEG A;  4UHU A;  4YWZ A;  4R3B A;  2ZLY A;  5J3W A;  5F1F A;  2P04 A;  5EVI B;  4S2N A;  5F82 A;  4HNB A;  3GV9 A;  4JGR A;  1PNE A;  1NZO A;  3PR6 A;  4HOI A;  1UWP X;  2ZC7 A;  4R1G A;  3UB8 A;  1BLP A;  2Y8H A;  2HDQ A;  4DXC A;  1ESU A;  4DDS A;  1GCE A;  3PBR A;  1F9I A;  1SKO B;  2C6W B;  3KX0 X;  1WYC A;  5F6A A;  4S2M A;  2WZZ A;  3M2K A;  3ULF A;  5EVI C;  1YQS A;  3CMZ A;  4Y15 A;  4P6B A;  3AGF A;  4BJP A;  1ZG4 A;  2V1B A;  3NI9 A;  5F69 A;  2EWW A;  3MBZ A;  1GA9 A;  4OOL A;  3S7O A;  1W5D A;  1TS6 A;  3WRT A;  1CK3 A;  2ZMA A;  4PM5 A;  3LEZ A;  3QP8 A;  3ICY A;  5CHM A;  3AGE A;  4N9L A;  3GTC A;  1ODV A;  4B4Z A;  5AQ9 A;  3FKV A;  4I3J A;  1SDN A;  4QHC A;  3S7N A;  5DF8 A;  1K55 A;  2W1T B;  3F1P A;  4MBH A;  4IUK A;  2XA7 S;  5DTK A;  4Y3I A;  1H0M A;  2M1C A;  4DE2 A;  3S1Y A;  4KZA A;  3BLS A;  2HJE A;  3D9Y A;  3LY4 A;  4GLQ A;  5HX9 A;  2PD8 A;  4FUW A;  4ZJ3 A;  3ZG9 B;  3PBN A;  4BQM A;  3E4Q A;  3B42 A;  5C5K A;  4OPQ A;  3MZE A;  4R23 A;  3T4O A;  2RL3 A;  1NRJ A;  4MNR A;  5G4Y A;  1S4S A;  3A0V A;  3KYE A;  4MN5 A;  4EUZ A;  3O87 A;  2ZC4 B;  2W0N A;  1OT6 A;  3G2Y A;  2V0U A;  1BLS A;  3JVV A;  3GEC A;  4XT2 A;  1MWT A;  5HZH A;  4EUV A;  3MZF A;  4N1H A;  2FZ0 A;  4OQI A;  5L07 A;  2AVX A;  1XPB A;  5DVA A;  2JHE A;  5A91 A;  2NUT C;  3FYZ A;  2OOL A;  2V8F A;  3ZNT A;  1MZU A;  3C2W A;  4WL9 A;  5A8B A;  4DJ2 A;  1GHI A;  3HL9 A;  4EQ1 A;  2HPB A;  4HHD A;  1I2W A;  2PYR A;  5FQ9 A;  1LI0 A;  5KIZ A;  1XX2 A;  4F3L A;  4LLO B;  2Y4A A;  3LI8 A;  1YLZ A;  3OOV A;  2QMI A;  4DMZ A;  1IYQ A;  4EQI A;  2H5S A;  4RYE A;  4OOM A;  3NCK A;  5F83 A;  4B93 A;  1BT5 A;  5FQJ A;  3BYD A;  2CC1 A;  3P98 A;  5CXW A;  4EBL A;  4MLL A;  5CTM A;  1I5Q A;  3IQA A;  1H3Q A;  3UY6 A;  1L0E A;  2QPN A;  4MN6 A;  5FEG A;  2EX6 A;  1S0W A;  2ZBB A;  3CUE C;  3U4L P;  1GA0 A;  4WEL A;  1IOU A;  4LV1 A;  3F1O A;  3BFC A;  1MPL A;  2Q0O A;  3IF6 C;  1NYY A;  5FAP A;  1K56 A;  1TDL A;  3CHW P;  1JVJ A;  3UPO A;  2FH5 A;  3H9W A;  4E3L A;  3N8R A;  2ZMF A;  4CLC A;  3E4P A;  1BUL A;  1PW8 A;  2Y2K A;  2HDU A;  5DJT A;  4HES A;  3N4I A;  2PDR A;  1TDG A;  5FEF A;  4IVK A;  1V9Y A;  4FOF A;  4JGP A;  3NOU C;  3SH8 A;  3VP3 A;  3LY3 A;  1PI4 A;  4OQG A;  3UME A;  1A0K A;  3IF5 A;  3PAG A;  2KDK A;  1AXB A;  3W8K A;  3JVU A;  5M1A A;  3TJZ C;  3WS5 A;  3G31 A;  1J9M A;  1JTD A;  2ZC6 B;  1NLZ A;  1XKZ A;  4EU0 A;  2WGW A;  1XGI A;  5A93 A;  1DRM A;  4KZ4 A;  4HH3 A;  2HGV A;  1Y28 A;  4ZAM A;  3NUL A;  1YSP A;  4OPZ A;  4WYY A;  3CLO A;  3Q82 A;  3MQ0 A;  1RGZ A;  1TS8 A;  5CEB A;  3MKE A;  3TOI A;  2PD7 A;  4GKU A;  5FI6 A;  1BZA A;  1DP9 A;  3MXR A;  3C5A A;  5GL9 A;  2M7V A;  1ERM A;  2ZD8 A;  1DP8 A;  3ZG0 A;  1YMX A;  3MR0 A;  2JKF A;  4BBT A;  4OH0 A;  3O88 A;  4XUZ A;  1PFL A;  1D06 A;  3T50 A;  4XUX A;  5AQB A;  2BTF P;  3Q1F A;  4WEJ A;  4ZTK A;  4GCZ A;  3BFE A;  4HI4 A;  1PWG A;  3S7Q A;  2JKG A;  3T4J A;  2VJW A;  3C7U A;  1KE0 A;  3A3J A;  5BOH A;  4KQD A;  2V2F F;  3LI9 A;  2Y2N A;  1LT0 A;  2KLI A;  2PU2 A;  1UGU A;  1YLP A;  2IWC A;  5EPH A;  5I5L A;  3WRZ A;  3T1X A;  1OTA A;  3PTE A;  4WMC A;  3HRE A;  5CRF A;  2W3H A;  4X69 A;  4RVA A;  3Q7V B;  3V67 A;  1ES4 A;  4GD8 A;  3ISG A;  1DY6 A;  3C38 A;  3LYX A;  4Y0T A;  2XQZ A;  5DKL A;  2QJ5 A;  3IS2 B;  3VP0 A;  5EFW A;  4XXR A;  2Y2J A;  4NEE D;  4U3T A;  2H10 A;  4GZB A;  3V50 A;  3LR0 A;  3LIE A;  4PM8 A;  4QWO A;  5DF9 A;  4E3I A;  1N4O A;  4FCF A;  4WM9 A;  1LSW A;  1EW0 A;  1N9O A;  4R3A A;  1H8M A;  3QNC A;  3SW1 A;  3T1S A;  1FR1 A;  4K08 A;  1JNU A;  4M4X A;  2ZJ9 A;  3O5Y A;  4HJ4 A;  4QJG A;  1ZHH B;  1KDW A;  5L8M A;  3DAV A;  2GDN A;  1Q2Q A;  4H6J B;  2FFF B;  1QME A;  2EA9 A;  5AQ7 A;  1SZV A;  2ZQ9 A;  3N8S A;  4IUH A;  3SS4 A;  1S1Y A;  3UO9 A;  3AGD A;  3V3S A;  2V1Z A;  2BLS A;  4LGW A;  5DTT A;  3LIC A;  1LI9 A;  1N9L A;  2VGL S;  3FKW A;  2K7S A;  5LBR A;  4EW7 A;  4HIA A;  3L7H A;  3UPP A;  3R4K A;  1U60 A;  4GD6 A;  3ZDJ A;  5HAP A;  3M6H A;  5HDD A;  1O7E A;  4HEF A;  1RCJ A;  4ZJ2 A;  4UA9 A;  3TG9 A;  3D4F A;  4IVI A;  5AQA A;  1W7F A;  4S2N C;  4LRY C;  5F1G A;  3OLO A;  1IFQ A;  4JKT A;  1PWD A;  3PBS A;  5GHX A;  1S1Z A;  4GDB A;  3RXX A;  4R4R A;  2XLN A;  3NDG A;  1W63 Q;  1QMF A;  1VB6 A;  5CHJ A;  2XSS A;  3T12 B;  3K2N A;  3NDE A;  1VQQ A;  5IT5 A;  4HBU A;  2ZMV A;  2QHK A;  4WLA A;  5HWT A;  2E8J A;  1MXO A;  2XD5 A;  3IH8 A;  2J3T C;  4BD0 A;  4IED A;  2B18 A;  2JKT I;  2HZ5 A;  4O7D A;  1ERQ A;  2WZX A;  4OKP A;  1G28 A;  4C3Q A;  2JE5 A;  5GHZ A;  5FQM A;  4OON A;  4S2J A;  1VET B;  5TBM A;  1GSX A;  4B9O A;  3O86 A;  3F1N B;  4LV3 A;  3EQU A;  1L3L A;  2R78 A;  4R70 A;  1X0O A;  1C3B A;  3RJU A;  3HLE A;  4BD1 A;  2HP5 A;  3BEC A;  3GDI A;  5FI7 A;  3HLW A;  4PM9 A;  1DJB A;  4L0L A;  4NXB A;  3CPT B;  4S2L A;  4KZB A;  4N9K A;  1YLT A;  2XFT A;  3UDX A;  1KVL A;  1Y4O A;  3R7W A;  1E3U D;  4HH2 A;  2Y2Q A;  4X68 A;  3RXW A;  1L0F A;  3PYP A;  1DJC A;  1EI5 A;  3SS3 A;  3VP1 A;  3CZD A;  1K6S A;  2A24 A;  2HP9 A;  4GHI B;  5FQK A;  2W3E A;  3HUM A;  4BWI A;  4GB7 A;  3MFD A;  4YIN A;  1BYW A;  5DF7 A;  1NJ4 A;  3BFF A;  1P97 A;  5EEC A;  2Y2G A;  3UE1 A;  1MC0 A;  2WYX A;  2A49 A;  4I3A A;  4N92 A;  3OPL A;  4G3K A;  4Y2F A;  1XJ3 A;  3DWZ A;  4DN0 A;  1ONG A;  4S2P A;  4Y0O A;  3NHQ A;  4Z1W A;  4L9F A;  3A0S A;  3BWL A;  4ESP A;  5FA7 A;  3ZVW A;  3JPU A;  1MY8 A;  1TD5 A;  1E4D A;  3H7W A;  4LPZ A;  4LV0 A;  1YT4 A;  4CLC E;  4FSF A;  1FSW A;  5KZH A;  4I39 A;  4R6L A;  1S4R A;  5FQI A;  3KSF A;  5J7E A;  4UQI M;  2GZA A;  2OLV A;  3LUQ A;  2OWH A;  3IT9 A;  2ZC3 B;  3LID A;  3VMA A;  1KVM A;  4IBR A;  2ZM0 A;  4B4X A;  1XFQ A;  1OPX A;  1H5X A;  4ETZ A;  3G4P A;  2B5R A;  5GLD A;  3E0Y A;  3QP4 A;  4RX3 A;  2VZW A;  1TEM A;  2OWJ A;  4DF6 A;  2JKR I;  4ME4 A;  3LFV A;  2WAE A;  5G4Z A;  3MKF A;  2B02 A;  3NEC A;  4KZ7 A;  2JN7 A;  4M3K A;  3UDI A;  3MFX A;  3UE0 A;  2J3T D;  4NG2 A;  5KMW A;  4EEU A;  3HLC A;  1BSG A;  3QP2 A;  4MBF A;  3SS5 A;  1KGE A;  4QY6 A;  1K25 A;  2E8I A;  5HL6 A;  3OCN A;  4CQH A;  2L1M A;  2OSU A;  1WA9 A;  4S2O A;  3KYQ A;  3OPH A;  4CPK A;  3CI6 A;  5GHY A;  5HWV A;  4C75 A;  5A92 A;  1G5U A;  1T1C A;  4RA7 A;  4X56 A;  1XXM A;  3HUO A;  1L0D A;  3SH7 A;  2PRF A;  3S7P A;  4CLC C;  4MEZ A;  5CED A;  3C8C A;  1I2S A;  5DJU A;  4E3J A;  2EX9 A;  4Y0U A;  3HJK A;  3DTM A;  2ZOH A;  3A3D A;  5EVI A;  3Q81 A;  1LSX A;  4YNR A;  3A3I A;  2L0W A;  3VOL A;  4X53 A;  1S6R A;  2W3F A;  3KYZ A;  3CG5 A;  1YMS A;  5DTS A;  5J8X A;  3QP6 A;  3E4O A;  3QHY A;  2VGL M;  1CI8 A;  4ZDX A;  3HUN A;  3IF6 B;  1SKO A;  4BEN A;  1VEU B;  5L09 A;  1W8Q A;  3IWO A;  2JKT M;  2VGJ A;  5HFO A;  4EER A;  2MJ6 A;  2QWS A;  5EVI D;  3DTE A;  3LIB A;  1YAX A;  4YOF A;  1G6O A;  2Q9N A;  1P0Z A;  1F2K A;  1XJ4 A;  2ZQC A;  4ARZ A;  1NY0 A;  2PR5 A;  2KX6 A;  4QPR A;  2XK1 A;  3VOY A;  4Q8I A;  1N9B A;  5F68 A;  4Y7P A;  2QJ7 A;  2WAD A;  4EET B;  4JF5 A;  2JC7 A;  2ZQD A;  2ZL1 B;  4NXF A;  2W1T A;  4PHT A;  4BMW A;  2X02 A;  4P6Z S;  4GS9 B;  2JCH A;  5E43 A;  1MKI A;  1TF1 A;  2Y59 A;  5CEC A;  2P9V B;  3CIT A;  4X25 A;  1TS0 A;  4DXB A;  4U0X A;  1J3W A;  3ZNY A;  2IWD A;  1NRF A;  2Y79 A;  1LHY A;  1Y54 A;  4WN5 A;  4A5R A;  2CMN A;  2P7J A;  5GLB A;  4OVD A;  1ALQ A;  3PHY A;  3EEH A;  1ERO A;  4N1X A;  3V3R A;  2JBF A;  2Z2M B;  1NZU A;  3SOI A;  4KQQ A;  2WAF A;  3WS0 A;  1K57 A;  1OJG A;  2P08 A;  4L9E A;  2LB9 A;  4WZ5 C;  2DCF A;  1BTL A;  4KEN B;  1RP5 A;  3MQQ A;  3VSK A;  1T18 A;  3PBO A;  4KUK A;  3MXS A;  2Z6C A;  5L2F A;  3KO6 A;  1SKF A;  3WS2 A;  3ZQ5 A;  1NWZ A;  2OV5 A;  3NC8 A;  3N8L A;  2W27 A;  4HY8 A;  4OP5 A;  2PT7 A;  2QZ6 A;  3E2K A;  5TGF A;  1YKD A;  2DNS A;  2A2L A;  3TE8 A;  3LGO A;  4HP9 A;  3EEA A;  5CHU A;  3VSL A;  2H0T A;  4JXW A;  1TVF A;  4ID4 A;  2Y2I A;  3H82 B;  4RX2 A;  5AVE A;  2JKR M;  1ACF A;  2J80 A;  2G7U A;  4WZ4 A;  2UWX A;  3EWK A;  1IYS A;  4KZ5 A;  4BL3 A;  3BFG A;  1MWR A;  3V5M A;  1FCO A;  4MBK A;  2J9P A;  2PBY A;  3UB9 A;  3BM6 A;  3VFH A;  3A3E A;  5E2G A;  5HW3 A;  2XA7 M;  4WF0 A;  5M19 A;  1O07 A;  5HDS A;  4P85 A;  4I3I A;  4NXG A;  2WKH A;  3ZG8 B;  2K31 A;  4BBU A;  3LEQ A;  5FQQ A;  2HJ9 C;  4OQ0 A;  3ZHH A;  4EXO A;  4X1M A;  2XH9 A;  4U0T A;  2ZQ8 A;  2KOI A;  4DE1 A;  4E3N A;  5EM0 A;  4IHQ A;  5CGS A;  2XR0 A;  4Z9Q A;  5K5B A;  4EEP A;  4BL2 A;  4QY5 A;  1JTG A;  1HD8 A;  5HL1 A;  1VHM A;  1DP6 A;  3TSG A;  3Q07 A;  2HDS A;  3T4S A;  5J4E A;  4OP8 A;  3LR5 A;  4GN2 A;  3IXB A;  1FOF A;  2P74 A;  5TJJ A;  4ETX A;  3IX8 A;  1ESI A;  2K2N A;  3LIA A;  3W4Q A;  3TW8 A;  3B47 A;  3L9K A;  4EV4 A;  4JGO A;  2R9W A;  3HBR A;  4YFM A;  3LIF A;  3DWK A;  4O8G A;  1UWN X;  1FCN A;  1LL5 A;  4AFI A;  2M7U A;  3DTI A;  3VP2 A;  2R9X A;  3T4Q A;  1NYM A;  3BQA A;  1F5M A;  4HJ6 A;  3GSG A;  1XJ6 A;  2Y2P A;  1E25 A;  3M2J A;  1TS7 A;  1MWU A;  4OPR A;  4E3O A;  4DDY A;  4OLD A;  1K54 A;  2EWV A;  2O9B A;  5EE8 A;  4Q0H A;  1XFN A;  2VV7 A;  3PAE A;  1KE3 A;  1OTD A;  4PM7 A;  2G2U A;  3LR3 A;  2I72 A;  2YKH A;  3K3D A;  2OAQ 1;  1M6K A;  3OC2 A;  3ZFZ A;  1PRQ A;  1K6R A;  3NOP C;  4D2O A;  1Z6F A;  1YLY A;  2YKF A;  4S2K A;  5HAQ A;  4Q0I A;  1XA1 A;  1YLJ A;  1XGJ A;  5EOO A;  2FFY A;  3T4T A;  3LO7 A;  1XJ2 A;  3F1P B;  4IJG A;  5CGX A;  2WGI A;  1V9Z A;  4GNU A;  1W8Y A;  2XRN A;  2VX8 A;  3MZD A;  1HVB A;  4B88 A;  1E3U A;  5EVE A;  3FWL A;  1H8Y A;  4DE3 A;  3G32 A;  3Q7V A;  3BQ8 A;  1XA7 A;  4JPM A;  2PHY A;  1W79 A;  4JXS A;  3GMW A;  3KSH A;  2V9A A;  3IS2 A;  5L10 A;  1CQA A;  1K55 C;  4EES A;  2PR6 A;  5E2E A;  4II7 A;  4L9G A;  2XF3 A;  3P01 A;  2Z6D A;  2V8C A;  2QKP A;  4PKY G;  5MC7 A;  2VGK A;  2OAP 1;  1YLW A;  3MF0 A;  2W1R A;  5FI2 A;  4XT2 B;  3IX4 A;  1JWP A;  1MWS A;  4KUO A;  4P87 A;  2PAV P;  1KE4 A;  4LRZ E;  3SZT A;  2ZM8 A;  3IHB A;  3ITB A;  4Y13 A;  4X1L A;  1G6A A;  2PBD P;  2VKS A;  3OCL A;  4H6J A;  2NUP C;  3W4O A;  3N7W A;  3UB7 A;  4F3L B;  3WS1 A;  3HJI A;  2UV0 E;  4I5S A;  3RFB A;  4O01 A;  5DFY A;  4BLM A;  3IH9 A;  3IX3 A;  1OME A;  5HAI A;  5IHV A;  2VEA A;  1K0K A;  4OPY A;  2VV8 A;  2W3D A;  4R4S A;  3G2Z A;  3IWQ A;  1OTB A;  3VE3 A;  2GX5 A;  4KZ3 A;  3EQV A;  3BRM A;  3W2Z A;  2XDM A;  4C6Y A;  4LEN A;  5DKK A;  3S22 A;  4ARZ B;  3F1O B;  1PZP A;  2Y2L A;  2Y2M A;  3LR4 A;  1YPR A;  1FCM A;  3G30 A;  3W4P A;  2J7V A;  4QB8 A;  1WE4 A;  1P9W A;  2XRO A;  5FAQ A;  1AWI A;  1ONH A;  2J8Y A;  4S2I A;  1SHV A;  4CLC B;  4ZRR A;  1FIK A;  1WYB A;  2XGN A;  5FAO A;  3MXQ A;  5IU1 A;  1ZTU A;  1GHM A;  1OT9 A;  1RGY A;  2WKI A;  4ZJ1 A;  3ITA A;  1VET A;  4G3V A;  1GHP A;  4KZ9 A;  2Y2H A;  3F1N A;  5HPI A;  4BBV A;  3I7J A;  4DKI A;  3A3F A;  3CWF A;  2ZQA A;  4JBF A;  3BFD A;  2O9C A;  3T4L A;  3CPT A;  1JWV A;  4GJ4 A;  4E3K A;  4KG5 A;  3G6O A;  3MMH A;  3HLG A;  3QP5 A;  3HVF A;  3NBL A;  1T1B A;  3IHA A;  1CI9 A;  3FC7 A;  3N6I A;  2INW A;  2G2W A;  5EOE A;  1ES2 A;  2WGW B;  2QYB A;  3K3C A;  4Y17 A;  3O3V A;  5TFQ A;  4FTX A;  4JGQ A;  1CEF A;  4GHI A;  3T1R A;  1PW1 A;  3NOT C;  3JYI A;  3VP4 A;  2Y2O A;  5EM1 A;  1N9N A;  3C30 A;  3D72 A;  3KSG A;  4OOY A;  1K4F A;  1KOU A;  2ACG A;  1SCW A;  3OPP A;  3G34 A;  1K57 C;  4KG2 A;  1T19 A;  1IKI A;  4RQ9 A;  3UB5 P;  1IEM A;  4UAA A;  1IKG A;  3RTY A;  1LSV A;  2ZOI A;  3QNB A;  2HDR A;  3V39 A;  3UE6 A;  3C7V A;  4JXV A;  1LL9 A;  2Y91 A;  4PAU A;  5AJG A;  3G35 A;  4PKY A;  3LCE A;  2EFU A;  1YM1 A;  4PM6 A;  5D3O A;  3HLD A;  4UEY A;  3BEB A;  4KG6 A;  1Z09 A;  3UPN A;  2B95 A;  3IBR A;  3GQZ A;  1F98 A;  1IYP A;  1D1J A;  3MQO A;  4NET A;  3WS4 A;  3PBQ A;  4UA7 A;  2Z2L B;  1S66 L;  4GDN A;  4KZ8 A;  2H28 A;  4K91 A;  3NJA A;  1KGF A;  3VV4 A;  3NY4 A;  4QD4 A;  3ZYT A;  1STZ A;  5E2F A;  3BY9 A;  5HD5 A;  1ES5 A;  2BG1 A;  3IXD A;  5HWW A;  2L4R A;  3OBF A;  5FAT A;  2ZM2 A;  5CTN A;  2X71 A;  3FV7 A;  1BUE A;  4EWF A;  2O9A A;  5EV0 A;  5FDH A;  2A3U A;  4D60 A;  5JYO A;  4QU3 A;  1FQG A;  4LCM A;  1K56 D;  2D01 A;  4DE0 A;  3UDF A;  2C5W B;  1H8Z A;  2I9V A;  1D7E A;  4K0W A;  4FH2 A;  3UB6 A;  4CLC D;  3EOI A;  4E6W A;  3UE3 A;  3T1Q B;  4DJ3 A;  1YSQ A;  4OQH A;  3B3X A;  2J9O A;  3MJQ A;  1PIO A;  3RH8 B;  4E6X A;  5CX7 A;  3FPW A;  3CUE A;  5G18 A;  3UMD A;  3IBJ A;  4LRX C;  3SH9 A;  1VM1 A;  1G68 A;  2XFS A;  2IA2 A;  2VLG A;  3IF6 A;  1OTI A;  4FD8 A;  1VEU A;  1XP4 A;  2HF6 A;  1FIL A;  5U47 A;  3NIA A;  5I94 A;  2ZQ7 A;  1MBL A;  4H8R A;  3P7N A;  1K4E A;  2Y55 A;  2XD1 A; 
#chains in the Genus database with same CATH homology
 3OC2 A;  1Q2P A;  3ZFZ A;  3IQA A;  5FA7 A;  3ZVW A;  3UY6 A;  1L0E A;  1MY8 A;  2QPN A;  1NXY A;  1E4D A;  3OZH A;  1K6R A;  4D2O A;  1Z6F A;  2EX6 A;  4LV0 A;  1S0W A;  1M40 A;  1YT4 A;  1KDS A;  1GA0 A;  1YLY A;  4FSF A;  1FSW A;  4S2K A;  3S4X A;  4WEL A;  5KZH A;  5HAQ A;  5FQI A;  1HTZ A;  4LV1 A;  1XA1 A;  4NK3 A;  1BLC A;  3BFC A;  1YLJ A;  2OLV A;  1MPL A;  4JF6 A;  3IT9 A;  2ZC3 B;  5FSR A;  3IF6 C;  1XGJ A;  5EOO A;  2FFY A;  1K54 C;  1NYY A;  3LO7 A;  5FAP A;  1ZG6 A;  3VMA A;  1KVM A;  4OLG A;  3E2L A;  4IBR A;  2ZC5 B;  2ZM0 A;  4B4X A;  4GOG A;  1H5X A;  5CGX A;  2WGI A;  1K56 A;  4WEK A;  3DW0 A;  1TDL A;  1JVJ A;  3UPO A;  3WWX A;  4GNU A;  3ZG7 B;  1KGG A;  2EXA A;  1W8Y A;  3FZC A;  1L2S A;  3G4P A;  2B5R A;  3MZD A;  1HVB A;  4B88 A;  5GLD A;  1E3U A;  5CER A;  3GRJ A;  3N8R A;  4E3L A;  3FWL A;  2PU4 A;  2P9V A;  1H8Y A;  4DE3 A;  4HBT A;  1BUL A;  1PW8 A;  2EFX A;  4RX3 A;  5A90 A;  2Y2K A;  3G32 A;  2HDU A;  4K0X A;  1TEM A;  2WUQ A;  3Q7V A;  4DF6 A;  1XA7 A;  1PZO A;  4KQO A;  2WAE A;  4JPM A;  4EBN A;  1W79 A;  3MKF A;  4HES A;  4JXS A;  4KZ7 A;  4PPR A;  4M3K A;  4WZ5 A;  3GMW A;  4X55 A;  3UDI A;  3UE0 A;  3N4I A;  4IBX A;  2EXB A;  1K55 C;  5KMW A;  5KSH A;  2IWB A;  3HLC A;  1BSG A;  4MBF A;  5E2E A;  1TDG A;  3VOZ A;  3IXG A;  4IVK A;  1KGE A;  4QY6 A;  3SS5 A;  1K25 A;  2XF3 A;  2E8I A;  3SH8 A;  3VP3 A;  3LY3 A;  1PI4 A;  3OCN A;  4OQG A;  4E3M A;  2OSU A;  4P0M A;  4S2O A;  5HAR A;  3IF5 A;  1K38 A;  3OPH A;  4CPK A;  3PAG A;  5GHY A;  3Q7Z A;  4C75 A;  5A92 A;  4CJN A;  3M6B A;  1AXB A;  3W8K A;  5M1A A;  2VGK A;  1YLW A;  5M18 A;  2WKE A;  4RA7 A;  3WS5 A;  5FI2 A;  4X56 A;  1XXM A;  3HUO A;  2H0Y A;  1J9M A;  3G31 A;  1L0D A;  3SH7 A;  1JTD A;  2ZC6 B;  3ZG5 A;  1JWP A;  1XKZ A;  1MWS A;  3ZCZ A;  5JYP A;  4WMC D;  1FR6 A;  2WGW A;  1XGI A;  5A93 A;  4MEZ A;  5CED A;  4P87 A;  1KE4 A;  1I2S A;  4JXG A;  5EUA A;  4KZ4 A;  2ZM8 A;  3IHB A;  3ITB A;  4R0Q A;  4E3J A;  4KQR A;  4PMA A;  2EX9 A;  4LV2 A;  4Y0U A;  5TR7 A;  1G6A A;  3DTM A;  2DRW A;  3OCL A;  3A3D A;  4ZAM A;  4WYY A;  4OPZ A;  5EVI A;  3Q81 A;  1PI5 A;  3Q82 A;  3A3I A;  3W4O A;  4X53 A;  4X6T A;  3N7W A;  1S6R A;  3CG5 A;  1YMS A;  1RGZ A;  3CJM A;  4LCL A;  5DTS A;  5J8X A;  1BLH A;  3WS1 A;  5CEB A;  1ZKJ A;  3MKE A;  2RCX A;  3TOI A;  3ZGA B;  3QHY A;  1CI8 A;  4ZDX A;  4GKU A;  5FI6 A;  3HUN A;  1PWC A;  3IF6 B;  3IWI A;  1BZA A;  4BEN A;  3MXR A;  3C5A A;  4BLM A;  3IH9 A;  5GL9 A;  1OME A;  5HAI A;  1W8Q A;  5E2H A;  5IHV A;  3IWO A;  1ERM A;  5HAP A;  3C4O A;  4UA6 A;  2ZD8 A;  3ZG0 A;  1FSY A;  1YMX A;  2VGJ A;  4OPY A;  3VFF A;  3BLM A;  1DJA A;  5HFO A;  4R4S A;  3G2Z A;  5EVI D;  3IWQ A;  4OH0 A;  4ZBE A;  3O88 A;  4XUZ A;  4KZ6 A;  3P09 A;  4XUX A;  5AQB A;  4JLF A;  2Q9N A;  1HZO A;  3HLF A;  2V20 A;  3Q1F A;  4KZ3 A;  2ZQC A;  3EQV A;  4WEJ A;  3BRM A;  3GVB A;  2XDM A;  1NY0 A;  4C6Y A;  4ZTK A;  3BFE A;  4LEN A;  2WK0 A;  1PWG A;  3S22 A;  1LLB A;  2XK1 A;  5EVL A;  3VOY A;  4Q8I A;  3C7U A;  1N9B A;  1KE0 A;  3A3J A;  5BOH A;  4Y7P A;  1PZP A;  2Y2L A;  1EWZ A;  2V2F F;  1IYO A;  2Y2M A;  2WAD A;  4QU3 A;  4JF5 A;  3UN7 A;  2JC7 A;  4JF4 A;  1FCM A;  2Y2N A;  5GLC A;  3G30 A;  2ZQD A;  3W4P A;  2PU2 A;  3C4P A;  2J7V A;  4QB8 A;  1WE4 A;  1YLP A;  2IWC A;  2X02 A;  5FAQ A;  4R3J A;  5EPH A;  2JCH A;  2XEP A;  1JWZ A;  4DRT A;  5E43 A;  1ONH A;  3WRZ A;  1MKI A;  5GLA A;  3PTE A;  2J8Y A;  4S2I A;  4WMC A;  5CGW A;  1SHV A;  3IXH A;  5KSC A;  2Y59 A;  5CEC A;  2P9V B;  3HRE A;  3PBT A;  5CRF A;  1WYB A;  2HP6 A;  4X69 A;  2XGN A;  4RVA A;  1PYY A;  5FAO A;  3GR2 A;  3Q7V B;  1SDE A;  1ES4 A;  2WGV A;  4GD8 A;  3ISG A;  1GHM A;  1DY6 A;  4DXB A;  4EBP A;  1RGY A;  2WKI A;  4U0X A;  4ZJ1 A;  4Y0T A;  3ITA A;  2Q9M A;  2XQZ A;  1ZC2 A;  1GHP A;  4KZ9 A;  2Y2H A;  1IEL A;  3HLB A;  3VP0 A;  3ZNY A;  4XXR A;  2Y2J A;  4U3T A;  2IWD A;  1NRF A;  2H10 A;  4GZB A;  1LHY A;  1Y54 A;  3V50 A;  4A5R A;  3ZVT A;  5GLB A;  1ES3 A;  4OVD A;  4PM8 A;  3I7J A;  4DKI A;  3A3F A;  5DF9 A;  4E3I A;  1N4O A;  3UNW A;  4FCF A;  1ALQ A;  2ZQA A;  4FH4 A;  4JBF A;  4WM9 A;  4F94 A;  3BFD A;  1ERO A;  4N1X A;  3V3R A;  2JBF A;  2Z2M B;  1NZU A;  3SOI A;  1JWV A;  4KQQ A;  4E3K A;  4KG5 A;  2WAF A;  3HLG A;  3HVF A;  3WS0 A;  3QNC A;  3NBL A;  1K57 A;  3IHA A;  1CI9 A;  4WZ5 C;  2EX2 A;  2X01 A;  3N6I A;  1FR1 A;  2G2W A;  5EOE A;  1ES2 A;  1BTL A;  2DCF A;  2WGW B;  4KEN B;  1RP5 A;  2EX8 A;  5TFQ A;  3O3V A;  2ZJ9 A;  5FAS A;  1CEF A;  2OLU A;  3VSK A;  3OPR A;  3PBO A;  4WBG A;  1L0G A;  4QJG A;  1CEG A;  4UHU A;  1PW1 A;  1KDW A;  3MXS A;  4R3B A;  2GDN A;  2ZLY A;  5L2F A;  5F1F A;  1Q2Q A;  4S2N A;  5EVI B;  2FFF B;  3JYI A;  5F82 A;  3VP4 A;  1QME A;  1SKF A;  2Y2O A;  5AQ7 A;  3WS2 A;  3GV9 A;  2ZQ9 A;  3N8S A;  2OV5 A;  3NC8 A;  3N8L A;  3SS4 A;  3UO9 A;  3AGD A;  3V3S A;  1NZO A;  2V1Z A;  2BLS A;  2ZC7 A;  5DTT A;  4OP5 A;  2QZ6 A;  3E2K A;  1LI9 A;  4R1G A;  1BLP A;  4OOY A;  1K4F A;  3FKW A;  5TGF A;  2DNS A;  1SCW A;  3OPP A;  3G34 A;  5CHU A;  2HDQ A;  1K57 C;  4DXC A;  1ESU A;  4KG2 A;  3VSL A;  4DDS A;  1GCE A;  3PBR A;  1IKI A;  2H0T A;  2C6W B;  1IEM A;  4UAA A;  1IKG A;  4JXW A;  1TVF A;  1WYC A;  3UPP A;  4S2M A;  2WZZ A;  1U60 A;  3M2K A;  4GD6 A;  4ID4 A;  2Y2I A;  5EVI C;  1YQS A;  3CMZ A;  4RX2 A;  3ZDJ A;  3QNB A;  3M6H A;  4P6B A;  1O7E A;  2HDR A;  3AGF A;  3V39 A;  4BJP A;  4HEF A;  1RCJ A;  1ZG4 A;  4ZJ2 A;  4UA9 A;  3TG9 A;  3C7V A;  3D4F A;  4IVI A;  5AQA A;  3NI9 A;  4JXV A;  1W7F A;  1LL9 A;  2Y91 A;  4S2N C;  5F1G A;  4JKT A;  1PWD A;  4WZ4 A;  3PBS A;  3G35 A;  3MBZ A;  5GHX A;  3LCE A;  1GA9 A;  2UWX A;  2EFU A;  1YM1 A;  4OOL A;  4PM6 A;  5D3O A;  1W5D A;  3HLD A;  3BEB A;  1IYS A;  4GDB A;  4KZ5 A;  3RXX A;  4KG6 A;  3WRT A;  1CK3 A;  2ZMA A;  4R4R A;  3UPN A;  4PM5 A;  3LEZ A;  4BL3 A;  3BFG A;  5CHM A;  3AGE A;  1MWR A;  3GQZ A;  1FCO A;  3GTC A;  4MBK A;  1IYP A;  2XLN A;  4N9L A;  3V5M A;  2J9P A;  5AQ9 A;  3FKV A;  4B4Z A;  3NDG A;  2PBY A;  4NET A;  3WS4 A;  1SDN A;  4QHC A;  3PBQ A;  5DF8 A;  1K55 A;  1QMF A;  5CHJ A;  4UA7 A;  3BM6 A;  3VFH A;  3A3E A;  5E2G A;  2Z2L B;  5HW3 A;  3NDE A;  1VQQ A;  4MBH A;  4GDN A;  4KZ8 A;  5M19 A;  4HBU A;  1O07 A;  4P85 A;  4K91 A;  1MXO A;  2XD5 A;  5DTK A;  2WKH A;  1KGF A;  4DE2 A;  3ZG8 B;  3IH8 A;  3S1Y A;  3NY4 A;  4KZA A;  4QD4 A;  4BD0 A;  4IED A;  5E2F A;  3BLS A;  3LY4 A;  5FQQ A;  4O7D A;  1ERQ A;  2WZX A;  4OKP A;  5HX9 A;  4OQ0 A;  4ZJ3 A;  3ZHH A;  2XH9 A;  1ES5 A;  4C3Q A;  2BG1 A;  2JE5 A;  3IXD A;  5GHZ A;  3ZG9 B;  5FQM A;  3PBN A;  4OON A;  4U0T A;  2ZQ8 A;  4S2J A;  4DE1 A;  4BQM A;  5FAT A;  4E3N A;  2ZM2 A;  5CTN A;  3O86 A;  5CGS A;  2X71 A;  2XR0 A;  4OPQ A;  3MZE A;  4LV3 A;  4Z9Q A;  3EQU A;  3FV7 A;  1BUE A;  4BL2 A;  4R23 A;  1C3B A;  2RL3 A;  4QY5 A;  1JTG A;  1HD8 A;  4MNR A;  3RJU A;  3HLE A;  4BD1 A;  4EWF A;  2HP5 A;  5HL1 A;  3BEC A;  5FI7 A;  5FDH A;  3HLW A;  3TSG A;  3Q07 A;  4PM9 A;  1DJB A;  4L0L A;  4EUZ A;  2A3U A;  2HDS A;  5JYO A;  3O87 A;  4S2L A;  1FQG A;  2ZC4 B;  3G2Y A;  4GN2 A;  4LCM A;  1BLS A;  3IXB A;  1K56 D;  1FOF A;  2P74 A;  4KZB A;  4DE0 A;  3UDF A;  2C5W B;  4N9K A;  1H8Z A;  1YLT A;  1MWT A;  2XFT A;  3MZF A;  4N1H A;  3UDX A;  4OQI A;  1KVL A;  4K0W A;  1ESI A;  1E3U D;  1XPB A;  4FH2 A;  5DVA A;  2Y2Q A;  4X68 A;  3RXW A;  5A91 A;  3W4Q A;  1L0F A;  3FYZ A;  4E6W A;  3UE3 A;  1DJC A;  4EV4 A;  1EI5 A;  2R9W A;  3SS3 A;  3VP1 A;  4OQH A;  3CZD A;  3HBR A;  3ZNT A;  1K6S A;  4YFM A;  2HP9 A;  5FQK A;  3HUM A;  3B3X A;  2J9O A;  3DWK A;  1GHI A;  3HL9 A;  1PIO A;  4GB7 A;  2HPB A;  1FCN A;  1I2W A;  3MFD A;  4YIN A;  5FQ9 A;  1LI0 A;  1LL5 A;  4E6X A;  5DF7 A;  1XX2 A;  3VP2 A;  1NJ4 A;  5G18 A;  2R9X A;  1NYM A;  3BFF A;  2Y4A A;  1YLZ A;  3SH9 A;  5EEC A;  1VM1 A;  1G68 A;  2Y2G A;  3UE1 A;  3GSG A;  2Y2P A;  1E25 A;  2WYX A;  3M2J A;  2QMI A;  2XFS A;  1IYQ A;  4EQI A;  1MWU A;  2A49 A;  3IF6 A;  4OPR A;  4E3O A;  2H5S A;  4RYE A;  4DDY A;  4FD8 A;  4OLD A;  1K54 A;  4OOM A;  4N92 A;  1XP4 A;  3NCK A;  5EE8 A;  3OPL A;  5F83 A;  5U47 A;  3NIA A;  1BT5 A;  3PAE A;  5I94 A;  3DWZ A;  2ZQ7 A;  1KE3 A;  4PM7 A;  2G2U A;  1MBL A;  3BYD A;  4H8R A;  4OP8 A;  5FQJ A;  2CC1 A;  2I72 A;  3P98 A;  1K4E A;  1ONG A;  2Y55 A;  4S2P A;  4MLL A;  4Y0O A;  5CXW A;  5CTM A;  4EBL A;  1M6K A;  2XD1 A;  1I5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...