1W7FA

Crystal structure of the class a beta-lactamase bs3 inhibited with isocitrate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
255
structure length
255
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVTYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNTAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALATSLQAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPEGWEVADKTGAGSYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVVKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Class a Beta-Lactamase Bs3 Bs3 Inhibited with Isocitrate
rcsb
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 87
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1w7fA00
3GQZA 3IWIA 1XP4A 3E2KA 1ES4A 1G6AA 5HAQA 3N7WA 1MWUA 3OCNA 1IEMA 1YLJA 3PTEA 3ZG7B 5AQAA 4X6TA 4Y0OA 5CHMA 1N9BA 2Q9NA 3AGDA 2DRWA 3B3XA 4WZ5A 1MPLA 4BL2A 1NYYA 2V2FF 2GDNA 2PBYA 4L0LA 4FSFA 3CG5A 5CTNA 1GHMA 2FFFB 3ZVTA 1YMXA 1FSYA 4JXGA 2ZD8A 1PWGA 1K6SA 2HDRA 1KVLA 3C4PA 4Q8IA 1E25A 3O87A 2ZM8A 2R9WA 5GLAA 2Y2MA 2Z2LB 3D4FA 3N8LA 2QZ6A 3UY6A 3OPPA 2A49A 3ISGA 2WADA 4N1XA 5GHZA 4JF5A 3M2KA 3LCEA 3A3FA 1XXMA 5J8XA 4DDYA 1YM1A 4S2IA 3PBRA 1FCNA 4MBFA 4GZBA 4EWFA 1PI4A 1JTDA 3G4PA 1Q2QA 1XX2A 1RP5A 3HLDA 4HBUA 2G2WA 3MZDA 2HDUA 2EXAA 2JC7A 3VOZA 3PAGA 3WRZA 2BLSA 4UAAA 3V5MA 4OPZA 5D3OA 3WWXA 3G2ZA 5GL9A 3CZDA 3IF5A 2HPBA 3W4OA 4Y0TA 3SH7A 4QY5A 3DW0A 1ES5A 1JVJA 1YLYA 1FSWA 1Q2PA 1NZUA 1U60A 1BLCA 1JWZA 2WKEA 1YLPA 3FZCA 2Z2MB 2ZC7A 2XQZA 4OLGA 4UA7A 3IWOA 3RJUA 1AXBA 5BOHA 3IT9A 5CHUA 4OQ0A 3A3DA 3AGFA 1K54C 4OONA 4UHUA 2XK1A 5F1GA 1EI5A 4MBKA 4U3TA 2H10A 4KQQA 3VP0A 2EFUA 2Y55A 3IH9A 4RX2A 3LY4A 3Q81A 3IWQA 4K0WA 4WEJA 1PIOA 5IHVA 4GD6A 2XD1A 2C5WB 2ZC4B 1LHYA 3BFFA 5EVIC 1EWZA 3WS4A 4WEKA 5CGXA 1Z6FA 3IXGA 4QD4A 4HESA 4E6WA 3BFEA 1IKIA 3G31A 3C7VA 4N1HA 2PU4A 3IXHA 2I72A 1YMSA 3MFDA 5EE8A 1K4EA 3SH9A 3LO7A 1K4FA 3HVFA 1XKZA 3BFGA 4QY6A 3ZG9B 1LL5A 3C7UA 1ES3A 1NJ4A 4B88A 3G34A 3UNWA 3Q82A 1BUEA 1W5DA 1L0EA 3FYZA 4UA9A 3E2LA 4KZBA 5F83A 3DTMA 5EOEA 4CJNA 2ZQAA 1KE0A 1KE4A 3GR2A 1LI9A 4GN2A 1BLHA 3ITAA 5GHYA 3M6BA 4EV4A 3S1YA 1ERQA 2IWCA 3ZG0A 4E3JA 5HFOA 1O7EA 1M6KA 4KQOA 3W4QA 4H8RA 5KSHA 4E3IA 3SS5A 1KGFA 3ZG8B 2C6WB 4A5RA 4JF4A 1CI9A 4HBTA 4GOGA 5FI2A 1NYMA 3VSLA 2WKIA 1K6RA 4K91A 2Y2GA 4KZ7A 5EVIB 3UDXA 5A90A 1ZG4A 3UDFA 1MXOA 5A92A 3QNBA 3N8RA 1K56A 4WYYA 2J9OA 3O88A 1M40A 1YLZA 3UPNA 3C5AA 1XGIA 2WGWA 1KDWA 1JTGA 3AGEA 3N8SA 3BFDA 1XA1A 3UE0A 2Y91A 1TDGA 1N4OA 2WAEA 4KZ3A 4MBHA 3HLGA 5FQKA 4S2NC 5FAOA 1ZG6A 3ZHHA 4X56A 2ZQDA 1I2SA 4R0QA 1PZOA 3WS5A 3IQAA 4DE2A 4U0XA 5FQJA 3VSKA 4WELA 1GA9A 2XGNA 1BSGA 3WS2A 2XFSA 1O07A 3V39A 1ESIA 4JF6A 4WZ5C 3FKVA 3MKFA 1QMFA 4B4ZA 4D2OA 1HZOA 3WS1A 4DKIA 4R3JA 5FI7A 5A93A 2IWBA 4BENA 2EFXA 3G32A 5EOOA 2ZQCA 3PAEA 4B4XA 4M3KA 3VP1A 3FWLA 1HTZA 1H8YA 5JYOA 4S2MA 5AQ7A 4MEZA 3W4PA 5FATA 4R3BA 4KZAA 4R4SA 4X53A 1K25A 2VGKA 4E3LA 1IKGA 4KG6A 2WZXA 5EVIA 2XD5A 4E6XA 4R4RA 1ZC2A 1DY6A 5DTKA 2IWDA 5CECA 1E3UA 5CEDA 3EQUA 3PBQA 4OOYA 4X69A 5CXWA 5TR7A 4K0XA 3FV7A 2A3UA 5FQ9A 3OZHA 4RA7A 1FR1A 1S6RA 4IBRA 2V20A 5FSRA 2J7VA 4DRTA 3SOIA 3VP3A 5GLCA 4X55A 2X02A 4FH2A 3VP2A 3PBOA 5E2EA 1NRFA 3ZNYA 4JLFA 4C75A 1IELA 3VMAA 2PU2A 4BJPA 3G2YA 4EBLA 4HEFA 2ZQ8A 4GNUA 1Y54A 1JWPA 4P6BA 5E43A 1W8QA 3O86A 3HLWA 5GHXA 4C3QA 4DE3A 3PBTA 3NIAA 1H8ZA 4E3MA 1S0WA 5CGSA 5DTSA 4KZ5A 4XUXA 4OQIA 2H0TA 2ZJ9A 2OV5A 1IYSA 1PZPA 4OPYA 3CMZA 5AQBA 2WZZA 5FAPA 4R23A 3NI9A 4LCMA 4EBPA 4E3NA 4IVKA 1E3UD 4ZAMA 2Y59A 3TSGA 2V1ZA 4NETA 4Y7PA 4E3OA 1XGJA 4ZDXA 4U0TA 3N6IA 3NC8A 3OPLA 1YT4A 4JKTA 5I94A 1KVMA 3HLBA 3ZFZA 3HUNA 4RYEA 4DXCA 4GDBA 4QU3A 4ZTKA 4PPRA 1H5XA 3ZCZA 1SKFA 2Q9MA 3HLCA 4R1GA 1K54A 4XXRA 3TG9A 4DE0A 3GTCA 3Q07A 1DJAA 2OLVA 4LV2A 4OLDA 3C4OA 2WUQA 3IXDA 1PYYA 4KG2A 3RXWA 1RGYA 1BZAA 5G18A 2ZQ7A 1BT5A 1K55A 1PWCA 2JBFA 3BEBA 3VOYA 4LENA 2XF3A 1L0FA 1WYBA 4QB8A 1L2SA 1SDNA 1CEFA 2ZC3B 3IXBA 4PM7A 2VGJA 5EPHA 1LLBA 5JYPA 2Y2NA 4YINA 3P09A 2WGIA 4YFMA 3LY3A 4JBFA 4Z9QA 5DVAA 3QNCA 5A91A 4OOLA 4N9KA 4IVIA 1E4DA 3OPRA 2Y2OA 1J9MA 3NDGA 1MWTA 1PWDA 2DCFA 4RVAA 1GHIA 3BM6A 1DJBA 2EX8A 4KZ6A 2X01A 1BTLA 3NCKA 1MWSA 3MXSA 4BD0A 1SCWA 4DDSA 4Y0UA 4C6YA 3Q1FA 3VP4A 5HAIA 3SH8A 2HDQA 5EVLA 3DWZA 3I7JA 4FH4A 4OQHA 4ZJ1A 3V50A 2ZC5B 2Y2JA 4FD8A 2WGWB 1YLWA 4E3KA 3HUMA 4N9LA 3GMWA 3HBRA 4WMCD 3Q7VB 5F82A 4S2LA 3WRTA 5CHJA 2EX6A 1NZOA 2ZM2A 3BLSA 4BLMA 3NY4A 1HVBA 3HL9A 1PW8A 1GCEA 1FR6A 2EX2A 3OCLA 3NDEA 4GD8A 1MKIA 1C3BA 1KDSA 4S2KA 4JXSA 3SS4A 4F94A 4MNRA 3O3VA 3ITBA 1K55C 4BL3A 3MBZA 5L2FA 2RCXA 3UO9A 2HP9A 1KGGA 2Y2IA 2Y4AA 5M1AA 5KSCA 4ZBEA 2B5RA 3ZVWA 4QHCA 1BULA 3GVBA 5HX9A 1L0DA 2P74A 4PMAA 2XFTA 5TFQA 3IF6C 4RX3A 1BLSA 3NBLA 3HLEA 3WS0A 1TVFA 5KZHA 5GLDA 2BG1A 4OPRA 3UE1A 1I5QA 4KENB 2WYXA 2ZM0A 4OPQA 5FASA 1IYOA 2HP5A 2DNSA 3EQVA 3S22A 4OP8A 3A3IA 3BECA 4OQGA 3IF6B 2H5SA 3QHYA 1JWVA 5CEBA 2P9VB 3MZEA 1OMEA 1QMEA 4KZ4A 5EECA 4IEDA 4BQMA 2XDMA 4S2PA 4ZJ3A 3VFHA 2X71A 2Y2QA 1XA7A 4JXVA 3PBSA 4XUZA 2WK0A 4DXBA 1HD8A 1GHPA 2Y2LA 2Y2KA 1XPBA 1PW1A 4P87A 5DF9A 2WGVA 2ZLYA 3SS3A 1YQSA 2HDSA 3V3RA 4EQIA 5CRFA 4PM8A 1K57A 1RCJA 1TDLA 2QMIA 5U47A 3GV9A 1W7FA 3PBNA 4FCFA 5HL1A 3BLMA 1MBLA 1FCMA 2XH9A 1K57C 3Q7ZA 3MXRA 2J9PA 2J8YA 4PM9A 4S2JA 4EBNA 3A3JA 2WKHA 2OSUA 1CI8A 1ZKJA 3G30A 1LI0A 4WBGA 3IHBA 5M18A 1WE4A 4KQRA 1MY8A 3BRMA 1FCOA 1L0GA 1KGEA 3VFFA 4NK3A 3JYIA 1VQQA 4LV1A 4QJGA 1K38A 3OC2A 5FAQA 5CERA 2EXBA 1SDEA 1ES2A 1W8YA 5E2GA 4ZJ2A 5FA7A 3P98A 4UA6A 4LV0A 1NXYA 5EVID 5EUAA 2FFYA 4S2NA 4KZ9A 3M2JA 2R9XA 4LV3A 4OP5A 5FI6A 3BYDA 1MWRA 1FOFA 4GB7A 5DTTA 2OLUA 1ERMA 3G35A 3IF6A 2JE5A 5HARA 4EUZA 4OKPA 5KMWA 3ZDJA 3TOIA 2EX9A 5AQ9A 3UPPA 4OOMA 4GKUA 3FKWA 4ID4A 1KE3A 3MKEA 3OPHA 4GDNA 5FQMA 3MZFA 1WYCA 2XEPA 4S2OA 4WM9A 1BLPA 2JCHA 4KG5A 1EROA 1W79A 5E2HA 5F1FA 4PM6A 4X68A 2ZMAA 1VM1A 1IYPA 4OH0A 1LL9A 2H0YA 4JPMA 4DE1A 4OVDA 3LEZA 3HUOA 5DF8A 1DJCA 4WMCA 4WZ4A 4P85A 3UN7A 3IH8A 2HP6A 4P0MA 1ONGA 5FQIA 3ZG5A 2RL3A 1RGZA 3A3EA 2QPNA 5DF7A 3RXXA 4BD1A 2Y2PA 2ZQ9A 2WAFA 1PI5A 1CEGA 2ZC6B 5CTMA 3W8KA 5HAPA 5HW3A 1I2WA 3GSGA 5TGFA 1G68A 1ONHA 1ESUA 2UWXA 3BFCA 3ZNTA 3IHAA 3V3SA 3DWKA 4CPKA 1SHVA 3Q7VA 2XR0A 1NY0A 2E8IA 2G2UA 2P9VA 1TEMA 3CJMA 2XLNA 4JXWA 4LCLA 5FQQA 1K56D 3GRJA 4IBXA 1CK3A 1GA0A 5FDHA 3S4XA 4KZ8A 4MLLA 3UE3A 4DF6A 3N4IA 1FQGA 4O7DA 2CC1A 2Y2HA 4N92A 3HLFA 5CGWA 4PM5A 1YLTA 5GLBA 3UDIA 5M19A 1ALQA 3ZGAB 5E2FA 3UPOA 3M6HA 3HREA 1IYQA
chains in the Genus database with same CATH superfamily
3GQZA 1XP4A 1G6AA 2QJ5A 2DRWA 2V2FF 5HZHA 5EV0A 2PBYA 5CTNA 1YMXA 4JXGA 1LL8A 1K6SA 1E25A 3O87A 2ZM8A 2Y2MA 4II7A 3DTKA 3M2KA 2O0YA 3LCEA 1TS8A 1XXMA 2K7SA 4DDYA 1YM1A 3HLDA 2HDUA 3VOZA 3WRZA 3BWLA 4CQHA 2O9CA 4H6JA 5D3OA 2XSSA 5L8MA 3WWXA 3G2ZA 5F69A 4G3KA 2D02A 3W4OA 1ES5A 1JVJA 3F1NB 1Q2PA 3FZCA 4PAUA 2ZC7A 2ZMFA 3IT9A 4OQ0A 1K54C 1EI5A 4MBKA 1W63Q 3VP0A 2Y55A 3IH9A 2BTFP 3LIBA 2C5WB 2PD7A 1W63M 3MMHA 2LB9A 2HJEA 5EM1A 2QHKA 3G31A 3T1QB 3A0VA 3LI9A 4N1HA 4GHIB 3V67A 4NKPA 4Z1WA 4GJ4A 3LIEA 1LL5A 3KYZA 4KZBA 2G7UA 5HPFA 2ZQAA 1BLHA 4WF0A 2IWCA 4LLOB 3K3CA 4JF4A 1CI9A 4BBTA 3MQOA 4WLAA 5EVIB 4ARZA 2HGVA 1MXOA 3QNBA 1YLZA 3UPNA 3C5AA 3S7OA 1S1ZA 1VETB 5FQKA 1XFNA 1PZOA 3CPTB 4DE2A 4U0XA 3VSKA 4HOIA 2XGNA 1BSGA 3UB7A 3V39A 1ESIA 3MKFA 4B4ZA 5J7EA 5FI7A 3E0YA 3IX4A 4BENA 1NLYA 2EFXA 3PAEA 2M1CA 4M3KA 2OAP1 5J4EA 5AQ7A 4R4SA 2PDRA 4E3LA 5G4ZA 4HH2A 2XD5A 1ZHHB 4R4RA 2ACGA 1ZC2A 2IWDA 1E3UA 4X69A 3S7QA 3IBJA 4R3AA 5FQ9A 1F98A 1FR1A 4X1LA 4YNRA 2I9VA 4DRTA 3PBOA 2GX5A 4MN5A 1IELA 3VMAA 2ZQ8A 5E43A 1W8QA 3NIAA 1S0WA 4OQIA 4NXFA 4OPYA 3CMZA 2WZZA 4R23A 4IVKA 3U2AA 1E3UD 4F3LA 4ZAMA 3TSGA 5IT5A 2YKFA 1UGUA 4R70A 1TD5A 1YT4A 4RYEA 4GDBA 4ZTKA 3E4QA 4DE0A 5EE8A 4LV2A 3RXWA 3FPVA 2B18A 3FG8A 3CWFA 4LENA 2XF3A 1L0FA 1SDNA 1CEFA 3IXBA 4PM7A 1FILA 4Z9QA 3BQ8A 4HP4A 2Y79A 1J9MA 4KZ6A 4M4XA 3LIAA 5F6AA 1SCWA 4C6YA 3VP4A 3SH8A 3PR6A 1YLWA 4QPRA 2W3FA 3Q7VB 4S2LA 5F82A 3WRTA 3T1XA 4HH3A 5AVFA 3HL9A 1OTBA 1VEUB 3LICA 4ETXA 3ITBA 1K55C 5L2FA 4ESPA 2RCXA 2QJ7A 2Y2IA 2Y4AA 4ZBEA 2B5RA 1L0DA 2L1MA 5FEFA 2INWA 3NBLA 1TVFA 5KZHA 3SW1A 5GLDA 3UE1A 4OPRA 4EQ1A 5FASA 3ZQ5A 1HLUP 3A3IA 3BECA 4OQGA 1L3LA 4KZ4A 1N9LA 4S2PA 4JXVA 3D72A 1HD8A 2Y2KA 1XPBA 2WGVA 2ZLYA 2HDSA 1WA9A 5HL1A 2XH9A 3Q7ZA 4EBNA 3G30A 1LI0A 4WBGA 3IHBA 5M18A 4ME4A 4KQRA 1L0GA 4GW9A 1S67L 3LIDA 4GS9A 2EA9A 5FAQA 5CERA 4Y15A 1W8YA 1TS6A 2Z6DA 1NXYA 4FOFA 4S2NA 2W0NA 2JKFA 4IUHA 1YPRA 4NXGA 3LUQA 2DMWA 2OLUA 1ERMA 3D3OA 4EUZA 2EX9A 1MC0A 5AQ9A 3UPPA 4OOMA 4GDNA 5FQMA 1WYCA 3LR4A 4KG5A 3QP5A 1IYPA 1ACFA 3S7PA 3BQAA 2VGLS 3UN7A 3A3EA 1RGZA 3UB8A 4BD1A 2Y2PA 1CEGA 2W27A 3H9WA 1NY0A 4LCLA 4IBXA 2GNXA 2V0UA 3S4XA 5A8BA 1FQGA 1IOUA 3HLFA 4LFUA 1YLTA 3ZGAB 5E2FA 1IYQA 3IWIA 3E2KA 5HWVA 3PTEA 4Y0OA 4ZRRA 2XRNA 2Q9NA 4BL2A 1NYYA 4L0LA 3CG5A 4L9FA 2ZD8A 1PWGA 3OOVA 2HDRA 4Q8IA 2R9WA 2ZOHA 1OJ5A 1SZVA 3N8LA 3UY6A 3OPPA 2A49A 2WADA 4JF5A 1YAXA 1ODVA 2M7VA 5J8XA 4S2IA 1FCNA 4MBFA 4GZBA 3UMEA 1PI4A 3G4PA 1G5UA 4HBUA 2OWJA 1FIKA 3VE4A 4EUVA 2G2WA 2P7JA 2EXAA 1LT0A 4O01A 2W1TB 5EM0A 1H0MA 2BLSA 5F5YA 2JKRM 5GL9A 3CZDA 4QY5A 1GSXA 1YLYA 1FSWA 1BLCA 2WKEA 1YLPA 5DJTA 4BBVA 3A0RA 1UWNX 3LY4A 3IWQA 4WN5A 2NUPC 3S7NA 5TJJA 2ZC4B 5CGXA 4E6WA 3C7VA 2V8CA 1F2KA 3T4QA 1YMSA 3CITA 1K4EA 4L9EA 5HD3A 4WL9A 4DMZA 2K31A 1XKZA 1ES3A 4B88A 4UQIS 3Q82A 4LRZE 1OTEA 5EOEA 1LI9A 5GHYA 3M6BA 4DJ3A 4KQOA 5DFYA 3NJAA 3SS5A 3T1RA 4GOGA 5FI2A 4NXBA 4UEYA 4MN7A 2V1BA 4WYYA 4I39A 4P6ZM 3ULFA 2J9OA 3O88A 1M40A 1JTGA 2PD8A 2M7UA 3BFDA 1XA1A 4CLCC 1IFQA 2Y91A 3P01A 1TDGA 2WAEA 4ARZB 2H28A 3F1NA 1JNUA 1P9WA 4S2NC 2VV8A 3JPUA 3IQAA 4IHQA 2PR5A 5FQJA 1PRQA 1F5MA 3E4OA 4R3JA 3LFVA 2IWBA 1VEUA 2PYPA 2WKQA 2ZQCA 2B95A 3QP6A 3BJNA 4MEZA 4R3BA 4Q0IA 1EW0A 4KZAA 4YOFA 4EERA 1GSVA 3CLOA 1XJ6A 4KG6A 2WZXA 1DY6A 3EQUA 3TJZC 1N9NA 4RA7A 3K2NA 3H82A 3SOIA 3VP3A 2X02A 4GCZA 1T1BA 2GJ3A 4BJPA 1MZUA 1Y54A 3O86A 3T12B 2O99A 5DTSA 4XUXA 3P7NA 2H0TA 2ZJ9A 2OV5A 2V0WA 1TF1A 5AQBA 2PR6A 2V1ZA 4Y7PA 4LRYC 2Z6CA 1XGJA 3HCYA 4ZDXA 3NC8A 3OPLA 3HLBA 4KQDA 4QU3A 1H5XA 4R1GA 2Q9MA 4XXRA 3T1SA 3IXDA 4KG2A 1K0KA 3F1OB 4JGOA 1BZAA 2ZQ7A 1PWCA 3BEBA 3VOYA 3CUEC 3P09A 2WGIA 3LY3A 5A91A 4IVIA 3C2WA 1MWTA 1NWZA 4R38A 1DJBA 2O9BA 3F1PB 2X01A 1BTLA 3NCKA 4Y2FA 5HAIA 2HDQA 5EVLA 3DBAA 3V50A 2WGWB 3IS2B 4E3KA 3PYPA 3GMWA 3HBRA 5FL3A 5CHJA 2EX6A 2ZM2A 1Y28A 4NG2A 1G28A 3R4KA 1GCEA 1FR6A 3UO9A 4EEPA 3NDEA 3SS4A 1MKIA 3CAXA 1KGGA 5M1AA 5J3WA 5L09A 1BULA 2P74A 3EWKA 3G6OA 2XFTA 3WS0A 3CI6A 4KENB 2WYXA 1X0OA 3S22A 5EECA 1QMEA 4FUWA 4IUKA 4ZJ3A 2X71A 2Y2QA 4DXBA 2Y2LA 1PW1A 4P87A 5DF9A 3SS3A 5CRFA 1TDLA 4I5SA 3GV9A 3LR0A 2ZL1B 1MBLA 2VV7A 4EXOA 1WE4A 2VGLM 1MY8A 2W1TA 1FCOA 3VFFA 5AJGA 1VQQA 4LV1A 2W3DA 4QJGA 3OC2A 2EXBA 1SDEA 1ES2A 4RQ9A 1A0KA 3K3DA 3M2JA 1DP8A 4LV3A 3BYDA 5DTTA 1FOFA 5HARA 5HDDA 4OKPA 3ZDJA 2VA0A 3LYXA 3OPHA 1TS7A 3KSFA 4MMNA 4WM9A 2PAVP 1LSVA 5E2HA 2ZMAA 1VM1A 3RTYA 2O9AA 2H0YA 4OVDA 3IH8A 1V9YA 2HP6A 5IS1A 1ONGA 3ZG5A 5HDCA 2FH5A 2RL3A 2WAFA 2ZQ9A 5CTMA 3KSIA 2ZC6B 5HAPA 3GSGA 4G3VA 2UWXA 3IHAA 3V3SA 3E4PA 1TEMA 2XLNA 1K56D 3UE6A 3BY9A 4O7DA 2PYRA 2CC1A 2Y2HA 4GLQA 3R7WA 3QP2A 5CGWA 3UB9A 3UDIA 5M19A 4IJGA 1ES4A 5HAQA 4NEED 3N7WA 2XROA 1IEMA 1YLJA 3ZG7B 5AQAA 2ZMVA 5CHMA 2LB5A 3LR3A 3AGDA 3B3XA 4WZ5A 3L9KA 3RH8B 1GHMA 3KSHA 3RFBA 5GLAA 4PKYA 3DTIA 3E98A 4I38A 3D4FA 2QZ6A 4N1XA 5GHZA 1OTIA 2BASA 4WUJA 3KYEA 4KUKA 1JTDA 5F68A 3CUEA 4AFIA 3NOUC 3MZDA 3HJIA 2J3WA 1VETA 1OPXA 3PAGA 3MQ0A 4UAAA 3V5MA 3MQQA 2CMNA 2HPBA 3SH7A 1GSWA 3DW0A 3B47A 1U60A 4OLGA 2HV1A 2XQZA 3RJUA 5IU1A 3A3DA 5FDSA 4UHUA 2XK1A 5F1GA 4CLCB 1P9RA 4Q0JA 4U3TA 4KQQA 1VHMA 2EFUA 4RX2A 3Q81A 4K0WA 2Y8HA 4WEJA 2XD1A 5EVIC 3WS4A 4WEKA 4QWOA 1Z6FA 4QD4A 1IKIA 1MKMA 3MS6A 3IXHA 4P6ZS 4CLCA 3MFDA 3LO7A 1K4FA 2VZWA 3HVFA 3BFGA 4QY6A 3ZG9B 3IBRA 2Q0OA 3UNWA 4D60A 4UA9A 3E2LA 5F83A 3DTMA 1KE4A 2B02A 3JVVA 4EV4A 1OJGA 3IX3A 3S1YA 3PHYA 4E3JA 3ZG0A 5HFOA 1O7EA 3W4QA 4H8RA 5KSHA 4E3IA 1KGFA 1PFLA 2ZL1A 4LPZA 3EGDC 4HBTA 3VSLA 1NYMA 1DRMA 2WKIA 4K91A 3BW6A 4KZ7A 5A90A 1ZG4A 3UDFA 3N8RA 3EEHA 2EWVA 5I5LA 1XGIA 2K2NA 1KDWA 2WGWA 3N8SA 1N4OA 3LR5A 1S4RA 2L4RA 3HLGA 5EVEA 5FAOA 1ZG6A 3F1PA 3ZHHA 1I2SA 4R0QA 4K08A 3WS5A 2JKGA 4GHIA 1GA9A 3WS2A 2XFSA 1O07A 4WZ5C 2PRFA 1PNEA 5TBMB 1XFQA 3G32A 5EOOA 4B4XA 3FWLA 3ZYTA 5JYOA 3W4PA 2W3GA 1K25A 2VGKA 5L07A 1IKGA 1F9IA 5DFXA 5DTKA 2E8JA 5CECA 5CEDA 5CXWA 5TR7A 2VK3A 4K0XA 3FV7A 1S6RA 1BYWA 5FSRA 2FZ0A 3H82B 4HIAA 4FH2A 3VP2A 4JGQA 3FC7A 3TE8A 4JLFA 3R7WB 4EBLA 3T50A 4HEFA 1OT9A 2OAQ1 5GHXA 4DE3A 1H8ZA 3NOTC 5FEGA 5AVEA 5MC7A 1IYSA 4BWIA 1PZPA 3NI9A 4LCMA 4E3NA 2Y59A 4E3OA 4NETA 4U0TA 5HPIA 3N6IA 1P97A 1XJ4A 4JKTA 5I94A 3ZFZA 3HUNA 2EWWA 1SKFA 1LSWA 3TG9A 1ZTUA 1K54A 1DJAA 2WUQA 1PYYA 5G4YA 5G18A 1BT5A 3EOIA 2JBFA 4EETB 4QB8A 1WYBA 2OOLA 1L2SA 4GS9B 2VGJA 5EPHA 1LLBA 5JYPA 4YINA 3C8CA 4JBFA 5DVAA 3QNCA 5EFWA 2Y2OA 4HJ4A 1PWDA 2DCFA 4RVAA 5CX7A 4X1MA 2EX8A 1MWSA 3PXPA 2GZAA 4BD0A 1XJ3A 3DWZA 3I7JA 4OQHA 4ZJ1A 2ZC5B 4FD8A 3HUMA 3NY4A 1HVBA 2HZ5A 5HL6A 3W2ZA 4GD8A 2AVXA 1C3BA 1KDSA 3NULA 4BL3A 3MBZA 4Y17A 2HP9A 3UB5P 3CHWP 5HX9A 4PMAA 4O8GA 5TFQA 3HJKA 3T4OA 4RX3A 1BLSA 3HLEA 2BG1A 1I5QA 3FPWA 2P04A 2VLGA 3EQVA 3IF6B 2H5SA 2XA7M 1JWVA 3GECA 2XDMA 3VFHA 1XA7A 4EU0A 1GHPA 3V3RA 1YQSA 4EQIA 3C30A 4XT2B 4PM8A 1RCJA 4EW7A 5HDSA 1FCMA 1K57C 2J9PA 4S2JA 2JKRI 2WKHA 2OSUA 1CI8A 1ZKJA 5DKKA 4B9OA 4JGRA 3JYIA 5E2GA 3T4LA 1D06A 1OT6A 2FFYA 4KZ9A 3TW8A 1S1YA 2R9XA 4OP5A 5FI6A 2JE5A 2V1AA 4G3WA 5KMWA 3TOIA 2J80A 3B33A 3CPTA 4GKUA 4ID4A 2KLIA 2XEPA 4S2OA 2YKHA 1BLPA 4HJ3A 1EROA 4YWZA 4PM6A 4OH0A 1LL9A 1NLZA 1DP6A 4DE1A 3HUOA 5DF8A 1CJFA 4P85A 5FQIA 5DF7A 2PBDP 4Y13A 1PI5A 3W8KA 5HW3A 1I2WA 5TGFA 1G68A 1V9ZA 4B93A 1ONHA 2QWSA 3BFCA 3ZNTA 3IX8A 5DJUA 3DWKA 4CPKA 4MCWA 2G2UA 3LI8A 1OTDA 5FQQA 2W3HA 3GRJA 1CK3A 5FDHA 3OLOA 4KZ8A 3QP4A 1P0ZA 4DF6A 3N4IA 4N92A 4DN0A 4PM5A 3UPOA 3M6HA 3HREA 2WKPA 1Y4OA 3OCNA 1MWUA 2JHEA 4X6TA 1TS0A 1N9BA 5HWWA 1T1AA 1MPLA 2GDNA 4FSFA 2FFFB 3ZVTA 2PT7A 1FSYA 5TBMA 3C4PA 1KVLA 4F3LB 3F1OA 2Z2LB 4CLCE 3ISGA 3A3FA 4I3JA 3PBRA 3MR0A 4EWFA 1Q2QA 1XX2A 1RP5A 3GDIA 3H7WB 4Y5FA 2JC7A 3VV4A 1J3WA 4OPZA 1OTAA 3VOLA 3IF5A 4Q0HA 4Y0TA 2D01A 1NZUA 1JWZA 2Z2MB 4UA7A 3IWOA 1AXBA 5BOHA 5CHUA 3AGFA 4HHDA 1KOUA 4OONA 2H10A 1DP9A 1PIOA 2JN7A 4GD6A 5IHVA 1H3QA 1LHYA 3BFFA 1EWZA 1NRJA 5HWTA 3IXGA 2VEAA 4HESA 3BFEA 4HNBA 3UMDA 2PU4A 4LGWA 1T1CA 2I72A 3SH9A 3MJQA 3C7UA 1NJ4A 3G34A 1BUEA 1W5DA 1L0EA 3FYZA 4CJNA 1KE0A 3GR2A 4PHTA 4GN2A 3ITAA 3O5YA 3QP1A 1ERQA 1M6KA 3UB6A 3KYQA 2KX6A 3ZG8B 2C6WB 4A5RA 2V9AA 3H7WA 2HF6A 1K6RA 1D1JA 2QYBA 3NOPC 2Y2GA 3UDXA 1LSXA 3QP8A 5A92A 1K56A 2W1RA 3C38A 4H6JB 3AGEA 3TRCA 1CQAA 3UE0A 4MBHA 4NXEA 4KZ3A 5K5BA 4X56A 2ZQDA 3T4SA 3EEAA 1YKDA 3SZTA 4WELA 4JF6A 3FKVA 4D2OA 1QMFA 1HZOA 3WS1A 4DKIA 2WKRA 3A0SA 5A93A 5HSQA 3VP1A 1HTZA 1H8YA 5L10A 4S2MA 3MF0A 4EEUA 5FATA 4DJ2A 4X53A 3NECA 4I3AA 3T4KA 5EVIA 4E6XA 2A24B 4HJ6A 3PBQA 4OOYA 2A3UA 3OZHA 4IBRA 2V20A 2J7VA 5GLCA 4X55A 5E2EA 1NRFA 2OWHA 3ZNYA 4Y3IA 4C75A 2PU2A 3G2YA 2KDKA 1H8MA 4GNUA 1JWPA 4P6BA 4FTXA 3HLWA 4MDZA 1XJ2A 4C3QA 1VB6A 3PBTA 4E3MA 4EESA 1SKOA 1D7EA 3MXQA 5CGSA 4KZ5A 4KUOA 5FAPA 2IA2A 4EBPA 2A24A 3MFXA 2JKTI 3KX0X 1KVMA 4MN6A 2J3TC 4DXCA 4PPRA 3ZCZA 2VJWA 3HLCA 4CLCD 3GTCA 4OLDA 3Q07A 1Z09A 2OLVA 3C4OA 3NHQA 1RGYA 3DAVA 4HQAA 1K55A 4JGPA 1S4SA 2ZC3B 2Y2NA 3LGOA 4YFMA 4OOLA 4N9KA 1E4DA 3OPRA 1STZA 3NDGA 2A2LA 1GHIA 3BM6A 1N9OA 3BY8A 3VE3A 1YSQA 2ZBBA 5KIZA 3MXSA 5HD5A 4DDSA 4Y0UA 3JVUA 3MSHA 3OBFA 3Q1FA 2KOIA 4FH4A 4BBUA 2Y2JA 2R78A 4N9LA 4WMCD 5LBRA 3KO6A 2XA7S 4BLMA 1NZOA 3BLSA 2W3EA 4R6LA 2ZOIA 1PW8A 2EX2A 3OCLA 4I3IA 4S2KA 4L9GA 4JXSA 4F94A 4MNRA 3O3VA 4O0PA 1T18A 4PKYG 4E04A 5KSCA 2QKPA 3ZVWA 4QHCA 3GVBA 3T4JA 3ICYA 3IF6C 1UWPX 3IS2A 5DKLA 2ZM0A 4OPQA 1IYOA 2HP5A 2DNSA 4OP8A 3B42A 2JKTM 2VV6A 3QHYA 5CEBA 2P9VB 3MZEA 1OMEA 4IEDA 4BQMA 2J3TD 2P08A 3LEQA 4XUZA 3PBSA 2WK0A 5U47A 1K57A 2QMIA 4XT2A 1W7FA 3PBNA 4FCFA 3BLMA 4PM9A 3MXRA 2J8YA 2VX8A 3A3JA 2VKSA 4X25A 1CF0A 3BRMA 1KGEA 4NK3A 1T19A 1K38A 1S66L 3EGXC 4ZJ2A 5FA7A 3P98A 5C5KA 4UA6A 4LV0A 5EVID 4HI4A 5EUAA 2UV0E 3KSGA 1MWRA 4GB7A 3IF6A 3G35A 1G6OA 3FKWA 1KE3A 3MKEA 3DTEA 3L7HA 3MZFA 4LRXC 2NUTC 2JCHA 1W79A 5F1FA 2HJ9C 4X68A 4JPMA 3U4LP 3LEZA 1DJCA 4WMCA 4WZ4A 1SKOB 4P0MA 3D9YA 2QPNA 1AWIA 3RXXA 4ETZA 1ESUA 3T4TA 2V8FA 4UQIM 1SHVA 3Q7VA 2XR0A 2E8IA 2P9VA 3CJMA 4JXWA 1YSPA 4HP9A 3LIFA 1GA0A 3UE3A 4MLLA 4BMWA 2MJ6A 4HY8A 2PHYA 5GLBA 1ALQA 2L0WA
chains in the Genus database with same CATH topology
3GQZA 3IWIA 1XP4A 3E2KA 1ES4A 1G6AA 5HAQA 3N7WA 1MWUA 3OCNA 1IEMA 1YLJA 3PTEA 3ZG7B 5AQAA 4X6TA 4Y0OA 5CHMA 1N9BA 2Q9NA 3AGDA 2DRWA 3B3XA 4WZ5A 1MPLA 4BL2A 1NYYA 2V2FF 2GDNA 2PBYA 4L0LA 4FSFA 3CG5A 5CTNA 1GHMA 2FFFB 3ZVTA 1YMXA 1FSYA 4JXGA 2ZD8A 1PWGA 1K6SA 2HDRA 1KVLA 3C4PA 4Q8IA 1E25A 3O87A 2ZM8A 2R9WA 5GLAA 2Y2MA 2Z2LB 3D4FA 3N8LA 2QZ6A 3UY6A 3OPPA 2A49A 3ISGA 2WADA 4N1XA 5GHZA 4JF5A 3M2KA 3LCEA 3A3FA 1XXMA 5J8XA 4DDYA 1YM1A 4S2IA 3PBRA 1FCNA 4MBFA 4GZBA 4EWFA 1PI4A 1JTDA 3G4PA 1Q2QA 1XX2A 1RP5A 3HLDA 4HBUA 2G2WA 3MZDA 2HDUA 2EXAA 2JC7A 3VOZA 3PAGA 3WRZA 2BLSA 4UAAA 3V5MA 4OPZA 5D3OA 3WWXA 3G2ZA 5GL9A 3CZDA 3IF5A 2HPBA 3W4OA 4Y0TA 3SH7A 4QY5A 3DW0A 1ES5A 1JVJA 1YLYA 1FSWA 1Q2PA 1NZUA 1U60A 1BLCA 1JWZA 2WKEA 1YLPA 3FZCA 2Z2MB 2ZC7A 2XQZA 4OLGA 4UA7A 3IWOA 3RJUA 1AXBA 5BOHA 3IT9A 5CHUA 4OQ0A 3A3DA 3AGFA 1K54C 4OONA 4UHUA 2XK1A 5F1GA 1EI5A 4MBKA 4U3TA 2H10A 4KQQA 3VP0A 2EFUA 2Y55A 3IH9A 4RX2A 3LY4A 3Q81A 3IWQA 4K0WA 4WEJA 1PIOA 5IHVA 4GD6A 2XD1A 2C5WB 2ZC4B 1LHYA 3BFFA 5EVIC 1EWZA 3WS4A 4WEKA 5CGXA 1Z6FA 3IXGA 4QD4A 4HESA 4E6WA 3BFEA 1IKIA 3G31A 3C7VA 4N1HA 2PU4A 3IXHA 2I72A 1YMSA 3MFDA 5EE8A 1K4EA 3SH9A 3LO7A 1K4FA 3HVFA 1XKZA 3BFGA 4QY6A 3ZG9B 1LL5A 3C7UA 1ES3A 1NJ4A 4B88A 3G34A 3UNWA 3Q82A 1BUEA 1W5DA 1L0EA 3FYZA 4UA9A 3E2LA 4KZBA 5F83A 3DTMA 5EOEA 4CJNA 2ZQAA 1KE0A 1KE4A 3GR2A 1LI9A 4GN2A 1BLHA 3ITAA 5GHYA 3M6BA 4EV4A 3S1YA 1ERQA 2IWCA 3ZG0A 4E3JA 5HFOA 1O7EA 1M6KA 4KQOA 3W4QA 4H8RA 5KSHA 4E3IA 3SS5A 1KGFA 3ZG8B 2C6WB 4A5RA 4JF4A 1CI9A 4HBTA 4GOGA 5FI2A 1NYMA 3VSLA 2WKIA 1K6RA 4K91A 2Y2GA 4KZ7A 5EVIB 3UDXA 5A90A 1ZG4A 3UDFA 1MXOA 5A92A 3QNBA 3N8RA 1K56A 4WYYA 2J9OA 3O88A 1M40A 1YLZA 3UPNA 3C5AA 1XGIA 2WGWA 1KDWA 1JTGA 3AGEA 3N8SA 3BFDA 1XA1A 3UE0A 2Y91A 1TDGA 1N4OA 2WAEA 4KZ3A 4MBHA 3HLGA 5FQKA 4S2NC 5FAOA 1ZG6A 3ZHHA 4X56A 2ZQDA 1I2SA 4R0QA 1PZOA 3WS5A 3IQAA 4DE2A 4U0XA 5FQJA 3VSKA 4WELA 1GA9A 2XGNA 1BSGA 3WS2A 2XFSA 1O07A 3V39A 1ESIA 4JF6A 4WZ5C 3FKVA 3MKFA 1QMFA 4B4ZA 4D2OA 1HZOA 3WS1A 4DKIA 4R3JA 5FI7A 5A93A 2IWBA 4BENA 2EFXA 3G32A 5EOOA 2ZQCA 3PAEA 4B4XA 4M3KA 3VP1A 3FWLA 1HTZA 1H8YA 5JYOA 4S2MA 5AQ7A 4MEZA 3W4PA 5FATA 4R3BA 4KZAA 4R4SA 4X53A 1K25A 2VGKA 4E3LA 1IKGA 4KG6A 2WZXA 5EVIA 2XD5A 4E6XA 4R4RA 1ZC2A 1DY6A 5DTKA 2IWDA 5CECA 1E3UA 5CEDA 3EQUA 3PBQA 4OOYA 4X69A 5CXWA 5TR7A 4K0XA 3FV7A 2A3UA 5FQ9A 3OZHA 4RA7A 1FR1A 1S6RA 4IBRA 2V20A 5FSRA 2J7VA 4DRTA 3SOIA 3VP3A 5GLCA 4X55A 2X02A 4FH2A 3VP2A 3PBOA 5E2EA 1NRFA 3ZNYA 4JLFA 4C75A 1IELA 3VMAA 2PU2A 4BJPA 3G2YA 4EBLA 4HEFA 2ZQ8A 4GNUA 1Y54A 1JWPA 4P6BA 5E43A 1W8QA 3O86A 3HLWA 5GHXA 4C3QA 4DE3A 3PBTA 3NIAA 1H8ZA 4E3MA 1S0WA 5CGSA 5DTSA 4KZ5A 4XUXA 4OQIA 2H0TA 2ZJ9A 2OV5A 1IYSA 1PZPA 4OPYA 3CMZA 5AQBA 2WZZA 5FAPA 4R23A 3NI9A 4LCMA 4EBPA 4E3NA 4IVKA 1E3UD 4ZAMA 2Y59A 3TSGA 2V1ZA 4NETA 4Y7PA 4E3OA 1XGJA 4ZDXA 4U0TA 3N6IA 3NC8A 3OPLA 1YT4A 4JKTA 5I94A 1KVMA 3HLBA 3ZFZA 3HUNA 4RYEA 4DXCA 4GDBA 4QU3A 4ZTKA 4PPRA 1H5XA 3ZCZA 1SKFA 2Q9MA 3HLCA 4R1GA 1K54A 4XXRA 3TG9A 4DE0A 3GTCA 3Q07A 1DJAA 2OLVA 4LV2A 4OLDA 3C4OA 2WUQA 3IXDA 1PYYA 4KG2A 3RXWA 1RGYA 1BZAA 5G18A 2ZQ7A 1BT5A 1K55A 1PWCA 2JBFA 3BEBA 3VOYA 4LENA 2XF3A 1L0FA 1WYBA 4QB8A 1L2SA 1SDNA 1CEFA 2ZC3B 3IXBA 4PM7A 2VGJA 5EPHA 1LLBA 5JYPA 2Y2NA 4YINA 3P09A 2WGIA 4YFMA 3LY3A 4JBFA 4Z9QA 5DVAA 3QNCA 5A91A 4OOLA 4N9KA 4IVIA 1E4DA 3OPRA 2Y2OA 1J9MA 3NDGA 1MWTA 1PWDA 2DCFA 4RVAA 1GHIA 3BM6A 1DJBA 2EX8A 4KZ6A 2X01A 1BTLA 3NCKA 1MWSA 3MXSA 4BD0A 1SCWA 4DDSA 4Y0UA 4C6YA 3Q1FA 3VP4A 5HAIA 3SH8A 2HDQA 5EVLA 3DWZA 3I7JA 4FH4A 4OQHA 4ZJ1A 3V50A 2ZC5B 2Y2JA 4FD8A 2WGWB 1YLWA 4E3KA 3HUMA 4N9LA 3GMWA 3HBRA 4WMCD 3Q7VB 5F82A 4S2LA 3WRTA 5CHJA 2EX6A 1NZOA 2ZM2A 3BLSA 4BLMA 3NY4A 1HVBA 3HL9A 1PW8A 1GCEA 1FR6A 2EX2A 3OCLA 3NDEA 4GD8A 1MKIA 1C3BA 1KDSA 4S2KA 4JXSA 3SS4A 4F94A 4MNRA 3O3VA 3ITBA 1K55C 4BL3A 3MBZA 5L2FA 2RCXA 3UO9A 2HP9A 1KGGA 2Y2IA 2Y4AA 5M1AA 5KSCA 4ZBEA 2B5RA 3ZVWA 4QHCA 1BULA 3GVBA 5HX9A 1L0DA 2P74A 4PMAA 2XFTA 5TFQA 3IF6C 4RX3A 1BLSA 3NBLA 3HLEA 3WS0A 1TVFA 5KZHA 5GLDA 2BG1A 4OPRA 3UE1A 1I5QA 4KENB 2WYXA 2ZM0A 4OPQA 5FASA 1IYOA 2HP5A 2DNSA 3EQVA 3S22A 4OP8A 3A3IA 3BECA 4OQGA 3IF6B 2H5SA 3QHYA 1JWVA 5CEBA 2P9VB 3MZEA 1OMEA 1QMEA 4KZ4A 5EECA 4IEDA 4BQMA 2XDMA 4S2PA 4ZJ3A 3VFHA 2X71A 2Y2QA 1XA7A 4JXVA 3PBSA 4XUZA 2WK0A 4DXBA 1HD8A 1GHPA 2Y2LA 2Y2KA 1XPBA 1PW1A 4P87A 5DF9A 2WGVA 2ZLYA 3SS3A 1YQSA 2HDSA 3V3RA 4EQIA 5CRFA 4PM8A 1K57A 1RCJA 1TDLA 2QMIA 5U47A 3GV9A 1W7FA 3PBNA 4FCFA 5HL1A 3BLMA 1MBLA 1FCMA 2XH9A 1K57C 3Q7ZA 3MXRA 2J9PA 2J8YA 4PM9A 4S2JA 4EBNA 3A3JA 2WKHA 2OSUA 1CI8A 1ZKJA 3G30A 1LI0A 4WBGA 3IHBA 5M18A 1WE4A 4KQRA 1MY8A 3BRMA 1FCOA 1L0GA 1KGEA 3VFFA 4NK3A 3JYIA 1VQQA 4LV1A 4QJGA 1K38A 3OC2A 5FAQA 5CERA 2EXBA 1SDEA 1ES2A 1W8YA 5E2GA 4ZJ2A 5FA7A 3P98A 4UA6A 4LV0A 1NXYA 5EVID 5EUAA 2FFYA 4S2NA 4KZ9A 3M2JA 2R9XA 4LV3A 4OP5A 5FI6A 3BYDA 1MWRA 1FOFA 4GB7A 5DTTA 2OLUA 1ERMA 3G35A 3IF6A 2JE5A 5HARA 4EUZA 4OKPA 5KMWA 3ZDJA 3TOIA 2EX9A 5AQ9A 3UPPA 4OOMA 4GKUA 3FKWA 4ID4A 1KE3A 3MKEA 3OPHA 4GDNA 5FQMA 3MZFA 1WYCA 2XEPA 4S2OA 4WM9A 1BLPA 2JCHA 4KG5A 1EROA 1W79A 5E2HA 5F1FA 4PM6A 4X68A 2ZMAA 1VM1A 1IYPA 4OH0A 1LL9A 2H0YA 4JPMA 4DE1A 4OVDA 3LEZA 3HUOA 5DF8A 1DJCA 4WMCA 4WZ4A 4P85A 3UN7A 3IH8A 2HP6A 4P0MA 1ONGA 5FQIA 3ZG5A 2RL3A 1RGZA 3A3EA 2QPNA 5DF7A 3RXXA 4BD1A 2Y2PA 2ZQ9A 2WAFA 1PI5A 1CEGA 2ZC6B 5CTMA 3W8KA 5HAPA 5HW3A 1I2WA 3GSGA 5TGFA 1G68A 1ONHA 1ESUA 2UWXA 3BFCA 3ZNTA 3IHAA 3V3SA 3DWKA 4CPKA 1SHVA 3Q7VA 2XR0A 1NY0A 2E8IA 2G2UA 2P9VA 1TEMA 3CJMA 2XLNA 4JXWA 4LCLA 5FQQA 1K56D 3GRJA 4IBXA 1CK3A 1GA0A 5FDHA 3S4XA 4KZ8A 4MLLA 3UE3A 4DF6A 3N4IA 1FQGA 4O7DA 2CC1A 2Y2HA 4N92A 3HLFA 5CGWA 4PM5A 1YLTA 5GLBA 3UDIA 5M19A 1ALQA 3ZGAB 5E2FA 3UPOA 3M6HA 3HREA 1IYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQZ A;  3IWI A;  1XP4 A;  3E2K A;  1ES4 A;  1G6A A;  5HAQ A;  3N7W A;  1MWU A;  3OCN A;  1IEM A;  1YLJ A;  3PTE A;  3ZG7 B;  5AQA A;  4X6T A;  4Y0O A;  5CHM A;  1N9B A;  2Q9N A;  3AGD A;  2DRW A;  3B3X A;  4WZ5 A;  1MPL A;  4BL2 A;  1NYY A;  2V2F F;  2GDN A;  2PBY A;  4L0L A;  4FSF A;  3CG5 A;  5CTN A;  1GHM A;  2FFF B;  3ZVT A;  1YMX A;  1FSY A;  4JXG A;  2ZD8 A;  1PWG A;  1K6S A;  2HDR A;  1KVL A;  3C4P A;  4Q8I A;  1E25 A;  3O87 A;  2ZM8 A;  2R9W A;  5GLA A;  2Y2M A;  2Z2L B;  3D4F A;  3N8L A;  2QZ6 A;  3UY6 A;  3OPP A;  2A49 A;  3ISG A;  2WAD A;  4N1X A;  5GHZ A;  4JF5 A;  3M2K A;  3LCE A;  3A3F A;  1XXM A;  5J8X A;  4DDY A;  1YM1 A;  4S2I A;  3PBR A;  1FCN A;  4MBF A;  4GZB A;  4EWF A;  1PI4 A;  1JTD A;  3G4P A;  1Q2Q A;  1XX2 A;  1RP5 A;  3HLD A;  4HBU A;  2G2W A;  3MZD A;  2HDU A;  2EXA A;  2JC7 A;  3VOZ A;  3PAG A;  3WRZ A;  2BLS A;  4UAA A;  3V5M A;  4OPZ A;  5D3O A;  3WWX A;  3G2Z A;  5GL9 A;  3CZD A;  3IF5 A;  2HPB A;  3W4O A;  4Y0T A;  3SH7 A;  4QY5 A;  3DW0 A;  1ES5 A;  1JVJ A;  1YLY A;  1FSW A;  1Q2P A;  1NZU A;  1U60 A;  1BLC A;  1JWZ A;  2WKE A;  1YLP A;  3FZC A;  2Z2M B;  2ZC7 A;  2XQZ A;  4OLG A;  4UA7 A;  3IWO A;  3RJU A;  1AXB A;  5BOH A;  3IT9 A;  5CHU A;  4OQ0 A;  3A3D A;  3AGF A;  1K54 C;  4OON A;  4UHU A;  2XK1 A;  5F1G A;  1EI5 A;  4MBK A;  4U3T A;  2H10 A;  4KQQ A;  3VP0 A;  2EFU A;  2Y55 A;  3IH9 A;  4RX2 A;  3LY4 A;  3Q81 A;  3IWQ A;  4K0W A;  4WEJ A;  1PIO A;  5IHV A;  4GD6 A;  2XD1 A;  2C5W B;  2ZC4 B;  1LHY A;  3BFF A;  5EVI C;  1EWZ A;  3WS4 A;  4WEK A;  5CGX A;  1Z6F A;  3IXG A;  4QD4 A;  4HES A;  4E6W A;  3BFE A;  1IKI A;  3G31 A;  3C7V A;  4N1H A;  2PU4 A;  3IXH A;  2I72 A;  1YMS A;  3MFD A;  5EE8 A;  1K4E A;  3SH9 A;  3LO7 A;  1K4F A;  3HVF A;  1XKZ A;  3BFG A;  4QY6 A;  3ZG9 B;  1LL5 A;  3C7U A;  1ES3 A;  1NJ4 A;  4B88 A;  3G34 A;  3UNW A;  3Q82 A;  1BUE A;  1W5D A;  1L0E A;  3FYZ A;  4UA9 A;  3E2L A;  4KZB A;  5F83 A;  3DTM A;  5EOE A;  4CJN A;  2ZQA A;  1KE0 A;  1KE4 A;  3GR2 A;  1LI9 A;  4GN2 A;  1BLH A;  3ITA A;  5GHY A;  3M6B A;  4EV4 A;  3S1Y A;  1ERQ A;  2IWC A;  3ZG0 A;  4E3J A;  5HFO A;  1O7E A;  1M6K A;  4KQO A;  3W4Q A;  4H8R A;  5KSH A;  4E3I A;  3SS5 A;  1KGF A;  3ZG8 B;  2C6W B;  4A5R A;  4JF4 A;  1CI9 A;  4HBT A;  4GOG A;  5FI2 A;  1NYM A;  3VSL A;  2WKI A;  1K6R A;  4K91 A;  2Y2G A;  4KZ7 A;  5EVI B;  3UDX A;  5A90 A;  1ZG4 A;  3UDF A;  1MXO A;  5A92 A;  3QNB A;  3N8R A;  1K56 A;  4WYY A;  2J9O A;  3O88 A;  1M40 A;  1YLZ A;  3UPN A;  3C5A A;  1XGI A;  2WGW A;  1KDW A;  1JTG A;  3AGE A;  3N8S A;  3BFD A;  1XA1 A;  3UE0 A;  2Y91 A;  1TDG A;  1N4O A;  2WAE A;  4KZ3 A;  4MBH A;  3HLG A;  5FQK A;  4S2N C;  5FAO A;  1ZG6 A;  3ZHH A;  4X56 A;  2ZQD A;  1I2S A;  4R0Q A;  1PZO A;  3WS5 A;  3IQA A;  4DE2 A;  4U0X A;  5FQJ A;  3VSK A;  4WEL A;  1GA9 A;  2XGN A;  1BSG A;  3WS2 A;  2XFS A;  1O07 A;  3V39 A;  1ESI A;  4JF6 A;  4WZ5 C;  3FKV A;  3MKF A;  1QMF A;  4B4Z A;  4D2O A;  1HZO A;  3WS1 A;  4DKI A;  4R3J A;  5FI7 A;  5A93 A;  2IWB A;  4BEN A;  2EFX A;  3G32 A;  5EOO A;  2ZQC A;  3PAE A;  4B4X A;  4M3K A;  3VP1 A;  3FWL A;  1HTZ A;  1H8Y A;  5JYO A;  4S2M A;  5AQ7 A;  4MEZ A;  3W4P A;  5FAT A;  4R3B A;  4KZA A;  4R4S A;  4X53 A;  1K25 A;  2VGK A;  4E3L A;  1IKG A;  4KG6 A;  2WZX A;  5EVI A;  2XD5 A;  4E6X A;  4R4R A;  1ZC2 A;  1DY6 A;  5DTK A;  2IWD A;  5CEC A;  1E3U A;  5CED A;  3EQU A;  3PBQ A;  4OOY A;  4X69 A;  5CXW A;  5TR7 A;  4K0X A;  3FV7 A;  2A3U A;  5FQ9 A;  3OZH A;  4RA7 A;  1FR1 A;  1S6R A;  4IBR A;  2V20 A;  5FSR A;  2J7V A;  4DRT A;  3SOI A;  3VP3 A;  5GLC A;  4X55 A;  2X02 A;  4FH2 A;  3VP2 A;  3PBO A;  5E2E A;  1NRF A;  3ZNY A;  4JLF A;  4C75 A;  1IEL A;  3VMA A;  2PU2 A;  4BJP A;  3G2Y A;  4EBL A;  4HEF A;  2ZQ8 A;  4GNU A;  1Y54 A;  1JWP A;  4P6B A;  5E43 A;  1W8Q A;  3O86 A;  3HLW A;  5GHX A;  4C3Q A;  4DE3 A;  3PBT A;  3NIA A;  1H8Z A;  4E3M A;  1S0W A;  5CGS A;  5DTS A;  4KZ5 A;  4XUX A;  4OQI A;  2H0T A;  2ZJ9 A;  2OV5 A;  1IYS A;  1PZP A;  4OPY A;  3CMZ A;  5AQB A;  2WZZ A;  5FAP A;  4R23 A;  3NI9 A;  4LCM A;  4EBP A;  4E3N A;  4IVK A;  1E3U D;  4ZAM A;  2Y59 A;  3TSG A;  2V1Z A;  4NET A;  4Y7P A;  4E3O A;  1XGJ A;  4ZDX A;  4U0T A;  3N6I A;  3NC8 A;  3OPL A;  1YT4 A;  4JKT A;  5I94 A;  1KVM A;  3HLB A;  3ZFZ A;  3HUN A;  4RYE A;  4DXC A;  4GDB A;  4QU3 A;  4ZTK A;  4PPR A;  1H5X A;  3ZCZ A;  1SKF A;  2Q9M A;  3HLC A;  4R1G A;  1K54 A;  4XXR A;  3TG9 A;  4DE0 A;  3GTC A;  3Q07 A;  1DJA A;  2OLV A;  4LV2 A;  4OLD A;  3C4O A;  2WUQ A;  3IXD A;  1PYY A;  4KG2 A;  3RXW A;  1RGY A;  1BZA A;  5G18 A;  2ZQ7 A;  1BT5 A;  1K55 A;  1PWC A;  2JBF A;  3BEB A;  3VOY A;  4LEN A;  2XF3 A;  1L0F A;  1WYB A;  4QB8 A;  1L2S A;  1SDN A;  1CEF A;  2ZC3 B;  3IXB A;  4PM7 A;  2VGJ A;  5EPH A;  1LLB A;  5JYP A;  2Y2N A;  4YIN A;  3P09 A;  2WGI A;  4YFM A;  3LY3 A;  4JBF A;  4Z9Q A;  5DVA A;  3QNC A;  5A91 A;  4OOL A;  4N9K A;  4IVI A;  1E4D A;  3OPR A;  2Y2O A;  1J9M A;  3NDG A;  1MWT A;  1PWD A;  2DCF A;  4RVA A;  1GHI A;  3BM6 A;  1DJB A;  2EX8 A;  4KZ6 A;  2X01 A;  1BTL A;  3NCK A;  1MWS A;  3MXS A;  4BD0 A;  1SCW A;  4DDS A;  4Y0U A;  4C6Y A;  3Q1F A;  3VP4 A;  5HAI A;  3SH8 A;  2HDQ A;  5EVL A;  3DWZ A;  3I7J A;  4FH4 A;  4OQH A;  4ZJ1 A;  3V50 A;  2ZC5 B;  2Y2J A;  4FD8 A;  2WGW B;  1YLW A;  4E3K A;  3HUM A;  4N9L A;  3GMW A;  3HBR A;  4WMC D;  3Q7V B;  5F82 A;  4S2L A;  3WRT A;  5CHJ A;  2EX6 A;  1NZO A;  2ZM2 A;  3BLS A;  4BLM A;  3NY4 A;  1HVB A;  3HL9 A;  1PW8 A;  1GCE A;  1FR6 A;  2EX2 A;  3OCL A;  3NDE A;  4GD8 A;  1MKI A;  1C3B A;  1KDS A;  4S2K A;  4JXS A;  3SS4 A;  4F94 A;  4MNR A;  3O3V A;  3ITB A;  1K55 C;  4BL3 A;  3MBZ A;  5L2F A;  2RCX A;  3UO9 A;  2HP9 A;  1KGG A;  2Y2I A;  2Y4A A;  5M1A A;  5KSC A;  4ZBE A;  2B5R A;  3ZVW A;  4QHC A;  1BUL A;  3GVB A;  5HX9 A;  1L0D A;  2P74 A;  4PMA A;  2XFT A;  5TFQ A;  3IF6 C;  4RX3 A;  1BLS A;  3NBL A;  3HLE A;  3WS0 A;  1TVF A;  5KZH A;  5GLD A;  2BG1 A;  4OPR A;  3UE1 A;  1I5Q A;  4KEN B;  2WYX A;  2ZM0 A;  4OPQ A;  5FAS A;  1IYO A;  2HP5 A;  2DNS A;  3EQV A;  3S22 A;  4OP8 A;  3A3I A;  3BEC A;  4OQG A;  3IF6 B;  2H5S A;  3QHY A;  1JWV A;  5CEB A;  2P9V B;  3MZE A;  1OME A;  1QME A;  4KZ4 A;  5EEC A;  4IED A;  4BQM A;  2XDM A;  4S2P A;  4ZJ3 A;  3VFH A;  2X71 A;  2Y2Q A;  1XA7 A;  4JXV A;  3PBS A;  4XUZ A;  2WK0 A;  4DXB A;  1HD8 A;  1GHP A;  2Y2L A;  2Y2K A;  1XPB A;  1PW1 A;  4P87 A;  5DF9 A;  2WGV A;  2ZLY A;  3SS3 A;  1YQS A;  2HDS A;  3V3R A;  4EQI A;  5CRF A;  4PM8 A;  1K57 A;  1RCJ A;  1TDL A;  2QMI A;  5U47 A;  3GV9 A;  1W7F A;  3PBN A;  4FCF A;  5HL1 A;  3BLM A;  1MBL A;  1FCM A;  2XH9 A;  1K57 C;  3Q7Z A;  3MXR A;  2J9P A;  2J8Y A;  4PM9 A;  4S2J A;  4EBN A;  3A3J A;  2WKH A;  2OSU A;  1CI8 A;  1ZKJ A;  3G30 A;  1LI0 A;  4WBG A;  3IHB A;  5M18 A;  1WE4 A;  4KQR A;  1MY8 A;  3BRM A;  1FCO A;  1L0G A;  1KGE A;  3VFF A;  4NK3 A;  3JYI A;  1VQQ A;  4LV1 A;  4QJG A;  1K38 A;  3OC2 A;  5FAQ A;  5CER A;  2EXB A;  1SDE A;  1ES2 A;  1W8Y A;  5E2G A;  4ZJ2 A;  5FA7 A;  3P98 A;  4UA6 A;  4LV0 A;  1NXY A;  5EVI D;  5EUA A;  2FFY A;  4S2N A;  4KZ9 A;  3M2J A;  2R9X A;  4LV3 A;  4OP5 A;  5FI6 A;  3BYD A;  1MWR A;  1FOF A;  4GB7 A;  5DTT A;  2OLU A;  1ERM A;  3G35 A;  3IF6 A;  2JE5 A;  5HAR A;  4EUZ A;  4OKP A;  5KMW A;  3ZDJ A;  3TOI A;  2EX9 A;  5AQ9 A;  3UPP A;  4OOM A;  4GKU A;  3FKW A;  4ID4 A;  1KE3 A;  3MKE A;  3OPH A;  4GDN A;  5FQM A;  3MZF A;  1WYC A;  2XEP A;  4S2O A;  4WM9 A;  1BLP A;  2JCH A;  4KG5 A;  1ERO A;  1W79 A;  5E2H A;  5F1F A;  4PM6 A;  4X68 A;  2ZMA A;  1VM1 A;  1IYP A;  4OH0 A;  1LL9 A;  2H0Y A;  4JPM A;  4DE1 A;  4OVD A;  3LEZ A;  3HUO A;  5DF8 A;  1DJC A;  4WMC A;  4WZ4 A;  4P85 A;  3UN7 A;  3IH8 A;  2HP6 A;  4P0M A;  1ONG A;  5FQI A;  3ZG5 A;  2RL3 A;  1RGZ A;  3A3E A;  2QPN A;  5DF7 A;  3RXX A;  4BD1 A;  2Y2P A;  2ZQ9 A;  2WAF A;  1PI5 A;  1CEG A;  2ZC6 B;  5CTM A;  3W8K A;  5HAP A;  5HW3 A;  1I2W A;  3GSG A;  5TGF A;  1G68 A;  1ONH A;  1ESU A;  2UWX A;  3BFC A;  3ZNT A;  3IHA A;  3V3S A;  3DWK A;  4CPK A;  1SHV A;  3Q7V A;  2XR0 A;  1NY0 A;  2E8I A;  2G2U A;  2P9V A;  1TEM A;  3CJM A;  2XLN A;  4JXW A;  4LCL A;  5FQQ A;  1K56 D;  3GRJ A;  4IBX A;  1CK3 A;  1GA0 A;  5FDH A;  3S4X A;  4KZ8 A;  4MLL A;  3UE3 A;  4DF6 A;  3N4I A;  1FQG A;  4O7D A;  2CC1 A;  2Y2H A;  4N92 A;  3HLF A;  5CGW A;  4PM5 A;  1YLT A;  5GLB A;  3UDI A;  5M19 A;  1ALQ A;  3ZGA B;  5E2F A;  3UPO A;  3M6H A;  3HRE A;  1IYQ A; 
#chains in the Genus database with same CATH topology
 3GQZ A;  1XP4 A;  1G6A A;  2QJ5 A;  2DRW A;  2V2F F;  5HZH A;  5EV0 A;  2PBY A;  5CTN A;  1YMX A;  4JXG A;  1LL8 A;  1K6S A;  1E25 A;  3O87 A;  2ZM8 A;  2Y2M A;  4II7 A;  3DTK A;  3M2K A;  2O0Y A;  3LCE A;  1TS8 A;  1XXM A;  2K7S A;  4DDY A;  1YM1 A;  3HLD A;  2HDU A;  3VOZ A;  3WRZ A;  3BWL A;  4CQH A;  2O9C A;  4H6J A;  5D3O A;  2XSS A;  5L8M A;  3WWX A;  3G2Z A;  5F69 A;  4G3K A;  2D02 A;  3W4O A;  1ES5 A;  1JVJ A;  3F1N B;  1Q2P A;  3FZC A;  4PAU A;  2ZC7 A;  2ZMF A;  3IT9 A;  4OQ0 A;  1K54 C;  1EI5 A;  4MBK A;  1W63 Q;  3VP0 A;  2Y55 A;  3IH9 A;  2BTF P;  3LIB A;  2C5W B;  2PD7 A;  1W63 M;  3MMH A;  2LB9 A;  2HJE A;  5EM1 A;  2QHK A;  3G31 A;  3T1Q B;  3A0V A;  3LI9 A;  4N1H A;  4GHI B;  3V67 A;  4NKP A;  4Z1W A;  4GJ4 A;  3LIE A;  1LL5 A;  3KYZ A;  4KZB A;  2G7U A;  5HPF A;  2ZQA A;  1BLH A;  4WF0 A;  2IWC A;  4LLO B;  3K3C A;  4JF4 A;  1CI9 A;  4BBT A;  3MQO A;  4WLA A;  5EVI B;  4ARZ A;  2HGV A;  1MXO A;  3QNB A;  1YLZ A;  3UPN A;  3C5A A;  3S7O A;  1S1Z A;  1VET B;  5FQK A;  1XFN A;  1PZO A;  3CPT B;  4DE2 A;  4U0X A;  3VSK A;  4HOI A;  2XGN A;  1BSG A;  3UB7 A;  3V39 A;  1ESI A;  3MKF A;  4B4Z A;  5J7E A;  5FI7 A;  3E0Y A;  3IX4 A;  4BEN A;  1NLY A;  2EFX A;  3PAE A;  2M1C A;  4M3K A;  2OAP 1;  5J4E A;  5AQ7 A;  4R4S A;  2PDR A;  4E3L A;  5G4Z A;  4HH2 A;  2XD5 A;  1ZHH B;  4R4R A;  2ACG A;  1ZC2 A;  2IWD A;  1E3U A;  4X69 A;  3S7Q A;  3IBJ A;  4R3A A;  5FQ9 A;  1F98 A;  1FR1 A;  4X1L A;  4YNR A;  2I9V A;  4DRT A;  3PBO A;  2GX5 A;  4MN5 A;  1IEL A;  3VMA A;  2ZQ8 A;  5E43 A;  1W8Q A;  3NIA A;  1S0W A;  4OQI A;  4NXF A;  4OPY A;  3CMZ A;  2WZZ A;  4R23 A;  4IVK A;  3U2A A;  1E3U D;  4F3L A;  4ZAM A;  3TSG A;  5IT5 A;  2YKF A;  1UGU A;  4R70 A;  1TD5 A;  1YT4 A;  4RYE A;  4GDB A;  4ZTK A;  3E4Q A;  4DE0 A;  5EE8 A;  4LV2 A;  3RXW A;  3FPV A;  2B18 A;  3FG8 A;  3CWF A;  4LEN A;  2XF3 A;  1L0F A;  1SDN A;  1CEF A;  3IXB A;  4PM7 A;  1FIL A;  4Z9Q A;  3BQ8 A;  4HP4 A;  2Y79 A;  1J9M A;  4KZ6 A;  4M4X A;  3LIA A;  5F6A A;  1SCW A;  4C6Y A;  3VP4 A;  3SH8 A;  3PR6 A;  1YLW A;  4QPR A;  2W3F A;  3Q7V B;  4S2L A;  5F82 A;  3WRT A;  3T1X A;  4HH3 A;  5AVF A;  3HL9 A;  1OTB A;  1VEU B;  3LIC A;  4ETX A;  3ITB A;  1K55 C;  5L2F A;  4ESP A;  2RCX A;  2QJ7 A;  2Y2I A;  2Y4A A;  4ZBE A;  2B5R A;  1L0D A;  2L1M A;  5FEF A;  2INW A;  3NBL A;  1TVF A;  5KZH A;  3SW1 A;  5GLD A;  3UE1 A;  4OPR A;  4EQ1 A;  5FAS A;  3ZQ5 A;  1HLU P;  3A3I A;  3BEC A;  4OQG A;  1L3L A;  4KZ4 A;  1N9L A;  4S2P A;  4JXV A;  3D72 A;  1HD8 A;  2Y2K A;  1XPB A;  2WGV A;  2ZLY A;  2HDS A;  1WA9 A;  5HL1 A;  2XH9 A;  3Q7Z A;  4EBN A;  3G30 A;  1LI0 A;  4WBG A;  3IHB A;  5M18 A;  4ME4 A;  4KQR A;  1L0G A;  4GW9 A;  1S67 L;  3LID A;  4GS9 A;  2EA9 A;  5FAQ A;  5CER A;  4Y15 A;  1W8Y A;  1TS6 A;  2Z6D A;  1NXY A;  4FOF A;  4S2N A;  2W0N A;  2JKF A;  4IUH A;  1YPR A;  4NXG A;  3LUQ A;  2DMW A;  2OLU A;  1ERM A;  3D3O A;  4EUZ A;  2EX9 A;  1MC0 A;  5AQ9 A;  3UPP A;  4OOM A;  4GDN A;  5FQM A;  1WYC A;  3LR4 A;  4KG5 A;  3QP5 A;  1IYP A;  1ACF A;  3S7P A;  3BQA A;  2VGL S;  3UN7 A;  3A3E A;  1RGZ A;  3UB8 A;  4BD1 A;  2Y2P A;  1CEG A;  2W27 A;  3H9W A;  1NY0 A;  4LCL A;  4IBX A;  2GNX A;  2V0U A;  3S4X A;  5A8B A;  1FQG A;  1IOU A;  3HLF A;  4LFU A;  1YLT A;  3ZGA B;  5E2F A;  1IYQ A;  3IWI A;  3E2K A;  5HWV A;  3PTE A;  4Y0O A;  4ZRR A;  2XRN A;  2Q9N A;  4BL2 A;  1NYY A;  4L0L A;  3CG5 A;  4L9F A;  2ZD8 A;  1PWG A;  3OOV A;  2HDR A;  4Q8I A;  2R9W A;  2ZOH A;  1OJ5 A;  1SZV A;  3N8L A;  3UY6 A;  3OPP A;  2A49 A;  2WAD A;  4JF5 A;  1YAX A;  1ODV A;  2M7V A;  5J8X A;  4S2I A;  1FCN A;  4MBF A;  4GZB A;  3UME A;  1PI4 A;  3G4P A;  1G5U A;  4HBU A;  2OWJ A;  1FIK A;  3VE4 A;  4EUV A;  2G2W A;  2P7J A;  2EXA A;  1LT0 A;  4O01 A;  2W1T B;  5EM0 A;  1H0M A;  2BLS A;  5F5Y A;  2JKR M;  5GL9 A;  3CZD A;  4QY5 A;  1GSX A;  1YLY A;  1FSW A;  1BLC A;  2WKE A;  1YLP A;  5DJT A;  4BBV A;  3A0R A;  1UWN X;  3LY4 A;  3IWQ A;  4WN5 A;  2NUP C;  3S7N A;  5TJJ A;  2ZC4 B;  5CGX A;  4E6W A;  3C7V A;  2V8C A;  1F2K A;  3T4Q A;  1YMS A;  3CIT A;  1K4E A;  4L9E A;  5HD3 A;  4WL9 A;  4DMZ A;  2K31 A;  1XKZ A;  1ES3 A;  4B88 A;  4UQI S;  3Q82 A;  4LRZ E;  1OTE A;  5EOE A;  1LI9 A;  5GHY A;  3M6B A;  4DJ3 A;  4KQO A;  5DFY A;  3NJA A;  3SS5 A;  3T1R A;  4GOG A;  5FI2 A;  4NXB A;  4UEY A;  4MN7 A;  2V1B A;  4WYY A;  4I39 A;  4P6Z M;  3ULF A;  2J9O A;  3O88 A;  1M40 A;  1JTG A;  2PD8 A;  2M7U A;  3BFD A;  1XA1 A;  4CLC C;  1IFQ A;  2Y91 A;  3P01 A;  1TDG A;  2WAE A;  4ARZ B;  2H28 A;  3F1N A;  1JNU A;  1P9W A;  4S2N C;  2VV8 A;  3JPU A;  3IQA A;  4IHQ A;  2PR5 A;  5FQJ A;  1PRQ A;  1F5M A;  3E4O A;  4R3J A;  3LFV A;  2IWB A;  1VEU A;  2PYP A;  2WKQ A;  2ZQC A;  2B95 A;  3QP6 A;  3BJN A;  4MEZ A;  4R3B A;  4Q0I A;  1EW0 A;  4KZA A;  4YOF A;  4EER A;  1GSV A;  3CLO A;  1XJ6 A;  4KG6 A;  2WZX A;  1DY6 A;  3EQU A;  3TJZ C;  1N9N A;  4RA7 A;  3K2N A;  3H82 A;  3SOI A;  3VP3 A;  2X02 A;  4GCZ A;  1T1B A;  2GJ3 A;  4BJP A;  1MZU A;  1Y54 A;  3O86 A;  3T12 B;  2O99 A;  5DTS A;  4XUX A;  3P7N A;  2H0T A;  2ZJ9 A;  2OV5 A;  2V0W A;  1TF1 A;  5AQB A;  2PR6 A;  2V1Z A;  4Y7P A;  4LRY C;  2Z6C A;  1XGJ A;  3HCY A;  4ZDX A;  3NC8 A;  3OPL A;  3HLB A;  4KQD A;  4QU3 A;  1H5X A;  4R1G A;  2Q9M A;  4XXR A;  3T1S A;  3IXD A;  4KG2 A;  1K0K A;  3F1O B;  4JGO A;  1BZA A;  2ZQ7 A;  1PWC A;  3BEB A;  3VOY A;  3CUE C;  3P09 A;  2WGI A;  3LY3 A;  5A91 A;  4IVI A;  3C2W A;  1MWT A;  1NWZ A;  4R38 A;  1DJB A;  2O9B A;  3F1P B;  2X01 A;  1BTL A;  3NCK A;  4Y2F A;  5HAI A;  2HDQ A;  5EVL A;  3DBA A;  3V50 A;  2WGW B;  3IS2 B;  4E3K A;  3PYP A;  3GMW A;  3HBR A;  5FL3 A;  5CHJ A;  2EX6 A;  2ZM2 A;  1Y28 A;  4NG2 A;  1G28 A;  3R4K A;  1GCE A;  1FR6 A;  3UO9 A;  4EEP A;  3NDE A;  3SS4 A;  1MKI A;  3CAX A;  1KGG A;  5M1A A;  5J3W A;  5L09 A;  1BUL A;  2P74 A;  3EWK A;  3G6O A;  2XFT A;  3WS0 A;  3CI6 A;  4KEN B;  2WYX A;  1X0O A;  3S22 A;  5EEC A;  1QME A;  4FUW A;  4IUK A;  4ZJ3 A;  2X71 A;  2Y2Q A;  4DXB A;  2Y2L A;  1PW1 A;  4P87 A;  5DF9 A;  3SS3 A;  5CRF A;  1TDL A;  4I5S A;  3GV9 A;  3LR0 A;  2ZL1 B;  1MBL A;  2VV7 A;  4EXO A;  1WE4 A;  2VGL M;  1MY8 A;  2W1T A;  1FCO A;  3VFF A;  5AJG A;  1VQQ A;  4LV1 A;  2W3D A;  4QJG A;  3OC2 A;  2EXB A;  1SDE A;  1ES2 A;  4RQ9 A;  1A0K A;  3K3D A;  3M2J A;  1DP8 A;  4LV3 A;  3BYD A;  5DTT A;  1FOF A;  5HAR A;  5HDD A;  4OKP A;  3ZDJ A;  2VA0 A;  3LYX A;  3OPH A;  1TS7 A;  3KSF A;  4MMN A;  4WM9 A;  2PAV P;  1LSV A;  5E2H A;  2ZMA A;  1VM1 A;  3RTY A;  2O9A A;  2H0Y A;  4OVD A;  3IH8 A;  1V9Y A;  2HP6 A;  5IS1 A;  1ONG A;  3ZG5 A;  5HDC A;  2FH5 A;  2RL3 A;  2WAF A;  2ZQ9 A;  5CTM A;  3KSI A;  2ZC6 B;  5HAP A;  3GSG A;  4G3V A;  2UWX A;  3IHA A;  3V3S A;  3E4P A;  1TEM A;  2XLN A;  1K56 D;  3UE6 A;  3BY9 A;  4O7D A;  2PYR A;  2CC1 A;  2Y2H A;  4GLQ A;  3R7W A;  3QP2 A;  5CGW A;  3UB9 A;  3UDI A;  5M19 A;  4IJG A;  1ES4 A;  5HAQ A;  4NEE D;  3N7W A;  2XRO A;  1IEM A;  1YLJ A;  3ZG7 B;  5AQA A;  2ZMV A;  5CHM A;  2LB5 A;  3LR3 A;  3AGD A;  3B3X A;  4WZ5 A;  3L9K A;  3RH8 B;  1GHM A;  3KSH A;  3RFB A;  5GLA A;  4PKY A;  3DTI A;  3E98 A;  4I38 A;  3D4F A;  2QZ6 A;  4N1X A;  5GHZ A;  1OTI A;  2BAS A;  4WUJ A;  3KYE A;  4KUK A;  1JTD A;  5F68 A;  3CUE A;  4AFI A;  3NOU C;  3MZD A;  3HJI A;  2J3W A;  1VET A;  1OPX A;  3PAG A;  3MQ0 A;  4UAA A;  3V5M A;  3MQQ A;  2CMN A;  2HPB A;  3SH7 A;  1GSW A;  3DW0 A;  3B47 A;  1U60 A;  4OLG A;  2HV1 A;  2XQZ A;  3RJU A;  5IU1 A;  3A3D A;  5FDS A;  4UHU A;  2XK1 A;  5F1G A;  4CLC B;  1P9R A;  4Q0J A;  4U3T A;  4KQQ A;  1VHM A;  2EFU A;  4RX2 A;  3Q81 A;  4K0W A;  2Y8H A;  4WEJ A;  2XD1 A;  5EVI C;  3WS4 A;  4WEK A;  4QWO A;  1Z6F A;  4QD4 A;  1IKI A;  1MKM A;  3MS6 A;  3IXH A;  4P6Z S;  4CLC A;  3MFD A;  3LO7 A;  1K4F A;  2VZW A;  3HVF A;  3BFG A;  4QY6 A;  3ZG9 B;  3IBR A;  2Q0O A;  3UNW A;  4D60 A;  4UA9 A;  3E2L A;  5F83 A;  3DTM A;  1KE4 A;  2B02 A;  3JVV A;  4EV4 A;  1OJG A;  3IX3 A;  3S1Y A;  3PHY A;  4E3J A;  3ZG0 A;  5HFO A;  1O7E A;  3W4Q A;  4H8R A;  5KSH A;  4E3I A;  1KGF A;  1PFL A;  2ZL1 A;  4LPZ A;  3EGD C;  4HBT A;  3VSL A;  1NYM A;  1DRM A;  2WKI A;  4K91 A;  3BW6 A;  4KZ7 A;  5A90 A;  1ZG4 A;  3UDF A;  3N8R A;  3EEH A;  2EWV A;  5I5L A;  1XGI A;  2K2N A;  1KDW A;  2WGW A;  3N8S A;  1N4O A;  3LR5 A;  1S4R A;  2L4R A;  3HLG A;  5EVE A;  5FAO A;  1ZG6 A;  3F1P A;  3ZHH A;  1I2S A;  4R0Q A;  4K08 A;  3WS5 A;  2JKG A;  4GHI A;  1GA9 A;  3WS2 A;  2XFS A;  1O07 A;  4WZ5 C;  2PRF A;  1PNE A;  5TBM B;  1XFQ A;  3G32 A;  5EOO A;  4B4X A;  3FWL A;  3ZYT A;  5JYO A;  3W4P A;  2W3G A;  1K25 A;  2VGK A;  5L07 A;  1IKG A;  1F9I A;  5DFX A;  5DTK A;  2E8J A;  5CEC A;  5CED A;  5CXW A;  5TR7 A;  2VK3 A;  4K0X A;  3FV7 A;  1S6R A;  1BYW A;  5FSR A;  2FZ0 A;  3H82 B;  4HIA A;  4FH2 A;  3VP2 A;  4JGQ A;  3FC7 A;  3TE8 A;  4JLF A;  3R7W B;  4EBL A;  3T50 A;  4HEF A;  1OT9 A;  2OAQ 1;  5GHX A;  4DE3 A;  1H8Z A;  3NOT C;  5FEG A;  5AVE A;  5MC7 A;  1IYS A;  4BWI A;  1PZP A;  3NI9 A;  4LCM A;  4E3N A;  2Y59 A;  4E3O A;  4NET A;  4U0T A;  5HPI A;  3N6I A;  1P97 A;  1XJ4 A;  4JKT A;  5I94 A;  3ZFZ A;  3HUN A;  2EWW A;  1SKF A;  1LSW A;  3TG9 A;  1ZTU A;  1K54 A;  1DJA A;  2WUQ A;  1PYY A;  5G4Y A;  5G18 A;  1BT5 A;  3EOI A;  2JBF A;  4EET B;  4QB8 A;  1WYB A;  2OOL A;  1L2S A;  4GS9 B;  2VGJ A;  5EPH A;  1LLB A;  5JYP A;  4YIN A;  3C8C A;  4JBF A;  5DVA A;  3QNC A;  5EFW A;  2Y2O A;  4HJ4 A;  1PWD A;  2DCF A;  4RVA A;  5CX7 A;  4X1M A;  2EX8 A;  1MWS A;  3PXP A;  2GZA A;  4BD0 A;  1XJ3 A;  3DWZ A;  3I7J A;  4OQH A;  4ZJ1 A;  2ZC5 B;  4FD8 A;  3HUM A;  3NY4 A;  1HVB A;  2HZ5 A;  5HL6 A;  3W2Z A;  4GD8 A;  2AVX A;  1C3B A;  1KDS A;  3NUL A;  4BL3 A;  3MBZ A;  4Y17 A;  2HP9 A;  3UB5 P;  3CHW P;  5HX9 A;  4PMA A;  4O8G A;  5TFQ A;  3HJK A;  3T4O A;  4RX3 A;  1BLS A;  3HLE A;  2BG1 A;  1I5Q A;  3FPW A;  2P04 A;  2VLG A;  3EQV A;  3IF6 B;  2H5S A;  2XA7 M;  1JWV A;  3GEC A;  2XDM A;  3VFH A;  1XA7 A;  4EU0 A;  1GHP A;  3V3R A;  1YQS A;  4EQI A;  3C30 A;  4XT2 B;  4PM8 A;  1RCJ A;  4EW7 A;  5HDS A;  1FCM A;  1K57 C;  2J9P A;  4S2J A;  2JKR I;  2WKH A;  2OSU A;  1CI8 A;  1ZKJ A;  5DKK A;  4B9O A;  4JGR A;  3JYI A;  5E2G A;  3T4L A;  1D06 A;  1OT6 A;  2FFY A;  4KZ9 A;  3TW8 A;  1S1Y A;  2R9X A;  4OP5 A;  5FI6 A;  2JE5 A;  2V1A A;  4G3W A;  5KMW A;  3TOI A;  2J80 A;  3B33 A;  3CPT A;  4GKU A;  4ID4 A;  2KLI A;  2XEP A;  4S2O A;  2YKH A;  1BLP A;  4HJ3 A;  1ERO A;  4YWZ A;  4PM6 A;  4OH0 A;  1LL9 A;  1NLZ A;  1DP6 A;  4DE1 A;  3HUO A;  5DF8 A;  1CJF A;  4P85 A;  5FQI A;  5DF7 A;  2PBD P;  4Y13 A;  1PI5 A;  3W8K A;  5HW3 A;  1I2W A;  5TGF A;  1G68 A;  1V9Z A;  4B93 A;  1ONH A;  2QWS A;  3BFC A;  3ZNT A;  3IX8 A;  5DJU A;  3DWK A;  4CPK A;  4MCW A;  2G2U A;  3LI8 A;  1OTD A;  5FQQ A;  2W3H A;  3GRJ A;  1CK3 A;  5FDH A;  3OLO A;  4KZ8 A;  3QP4 A;  1P0Z A;  4DF6 A;  3N4I A;  4N92 A;  4DN0 A;  4PM5 A;  3UPO A;  3M6H A;  3HRE A;  2WKP A;  1Y4O A;  3OCN A;  1MWU A;  2JHE A;  4X6T A;  1TS0 A;  1N9B A;  5HWW A;  1T1A A;  1MPL A;  2GDN A;  4FSF A;  2FFF B;  3ZVT A;  2PT7 A;  1FSY A;  5TBM A;  3C4P A;  1KVL A;  4F3L B;  3F1O A;  2Z2L B;  4CLC E;  3ISG A;  3A3F A;  4I3J A;  3PBR A;  3MR0 A;  4EWF A;  1Q2Q A;  1XX2 A;  1RP5 A;  3GDI A;  3H7W B;  4Y5F A;  2JC7 A;  3VV4 A;  1J3W A;  4OPZ A;  1OTA A;  3VOL A;  3IF5 A;  4Q0H A;  4Y0T A;  2D01 A;  1NZU A;  1JWZ A;  2Z2M B;  4UA7 A;  3IWO A;  1AXB A;  5BOH A;  5CHU A;  3AGF A;  4HHD A;  1KOU A;  4OON A;  2H10 A;  1DP9 A;  1PIO A;  2JN7 A;  4GD6 A;  5IHV A;  1H3Q A;  1LHY A;  3BFF A;  1EWZ A;  1NRJ A;  5HWT A;  3IXG A;  2VEA A;  4HES A;  3BFE A;  4HNB A;  3UMD A;  2PU4 A;  4LGW A;  1T1C A;  2I72 A;  3SH9 A;  3MJQ A;  3C7U A;  1NJ4 A;  3G34 A;  1BUE A;  1W5D A;  1L0E A;  3FYZ A;  4CJN A;  1KE0 A;  3GR2 A;  4PHT A;  4GN2 A;  3ITA A;  3O5Y A;  3QP1 A;  1ERQ A;  1M6K A;  3UB6 A;  3KYQ A;  2KX6 A;  3ZG8 B;  2C6W B;  4A5R A;  2V9A A;  3H7W A;  2HF6 A;  1K6R A;  1D1J A;  2QYB A;  3NOP C;  2Y2G A;  3UDX A;  1LSX A;  3QP8 A;  5A92 A;  1K56 A;  2W1R A;  3C38 A;  4H6J B;  3AGE A;  3TRC A;  1CQA A;  3UE0 A;  4MBH A;  4NXE A;  4KZ3 A;  5K5B A;  4X56 A;  2ZQD A;  3T4S A;  3EEA A;  1YKD A;  3SZT A;  4WEL A;  4JF6 A;  3FKV A;  4D2O A;  1QMF A;  1HZO A;  3WS1 A;  4DKI A;  2WKR A;  3A0S A;  5A93 A;  5HSQ A;  3VP1 A;  1HTZ A;  1H8Y A;  5L10 A;  4S2M A;  3MF0 A;  4EEU A;  5FAT A;  4DJ2 A;  4X53 A;  3NEC A;  4I3A A;  3T4K A;  5EVI A;  4E6X A;  2A24 B;  4HJ6 A;  3PBQ A;  4OOY A;  2A3U A;  3OZH A;  4IBR A;  2V20 A;  2J7V A;  5GLC A;  4X55 A;  5E2E A;  1NRF A;  2OWH A;  3ZNY A;  4Y3I A;  4C75 A;  2PU2 A;  3G2Y A;  2KDK A;  1H8M A;  4GNU A;  1JWP A;  4P6B A;  4FTX A;  3HLW A;  4MDZ A;  1XJ2 A;  4C3Q A;  1VB6 A;  3PBT A;  4E3M A;  4EES A;  1SKO A;  1D7E A;  3MXQ A;  5CGS A;  4KZ5 A;  4KUO A;  5FAP A;  2IA2 A;  4EBP A;  2A24 A;  3MFX A;  2JKT I;  3KX0 X;  1KVM A;  4MN6 A;  2J3T C;  4DXC A;  4PPR A;  3ZCZ A;  2VJW A;  3HLC A;  4CLC D;  3GTC A;  4OLD A;  3Q07 A;  1Z09 A;  2OLV A;  3C4O A;  3NHQ A;  1RGY A;  3DAV A;  4HQA A;  1K55 A;  4JGP A;  1S4S A;  2ZC3 B;  2Y2N A;  3LGO A;  4YFM A;  4OOL A;  4N9K A;  1E4D A;  3OPR A;  1STZ A;  3NDG A;  2A2L A;  1GHI A;  3BM6 A;  1N9O A;  3BY8 A;  3VE3 A;  1YSQ A;  2ZBB A;  5KIZ A;  3MXS A;  5HD5 A;  4DDS A;  4Y0U A;  3JVU A;  3MSH A;  3OBF A;  3Q1F A;  2KOI A;  4FH4 A;  4BBU A;  2Y2J A;  2R78 A;  4N9L A;  4WMC D;  5LBR A;  3KO6 A;  2XA7 S;  4BLM A;  1NZO A;  3BLS A;  2W3E A;  4R6L A;  2ZOI A;  1PW8 A;  2EX2 A;  3OCL A;  4I3I A;  4S2K A;  4L9G A;  4JXS A;  4F94 A;  4MNR A;  3O3V A;  4O0P A;  1T18 A;  4PKY G;  4E04 A;  5KSC A;  2QKP A;  3ZVW A;  4QHC A;  3GVB A;  3T4J A;  3ICY A;  3IF6 C;  1UWP X;  3IS2 A;  5DKL A;  2ZM0 A;  4OPQ A;  1IYO A;  2HP5 A;  2DNS A;  4OP8 A;  3B42 A;  2JKT M;  2VV6 A;  3QHY A;  5CEB A;  2P9V B;  3MZE A;  1OME A;  4IED A;  4BQM A;  2J3T D;  2P08 A;  3LEQ A;  4XUZ A;  3PBS A;  2WK0 A;  5U47 A;  1K57 A;  2QMI A;  4XT2 A;  1W7F A;  3PBN A;  4FCF A;  3BLM A;  4PM9 A;  3MXR A;  2J8Y A;  2VX8 A;  3A3J A;  2VKS A;  4X25 A;  1CF0 A;  3BRM A;  1KGE A;  4NK3 A;  1T19 A;  1K38 A;  1S66 L;  3EGX C;  4ZJ2 A;  5FA7 A;  3P98 A;  5C5K A;  4UA6 A;  4LV0 A;  5EVI D;  4HI4 A;  5EUA A;  2UV0 E;  3KSG A;  1MWR A;  4GB7 A;  3IF6 A;  3G35 A;  1G6O A;  3FKW A;  1KE3 A;  3MKE A;  3DTE A;  3L7H A;  3MZF A;  4LRX C;  2NUT C;  2JCH A;  1W79 A;  5F1F A;  2HJ9 C;  4X68 A;  4JPM A;  3U4L P;  3LEZ A;  1DJC A;  4WMC A;  4WZ4 A;  1SKO B;  4P0M A;  3D9Y A;  2QPN A;  1AWI A;  3RXX A;  4ETZ A;  1ESU A;  3T4T A;  2V8F A;  4UQI M;  1SHV A;  3Q7V A;  2XR0 A;  2E8I A;  2P9V A;  3CJM A;  4JXW A;  1YSP A;  4HP9 A;  3LIF A;  1GA0 A;  3UE3 A;  4MLL A;  4BMW A;  2MJ6 A;  4HY8 A;  2PHY A;  5GLB A;  1ALQ A;  2L0W A; 
#chains in the Genus database with same CATH homology
 3GQZ A;  3IWI A;  1XP4 A;  3E2K A;  1ES4 A;  1G6A A;  5HAQ A;  3N7W A;  1MWU A;  3OCN A;  1IEM A;  1YLJ A;  3PTE A;  3ZG7 B;  5AQA A;  4X6T A;  4Y0O A;  5CHM A;  1N9B A;  2Q9N A;  3AGD A;  2DRW A;  3B3X A;  4WZ5 A;  1MPL A;  4BL2 A;  1NYY A;  2V2F F;  2GDN A;  2PBY A;  4L0L A;  4FSF A;  3CG5 A;  5CTN A;  1GHM A;  2FFF B;  3ZVT A;  1YMX A;  1FSY A;  4JXG A;  2ZD8 A;  1PWG A;  1K6S A;  2HDR A;  1KVL A;  3C4P A;  4Q8I A;  1E25 A;  3O87 A;  2ZM8 A;  2R9W A;  5GLA A;  2Y2M A;  2Z2L B;  3D4F A;  3N8L A;  2QZ6 A;  3UY6 A;  3OPP A;  2A49 A;  3ISG A;  2WAD A;  4N1X A;  5GHZ A;  4JF5 A;  3M2K A;  3LCE A;  3A3F A;  1XXM A;  5J8X A;  4DDY A;  1YM1 A;  4S2I A;  3PBR A;  1FCN A;  4MBF A;  4GZB A;  4EWF A;  1PI4 A;  1JTD A;  3G4P A;  1Q2Q A;  1XX2 A;  1RP5 A;  3HLD A;  4HBU A;  2G2W A;  3MZD A;  2HDU A;  2EXA A;  2JC7 A;  3VOZ A;  3PAG A;  3WRZ A;  2BLS A;  4UAA A;  3V5M A;  4OPZ A;  5D3O A;  3WWX A;  3G2Z A;  5GL9 A;  3CZD A;  3IF5 A;  2HPB A;  3W4O A;  4Y0T A;  3SH7 A;  4QY5 A;  3DW0 A;  1ES5 A;  1JVJ A;  1YLY A;  1FSW A;  1Q2P A;  1NZU A;  1U60 A;  1BLC A;  1JWZ A;  2WKE A;  1YLP A;  3FZC A;  2Z2M B;  2ZC7 A;  2XQZ A;  4OLG A;  4UA7 A;  3IWO A;  3RJU A;  1AXB A;  5BOH A;  3IT9 A;  5CHU A;  4OQ0 A;  3A3D A;  3AGF A;  1K54 C;  4OON A;  4UHU A;  2XK1 A;  5F1G A;  1EI5 A;  4MBK A;  4U3T A;  2H10 A;  4KQQ A;  3VP0 A;  2EFU A;  2Y55 A;  3IH9 A;  4RX2 A;  3LY4 A;  3Q81 A;  3IWQ A;  4K0W A;  4WEJ A;  1PIO A;  5IHV A;  4GD6 A;  2XD1 A;  2C5W B;  2ZC4 B;  1LHY A;  3BFF A;  5EVI C;  1EWZ A;  3WS4 A;  4WEK A;  5CGX A;  1Z6F A;  3IXG A;  4QD4 A;  4HES A;  4E6W A;  3BFE A;  1IKI A;  3G31 A;  3C7V A;  4N1H A;  2PU4 A;  3IXH A;  2I72 A;  1YMS A;  3MFD A;  5EE8 A;  1K4E A;  3SH9 A;  3LO7 A;  1K4F A;  3HVF A;  1XKZ A;  3BFG A;  4QY6 A;  3ZG9 B;  1LL5 A;  3C7U A;  1ES3 A;  1NJ4 A;  4B88 A;  3G34 A;  3UNW A;  3Q82 A;  1BUE A;  1W5D A;  1L0E A;  3FYZ A;  4UA9 A;  3E2L A;  4KZB A;  5F83 A;  3DTM A;  5EOE A;  4CJN A;  2ZQA A;  1KE0 A;  1KE4 A;  3GR2 A;  1LI9 A;  4GN2 A;  1BLH A;  3ITA A;  5GHY A;  3M6B A;  4EV4 A;  3S1Y A;  1ERQ A;  2IWC A;  3ZG0 A;  4E3J A;  5HFO A;  1O7E A;  1M6K A;  4KQO A;  3W4Q A;  4H8R A;  5KSH A;  4E3I A;  3SS5 A;  1KGF A;  3ZG8 B;  2C6W B;  4A5R A;  4JF4 A;  1CI9 A;  4HBT A;  4GOG A;  5FI2 A;  1NYM A;  3VSL A;  2WKI A;  1K6R A;  4K91 A;  2Y2G A;  4KZ7 A;  5EVI B;  3UDX A;  5A90 A;  1ZG4 A;  3UDF A;  1MXO A;  5A92 A;  3QNB A;  3N8R A;  1K56 A;  4WYY A;  2J9O A;  3O88 A;  1M40 A;  1YLZ A;  3UPN A;  3C5A A;  1XGI A;  2WGW A;  1KDW A;  1JTG A;  3AGE A;  3N8S A;  3BFD A;  1XA1 A;  3UE0 A;  2Y91 A;  1TDG A;  1N4O A;  2WAE A;  4KZ3 A;  4MBH A;  3HLG A;  5FQK A;  4S2N C;  5FAO A;  1ZG6 A;  3ZHH A;  4X56 A;  2ZQD A;  1I2S A;  4R0Q A;  1PZO A;  3WS5 A;  3IQA A;  4DE2 A;  4U0X A;  5FQJ A;  3VSK A;  4WEL A;  1GA9 A;  2XGN A;  1BSG A;  3WS2 A;  2XFS A;  1O07 A;  3V39 A;  1ESI A;  4JF6 A;  4WZ5 C;  3FKV A;  3MKF A;  1QMF A;  4B4Z A;  4D2O A;  1HZO A;  3WS1 A;  4DKI A;  4R3J A;  5FI7 A;  5A93 A;  2IWB A;  4BEN A;  2EFX A;  3G32 A;  5EOO A;  2ZQC A;  3PAE A;  4B4X A;  4M3K A;  3VP1 A;  3FWL A;  1HTZ A;  1H8Y A;  5JYO A;  4S2M A;  5AQ7 A;  4MEZ A;  3W4P A;  5FAT A;  4R3B A;  4KZA A;  4R4S A;  4X53 A;  1K25 A;  2VGK A;  4E3L A;  1IKG A;  4KG6 A;  2WZX A;  5EVI A;  2XD5 A;  4E6X A;  4R4R A;  1ZC2 A;  1DY6 A;  5DTK A;  2IWD A;  5CEC A;  1E3U A;  5CED A;  3EQU A;  3PBQ A;  4OOY A;  4X69 A;  5CXW A;  5TR7 A;  4K0X A;  3FV7 A;  2A3U A;  5FQ9 A;  3OZH A;  4RA7 A;  1FR1 A;  1S6R A;  4IBR A;  2V20 A;  5FSR A;  2J7V A;  4DRT A;  3SOI A;  3VP3 A;  5GLC A;  4X55 A;  2X02 A;  4FH2 A;  3VP2 A;  3PBO A;  5E2E A;  1NRF A;  3ZNY A;  4JLF A;  4C75 A;  1IEL A;  3VMA A;  2PU2 A;  4BJP A;  3G2Y A;  4EBL A;  4HEF A;  2ZQ8 A;  4GNU A;  1Y54 A;  1JWP A;  4P6B A;  5E43 A;  1W8Q A;  3O86 A;  3HLW A;  5GHX A;  4C3Q A;  4DE3 A;  3PBT A;  3NIA A;  1H8Z A;  4E3M A;  1S0W A;  5CGS A;  5DTS A;  4KZ5 A;  4XUX A;  4OQI A;  2H0T A;  2ZJ9 A;  2OV5 A;  1IYS A;  1PZP A;  4OPY A;  3CMZ A;  5AQB A;  2WZZ A;  5FAP A;  4R23 A;  3NI9 A;  4LCM A;  4EBP A;  4E3N A;  4IVK A;  1E3U D;  4ZAM A;  2Y59 A;  3TSG A;  2V1Z A;  4NET A;  4Y7P A;  4E3O A;  1XGJ A;  4ZDX A;  4U0T A;  3N6I A;  3NC8 A;  3OPL A;  1YT4 A;  4JKT A;  5I94 A;  1KVM A;  3HLB A;  3ZFZ A;  3HUN A;  4RYE A;  4DXC A;  4GDB A;  4QU3 A;  4ZTK A;  4PPR A;  1H5X A;  3ZCZ A;  1SKF A;  2Q9M A;  3HLC A;  4R1G A;  1K54 A;  4XXR A;  3TG9 A;  4DE0 A;  3GTC A;  3Q07 A;  1DJA A;  2OLV A;  4LV2 A;  4OLD A;  3C4O A;  2WUQ A;  3IXD A;  1PYY A;  4KG2 A;  3RXW A;  1RGY A;  1BZA A;  5G18 A;  2ZQ7 A;  1BT5 A;  1K55 A;  1PWC A;  2JBF A;  3BEB A;  3VOY A;  4LEN A;  2XF3 A;  1L0F A;  1WYB A;  4QB8 A;  1L2S A;  1SDN A;  1CEF A;  2ZC3 B;  3IXB A;  4PM7 A;  2VGJ A;  5EPH A;  1LLB A;  5JYP A;  2Y2N A;  4YIN A;  3P09 A;  2WGI A;  4YFM A;  3LY3 A;  4JBF A;  4Z9Q A;  5DVA A;  3QNC A;  5A91 A;  4OOL A;  4N9K A;  4IVI A;  1E4D A;  3OPR A;  2Y2O A;  1J9M A;  3NDG A;  1MWT A;  1PWD A;  2DCF A;  4RVA A;  1GHI A;  3BM6 A;  1DJB A;  2EX8 A;  4KZ6 A;  2X01 A;  1BTL A;  3NCK A;  1MWS A;  3MXS A;  4BD0 A;  1SCW A;  4DDS A;  4Y0U A;  4C6Y A;  3Q1F A;  3VP4 A;  5HAI A;  3SH8 A;  2HDQ A;  5EVL A;  3DWZ A;  3I7J A;  4FH4 A;  4OQH A;  4ZJ1 A;  3V50 A;  2ZC5 B;  2Y2J A;  4FD8 A;  2WGW B;  1YLW A;  4E3K A;  3HUM A;  4N9L A;  3GMW A;  3HBR A;  4WMC D;  3Q7V B;  5F82 A;  4S2L A;  3WRT A;  5CHJ A;  2EX6 A;  1NZO A;  2ZM2 A;  3BLS A;  4BLM A;  3NY4 A;  1HVB A;  3HL9 A;  1PW8 A;  1GCE A;  1FR6 A;  2EX2 A;  3OCL A;  3NDE A;  4GD8 A;  1MKI A;  1C3B A;  1KDS A;  4S2K A;  4JXS A;  3SS4 A;  4F94 A;  4MNR A;  3O3V A;  3ITB A;  1K55 C;  4BL3 A;  3MBZ A;  5L2F A;  2RCX A;  3UO9 A;  2HP9 A;  1KGG A;  2Y2I A;  2Y4A A;  5M1A A;  5KSC A;  4ZBE A;  2B5R A;  3ZVW A;  4QHC A;  1BUL A;  3GVB A;  5HX9 A;  1L0D A;  2P74 A;  4PMA A;  2XFT A;  5TFQ A;  3IF6 C;  4RX3 A;  1BLS A;  3NBL A;  3HLE A;  3WS0 A;  1TVF A;  5KZH A;  5GLD A;  2BG1 A;  4OPR A;  3UE1 A;  1I5Q A;  4KEN B;  2WYX A;  2ZM0 A;  4OPQ A;  5FAS A;  1IYO A;  2HP5 A;  2DNS A;  3EQV A;  3S22 A;  4OP8 A;  3A3I A;  3BEC A;  4OQG A;  3IF6 B;  2H5S A;  3QHY A;  1JWV A;  5CEB A;  2P9V B;  3MZE A;  1OME A;  1QME A;  4KZ4 A;  5EEC A;  4IED A;  4BQM A;  2XDM A;  4S2P A;  4ZJ3 A;  3VFH A;  2X71 A;  2Y2Q A;  1XA7 A;  4JXV A;  3PBS A;  4XUZ A;  2WK0 A;  4DXB A;  1HD8 A;  1GHP A;  2Y2L A;  2Y2K A;  1XPB A;  1PW1 A;  4P87 A;  5DF9 A;  2WGV A;  2ZLY A;  3SS3 A;  1YQS A;  2HDS A;  3V3R A;  4EQI A;  5CRF A;  4PM8 A;  1K57 A;  1RCJ A;  1TDL A;  2QMI A;  5U47 A;  3GV9 A;  1W7F A;  3PBN A;  4FCF A;  5HL1 A;  3BLM A;  1MBL A;  1FCM A;  2XH9 A;  1K57 C;  3Q7Z A;  3MXR A;  2J9P A;  2J8Y A;  4PM9 A;  4S2J A;  4EBN A;  3A3J A;  2WKH A;  2OSU A;  1CI8 A;  1ZKJ A;  3G30 A;  1LI0 A;  4WBG A;  3IHB A;  5M18 A;  1WE4 A;  4KQR A;  1MY8 A;  3BRM A;  1FCO A;  1L0G A;  1KGE A;  3VFF A;  4NK3 A;  3JYI A;  1VQQ A;  4LV1 A;  4QJG A;  1K38 A;  3OC2 A;  5FAQ A;  5CER A;  2EXB A;  1SDE A;  1ES2 A;  1W8Y A;  5E2G A;  4ZJ2 A;  5FA7 A;  3P98 A;  4UA6 A;  4LV0 A;  1NXY A;  5EVI D;  5EUA A;  2FFY A;  4S2N A;  4KZ9 A;  3M2J A;  2R9X A;  4LV3 A;  4OP5 A;  5FI6 A;  3BYD A;  1MWR A;  1FOF A;  4GB7 A;  5DTT A;  2OLU A;  1ERM A;  3G35 A;  3IF6 A;  2JE5 A;  5HAR A;  4EUZ A;  4OKP A;  5KMW A;  3ZDJ A;  3TOI A;  2EX9 A;  5AQ9 A;  3UPP A;  4OOM A;  4GKU A;  3FKW A;  4ID4 A;  1KE3 A;  3MKE A;  3OPH A;  4GDN A;  5FQM A;  3MZF A;  1WYC A;  2XEP A;  4S2O A;  4WM9 A;  1BLP A;  2JCH A;  4KG5 A;  1ERO A;  1W79 A;  5E2H A;  5F1F A;  4PM6 A;  4X68 A;  2ZMA A;  1VM1 A;  1IYP A;  4OH0 A;  1LL9 A;  2H0Y A;  4JPM A;  4DE1 A;  4OVD A;  3LEZ A;  3HUO A;  5DF8 A;  1DJC A;  4WMC A;  4WZ4 A;  4P85 A;  3UN7 A;  3IH8 A;  2HP6 A;  4P0M A;  1ONG A;  5FQI A;  3ZG5 A;  2RL3 A;  1RGZ A;  3A3E A;  2QPN A;  5DF7 A;  3RXX A;  4BD1 A;  2Y2P A;  2ZQ9 A;  2WAF A;  1PI5 A;  1CEG A;  2ZC6 B;  5CTM A;  3W8K A;  5HAP A;  5HW3 A;  1I2W A;  3GSG A;  5TGF A;  1G68 A;  1ONH A;  1ESU A;  2UWX A;  3BFC A;  3ZNT A;  3IHA A;  3V3S A;  3DWK A;  4CPK A;  1SHV A;  3Q7V A;  2XR0 A;  1NY0 A;  2E8I A;  2G2U A;  2P9V A;  1TEM A;  3CJM A;  2XLN A;  4JXW A;  4LCL A;  5FQQ A;  1K56 D;  3GRJ A;  4IBX A;  1CK3 A;  1GA0 A;  5FDH A;  3S4X A;  4KZ8 A;  4MLL A;  3UE3 A;  4DF6 A;  3N4I A;  1FQG A;  4O7D A;  2CC1 A;  2Y2H A;  4N92 A;  3HLF A;  5CGW A;  4PM5 A;  1YLT A;  5GLB A;  3UDI A;  5M19 A;  1ALQ A;  3ZGA B;  5E2F A;  3UPO A;  3M6H A;  3HRE A;  1IYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...